5JHLL

Crystal structure of zika virus envelope protein in complex with a flavivirus broadly-protective antibody
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
211
structure length
211
Chain Sequence
b'FDIVMTQSQKFMSTSVGDRVSITCKASQHVGSAVAWYQQKPGQSPTLLIHSASNRYTGVPDRFTGSGSGTDFTLTISNIQSEDLADYFCQQYNSYPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords envelope protein
publication title Structures of the Zika Virus Envelope Protein and Its Complex with a Flavivirus Broadly Protective Antibody.
pubmed doi rcsb
source organism Zika virus
molecule tags Viral protein/immune system
total genus 47
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2016-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jhlL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jhlL01
2HH0L 3MNVA 2A1WH 1DBKL 3L3GB 1UB6B 3P40A 5GGQL 2CIKB 5GGRB 5T3XL 1Q94A 1X5HA 2VDQL 2Z8RA 3RWIB 1KTLB 2EIZB 3M17A 5EUKB 3MV8A 4G42B 2BSRB 1H3GA 2CO7B 3SO5A 3C8KB 1SHMA 2Y5TA 3ORJA 4Z7UF 3SPVB 1GGCH 5F7NC 5JTWA 4AL8H 4C57C 3EKCA 1RJYA 1RZ7L 2FATL 4H0GA 4IIQA 3IF1B 3EYVA 4LPCA 1J87A 1W2KT 3HE6B 5T33H 5E5MA 3QIUB 3BEVA 1INEL 4Y5XC 5EC2B 4WEUD 4Q97A 5I73B 5K9OA 4GS7B 1RZIB 5E1AA 1F3JB 1ZT4A 2P48B 1T03L 4WHDA 1QKZH 4M3JA 1CK0L 2Q86A 5L9DL 2C1PA 4GW1B 5FYLL 5EBWB 2F74A 1JNHB 5D96C 3MROA 3FOMA 8CGTA 3HE7A 3ZKMD 43CAA 1BZ7B 4DTGL 3LQAC 5JMOC 1YA5A 2B4CL 1ZEAH 4NO0A 3QEQB 4N0UA 3SGDH 2HTKC 4CNIB 1JPSL 2LVEA 4HFWB 3RWHB 4ZXBC 3VXOB 3MRHB 2EH7H 5I74C 5IHZA 1I9IH 1RJLB 4FQXB 1OD7A 3TBTA 3GSOA 4V1DD 4ONHB 1WICA 5FYKE 4QOKE 3T3MF 3HI5L 4ZYKB 2G60H 3ISWA 1QFWM 4KDTC 1P4IH 4D3CL 1S5HA 2PTVA 4F9LA 3QDJB 1IAMA 3RX8A 4R97B 1A8JH 3TN0D 2VKXA 5ESQB 4R6UA 1KCRL 4IRSA 5JO5A 1YEFH 1DBBL 2DM2A 1A4KB 4CJ1A 1F00I 5EUOA 5I1HH 4TQEL 1DBJH 5HYJB 3JUZA 3SCMB 5D72L 1V7ML 3FQUB 3G6JA 5EPMB 4BKLB 3E6HA 3T3PE 3OGCA 4EKXA 4UT6H 1QTYT 1G9MH 4KFZC 4HGKC 2FGWL 1OSZB 3RVWD 4ONOA 2ADFL 3U4EA 1PD6A 4PJCB 3S5LB 4ZPTB 1SJHB 2H2SD 5F1OB 4WTWA 1YDPB 2GUOA 3H8NA 4WIQA 4L9DA 5IHLB 5IG7A 3GRWH 4JANA 1KCSL 4JLRB 3IS0X 2GSGB 2DLGA 3KR3L 2K3TA 1VGEL 2W9EH 1DSFH 1FVCB 3RIFK 3O9WD 4P2OB 1MCPH 2H2PC 1KB5B 4XPAL 1MAMH 1EMTH 3NPSB 5F70A 1BAFH 3C6LD 1MHPH 4L3ED 2IC2A 4L4TE 2FEEL 2NR6D 3ULVC 2A83B 4YPGA 3WLWD 5F3HB 5ITBH 4M1CD 5AZ2H 4OAWB 5IB1B 4ZS7L 3HB3D 1DE4B 1PQZA 4NT6B 2XWJA 5HPMB 1PG7L 4PTUA 1NUDA 2CUIA 3M1BA 4L4VD 5ALBH 1XZ0A 1NBQA 4TPRH 4MXVE 4HJGA 1FL6B 3BWAA 4KDWA 1ES0A 1RHHB 5L2KB 3TVMA 4XNYL 1HXMB 4PRDB 3FT3B 3LPGA 3GJEB 4P46A 2DL9A 3O6FC 4GAYA 4Y0GA 3I85A 1TZGH 4R4BA 5T1KB 3TH3T 4MVBC 4PLJD 1NFDA 1UJ3C 2MOVA 5IJVA 1RU9H 2VKWA 2JTDA 4NQDE 2AK1L 4MQ7B 1AIFA 4XNUH 4JZJA 5DURD 1BLNA 1K8IA 3TA3B 4YLQT 1YEJH 4FQ2H 3L3JB 1MJJA 2BNRD 1HE7A 3U1SH 5C9JB 3STZA 5BS0A 2HLAB 1EUTA 1T04A 1WISA 1TXKA 5DVOA 3SDXE 1ETZA 4UZGA 2W9LA 1FRGH 3HPLB 4PRHE 4XPFL 2ED9A 2KKQA 3ARGD 4KROB 3BP4A 2X7LB 2FX7H 4PJIA 2VMFA 4FHBD 2XKSA 4PY7A 2X4NA 3D2UB 3K4DA 4NZRH 4WV1B 4NP4H 3GMLA 1RIVL 1ZAGA 4YHPB 5DI8B 3HZMB 4WW2F 1FLTX 1NUGA 3ILQD 4FMFA 2AGJH 5JA8B 3JTTB 1JGVH 1CL7H 3NIGF 4BZ2H 4XI5C 2FR4B 1WAAA 3DX7A 3RWJA 1T7WA 3LIZL 3MRBA 1GL4B 4EN3C 2VC2H 3UTPE 2Y23A 3IRPX 4L4JA 1YJDH 3BZ4B 3VGAC 3WN5C 4PJDB 5FOJA 2ATKB 3ROOB 2ZUQB 2BY3A 5J11B 4U6XB 4XRCA 3IDMA 2XKNB 1BVLB 2VDMH 4ODWA 5DC4B 5JOPD 4OGAD 4E9LA 4OBSA 1CS6A 1FDLH 4ELMA 2NX5D 1OAXL 1GC1C 5CMAB 1JI2A 1CDGA 3DPBA 3FB7B 3RHWF 1B0WA 3BIAX 4OLWH 3U7AA 1LP9E 2Z31B 3WKNA 5DMGD 1JF1B 5IQ7H 3L7FB 1GRWA 4KHXH 3OAZK 1HHJB 5FYKH 4X5WB 1FNGA 5JHLH 1XGQA 2XN9A 4AT6A 4RGNC 4NCC1 4Y1AD 5KSAB 1GCFA 1RZJH 2DWEB 1FSKB 2CO6B 4HCRH 2ATPB 1OAQH 1S78C 2LAAA 4CMHB 5F7WC 4LNRB 3N9GH 1OAUL 3P9WB 4Q2ZA 1OB1B 3DVGB 1JWUA 3MLZL 2VAAB 3NCYP 3QUYD 4KDTA 1BPVA 3OAZH 1O0VA 3DOSA 1JRHL 2HJLB 4P5TB 1G7HB 1A21A 1MF2H 3IXAB 3IJSA 4LHUB 3OR7A 4GAJH 1HQRB 4U6VL 1IQWH 1H3VA 4HBCH 3ZYIA 3OV6A 1M71B 3WFCL 2NYYD 4XXCC 5TGBB 4UIKH 1B4RA 3CH1B 2ITCB 1EDQA 2CUMA 5DHYB 4JB9H 3FQXA 1NQBA 5JUEH 3LS5H 3DV6A 5ETUB 2APXA 4N8CL 4W4OC 3VXSB 1NDGB 1OT2A 4LKXA 4RWHA 4AIXA 1H5BC 1OF2A 5D71L 3EOTH 4KC3B 2APFA 4H5SB 5LXGH 1KXQE 3FAXA 4JM4L 2HWZH 1RUAL 3V79C 2R1XA 2QSVA 1S7RA 2WBJC 4IOFC 1Q9WB 3MFFA 4U05A 1JJUA 2C3XA 4ZMAT 4APQD 3KYKL 4YHKL 4JFFA 2FL5A 3B5GA 4UQ2A 5FF6B 3RX5A 4HULB 2VLJA 3QDGB 5F1NB 4HD9A 3KPRD 1IGIH 5J9PB 4FXKA 3L9RB 2X9WA 5EBMB 3AB0B 2A1WL 3CGTA 5EU3A 3CXDH 3OB0K 4P9HH 5D7KD 1QEWA 1JPFB 3AU1A 3QIUD 2LE9A 1IQDB 1HILB 4QXTA 5IQ9A 3QO0A 1T1WB 2AXHA 5KVEH 3QWQB 3MNVB 4XBPA 4JFEA 4FTVE 1IGMH 4AL8L 4BA8A 3LKQA 2DAVA 1Q94B 3IAGC 5TDPA 2Y36H 1CFTA 3M17B 3MV8B 3T2OA 4MHHG 3QEQD 4GRLC 1LO2L 3OB0H 2F58H 1RJYB 4Z7VA 3ZE1E 4FRWA 2C4XA 4FQXD 4IIQB 4ZUSA 3P0GB 1MREH 5KZCB 5E5MB 5DEGA 4G7YH 4LRNH 4RBPK 5K9OB 1DN0A 5E1AB 1ZT4B 3X3FL 3QDJD 4JGJA 2YD4A 5E2TH 5SX4H 3TJHC 5HJ3A 2Q86B 2C1PB 4Q9RL 2EH7L 1U9KA 2F74B 3DRTA 4ACPA 3VD7A 1I9IL 3MROB 3FOMB 3RJDA 3HE7B 43CAB 4BQ8A 4NO0B 4N0UB 5I1AA 3LPFA 2G60L 5HYJD 3SCMD 1OTSC 3LDBC 4EN3A 5JW4Q 1P4IL 5D2NC 5IHZB 4U1JA 4Y19A 3TBTB 3WN5A 1KV3A 3GSOB 1MFCH 2MQ3A 4HUMB 1YEFL 3H3BC 4Z7NE 1QBBA 1ZT7A 3D18A 1S5HB 1U95A 4JAMA 4TVPE 5I1HL 