5JHLL

Crystal structure of zika virus envelope protein in complex with a flavivirus broadly-protective antibody
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
211
structure length
211
Chain Sequence
FDIVMTQSQKFMSTSVGDRVSITCKASQHVGSAVAWYQQKPGQSPTLLIHSASNRYTGVPDRFTGSGSGTDFTLTISNIQSEDLADYFCQQYNSYPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords envelope protein
publication title Structures of the Zika Virus Envelope Protein and Its Complex with a Flavivirus Broadly Protective Antibody.
pubmed doi rcsb
source organism Zika virus
total genus 47
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2016-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jhlL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jhlL01
1Y0LA 3MRBA 2RHEA 5C0AA 1ZLUK 5IB5B 2R56H 1IM9B 1FORL 1LQSR 1A1NB 5HHXH 3PV7A 5B3NA 4HZLA 4IOSD 3QA3A 3ROOA 1Y6KR 3L3GA 5HGAA 2BY2A 4HIEA 3MUHL 5B4MC 2J8HA 2QHLA 5D2NB 4P23A 4IRZH 4R8WL 5BV7C 1KJ2B 1EEQA 3NFSH 3V0WL 4AJ0A 4KK8D 2VAAA 2VDQH 5HHNB 1TIUA 3MV7E 1R3KA 5C8JB 1EFXD 4JPWH 4KFZC 3Q6FA 3KJ6H 1MWAB 1U8HB 3SGEH 4N0UE 1U0QA 5CSZA 3TV3H 4R4FL 4K7PX 1QACA 2XQYK 1IARB 1AQDA 4CAGA 4LGPB 3NIDF 3VH8B 3EDJA 3VI4E 4WHCA 1F4XL 1P9MC 4WI7A 4UV7L 4GXUN 5AZ2L 3SKJL 3R1GH 4DOHE 3QQ3A 4UT6L 2EDNA 3CVIH 2EYRB 3FFDA 4N8VB 1K8IA 2OP4H 2VXSL 1L7IL 1N26A 4LSPL 1PG7L 3LKPB 2B39A 4N5ED 5T1KA 1JIBA 5IEHB 5DQDH 1FFNA 3TBTA 1JGEA 4QTIL 1ZMYA 4NQCD 4X5XA 3TBYB 2PUQT 4GRWF 2H2SC 2ATKA 2YEZB 4HF5L 1N2RB 1UWGH 3JWDH 1B4JH 4HHAB 5EOTA 1EK3A 1INDH 5INCB 5F1NB 4X9BA 2L7UA 1YPZE 4KHTH 5ISZE 4IMKA 4QRSB 4HX1A 5FDYA 5DUPL 3QPXH 3HLAB 2BSTB 2B0SH 4JM2B 3TVMC 2D0FA 3O2VL 4K55A 4CVZA 1F4YL 3OKLA 3Q0HA 2XZCH 4UU9B 5KS9A 3H7BB 5KSBF 1YQVL 1YNLH 3TA3A 4FABL 1X5GA 2R2EB 5C2UB 1CVRA 3W82A 4NZUL 2P7TA 4XPBL 3FT2B 3HUJA 4GKSA 1S9KC 4QYOB 2ZUVA 3QQ9C 1OGAB 5E00B 4XPAL 2VDRH 5EZLB 4X80L 4ZS6C 3S37X 3RKDC 1R3HB 3C60C 4Y4FD 5CBAA 3QUXB 1P7QB 4KRPD 5GGVL 4I4WB 1RD6A 4XPGL 5F7DA 3NA9H 2VIRB 4N8CL 4L29A 2EH8L 4Y2DD 2ORBL 3GIVB 1HHGA 4XP4L 4HIJB 3K2UL 3HAEB 3ZKMD 4ZUSA 4R4FH 3ZYIA 3MX0A 2A77L 3R4DA 4XP9L 4QHMA 4RFNC 1YZZA 1HHJB 4NT6B 2VLRA 1F3DH 2UZXB 2HKHL 4X4ME 3WFBL 3VFVB 3KPLA 4MA3A 5AZ2H 3SKJH 3QXDA 2JLLA 2D0HA 4ZXBD 3GZKA 5C0CE 3CFJA 3RPKA 1ZT4A 1G7MB 4K07A 4Z7VE 1W0WB 5LGJA 1X5KA 3DX9A 2DTML 1Q1JH 1X3DA 4PJGB 3VXPA 2N56A 2F74A 1R3JB 3GJFH 4MNQD 4J12A 5HY9B 1BQHA 4PGBB 3CLFH 4KXZH 4LNRA 1J0KA 1KJMB 3K8MA 3ARRA 5TDNB 3P9LA 4JQXC 3DHMA 3LEYH 1LE9A 1YJDC 2HJKB 2NY4B 4CVXB 2PO6B 3B8SA 2QJDA 3CDCA 1D6EA 2J8OA 2R0KL 2V2XB 1FFPB 2X10A 4PJDB 3BP4B 3NGBC 4AEHH 3SGDH 1YNTA 3E0GA 1WC7A 4ONHB 2J3SA 3MXWL 4FP8L 5LAXB 5C0GB 1OCWH 1YMMD 3MCKA 1EEYB 2Q20A 5IFAH 3O2VH 1NAML 3GKWL 3BEWB 2VR5A 4XPHL 3VGHA 4GS7B 3PDOA 4LQFL 1WZ1L 4LPUA 1YQVH 1VFUA 4U31A 4UV4H 3QDMA 4RGND 4YJZL 4NZUH 5B39B 1T89A 2ESVA 3MNZB 2ZZUT 3QXTA 4XPBH 1X5IA 1VADA 4LHUB 1AGEB 1I85C 1KELL 3GO1L 5KSAC 1CFQB 3IDYC 2Y4SA 4U1SB 5EUOE 3S34L 3V4VH 3WMSA 4KU1A 3QFJB 1Y0LB 3MRBB 1CGYA 4RDQF 3UROR 5EBMB 3WXVL 5C0AB 1IVLA 1U8PA 1TQBB 5T3XH 4XPGH 4G6AC 4OM0H 1YY9D 2EEBA 1HH6A 3D48R 4P99A 2B4CC 5I71B 4HZLB 4FTVD 2ORBH 4XVTH 3QA3B 3ROOB 3F65A 3L3GB 5HGAB 1S78C 2VN7A 4RGMC 4HIEB 3P4NA 3T0BA 4HJ0C 3SDYL 4P23B 4OZIE 2NZ9C 4XP9H 4NJAH 1BZ9A 2VAAB 1K3ZA 1CGUA 2JJSC 2E9JA 1R3KB 3T04D 2CRMA 4LHQB 1RVFL 2HMIC 3D25A 3Q6FB 1OTTC 3MCG1 1WJ3A 2JJTC 1QFUL 1J86A 5CSZB 1EEZA 1HDMA 2GFBA 2VXQH 3OKYA 2NY3D 1A6AA 3JXAA 1AQDB 2IBBA 4ZD3H 2N7BA 5D1XA 4Z8FH 3NBNA 4HWEH 2JTDA 1OW0C 1UJ3C 3MJ8A 3DMMA 3QQ3B 3VXMA 3LS4L 1I3VA 1VGKA 3MACL 2H8PA 5SWQA 2MTPA 1FZOA 4WFFD 1K8IB 2V2WA 3H9SD 1KYOJ 5IB3A 3BGMA 1FGVL 1E4KC 5T1KB 3RY4A 5IROA 2YRZA 5I8KH 1FFNB 3TBTB 1JGEB 3UTSE 2VL5B 1A5FH 1FG2A 5SV3A 4X5XB 1S9WA 3BT2L 4P46C 1IT9H 2ATKB 5D1QC 1QFWL 1LEGA 1NAMH 3GKWH 5EOTB 5FO8B 5FF6A 3CLEH 3WNNA 4LSVH 4HX1B 5F7WC 2DLHA 3UPCA 4Q9QL 1QRNE 1BX2A 2AK1H 1A22B 1KJVA 3GSXA 4AYFA 4CVZB 5L6YL 3OKLB 3U7YH 5KS9B 4NIKB 1VESA 4UTAL 1NC2D 2W9LA 3TA3B 2X4SA 1IAKA 1PGRB 1F97A 1P5UA 2P7TB 3HUJB 4GKSB 3CFEA 2CLVA 4NDMA 4B5EA 2Q76A 3MLSH 5D7JD 5BCAA 1KB5L 4HUMB 3ORJA 4KKBC 3STBA 3EYVA 4YZFF 1P5VA 5CBAB 3QJFB 4AG4H 3UBXA 5J6GA 5I6XC 1DQLH 5MHSE 5F7DB 3MUGB 4OI7A 5D7LD 4OF6A 3MMEA 3GSNH 3MO1A 5J1TC 2VQTA 3TN0D 1F4WL 2BVPA 1RVFH 1TLKA 1GZQA 5E08L 3B6SA 4G6FD 4P3CH 4ZUSB 5F7LB 5F71A 4E5XB 1TNMA 2VLRB 1T0MA 1I8LA 1WZLA 2V5RA 4LPWA 4K8RL 2AP2A 3KPLB 2OSLB 1HSAB 3QXDB 1I7UA 3LS4H 1S7TA 1N5YH 1LILA 3CFJB 2HFTA 5KVEL 1ZT4B 2R0LL 4ZFOL 1NGWA 2XZQL 1OAUL 3DX9B 3NCJL 3W11D 4EDWH 4RWYH 5GPRA 1FGVH 5J3HD 3R8BB 2PF6A 3VXPB 4CMHC 5J4MA 2F74B 4LDEB 4BQ9A 1EHNA 4NKQB 1BQHB 5F9OL 3VXSD 5CHNA 1M05A 5INDA 3QG6A 3SQOL 5IMOB 3S4SA 4S1SH 4I18C 1QSED 4JFFA 2NMSA 3B43A 3P9LB 1WBZA 1LE9B 1QFWH 2UUDK 3IS1X 2Q6WA 3RWCA 1RUAH 1ZHKA 4NZRL 1G6RL 1D6EB 1JGLL 1JFQH 4Y16A 1YNTB 3O2DA 1DCLA 4HLZG 4LLUA 5BZDA 1WC7B 5EOCH 2J2ZA 3PDDA 1H5BC 3ARZA 3NZ8A 5HYJA 5L7XL 3BD4A 4ZUTA 2VITA 5EIVA 1PDKA 3QDMB 3U9UA 3NIGE 1GOGA 3GSVB 5C09D 3NZHL 2ESVB 4LARL 4OZFA 4WFED 4RBPK 2QQNH 2UZYB 1VADB 2W60A 4GKZB 3X3GH 2HJFA 4YQXH 1A64A 4F7TA 