5JHLL

Crystal structure of zika virus envelope protein in complex with a flavivirus broadly-protective antibody
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
211
structure length
211
Chain Sequence
b'FDIVMTQSQKFMSTSVGDRVSITCKASQHVGSAVAWYQQKPGQSPTLLIHSASNRYTGVPDRFTGSGSGTDFTLTISNIQSEDLADYFCQQYNSYPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords envelope protein
publication title Structures of the Zika Virus Envelope Protein and Its Complex with a Flavivirus Broadly Protective Antibody.
pubmed doi rcsb
source organism Zika virus
molecule tags Viral protein/immune system
total genus 47
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2016-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jhlL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jhlL01
4R2GC 3GSXA 3S37L 1NBQA 3EYSL 5C07A 4J12A 1QG3A 3AAZB 1OAKH 3HNSH 1ZHKB 4J4PD 4MJ4A 4PJ5E 4XP4L 3GI9H 3STLB 4EUPA 2RCSH 4Z7UA 1Y0LA 3WN5C 4BSVB 5DEFB 3TBWB 5DK3A 4GS7B 3JSSA 4JFYA 1AXSB 3G04A 4GG6A 3UYOD 1SY6H 3GEWB 5F3BB 2X6MA 4TNWF 3VCLA 3RDTB 3JTTB 1WAAA 1S7RA 1CFTB 1MWAL 2XOTA 1F90H 1HYSD 2ZUSA 3SY0A 3REVB 5HDBF 3HMXL 1DSFH 2DKUA 2HFEA 1ZV5A 1KV3A 2LQRA 3KXFA 4TSBH 2X70B 3RUGF 4HKBB 1N6UA 3O6FA 4UTBL 4KAQH 3ARBA 5I1JL 2DQIH 1U8KB 5FHBL 5SWQB 2D2OA 3CVHL 1A7RH 2DQDL 3QDHA 3VXOA 3C6LD 3NFSH 1J1OL 5EFIB 2Y06L 3ET9F 3NBNA 5AAWA 4KRPC 4NNXB 4XP1L 2Q8AL 1J0IA 1J1PH 3UROR 1J18A 3SGKC 1PZUB 4JRXA 1NKRA 3KLHC 1ZHNB 3RKDD 4WI8A 1S5IH 3HS0B 4GKZA 1CF8H 4HZAA 3RWGA 3UJTL 5ICYB 1HXYB 4H8WC 1LO3L 5BO1L 3WS3A 5GPRA 2J88H 4O51A 4LOUC 4WRLA 2RB8A 3EYOB 4R4ND 2V6HA 4YX2H 2JF1A 2VSCA 2XWBB 2ZKHH 1NBYA 3MLRL 4XI5D 5DJZA 3V6BR 1XGQA 3H3PH 4LVNC 1U41A 2NTFB 5JPNB 3BW9A 3VGBA 3ILQC 3EGSB 2XZQH 4X6CF 1MOEA 1T1ZA 4TQEL 3C2AH 4HBQA 3HLAB 4LPYA 1WIUA 4S2SA 4LRIC 2ZUVA 5F7HA 5BV7C 3SE4A 1FJ1A 5IVXA 4IRJA 1NAMB 5TE6L 3ULUC 1KSRA 5EDXA 3IFOA 1FVDA 4KKCC 3RWFA 3WKMH 1IC1A 5C0CB 2VJXA 4RBPK 2IQAB 4WO4B 3GSQB 1Q8MA 1K85A 2A73B 1BIHA 1ORQB 4KTEL 5D93C 3ULVF 5DMJB 3PP4H 2DI9A 4WW2F 5CJBA 1XZ0A 3TA3C 1HILA 1OSPL 3QH3A 3NACH 4KPHL 4D0CB 4U0QB 4WFEE 1CG9A 3BPLC 5IB4A 5EU3A 3HNVH 2GAZA 4HS8L 1MPAL 5K9KA 4N0YL 2BP3A 4P23C 4NC0B 1ZHBA 1PQZA 2RHEA 4X6DE 3L6FA 1KT2B 4LRNL 1EAPB 5CILH 2EC8A 3QUXB 4Z7UF 1KCKA 4DKAA 5J1SC 5CIPA 4I2XA 4QWWC 4WDIA 5T3XL 1CVSC 4JFDD 3G5ZA 1HSAB 2GT9A 4G8GA 1NEZA 3PJSA 2IJ0C 4X80L 5F89A 2ERJB 3T3MF 3EOYG 3WUWA 1WAAF 4QRSA 3WXVL 1FIGH 1RK0B 2VL5A 4NO0B 1I3VA 1OD7A 4DN3L 4YAQA 4U31A 5IEKA 3EJJX 4RFEA 2HT3D 1J10A 3BEWB 2F53D 1B4RA 2Z9TA 4GQ9H 5E8DH 2E9JA 4U6XB 1FZMA 1QA9A 4YDJB 3LKRB 5E6IB 3MV8D 2V5TA 25C8H 2DLGA 4RGMB 1MEXL 2IBGA 2BMKB 3DBXA 3L5XL 3V4PH 1I8LC 4DFHA 1RUAL 2C5DC 4DZBB 1EUUA 2FCBA 3DX7A 3MNWA 1OM3H 5ID0A 5JLZA 1ZT1B 2FH6A 1ZGLA 4XNZC 4R7DA 1LILA 3QDGA 4YR6A 2WQ8A 3UEZA 5ADPH 4Q2ZB 5K9QI 4I4WA 1CVRA 2O5XL 5MENB 4Y4KC 2UWEA 2EDOA 4JFHE 1IAOA 2H2SC 4OLXL 1LEIB 4PJGB 3GIZH 1R3KB 1EVTC 5L2JB 4NQDD 4TVPE 1H3UA 1NC4D 4OCRH 3NFPA 4Z5RA 5IKCA 2BERA 5C0DA 4UU9A 1G7JB 3QWOA 3PWVB 3SKOA 2VYRE 1YN6B 1NFKA 1AD0B 4FXKB 4P5TC 4NDMB 3V5HB 4HWEL 4OZHB 1KACB 5E24E 1A1MA 3WNMA 4Y19E 2QHRL 4JM2C 1FH5H 1AY1H 3ZHKA 1IGTB 4IM8A 1OL0A 1A6AB 2GJ6B 3BPCA 2OL3A 1FBIL 2O93L 1C08A 4LF3B 5DO2C 3DSNA 3K2UH 5IOPB 5C0GA 1G7IA 5EC2A 1ONQB 5ISZB 1EO8H 5CEZH 3RKPA 4KZDH 3ALPA 3CXDL 1OOAA 4PJ5A 4HK3N 5B4MD 1A6UH 1A4KB 3WL9A 5D71H 1EGJH 3GMPA 4G8EB 4PREB 2X1QA 4NGHL 3TH3T 5DJ8B 1BF2A 3T65B 3BHBB 4L8SA 4MD5A 3VH8G 1OHQA 1S7SA 2C4FU 2MSPA 5I1EH 4NP4H 1LE5A 1ADQL 4HCRA 3IVKB 4OIAA 1YEFH 3V4VH 2AKRB 1JNNH 4PTUA 3KPOA 4JFZL 1I1RA 5KSBB 2BSSB 5DVMA 2BOCB 3PWLA 4NO2B 4UTAH 3B5HA 3Q6FB 1C7SA 3LSOA 1MCEA 1F3JA 2CUIA 5F3HB 1FNHA 1QFHA 4PYHA 5LVEA 1MH5B 2DQCL 4XWGH 2VXSL 3VFRB 3WYRA 3KYOA 5J11C 1TMCB 3RWDB 4HUMB 2J12B 5D7LE 3LEYL 4M6NH 4EDXB 4CDHA 1NFDE 4ENEC 2PYEB 1A22B 3CNKA 1YPZB 3X14B 3HB3D 1KTLB 4PY7B 1VFBA 1MFNA 4KRMB 3PG2A 3QG6B 4JQVA 3VFPB 5JW5A 1A6PA 3MJ9A 1T1YB 5CEZD 4FNLL 1QKZH 4HUVB 3MYZA 4F33A 5MERB 1U8JA 4L8BB 4EN3B 3VE0A 3NCCB 1I9EA 2JK5B 1FGNL 2NY7H 3P30L 4I0KA 3U6RB 2VLKE 4MWFB 2UWEF 3HZVA 4H88H 1J05B 2C1OB 4JZJB 3SO3B 1S7TA 4JRYD 1N7MH 3BDYH 4L9LA 5T5FL 2ICEB 4KDTA 4XAWH 4KK8D 2DTSA 1OAUL 2V5SA 1B88A 1GRWA 3S3PA 5BVPL 4AK1A 1OARH 1XF3A 5GGRB 1NCWL 1Q9WA 