2AVGA 3JWOH 4QWWD 1SEQH 3OJVC 4W81A 3SGEI 1MCNA 3N0PB 4IRSB 1ZANH 2GCYA 5JO5B 4UT6L 5I1EH 1G9ML 5C0AE 3E8UL 4G8GE 2DQTH 2GSIA 4OZIF 3MUY1 5EUOB 4JCLA 5IROC 5C71A 4URTB 3TFKC 5DMYA 1NGXA 5DK3A 2IWGA 4BQ6A 2GK0B 1QHOA 3G6JB 3EZJB 3KPNA 3E6HB 3OGCB 3OKNA 3D85A 5D7IE 5I1CH 4OM1H 5E94A 4MS8D 3U4EB 2NY2B 3ARUA 2W9EL 3J8F7 3AS0A 1UXSA 1EMTL 2GUOB 1H3TA 4JANB 2EXYC 3CZFA 2E9IA 3CMGA 2CKBL 4K8RL 5ITBL 5AZ2L 4CRPA 2DQHH 1MAKA 5AWNL 4NHUA 4U1GB 1TETH 3H9SE 5J56B 4OT1H 5BXFA 1AXTL 1NKRA 4YPGB 5J1AB 4HAFA 5L8KB 3U7YH 5C0BD 1A6AA 1F90L 5ALBL 4OZHE 4TPRL 3ZE0F 5FEBA 5HI3C 1N8ZA 3EJYD 1T6VN 1HKFA 4KKAD 2L7JA 4FOMA 1PQZB 3TA3D 3OJDA 4PTUB 1KJVA 4NOFA 3HUJF 3M1BB 3DHMA 2FSEA 3MV7A 1G7QA 3EJZD 2Y1VA 1NJ9A 1XZ0B 4DN3H 1TZGL 1X5YA 4HJGB 5KSBA 3BWAB 1ES0B 3TT3H 1VGKA 4PJXF 1RZFH 3IU3A 4KROD 3TVMB 4KJQD 3DSNA 3D2UD 3RGVA 2Y06H 4P46B 5T5FH 4GAYB 1YEJL 4R4BB 2R0LH 3U1SL 3M8OL 3O4LE 4PGCA 1NFDB 5IJVB 2X42A 2WBJA 2EO9A 1AIFB 5J1TC 1T0MA 1LVEA 1FRGL 2EYSA 4JZJB 4YHNA 5DLMH 1BLNB 1K8IB 5FO9A 4KXZI 1EXUA 2Z35A 2FX7L 1MJJB 3R4DA 3STZB 5BS0B 3R06A 2AEIT 4NZRL 1T04B 1WWCA 3D87B 3MUZ1 4NP4L 4OCXL 1EZVX 1ETZB 1HHHA 1NCWH 3P73A 5FM4A 2YD2A 3BP4B 4ZG1A 4PJIB 4PY7B 2X4NB 1JGVL 1CL7L 4HG4J 3GMLB 5BZWB 1JZ4A 3GFUA 1D5BA 3SGDI 5IB3A 3BN9C 1YJDL 4FG6D 4FABH 3DX9A 2Z31D 3RZCC 1QOKA 4XNMA 3DX7B 3JV5A 3RWJB 3MRBB 1NBYA 2EC9T 2VDML 3UBXG 4KQ4H 5D1QD 5LAXA 4MZ2A 4HG4K 4NWUH 3S6CA 5KSAD 1WITA 1TCRB 4H0HB 5GGVY 1KEGH 4XRCB 3IDMB 1MFNA 1N7MH 4ODWB 3ZKQD 2GKIA 3OKLA 5IQ7L 4XP5L 2OBGA 4WU5A 4KHXL 1HINL 4ELMB 1BD2D 3STLA 2Y72A 3A6CL 1UZ6F 3VXPA 4V1DE 2N4IA 4XWGH 5IB4A 2R9HC 5HGHA 3ARFC 5TE4H 5D96B 3T0DA 4KRLB 3EDDA 1FNGB 2MHAA 1EHNA 1XGQB 1JHKH 4HCRL 1EBPA 1PLGH 2XN9B 3H9HA 3N9GL 4ALAH 4HXBL 4AT6B 4Z7OE 2LU7A 1NAKL 1XGPA 5ENWA 2PETA 4TVPH 1OQXA 1GOGA 1KXTB 3FMGL 4U6TA 3QCUH 4Q2ZB 5DWUH 5FGCE 5T1DH 4PJBE 1J0IA 1JWUB 3UYRH 2FBJL 3WNKA 1E27A 5E6IC 3S88H 2ZG2A 4GAJL 2OQJA 1M7DA 3NIFE 2Q20A 4QNPE 2WMPA 1OLZA 4F8TA 4E41D 3MJ6A 1KJ3H 3FONA 5EIQA 2IEPA 3IJSB 3OR7B 4UIKL 5I1IH 5CGMA 4PJAA 3MMEA 5I1KH 4JB9L 2XPGA 1VHPA 4NO5A 4LLAA 1A3LH 3TP4A 4HIJA 3C2SA 1ZVSA 4Z7NF 3QDGD 4L3EE 3EOTL 4PGZA 3FQXB 4N0YL 3DV6B 2HWZL 4UV7H 1G9NH 4KY1H 1OF2B 3P4OA 4M02A 2P5EA 3RKPA 3TO4D 3NCFB 2ZNWA 3WIIL 5F9WC 5IVXE 4L4VE 2R1XB 1S7RB 3NGBC 2NCMA 5FOBB 3MFFB 2ZCKH 1CG9A 1UC6A 4CAGA 1QD0A 1UKTA 1LDPL 3WS6C 3CXDL 4KK9C 4XMKH 4CVXA 4JFFB 2FL5B 4UQ2B 1T89A 2VLJB 1LE5A 1NL0H 3U0TA 4FXKB 2KL6A 1JI1A 1FCCA 2YD5A 5KVEL 4KJWC 5I8CA 3S36L 5EU3B 1AQKH 5MEPA 1T7ZA 1QEWB 1TJIL 3DGCR 1X4ZA 5KZCD 4M03A 3V6OE 2BNRE 2Y36L 3AU1B 2J7LA 1U3HC 4QXTB 2NXZC 2AV7A 3WUWA 5IQ9B 3IU4L 3QO0B 2GYSA 4XBPB 4JFEB 3S34H 5AYUH 3K8KA 4OZHF 5E03A 1NFIA 2F58L 1BX2A 4LEXL 4P2RE 5TDPB 1CFTB 3WXVL 2E7LC 2FX8H 5F7LB 3HE7D 1IZKA 4HEPG 4OLEA 1CTNA 3BUTA 3K4AA 4NO0D 2C4FU 4G6KH 4O2EA 2XA8H 2ILLA 5LKNA 5GGRY 4G7YL 4OCNC 4LRNL 3RI5K 4OZ4A 1KLUA 4QLRA 4Z7VB 4A6YH 4PV9A 4ZUSB 1SJVA 2OL3L 4PJFA 2D7TH 5DEGB 1IC7H 4ZFOL 3PWJA 2C5DC 1DN0B 2XZAH 1RFDH 5HJ3B 3MXVH 4RMVA 5FUOH 3MZGB 5CWSA 4F15C 2J4WL 2QBWA 4WEMB 1MFCL 5I1AB 4GAGH 3ZE2E 3QA3A 4EN3B 3GSXA 3E6FB 3QPXH 5SWZA 5JW4R 5KN5A 4U1JB 3EBAA 4UOJA 3JWOL 3VGAB 4Y19B 3WN5B 3WIHH 1SEQL 2L4OA 1E4JA 3P4MA 5SX5K 2HFFA 1HEZB 3Q5TA 3BT2H 5KSVB 5I1EL 4PJ7A 1P7KA 5JDJA 1K6QL 3D18B 1ZT7B 4YK4C 1JPGA 4Y1AE 4Q6IA 3CD4A 1U95B 5D7JC 1OTTC 1YNTA 4JAMB 5HY9A 4BELD 4YHIA 1A6PA 3N06B 1QRNA 2GCYB 2OSLA 4AEIH 2XZCH 5DEZA 5J89A 4OM1L 3UCRA 2GSIB 5IBUB 4LBEB 5I75B 2ZSWA 1KJMA 3ARFA 5FA3A 1Q38A 1KIPA 1NGXB 4ELKA 2AP2A 2OK0H 2FYYB 5C86A 5EORL 5SX5H 3RTQD 1FL3A 3KPNB 2YS4A 3UMTA 1NCBL 3D85B 5E94B 4RGNB 4CU7A 2YD1A 4XP9H 5KS9F 4L29A 4PJEF 1T0PB 1JGEA 2NY4C 25C8H 1KN2H 5HGBB 1R0AH 1UXSB 4N8VG 2J12B 5DT1L 4ZUWA 4N9GA 3WL9A 3B4NA 1K3ZA 1ZLVK 4OT1L 7FABH 3CZFB 4JFOA 1IC5L 3TVMD 1NCDL 1MLBA 3U7YL 4XHQA 3SE3A 4NHUB 5DEFA 2DQDH 3O2VH 5DJXB 5FUZL 5T1MA 4UU9A 4QTIH 3OPZH 5BXFB 1D5IL 1E4WH 1A6AB 1A9EA 3B9VA 1N8ZB 5AYQA 1KN4H 4S0SD 3TT1H 1OTUD 1RZFL 1YYML 2YD8A 5H2BA 3I6GA 1ZLVH 1P9MA 5D7SL 3U6RA 2OJZL 3OJDB 5BS0D 1KJVB 1JZ2A 4MXWH 2FSEB 3ARPA 2Y06L 4ODVL 3MV7B 4P5KA 5T5FL 1G7QB 2IBZX 3TBVA 2H26A 2R0LL 1MOEA 3KLSA 5KSBB 3B9AA 4PYGA 2ED8A 1VGKB 2ZOKA 3IU3B 4JQVA 3SKJH 2QQKH 3HFML 3RGVB 3KPRE 5DLML 3MACH 4TULH 1G84A 3D48R 1QHPA 3WYRA 1WIPA 4M3KB 3EYUL 5CINH 4PGCB 3LRHA 5D7KE 2Q8BH 2WBJB 1OOAA 1T0MB 4QCIA 3DO7A 4Y88A 4YHNB 2EYSB 5FO9B 1T6WA 3RA7H 1S8DA 2VQTA 1EXUB 4M7ZC 2Z35B 1NMAH 5DMKA 3R06B 2IFGA 2JJWA 2UY7A 5ID1A 2WBKA 1HHHB 3K7UA 3P73B 2AEWA 3MQIA 5SX4I 3QEQE 4NRXA 2AABH 1K2DA 4X6DF 4GG8A 1GGBH 1MCOL 2LTQC 3DBXA 2VISA 3BVNB 1U3HA 3ZDXE 4HLJA 3HC0B 1D5BB 5IB3B 4KQ4L 5F7FA 2CH8A 2ZUVA 4NWUL 3OMZA 3DX9B 3DMMD 4GKSA 1S7XA 3WSQL 4XNMB 1MCFA 3QH3A 4OCYH 1EJOH 1NBYB 1AR1D 1N7ML 3QDJE 4OLVH 4EXPX 5A43C 5IEKA 2XN9D 2RCSL 4KHTH 2WQRA 3GMOA 4DEPC 3OL2A 3B8SA 3VRJA 3BO8A 4CW1B 3DX6A 4K7PY 4XWGL 3PDOA 2AXGA 2AKRA 2EDBA 3OKLB 1E28A 1MFDH 1G7IA 4MQSB 4WU5B 5TE4L 4RDQG 1JHKL 4M8QA 3STLB 1PLGL 3VXPB 3GKWH 4ALAL 3GHBH 1WQVT 5FUCE 5IB4B 5IVZB 4D9LL 5HGHB 4U1IA 1RIHH 3ROLA 2MHAB 2VDLH 4ORZC 3H9HB 