1JNNH 3HTLX 1Q38A 5DJXB 4BK4A 4NRYB 2HG5A 2CLZB 1S3KH 1RUQL 2YUVA 5KVDH 2EDXA 1F00I 4M6NH 2FLRT 1U8PB 5GGVY 1UGNA 2YA2A 5D5ME 4GLRH 1SY6L 2VC2H 3BD5A 1F4WH 4NWUL 3DBXA 2XG4A 2RCSL 1OLZA 3P4NB 4J3VA 5E08H 4XBEL 4LCIL 1J0JA 3IU4H 1DSFH 1BZ9B 2I24N 1E4XL 3B9VA 3HG1D 1WV7T 5EZJA 5JHDE 4K8RH 3D25B 3SDXA 3MGTA 2N1KA 3U9PH 2F54E 4YPGA 1EEZB 1HDMB 5EZOH 2GFBB 1W0YT 1A6AB 2R0LH 4HJGB 3UDWA 2BC4A 1E28A 1OB1A 1TPXC 4KTDH 5TE6L 5D1XB 1ZVSA 1T7XA 5BMFH 2BDNL 5JPNA 1Z9SA 3FO2A 3MJ8B 3DMMB 1F2QA 3AU1A 3VXMB 1VGKB 4PP1D 2QHRL 2XRAL 5MEQA 2H8PB 3KXFE 5SWQB 5F9OH 1FZOB 4CDHA 2OS7A 5L2KA 2V2WB 5GIRA 5IOPA 1IQWL 2NY2B 5DMJB 5IB3B 1HXMA 3BGMB 4U6TA 1QA9A 2P8PA 1DFBH 4JE4B 3SE3C 1X44A 1HKLH 1UKSA 5MP6H 4HWZA 1FG2B 1UCBH 2FHBA 1JGLH 1T4KA 1S9WB 1T66D 3O6KL 2D4FA 1LDSA 5C3TA 2FECI 4QOKD 1V7ML 3KJ4C 4GO6B 4HMDA 1LEGB 4GAJH 4GRLC 4U7SA 2ATPA 5FF6B 2X70B 2PXYA 2V17H 3QXWA 4GBXC 2ZUWA 4LNVA 4C56D 4CU8A 4YHZL 1EIBA 5I8CA 4OCLC 4LARH 4DKEH 4NFDA 4M7ZC 1BX2B 5EU6A 3GSXB 5GZND 3S9DB 1CCZA 3UJTH 2IFGA 1FQ9C 5EH1A 3UTZA 3VFRA 3C6LC 4IJ3B 1JGDA 1MFDH 5FO9A 4XNUL 2X4SB 3H3KA 1IAKB 1MH5A 1FSKB 1MFAL 1RUQH 2WZPD 3CFEB 2CLVB 4NDMB 2Q76B 3DJ9A 5CIPA 2GUOA 4HWBH 1A7QH 1P53A 3MA7A 3VFSA 4NKIL 5LXGL 3EYVB 2WP3T 2W65A 2QQQA 2ZCHL 3BKML 5GGRY 1KJ3L 1IC7L 4LRIA 1ZWIA 5J6GB 3UBXB 1VGEL 3ZKQD 4FZEH 1A7BA 3PG2A 3MJGX 2A1WH 2ZP0T 3KS0J 3MLPA 1NCDL 2YN5A 4DGIL 2VDPL 3MMEB 4J3TA 1E4XH 4ELMF 1N8ZA 1QKZH 2RIKA 2BVPB 3TYFA 1GZQB 4XNYL 3B6SB 5F6IC 1G6VK 4JO4H 4R7DA 4X8JA 4PJCA 5TE6H 2EDRA 4R2GB 3PP4H 1T0MB 1QSFD 2WQ8A 4M7LT 2VUOA 5BV7L 5C08B 5I9QC 4RSVA 3M1BA 1I7UB 4KJYB 3JTSA 1IJ9A 1S7TB 2QHRH 4PJ9A 1TZHB 2ED9A 2UVFA 1VEPA 3T4YA 3QUKB 1NGWB 1UEMA 1VB9A 3UTPD 2ZUSA 3OKOB 3DVGA 3BRGC 5MERA 1FC2D 4YBLC 3KYAA 1JRHI 5SWZD 5C0ND 2MCPH 1U95A 4UBDD 35C8L 2HFEA 5CHNB 1M05B 2O61A 3QG6B 1BMGA 4TNWF 4U6XA 5BZWB 3KNBA 5HHMD 2HT2D 3S4SB 1JYNA 3L5IA 4JFFB 4QHKJ 1YEJH 1WBZB 4JFZL 3QEQD 4PP2A 3I50H 2Q6WB 2XTJB 3RWCB 1AGBA 3GKZA 3BGFC 1ZHKB 4R4BA 5IM7A 4FXLA 4MB5A 4Y16B 2ICES 3WDHA 4LLUB 5BZDB 1HINL 3QRGH 5FB8A 2LAGB 3WIFA 3NZ8B 5HYJB 5T5FH 1KIUA 1C16A 2JCCE 2LVCA 2CRZA 2VITB 3MLRL 4QHUA 4ZUTB 2JIXD 3QXVA 2IBZY 4FFZL 3MSPA 4JHZA 4H8WH 2K9UA 3U9UB 3O6FC 1RULH 5E99H 4Y89A 2EDHA 4L4JA 4OZFB 3HI5H 4TNVF 2GJ6A 2W60B 1R24B 2HJFB 3NACH 4F7TB 3M07A 3O2WL 3GMNA 5D7IE 3U36A 3QI9C 2DQCH 4KKCC 4YHLL 5C71A 4H88L 4DFIA 2WWKT 2IAMC 4WTXA 1VGEH 3ARGD 4AY0A 5FGRA 4S10A 5T3XD 3NABH 1CBVH 4JG1H 3FB8A 1CD1B 4LSSL 2VDPH 1U3HA 5GGQL 3EO9L 3DBXB 4XB8A 3RVTC 2QL1A 4DVRH 4PBWD 5B3JE 1GOFA 4KRLB 4HFWA 1UC6A 3GI9L 3EOTL 1H0DB 4L8BA 5FGSA 5BV7H 4WW1B 3SDXB 4M62L 1CL7H 4WTZG 4YPGB 5DEZA 3NFNA 5IBLC 1T2XA 3IFPA 2BC4B 1OB1B 2FRGP 1CU4L 1ZVSB 4OV6F 1TITA 5JPNB 3DV4A 3FO2B 3I6GA 3PV6A 2FEDD 3AU1B 3AB0B 3L95B 5E2TH 4DUXA 4XI5C 3V6ZB 4HWNA 5MEQB 4NQEE 4EI5D 5L2KB 5IOPB 1NMBL 2WIIA 5EA0H 4Z77A 4G8GD 2J4WH 1HXMB 1QYGL 1IAIL 1QA9B 3EKCA 4NN5B 3FB6A 2P8PB 5IVZA 5C0FA 4XX1G 1F3DJ 3H3PL 4DQOL 4HWZB 1JGUH 4V1DD 3UC0L 5C9JA 3G9VA 3LQMA 4M93C 1T4KB 5HI3C 3VD5A 2FYYA 3QPQD 1P7HL 5LQBL 3U2SA 1MCOL 5I15H 3DO3A 2RBLA 2ADIA 5I66A 2ATPB 2G60H 1KCSH 2BHZA 2PXYB 3I02A 1YJDL 2A0LD 4DGYL 3T0ED 5I8CB 4ODXA 4NKDA 3ZDYF 4CU6A 2DRUA 5EU6B 3RVVC 1XGPA 3OKDA 3BVNA 3CMOL 2YWZA 3UTZB 3VFRB 1JGDB 5FO9B 2R9HD 2ZPKL 4YHLH 5D71H 4ZOAA 1MH5B 1RAMA 4KUCF 4Z7NE 4OLWH 2ITCB 2QSQA 4IRSD 4PS4H 2DJSA 4FQXD 3U0TA 3W0WE 5CIPB 2GUOB 3O3EB 3JV0A 3MA7B 3VFSB 2DQTH 1PX4A 3I3EA 3LQAC 2NZIA 4KI5F 5CGYC 1EXUA 2DIBA 2QADB 5JW4R 2W65B 3KPRD 1BPVA 4B0MM 1ZWIB 2VL4A 3V6OC 4F37F 4LFHD 3ARED 5DK0A 3X11A 2NY0B 4Y8AA 1N8ZB 4KDVA 4ESKA 2AQ2A 3A6CL 1KTDA 3TYFB 3QUYC 1TETL 2B1AL 4M62H 4ZUVA 2J8UE 3QT2A 5CD3A 2B4CL 2B7DT 3EOYG 4R7DB 2DIAA 4X8JB 3N1MC 4PJCB 5HYQA 2WUCL 3ET9F 3SBWC 5F3BA 4RIRA 1C1EH 1WZMA 3P11L 4OZHF 1QSVA 3UTTE 5ESVB 1OARH 5F7NC 1RI8A 2HP4A 3M1BB 3IETA 3JTSB 4NQDA 1JGVL 3ULVF 2W59A 3T4YB 1YEFH 5IQ9A 3FB7A 5FYJU 5F9DC 4WNQA 5CAYB 3TGXA 3DVGB 1VPOL 1FL6A 2QSTA 5MERB 4RNRB 4MAUL 4E41A 1XCTA 2X4OA 1U95B 4X4ZA 2O61B 4U6XB 1H3PL 3KNBB 2DDQH 5A3ID 3KPMA 1NBVH 5DD5L 3LB6C 5LQBH 5JA9A 1MCOH 4DAGL 4PJ8D 4F57H 4KK5C 1AGBB 2Q86A 1XF4A 4R4BB 5IM7B 1D7FA 4KQ3H 2HTLD 4JVWA 1BFVL 4G42A 5C0IA 1MI5A 2OMBA 5L8LB 1A7PL 1K9TA 5FB8B 5DLML 3GEWB 3IDIA 3WIFB 1DR9A 1C16B 2RR3A 4QHUB 3NCEB 1CDYA 1WLHA 1WTLA 3PHQA 2K3TA 4O58H 4NOBA 6CGTA 3RFZC 4YWGL 3VDCA 2GJ6B 2I9TA 3F5WA 2YPVH 4AM0B 5I18L 4FZ8H 3S3SA 2BNQE 3GMNB 2Q7YA 5DD1H 5HDBF 5T1LA 5DMGC 3X13A 3U36B 4PRAA 5I1HH 6FABH 4CVUA 4BA8A 4JG0L 2H3NA 4L3EE 3O6LL 4QRTA 2XFXB 4GW1A 1DQJA 3FB8B 4U33A 5D1ZA 3P4MA 4JREB 1BD2E 1UVQA 3HE6D 1GAFL 1U3HB 4FQQA 4HUXA 2FBJL 3JWNC 5ACZA 3A6CH 2YZ1A 4UZGA 4JQVC 3I75A 5CJ5A 3SGJA 2EDKA 1YEKH 4NKOA 3LEVL 2C9AA 2B4CH 3A67L 4HFWB 2WUCH 1D9KC 3OSKA 4MD5A 3VW3L 4L8BB 4K8RD 3DWTA 3P77A 3C5ZD 2HH0H 3DYMA 2NY7L 4M4PA 5CILH 3NFNB 5HVFB 4ZUWA 4UOJA 3IFPB 3MYZA 4XBGA 4LCWD 1MCDA 4XNXH 1WFNA 1N64H 1TVDA 1VPOH 1PYWA 2DD8L 3PV6B 3I6GB 5CGTA 2FR4A 4NC1C 4WUUA 1QEWA 4TSCL 2XN9D 2WIIB 4NC1E 4Z77B 4OLUL 2P4AB 4Z7VF 1J8HE 3T65A 1KIRA 2FX7L 3FB6B 3FO9A 5IVZB 