3GGWB 4QTIH 2ADIB 4DOHB 3CFIC 4NC1E 1RURH 3LQAC 3WUZA 3MLXL 2X4NB 2UVEA 1HZHH 2HTKD 3HG1E 1JF1A 3SN6N 3ZLQC 1GVIA 3W9DB 3WFCL 3GSRB 4OD3H 3QG7H 5E7BA 3JV4B 2F8OA 3LV3A 4Q0XL 5C0EA 2IANE 4F7MB 5ADOH 3GBML 3CXHJ 2GFBB 3ROOB 1OCWL 1AXIB 5GJSH 4OUUB 3FQWA 3CK0H 3MXVH 5DQDH 2NY4C 4AIZB 3MZTA 1FORH 5KVEL 2IPKA 4ELME 5IBTL 4X6DA 5H37H 2Y7QB 1AO7E 4QRTB 4WUKL 3FCTA 5EIIB 5FK9B 3BXNA 2KZWA 4QXGL 3NABH 32C2A 3N85H 1P2CB 1WFOA 4OFYD 4OZGE 1TPXC 5LGJB 1GGCH 2V9TA 4NQCD 2DQHH 2Y07L 1RZKL 3OKKA 5DJDA 1BVLB 1UB5A 1CLYL 3H7LA 3IS0X 2YD1A 3EDFA 4D3CL 5TDOA 1TTUA 2XQYK 2W59A 3O3EA 1T7XA 2A77H 1JWSB 1PSKL 3KPQB 1JMZA 1I9IH 2XKNA 3O0RH 5DTFA 3HN3A 4K3JL 4NN6C 2OZ4A 1QSFD 3SDXE 3KR3H 3NA9H 3VXUE 1T83A 1NCUA 4NKDB 1HHKA 1ZKAA 1CE1H 5DMGC 5F88A 5T1DH 4PRPB 2V9RA 5E8NB 1F11B 2PXYB 2P24B 1U8PB 5E6ZA 3GFUA 5K93A 1RUKH 1AQKH 1I7ZA 2ZNXA 1KN2H 5ETUA 3RL2A 3JVGA 3LKSA 1P7QA 5LAXB 4ONFH 3VDCA 1AGEB 3HAEG 3WJLA 4YHLL 1II4E 3I6GA 5BS0E 3DUUA 1CDBA 5F97E 1EIBA 3VH8A 1K9TA 2HRPL 5E4EB 5EC1A 1T21B 1HKLH 2V2WA 5GS0H 1F02I 4OSUL 3OB0K 1NGZB 2C9AA 4LSSH 3KHOA 2APVA 3UTPE 1MCJA 1OAQH 3ARFA 1QVOA 3LEVH 4PJIE 4KQ4L 3GMOA 4Y19A 3LH2H 4ZUVA 4J3UA 3C09C 3NFNA 3T4AB 1G9EA 3BGFB 4XP5L 4NRXB 1ZLSL 1MJ8L 4DW2H 4U1LA 4HEPG 5E99H 4XTRC 4H1LG 3BP7A 5DSCB 4F9PA 1UC6A 3LN4A 5DD0H 2VB5A 1FHGA 4KROD 1EHLH 3GMNA 3CH1A 4G8IB 2ICCA 4YC2C 2P47B 4KKBD 5E7FA 5B8CB 5FECA 4IIQB 2ZOKB 4YPGA 1LO0L 4P46A 5EBMB 1FDLH 5DJCA 3SPVA 5SX5K 2BY2A 2CO6B 1OF2B 1EFXD 1N64H 2I9LA 3VGHA 4LNRA 3MCKA 4ZUTA 1JPGA 1HWHB 1Y18B 3SGJC 1OQOA 4QLRA 1QBLL 5D7SH 2QL1A 5L7XH 2DM7A 1I9JL 4PJFA 4WWKC 4LKXB 4X6DF 4Q6IC 4AIXA 4NKQB 3IJHA 3QUYD 4M61A 1JGDA 3RY6C 1F4WL 3SCMB 2XV6B 5IJVA 5GS0D 1LK3L 4G7YL 4ZFZA 2FR4A 4F15B 4HIXL 2R9HD 1GPOH 4PJEE 5L9DL 1JGLH 5C2BL 4QT5B 1XGRB 4BZ2H 4PB9H 2FHFA 4QCIB 2Z31B 5D1ZA 1NFDA 4YHNA 4KDWA 1Z0MA 4ZFOL 4ETYA 1T2JA 1QFUH 1ZS8A 5EPMA 5T5NG 1U95B 3MOQA 5FDWA 3QI9A 1MWAB 4U3HA 3WFEH 4PR5B 4GRLD 1FE8L 3VXPB 4WHCA 2W65A 2J8UE 2ZCHL 3O2DA 4O2FB 1I1CA 1XF1A 2VH5H 1AHWA 3TP4A 5DUBA 3U83A 1ED3A 2VLKA 1Q9KA 1T1WA 3S5LG 2H3NB 5CHNA 1MLCA 5DJ0A 3FQNA 4JZNA 1WEJL 3GJEB 4MA1B 2XG4A 1NGQH 3CVHB 3M8OH 3QDMD 4WJ5A 4HS6B 4UV7L 4WFHD 1A1NA 5AG9A 5FKAB 1JTTA 3MLTB 3BKCH 2Y9RT 1S7XA 1X5KA 4OZFB 3O11B 2V7NB 4X83A 1T0PB 5ACZB 3BZEB 4KKAC 3MYJB 4PJDA 4XNUL 3HG1A 3P0GB 1ZHLA 2Y25A 3QUZC 5GGSY 3KWWB 1JRHI 2XKUA 3LPWA 4O2EA 5BRZD 1TXKA 2IANA 4P2OD 3VD7A 3FB7B 4U6VL 3BAEH 3QIWD 4APQC 4P57A 1PG7H 4ODUA 1MQKH 4ELMA 3UPCA 2Z8SA 5JW3H 4NZTL 1E27B 3UC0H 4H25B 3ARED 3HAEA 1AO7A 4Z7VE 5I2IB 1P6AB 3FRUA 4P9MH 5LWYL 4U05A 1V5JA 3S7GA 1GZQB 5JXAH 4OZGA 2P7TA 4X0KB 4Z0BL 3UTZB 1I7RB 4NN7B 3IDXH 2APWA 2DDQL 3ZZ1A 1WGOA 1FL3A 4F9LC 4UNVA 5GS1A 1TTGA 2R56H 2EDYA 3QA3B 1LEKA 4Z9KB 3BD4A 1WCBA 1WZMA 3EFDH 4WGWB 1YECL 2LV4A 5BCAA 4GBXD 4JKPH 4IJ3B 3HR5A 4ZSOE 5EO1A 4PJFF 5I19H 4HX1B 4D0DA 2FEDD 5AYUL 3VXUA 3CFBB 1XR8B 3C5JA 4H1LA 4LARL 1KTKE 3M45A 3ALXA 1WT5A 3RP1A 4OLUL 1T89C 1KEML 3U4AA 3VWJB 5F7DA 1XEDA 1I3GH 1T2XA 1OGTA 1V7MH 4W6XB 3V5KA 2OR8A 2R69H 4QRRD 5DUMH 4H0HB 1X4XA 3PNWB 4OBSA 4P0DA 3UBXA 1JZ2A 5IW6A 3S36X 4JFFA 5DJ2B 4Q97A 1BQHG 1DQDH 4YDIH 3D3VE 1KB9K 5JQHC 1MRDL 5GQBA 3RWCA 1BQLH 1SBSL 1LGVA 2ORBL 2YPKB 2P8PB 4HLJA 4RQQB 6FABH 2FH8A 2IG2H 4POZC 1FYTD 4Q74A 2HVJB 1CD1B 4X7TA 4PJIA 4WI6A 5F7UA 5I30H 3C8HA 3RIFF 4P5MB 3GRWH 3JV6A 3H3BC 4KJQD 2ED8A 4KK9C 4CN6A 4IMKC 4M48H 1CZ8L 3C60A 3QEGL 3RDTC 1MRFH 4JFDE 3T3PF 5EO9A 5J56B 5CP3A 5BVJB 4L3EB 3B3IB 2ZCKL 3GO1H 3M17A 1DLFH 1OSZA 1YEDB 5DT1H 5EU6E 5IVOA 2VAJA 1IEAA 4MVBC 4P4RB 3EOBA 4BA8A 2NMSA 4RZCA 2F53E 2EICA 3BE1H 3TLRA 3WDIA 3QPQD 5DC9B 4D94A 3B6SA 3W0WB 5HBBA 4Z95L 4LGRB 2E6QA 1GAFL 2X4UA 3MV8E 4FQQA 4OFDA 4K3HA 4PJDF 5HHMD 5F8RC 4YPJA 4OM1L 3RU8L 1JP5A 1QRNB 4N1CA 1S7QB 4MX7B 2CK0L 2EDXA 4UOW0 5SX4H 4LLYB 1QFWI 3N1GC 4Y2DA 3VXRD 4HKZB 1BM3H 1MVFA 3SE9H 2AEQH 2IPTH 2B4CC 2P5ED 3MLZL 3P9WB 3S5LA 3H42L 3QCUL 3QJHB 4XP9L 2FJFB 1CK0H 2EDDA 4ELMF 4FG6C 1KB5B 3G6JB 4X4ME 43CAB 1NCNA 4NQDE 2AXFB 1EXUA 2PTVA 3LMJH 3I9GH 1JNLL 1XGPA 2B7DT 3IKKA 1KNOA 4IDLA 2PR4L 4X7CC 1GIGH 3TIDB 4FQCL 4TVSa 4OZGF 2EYSB 1JPSH 4PJEA 3BGAA 5HHOB 5JPMA 3GMQA 5CJOL 1FZJB 3RVUC 4QRUA 5F9JB 1TJGH 1JHTA 1JPTL 2OJEB 1F8TL 5HGBB 1FCGA 3HI5H 4XNQB 5DJYB 3DIFA 