3L1OH 5DWUL 5E5RB 3UYRL 1XGPB 4NC0B 4RMRA 5ENWB 3E1F1 2VXVL 1A0QH 4EUPG 1UM5H 2OX5A 5C3LD 1KJ3L 4FQJH 3CDYA 5IV2A 1E27B 2V7NA 2OQJB 1NEUA 1M7DB 4TSBL 2MTPA 5IWLC 5D7JA 5I1KL 1A1NA 1AJ7H 3PGCA 3T65A 1WSST 4HK3J 1KELH 2GK2A 1KULA 3SE8L 3FONB 4JM2A 4LIQL 3FB5A 1Q1JH 8FABA 3UDWC 2AJXL 4PJAB 3VCLA 3MMEB 2MPAH 3CCHA 3DRQA 2XPGB 4NO5B 5D70L 4EQ3A 4Q9CA 4UV7L 1G9NL 1CGWA 3TZVC 4HIJB 3DO3A 1NAMH 4JFFD 1ZVSB 2WWKT 3MLUH 2VLJD 3D3VA 4KZDL 1NCUA 2B1AH 1A6UH 1CN4A 3LHPL 3ZKXB 4CU8A 1CXHA 5C0BE 3CK0L 3RDTC 4QT5A 2ZCKL 3P4OB 5LJYH 5IP4A 2P5EB 2WP3O 4XMKL 5CZKA 5A3IC 2Z93A 2VH5H 1FO0A 4JFDA 1J12A 1NL0L 3ULVL 3D9AL 1CG9B 2CMRL 2XZQH 2P5WA 3P11H 1AQKL 4R3SA 4CVXB 3C2AH 3WHXA 1AHWC 1LE5B 3U0TB 4XVSH 4JDVA 4KK6C 1CICA 4NJ9H 4QEGA 2A73A 5EC1A 5I8CB 1NGPH 1G0XA 5AYUL 3CH8A 4I8DA 4PTTA 5MEPB 5DO2D 2XTJE 1SMAA 4PJGF 5DK0A 5DD0L 3WUWB 2AV7B 32C2B 4QRQA 3TJEH 3ZSSA 4PJDE 2XA8L 3SDDC 2YPLD 2F53A 3S96A 1NFIB 1BX2B 2GT9A 4LGSB 3O3EB 1QSZA 1IAKA 2D9CA 4G9FA 4F7EA 4KUZH 4O2EB 1CGSH 3QUXC 1J11A 1IC7L 4DZ8A 3W81A 4OZ4B 3ALPA 1KLUB 2GQHA 2XZAL 1HZHH 1BEYH 4Y19D 1X5AA 2DQIL 2XRAL 4C56A 3C8HA 4PJFB 3GMMA 4QXGH 3PWJB 5HI4C 3UEZA 2VDNH 4JR9H 3F58H 4QRSA 1R6VA 4JVWA 1XR9A 2VERN 2PXYC 3WJLC 1G9EA 2W0PA 5J0BA 3QPXL 4EIZC 3WIFA 1U8HA 1YPZE 5CWSB 1W8OA 3WIHL 2JJUA 1OL0A 3SJVB 1P5VA 1ZS8A 1BD2E 3LKSA 3QA3B 3GSXB 1AXSA 3DX8A 3ULUC 5SWZB 5KN5B 4KVCL 3REWA 3KS0J 4Y5VC 3D85D 4S1RL 5B3JE 5ECJE 3P4MB 2HFFB 4HZAA 2IALA 4AEIL 3R1GL 4KI5D 5DVNA 4PJ7B 4PP1C 1P7KB 1BF8A 2D03H 1JUFA 3F65A 1JPGB 4Q6IB 4RMUA 1YNTB 4M6MH 4HV8A 5H94A 4AIOA 5HY9B 2OK0L 4MXQD 4YHIB 5LGKA 1QRNB 2OSLB 3RVVC 3BD5A 3KPSA 3CLEH 4XP9L 4S1QL 2ZSWB 1KJMB 3ARFB 5FA3B 1KIPB 4ELKB 4KV5E 1U3JA 3I84A 1JZ5A 5B22A 5JLZA 4E41E 3T1FA 4L29B 2CGRH 4I0KA 1JGEB 2DLFL 5HVGB 4DCQA 4Z7UA 1Z9MA 4HK0A 4M4RA 3MV7D 3O2VL 3KS0H 4ZUWB 4N9GB 2A6DB 3WL9B 3OPZL 2IADA 4K71B 2I24N 2VLRD 4PJCF 4JFOB 2O61A 1E4WL 2WK2A 3MLWH 3AS1A 1MLBB 1ZXQA 4X6FA 3QDGE 5IWLA 3Q5OA 4Q0XL 3IDIA 3RGVD 5DEFB 3SDCA 1KN4L 4UU9B 4YBLC 4CL7A 1C12A 4ISVA 2ESVA 4MXWL 2EE6A 3OR6A 3MCG1 1A9EB 3HR6A 4X4ME 1FC1A 3MRKA 1FLRH 1J1XH 1SY6H 2Q76A 2YUZA 2XV6B 5EULV 5H2BB 3I6GB 3U6RB 4OZFA 3VXNA 5GRXG 4NNPH 4N90D 1DVFC 3MACL 4P5KB 4TULL 1JGUH 3RQ3A 3TBVB 2H26B 4HZLA 5DRXA 3VRIA 5I71C 5F9DC 4ZD3L 3QRGH 5CINL 2ZOKB 1UH2A 5FHBH 2Q8BL 2D4DA 5ID0A 5I9QB 5CZXC 1CLYL 4I5BA 1FNSH 5CUSL 2P8LA 1NMAL 1JK8A 5F9WB 3RY6C 4OLZL 1DTUA 3NGBB 3VFTA 1NLBH 2QEJA 4QCIB 3DO7B 1A7OH 3V5HA 1XGTA 1IEAA 5DMKB 3QHFL 2AABL 4J23A 5SV4A 1GGBL 5ID1B 1EUUA 1AHWA 1VFUA 4PLOB 1CFNA 4H1LG 1B0RA 5FGSA 2KPNA 3CAFA 4NRXB 4N0UE 1K2DB 4MAYD 4GG8B 2WUCL 3ZT6A 3DBXB 5E2WH 4OCYL 5K9QG 2VISB 1U3HB 4FFWC 2EH8L 4QF1A 4OLVL 2EDQA 1MCWM 3QZWG 3F7VA 1MQKH 4KHTL 2VN4A 1CVSC 4GKSB 1J0YA 1S7XB 4ETQA 3QH3B 2ZWLT 3IXTA 1FPTL 3BH9A 3GSWA 3BMVA 2J8UA 4L9LA 5IEKB 2W91A 5HYSA 3QUXA 4PBVC 2HYMA 5E6YA 1S9VA 3GMOB 3BX7C 3BO8B 4KDVA 2UUDH 2YWZA 2P47B 3DX6B 2APTA 3TESA 4ENED 5EUOE 3PDOB 2AXGB 4PGDA 2AKRB 3HMXH 3ZDZE 1E28B 1RIHL 1G7IB 4ERSL 4U1MA 1KPRA 5M7QA 4M8QB 2VDLL 1YUHA 1Z0MA 4MJ6A 4OV6F 4W6WB 5FYJD 4DGVL 1E4KC 1XF3A 2PXYA 3WJLA 5F71A 5F7MC 4JFHE 4U1IB 2YN3A 4YHMH 3W39A 3ROLB 3CDCA 1UM5L 3KG5A 4TOYH 3HPJA 5CEXB 4F15B 4P9MH 4KKBC 3G5VB 2J6EH 1YQVH 4FQJL 3LPWA 2R2CA 1YNLH 3N1PC 3PXHA 4JFQA 4NZTH 3QISA 1IGFL 4Y5VA 4OCMC 3QDHA 5CAYB 1CIUA 2BY2A 3MUHL 2HFGH 1KELL 3BZFA 1VA9A 5KVMC 5IV2B 1L7TL 5AAMA 2V7NB 3I50H 4JHAH 1SYVA 5D7JB 1A1NB 2MPAL 3D69A 3PGCB 4NUGH 2JJTA 3T65B 5GS0D 1ACYH 4AQOA 2EXYD 2FO4A 4JM2B 3VFWA 3EYOA 3FB5B 3GMQA 5DVMA 8FABB 3AC0A 4MA1C 1NAML 1H0DA 4JO4H 3W5NA 1ED3A 3MLUL 3GKZA 1A6UL 5FV2A 3VCLB 3CCHB 1I85C 3OKEA 3DRQB 5TH2A 5B3JF 4JG1H 1RVFH 4MMZC 5HI3D 3D3VB 4BFEA 3VFSA 4MCYA 4GW4A 4QHUA 3EO1A 1J10A 2NY4B 1I1RA 2N1KA 4QT5B 3TF7C 2OTWA 5B4MD 4KKCC 3RNQA 4EI5C 1AGDA 1F8TH 1KTKE 4XPBL 5TE6H 4ZNEA 2MSPA 2H3NA 4LASH 1EVUA 5DQDH 2VOTA 5BS0E 4PG2A 3I6KA 2J1KA 2Z93B 3C2AL 5I0ZA 1G0DA 2E7CA 1HSBA 3I75A 4X9GA 1FO0B 4JFDB 1A6WH 3DWTA 5B39A 4PJIE 1A6VH 4NJ9L 1ZK9A 2P5WB 4HH9A 2JB5H 1HH6B 1QACA 1FJ1A 1NGPL 2FRGP 2QHRH 2UVEA 3HAEA 4KU1A 4R3SB 1FBIH 1V3JA 1J0ZA 4ZOCA 3WHXB 1MCCA 4NWTL 5JXEA 4RMTA 2N56A 4GFTB 3TJEL 3BHBA 3GSQA 4JDVB 4HC1L 1IL1A 2A73B 3H2WA 5EC1B 1DVFA 1AI1H 1MNUH 4ZFGL 1RD6A 3EHBD 4PTTB 5KG9B 1WAAE 3HNTH 2R56H 4J12A 2IQAA 2E5EA 5F1SA 5DK0B 3T0VA 2XWBA 4QRQB 1BM3H 5HBBA 4KUZL 2BK8A 2NZ9D 5CIPH 4OGYH 5HHQA 2F53B 3S96B 3NCYS 1JZ7A 2ICCA 2GT9B 3GJFB 3QQ3A 1HZHL 1FG9C 1PZ5B 3IFLH 2YBRA 1IAKB 4G9FB 1IGTA 4F7EB 1AFVL 4ELME 1VEPA 3QAZC 4R90L 4H8WC 3T8XA 4DZ8B 5I19L 3KLHC 2W1NA 5EO1A 35C8L 3F58L 3CZJA 2RHEA 4C56B 4YHZH 2VZSA 4Y5YC 3GMMB 2XN9E 4LSPH 5GRJL 1CT8A 2XOTA 1XR9B 1A47A 3TNNA 4ZS6D 2R15A 1INDL 1QRND 1U8KA 2BXYA 1BBJA 1J0KA 1U8HB 2XY2A 4DKEH 4GQ9H 4JJ5A 3A0OA 3GI8L 4R2GB 5FHAL 1ZS8B 3QHZL 1V8HA 3KDMA 3LKSB 1AXSB 2D03L 3DX8B 3REWB 1T2QH 3C8DA 5HYFA 4M6ML 5EZJA 1JTTA 3DNKA 2FHCA 5EU5A 5D9SA 5BRZA 2EE2A 4R9HA 4I18A 4XT1C 3SGKC 3VMPA 43C9A 4IDJL 5FYJU 2IALB 3I3EA 3MGOA 1XGUA 2BHYA 3CLEL 1JUFB 2Y6SD 4WEBL 4HV8B 5H94B 2W60A 3ZHLA 3EYQD 5IESH 3KPSB 4AENA 