5C0FB 3PXHA 3ARQA 3RU8H 3L5HA 4KMTL 1U3ZA 1G84A 3BMVA 5C9JB 2HT3D 3FFCD 1AY1L 5BOZG 2FYYB 3PGCA 5JOPE 2WANA 1WT5A 5C6TH 3FQUB 3TEUA 3U2SB 2F15A 1S7RA 3OB0K 1I7TB 3DLQR 3ZKXC 2ADIB 5ALCL 4L3CB 1DLHB 5I66B 3N1GC 3ARPA 2VN4A 2NY1B 3I02B 4U1LA 5J12C 4PYGA 4ODXB 4NKDB 1GGBH 5F44A 4U3XA 5J1AA 5K59E 1A3RH 4JO2L 4ENED 5ACLA 1XGPB 3OKDB 5L8JB 3BVNB 1QP1A 2IPTL 3MV9A 4Y1AA 1CICC 4D2NA 1DQML 3DOSA 4LVHB 4NKMB 1CK0L 3BQUA 1EHAA 3QWOA 2WIMA 3U0TB 2EEAA 5JLZA 2Q87A 5EOCJ 1URLA 1OPGH 4EEEA 1GAFH 4PJXB 3U4BL 3WFHA 1EXUB 1XGRB 2Y5TB 5KOMC 2FBJH 3RVWC 5ADOL 1W0VA 5EUOF 1CIDA 1T83C 12E8H 4UNTA 1A6VL 1WWBX 5DK0B 3X11B 5LCVL 2AJUL 3MOQA 3KPTA 4ONFH 5I19H 1MPAL 2BNRD 3VW3H 1HILA 1F8TL 4MAYD 1KTDB 1KN4H 2ENSA 2P43B 5D2NC 4I0PA 3KPOA 4G3YH 4KVCL 5CD3B 1DUZA 2QSCL 3BKYL 5D2NE 5F9WC 1GGUA 5HYQB 3LCYA 4GG6A 4PB0L 4TNVK 5F3BB 2NW2A 4RIRB 3C6SA 2DD8H 5E9DA 3RL2A 5TFSH 1JBJA 3IETB 4NQDB 5FUOL 2PTTA 2X44D 4YXKL 4XP6L 3HMXA 1XGUA 5GGRA 5IQ9B 3FB7B 4UIKL 5KOVC 4WNQB 1JWSA 5F96H 3QUMB 2FX7H 1AKJA 1S7VA 2FD6L 4OAWA 4E41B 1LE5A 5DJZA 1FLTX 1XCTB 2X4OB 4JZOA 4KMTH 3VFNA 5I75B 3VFPA 4PJFA 3TJEL 3DYPA 3CSBA 1I1RA 1GH7A 1YYLL 4LPTA 5ADPH 2EXYC 2JJUA 4MS8D 5MEND 4XNQA 2NXZB 5EG6C 5JIHA 5HGGS 5FYKL 3IKCA 3QRFM 3JV6B 1NBYA 2Q86B 1L0QA 1XF4B 1C5BL 2EDJA 1JPST 1S7SA 4G42B 5C0IB 1MI5B 4OB5L 3ZE0E 3GNML 3WUZA 3IDIB 4JO2H 2IPTH 3MV8D 2FJHB 1DQMH 2GK0A 4UQ2A 2X89D 4WWID 1CK0H 3PHQB 4DW2H 1EGJL 4KUCD 5E2VH 4P9ML 2BRRL 3V7AE 4JM2C 2I9TB 3F5WB 4XH2A 5HDOA 4YHPA 1Q9KA 3BRFA 2GK2A 5FGBC 3O4LA 2Q7YB 3QHZL 1PAMA 5T1LB 1AO7E 3WJLA 3SCMD 3X13B 4PRAB 5JNYA 1AD0A 2A9MH 4P5TD 4PD4J 4XPFH 4RMTA 2HLFD 2H3NB 4XWGL 4QRTB 4GW1B 1A6VH 1DQJB 2VR9A 4UAOB 2WAHA 2AJUH 5D1ZB 3LRSB 4D9QE 1M71A 4BK5A 4PJIA 5LWYH 2ICWJ 1UVQB 4FOMA 3M45A 4L4TA 4FQQB 4HUXB 1MPAH 1GGIH 3QUXC 5D93B 3EJZC 5ACZB 1OP5H 5DVKA 3MROA 3I75B 3STZA 3CVHH 5DWUL 2OR8A 3HRPA 1JHKH 5IESH 3ULSA 4JO1H 4NKOB 2QSCH 1E4WL 4EQ3A 2DMKA 2PYEA 5B4MD 1F90L 3EFFA 3HZMA 1CDBA 2BXZA 4HQQL 4MD5B 3CDFA 1MQKH 3PHSA 3P77B 5BO1H 2CXKA 2E6PA 1EERB 5LGHL 4NPYA 4P2RE 1A2YA 1X7QA 4ZUWB 4EOWL 4XBGB 3P30H 3V8OA 4UIKH 2ZWLT 2EZ0C 4Y5VA 1PYWB 1Q9OA 3AC0A 4ERSL 1I3UA 5FKPA 2FR4B 4WUUB 4I77L 1QEWB 3LKQA 4OLZL 1ZA3A 1T2QH 5DC4B 2C4XA 3MLZL 1MHHA 4HG4J 1YYLH 2ZCLL 1BQSA 4QKXB 2Q8BH 3T65B 3RBGA 2IMMA 3WN5A 3FO9B 1ZXQA 3MA9H 4IRJA 4PJGE 1J0YA 1HEZA 3B5GA 1LP9A 5L0QB 1F6FB 4LGRB 4R26H 4P57B 2R8SL 3PGCB 1VA9A 1CZ8L 2GSIA 3QUZA 3GNMH 2SEBA 2NY4C 1S7RB 2B2XL 4MJ5A 3H9YA 5KANI 4N1EA 5B8CA 5BS0E 2H2SD 4G8EB 1W8NA 4WY7H 1EBAA 2P5EA 4U1LB 1EGJH 4S0SD 4PG2C 3BDYH 5ISZD 4YAQA 5FHBL 2AXFA 1GOHA 3MV9B 4GS7C 1VACA 2HKFH 3E8UL 3RWGA 1FYTE 1LO5A 4Y1AB 3QHZH 4K3JL 2R1YA 5F93C 3TVMD 3BQUB 4NNPH 1MIML 3QWOB 4XVUC 2C3VB 3NIGF 4Z0BL 4PY8I 4NP4H 1JF1A 1EZVY 1OGTA 4L8SA 3TO4B 1GGCH 1OHQA 2RGSA 5GS2H 2VAJA 3WFHB 4FQHB 1NAKL 2XNAA 5EBWA 3BPNB 5IR1A 1FHGA 1OTUC 4B7IA 3QISA 5GGTA 3VE0A 3DETC 1TQBC 3C60D 4OI9A 5EB9A 1D3CA 1O5DT 1RJCA 2IJ0C 1A9BB 1E4WH 5C0AE 5D5MF 4TRPL 1FL5A 3EYUH 5I71C 2HJLA 3PWVA 4NM4H 5IJKA 1DVFB 1HILB 1QFHA 2R0WH 3VGBA 5T3ZL 3S36H 4LGSB 3C8HA 1MFBL 4YEEA 4P23C 3HI6L 1S8DA 4I0PB 3KPOB 5I74C 5GS0L 1DUZB 2D03H 3O0RL 1B0RA 4OIIL 1OWRM 4DUVA 2G5RA 5E4EB 3D39A 4U49A 3RVXC 4C58B 2NW2B 3C6SB 3FO1A 5E9DB 3RL2B 1AR2A 4N0CD 4I77H 5CZVL 1SY6A 5IVOA 4JHAL 2PTTB 2VYRE 3TIEA 2AEIT 1ZTXL 5C0CD 1UM5H 1XGUB 5GGRB 2FHFA 1NGPH 1JWSB 4YFLI 4ZS7L 4GQ9L 4LAJH 1AKJB 4LIQL 1S7VB 2ADGA 4MJIA 4OD3L 4OAWB 1ZKAA 5CJ8A 5SWSA 1IM3A 2RB8A 1JTTA 2APWA 5DJZB 2B5IB 1R5WA 3VFNB 1RFDL 2NQCA 4IOIA 3VFPB 4M7JH 2R1XA 4PJFB 3OXSA 1O0VA 2AJXH 2ZSWA 4LSQH 4XNQB 5C07A 4Z6AT 1OL0A 3UMTA 3T3PE 4FG6D 3IKCB 3WE6A 1CE1L 1NBYB 2YBRA 1DUYA 5ALBH 2CO6B 4NGHL 5J9PA 5KAQG 1EMTL 2IFFL 1S7SB 3IDGA 1BBDH 4P2OC 1X5HA 5FHBH 4OFPA 1HYSC 1WAAE 2CUIA 3EAKA 4PJBE 1JZ7A 2J6EA 5IHBA 3B2VL 1DBMH 1MIMH 5HPMA 1A3LL 4D9LL 3EDFA 4QXUL 3ISWA 2D7TL 2ZKHL 1FVEA 4XH2B 1PLGH 4YHPB 1NSNL 1Q9KB 3O4LB 2YK1L 3TA3C 1EFXA 3P3YA 1GC1C 3FONA 5EU5A 5JNYB 3OAZH 1AD0B 4H1LG 1P4BL 3UXFA 3CDYA 4Z18A 4O00A 4GAFB 3PNWA 1Y6NR 5T1DL 5KSAD 4J3OC 3U82B 1UH4A 2VKXA 5IHUH 1NUNB 4RMUA 1M71B 4FXKA 4PJIB 5CJOL 5K9OA 4L4TB 4NZDA 4KKAC 1EUUA 5HYEA 4G6AD 5IT2L 4FQCH 1M4KA 1NFDA 3MROB 3O9WD 3STZB 3MODH 3ULSB 3HI6H 3LQAL 2MKWA 2VZ3A 2CR3A 4LRNL 1IRAY 1PD6A 1S78D 5DURB 2PYEB 4OLEA 4MDIB 3EFFB 3HZMB 4HJ0D 3DX6A 1IE5A 2HTKD 4NQCA 4DK3A 1IL1A 1UM4H 3ARTA 3BIAX 1KULA 4NN7B 3MCLH 1IEHA 5FCSH 1QUNA 4C59B 4NPYB 1JPTH 1A2YB 2W9DL 5JW3L 1X7QB 3QHFH 4DUWA 5IVXA 2HMID 1CFTA 3TT1H 2GQHA 1AD9A 1JPGA 3HPLA 4Y5VB 1U3YA 1Q9OB 3KPSE 4C4KO 5FKPB 2IGFH 2MKLC 3LKQB 5IMLA 1ZA3B 1NMCB 4AEIH 1SJHA 4MQTB 1MHHB 3VFGH 4X6CE 5F7HA 2V2TA 3WN5B 4C54A 4IRJB 1FO0H 2KBGA 3RAJL 1HEZB 3D3VE 1F3JA 2E7LA 4HGWA 5AYUL 3UTSD 1EMTH 5FECA 2UV3A 4XCNA 2GSIB 3QUZB 5TH2A 3L1OH 1ZLWH 1YC8A 4H0GA 2SEBB 5AUMA 1HHIA 4CN4A 4MJ5B 1X5JA 1N0XH 3CPLA 4Y4FA 4AENA 4QRQB 2RQ8A 5B8CB 5T1MA 5CP3H 2CJUL 3CCHB 1CLYL 2P5EB 5D1QD 3FMGL 3W9EA 3I6KA 5T5NF 5I8EA 1QHPA 4OFVA 2ZKHH 2AXFB 1NSNH 2VZTA 4Y2DA 1VACB 2DQJH 4GUPA 1QRND 3RWGB 1LO5B 2WWKO 2JCCF 3WS3B 2H2PC 