1MHHB 4I18A 3D0VB 4QNPE 1JZ3A 1CN4A 5HDQL 1AGCA 1HH6A 1TDQA 4PLJD 1LMKA 3RPIB 1AKJD 3OTTA 4M93B 4ELKA 1EEUA 1RIUH 5K33A 3RL1B 3SKMB 1CTOA 1O7SA 5I1DB 2EYRA 5GGRY 3TWCL 3DWTA 1IAIH 3KYKH 1GL4B 4YQXL 5SV4A 2IBZY 4KJWD 2FJGB 4WO4C 4DN4H 2E9BA 2VXUL 1DFBL 4J4PA 4FQHB 1MCFA 2C3HA 3JWOH 4QHNA 4KGJA 4NYLB 2ITDA 1G0DA 4MAYB 3DV4A 4LLMB 1WWCA 3NMEA 2VMFA 1CFNB 2A74B 4E5XA 5I1CH 4EI6A 1EHAA 2F19L 3AM8A 3SDAB 1I1FA 3BJ91 3KPRB 4G8FB 5TDPA 4TULH 3LPFA 3ECBB 3WNKA 5CGYD 1LDPH 2VXQL 1PX3A 1V7NH 5DA0B 4TOYH 2HH0L 3VDBA 4PJIF 1MCRA 4F3FA 5JW4N 3GI8L 2NX5B 4OLYL 3WIIL 3IXTA 3VFUA 1F4HA 1H8NA 2YZ1A 3FB8A 2A0LD 2ERJC 4L3CA 1DQJB 4ZXBD 3C6LA 4HDIA 2A1WL 1MAML 4PJXE 1S8DB 3MRPA 1NCTA 4YO0A 5DJ6B 5E1AB 3SBWA 5D6CB 4O5LH 3NPZB 3K8LA 2HJFB 3D39B 1JZ4A 3IT8D 5E6IC 5LGHL 5D7LB 5BOPA 4RGMC 3MV9D 1WBZA 3RZCD 1NCBH 4Y16D 3TC9A 2X05A 1LVEA 1BQHA 1MCCA 2D31B 2NY2B 5T5NF 4PJBB 3LZFL 5CEZE 1DR9A 4HWBA 1RULL 3HC3H 2A6DA 4UOJA 2AV1A 1U58B 5T1LD 4MDJA 3KNBB 1RJZA 4BKLB 4G7VH 3NIFE 5JO5B 1IL1B 4TUJA 1A4JA 3ILPA 3KYMB 3LQZA 4H8WH 5J7CC 1FNSH 1SY6A 1BFOB 2OTWA 4JRYE 2DJUA 1MHCA 4R2GD 2VC2H 2R2CA 1U8HA 3LVEA 1K4CA 3FTGA 2I60L 4MNHB 2QKIA 1K2DA 2E7MA 4EIZC 1ZT7A 4U3CA 1J8HE 2KPNA 4MD0A 5DK2A 1AGBA 1KCSH 5FCSH 2R2BA 5A2IH 4PJEF 5EN2A 2EDEA 5H94B 1QFWL 1U36A 3LKQA 2ZSVB 2QQKL 2AEPL 4Y5VA 5BV7H 4R4FL 2W38A 3ISWA 1RIHL 1P4IL 4C57C 1KIUA 5FO9B 3ULUH 4N8VA 2ZG3A 2PW1B 4OGAC 5F9DC 4E42B 4JANB 1ZT4A 3D85D 5IFAH 1A0QL 1JCKA 1NMAL 3STZA 5MEQA 5T1MA 2AK1H 2YD9A 15C8L 3CUPB 3TEUA 1YQVH 2ED7A 3H9YA 4HGMA 2B5IB 2FGWL 3ARTA 1WV7T 3G6DH 3N1QC 3ARZA 5F1IB 5SWSB 4EKXA 4I9WD 4JFDA 4NQCE 5I66B 2IFFL 4KRPD 3BDBA 1LO5A 5CINL 4DKDC 4ODHH 2HJKA 1T0MB 5D6DC 4CVXA 2IPUK 5EZJB 1YC7A 2HJLA 3DUSB 4MDIB 4M5ZL 2F53A 1A2YB 4NPYB 1A7NL 5TH2B 3TT3H 4H0GA 1VKXB 4LOUD 3PQYD 5C0RH 3X3GL 4X9HA 5DRNB 3MV7B 3KPTA 4X9FA 4HC1H 1IBGH 1QSFE 3CDGA 1NL0H 2VN4A 2Z4QA 2N7AA 3FO9B 3UYPA 4P4KB 1K5NA 1ROWA 1FSKB 3ILQD 1FVEB 4GW4B 9CGTA 5E4IA 1GSMA 2R29L 3V6OA 1RIVH 2EDLA 4LP4A 4X4MA 2BFVL 5JHDD 1VHPA 4OV5A 1HHJA 4NQDA 1NC4A 1MCLA 3DOSA 1F3RB 1FPTH 3ULUD 1N5AA 4KKCD 2ZCLL 4K94C 4EN3C 4IBLT 4XPBH 4RWHA 2FO4B 4JVWA 1BD2B 2I07A 4WU5B 4JZJC 1HOCA 4ZOBA 4ZDHB 3SO3C 3TBSA 1WZLA 2VXVL 4DKEH 2EH8H 2N4IA 4RWYH 1DUYB 2FYYA 4ZUSB 3QEUB 1BREA 5TPWH 5KOVC 2DYPD 3FT4A 5JMRA 1U93B 3U4EB 2BDNL 4U6YB 4JPKL 1DBJH 5KN5A 4ORGA 1JF5A 2CMRH 4ODVL 2D4DA 1MY7A 1P4LB 4ZS7L 2AS5M 3VW3H 4QWWD 2VQ1A 4EBQL 3BVNB 4U1JB 2CLVB 1JYWA 5TF1L 3PL6D 1RY7B 3CFDB 4WHTB 3BFOA 3MOAH 5H35A 4FQXB 4G9FB 3WLWC 5E08H 3ES6A 3WD5H 5ESAA 4RAHA 2ZSWA 4YIQA 4V2BA 2NZIA 4D9QD 4HKJB 2BRRH 4GUPA 5I16A 1UENA 2JCCB 2BVOA 1G7LA 4PUBL 2YPLB 5H37G 5A16B 3T2OA 1N3NA 2VDLL 4ZFOB 5BQ7B 3MRCB 3TF7C 4HKXB 3S37X 2XTJB 5ITFB 2CKBL 4F58L 2HMIC 3MOBH 3TPUA 3K81A 2ARJA 1RZ8B 2XG5A 4LHUB 4XVUC 2H8PB 4Y4KD 1U8QA 2H2SD 3ROLA 5AAMA 4LHJB 3ORJA 4Z76B 3MNZB 1UH2A 4XNXL 2FWOA 3GSOA 4OKVA 5TE7H 1M4KA 2AGJH 4KV5E 5E8EB 4XRCB 1NMCB 4CAGA 1RI8A 3HRPA 2DWEB 5CD5C 3UZVB 2ZUUA 4QHLB 4ONGL 4ZO8A 3GMRA 4P5TD 2NR6C 1YQ2A 4HUKB 1WC7B 2A9MH 2PXYC 4A6YA 1I1AB 3DO7A 3BIKB 4JM2D 2UYLA 2VISB 2RIKA 5I8OL 4M00A 1EGJA 3OZ9H 4UT9L 1CXLA 5D5MB 5F21B 5DO2D 4HCRL 1WSST 5E4EC 3QDME 4JRYA 5JR1L 4WFHE 1YEHL 3MO1B 3RNKA 1ZLUK 1MHPH 3Q1SL 3SDDB 1U8NB 2Y5TB 3OAZH 4JFEB 2Z35B 1U6AH 4JQXC 3TFKC 1NC2D 4XMLH 4WU7B 4LDEB 4G6KL 4U7SA 3U30C 3D2UD 3BGFC 4Y5YB 1VADB 4HZLA 4J8RA 2EEAA 4TPRL 2BOBA 1F13A 3QJFB 2W07A 3DX9A 1FLTX 4I3SH 5B39G 1KJ2L 2A2QT 1N4XL 5BRZE 2R4SL 3CLEL 4PRDA 3WMSA 4JO2H 5B8CC 3B9VA 3RWHB 2DQUL 3VXMD 4IIQC 3LQAH 3F6IA 4OQTH 4YNYA 4OT1H 5SWZD 1KXTB 4JGMA 2O5YL 3GMLA 4HH8A 5IW3A 2GUOB 4LEOA 3D18A 3QCTH 1CE6A 3B2VL 2PKDA 2ENSA 1T0NB 4NQCA 3F65A 2AJYL 3LS5H 3L3IB 3C08H 1A14L 5TFSH 1M1SA 4XXCA 4GAFB 5IHUL 1YMMD 1IT9H 1EEYB 1PEWA 1NGPH 5I71B 4R8WH 2BSRA 5IEHA 4PLNC 3E2HB 2AJVH 4JPIA 2VDNH 4TRPH 1P9MC 4LSRL 1D6VH 3LN5B 4KJYB 3SCMC 4LSPL 1QSFA 4F15C 5DZNA 5DRWB 3OR6B 1A3RL 2C7UB 3MC0A 2NCMA 1R5WA 2V17L 3CVIH 2Z31C 5FYKU 1RQ5A 3RAJH 4PJ7E 4QHKI 4QRRE 3DI3B 3D25A 4Y8DC 1LP9B 4XBPB 3GB7B 2EDNA 2OXGA 4N0RA 5KG9B 2EDTA 1RZFL 2B0SH 5HJ3A 3BRFA 4MNGB 5SX4I 4MLIA 2AV7B 2DI7A 3PABB 5ESQA 5FHAL 1WISA 1VFAB 4MA8H 3N0PB 3QDJB 3L3HB 3O6MH 5DS8A 3D3VB 3MGAA 1FYTE 3WHXA 2Z8RA 2HWZL 5EOQH 2MPAH 