2EC8A 5K9QI 2CGRL 1X5JA 1Y6MR 3MA9L 4ZOBA 5FV1L 5EWIH 4RFEA 5JLZB 5C07D 3T1FB 4RRPA 4IRZH 4IJ3C 3H7LA 1BHGA 2A9NH 3G6JF 4EBQH 1A4JA 1ADQH 4DCQB 4Z7UB 1MRFL 3BKMH 4HK0B 3ETBF 2IH1A 4NQVA 5FAAA 1FP5A 2IADB 2R0ZH 4WWKD 1FAKT 2O61B 2EZ0D 4JFFE 2P46B 1A7BA 1IGCL 4X6FB 2VLJE 4BZ1L 1S9YA 3IDIB 5I15H 1J1XL 1SY6L 3U83A 3CSYA 3RVXD 3SDCB 1C12B 2BZDA 4ISVB 1YC8A 2ESVB 3CLFL 3VI3E 3OR6B 3OSKA 3T09A 5DHVA 1JGUL 1MCLA 3MRKB 1XF1A 2Q76B 1TQBC 3TZVB 4OZFB 3VXNB 4MX7A 1EERB 4PYHA 1OP9A 5DUBA 3O41A 1FNSL 2RQ8A 5ELIA 3VRIB 4HZLB 5DRXB 5GZND 4HSQA 3VU2A 1EJ6A 4N1EA 2CLZA 3GSRA 3VD4A 5ID0B 4IRJA 1NLBL 4J6RH 3NABH 2E9JA 2VN7A 2BERA 3QWOA 3NFNA 4I5BB 1REIA 4EI5A 1VKXA 5HYEA 2P8LB 4WFGE 3X17A 1U3HD 4Z7VE 1N6QL 1JK8B 1RULH 3DARA 3LQZA 4TRPH 1FFPB 4WHTA 3VFTB 1F6LL 3RX7A 5K59F 5HTSA 3AAZA 1EFQA 4KRPC 2OR7A 3V5HB 1XGTB 5C0ND 1IEAB 1NFDF 3EFDH 2VLKE 5J4MA 1JZ6A 4OZIA 2YPLE 3MLTB 3D39A 5E2WL 1AHWB 3I02A 2ZG3A 4OQTL 1CFNB 5IOPA 4MA3A 3FT4A 3HZYA 4W68A 3CU7A 5J12B 4UOW0 1KC5L 4Z9KB 1MQKL 4WI9A 5CGYC 5EU6A 2BSSA 5TQ0H 4K94C 4K7FA 3C87A 4QF1B 1A64A 4B50A 4DVRL 2Z8WC 4OCRH 3G6DL 3F7VB 5A40E 4GH7B 3NCBB 1WWBX 2Z0BA 4G6AD 5EFIA 3IXTB 4JFZL 4AQ1B 3BH9B 4F80A 3GSWB 3MLVL 1BP3B 3LEYH 3NH7H 2J8UB 1QSFA 3HMXL 5HYSB 3QUXB 2B2XH 1S9VB 2HG5A 4EDXA 4LNVA 1NSNH 4B41A 5I1JH 4OF7A 1KOAA 4O58H 3V7MA 4PGDB 4YHML 1CD8A 3EZ8A 4U1MB 5BVJA 1K9TA 2VWEE 3HUJA 3UXFA 1KPRB 5MEOA 4O02H 3VWJC 1P1ZA 1YUHB 4MJ6B 2NNAA 2YPKB 4AEHH 2J6EL 1YQVL 4JCMA 3JV4A 1YNLL 1XF3B 4KI5E 2PXYB 2BSTA 4LRIC 4NZTL 4M43H 4ELMF 4JM2D 3W39B 3OG6B 3QNXA 1PEZA 1U8MA 2IPUG 3CVHA 2HFGL 3HPJB 1DEEA 5GRVK 1NC2D 2QQQA 4L5FH 3EOYG 4UTBH 1MPAH 1G1CA 4JEGB 1SMOA 4Y5VB 5ICZA 4NUGL 5B21A 3SGKA 3D3VD 4M00A 3BZFB 5F6IB 1CWVA 4L3CA 3WJJC 2NXYC 2HTLD 3GUTA 4JO4L 3LSOB 3CVIH 2ADIA 5L7XH 1SYVB 1RV6X 2UWEA 3PGFL 2EC9U 4WI5A 3KHQA 2FO4B 3VFWB 3EYOB 3GMQB 4LVHC 3F7RA 3MV7E 1H0DB 1RVFL 3WNPA 2H32A 1ED3B 4NNYA 1PYWA 2FJFB 1A6TA 4RFNB 2VSDA 5KSBE 2VLRE 1ZGLM 1XF5A 2HMID 3OKEB 4JN1L 1MAJA 5TH2B 4N5UA 1QPXA 2OCFD 3IDGA 1JGLL 2PTUA 1T21A 3ELAT 3SQOH 1RZKC 4W6XB 2VDRH 3BGFB 1F8TL 3VFSB 1Y6KR 1JE6A 4GW4B 4GXVH 3EO1B 4LASL 4MCYB 4QHUB 1YN6A 4PR5A 3QCTH 1T83A 3NOIA 3HRZA 1CICD 4X5LA 3ARVA 1AGCA 2OTWB 1A6WL 2B39A 3RNQB 4LVOC 4NKQB 4DQOH 1AGDB 1A6VL 2H3NB 3LEVH 1I9EA 2GHWB 2JB5L 2QHRL 4N90E 4XNZC 3I6KB 1FBIL 2EDTA 1QLEH 3TBYA 3HNVH 3I75B 1HSBB 5J8OA 2F53D 4YBLB 2XG5A 4HJ0D 5B39B 3JV6A 3RL2A 5EZLA 2DF3A 4HH9B 1AI1L 1FJ1B 1MNUL 3HAEB 3MLXH 3MO1A 3UTOA 2EDOA 6CGTA 1AGFA 1L0QA 1GPOL 3ZDYE 3K2UH 3ULVF 3BHBB 3GSQB 1BM3L 4M6AA 4PJ8C 3PP4H 1IL1B 5E8DH 4OGYL 1DVFB 1JFQH 4OF3A 3MOAH 1X5ZA 1B3JA 5I71B 3C60C 4C56D 5DFWH 3O11B 2I9LB 1FNHA 2IQAB 1X5KA 1GAFH 5D2LA 3ET9F 3IFLL 2XWBB 2A9ML 3PL6A 1OM3L 2NW3A 4YHOL 2R0KH 1CDCA 3GEWB 1EEQA 5HHQB 3WS3A 5H37G 3QUZC 3TGXA 1LO5A 3QQ3B 2D4FA 4WHYH 2EDDA 2AQ1A 3TH2T 1IGTB 1WV7T 1I8IA 4R2GD 1PY9A 5IBTH 4YHZL 3T8XB 3ZHDA 2V5MA 1J05A 5EO1B 2BC4A 4TYUA 4XBEH 4Y2DC 1OARL 2VYRE 1N5YH 3PQYB 4XWOD 3H42H 4GG6E 1MJUH 1QUNA 4ODUA 5E99L 4IMLA 4DKEL 4GQ9L 1CT8B 3O3DA 5AD0B 4OM0H 1UGNA 4HJJH 3MRDA 3TNNB 4KRNA 1EGJH 4NC2B 4E5XA 1HOCA 1U8KB 4DWHA 4BK4A 1BBJB 3MREA 3KPSD 1I7RA 4JJ5B 1HN1A 1QFWL 3KPOB 3VWKA 1QP1A 4TNWF 3KDMB 4OLUL 3F7YA 3FZUD 5FYJE 1OAKH 5EZJB 4R8WH 5EU5B 5BRZB 5D9SB 4WO4A 3RVUC 4I18B 3DECA 1ZLSH 3MNWA 43C9B 1MFAL 2R2EA 4I0PC 2BNUA 3MGOB 2NY6C 1XGUB 3ARRA 3DGGA 5DHXB 1MCSA 2W60B 2DD8H 3TBWA 4NM4H 1UWEH 1I1AC 4O9HH 4QHLA 4PRPA 1NFKA 3RRQA 2EIBA 4IRZL 4AENB 4NO2A 3SDCD 3WKMH 3UYPA 3FQNA 2ESVD 3P0YH 1ADQL 4DGIH 1PJ9A 4RFEB 3VFOA 3BKML 3O4OC 4W6YB 4J2XA 1X44A 1QBLH 4I3RH 5C3TA 1P6AB 4C4KT 5IM7A 5CP7A 5MEQA 4G3YH 3ALWA 3GK8L 1A4JB 1XCQA 2NY3B 5I15L 2IH1B 3CMOH 4NQVB 3VI4F 3WJJA 2BVPA 4JKPH 4QO1A 2VAJA 1LHZA 1HHIA 5JORA 1S9YB 4JG0H 3V6FA 4O4YH 5E8OA 3SKOA 1DP0A 1I8MA 1W0VA 1C5BH 3NPZB 5GRZA 4G6ML 4MA1B 5KSUA 1KXVC 1O5DT 2FX9L 5DHVB 4TNVK 2DM7A 2VL5A 4YEEA 2V6HA 3L6FA 3HN3A 4WCYH 3NABL 4MX7B 1WK0A 5DUBB 3O41B 3SKNA 4OI8A 3L95A 3NCCB 1ZTXH 2Y7QA 4CMMA 4PPTA 4HWEH 1RULL 2BOBA 2FJHA 2IJ0C 5DUML 3BDXA 1NMCC 3GSRB 3NMEA 4TRPL 5GGSA 4HUWA 4IRJB 1IVLA 4EXKA 2RGSA 1J18A 3QWOB 3NFNB 4GMSL 4EI5B 1VKXB 5KSBF 3GI9H 5JZ7C 2Q3AA 3V7AE 4R4ND 5HDLA 3QO1A 3LQZB 4X7TA 1X5LA 4WHTB 1OSPH 4PJFE 4XC1H 3AAZB 5C6PB 5DYOA 2FLBT 1TZIA 4CGTA 4U33A 3ZZ1A 4OZIB 4Z77A 3P0VH 3QDMA 4D0DA 1RUPH 5TQ0L 3D39B 2R2BA 1CGYA 3I02B 1VFOA 4Y16C 4GBXA 5LGHH 4MA3B 5IOPB 3ARED 3FT4B 3HZYB 3Q2CA 4PJ8A 2J5LC 4UOW1 2H6PA 4OCRL 4U0QB 1K4CA 4ODHH 1HK6A 1FIGH 5HYIA 4PJEA 5EU6B 2BSSB 4Y4FC 4G7VH 1NMBL 4K7FB 2F5AH 4NQEA 4QHMA 4CBPA 2DKMA 3NH7L 5D5MA 2NY0D 4X6BA 2VB5A 2B2XL 5AAWA 1HKLH 4TSAH 5IR1A 1T66D 4K3JH 1D9KC 2VDPH 4LCWA 1QSFB 2ENYA 2ARJA 3X14A 3QAZB 2HG5B 1QRNE 3P4NB 4EDXB 5ALCH 4O02L 5EU7E 4UINL 5MP6H 4ZDHA 3VH8B 2D7QA 3GBLA 3VDCA 4OSUH 5BVJB 1F6AA 3HUJB 2CIIB 4PP1D 5MEOB 5T5NF 2BFVH 2XFXA 2NNAB 1IKNA 3C08L 5EZIH 5FYJH 4L5FL 3JV4B 5D7LA 2BSTB 2OTPA 3K1KC 3RVVD 3BH8A 3QNXB 2X1PA 4PLKD 4RISL 3E3QE 1U8MB 3ZSTA 3UZQA 3CVHB 1SBSH 4PIRF 5HVHB 4PBXA 1DEEB 3U9PH 5EOCJ 3T77A 4MD4A 3ABZA 3ULUL 5ANMA 2MFNA 2R0WH 