2AJSL 3L7FA 3EBAA 2R1YB 3PWLB 3Q1SH 5KVGH 2GYSA 2E7BA 1KENH 1D5XA 5IW1A 4A6YB 1ZK9A 4ZODA 1TVHA 3VG0L 2ESVE 2Y1VA 4J3WA 3CK0L 4MX7A 1JF1B 1OGTB 4JQIH 4L8SB 4XXCC 2YMXH 1RIVL 1ZLVH 1PG7X 4X6DA 3QDJE 4OIAA 5D7IF 4L9LB 2XNAB 3L3HA 5EBWB 5IR1B 4XCFL 4ZXBA 2VOTA 1RZ8A 3VE0B 2ICEA 1ZAGA 2GY7B 3S3JA 3ZZ1A 3LQAH 2OZ4L 2EIZA 5MHSD 1FL5B 3HN3A 2HJLB 3PWVB 1ZANH 4MNQA 2W0LA 3V0VA 1BQUA 4ZAKA 3U4AA 4Q9BA 3TZVA 3MLUL 1S8DB 1JRHH 4URTB 4LSTL 5TE7H 5JW3H 1B0RB 3MFFA 3SOBH 4KROC 1Z9OA 3D39B 3MGAA 3FO1B 1RUKL 1KC5H 4ZTPH 5F97E 2EDQA 1IKNA 4I3RL 1KEML 2Z0BA 2ERJB 3GBML 5HVGB 3L6FA 3TT3L 3TIEB 3QH3A 2NX5A 1YMMA 3DUSA 3MLTA 2E7CA 2FX9L 1UFUA 3PWUA 2ADGB 3DMMC 4MJIB 5SWSB 1IM3B 3AFLA 4H1LH 2VABA 1P4IL 1R5WB 2EE9A 4IOIB 5KZCD 2NY2C 3VXME 2R1XB 4HMEA 3OXSB 4MSWA 1S9XA 4JO3L 2ZSWB 4NWTH 5IROC 2UZIH 5I0ZA 5C07B 1BIHA 4XMPL 4YK4B 5DJ0A 1FN4A 3WE6B 4MA8H 3D5OF 3MRHA 1DUYB 3PHOA 3OZ9L 5J9PB 3V4UH 3IDGB 3IS0X 1TJIH 4Z7OE 4TOYL 3OBAA 2VH5H 5E8EA 2O5YL 3BUYA 1BZQK 1MCIA 2DQIL 4FTVA 4TUOA 3U0PB 1B2WL 5DD3H 3WV0A 4PFEA 5HPMB 5EC2A 3NPSB 4GSDH 4LP4A 3EYSH 3VG0H 1FVEB 1M6OA 4JFOA 4PR5A 3B5TA 5F6HI 3R8QA 5CD5C 2RFXA 4AT6A 8FABA 4IJ3C 1EFXB 5EU5B 5JW4Q 2F53E 3LRHA 1FLRL 4HIHA 4PREA 2WBWB 4PJEA 2APFA 3VH8G 3PNWB 3IYLW 4ODVL 4Z7NF 3EHBD 4IBLT 3ARBC 3ZHLA 4UILL 1BVLA 4FXKB 2ZOLA 5K9OB 4N8VG 3S6CA 4S2SA 4QRPE 5JDSA 3AS3A 1A9EA 1NFDB 5AWNH 1T7WA 5ITFA 3WFEH 4OLYH 5DD6A 1B4RA 3ME0A 4JPVH 3DX6B 3FL7A 3IVKA 2HVJA 4NQCB 4PJHA 1RUKH 1IL1B 4LVNB 1T22A 5JHDD 5JXAH 1GIGL 1JNLL 2X4QA 3BSZH 2F54D 4PJ5A 5IVXB 2H6PA 1CFTB 3WS6C 1JPGB 1FJ1A 3U4EA 1I8LC 3HPLB 4NQVA 4QLRA 5HDQH 5ESQA 1BJMA 1U8OA 1KJ2L 3QR2A 5C86A 2F5AH 3NIFE 1RUPL 2HRPL 2PYFA 4HGKC 1P4IH 4MZ3A 5IMLB 4OGYH 2PTUA 5EWIL 5HHVL 2LQRA 1HOCA 2D7OA 3KXFD 4DKFH 3CSGA 1MWAL 2V2TB 1UB5A 2VWEC 4WEMB 3IKKA 1NC2A 1KB9K 1PZ5A 3UPRA 1F4AA 4P4RB 5CGMA 3P4LA 4OLXL 3TIDA 5IBTL 3OZ9H 1F3JB 3U7WH 5FECB 3V7MA 4MD4A 4XCNB 2DN7A 1NGXA 1QQDA 1A0QH 5TH2B 5AUMB 5E6IA 2R4SL 4JFFE 3X14B 1HHIB 3CPLB 4Y4FB 4CNIA 1VDGA 4AENB 3ZKNC 5T1MB 1B2WH 1LK3H 1MCWW 4Y16C 4KRPB 3SO3C 2XOTA 4TTDD 3W9EB 3I6KB 3ZDZE 2R0ZL 4GRLD 2NY6C 5D7LA 5JW4N 4M7LH 2DKSA 1AC0A 4PRPE 5GJTH 4GBXD 4Y2DB 4ZNEA 5ILTL 2AAVA 3HAEG 5HYJE 1LDPL 1ADQA 3BKCH 3L7FB 5L8KB 2AQ3A 4EBQL 5EU4A 3MJ9L 5FV2A 1D5XB 5IW1B 4ODVH 2AJYH 3PIQA 5E2JA 1CT8B 5DK2A 3FHAA 1QZ1A 4MX7B 3PL6D 1KPRA 4UILH 3DURA 4ZO9A 5GS2D 5C1MB 1NUGA 2X09A 7FABH 4X6DB 4NZJA 4AZ8A 1BECA 5CLTA 4ZXBB 1RZ8B 2FL5A 2X4RB 2ICEB 5E8NA 2BVOA 2Q8AL 1RK0A 2EIZB 1TZIA 1SYVA 2R39A 4UT9H 3SE9L 4MNQB 2P8LA 3V0VB 4ZAKB 5D96B 3VXSA 1KLFA 4OKVB 3TZVB 4DJMA 2DLFL 4DEPB 1J88A 5GS3A 5CBEA 3MFFB 4XHJC 2CK2A 1KGCE 4U1MA 3KYNB 3PGFH 4QEGA 1BREA 1KB9J 1EO8L 3LH2L 2HRPH 1MRDH 2DBLL 2APBA 5FM5M 3L6FB 1HKFA 1A14L 3SDXE 3RRQA 3UDWC 1AR1C 5EWIH 1A21A 3RIFF 3QH3B 2NX5B 3ZL4H 1YMMB 1L9NA 2JELL 3DUSB 4TUKH 1K4DA 4D94A 1MLBA 3MLTB 3R0MA 3EZ8A 5CKAA 3LKSA 5KSBA 3PWUB 4K71B 5B39G 3I2CL 4KAQH 1MCWM 4QT5A 2VABB 3TM6A 4RGNB 1D5ZA 4IOFC 2AJZA 4LHUG 4QRRA 3DRQB 1WZKA 2WINB 4OLXH 3TLRA 1A47A 1ODAA 5ANME 4PGCA 4MXWH 4MSWB 1S9XB 4NN5C 4KGJA 4P5MA 2R4SH 3L3JA 3QWRA 4EIZC 2Z31D 5DJ0B 1FN4B 3O3DA 3MRHB 2ZJSL 1YYML 3BOVA 2MQ3A 1HYRC 2R1WB 4I8DA 1QNZH 5BOPA 4WGWB 2APTA 4YDLC 1UENA 3F62A 4FTVB 4X4YA 4TUOB 3HB3C 2PXYC 4XVJH 4M5YH 1BGXL 5EC2B 5IP4A 1RZFH 3QCVH 1FNAA 3ULUC 3RTQA 3RWHA 1M6OB 4JFOB 3DSFL 5K59F 3O6FD 1ZT1A 2AERT 4PR5B 4ETQA 2RFXB 5E8PA 4AT6B 4ODTL 8FABB 5JHLL 4XZUA 4ZFGL 2DL2A 4PJXF 5J7CC 1BBJA 4P9HC 4IDLA 3HA0A 4HIHB 4PREB 4PJEB 2NY3B 1QG3A 1XF2A 3QI9D 3JTTA 1FNSH 4KKCD 2X4PA 1BVLB 2DAVA 5LG1A 2Q8AH 3C8KA 3OJMB 1DQQA 4JY6A 2IAMD 5DC9B 2Q3AA 3SGEI 4S2SB 4D3CL 5JDSB 4FQPA 1MFCL 4HIXH 4X9FA 4LRIC 3GRWL 1NLDL 3H9SB 1XMWA 5K9JL 1Z6JT 4OCSH 5ITFB 5I1AA 2N7AA 3GHBH 1MCSA 3W5MA 1E6OL 5DD6B 3RVTD 1FNLA 3BJLA 1GHFL 5LBSL 4P5KA 3IVKB 5D8JH 2HVJB 4FQLH 4PJHB 4JKWA 1T22B 2MMXA 2AVGA 3HHRB 3X3FL 3WKML 15C8L 1A14H 2X4QB 4QOKA 4M5ZL 4PJ5B 3QNYA 2H6PB 1YECL 4HXBL 2JELH 1FJ1B 2HFGH 3U4EB 4NQVB 4B50A 5ESQB 1U8OB 1YNKL 5IBLD 2PYFB 3I2CH 4C56A 4PJ9C 2AXHA 2R15A 2F9BT 1HOCB 2L0DA 4WU5A 4MQXC 5GRUL 4NFBA 4NQED 5GGUA 3WD5H 1UB5B 4XI5D 1UM6L 4K94C 1NC2B 3ILQC 1PZ5B 3UPRB 3TIDB 5DT1H 1YYMH 1S7XA 1C5DA 4MD4B 4JY4A 1J9CT 4M1GH 4KK9C 1NGXB 2XIDA 2ZCKH 1QQDB 3U46A 3S88H 2BY1A 3RY5A 4KQ4H 4RCAA 3MRPA 4YBHA 1V3KA 5HI3D 1AXSA 3NH7H 1BHGA 5IB2A 1H8SA 1A7OH 5D2LF 1ZVHA 2KQNA 1E6JH 1BGXH 5HYSB 3TO2A 4NUGH 4PRHE 1MCLA 3INUL 2EH7L 5D7LB 2YXMA 4MNGA 5FUCC 3RA7L 3ZE0F 2YRLA 4M4RA 3MRQA 43CAA 4HC1H 5FUCE 3VXUE 4YDKH 1WISA 1ONQB 3E3QC 4HUNB 3RVVD 3T77A 5EU4B 5C6WH 4L4VA 1FZMB 3E3QE 4LVOC 3PIQB 5FGCB 3GM0A 4BH7A 5DK2B 1KPRB 3DURB 3MRCA 1UZ6E 4YHIA 3W0WD 1MUJB 1RY7B 3BAEL 4OLVH 1V3MA 2FL5B 1FYHB 1QSEE 2FSEA 1C08A 5E8NB 3MZTA 5CGYD 1GC1L 3QJHA 2BVOB 3IFOA 4JREC 5D70L 1RK0B 1BQHG 1U3HC 1TZIB 1SYVB 3F58L 3GJFA 5SWZA 4M1CC 2Z8VC 2P8LB 4G6KH 3VXSB 4OCMC 2Q3ZA 1N7ML 3D1MC 4GRWB 2WWMC 4OF8A 3B9AA 1FL3A 5CBEB 5I1KH 3QEQA 3QG7L 4U1MB 1I3GH 1YECH 4HXBH 3QUYD 4YHKL 1CE6A 3KR3L 1UJTA 3MTRA 5CINL 5LVEA 4KXZI 3AGVA 3UYOD 4PJ7E 4P59L 4LCYA 