1ZSDA 3L7EB 3GNML 3RIAK 3TO4B 3LKPB 3OJ2C 4MA1C 1NLBL 1AXTL 1LQSR 2X1XR 3UTQB 4JKMA 3MBEB 3NIFF 2R0KH 4R7NB 5AWNL 1YEEH 4EOWL 4UDTA 2IWGA 3U9PL 3ZTNL 1OPGH 2YEZB 3ZYIA 2V2TB 5DJXB 3H9SE 5JORA 2NY4D 1KTDB 3OKYA 1WLHA 5FM8A 1W8NA 2X4QB 2WW8A 3QUML 4U1KB 3D0LB 2F74B 3HPLB 4K23L 3GKWL 3SJVD 1YNLH 4HWZA 1I8KA 1U8LA 5HHME 4NKIL 1IM9B 1T20A 2PCPB 1J1XH 4PJHB 4X7SL 1H9VA 1EFXA 2CR6A 4I48B 2P8LB 3SKUD 4DGVH 3H7BB 1FFOB 2FJHA 1SMOA 2GTWA 3G6AB 3U1SH 4OF6A 1HHIA 2IH3A 3T77A 4MJ5A 2P5EE 1A3LL 1DUZB 5GZOC 4FA8A 5DURB 2K7PA 2YD4A 3KYAA 1SVCP 5DMGD 3QUYA 3OF6D 5FKPB 3BISA 4NN7C 2XPGB 3EOAB 4JHBA 3FFCD 2C4FT 5C8JB 2Q6WB 5FAAA 2Z0BA 4WEUD 2EDFA 1UZ8A 1MJ7H 2VLRB 3U4BH 5E6YA 5F1NA 5L2KB 5ELIA 3TBYA 4CDGC 4IJ3C 1QNZH 2CK2A 4GW1A 2CIKB 2X40A 1U2CA 4RGNB 3MLUL 1R3IL 1J0KA 4UIKH 1OT2A 3BMVA 1MI5D 2A6IA 4O9HL 5B39A 4X6CB 1RU9H 2XTLA 2OLDA 4UOW1 2YD7A 4GRLA 3VWJC 3MREB 5IMMB 4ZFGH 1CQYA 5EH1A 4EI5B 3K1KC 4FQ1L 1RVFH 2BJML 1SJHB 3GHBH 1CGSH 1TIUA 2Z8VC 4AZ8A 1A7QH 3QAZB 4YGAB 2DM2A 4GRWH 2FL5B 3QULA 5TDNB 2VQTA 35C8L 4IDJH 4UAOB 4WV1B 2CQVA 5T33H 5ECJE 5DFVC 4XTRD 3X13A 5FB8A 4C56D 5FGBA 3QDMA 3O4LB 3BEVB 1CGVA 4EVNB 2NZ9D 3EYUH 2IC2A 1TZGL 4CADA 3VGAB 3E6HB 4FQLL 2YK1H 2ICWI 3SO5A 1CFVH 3F58H 3EOTH 1KC5H 1QR1B 1KG0B 4GAJH 5IMOB 4M02A 1Q0YL 2BCKB 4JM4L 3VU2A 2V2XA 5I1HH 4MQTB 3QPXL 3MFFB 5BRZA 1BLNA 3U2SA 1Q9LB 4P2OA 4J23A 3TJHC 3QYCA 3JWDL 1ZWIA 1A8JH 4AMKH 3C6SB 2EE9A 4XNYL 4U6TA 4EEEA 4X6BA 3QIWA 4MJ2A 5A2KH 3LEXA 1T5XA 2ZJSL 4MAUL 4WWKD 4M7LL 1NEUA 1KIRA 1YYLL 4GFTB 5I8KL 4LSVL 3CLFH 1G9NH 3R0NA 3SY0B 2HG5B 3AREA 3QUKB 2YXFA 1P7KA 2HFEB 1CXFA 3BSZL 2WINB 3U46A 3KXFB 2GK0A 2YUVA 4MA3B 1JGEA 4IMLA 3OG6B 1GCFA 3ARBB 3G08A 2YHGA 1IGMH 1WIPA 1FG2B 3OR7B 5FYJL 3VXOB 4OIBA 4PJAE 3W82A 1D5MA 1ACZA 5E5MA 4GBXA 5C70A 2ADFL 4WUUD 3TN0B 4XHQA 3IS1X 3RX8A 2KUTA 1T22A 5ALCH 1C12B 4PPTA 3CC5A 1T5WA 3KPSB 1J87A 4HUUA 1ZA3A 1W0WA 4GKZB 3I50L 5IVNA 3P3YA 2V5YA 5F96L 3DRTA 43C9A 3WS3B 1UWXK 4O51B 1MNUL 1IAKB 2WLZA 1JV5B 1CDGA 5E1HB 2DBLL 4QRRA 1BWMA 1NBYB 5C0AD 1VEMA 4LCWD 3P77A 4P5KA 1UKQA 1ND0A 5FUCC 1CDJA 4JPWH 3S97C 3TGXA 3OB8A 3BW9B 2H9GB 3QHZL 1MCPL 1A6ZB 4ZTPL 5GHWL 3IETA 1T1ZB 4L4TD 1HHHA 3MRDA 1R24B 1YEIH 4JHWL 1FYTA 5IGXH 2R2HA 4IHOB 3U0PA 4KKAD 3VFGL 4ALAL 3I85A 3VRJA 4GRMA 3MRKA 4IRJB 3OHXB 3QUZD 4MAYC 3B43A 1FVDB 5EOCL 1FIEA 1WZKA 3TYGL 5CFHA 3GSNL 2EEBA 2WK2A 4JN2B 1W2KT 4YDKL 5D2LE 1H0DB 3SDAC 5E2WH 4APQD 2EXYC 3BKMH 3FO0L 1IGFH 1DE4A 4PBWD 1OB1A 4M7KH 1CGTA 3IDNB 1D6EB 2VABA 2EDJA 2X1PA 4OJFH 1U8IB 4AH2A 3N50A 3MODH 3VRLE 3L6FB 2XNAA 3HZMA 4KY1H 1N2RB 3J8F7 2VNCA 3VXRA 4I2XB 5EBGA 2Y23A 1RZ7H 3HE6D 1XIWA 1QO3B 4LPTA 4HFUL 2GTZA 3U7YL 1KFAH 4HXBH 1NEZB 2MTPA 3PJSB 2P5EA 3AY4C 3RWIA 4BJLA 4K9EL 1FRGL 2VL5B 4ODWA 4PGCA 2OK0L 2WUBH 4N5EC 5JHDE 5FYKE 2NY2C 4U1MB 1R5VB 5AEAA 1IC7H 3QXDA 3UMTA 3ULUE 3S35H 5HHVH 4AEFA 4RMQA 4ZS6D 5FCUL 3BKYL 3EZ8A 2B4CH 2CRIA 4R3SB 3DBXB 4FP8H 4HIJB 4PIRF 5ENWA 5INCB 3IGAA 3O2WL 3TT1L 1IGYA 1A6TA 3NPSB 2XKSA 2GW5A 4NKMA 4F2MA 4MJID 1G84A 5GJTH 1RD6A 2PN5A 1YYML 2EIDA 1F58L 4I4WB 5FV2A 4I5BA 3EYVB 5MEOB 1JGVH 1E6OH 1IAOB 3MRQA 4NZDA 4YXHL 2PTTB 4AG4H 1AKJA 1JF6A 4POZD 5EU4A 2D7OA 4LBEB 1N8ZA 3MGOB 2KH2B 1MJUL 12E8H 4RCAA 5FXCH 4KVNH 3U0WH 3R1GL 4QXUH 5IKCB 5C0JA 4K8RL 4UU9B 4KK9D 4Y1AB 2XFXA 3WXWL 5EU5A 1Q94B 5J89A 4FTVD 4M43H 1ZGLM 4NC1C 2YWZA 3OX8B 2CKBB 4D2NA 1I3RA 1O7VA 1RZKC 4TUOA 1A1MB 1XH3A 2FSEB 1NAMH 2G9HB 4MVBD 5HI5D 3MBXL 5IIEA 1ULVA 4L8DA 1M71A 3VI3E 1V05A 3IDIA 4GMTH 1MLBB 1HH9A 4D9QE 4UILL 5JHLL 3LHPL 3WFDH 1TENA 5EC2B 4JFQA 4XPGL 2I9TB 4X8JA 2F9BT 4J6RL 4P2YA 3CFKA 1RMFL 5IHZB 3PWNA 3EJZC 1L6XA 4ZXBA 1L7IH 4LSTH 2CKNA 3RVVC 5F9OL 1WVZA 2Q76A 4HBCL 3CZFA 4QOKB 4PB0H 5KVDL 4FG6D 5K9OA 1K6QL 3ZL4L 3VFMA 1IGIH 3NVQA 5DWUH 2K7QA 1T4KB 3BH9A 1INDL 3K4DA 3MV9A 3RZCA 5DC0A 4Y16A 4YEFA 4OGXH 3TO2B 1CXIA 1FGVL 1MJJA 4PTUB 3ARRA 3O45A 3TYFB 4GXVL 2E9WA 4P4KC 4JY6B 2GJZA 1FSKC 3RVUD 1F3JB 4F37F 4EJ1C 2AI0L 4RIRB 1UA6H 5T1LA 5C7XH 1HI6A 1CL7L 1ZVSA 1JL8A 4XX1E 2PETA 2EC9U 5D96B 3I02A 5ACLA 2OSLA 1GGIL 4PJ8B 5HYSG 1QBMH 1KJ2B 4OM0H 2VKWA 3X12A 1NDMA 2FX7H 1VGEH 2D0HA 5E8OB 4WO4D 1VFBB 1L7TH 1I7UA 4Y4HB 5FO8A 3QXAB 4QXWA 3WN5A 5JW5B 2W9EH 3CSYB 5DUPL 2PTUA 4M7JL 1XCTA 4RFOH 3O9WB 4IRSB 