5L7XL 4OB5H 5ICZB 4F7PA 5BW7C 3MSPA 4WHYG 1I8LA 5GRVL 4L3CB 4JVUA 3VFVA 4N5EC 1TDQA 4XCEA 1CQYA 3GSNL 1PX4A 4Y4KD 2UZYB 3DVFA 3GUTB 5DD1H 4ZPVA 4U49A 5C07E 3JZ7A 2ADIB 3QXUA 1TIUA 2UWEB 3WD5H 5GS0H 3B9EA 4TN9A 1MSPA 1T4KA 4MCZA 3CFJA 3WV0A 1I1AA 1JNJA 1NC4D 3SQOL 2Q8AL 4YDKH 2H32B 2YD7A 4NNYB 1PYWB 4WU7A 1XF5B 5DD3H 3IDXL 1EHAA 3QCTL 3IDGB 2DJSA 4JO3L 1T21B 4JRXA 3DVNA 1C8PA 2H9GA 2EDEA 3O3BA 4RAHA 4MJ2A 4PJAF 4M7LL 3U82B 3EIFA 5L0QB 3LEVL 4IJ3B 5JXED 3B3IA 3QPQD 2CJUH 1YN6B 4NN7C 4PR5B 4POZC 3ESVF 4YAQA 3HRZB 2NLJA 1AGCB 3BPCA 3BWUC 5I1LA 1MH5A 3MRMA 4YDIH 5DK2A 3BGAA 1IKFH 3AM8C 4JJHA 1OAYH 3BKYH 5C7XH 2XYCA 3QYCA 3TBYB 4X6CA 5HHOA 1CVRA 4KMTL 4FNLL 5DD5H 5C0GA 2VZ1A 3JV6B 4Z95H 3RL2B 4GXUN 5EZLB 2NTSP 1CGVA 3PP4L 5E8DL 1U58A 4K2UH 4CKVX 1DLFH 4WUKH 3B9KA 3MBED 3MO1B 3IYLW 5E2VH 1AGFB 2E7MA 3BQUA 3Q1SL 1GAFL 5HSFA 1TQBB 4X7CC 2EYTA 1ORSA 2R0KL 1JPTH 2E7BA 4YZFE 3V6ZB 5D2LB 3PL6B 2NW3B 4Q7DA 4FFYL 2ZCLH 1IAII 3RKDC 5FM5O 3BP6A 3WS3B 5ADOH 3SKMA 1D5ZA 3OKMB 3W2DH 1LO5B 1MIML 3MC0A 4XBEL 1DCLA 1N5YL 1MQ8A 1TQCC 3H42L 1MJUL 2AAVA 1I8IB 2ZCHH 3OAUL 5B38G 2NY7H 4XHJC 2BC4B 1KIUA 4OM0L 1BFVL 1OP3K 4RFOH 1RQ5A 5HDQL 4Y16A 1EGJL 2BVYA 2JIXA 3T0EA 3AMLA 4OGZA 5IBLC 2QQLH 4IMLB 2ZP0T 1V7NH 4YBQD 5CKAA 2HA1A 3TYFA 3O3DB 4KWUA 2DJ4A 3BKCH 2DQCL 4QHNA 3MRDB 2X70A 4PJFF 3X11A 3QQNA 4E5XB 2AEQH 2PUQT 1HOCB 1OAKL 5T3ZD 1WBZA 4L1HA 1F45A 3MREB 1I7RB 1ZLSL 2ZUYA 1UZ8A 1UQSA 3W5MA 5GHWL 3MRLA 3CC5A 2YN5A 2YOCA 4MQTB 5HD8C 1KLFA 5D8JH 2M8XA 3F7YB 4F7CA 1D9KA 4V2BA 4X9IA 1OHQA 2VTFA 3UTZA 2HJKB 3RL1A 5LCVL 3DXAA 4WO4B 3MNWB 2R2EB 3MRJA 3DSFH 4RNRA 5BMFH 2IGFH 2BNUB 4NQXA 2NY3D 3DGGB 5A2LH 4XMLH 1NPUA 3TBWB 1YEDA 4DGIL 1A7RL 4PJ7F 1BBDH 4P5MA 1TPXC 3SDAA 4C59B 4QHLB 2EDRA 3D3VE 4PRPB 1QBLL 3S97C 5HPOA 4NO2B 4U7MA 3QIBC 2WIIA 1I7TA 3FQNB 4G3YL 3NTCH 2VXQL 1GOFA 3RUGF 3VFOB 1DLHA 4ZOAA 4XZUA 3CMOL 1JYNA 4XVUD 4JKPL 4LPTA 3P9MA 5IM7B 1HXYA 1YECH 5CP7B 3B2UC 1P69B 5MEQB 1YJDC 4WI2A 5C0EA 1XCQB 3KPPA 5BW7A 4JG0L 5FECA 4MQXC 2F8VA 5GS1C 2YPVH 1C5BL 2KQMA 2BVPB 2GJZA 4HLZG 2BSRA 1HHIB 1XAUA 5JORB 4FFZL 4R26H 2J3SA 4IRJD 5CJXA 5EOQL 1B6DA 2EKSA 4G43A 1U8NA 2A38A 3V6FB 1A7QL 1YNKH 5E8OB 3SKOB 1I8MB 1W0VB 1JMXA 2JCCA 5JA9A 5KSUB 4UAOB 3SE9H 4HUXA 1R5VA 3HE6A 4HKBA 3QQ4A 4LCCC 3OTTA 4HIHA 4GRWB 2QR0A 3BIKA 4N0RA 2VL5B 2XTLA 3L6FB 4TTDD 4FQLL 2HT2C 3JV0A 3WCYA 4MMXC 2F53E 5IJKC 3FOLA 4KGLA 4FP8L 3D39D 6FABL 3PV6B 3SKNB 3L95B 2HT4D 5CD5D 3GI9L 2VXSH 2Y9RT 4CMMB 1RZJC 1TJHH 2YKLH 2BOBB 2FJHB 3BKJL 2N7AA 3G9AB 1RZKH 5GGSB 4HUWB 4MDIA 4FZ8L 4BH8A 4PJHF 4XC1L 5EU6D 1UM6H 3CXHJ 1PSKH 4GOSA 4DUXA 2FECI 3AM8A 3OAYK 3VXRD 1WBYA 4XNZB 3P0VL 3QO1B 3QXAA 1RUPL 4X7TB 4C56E 1PG7W 4ZYKA 5LGHL 1XIWC 4KUCD 2WWMD 5CILH 1S7QA 1SYSA 4IHOA 5DYOB 3QI9A 5FYKU 1TZIB 1N0XH 4ODHL 1FIGL 1KLGA 4Z77B 1QSFD 3QDMB 2QTEA 5D6CA 2R2BB 4NQTA 4G7VL 3S7GA 3CXHK 5ADPL 2F5AL 4GBXB 2WLZA 2C9AA 4GXUM 4PJ8B 1AXIB 2H6PB 3OAYH 2FD6H 1K4CB 4PJEB 2LQRA 4GMTH 4P4KC 4XCFL 4XPGL 2K1MA 5EPMA 1HKLL 1CFVL 5LBSH 4K3JL 4LSRH 5CKGA 4NQEB 5GSVA 4QHMB 3H3PL 2BDNL 2VDPL 4JQIH 2QADB 5D5MB 1YY9D 4X6BB 3B5HA 3ARBD 3UZEA 4X8JA 1CQKA 4J3TA 3IRZA 1C1EH 1HYSD 4LCWB 2ARJB 4JFPA 3X14B 5FDYA 3AS2A 4OSUL 2CKBA 3KNBA 4P2OA 2FEDC 4L8SC 2DTML 3KPSE 3EYSL 1DQLL 5FYJL 4ZDHB 4OFPA 4ZAKA 3MCLH 2ZPKH 5E4EC 3D0VA 3LB6C 2ICWJ 1I3GL 2ERJC 5K93A 1F6AB 3UTSD 4P9HC 3TV3H 4Z8FH 1FZKA 1VACA 2XFXB 1DE4A 4XX1E 4M48L 4NT6A 2E7HA 5MENA 5D7LB 2DRUA 3G5ZA 3BH8B 4Z7UE 4OB5L 2YXMA 2XA3A 1QBML 1T0NA 3LN5A 4M5YH 3T77B 3Q6FA 4MD4B 1ODAA 5ANMB 3S35L 1RI8A 4PRBA 1FFNA 2VZUA 4NBZB 2LV4A 2VL4A 5F89A 4F7PB 1A7NH 2B0SH 3NCEB 4OZGF 3QEHA 4WJ5A 1BQHG 2DQJH 2PO6C 2ESVE 4XCEB 3VG0H 1CF8H 2PW2A 4YDKL 4NZUL 3ARDA 3SN6N 2NY6B 2HLFC 3LD8C 1RJCA 2FIRT 1Q9OA 5DD3L 5F97E 1L6ZA 5D1XA 3T2NL 1T4KB 4MCZB 3CFJB 2MJWA 5IFJA 3WHE1 1I1AB 2OYPA 1Z9SA 4P59H 1BQLH 4PFEA 4BM7A 3VXQA 4WU7B 3EJJX 1FO0H 2UY6A 5EOCL 3X12A 4HX1A 1BJMA 4JRXB 3DVNB 2UZIL 2H9GB 2MKWA 3O3BB 1I3RA 4OIBA 3T3ME 1VDGA 1MHHA 3MYZA 1RUMH 1SEBA 3B3IB 1IKFL 1BVZA 1OAYL 1GXEA 3BKYL 5C7XL 4YAQB 3PDGA 5I8EA 3G5XA 1UCBH 2NLJB 5DD5L 3BPCB 2PYEE 1KENH 4PGBA 5I1LB 1MH5B 2LVCA 2VITA 5KANG 1DL7H 5DK2B 1S7TA 1KBGH 1WT5C 4K2UL 3PL6D 4WUKL 3QEUA 4TSCH 3SE4C 4Y4HD 3JWOC 5E2VL 4X6CB 5HHOB 1NLDL 4GT7A 4FQHA 5C0GB 3DURA 5LG1A 2OM5A 2VR5A 2ZJSH 3WFEL 1CE1H 1U58B 3IVKA 4U31A 3B9KB 3TNMA 3CU1A 3V2AR 3MRFA 3BQUB 4QOKA 5DJCB 1EO8H 2DLHA 2EYTB 1ORSB 2K7QA 5BQ7A 5IJKA 2ZCLL 4HWNA 3HCVA 1NBVH 5IVOA 2RJMA 2CSPA 3W2DL 3ARSA 3MV9E 3EFFA 5A1AA 1NMCB 1B4JH 1MCEA 5D1ZC 5ERWA 3AXLA 1YYLL 2NY7L 5KOMC 1WTLA 3BP6B 4WHCA 1KCUH 3SKMB 1D5ZB 5DJ2A 5ICYA 4RFOL 4NDMA 2VR9A 2QSQA 4P2CG 1MY5A 2IF7A 3VWKD 4JREB 2QQLL 3IS1X 3GB7A 5BVPL 1TITA 3IKKA 4DFHA 4CVUA 4WO4D 4OJFH 1EHXA 4G80A 2AQ3A 2JIXB 4Y16B 3T0EB 1NGZA 2AEQL 2ZUSA 1GZPA 1BJ1J 2R8SH 3LN4A 5CEZD 3FFCA 2J5LB 3BZDA 1U8JA 1ZHNA 5C6WH 1F4WL 2ARJQ 1FVEB 2QJDA 3IDJA 1C08A 2V17H 4HAGA 4K94L 4P4KA 3TYGH 4QHNB 1OAZH 2X70B 3X11B 4DKFL 4LHQB 4M6NH 1NEZG 1PVHA 1WBZB 4PRPD 4H88H 4N68A 5KVFL 3HHRB 4HDIA 1EEZA 2FIKA 1JTOA 2XI9A 3UBXA 1UZ8B 