3HNSL 3LZFH 3GMMA 3DX7A 5DJDA 3UTTD 2ADFL 3O45A 5MI0B 3DVFA 4KKLD 1F58L 4X6EA 5GRUH 3HKFA 1K4DB 1SMOA 1MLBB 4NBYB 5IG7A 3LKSB 3FRUA 2IQAA 5KSBB 4FRWA 1T1YA 3VD9A 3SGDI 1NQBA 4QT5B 1ZLVK 1D5ZB 2AJZB 3FTGA 3RQ3A 5C09B 4PGCB 1NCAL 4XMKL 4ACPA 3CSPA 3T8XA 5E56A 5F9AC 1NCUA 3N9GL 4P5MB 4UINL 3KLSA 4F7CA 1BP3B 1NEZA 3L3JB 3C2AL 1RUMH 2XT1B 4N9OB 4P2QA 3H8NA 5TQ2H 2LE9A 3W81A 3TCLA 3LB6D 3ARGA 3WFZA 2V9RA 2HAZA 3KYKH 4KK5D 1FE8H 2D3VA 3INUH 3FAWA 4PGZA 1GSMA 2WQRA 4X4YB 1OAXL 3FQXA 2FDBP 2YPLA 5DJ6A 4TTGA 3EYFA 2FNBA 3ZMRA 4ODSL 3RTQB 3RWHB 4QF1A 3KYMA 1RU9L 3TJHC 4WU7A 1ZT1B 5E8PB 2YHGA 4RA0C 3S5LA 4LVHC 2BNQD 5EOQL 1BBJB 3QQ4A 4GT7A 4R3SA 2Z93A 1BWMA 2EDDA 4TSBH 3ZDXF 4HKZA 1XF2B 5DMGD 2PN5A 4RX4A 3JTTB 2WUBL 1JZ3A 4UI2A 3DTXA 4L3ED 2X4PB 5IMKA 1NGQL 3C8KB 1DQQB 4JY6B 4LLDA 3T2NL 1BD2D 2BJML 5DQJA 4BELD 1JF5A 4LCUA 1BJ1J 4MYWB 1HIMH 3NCFB 4G8GA 5I1AB 1FP5A 3MRNA 5LJYH 3QG7H 4YHKH 4D0CA 2F8XC 1YEGL 4P5KB 3GMOA 4RAHA 2M2DA 4V1DA 1CXIA 2Y23A 5ABDE 4PTUA 1D9KD 5HVWA 4YDIH 4QOKB 4M7KL 3QNYB 3BEVB 3LD8B 1Z3GL 4G6JH 1CR9H 1CI5A 1VERA 3IAGC 4O2FA 1CLZH 4Q7DA 2I60L 3BPLB 4C56B 3MZGB 4G7YL 3T0EA 3B8YA 3EJJX 5DEFA 3KLHC 4WU5B 2FGWL 4M43L 25C8L 3OAYH 2ED8A 4RISL 5GGUB 1N4XH 5BVJA 3VJ6A 3FAXA 4PGJA 3RWIA 5DJYA 1J8HD 1OAKH 3F7RA 1YEIL 5I75C 1RIHL 4BUHA 2VZUA 4YBQC 2EDLA 2WBJC 4IRSA 5ITBH 3BN3B 1S7XB 2AABL 4ORZC 3V8CA 4JY4B 4O2CA 5TQ0L 4GRMA 3X12A 5JOPD 2NXZC 5JUEH 3HNTH 4HV8A 3TCXA 3ZLQC 3MRPB 8CGTA 1AXSB 3UBXG 3KPRA 5HD8C 1OAXH 5IB2B 3T3PF 5HJ3A 5ENWA 5GISL 4LLAA 2GCYA 2O5XL 3TO2B 4X9IA 3AREA 1NUFA 3GSNA 5IK3A 1R3IL 4MNGB 3UEZA 2CGRL 4QGYA 4F7MA 3MRQB 3WUWA 43CAB 3I9GL 1WAAF 3HR5A 2IAND 3RY6C 2EDFA 4PJBF 5FDWA 1FIGH 4HK0A 3T77B 5CUSH 4FFWC 4L4VB 2DMCA 4IIQC 1CICD 3JWOC 1PKQE 4BH7B 1T03H 2WUBH 4RAUA 3MRCB 1INEH 4YHIB 4YE4H 1RURL 4L3AA 3V5DA 2XPGB 1SVZA 1LO0H 1WBXA 3RUGB 2FSEB 1C08B 4YHMH 4KDTC 2EKSA 4OCRH 4K23L 5D1ZC 4YLQT 3RVWD 3IFOB 3OMZA 1RIUL 2P5WA 2BY3A 3GJFB 3L3DA 1YEGH 4K3EL 5D93C 3GGWA 5SWZB 4EJ1C 2O5ZL 3S4SG 5GJSL 2C7UA 2DWEA 3BKJL 5B38A 5HHMB 1RZ7H 2I07A 1LGVA 1FL3B 5FK9A 3QEQB 3NCBB 5I1GH 1CE6B 4PJ8A 3OGCB 1MNUL 4LCYB 1S9YA 1YEHL 1IQDA 3SGKA 1X5FA 3I6LE 3GMMB 3DX7B 2YPKA 3DGCR 4JHWH 3O45B 3RZCA 1QLRA 1QFWI 2PR4H 5M95B 3DHJA 4X6EB 4DN3L 4OQTL 1U41A 2F5BL 4HK3N 5IG7B 2JIXB 2IQAB 3FRUB 2FEEL 5TDOA 1T1YB 4UB0H 4NO2A 4OZFG 4WEBL 1YEIH 3FTGB 1MSPA 3DO7A 2VLLA 1ED3A 4P0DA 3T0WA 3V4PH 5L9DL 3QAZB 3T8XB 1MCKA 1P6FA 4X6CF 4F7CB 1NEZB 4GXUM 4P2QB 4HD9A 3CFKA 2EXYD 2WLYA 3MJ6A 5IJVA 5L0QC 4HS6A 4XWOC 4LU5H 3ARGB 2O5XH 4LLQA 1WT5C 4MA7H 2CGRH 4ELMA 4ZSOA 2CR6A 3VRJA 3I9GH 3FQXB 1FAIL 4XCEA 1FVCB 5DJ6B 3V5KA 4R4NC 3EYFB 2Y07H 2YN3A 3MGOA 4GLRI 1Q0YL 4APQC 5EFIA 3GJEA 1A8JH 4JFYA 5I2IA 1JL8A 4QF1B 3KYMB 4WU7B 2M1KA 1CFSA 1AXTL 2YKLL 5BRZA 1HXYA 3S5LB 4N68A 2WLZA 4JM2D 3BQUC 3HE7A 1DBAL 5JPMA 1AO7D 1WEJL 3QQ4B 2BX5A 4P3DA 4MJ4A 4R3SB 2Z93B 4WTWA 4Z5RA 3VMOA 4JN2A 4UT7H 4HKZB 1NCCH 3MC0A 4LCWA 1H15A 3DTXB 5IMKB 2M8XA 4LAQL 3VXTA 4BFBD 2AGJL 4LLDB 1ULVA 2H32H 1QBLH 2J88H 4D9QD 3BPNC 2BMKA 1VFBA 5DQJB 2D7PA 4OM1H 5D9SA 5GJSH 4LCUB 2Q7NA 2XN9A 1T1ZA 3MRLA 4G8GB 1NGYA 3KPNA 2X1QA 3QUXD 5D72L 2ARWA 3EJZD 3FN3A 1P7QD 3DVNB 2HVKA 2IG2L 1OD9A 1KFAL 4D0CB 2DM3A 3GMOB 5I1JL 4K2UH 4V1DB 4YFLF 3FFCA 3RNKA 4ZFFA 1IGJB 3MUJA 4NZTH 1EHXA 2BERA 4HKJA 3BISA 4P2RD 5E4EC 4BYHA 1J0IA 3PJSA 1KIPA 5CZXC 5EIQA 2VXUL 4GG6E 1B90A 1KCRL 4I2XA 4O2FB 5JTWA 2OZ4A 2Y06L 3T0EB 2BNUA 5AZEH 5DEFB 4OCYL 4OSUH 2ICWA 2XI9A 1H3XA 3ARDA 2DYPD 4TVPE 3SDDA 5BVJB 5EU3A 3VJ6B 3MXVH 3RWIB 5DJYB 2OR9L 3HMWL 2OM5A 3AUVA 3OPZL 3SDCA 2KZWA 4PLKD 3NFPA 3Q3GA 1NDMA 2PETA 3DUUA 4IRSB 4KZEH 3GMPA 1HWGB 4O2CB 1OD7A 1TTFA 1GPOL 4GRMB 3X12B 4HWBA 4KWUA 1P7KA 1DBJH 2AEPL 2VTFA 4HV8B 4J3SA 3T4AA 3V52H 4S1QL 3KPRB 4AL8L 1TJHL 5DF0A 5HJ3B 2XKNA 5F7KC 5BS0D 1PSKL 4Y2OA 3AREB 1HH9A 4Z7OF 3GSNB 1I9IL 5IK3B 4HDIA 3JZ7A 4NNXA 2DB8A 4F7MB 3WUWB 4PPTA 3O2DH 1QPXA 3M17A 1T6VN 3HR5B 1ZOXA 2GHWB 1J05A 1RMFH 1FYTD 3G5VA 5FDWB 4HK0B 1DBAH 2FATH 1J87A 2VXVL 2XZAH 3D9AH 1UH2A 1YN6A 1E4XI 5ICYA 1MCPH 1CLOL 3TBWA 1AH1A 2C1OA 2EXWC 2OQJB 5J89A 4F9PA 5HHPA 4XVUD 3WJLC 3ULUL 1TCRA 4LAQH 1P84K 4OZFH 4WW2B 1J1XL 3OAUH 1DP0A 1HHHA 3V5DB 1JUFA 1IFHL 1WBXB 4WRLA 5H37G 1OSPH 2EKSB 3HFMH 1EJOL 4P9HL 3GHEL 4HUKB 1N6UA 2IG2H 2P5WB 5C0AD 3L3DB 3DETD 5GHWH 3GGWB 4PJIE 2DWEB 2NPLX 5AAMA 2FX8H 5B38B 4Q6YA 2I07B 3IFNH 2ARJQ 3KHQA 5FK9B 5DUML 3S37L 5BJTA 4PJ8B 1R0AL 4P23D 4NRXA 1I9JH 1IQDB 1KCRH 4NN7C 2XA8L 2YPKB 3RZCB 3KPQA 1IZJA 1UWXH 3W2DL 3TNMA 3VDAA 1CFNA 2VLJE 3MV8A 3CFDA 1RZGA 4Y5VC 5TDOB 1KCLA 2X89A 4KVNL 3OPZH 4NO2B 3WHE0 1NCWL 3NIFF 4K3DH 3DO7B 1NMCC 2VLLB 1ED3B 4F58H 4FQIL 3HC3L 3BMWA 4K3GA 1GPOH 3RP1A 5C7XH 2AEPH 3WN5C 3SCMA 4S1QH 4IRJC 3GM8A 4HMCA 4BKLA 5IJVB 4HS6B 4KI1A 1FNFA 4CDGC 1LP9E 5HGHA 4LLQB 2ZOKA 1RZIA 1IZKA 2HA1A 1Z5LA 4EDXA 1P84J 4ELMB 1QR4A 4KY1H 5B8CC 4ZSOB 3VRJB 4XCEB 4JDTH 3V5KB 4P2OD 1CF8L 3MGOB 1HYSD 5EFIB 3GJEB 2X1WL 3WNLA 3BRDA 4JFYB 5I2IB 4R97B 1BEYL 3IF1A 1CFSB 5BRZB 1HXYB 4OZHA 1FC1A 3MV7A 3HE7B 1QBBA 1IGIH 4ZO8A 5JPMB 4MXQC 4P3DB 