1QZ1A 4NWUL 4CMMB 3HZVB 1ES0A 4NZRL 4DTGH 4XNMB 5I75B 5J4MA 4NRYA 3GUTA 5IK3B 3MRHA 2CPCA 4HXAH 5JZ7C 3D85A 1CXHA 4XC1L 1AJ7H 5HGDA 3VXME 2LE9A 4ZTOL 4FFYL 1KJMB 4X4YB 3HMWH 4LASH 4HWBL 1SVZA 1TQCB 1XF3B 2VKXA 3DTXB 4FQXC 4XX1G 1Q9WB 4NO0D 2EIZA 4C55A 1T1XB 3GI9L 3HC4L 1IEHA 3HI6L 2MCPH 2DQFA 2WWKT 4FMFA 5EUKA 5TQ2H 5CBEA 3HUJE 1T3FA 3N06B 3P0YL 3SGKA 3RNQA 3QIBC 5B3JF 1YMME 5E6ID 4JDVB 4Z7NE 3GSUA 2MQ3A 1UFUA 2ICWA 4M1DL 8FABB 2XTJC 1FAIH 4PGEB 1AIFB 4MB5A 4Z8FH 5AZ2H 3FQWB 5BMFL 3P11L 3PQYA 5I1LA 3QEHA 2IPKB 4XP6H 1C16A 3D1MC 1K8DA 5MEND 3F6LA 4WEBH 4XVTH 1G1YA 3RVTC 1X5LA 5DF0A 4PGBB 3JTSB 1A7RL 1TNMA 3OKKB 1XF4A 1NQBA 3W9EB 1NMCC 4OFVA 4TYUA 2DJSA 1UB5B 1DN0B 4NWTH 2VWEC 4AM0B 4D8PB 4XCFL 3VDAA 5I1AA 2X4RB 2NW3B 2AJSH 5JHDA 4HJ0C 1DBBH 4LRIA 5TDOB 2R2EA 4BH8A 4UT7H 4S1RH 5KTEH 4HWNA 2R0ZH 4KMTH 3O3EB 5FUOH 1I1AC 3OGOE 3PGCA 2F8XC 3BP4A 3V6FA 2QADB 5HGHA 5DTFB 3VD4A 1TJIL 1GZPB 3B83A 2GJ6D 3KS0J 3QUMB 5F88B 3OJVC 2P43B 5GRZA 1FYHB 4K7PY 3FO1A 1Z2KA 3T2PA 4NOFA 2VDOL 1BZ7A 5F7FA 4JPVL 4JREB 5ISZD 4JFOA 4ODSL 3V7MA 3SDDC 4OGAD 2DYPA 4WHYH 1IFHL 4K94H 3TNNB 5JDSB 2BSTA 2DLEA 2QQLL 2D03H 3D9AH 1YUHA 2A9NL 1JK8A 4Y5YC 2F5BL 2A6KA 4DCQA 1T6WA 2C26A 1GGUA 1BGXH 2BNRB 1ETZA 3DVGA 3O3DA 4KK5C 3IAQA 3ZKQD 3PL6A 1HE7A 4RISH 4HC1A 1KLGA 2BNQD 2CXKA 4XPFH 3DSFL 4LSQL 5INDA 4NHUB 1ITBB 4XPTH 3CFEA 3WDHA 1G1CA 1LE9A 5ICZB 5D7IE 3PP4L 3Q3GB 3VG0H 5TE4L 5L88L 1AE6L 3LN4B 3NACL 2FDBP 1CD9B 5EUOA 3IU3A 5HYSA 5DVNA 1WFNA 3CH1B 3HNVL 3SEPA 1D9KB 4S1QL 3KGRA 3ARDB 3MUHL 4JO4L 3VXTB 3FFCE 2VXTL 2VO5A 2GSIA 4F7CA 4NQTA 1QLRB 2XA8H 1ZAGA 4Y4KA 4O58L 5I71C 1UB6A 4P46B 1UWEL 2G60H 3WBDA 3E2HC 5IQ9B 3QRGL 1INEL 1YNKH 1JPFA 5F93C 3CDFA 1NMBH 1UWGH 3MCKB 4LNRB 4ZUTB 1I8IA 3REWB 4R26L 1HQ4B 5GRUL 5D70L 4QHUA 5JNYB 3RTQB 4Z7OE 1GOHA 2GYSA 2W0PA 1MI5E 1ZTXL 3EBAA 4RBPH 4EN3D 3VRLF 4PJFB 4P5TA 1YN7B 4JO1H 4M61B 1QACA 3TCLB 3K4ZA 2WLYA 1IILE 3TJEH 5CD3A 4JM2A 4BZ1H 3HPJB 2G2RA 4DK3A 2YS4A 1KCUL 3IKCB 5A2JH 3DROA 2P44B 5ADPL 2UZIL 2IFGA 5JTWA 1KXQE 3C87A 1I85A 4X99A 2G5BA 5FYLH 4PP1C 4AT6A 1YY8A 2D9QB 4K2UH 1NGYA 4NBXB 3ULUF 5E94A 3QDAA 1G7PA 1NC2A 3TBTB 5IQ7H 1R0AH 4FZ8L 1MFEL 3TO4C 3FOLA 3OKEA 1C5CL 1UACH 4W81A 3CIQA 3D2UA 1OLZA 2Y5EA 3MBEC 1CBVL 1KXVC 3T2QA 2IH1B 1YNTB 3IDYB 3LY6A 5IBUG 5AD0A 5KSUB 3MA9L 5E9DB 1KPVB 3WLWD 1TCRA 2DLHA 3CX2A 4NSKA 4RMVA 2P4AB 2P49B 1DN2A 3KPPB 5KSAB 1ED3B 5FOJA 1Q9KB 1FH5L 5CHNB 5CJQH 5CP7A 1KIQB 3EUUA 4F8TA 1X6NA 1HINH 1Q9OA 3M1BB 3VXMA 4PRNB 1A1NB 1FN4B 5SWZA 2HMID 4A6YL 2QJDA 4KZDL 1A9BB 2FGZA 1SM3L 1JFQH 1NCDL 4WW1A 4GLRH 4LU5H 4XVUD 4LCYA 3FT3A 1EMTL 2YRLA 1Y6KR 3X3FH 4YJZL 3VFVA 4P3CL 5JOFA 3V7AE 1YMMA 4BH7B 2FB4L 1ZEAL 4O2EB 1MFAH 1CYGA 4GRWE 5EZOH 5CD5D 2X42A 3H2WA 1DQMH 5FIEA 2ZOLB 2HTLC 3MLSH 4PRPD 3K0WA 4WUUE 4P57B 4KMLB 1YEFL 5EUOF 2NR6D 1GC1C 1SEBA 4YXLL 2PXYD 2YN5A 5JIPA 4UDUA 1C5BL 5GGUA 2MKWA 4S1SH 1XFPA 4TSAH 4Z7WE 4DWHA 1NANI 3BPNB 3FQRA 2P7TB 5ITBH 1ZA6A 3DI2B 3NGBB 4OCXH 2FD6L 4XWGL 1UXWB 4RGNC 5HVHB 3RWEB 3BP5A 1D5XA 1FL3B 2OJZH 4K3EH 1UT9A 3GSNB 1HNGA 1D5IL 4RMSA 5C0AE 1IC4L 4G42A 1MUJB 3S37H 3TFKD 2IALA 2FHCA 3EYSH 4MCYA 5A1AA 2VUOA 5SV3A 2NNAB 4L4TE 1LD9B 2E7CA 3MRJB 4XPHH 3HHRB 3V7AG 1S7UA 3QAZC 3QQ3B 4JM2F 4JZOA 1X5ZA 4WV1C 1QKZL 1PGRB 4R96B 3ZT5A 1MWAH 2HKFL 3MNVB 1M05A 4ZPVA 4LLVA 3ZDZE 3HMXH 4H88L 2DLFL 3F7RA 1UGNA 3VGAC 3UBXB 2X89D 3KYNA 2ATKA 2X2YA 4OF7A 4QHMA 4UTBH 4JJHA 4JFFB 1B0RA 1A6VL 5I1JH 5FHBH 1JUFB 2IADA 2NY5L 3RWCB 3L3KA 5I8EA 3CVHH 1RZIA 2DQDH 3MR9B 1G7HA 1J1OH 3IDJB 2IAMB 3SJVA 2H6PB 2Y06H 1FL5A 1FV1A 4M6AA 4XP1H 2Q8AH 5J6HB 2AQ3A 4OZFH 1KPUA 4GAYB 1WK0A 3HFML 1MHEB 1F97A 2LVEA 2XZAL 3FB6A 3OKOA 5ILTL 5BXFA 3QWQB 1KCVL 1G7QB 4OBRA 4F7EB 5EO9B 5D7IA 3E1F1 3UJTH 5I1KL 1LO3H 4M7LT 3SCMD 5ICXB 1IEAB 1RK1B 3MXVL 3MLRH 3OF6A 4YEEA 2AEWA 4PRAA 3BD5A 5HSFA 3ARBC 1XF5B 3FFCA 1C1EL 2Z31D 4C4KO 5I76B 5C08E 2Q3ZA 2CD0A 4Z18A 1PY4A 2YMXL 2EDQA 2FIKA 3N85L 5F7WC 4TQEH 4HLZH 3S88L 1BOGB 4X4XB 4MJIE 2EKJA 3DVIA 4WTWA 4WI5A 3TN0C 5C09B 4RMUA 4ZG1A 5FA4A 4H20L 4PG9A 3P0VL 5TE6H 1AQDB 1MI5A 2WSKA 3ZT7A 5IB1A 5J9PB 2WBJB 4GKSB 1B0WA 1R3JB 1MCBA 1KNOB 1BJ1H 1QLFA 3AB0B 1CE1L 1FFNB 2NY1B 4LCUA 4Y88A 5E8PA 3UJIL 5CGTA 2HP4A 5JPMB 1OSPH 5C9JB 1XCQB 3FN9A 2J6EA 4KPHH 