1UQSB 3UAJD 3MRLB 3CC5B 5BMFL 3O2WH 1H8NA 3VXSA 3VMNA 1INQA 3U2SA 4Y8DC 4OF6A 4YDVA 4F7CB 1D9KB 1CCZA 3RL1B 1GIGL 4ZTPH 2Z9TA 3DXAB 2JK5A 4RNRB 5JR1L 1E4XH 1YEHH 4NQXB 2PTTA 4XB8A 5TE7H 5T3XD 4DK6A 1VESA 4JPVH 1YEDB 3MOBH 1LEGA 3NIGE 1BJ1H 3SDAB 5JOFA 2AJSL 1MLCA 3KJ4C 2WIIB 1I7TB 4UNUA 2A2QT 5GIRA 2I5YH 1WC7A 1DLHB 4XZUB 2GW5A 2G5BA 3SDXA 4NZDA 2EIDA 2YPVL 4ZO6A 4LCYA 1MIEL 2EDXA 4PRHA 3P9MB 3PWNA 4M7KH 4WI6A 5I0DA 1HXYB 2OR9L 1RURH 1WWWX 1I9RH 1RMFH 5C2UB 5C0EB 1HIMH 1MCWW 3QFJD 3KPPB 4GKNA 3DI2B 5FECB 4IBLT 1YMHA 4QRPA 2GJZB 3V6BR 2CPCA 5C2BH 3SE9L 3F6LA 3MR9A 3MLSH 2CR6A 3GGWA 2EKSB 4G43B 1U8NB 1S7UA 4XP4H 2JCCB 5FM5M 4F33A 4F57H 2QQNL 4JHBA 4KXZH 4KTYA 4HUXB 1R5VB 1F58H 2G5RA 1I4FA 4M1GL 4HKJB 4Z7QF 4HKBB 4JY5H 3QQ4B 2OL3A 4HIHB 2VXSL 1C5CH 2QR0B 3BIKB 3VW3H 4ZFOA 3SOBH 3BPOC 3UZVB 1RZKL 3JUYA 1GHFL 1TVBA 3FOLB 3UC0L 1PSKL 1RK1A 1N3NA 4UBDD 2DQGH 3S3PA 1MRDH 4GBXD 2VLMD 2JJSC 3KPLA 4MDIB 4BH8B 3IB4A 2DM3A 5CILL 1LK3H 1N0XL 1WT5A 4NQED 1WBYB 3RWEA 2HRPH 2QADD 3O8XC 3QXAB 5IIEA 1F42A 5MI0B 3U0WH 4HF5L 5CJQH 1S7QB 1SYSB 4IHOB 5IMKA 3QI9B 2FD6L 1KLGB 4LCWD 4HIEA 5D6CB 5GS2D 1A5FL 4LSRL 4UMGA 1QLFA 5FCSH 4JQIL 1ZKAA 1YMMA 5FA4A 4HUKB 4EDWL 2GK0A 1Z3GL 4HT1H 4HS3A 4RIRA 1C1EL 4XAKD 1G9NC 5GSVB 5D1ZA 1DBAH 2HRLA 1UADC 2BNQD 3BUYA 3QG7H 5GZOC 4X8JB 2MQ0A 5KANI 1A3RH 3DETC 1RZ8A 1UFUA 1VFBA 3MCLL 2ZPKL 4OUOA 2YA0A 4JFPB 4XB7A 1J8HA 2EXWD 1MHEA 2ED7A 2CKBB 3KNBB 5T3ZE 4OLYL 2HVJA 3QIWC 2J8UF 4O5LH 4ZAKB 1ONQA 1EAPA 3GBMH 4U1LA 3D0VB 3HC3L 5J1AA 5EN2A 3VGBA 1PDKA 1HNFA 1N26A 2JF1A 5J3HC 3QQ9D 1FZKB 1VACB 3D6GA 3DYOA 4HIXH 4CVWA 5MENB 4MWFA 1ZOXA 3ARZA 3G5ZB 4RZCA 4WWID 1I1AD 4LSTH 5DC0A 4NRZA 3BRGC 3JBG7 3PABA 1T0NB 1RZGA 2DQJL 3LN5B 4KK8D 2ZUWA 3Q6FB 4M5ZL 4PREA 3BE1H 2DI8A 1JYVA 4PRBB 1FFNB 4YXLH 5F89B 4G8EA 4AK1A 3V52H 2CXGA 3ZTNL 1IMHC 4FQCH 3QEHB 2E8ZA 4WJ5B 5GRUH 3DLQR 3FO9A 4P59L 5BV7H 1BQLL 2PW2B 3RHWK 3ULUF 3ARDB 2P1YA 3HZVA 4JKWA 1Q9OB 2XICA 2DN7A 5D1XB 4NBYB 2IAMA 2DDQH 5JPNA 3QCVH 5IFJB 1CFQA 4JQXA 1TPXB 3UO1H 3HG1D 1Z9LA 2YRZA 4DUWA 1NCCL 3VXQB 1EK3A 2X4OA 4J4PA 3X12B 3O81A 4HX1B 4MA8H 4M8VA 3ZKMC 1CD0A 3KVQA 3TCLA 1I3RB 1KENL 3HAEH 3B9KD 5BZWA 1CXLA 1MHHB 1MFBH 4N8VA 1KBGL 5M95B 3UJJH 5E56A 1SEBB 3BQUD 3FO0H 4MA7H 2HT3D 1PZUB 1AQDA 4HEME 5I8EB 3G5XB 4I9WD 4HPOL 2VXUH 4JN2A 4PGBB 5SWSD 2VITB 2QKIB 4LARL 1CE1L 1S7TB 1WZ1H 1BVKA 4OZIE 4PD4J 3S4SG 2YC1A 3TLRA 2NY1D 3QEUB 5C9KA 4Q9BA 1TCRA 4FQHB 3D25A 3TN0C 1IRAY 3DURB 4LP4A 5C8JB 3SBWC 1EFXA 4JRYA 2BRRH 4PJ9C 4XVTL 4JKKA 5EU6E 3IVKB 5GGTH 4HGWA 3RWCA 1NBVL 4OF8A 3TNMB 2ZSVA 4Y5XA 5C6TH 3VXRE 4X99A 3MRFB 4QOKB 4JY6A 1B4JL 4PD4K 2O5YH 1ITCA 2FHFA 2YUWA 5BQ7B 4OTXH 3RVWC 4ONGH 5MHSE 1KCUL 3HCVB 3REVA 2E27H 1IM9A 3T0ED 2H2SC 3U30B 3I6LE 1NBZA 3EFFB 1QSFE 5FM8A 1GGIH 3R8BB 4K55A 5C0AA 3ZL4L 5ERWB 2A6IA 4HUNB 4LVNB 3PHOA 3AXLB 4LU5H 4ZXBA 3OKYA 3SDYL 2YEZB 3HR5A 4L8BA 1L7IL 5DJ2B 4JY4A 3ZE0E 3O9WC 2H8PA 4JZOA 4LP5A 5ICYB 5DZOA 1HI6A 4NDMB 4OJFL 4XMPL 2KDGA 5ESAA 1QNZH 3HUJE 4KKLD 2R8SL 2NR6C 1I7ZA 3C5ZD 2R69L 2BVUA 3RPKA 2D7PA 3WLWC 3GB7B 2GI7A 1YZZA 4M1CC 2VUOA 3MGTA 1S5IL 4D9RD 2IG2H 3UROR 3TYGL 1OAZL 4A2MA 3HB3C 4PJXE 4WFFD 2NY5H 3DXAD 4XXDA 4G80B 3KXFA 1NGZB 1GZPB 3LN4B 3FFCB 1U8JB 1ZHNB 4JHZA 1E6JH 4H88L 3TH4T 3IDJB 5E8PA 2CK0H 3MA7A 1C08B 3MUGA 4I2XA 4P4KB 4ZFFA 1NUFA 3LKNA 2D7MA 4YHYC 1FORH 4M61A 4UQ3A 1IFHH 2VDKH 4QXUH 4OFKA 5KVGH 4JZNA 5HHXH 3SDAD 5T3ZH 5I6XC 3I3DA 4WUUA 4HDIB 1EEZB 2FIKB 3UBXB 4IM8A 3ILPA 1F4YH 5DRNA 1XEDA 4MB4A 4PLJC 3UTSE 4M4PA 1E4XL 1INQB 3U2SB 5EIVA 4YDVB 1SJXA 1S9KC 1DQJA 2C7UA 5J1SC 2B5IC 2YD3A 4IMKC 1KCKA 1X7QA 3MOBL 2JK5B 4ZQKA 3N1FC 3V6OC 3QIWA 3BYTA 3RNKA 4LAJH 2CDFA 5FOBA 1AC0A 3GBNH 2PTTB 3OGOE 5D93C 2ICWI 3RPIA 3JXAA 1QFUH 3ARGC 2ERJB 3HRPA 1LEGB 2I5YL 1U93A 2E9WA 4Z0BH 5JOFB 3FL7A 1MCBA 1MLCB 2QLVB 4X80H 5FGBC 5DMIL 4POYA 4M7KL 5JIHA 4OLXH 5JIPA 1RURL 1I9RL 1RMFL 3IGAA 3ILQC 1E6OH 1HIML 5GIRB 1BFOA 1WC7B 4X7EC 1S7VA 1FFRA 3HE6D 3WLBA 3FQTA 2G5BB 3SDXB 5DHVH 4EUPA 3B43A 4LCYB 5C2BL 4PRHB 3PWNB 5I8KH 3MLSL 2X4QA 1GGCL 3O6FA 2BY0A 4M93C 4GKNB 4XPHH 1LDSA 4NJAH 1UZ6E 2V9TA 1YMHB 4QRPB 1UJ3A 3EO9H 2V5YA 4POZD 3DI3B 3MR9B 2Q6WB 4ODTH 4JY5L 3GGWB 5T33L 4OGAC 3VW3L 5KAQG 3FRPG 1S7UB 3SOBL 1FCGA 2DJUA 1QKZL 4F33B 4N1CA 1I4FB 1BQUA 2OL3B 4JHWH 3CPLA 5JW3H 5DMGC 4ZFOB 5D2LE 1FGVH 1U8LA 1ZEAL 4Q6YA 3QI9D 2A77H 2DLTA 1MVFA 2A6KA 3OWEA 2JB6A 1A7PH 3B2VH 1TVBB 4GKZA 4WW1A 3ARQA 1RK1B 3NAAH 2DOCA 1N3NB 4GKOA 4MAUH 4U0RC 2LAGB 2HRPL 3ZHKA 3WIHA 3KPLB 5TPWH 3C9NA 1XFPA 4U7KA 3E6FA 3UPRB 5DJ0A 1T1YA 4OCSH 3QUYC 2DLIA 4O51A 3RWEB 3QHTC 5GGSY 1XR8A 3KYOA 4YFLF 5IIEB 5DRWA 1HEZA 5KSVA 3TN0A 5JXAH 5IKCA 2ITDA 5FO7A 3N1GC 4EZMA 5IMKB 1HH9A 4N0CD 4PJ9A 2IBGA 2BJMH 1M7IA 1DBJL 4F37F 5C0JA 3W11C 4HIEB 1IJ9A 4PJBA 5HI5D 4F9PC 4K8RD 2NYYC 4P2OD 1QLFB 1JZ3A 4KVNH 4YO0A 1DBAL 1M6OA 4LBEA 4K23H 1YMMB 3UP1A 5B39G 3QUKA 4LLUA 4N9OB 4ZAKD 5F7EH 4L8CA 3QG7L 5FA4B 2FYYA 5CJBA 1A3RL 4HS3B 4RIRB 3IDYC 4HMCA 4LQ1A 3GRWL 4XPTH 5D1ZB 3T1WA 2QL1A 5MEND 1DSFL 3BUYB 5CEZE 5HGBA 1MCPL 1MAML 1BAFL 1RZ8B 4O5LL 2D7OA 