4Z5RB 4QXGL 4N0UA 3AVEA 5I16A 1P2CA 3TA3D 3MQIA 1X4ZA 1JZ6A 4L8SC 1MCCA 1H15B 3LKPA 2J5LB 4LCWB 3VXTB 2AK4A 2HYMA 2BMKB 4Y4KD 1VFBB 5D9SB 2ARJA 2FLBT 2XN9B 1T1ZB 4PUBH 1X6LA 1NGYB 3KPNB 4WVRA 4JDZA 1EAPA 3DI3B 1N2RA 4OTXL 3UAJC 3S35H 2HVKB 5E5MB 1R0AH 1A4KA 4PJAE 4KTYA 2E8ZA 3GIZL 4Z95L 2VUYA 3FFCB 3HNVL 3RNKB 4OBSA 3RX5A 3JV5A 1IC5H 1U58A 4L5FL 2CSPA 1CVSC 3MFGB 5F1KC 3PJSB 1KIPB 4F15C 3FCTA 2XY2A 5D7SL 1MIEH 2XTLA 3D39E 4YXHH 2OTWA 2MHAA 4I2XB 2ERJC 5DC0A 4G5ZH 3CH8A 1JK8A 2BNUB 4A2LA 5I1CH 3KPSD 3QCTL 2ICWB 2BSRA 4PG9B 1LEIA 1AE6L 1J1PL 4HAFA 3O11A 1VFAB 4DTGL 3DSNA 1G9NC 4Y4HD 3QZWA 3TVMA 1ITBB 1I4FA 3NFPB 3Q3GB 1U8NA 4N9GA 5H37H 3DUUB 3GMPB 4NHCL 3CC5A 4K94H 3D3VD 2XQBL 1D6VH 3OTTA 1P7KB 3T4AB 4YK4C 4XBPA 5CCKL 3OKMA 4ZMAT 2DQGL 3GIVA 5E24E 2XKNB 1SM3H 3PGDA 3HAEA 1HZHH 1KG0A 4KHXL 3WL9A 5HDLA 2E8YA 5F1OB 1HH9B 1MEXL 4MD0A 1HHJA 4HDIB 4NNXB 1BEYH 3SKMA 2BNRB 3M17B 4R0LA 1NEUA 3VG9B 1CDHA 1T21A 2B20A 1Z9LA 3G5VB 1J05B 4J6RL 4HBCH 5GRJL 4NHUA 3G6DL 2GKIA 4LMQI 4FN0A 4Z0XA 2DQHH 3B3IB 3MRIA 1YN6B 4ZYKA 2H2PD 3TBWB 3U0WH 2C1OB 5DJ8A 3WSQH 5HHPB 1B3JA 3OAYK 2ESVD 1TCRB 5T33H 4X4MA 1H3WM 3VCLB 1HHHB 1JUFB 1AI1L 5EUKA 4N90E 3QDJD 2F58L 2EE3A 5E8DH 4GXVH 5C0CA 3BZFB 4Z7VA 1OAQH 1OAYL 3VD4A 1AIFA 1D5MA 2I5YH 1OWWA 2HJKA 4I3SH 5FYJL 3Q5YA 3P0VL 3L5XL 4XNZB 1AP2A 2V2XA 3BP4A 1IAII 1L9MA 2AJVL 1BF8A 2QR0A 4H20H 5BJTB 3RGVC 1I9RL 3EGSA 1MFEL 2X9YA 5D7SH 5A2JH 1IGYA 4JQXA 4LVNC 4KROD 4F9LA 3KPQB 3VWKD 3TNMB 3O3BA 1J1PH 3MV8B 2OL3H 1RZGB 4XNMA 3GRWA 1CXHA 4O5LH 4OZGF 3VWJD 5C0BE 1RJYB 5I30L 1U93A 3ZHKA 2YUZA 3DMMD 5EBMA 1GGTA 2XQBH 1W8OA 4K7PY 3VXMD 5DZNA 3SCMB 4JCMA 1G7PA 2YC1A 4P5TB 3D85D 4JY5L 1LWRA 4BKLB 3U83A 2DQGH 4LBEA 2E7LC 3PE9A 3QUML 5EUOA 4KHXH 5HGHB 1ITCA 2ZOKB 5IQ7H 1D5IH 1RZIB 1H3UA 1MEXH 1MREL 3WO4C 1Z5LB 3QEUA 4EDXB 4O02H 3RL1A 4O2EA 3EO1A 1K2DA 2YD4A 4HEPG 4BQ6A 1MHPH 2KL6A 1WVZA 4U6VL 3O9WA 3G6DH 1RZKL 4IM8A 2FIRT 2EO9A 3AS0A 3RIAK 5BQ7A 1WCBA 3VGAB 5GRYA 1UADC 3K4ZA 4NJ9H 3IDNA 1MJ8H 3IF1B 3U30C 2K7PA 2DWDA 4OZHB 4PY8J 3MV7B 1ZLSL 4HJJL 2JJVA 3QSKB 1AI1H 2JJSA 5CD5D 1PBYA 2F53D 4N0UB 5I16B 1P2CB 3Q2CA 4XAWL 3LS5H 5KW9L 3CFCL 5KJRL 2J12B 2AK4B 5I73B 1A6UH 1WFUA 3JWOL 3CX5J 2WSKA 1IKFH 1H3VA 3ARBD 2EDYA 3CH1A 2E27L 2VL5A 4QRPD 1JZ8A 2ARJB 1FFQA 4OZ4A 5D6DA 2VXTH 1UJ3A 4FS0A 4LEXH 5I8OH 1UXWA 1NLBH 4JDZB 1EAPB 4LSDA 5ECJE 1CWVA 4GG8B 5IWLC 2AI0H 4RFEA 1A4KB 4M8QA 4ZAKC 2GTZA 4GMTL 4NC2B 5FO8A 4U6HA 3MV01 1Q9WA 3TZVC 3UTSA 1FCGA 1U58B 2E9BA 2MFNA 3FCTB 5F3HA 3WNPA 4NM8H 4H0IA 4WDIA 4J3UA 2OTWB 2MHAB 4PJ7F 5EO1A 3TP4A 2FO4A 3A0OA 3RHWF 1JK8B 4YFDB 4F80A 1W2KT 5I30H 3QDGE 3CAFA 3ETBF 2BSRB 2PCPA 1LEIB 1N6QL 3S8WA 3O11B 2NX5E 5JA8B 4K71C 3QZWB 1FORH 1F4HA 2J1KA 4UIMB 4RGNC 3TVMB 1I4FB 1U8NB 3G6JE 4N9GB 3N1QC 3OF6A 3QJFA 4LMQE 3CC5B 3GBLA 5DYOA 2BFVL 3VRLE 4R8WH 2UYLA 3MUGA 3IXTA 3V0WH 1TZGL 3G08A 4XBPB 3OKMB 4JFFD 1JZ2A 3BXNA 3PGDB 4WENB 2IADA 5L88L 1KG0B 2YXFA 3WL9B 5H94A 2Z4QA 3KWWA 4KUZL 4M6ML 1F42A 4E5XA 4MD0B 2XICA 4ZNCD 2JF1A 4WCYL 3SKMB 5KTEL 4PRPD 4R0LB 1FG9C 1F4XH 1T21B 4UV7H 4A2MA 2OSLA 4HJJH 4BQBA 2NY6D 4NHUB 3UO1L 1HSAA 5HYJD 4UT6H 2V9TA 3PP3H 4Z0XB 3ZTJG 2P45B 3MRIB 3ARFD 4XAWH 4ZYKB 2VXSH 1L7IH 5ETUA 3G5XA 1XGQA 4LSPH 1J1OL 1PG7H 5DJ8B 5KW9H 1KN2L 5KJRH 5HHOE 4RFNB 3VXQA 4Y19E 1XIWA 2Y6SC 5CEYA 2NXYD 2BVEA 5EUKB 4QTIH 1CN4A 2NY3C 3OKEA 5C92A 2DM4A 5IMOA 2OYPA 3D0LA 2JB5L 5C0CB 4FFYL 4Z7VB 1JCKA 1AIFB 1D5MB 2IBGA 4HF5H 1KXQE 2CDEA 1AFVL 4NSKB 1IGFL 1F11A 1SHMA 1AP2B 1UACL 1NCBL 5I76A 5EO0A 1FRGL 1KYOK 5DUPH 4POUB 4XC1L 2QR0B 4JFDA 3SDAA 3WCYA 3EO0A 1ZEAL 1F4YH 1KGCD 3EGSB 1K6QL 1IGYB 3JVGA 3CXHJ 3OHXA 2VDNL 4FABH 5IIEA 4HFUL 1RHHB 3GSVA 1BFSA 2P8MA 1ES0A 1CDJA 4GKZA 3FT3A 3ZO0A 3O3BB 2H1PL 1BWWA 4XPAH 4X80H 4XNMB 1I1AD 5DJXA 1AR1D 4NRYA 2CLZA 3VGEA 4G9FE 4PV9A 4YXLL 1U8MA 4NBZB 2MWCA 3I85A 1U93B 1P6AB 4XP5L 5GGVH 4WI5A 4Q9RL 4XX1E 2BFVH 2XWTA 4IOFD 4LASL 5I17A 4X7SL 4YDVA 2FH6A 4N8CH 2EH8H 4TVPL 1G7PB 3HMXL 2YC1B 3QWQB 5CEZL 1GGYA 4U6YB 4NBXB 4XP4H 4LBEB 3F7VA 2UWEF 5EUOB 3K2UH 4YHOL 3AY4A 5FKAA 2AV7A 4KJPC 3PABA 5E6IC 2A77H 1R5VA 2Z8WC 5D5MA 3IFLL 3QEUB 3RL1B 4O2EB 3EO1B 1CQYA 1K2DB 2HKHH 4ZQKA 2P24B 3WFBH 1A3QA 4U1HA 3CVHA 1WCQA 2VB5A 3O9WB 2V7NA 5BQ7B 1WCBB 2DJUA 4WGVB 2OXHA 3HB3D 4HJGA 4OZIB 1NPUA 4JZJA 3T3MF 2D31B 2VNCA 3IDNB 4W81A 3BI9X 1I9EA 2DTMH 4KJQD 2DWDB 4LPYA 3H9HA 4D9RE 1NBQA 4ZNEE 3P4OA 5JHDA 4LVEA 1I1FA 4S1DC 3RUGF 1MRCL 4FFYH 3NIDE 1QLEL 3OX8A 4I3GA 4BZ2L 1AFVH 3QXUA 1X4YA 3C8DA 3RJQB 3DROA 3CH1B 3HCVB 2R0KH 4NCC1 3IJSA 4OZ4B 2QQKL 3KXFA 1NCBH 3W11C 3I3DA 1UJ3B 3SE8L 3N0PB 4HUWA 1UXWB 3GSRA 3MXWH 4FP8H 4L1DA 4RFEB 1QBML 4M6AA 4M8QB 4XPHH 2GTZB 4Z7UE 5IBUB 4LQFH 1WZ1H 5DMKA 4U6HB 2X70A 1Q9WB 2VDNH 3UTSB 4K3HA 4ZOBA 4R90L 2VKWA 3JV4A 4GRWE 4XAKE 3TPKA 3B9KC 4V2CB 1KELH 1WICA 5F3HB 4D0BA 3GO1H 4ODWA 3LHPL 4DGVL 4WDIB 5EO1B 4RMRA 2FO4B 3S34H 5MI0C 4NO3A 5AG8A 1AGCA 3WXVH 1T6WA 2BXYA 2PCPB 4GBXA 1P4LA 4PJ9D 2Y9RT 4TVPH 4JB9L 4NQUA 5DZOA 4MQXD 4O4YL 4WO4A 4P2CG 4QRRE 1NJ9A 1UXSA 5DYOB 3SDYH 3V95A 3PL6A 2EICA 2UYLB 3MLVL 