1XGUA 2MHAA 3MRBB 4C56A 1JHTB 3PHQA 1KLUB 5DD5L 5I1GL 4HS8H 4JDZB 4YBQC 3DIFB 4Z6AT 4AEIL 2CLRA 4HH9B 1TVDA 4LRNH 1AGCB 1MF2L 5BZDA 2OYPA 4IRJC 5T3XH 4ELKB 1QQDA 4ZUWA 3MACL 1WBYB 4HGWA 4HK0B 2Q7YA 4X80H 4P2RB 3CSBA 4JLRB 4W4OC 4DN3H 4KK6C 3CCHB 4PV9B 3L5IA 4JHAL 4E0RB 3SGJA 5HY9B 4HUWA 1IM3A 2EO9A 1V3JA 2OP4L 4YDVA 5GZOD 4YBHA 4E5XB 4WWKA 4BQ9A 1MEXH 1H3PL 3L5XH 4Q6IA 2X4PB 2D7TL 1RUAH 4RNRA 3RY6A 1FNEB 1P6FA 5DJAB 1K8IB 2X09A 4UUJA 1TZIB 4HMDA 5D2NA 2FX9L 3N9GL 4MNQB 1S78C 2O5XH 3BZFA 3ZT6A 1C5DA 1N0LA 4N1HB 4OLXH 2R1XB 3D69A 2VUYA 3L95B 3M07A 3QNZB 2NQCA 2Y6SC 1RUPL 1M7XA 5IR1A 5D7IF 3OB0H 4LAQL 3OL2A 1Z9OA 4NM4L 4NQXB 4HT1L 2QHLA 2Z8WC 4WUUA 3R0MA 2PUQT 4HK3J 3VWJD 4HWEH 4HS3B 5C0CE 4GKNA 2QHRH 1UXSA 5B21A 3DMMC 5DRZB 5T3XD 3VJ6A 1KB5H 2K1MA 4JG1H 5DMKA 5DFVD 2YUWA 1FBIH 4LCCC 5DD3L 5H2BB 4BUHA 2EDKA 3KPLA 2J8HA 5C0AA 4TVPH 4MDJB 4LCWA 1GGBL 4HF5L 4N9OB 3PUCA 1NGWB 4Z7OF 2QQNL 1MVUA 3CXDH 5CSZA 2V5RA 5IF0B 3UJJL 4L4TA 2JB5L 2W0LA 3MLWL 4YHPA 1U8HB 3PDOA 2WBKA 4NGHH 3FTGB 3WFEL 4X6FA 4DKFL 3BO8B 3JZ7A 3G5YA 4L3ED 4MD0B 5FM4A 3QUZA 3U0TA 2ADJA 2X4OA 3WHE0 1UM5H 3MJ6A 1JWMB 1SYVA 1ADQH 1CFQA 2EYTA 3TJHD 3WLBA 3SKJL 5HHNA 4JFZH 4APQA 4DAGL 4KQ3L 5D8JL 2FBOJ 4JKKA 5C9KA 5DDHA 4U1IA 4Y5VB 3S36L 4RAVA 4JGUA 4N8VB 1QRND 3EYFA 1VFOA 2DQCH 4IRZL 1ZT4B 4CN1A 3OGCA 3FT2B 2VXSH 1WFTA 4ZYKA 1B6DA 4N0CC 1MCOL 3CXHK 3LIZL 5FF6B 3LEYH 4F9LA 5MENE 4PTTB 1KLFA 2IEPA 1Z5LA 2AABL 3ARPA 2BK8A 5HDOA 2ED9A 3HE6A 4PJGE 4ZOAA 2JLLA 2Q1EA 4JB9L 1CICB 2A38A 1LO5B 5JQ6L 1OAYL 4NT6A 3FKUS 2YBRA 4TVPD 1PYWA 4MQSB 1CLZL 1IC5H 2MOVA 5EBLA 1FVCB 1RJYB 5GGTL 4OZHE 1FGNH 1T89A 3P30H 2XN9B 4M7ZB 1D5BA 3QEQB 3L3GA 3OMZA 5ALBL 2DI8A 2EKSB 1MFCL 2AQ1A 2GJ6E 4FHBD 5T5FH 1L9NA 4MJIA 2Z4QB 7FABL 4PJ8C 4GRWF 2I27N 4HUNB 2X1OA 2H41A 3RGVB 1OAUH 2P8MB 5ISZE 2YD5A 1DEEB 3BMWA 3RPKA 3KDMB 3ZKSD 1IARB 5I9QB 3AAZA 3UTTB 1ZHKA 4LAJH 5I19L 4Y4HC 4JKWA 4BSVA 5DEFA 4Q9QL 3TBWA 2CDEB 1BBJA 4MAYD 2D4FA 1AXSA 1QBAA 3W5MA 4H5SB 4IMKA 3WFCH 1UKTA 5F3BA 4FTVA 3O9WC 4IRSC 4OF3A 3SDAD 1CFTA 3BDXA 4Q0XH 3ZE2E 4X5WB 3KPRD 2BZDA 3F62A 3GBMH 4M3KB 2EXYD 2I07B 1VA9A 3W11C 1OCWH 1XT5A 5I75C 4XC3L 3TBSB 5KVEH 5I1IL 5KSBE 3IRPX 5IBTH 1CDYA 2X70A 4KDTC 4GXUN 2NX5D 4WUKH 1FO0L 2VZUA 4N0UB 1U8KA 3LCYA 4YHIA 3ZKXB 2L7JA 1BQLL 1TQCC 3GHEL 3ZDXF 2D7MA 2WMPA 2GY7B 5KN5B 2Y07H 1RZKH 4PLKC 5EFIA 5C6WH 1BEYL 1CLYH 4NNXA 2VQ1B 2DJ4A 3ZDZF 4D3CH 5DD1L 2RFXB 3D39D 5D7LD 2PYEE 1ZHNA 1YPZE 5H35B 3HS0A 1PSKH 3AMKA 5ICYA 3ES6B 3DX6A 2XZZA 4N5ED 2COQA 4K3JH 4M62L 5I74B 2NY2D 1MSPA 4FQ2L 1A6WL 2ATPB 3E3QC 5DQJB 4POYA 4O2CA 4HULB 3MFGB 1QLEL 3BZDA 4GUPB 2XWBA 1BECA 2L0DA 4P9HL 5FM5M 5A2FA 3PGFH 5DHVB 5MP6L 2NTFA 5HGAB 5JPNA 3STBA 3T0VA 3BI9X 2KBGA 5E00B 3VXSB 1BAFL 2ARJB 3L9RB 4YHLH 5GGVL 3HLAA 1U8QB 5BOZG 1E4XI 3ROLB 2HRPH 2AEQL 3O41B 3T0EB 4Q58C 3T0BA 4LCIL 2FWOB 4OSUH 1NAMA 1U2HA 4JFXB 1I1YB 3OXSB 4JKLA 1A5FL 2X4SB 2QADC 4KQ4H 5EOCJ 4ZAKA 3UCRA 4DOHE 2IQAA 1ORSA 4WO4A 3GSQA 1BJ8A 5TF0A 4U1SB 3EDDA 3ZDYE 1TETH 3GMRB 3O3BB 1GIGL 2A73A 1F4XL 4BSWB 1ZLSH 5ESVB 1JPSL 1MJ8H 3CFJB 4A6YB 5C0IB 3DO7B 5DR5L 4G3YL 2JJWA 1T2QL 2Y72A 4K3DL 4D0CA 3MRLB 5IMKB 4WHYG 3QFJB 4OTXL 3HI5L 5FO7B 1JHKL 1PW3A 4Z0XB 1OAZL 1KT2A 1EAPA 3ULSB 3P73B 1U3YA 5SWSD 2OI9B 3AS0A 1LO0H 4NNPL 1HSAA 1OY3B 4XCEB 1X7QA 5GISH 3TBVA 1D3CA 2A6JA 3EJZD 1RK0A 4NO0A 3HZKB 3W5NA 3DRQB 3WFZA 3RVVD 3SGDH 3JWOL 3BEWA 1QBLH 3VMOA 3L7FB 1U42A 4EXKA 1AC6A 1I9JH 5EBWB 2DM4A 4U6XA 1CDCA 4YDJA 5E6IA 1D5ZB 1WBXB 3CDYA 2BMKA 3MV7D 1F4WH 4DZBA 1NKOA 4EDWL 1D9KC 4PRPE 1LK3H 3ARDC 4G7YH 3X11A 4EQ3A 1ZT1A 4KUCD 4HIXH 4TTDC 5L9DH 2YC1B 3P9MA 5C2BH 4P4KD 5FYLE 4YNYB 4Q2ZA 3OKDB 4F7TB 3TPKA 1ZK9A 5MENA 2B8OT 4P46C 3UO1L 1CE6B 1LEIA 4PJGA 5IROC 1R3KA 5L2JA 4LNVA 1JE6A 2J4WH 5DEGA 4YK4B 4JR9L 3RTQC 1G7JA 1FE8H 4BQCA 3WFBL 3PWVA 1YN6A 4NO5B 5BS0D 2ZCHH 4FXKA 4L29B 4LSUL 2X4TB 3V5HA 5DLML 4OZHA 1BD2D 3BIAX 1NSNL 4LLDB 4QY8B 1E4JA 3UTOA 5DK0B 1WEJH 4LQFL 4PD4J 2YUZA 1IGTA 1A6AA 1RUML 2GJ6A 5M95B 5IG7B 3BT2L 4UV7H 2Y36L 3T1FB 4LF3A 3DX8B 3MV11 1BIIB 5IOPA 5DFTA 2VTFA 1QHOA 3DETC 1ONQA 5ISZA 4F8QA 1EEQA 4I3RL 3HI1A 3JWDC 1JJUA 1Q0XL 2OMNA 3EO0A 5JZ7D 3L3DA 3PGDB 3W2DL 5D72L 2DTMH 5HJ3B 5DMIL 4GOSA 4G8EA 4PREA 4XNUH 1INQB 5C6TL 3IDYC 3MLVL 4FQXD 