1VFBB 1MHPL 2GTWA 2MMXA 3CVHH 1NGQH 5EIIA 1JBJA 3GBML 1E4XI 4L3EA 2NZIA 4FQQA 1J8HB 5L2KD 1MHEB 4APQC 4KUCF 2CR3A 4S1DD 2HVJB 4PRPE 5DJYA 5DJXA 3LRSA 1HCFX 3K8MA 5T1KD 1ONQB 1EAPB 4S11A 4XP1H 4U1LB 1XF2A 1WJ3A 5EN2B 3ARDD 2DICA 5IVXA 3JWNC 1UWXK 2GEEA 3ZKND 3PF2A 5HGDA 4MWFB 5D1XD 4XXCA 2IBBA 1EEUA 3BGMA 4RZCB 5CS7A 2QV2A 5JQHC 2OZ4H 5I73C 4NRZB 4GS7C 3V52L 4CJ0A 4LPVA 2H32H 3PABB 5T3XE 4FQCL 1RZGB 1L9MA 2CRMA 1II4E 3OJ2C 1RU9L 4W4OA 5BV7L 4PREB 4XNUL 3W82A 1H5BA 5DTFA 2VLLA 4JGUA 1M4KA 4G8EB 2BX5A 3MODH 1UWXH 4FQ2L 4Z18A 4HPYH 4QKXB 4CVZA 4P2QA 3LCYA 3GSVA 3QCVL 5JNYA 3FO9B 2IPTH 4HMDA 3WO4B 2KH2B 3UO1L 4FQXC 5L2JA 2VE6A 3HZVB 1GJIA 4UNVA 5D6DC 3ARGA 2K7PA 5JIKA 4MA8L 2IAMB 1JNLH 4P2RA 5JPNB 1CFQB 5HGAA 2P8MA 2YXFA 3QFJE 1YY8A 1JMZA 3KJ4B 4BQBA 4J3UA 1MFBL 4KJPD 2UWEF 3U79A 2X4OB 4M6OH 4R97C 1F4XH 5L6YH 2AGJL 4LF3A 2VUYA 5DFVC 4YWGH 4BZ2L 2VXUL 3TCLB 1P2CA 3BVNA 1IT9H 2VC2L 4DK3A 4N8VB 4YFDB 1IEBA 1C7SA 3HC0A 1WZ1L 3SCMC 4I0CC 4JO2H 4QOKD 3VGDA 2X4SA 4E42A 5HXMA 1AQDB 4OQ1A 4P3CH 2W9DH 3LQMA 4YQXH 4X8XA 4JN2B 1H15A 1ZVYA 5FUCC 3FN0H 5I2IA 1BVKB 4P99A 1GGTA 2YC1B 4GRLA 5GGTL 1FDLL 1P53A 2A0LD 4CW1A 3D25B 2VLME 4ZSOA 3MBXH 2O5YL 4JDZA 1EFXB 4KK5D 1BREA 4JRYB 4OLWL 4OI7A 4OTXL 5KS9E 4RQQA 4PJEE 4ONGL 3BD3A 4HGWB 3RWCB 2OTUA 4OCLC 2E27L 4D8PA 2R1YA 5FYKL 2ZSVB 4Y5XB 4BUGA 5JHLL 4X99B 5BOPA 3BPOB 4I77H 4JY6B 1GGIL 4OUUA 2FNBA 1RUQH 4LU5L 5IVZA 1BECA 4P5TD 1RZJL 4MS8C 5GJSH 2F5BH 4J3OC 3REVB 1IM9B 5HYQA 4LHUD 2D31A 1I1YA 1OAQL 3FFCD 3F62A 1NBZB 4LCWE 3UJIH 5C0AB 4JO1H 2PKDA 2A6IB 2PNDA 2OMBA 4MB3A 1AE6H 4S1SH 3ZT5A 3PHOB 4ZXBB 3VGFA 1QYGH 5I74B 5D2NA 3HR5B 4L8BB 3MRGA 2GIYA 4JY4B 3QUYA 4Y89A 4MNQA 5JQ6H 2H8PB 4JZOB 5D2LF 1R5WA 3PJSA 1HI6B 1MF2L 5D7IB 1D6EB 4XAKE 5ESAB 1EIBA 2FB4H 1KJ2H 1I7ZB 3VXSD 4H1LA 5HHVH 1IQWL 1E6JL 5HDBF 4HBCL 5IGXH 3MGTB 2BNQE 2RBLA 2DB8A 3BESR 1L6XA 2CRYA 4KKAC 2EIEA 1FORL 1CFSA 4XXDB 3TA3C 1IFHL 1N4XH 2VDKL 3KXFB 1NAMA 5KVGL 5HHXL 5CEZH 5CZVH 5T3ZL 3RZWA 1J1PH 1G6RH 3EJZC 1VEMA 5E8PB 5IROA 3FQWA 3MA7B 3MUGB 5JUEL 3LS5L 3QZWA 4I2XB 4ZFFB 3LKNB 5ANME 3QJHA 4M61B 4UQ3B 1YEKH 4KROC 2ZG1A 2XY1A 3QB7C 3PIQA 4JGMA 3MX0A 5IW6A 4JZNB 3MV01 4F7MA 3KJ6H 4Y7MA 5DRZA 4WUUB 5LXGL 3WNLA 3ILPB 1TCMA 5DRNB 5F3BA 3B8YA 1RUKH 1DQJB 3MGAA 5HHMB 1B90A 3WFDH 2C7UB 3O6LH 4XP6H 2A6JA 1X7QB 2XTJC 4QRRA 4APQA 2Q7YA 1FV1A 4ZQKB 4HXAH 4X6DE 5TF1H 3RIAF 3QIWB 4ZNCD 4Z0BL 5FGRA 3RNKB 2CDFB 4LLDA 1IGIL 3CFBA 4X80L 5EZOH 3KPRA 3WE6A 4OLXL 3RPIB 4OD2A 4QRPD 5T3XH 5J11C 2VDQH 3MV8D 4X5XA 5H8DA 5DZLA 4XCNA 2YD6A 4P9HL 4NCC2 1DQDH 1WZKA 1U93B 3GDBA 5DDHA 1KIQA 3ULSA 5I8KL 3IGAB 4HC1A 1RZ7H 4FG6C 1IGML 1BFOB 1S7VB 3WLBB 3FQTB 4FFVD 4JKLA 4WI3A 3X13A 1HCVA 4EUPB 2C3HA 32C2A 4JFXA 3HG1E 5D1QC 4X6CE 2X4QB 3O6FB 5DJ6A 5KSAC 4G9DA 3PUCA 1CK0H 3O3EA 1UJ3B 1O7VA 1MREL 3C5JA 2B4CH 4JHWL 4FZEH 4CMHC 3L5HA 3BI9X 4AJ0A 4WRLA 1FGVL 4MD0A 2Q87A 2BY1A 5A2FA 1JIBA 1FVDA 4PV8A 1TJGH 4I9WE 5E2TL 2W65A 1KACB 2EEDA 3CPLB 5SWSE 4MAUL 5FO8B 2G2RA 4ODXA 1U8LB 4QYOB 4X6EA 3V4UH 2A6KB 5IT2H 4D3CH 1U0QA 2JB6B 4N8PA 2AJVH 4GKZB 4GRWF 4WW1B 4IRSD 4Y8AA 3L7EA 4OCSL 1J88A 4NQCA 5JOPE 1KCRH 3QUMH 1DBBH 5F7HA 2DIBA 1YMMD 3RZCA 2NX5E 3N85H 3SJVA 1EA9C 5JXAL 4I4WA 1UA6H 3C9NB 3CSPA 3RWGA 4TQEH 1UWGH 4JPKH 3W9DA 5DJ0B 1T1YB 1V7MH 4XTRD 4O51B 1XR8B 3KYOB 1QFOA 5DRWB 3T0EE 1ZANL 2NY2D 2WWKO 3UTTA 3CDGA 3TN0B 2ADFH 2X4PA 5IKCB 2ITDB 5IB5A 1U91A 5FO7B 1OW0C 2DQTL 4KVNL 1URLA 3VFUA 4K23L 4TTGA 1HH9B 4PJ9B 5F7EL 1M7IB 3UJTH 3VG9C 1M05A 5C0JB 1KTRL 4UDUA 1J8HD 5GS2H 4PJBB 3KR3H 3RUGA 4XPTL 1B2WH 2YUVA 5I1CL 4YO0B 1M6OB 2BXZA 1EO5A 3QUKB 3WNOA 4LLUB 3PP3K 4L8CB 5B8CC 4MLSA 3MRNA 4LOUC 2E8YA 1Z9OA 3CVHL 4WFFE 1NGQL 5IFHH 2YA1A 4ZS7H 2F15A 1MY7A 3TO4C 2DQHL 2OXGA 2P45B 3VXMA 1LQSR 1TETL 5D5MF 2GTWB 2A6DA 5GGUA 1V3LA 5EIIB 5E6IA 4L3EB 4XP1L 4FQQB 3PP3H 2VSCA 2W0FA 5C0BA 1OT1A 4CDHA 5DJYB 4P46D 1SY6A 4PJGE 3LRSB 4HS8H 2OJEA 2DLEA 3ME0A 1XF2B 2OZ4L 1DZBA 3F7PC 1HWHB 4DN3L 5IVXB 3CUPA 2AK1H 5HGDB 3TT3L 4OF0A 2V9RA 1CLCA 4YHYB 1QZ1A 1DANU 2IAMD 3BGMB 5F9AC 3F8UB 1GYAA 4PJHA 1RHFA 2GJJA 4HPYL 4QGTA 3BMWA 1A22B 2IPTL 5KTEH 4MD5A 4J4PD 4OFDA 4ESKA 4XPFH 1SVZA 3HE7C 1H5BB 5DTFB 1OWRM 2VLLB 2B5IB 4YDLC 5DURB 4CVZB 4P2QB 1JNLL 3GSVB 5JNYB 4YHLH 1NCWL 5L2JB 4M1DH 2VE6B 4XNQA 1QRKA 5D93B 1F4XL 4KMQA 3WS6A 3ARGB 3LIZH 4P2RB 5GGVH 2DQFA 4UIMA 4YWGL 5HGAB 2P8MB 4HWBA 1YY8B 2X41A 4Z7WF 4OQTA 4WFHD 1WLHA 1ZV5A 1EFXD 4FABL 1W72H 4JRYD 4LF3B 4P3CL 2W9DL 2CDEA 1BWMA 4KRMB 4YQXL 5IUSA 1FL5A 5I76A 1IEHA 1P2CB 1IEBB 4IDLA 5EOTA 3NACH 3LRGA 1OAXH 4E42B 2X4SB 4PG9A 1HHGA 5D1QA 2QHLA 4NKIH 1ZT1A 5GSRA 1X6NA 12E8H 4L8DA 5TFSH 1KEGL 2GITA 1H15B 2E7LA 1UVQA 1IM9D 2EO1A 3O45A 5I2IB 3FO2B 1AR2A 4GRLB 5E9DA 5C0AD 2HTKD 3HMXA 1YPZA 4ZXBD 3MTRA 2ZUUA 4ZSOB 1OPGH 1LO3H 1BD2A 4I77L 3KLAA 3AGVA 3HZKA 4JDZB 3T0WA 3JWDC 4RQQB 5HYJE 4X6CF 2OTUB 5GJSL 2F5BL 4D8PB 2R1YB 1OAUH 4YH6A 1VCAA 3BP5A 3MLZH 4JPWH 3UJIL 3RTQC 4OUUB 4S1SL 1AE6L 2J6EA 1MWAH 4PJCE 4WI7A 4TVPL 1JRHH 2M26A 3VGEA 4U0RB 3KXFD 5HYQB 2D31B 1I1YB 5CEXA 1MCQA 1JZ8A 3QCUL 3G5VA 3KPTA 4OZGA 