1QRKA 3IXTB 1Z2KA 3ZYZA 3G08B 1YEDA 2MPAL 4D8PA 3BXNB 4KK9D 5JQ6L 3HZKA 2IADB 2Z8SA 1QFUH 4OQTA 5H94B 2Z4QB 3KWWB 4PRHD 3VI3E 3RDTA 3ZYJA 1ZGLP 1SVCP 2Z8RA 2KZ1B 1V8HA 1V3JA 5C08A 4QNPF 3VXUD 4KJYA 2E5EA 1H8OA 3MACH 5F6HJ 3RTQC 1TZHA 4WJ5A 2P42B 5ETUB 3G5XB 3GK8L 1XGQB 3QUKA 1NC4A 4JEGB 1WBYA 1DBBL 3OKOA 1KBGL 2YA0A 4CBPA 3VXQB 4BZ2H 4GFTB 1XIWB 5CEYB 5DQ9A 1MAML 1Y18A 1G7HA 3OKEB 5I1EL 3A6OA 1PX3A 5BZWA 5E2WL 3D0LB 4LCCA 1SBSL 1VHPA 5TPWL 4U0RC 2XQYG 3BT2H 4U1JA 3D2UD 4FHBD 4A6YL 2CDEB 3GDBA 3T1FA 4PP1C 3T2PA 1F11B 2YSSA 1IC4L 2X40A 4P4KC 4CMHB 5I76B 5EO0B 5F70A 2FHCA 2DQDL 3OL2A 4JR9L 3VXRE 5HYIA 2ZUTA 3SDAB 4JFDB 4Q9QH 5GGTL 4ODHL 3EO0B 2Z31A 4YH6A 4JPKL 5L6YH 1V7NL 3WYRA 1TTUA 3LHPH 4IEFB 4UTAH 3OHXB 5IIEB 1QPPA 2P8MB 4KMQA 1ES0B 4JFHD 4J7RA 1QFPA 3FT3B 1R24A 1KIQA 2AV1A 1KB5H 2JCCA 4JB9H 1TNNA 1MVFA 4PV9B 1U8MB 5DR5L 5GZNC 4OBRA 5HHQA 2XWTB 3U1SL 5I17B 1CD1A 4YDVB 4X8XA 3T2OA 1AHWA 3NAAL 1KTKE 1CFVL 4E0RA 4N1CA 5D7IA 3ARWA 2MPAH 4MGXA 3F7VB 1CIUA 1G9NL 5FKAB 4Q0XL 1LO4L 2AV7B 5EBGA 3PABB 1A7RL 1FZJA 1R5VB 2IAMA 5D5MB 1RSFA 1WIOA 4ZQKB 1H0DA 2YUXA 4U1HB 3CVHB 4WW1A 4WHTA 1ETZA 4PY7A 4RZCA 2V7NB 4XP1L 5GQBA 5KVEH 3RHWK 1UWEL 4JZJB 3GK8H 2X2YA 2XZQH 1J7VR 1OAUH 3NCJH 4WW2F 3H9HB 3NCYP 4KJWC 3P4OB 5JHDB 3L95A 2YD1A 1HE7A 3C5SB 3TJHD 1G0YR 1I1FB 3V6ZA 2J6EL 3HZYA 3SQOH 2VSDA 4XTRC 4LLVA 1DL7L 5TPWH 5FYKE 3OX8B 4JRYE 2DOCA 3SJVA 4U3CA 3MBXL 4JZNA 3DROB 4NZRH 1G6RH 3WO3B 3IJSB 3KXFB 4HUWB 1KUMA 4F8QA 3GSRB 3L7EA 4JRXA 1FO0A 4G8FB 5L7XH 4JPKH 1KLGA 4UBDC 4YIQA 5DMKB 3DPBA 3NZHH 3JV4B 4U2YA 5FUZL 1ZLUH 3KPPB 3K46A 1QLFB 3QBTB 4TSAL 4D0BB 5JZ7C 4ODWB 3UJJL 4Z7WF 5DUBA 3KJ4B 5A40E 2QSVA 4JFQA 1UKQA 1M7DA 1UG9A 2ITCA 4NO3B 5TJWK 1AGCB 4GBXB 2LAAA 1P4LB 5J1SC 4YX2L 1BOGA 3O3EA 1SY6H 1QFOA 5DVMA 3NAAH 3IJYA 3KLHD 3C87A 4M7ZB 4G80A 1CDGA 4WO4B 4NWUH 1NJ9B 4M03A 2RCSH 4XVSL 1UXSB 3QAZC 2ADJA 1LO4H 2W9EL 4E41D 4XBEH 4LCIH 3PL6B 2A6DA 3K80A 2WBJD 1IGML 3O8XD 1YEDB 4JFEA 2NLJA 4D8PB 1MLCA 3W39A 3FZUC 2AXGB 4P2QE 3ARGC 4YZFE 3HZKB 4HLZH 3CUPA 1F2XK 4XXDA 5HD8D 5IB1A 3M8OL 1F02I 1LO2L 1YEEL 3BH9A 2R69L 5HI4C 3RDTB 3MRJB 3F12B 1KLUA 1OY3B 2MCG1 2CK0L 1KEGL 2BDNH 5ESVA 2DLTA 2DLIA 2YPLE 5ERWA 4NNYA 2XRAH 1L6ZA 1IQWH 4WJ5B 1NC4B 2VDOL 3LPWA 4DN4L 5BVPL 1WBYB 4FFWD 5F6IB 3BP6A 4HPOL 1ORSB 5DGQA 4RNRA 2A73A 3GSOB 5DQ9B 4W6XB 2PNDA 1Y18B 1G7HB 3K4DA 2FB4L 3ARXA 1XF3A 4KV5F 4LCCB 3FOLA 4C4KT 1KCUL 3O6KH 2BVQA 2DL9A 4XPTL 1V7MH 4U1JB 2Y36L 3FN0L 5FIEA 2VDML 4DCQA 2FEDC 2VDLL 5EZIL 3T1FB 3SE4A 2BSED 2YSSB 4DFHA 4PYHA 3Q5OA 4YBLB 2A9NL 4NCC2 4YHZH 5CJQL 1NUDA 4DVBB 4OCXL 2Z31B 1LVEA 3WXWL 4AEFA 4TSAH 4PJAF 2VDKL 3UJJH 2VLME 4RFOL 4X83A 3WNMA 4MVBC 4XNUH 3QPQC 3DGGA 3ZKSD 1MFAH 5E5RB 2MQCA 3I6LD 3BGFB 3BESR 4MDJA 1J0ZA 4AM0A 1KIQB 1QVOA 1HN1A 4AH2A 7CGTA 2AV1B 4UNUA 2JCCB 2HWZL 1JNHA 2OJZL 4NKIH 5LXGH 2A0LC 3T0EC 3IDMA 2ZCHH 3BKMH 3C08L 4LKXB 1KJ3H 3GJFK 4LOUC 1IC7H 2WNGA 1IGCL 5MEPA 3PWPE 3FQWA 2UVEA 5HHQB 1TCMA 2XFXA 3O6FB 1NCDH 4DGIH 1AHWB 2BNQA 1IGMH 2C1PA 4E0RB 5T3ZE 5GS0C 3BIKA 5D7IB 5DMIL 2KKQA 3MLYL 4IRSC 4NQSA 3WLBA 1C12A 1L6XA 2V5MA 4XNYH 5FHAL 4L3EA 3CDGA 1FZJB 2EIDA 4NYLA 4XWOD 1YEEH 2IAMB 2R69H 3BWUC 5E2UL 4TVSa 2D7NA 1OF2A 3DXAE 1FPTL 1H8NA 5IW3A 5IFJA 4WHTB 1ETZB 4PY7B 4RZCB 3AREC 5IGXL 1MY5A 1FDLL 4R4ND 1YN7A 4NUJA 4LIQE 5GSVA 5BVPH 5JIKA 2AW2A 5F7YC 4APQD 2DKUA 2BCKA 4RWHA 1D9KA 35C8H 2FB4H 1EAJA 3HZYB 3MNWA 3BQUD 4LLVB 4OD1L 1YDPA 2I25N 3ZTNL 4MQ7A 5EORL 2Y36H 1MAJA 4JFZH 3L5WB 2DQEL 3RKPA 3SJVB 4Y88A 4JZNB 1UZ8B 5FCUL 3WIIL 1VCAA 4J3XA 2A9NH 1U8KA 1HINH 3FQUA 5CJQH 1J11A 3L7EB 3WFCL 4JRXB 2E6QA 1FO0B 4I5BA 1I7TA 5GZOC 1KLGB 3H42L 3WXWH 3MLRH 4L3CA 1DLHA 2P5WE 4YIQB 3REVB 4FFZH 3MREA 5A3IC 3U48A 3EUUA 5FYLL 4M93B 4PJ8C 2WBKA 1F3RB 3O2WH 4AIZA 5HYSG 3SGKC 5DUBB 1ZHNA 2HWZH 5J13C 1CGSL 4NKMA 1WF5A 3RZCC 4JFQB 4H88H 4ZTOL 4XCCL 5CZXD 4BSVA 1ZA6A 1EH9A 1M7DB 3C08H 1NDGA 1BM3L 4ZUUA 4HCRA 2YD3A 1BOGB 4S0TD 1FBIL 4TVPD 2IEPA 4C57C 4LSSH 3IJYB 4PJXA 2JB6A 4ZO6A 5GGQH 1XGRA 2Y5TA 4G80B 1MJUL 3V9FA 3RWDA 3EO9H 3HRZB 3MLYH 2ADJB 4XMLL 3N1FC 3MPCA 3QIUA 2A6DB 1KOAA 3V6OE 1BAFL 3KYOA 4JFEB 4LL9A 1HSBA 3GI9H 2NLJB 3EOTH 4EN3A 1MLCB 4CL7A 3W39B 3T08A 3BYYA 1MCRA 5H35A 1SEQL 1MQ8A 3CUPB 1RJLA 4MLIA 1L7TL 4XXDB 5IB1B 1FDLH 3FRPA 2R2CA 3LQZB 2VRAA 3BH9B 5DD0L 1CU4H 1MHCA 3NCYS 4TULL 5HXMA 4JM4L 1KLUB 4ZSOE 5CS7A 5ERWB 3K8KA 4NNYB 3N1PC 4UUJB 1NMBH 3QUYB 3L3IA 5C2BL 3BP6B 1QYGH 1N5AA 3ZTNH 1IAIH 3QUMA 4JVPA 5EIIB 3WBDA 3VI4F 3HE7C 4ALAL 2A73B 2PW2A 5BRZE 2EXWD 3H3PH 3QXAA 3N85L 3HC0A 4DQOH 3QIWA 5FCUH 3UC0H 5JXEA 3WIIH 2B1HL 1ADQL 1XF3B 2CMRL 5F9JA 3FOLB 2J5LC 5DVNA 2BVQB 4DZBA 1XF1A 5LKNA 1WFTA 3WFCH 4DCQB 2CKBA 3MBED 4WWKD 4JFXA 2C26A 3JV6A 1ACYL 1JMZA 1YJDH 5JDJA 1GVIA 4DGYH 5C0JA 3OJDA 4NFCA 3HPJA 4PLJD 3B9EA 1OAZL 3CX2A 3CMOH 3BN9C 4RMSA 2FJHA 1PKOA 5KSVA 3QIBD 5D2LA 2ZPKH 4JKLA 3K4AA 3DGGB 4XCCH 2X42A 1OSZA 4ELKA 3BD3A 4TUJA 1YPZF 3BE1L 4MDJB 4NO5A 1QVOB 4Y7MA 2X1PA 1FBIH 2VLJD 2D9QB 1JNHB 2VLKE 4OFYD 3IDMB 2CIIA 4ODBD 5DFVC 5MEPB 3ARDC 3FQWB 3SDDC 1Q72L 1QSZA 1T0PB 4XMLH 