5EIVA 2HVKB 4G9FD 3O4OB 5DJ8A 1NDGB 3BHBA 3TV3H 3AS3A 4XPAL 3WHXB 4UB0L 5KSAC 2FBJL 3QO0B 3VFWB 4U6VH 1ZSDB 4K71B 2PW2B 3SDCB 3IVKA 2BNQA 4Q9CA 5D6DA 2AKRA 3QIBD 5E2TL 2YPLD 5KSBA 3RX7A 4NZTH 2BSSA 2BOCA 5A40E 1AP2A 4NO2A 2XTJD 2LU7A 3Q6FA 1FG9C 1JYVA 3MUY1 4X5XB 1NAKL 2YRPA 2NXYB 5LWYH 2F5AH 5F3HA 5JORB 3V6ZA 2Y1VA 2J1KA 3SGEH 1OW0A 1MH5A 1DDHB 1LK2B 3CMOL 4X6EA 4Z0BH 2I5YL 4LHUD 3VFRA 2DDQH 4OCSL 3D48R 3RVTD 4FABL 1QEWB 3UPRB 4EDXA 3KPNB 5IESL 1YECH 2DL2A 1UKSA 1YPZA 3RHWK 3X14A 3T8XB 1KTLA 4PY7A 5FFLA 5C08B 3IAGC 1EFXB 5GRVL 4UBDC 4HJ0D 3QG6A 5AYUH 4LARH 4K7FA 3VFPA 1IKFL 4WEMB 1T1YA 4WI7A 3QXTA 4HUVA 1I1AD 4OLUH 1KEMH 1TVHA 5MERA 1HXMB 2BY1A 4EN3A 1BOYA 4YLQT 4J3VA 1KEGH 2XWJB 1F6AB 3BPNC 4MWFA 1J05A 4KKLC 3NGBC 3OXRB 5HVHC 4JZJA 4O4YL 4MHHG 5KJRH 1UCTA 4PJGF 1P7HL 4KTDL 1Q1JL 2ICEA 3U36B 4GAGH 2XIDA 3SDDD 1UZ6E 1MRDH 1SBSH 2ORBH 5IWLC 5LKNA 4MXQC 5GSRA 5F71A 5GGRA 2XQBL 3GGWA 2ADIA 2RBLA 4OZHF 2CDGA 2QEJA 1CZ8H 5IVZB 1UYWL 4XCCL 2Z92B 1CFBA 3QEGH 4KK5D 5DHYB 3W9DA 4MCZB 2EC9T 3GSRA 3MRRB 1H3GA 3JV4A 2ZCKH 4F7MA 4AENB 4DVBA 2GFBA 3ROOA 4OUUA 4P3DB 3MLYL 5F72S 4AIZA 2EH8L 2L4OA 1G7MB 2Y7QA 2ZUTA 3MJ7B 4Z95H 4QRTA 5TPWL 1GAFH 3PXJA 5FK9A 1LEGB 2ICES 5EIIA 5I18L 2GHWB 3BP6B 3VRIB 5LGJA 3RU8H 2IAMC 3UTSB 3PIQA 2CGRL 2CK0H 2CMRL 4Y5XB 2X7LA 4HJJH 1BVLA 4HAGA 4OZFG 4DQOL 4OZIB 3MLZH 4G5ZL 1SBBA 3H42H 3QCUH 4XP9H 2E27L 5KSBF 5C0BB 1JWSA 2Z91A 2QV2A 3KPQA 1N0XL 2DD8L 1PKQB 2NW2A 4N8CL 4UQ2A 4ZFFB 5A2LH 3KG5A 2MWCA 1JNLH 3S8WA 3U2SB 2PR4H 4NKDA 4FQCH 3THML 2E9IA 4PRPA 3LEXB 1KIRB 1F11A 2PXYA 3S3SA 1JRHH 5KSVB 3NCJL 3CFCL 4HMCA 4K8RC 3AREB 3ZKMC 1EV2E 4NCDA 1JPTH 4G80A 2GK0B 3NH7L 5LAXA 1FNGA 2N1KA 4HLZG 1AGEA 5T3XE 1YPZF 3R06B 5HDQH 5L8JB 1GC1H 5GGQL 4UMGA 4JHZA 1H8SA 2AXHA 4PP1D 1NGZA 5KW9L 3TWCH 4YQXH 3D3VD 3MQIA 4JQXA 1X5GA 2WBJC 3MUGB 5FM5O 1E28B 2V7HB 2VXUH 1DFBH 3KPMB 4XAKD 3TO4D 3E6FB 1W72H 4GG8B 1T22B 3X17A 3T4AA 5CUSL 1G9ML 3MBED 4L3AA 5J13B 5IFJA 2NY1C 4G43B 4NRXA 1HIML 1ZA3B 4JO3L 4AJ0A 1C7TA 4L3EE 4FQJL 1MRCL 2F19H 3PHOB 5DSCA 4QYOB 1N5YL 5JW4Q 1I4FB 2VSDA 4GG6F 2VXQH 3QQ4B 3ARGB 3NZ8A 5GGSB 5AZEL 4W68A 3LAFA 5EU6D 5B8CA 1URLA 2YN3A 2X89A 1YEGL 4LGPB 4IIQA 2DBJA 4Z77B 3W0WE 3GI8H 3WIHL 2R8SH 4OLYH 3WIIH 2ZOKA 2P1YA 1QUNA 3I2CL 4K7PH 3ZDYF 1IM9D 1QRNE 4XMLL 2QLVB 3P4OA 3PWJA 2A1WH 1MAMH 1CGWA 1HWGB 4JG0L 5L8KB 2VLJB 2XQYG 1OVZA 4MA7L 1WWWX 1Y18A 4MSWA 3DXAB 4YHKL 3VFTB 3SDYL 5AUMA 3ETBF 5LGHH 3KLSA 4LKXA 2X41A 3G6JE 4U4BA 2DL9A 1HYSC 1W0YT 3GSVB 4YHOL 2HYMA 2AK4B 3T0AA 1P9MA 1HQRB 1MREL 4YUEL 5HHQB 2AXJA 3SCMA 3LZFH 3IFPB 4M6ML 3BUTA 3ELAT 3WHE1 2XT1B 3FQUB 1DEDA 1RULH 5HHOE 2VLRD 4GMSL 4QXTA 5I15L 5L2KD 4QT5A 4G6ML 2VABB 3V0VB 2Z31A 1S9WA 2Q7NA 3EO1B 3P40A 2LU3A 2B2XL 1ZLUH 2BVPB 1U95A 5EORL 2JKXA 3VXQB 1MWAA 5FUCE 4AEHL 4NBYB 1XIWB 1UM6L 5GRVK 3VXPA 5K9JL 5HPMB 4XCNB 3GM0A 3HMXA 2AJVL 4O2FA 1SEQL 1R3HB 1QFWH 5IVXF 2H3NA 1FO0B 3A6OA 3QXUA 2QQKH 3HR6A 3CVHA 2AEPH 3O4LD 3Q6GL 5CWSB 4R4FH 2OX5A 1RIHH 5ENWB 1P4IH 4W4NA 4XVJL 3IGAB 5FKAA 1IGYB 3KPRE 3MLTA 1J5OL 5KVGL 4NKMB 2VR9A 5T3ZL 2GY5A 1NMAH 4OZFA 3O11A 5E70A 4FFZL 3EKCA 1CLOH 2V7NA 3WDJA 1YC8A 3CDCA 4FXGA 4ZUUB 5ACZA 3BZEA 3MYJA 2NX5E 1PKOA 2FGWH 5EU4B 4L8CB 1N8ZB 1RZJL 3LN9A 4XGZB 2IFFH 3RA7L 5IJKC 5CINH 3FB7A 1YMHB 1U3HD 3MRFA 4Q7DA 5IT2L 3HC0B 2ZPKL 1VFMA 3B5GA 3F7VB 3D39E 4M5ZH 4Y5VC 1NJ9A 1E27A 4OAWB 4H25A 4CVZB 5DMYA 2BC4B 3V79C 1PDKA 1F6LL 1DQTA 1GZQA 4OLEA 4YWGH 4HMEA 4X0KA 4I0PC 4PJBE 3UTZA 4OLWL 1I7RA 3ARBD 3ARXA 1TTFA 2HFGL 3QA3A 5EA0L 4X8JB 4PBVC 1FZKB 3QQ9C 1YY9C 1Y6NR 1CICC 2C3WA 1FC1A 1VESA 2J6EL 3LRGA 1FNLA 3MRMB 2BFVH 3PWNB 3TN0D 4HX1A 3DUHA 2JIXB 5D7KD 5JXEC 1JZ7A 3KPSD 1XR8A 3CMGA 4NQVA 3CZFB 2ZCLH 4NIKB 5D1QD 3H6JA 3SGDI 3W39B 2ENYA 5CJXC 3VWJA 4M7ZC 2EE2A 1J8HD 3MV9B 5CEXB 5HYEA 2VQUA 2VXVH 1I9RL 2HN7B 1CGXA 3PNWA 4CVUA 4MJ6B 5F7LB 5DJ2A 1DQLL 3RGVC 1FLRL 4X98B 2BDNH 3U4BL 4JPKH 2YPKA 4RQQA 2P8PA 3C5SB 3V6OC 2YKLL 4YBQD 2CRZA 5I9QC 1AR1C 4ODVH 2LAGB 1IRAY 1ZVSB 1CD1A 3TH2T 4ZS7H 1JNJA 4NNYB 3BRDA 1X5YA 3AMLA 2CUHA 4EBQH 1RJLB 3QZWB 1Z0NA 3ZYJA 5K9QG 3ARVA 4WCYL 1NDMB 5SWSE 5EOTB 4KXZI 4CW1B 2XYCA 1IAIM 3INUL 5BVJA 4L3EA 3B3IA 4ORZC 1YEDA 4KGLA 2GKIA 4D9RD 3QWRD 5EZIL 4P4RA 2R4RL 4PUBH 3FJTA 3K3QA 1G6RA 3JV0A 