5T1DL 3S88L 2PR4H 3LDBB 2FB4L 1KJ2L 5D2NB 3MRGB 3TVMC 3QUYB 4MNQB 5IGXL 4U3XA 3T08A 2IANA 1R5WB 3PJSB 4POUB 1RK0A 4WUUD 5C0DA 4E41A 1V3MA 1N4XL 1IAOA 2L0DA 3F12A 4NSKA 5I1IL 5CEZL 2XACC 4H1LB 4EOWH 1G6RL 4N8CH 5HHMD 4AMKH 3K2MC 2AW2A 5DXWA 1IE5A 4DKDC 4JZJC 1MCHA 1A3LL 5D71H 1CFSB 2Z92A 1KPUA 1YEKL 5E7BA 1VPOH 2H2PD 1NAMB 4XBGA 3S98A 4U1SA 3KJ6L 3MJGX 1IGJA 3FQWB 1V3KA 5L2KE 3C5SA 5B8CA 3QZWB 3ULVD 2JE8A 3QJHB 1S7WA 1RUKL 4NKDA 1WZLA 3KYKH 4WGWB 5KJRH 3PIQB 4KY1L 3WFDL 3O6LL 5IW6B 5L8LB 4XP6L 1T3FB 4F7MB 5DRZB 4X4MA 1P7HL 2EEBA 4PY8J 4HXAL 5TF1L 3RWFA 2WV3A 4RGOH 3TO4A 5F3BB 1A9BA 5EZOL 2HKFH 3RY5A 2A6JB 3VGHA 5F7DA 1CGXA 4QRRB 4APQB 1I9JH 4NC1E 1FV1B 2Q7YB 1BGXH 1KSRA 5IB2A 1SQ2N 4LCIH 1DQDL 2MQCA 5A2JH 4JFED 5CCKH 3O6FD 4LLDB 3CFBB 2Y07H 3KPRB 3WE6B 4MVBD 3VFGH 4OD2B 5E95B 1T80A 1HH6A 4X5XB 3MYJA 4XCNB 3B83A 2MKLC 2P44B 5DDHB 1KIQB 2P43B 4HWUA 1LO2H 3G6AA 3ULSB 1SBBA 3C09C 4QXWA 4X0KA 2GAZA 3S34L 2FHBA 1G7JA 5CIPA 5KG9A 3IKCA 3DMMC 1G7LA 3X13B 1MRCH 2FX8L 3N50A 4JFXB 1MI5A 1AR1C 4HUVA 4G6KL 2AERT 4FZEL 3X3FH 5DJ6B 4LDOB 2VABB 4G9DB 3GJFA 4XAWH 2C3WA 1T7XA 4Q9RH 3WDHA 4A6YL 1NCNA 1PZ5A 1ZVHA 3MPCA 1TJGL 3OZ9H 5GQBA 2AEPH 2NTFA 3C5JB 4ZUUA 4XI5D 1U6AH 2D7TL 2HN7A 4EN3D 4D94A 4H0IA 4MD0B 3V4UL 5INDA 3L3OA 1FVDB 4PV8B 5IT2L 4M7LT 5CLWA 2W65B 3PHSA 4C54A 1RFDL 1XH3A 2AJVL 3MXVL 3T4YA 5FUOL 4TUJA 2G2RB 1N5AA 3QUML 4ODXB 3PNWA 2JCCF 3FB6A 4X6EB 4PJ9D 3N85L 4BK5A 3U9UA 4GAGL 1DFBH 1UA6L 3HI1A 5TDNA 4RAVA 1UWGL 4JPKL 3R8QA 2DYPA 3NN8A 3L7EB 3UTQA 4NQCB 2XKUA 3NA4A 3E8UH 3RZCB 2VNCA 4X7FC 3BT2L 5F96H 4P3DA 2E3VA 4I4WB 3RWGB 5DS8A 3CDFA 2AXFA 4I13B 3W9DB 4K3GA 4K7PX 4RGND 3UJTL 2ZKHH 4PB9H 3UTTB 1XF4A 1RY7B 2XZCL 3CDGB 2X4PB 3FFCE 1B2WL 1U91B 5IB5B 3VFUB 3VD3A 4R7NA 1S78D 1L0YA 3MRIA 1M05B 4C58B 4UDUB 4HGMA 4NFCA 1FAIH 3RUGB 2CKBH 2EECA 4K8RH 3RTQA 1KB5H 5AWNH 5IFHL 2HVKA 25C8L 1KN2L 3VXSE 1R0AL 3MRNB 3PXJA 3QJFA 1ADQA 4BQ9A 1AXTH 4F7TA 1LILA 7FABL 1F90H 1P7QA 1AD0A 3NVQA 2YMXH 2WINA 4AIZA 2LU4A 1T5WA 3I9GH 3BFOA 1CXIA 1FNLA 1JV5A 3VXMB 2DQDL 2X4UA 4OFVA 4RGMC 4YR6B 1IGYA 4QTIL 5GGUB 1YN7A 4HS8L 5E6IB 3P77A 4F3FA 2W0FB 5C0BB 2F9BT 5KAQF 1Q72H 3TT1L 3PHQA 1D3CA 4I3SH 4P2QD 2OJEB 3O2DH 4LMQE 1BJ8A 3M8OH 4WTZG 4NFBA 3UDWA 5J7CC 2WBJD 4IOFD 2V2TA 1CFBA 3RY4A 3CUPB 2RFXA 3Q48A 5DO2C 1Z6JT 4E0RB 5KTEL 4P0DA 3SKJL 2QQKL 3TZVA 4P2RD 3OF6A 4ZUTA 3D1MC 3RIFF 5DC9B 5DR5H 4PJHB 4YGVA 4OCXH 4S2SA 3MRQA 2NW2A 1QLRB 1A3QA 4QRPE 1X9QA 3MV8E 3RGHA 4MD5B 3RDTA 4YHLL 3O0RH 1Y6NR 2X4TA 2Y5EA 4M1DL 5HVWA 3RA7L 4JDTH 4LSQH 5JOEA 2XTJB 1KPVA 5GGVL 1G0YR 1FFPA 5F7UA 4G6FB 1GH7A 4XNQB 1L0XA 3VD5A 1SM3H 1ERNA 2FDBP 1N6UA 2CDGA 1W72L 4K7PH 1NANH 2DQFB 4UIMB 4FQ1H 1LGVA 3MLTA 4GRLD 5CSBA 1F02I 4K9EH 5CD3A 4PGJA 3NACL 1L9NA 2E9BA 4NKIL 3OXSA 2CDEB 4OV5B 1TENA 12E8L 3DMMA 1FL5B 15C8H 1KEMH 2UUDK 5I76B 5I75C 2DKSA 5TFSL 1EJOL 4R96A 3EDEA 4XP5H 3LKRA 3S36X 2NXZB 1J1OH 5EOTB 1HINH 4CN6A 1H9VA 2VWEC 4PG9B 1HHGB 3SDDA 3A6CH 5D1QB 3DYPA 1ZT1B 5GSRB 4J7RA 5C0IA 3TJHD 1BZ9A 4L8DB 1OPGL 1LO3L 2GITB 3G04A 1UVQB 4KI5C 3O45B 5E9DB 1MFDL 1MELA 4CADA 2O5ZH 4KTEH 2Z8SA 1YPZB 4HXBH 3ZTJH 2R2HB 1OTSD 1NAKH 4MXQC 5AZEH 4JPWL 1BD2B 3KLAB 3HZKB 3GKWL 1MFEH 4DZBA 1LEIA 1YMME 1T1ZA 4MNQD 3GHBL 1MWAL 1Q8MA 3U4BH 3BP7A 3FMGH 3G6JE 5TJWK 1KF9B 2FBJH 3BP5B 1PY4A 4DAGH 1I7UA 4OCWH 3U46B 2YPKA 3L1OL 4NNXA 1IZJA 3C6SA 2VZ3A 2FEEI 3FKUS 2PR4L 3W11D 2FLRT 5DA0B 1A0QL 3MLRH 4OZGB 1H3XA 3TFKD 1J8HE 3FHAA 2CLRA 4EOWL 1AJ7L 1T2JA 2FZ3A 3L3DA 3SGJC 4AMKL 2IANB 2X1WL 4GW5A 3RGVC 1RK0B 3WBDA 1Q1JL 4E41B 5C0DB 4H25A 3GSNA 1IAOB 1VPOL 3F12B 4NSKB 3LSOA 4N0YH 4YK4B 5EA0H 3T3PF 4FA8A 3VG9B 5IMMA 4R4FH 1UYWH 1I3UA 2P5ED 3HMWH 2Z92B 1KPUB 4QRRD 2YD9A 5KJRL 3FB8A 1AKJA 3WIIH 4XBGB 2FJFA 4U1SB 2B1AL 4OKDA 1IGJB 3C5SB 5B8CB 4RGOL 4S10A 1S7WB 1EZVY 4NKDB 1DN2A 2EYRA 1LDPH 5EU4B 4AZ8A 5K59E 2HKFL 4KGJA 2NMSA 1YEGH 2YZ1A 1NFDE 1I9JL 2BHZA 1BGXL 3TO4B 3RWFB 4LCIL 1A9BB 2VH5L 5CCKL 4ZO7A 2Y07L 3S36H 4BFBD 1TJIH 3BISA 3VFGL 2XZQL 5F7DB 4PRIA 3P11L 5IB2B 3IU4H 3S5LG 3K0WA 2Y5TB 3U48A 4PRNA 4XVSL 5JMRA 3OB8A 4MXVF 4NZJA 3NIDE 4LEXH 3MYJB 3WXVH 1VENA 3CNKA 3EYVB 4MAYC 5EG6C 3LKOA 1MRCL 3KAAA 4RMSA 3G6AB 4LLWA 3BEVB 5F6HJ 3V9FA 1Z0NA 3SO3C 4X0KB 2GAZB 1G7JB 5CIPB 2VLKA 3VGGA 3IKCB 2YPLA 4Q9QH 1G7LB 4ZFZA 3O11A 4XAWL 2I9LA 2OL3H 1FZJA 4YGAB 2C3VA 3OZ9L 2EDFA 1MI5B 2AEPL 5DFVD 4HUVB 4XH2A 3QNZA 4J3XA 1CGSL 1U6AL 4WFHE 4YDLB 3SDXF 5JDSA 1U2HA 3RY6A 4JRYE 2APVA 3BN9D 5FDWA 3OKDA 4LSUH 4NQCD 4L3AA 1BEYL 1EO7A 1PKQA 1Y18A 4ENEC 2NTFB 3RZCD 4RBPH 4WVRA 4ZUUB 3SJVD 2J4WH 2HN7B 5I1DA 4M7ZB 1UKSA 4QXGL 2VDNL 4JR9L 1UENA 5SWZD 5INDB 3L3OB 1A2YA 1KNOA 3PQYA 5I16A 1DFBL 1XH3B 3ARWA 1EGJA 3UTTD 3T4YB 5DQJA 2XIDA 3EOAA 4TUJB 1N5AB 5EO0A 3PNWB 2PYFA 1JRHI 3FB6B 5AD0A 1K6QH 2LTQB 1OQOA 5F96L 3U9UB 5L88H 4L1DA 4LLMA 4NPYA 1BOYA 3HI1B 1W8NA 5TDNB 4RAVB 2DYPB 3NN8B 4XVJH 3UTQB 2H1PH 3DYMA 2ZKHL 3LMJH 3NBNA 4PB9L 1VSCA 3KPOA 2R9HD 3ARFD 4PS4H 3G5YA 4P3DB 3GMPA 5DS8B 3ZKXC 1JN6A 3TWCH 2AXFB 3Q6GH 5EORH 5IG7B 2F19H 1NCBH 1VEOA 1EEYA 4NQUA 5GS0C 4DEPB 4LGPB 1LP9F 3KXFE 1XF4B