4PGEA 4HS3A 2NTSP 5E5UB 3LRSA 2BNQB 3SDCC 2C1PB 3BDBA 4FNLL 4M9PA 3BIKB 1AO7A 4P48A 5FGBA 4HS8L 4NQSB 3WLBB 1C12B 3G6JF 4EUPA 4J4PD 1DLFL 1HQ4A 1TETH 2B1AH 3BDXA 4IRJD 3D69B 1L7TH 4L3EB 3CDGB 4U1GB 5DA4A 4NYLB 4M48L 2DI9A 2AXJA 4I0KA 1OF2B 3MRGA 4OF5A 3P11H 3ILPA 4G43A 5IFJB 4F3FA 4KZDL 1JGVH 1YN7B 2GITA 4NUJB 4X6BB 5GSVB 3VG9C 2UUDH 4ALAH 4MAUH 5HHXL 2BCKB 3CFBA 1D9KB 1REIA 1BLNA 3OKKA 5FEBA 3SKNA 2CLRA 3MNWB 2B1HH 4P2RA 1ADQH 1H3PH 4F9PC 1YDPB 3CSYA 5J11C 4IRZL 4MXQD 4MQ7B 5DD5H 3NFSL 1DN0A 1KNOA 4DAGH 1A4JA 2VDQL 3VGDA 3ARUA 2FBOJ 5FOJA 4X9GA 4JPWL 2X1XR 3KJ6L 1ACYH 4P57A 4JJ5A 1BFVH 4LKCA 5KG9A 4RBPH 3TV3L 2XYCA 1U8KB 3VFMA 3GMRA 2X7LA 4L8CB 1A7PH 2P46B 5DLMH 1J8HB 1F6AA 3AROA 3PQYE 4I5BB 2IH1A 4CVWA 3VDBA 4XNZC 4RDQG 4HKBB 4PRIE 4G8EA 3MREB 3U6RA 3UAJD 3R1GL 1B6UA 3CVIL 5CZKA 1XR8A 4YWGH 3BE1H 2OP4L 2D7MA 3DI2B 1RJZA 1GJIA 5I18H 2IANE 4GRWH 4OIBA 4AIZB 1CDUA 2DM7A 1XT5A 1ZHNB 5DQDL 3D39D 5BS0A 3ZKXB 5DJCB 4BSVB 1ZA6B 2VO5A 2C3VA 1NDGB 2H41A 4ZUUB 4JG0H 2NYYC 2V7HA 3O6LH 4B7LA 4E42B 4HC1A 3TO4A 4TNWK 4YHNB 1FYTA 1UWGL 3EOBA 3JWDL 2JB6B 4FQHA 4Y5YA 1JZ4A 2DICA 1B4JL 3RWDB 1INDL 4HULB 1WSST 1CD0A 4HK3J 1BF2A 4KHTL 3LN4A 3LEVH 3KS0H 3QIUB 4Z78A 4I9WE 3SCMC 1A9BA 4M48H 4HLJA 3A67H 2B0SL 4KI5C 4UMGA 3OV6A 3G5ZA 3KYOB 1HSBB 2KUTA 2O26U 1DVFA 2XZCL 3F7PC 4X6FB 4EN3B 4KI5E 3WJJA 5H35B 4PD4K 3EFDL 1ZGLM 5I1DA 1RJLB 1UQSA 2NY7H 4WFHE 1D5BA 3UZQA 4K9EC 4OZIF 4XT1C 2OBGA 1GYAA 3IU3A 1ND0A 1MHCB 3QO0A 5F7EL 2VDRL 4WHYG 4OT1L 1IBGL 1T20A 3CFIC 3C9NA 3VA2C 1JZ5A 3BPOB 3VGAC 4TSCH 3SPVA 5IHLB 3L3IB 4OLUH 4MJ6A 4WIQA 4HBQA 1N5AB 3NA9L 2PW2B 1I8MA 5F9WB 1SEBA 4OZHE 3QXAB 1K8DB 3HC0B 5D6CA 3QIWB 3P9MB 1KXVC 3ULVC 2IMNA 1X5ZA 4N90D 1AY1H 5F9JB 3OB8A 3G6AA 3O81A 3ULVE 1R6VA 2E6JA 4DZBB 1NGZB 5I73C 4PRBA 3G04A 5J57B 2CKBB 4JFXB 2AK4E 5ALCH 1YY8A 3RBSA 4L8DA 1NEZG 5C0JB 3OJDB 4HG4K 5I1IL 1Z0NA 3HPJB 4POZC 5TDPA 1G1CA 1Q1JL 5KSVB 4Z7UF 5D2LB 4BFIA 4NRZA 4BZ1L 1XH3A 1A1MA 2WK2A 2OI9B 3RGVD 3CLFL 1OSZB 4NO0A 4ELKB 4TUJB 3TF7C 5K9QI 4NO5B 4FFVC 1WAAA 2C5DC 3UYRL 3LEYL 4P2OA 4PJBA 1FGNL 3U4BH 2CIIB 3IDXL 5ADOH 5HPOA 5C0BD 2R2BA 3S5LG 4W70A 2IPKA 4AEHL 4F7EA 4PGEB 4MZ2A 5HYFA 4HS3B 5LCVH 4OQ1A 1OGAE 4GAYA 1OCWL 4F2MA 5IFAL 1CS6A 1AO7B 5HDBE 1F8TH 1U2CA 4EUPB 4UV4L 1HQ4B 3EFDH 3SKOB 4KVCH 1S5IL 2A83A 3BZEA 3BKYH 3WKNA 3OG4B 4MDIA 5F7EH 5F1SA 4PB0H 4Y4KA 3MRGB 4OT1H 3S35X 5BXFA 3ILPB 1IBGH 4G43B 5E8OB 1VEOA 4PLOB 4ORGA 4F3FB 3V4VL 5L2JA 5FUOH 2DF3A 1S7WA 4YXKH 4XP6H 2GITB 4R0LC 5T3XL 2LU7A 3VI3F 4OM0L 2Z92A 5F72S 2FD6H 1SYSA 3CFBB 4XVTL 3OKKB 1BLNB 2QTEA 4MJ2A 3SKNB 2CLRB 4P2RB 5FO7A 1AGDB 3TJEH 5JW4M 5J6HA 3CSYB 4MCYA 3OJVC 4NJAL 1DN0B 1KNOB 4F37K 1LNUA 1A4JB 2ZG2A 4N0CC 5TF1L 5FYKH 2GJZA 3KPSA 2EDBA 1C5BH 3K1DA 3CNKA 4JJ5B 2DYPB 3CIQA 4LKCB 5KG9B 3MRFA 2BOCA 4OB5H 3VFMB 3GMRB 2X7LB 4HUUA 2VXQL 4X6CA 5I1IH 4Y4HA 1F6AB 4ZD3L 3O4OB 2PO6C 4L1HA 4Z8FL 2IH1B 1WFOA 4QRQA 5FM5O 4HWEL 4MHHG 3U6RB 3IAQA 4BZ1H 3CCHA 3UZVB 3D3VA 2YOCA 1XR8B 5B21A 4PJDE 3QCUL 4ZAKD 4DZ8A 4P9MH 2BRRH 3HI1B 4FG6C 1RJZB 4WHYH 3TZVD 1WITA 4U7KA 2VQ1A 4LLMA 3UYRH 3WS3A 4LFHG 1FGNH 4F9LC 3PWLA 5I8KL 5BS0B 4P3WA 3IDXH 4KRMB 4YO0B 1A5FL 3VFUA 2OLDA 4A6YA 3WUWG 3CZJA 2V7HB 1CDCA 2EECA 4XWGH 3QDGD 4BQ8A 2NNAA 1IT9L 1L0YA 3LKRA 2NX5D 1FYTB 3EOBB 4Y5YB 4L9LA 3QQ9D 1MY7A 4ZS6D 4WI6A 4MB3A 4ZPTA 3ESUF 5DWUH 3CLEL 5IB4A 3RKDD 3QFJE 3LN4B 1S5IH 4LSVL 4QTHA 2CDFA 4Z78B 2P49B 5DK3A 2DTSA 3T0DA 2AK1L 2FWOA 3G5ZB 3MRMA 1F90H 4HQQH 3U7YL 1C5CL 3QDJA 4XXCA 1MFNA 4HIIA 4DK6A 5I1DB 1UQSB 5LGHH 1D5BB 4HGMA 4EOWH 2X41A 4UTBL 3IU3B 1ND0B 3QO0B 3MLSL 2NR6C 5B38G 2GIYA 3O9WC 4ERSH 1G0XA 1T20B 3VMPA 3C9NB 3ELAT 4OLZH 4AG4L 3SPVB 3MLZH 4X5WA 3BX7C 3FOMA 1T7ZA 3T2QA 2ZCLH 4MJ6B 1DQLL 2HTKC 4JLRA 4Y0GA 1OVZA 5I74B 1ZT7A 3GSNL 1I8MB 3V2AR 1SEBB 5TF1H 5HHOD 5D6CB 4Y19D 4U0QB 5I1LA 2K1MA 3VWKA 2R8SH 2M26A 3G6AB 4P3CL 2Y6SD 1CZ8H 3RWFA 4PRBB 2ZUQB 3G04B 1DEDA 2B2XH 3VWJA 1FCCA 1E27A 5DRWA 1YY8B 5D6DC 4I48A 4L8DB 5FYLD 2ZUUA 3P2TA 3FFDB 3QCUH 1N5YL 2EEDA 5TDPB 9CGTA 4EDWL 3D85A 4X7TA 4RWYL 3E8UH 3U0PA 5FA3A 4BFIB 4K3JH 4NRZB 1XH3B 1JHLL 1A1MB 2F8VA 4IMKC 4NO0B 4Z0BH 2A6IA 4S1SL 2BK8A 4PJ5D 4JFPA 4P2OB 3MRDA 4PJBB 5KS9E 2A38A 1NAKH 1RUAL 1LK2A 3PUCA 1PG7W 4G9FD 2CO7B 1JFQL 2R2BB 2IPKB 4F7EB 3HUJE 3LN5A 5DO2C 1P69B 5EOCL 5DHYA 1LEKA 1TENA 3S97C 4GAYB 4TRPH 4F2MB 5CEXA 3VFWA 5F8RC 1C5CH 1CYGA 2F53A 5T3ZH 1MFBH 4N0FA 5GS0H 1BIIA 2A83B 3BZEB 3O0RH 1HQRA 2QQNL 2H32A 4OIIH 3X3GL 4UTBH 4YQXL 4KJPD 4Y4KB 1JNNL 3ARBA 5BXFB 5C70A 2FO1A 2NZ9D 4QRPA 5E6ID 2X9WA 3FN9A 3H9ZA 1S3KL 4ORGB 5ID1A 5JQHC 2CH8A 5L2JB 5CZVH 4JHAH 5KVDL 4HH8A 1S7WB 1YA5A 2V9QA 1JYWA 1ZTXH 3K8LA 2PW1A 1OTTD 2DIJA 4M6NL 1RHFA 2G2RA 4BJLA 2Z92B 4ZS7H 1KT2A 2VLRE 4GQ9H 4L29B 4LIQH 1FFRA 4OD3H 4EIGB 2VC2L 3ZE1E 4BSJA 4D9RD 1SYSB 1RFDH 1HHGB 4LHJB 5CSBA 3UBXI 5FO7B 1G7QA 4KKNA 3KGRA 4WEUD 5J6HB 3GMLA 3N50A 4MNHA 4MCYB 3IU4L 2X9XA 1EEUA 4S1DD 1EBPA 4QHMB 1DSFL 3DARA 1XIWC 1LNUB 2HN7A 4FQ1L 3WS6A 5SX5H 5A43C 2GJZB 4P4RA 1CE1H 3KPSB 1U91A 4MA3B 4NGHH 3AM8A 4M6OL 2IFFH 3U9PL 3MRFB 2BOCB 5EZO