3JXAA 2UY7A 2VDLH 2W9DL 3GMMB 8CGTA 3ZKXC 4ZO9A 5IW1B 4OLZH 1ES0B 2NLJB 3SKNB 4B50A 2CKBH 5DGRA 4F58H 3MV7E 1J0ZA 3IU4H 4XZUB 1U91B 3IF1A 3GUTB 1QRNA 2VITB 4MX7A 5CKAA 1H3VA 1S78D 4LLYA 2E7LC 1UQSB 4LVOB 1OTTC 4A2LA 4XNXH 4PRBB 2UV3A 1OP3K 2Y6SD 3QJHA 5FA3B 4PJ9B 3FN0L 4DGYL 4O00A 1KB5A 3G6JA 4X7DC 1UJTA 4NUJB 4XB8A 5I74C 1BVZA 5MEPB 2AXFA 5EO0B 4JQIL 1BX2B 3C5ZB 4ONGH 3TIDA 1EHXA 3RNQB 3TVMB 2EYSA 3GSUB 1JZ8A 3QP3A 4YFLI 2APFA 4KI1A 4RFNB 4CN4A 1FZJA 3DMMD 1BD2E 2J2ZA 5I8OH 5F9JA 2OQJA 2OJEA 2VZ3A 3PQYB 5HGBA 4Z7QE 2OTUB 4UT9H 4XNQA 5DJYA 5MHSD 2NY6D 1BQSA 4E41B 3SGEI 3D0VA 3T0EC 5JR1H 1YEHH 3WNNA 1WZ1L 3Q1SH 1OGAB 3RL1A 1IAMA 2JJSC 4M1GL 3SKMA 1ADQA 4MQ7A 2EECA 4HUXA 4KU1A 4G6KH 2FJGA 4Y1AD 1T7ZA 4FQHA 3MCLL 3NAAL 2R2EB 4BH8B 5ALCL 4HEME 4NYLA 4CL7A 4NM8L 3D87B 4MAYA 1J8KA 3BP4B 3WKNA 4G9FE 1CFNA 2DS4A 2A74A 1KJ2H 2KQMA 3EDKA 5GSVB 3V6FB 4OKDA 4KZEL 1N4XH 4PBXA 3SDAA 2R4SH 3CLEH 2DWDA 2WUCH 3KPRA 4G8FA 3ECBA 1X44A 2VDKL 2DQUH 2JCCE 1BZ7B 1E4WL 2YPLE 5GRJL 5CZVL 1QTYT 2BVQB 2OI9C 2O5YH 2NXZB 2XTJE 2NX5A 4J7RA 5KS9B 4J2XA 1F2XK 2C4XA 3P9LB 3B2VH 2BSTB 5DI8B 5LCVL 2B1AL 5I6XB 3FHAA 4N0CD 5FUZL 1DQJA 2AJYH 1A14H 5D9SB 2ADGB 5IHUH 4F7PB 5DJ6A 1PLGL 4UV4H 5D6CA 4QOKD 3NTCL 4G9DA 2HJFA 3D39A 3PL6B 2WM0A 1NUFA 5D7LA 3AY4A 4LSRH 3OAYH 3U82B 2ESVB 2I25N 3OKLB 1NCCL 1ACYL 2VWEE 5INDB 3ZO0A 4X9IA 2D31A 4LSPH 3V5DB 1SYSA 5HDLA 4PJBA 5F9WB 3MRNA 1UWXH 1A3RH 4B7LA 4NRZB 5HTSA 4MS8C 3MJ8B 3RVXC 2V17H 4LLUB 5ERWA 1U58A 5EUOB 3HE7B 3KNBA 1BZ9B 4BKLA 2MJWA 5F44A 5D5ME 3RI5K 1KOAA 4PJ8D 1BBDL 1BFOA 3G6JF 1RZFH 3P4NB 4KHXL 5FHAH 3RWJB 3UDWA 4HIEA 4JFEE 3WJJC 1QSEB 4LHUG 4HXBL 3C9NB 2HWZH 3DJ9A 4Y4HD 1I8IB 1WITA 1JN6B 2H32B 4PG2C 3GNMH 4GT7A 5H94A 1TVBB 1NLBH 1AXTH 2NY5C 1NBVL 2M1KA 5HI4C 2ZSVA 3MXWL 2UUDH 2DQEL 4HFWB 2DQTL 3O9WD 4IRSD 5HHVL 4OIIH 4OV6F 4QRQB 2XACC 4DVRL 5I0DA 1G9NC 2C1PB 2PO6B 3U9PH 2GSGB 3GJFK 3ZTNH 3VFSB 3W11D 5J1AB 5KANI 5FO9A 1H5BB 4JAMB 3BIBX 2DAVA 3RRQA 4E42A 4JANA 3V8OA 3DROB 4LPCA 2W60B 1ZVYA 3CUPA 3QUMH 4K23H 3GKWH 3MUJA 4J1UB 3VFNB 2R23A 2R0WL 4PLKD 5SWSA 5F1IA 4NKIH 1NLDH 2GIYA 4LVHB 2YA1A 4X7SH 4HIHA 4K71C 3NIGE 3SDCC 4MMZC 5LQBL 1DZBA 1T0MA 3D2UB 2VDQL 1VACA 2O61B 5EZJA 5C2UB 3DUSA 1A3LH 4MDIA 3UZEA 3U9UB 1A2YA 4NPYA 2NY0B 1ZE3C 5TH2A 2DOCA 2NXYC 2QQQA 3CGTA 5M94B 1VKXA 3BD3A 5DRNA 4OLVL 4HQQL 3MV7A 4CUCA 1DBMH 1NUGA 1RFDL 1IZJA 1Q9OB 3DARA 3T0XA 2EEDA 1YJDL 3LDBB 3DV6B 4IEFB 3FO9A 3SDXA 4D0BB 4P4KA 5SWZB 3KLAB 4GW4A 4IOIA 5EIQA 3I6KB 4WW1B 3LD8B 1IEBA 1BFVL 1LP9E 3MLUH 2VDRL 1R3IH 1MY5A 1JGUL 2R1YB 4O9HH 1MQ8A 4RRPG 4MNGE 4PP2A 1NFDF 2JJTC 5TGBB 2IGFL 2YRZA 3QDJE 4QF1B 4XT1C 2QADD 4U3XA 4PJBF 5F70A 5BS0A 4BSJA 1EPFA 2BJMH 3GIVB 1S7WB 4ZPTB 1BD2A 1L6ZA 4PRHB 4XAKE 4WU5A 1EK3A 1FC2D 1SEBB 35C8H 4GQPH 3P4MB 5D1XA 3U7WL 4ODTL 1MCQA 4P99A 1DUYA 5DZLA 4LK4A 4GS7C 3QEUA 3RBSA 3FL7A 1U93A 3U4EA 4NJ9L 4PGDA 1P5VA 1ZA6B 3S4SB 2RGSA 4NQEB 4ETQB 1TZGH 2VE6A 4FQLH 1P4LA 3H9SD 1DVFB 3S98A 1JTPA 1LO4L 5I17B 1PG7X 2BNRD 3BVNA 4U1JA 2CLVA 2O5ZL 3IXAB 5J6GB 1Q0YH 3CFDA 4JM4H 4WHTA 4DZ8B 2JELL 2DQGH 4XBEL 4FQXA 2DQJL 4G9FA 1HHGB 4PJHE 4ERSL 3QPXH 4OCWL 2HFFB 2IPUG 4CJ0A 3JWDH 5LG1A 2QBWA 4GSDL 4XNYH 5D7JB 2ZJSH 2BXZA 4MAUH 2GI7A 3CPLB 4M7LH 5F7YC 1YYLH 2YPVL 3QIBA 2JCCA 5I8KH 4LSVH 2YPLA 1M05B 5GGVY 5BQ7A 5GIRB 3MRCA 4HKXA 4YHZL 1JNHB 5CS7A 4DTGL 5ITFA 1D9KD 3VWKB 2H26B 3ARDD 3BSZH 3MGTA 4QHKJ 4ODXA 4LEXL 4Y5XC 5DYOB 4TTDD 3KYNB 3KVQA 2ATKB 2WZPD 3RZWA 1BVKB 1RZ8A 1KJVA 4LHUA 5B38G 4XMKL 1X5IA 2IADB 2VLRE 5HYJB 3L3KB 4IS6B 5I8EB 4Z76A 3PV7A 5FYJH 3MNZA 5IV2B 5L2KE 3ZSSA 1KENL 4YHYB 5DVKA 4W70A 4ZD3L 1Z6JT 3SJVB 3PDGA 1IQDB 3QSKB 4RGNE 5E8EA 2EO1A 3AXLA 2PYFB 4NJAL 2ADFH 1AFVL 2DWEA 3RTQD 2QSCH 1HNFA 4X6CE 1MAJA 3QIUB 4QHLA 4A2MA 2GITA 3QXVA 5JOEA 4LLWA 1PJ9A 1WC7A 5JIKA 3I50H 5KVFL 3BH8B 5KANG 5F96H 3AREC 1VGKA 4KUCF 3SDXF 1S5HA 2NY3B 4PV8B 1MNUH 1LDSA 2VISA 2J8UA 4Z8FL 3H0TB 2DBLH 5IB3B 5D5MA 4ZMAT 3T2NL 1UJ3B 3L1OH 3T0DA 2ARWA 4XVTL 2UZXB 3O4LE 3DETD 2IBBA 5HD8C 3QHZH 1MCPH 3MO1A 4ZTPH 3SDDA 1U8NA 2Y5TA 5GHWH 4LKCB 5DVOA 2Z35A 2DMCA 4OGYL 2AJZB 5EU7E 4WU7A 1A9EB 4JHWH 4S10A 2ZP0T 3EDJA 3VD5A 3VFGH 4ALAH 5FA4B 4Y5YA 5J13C 1UVQB 3CJJA 4Y0GA 3CSGA 1S9VA 3K46A 5E9DD 3TYGH 3GSNH 5IB1B 3QUXC 4Z7QF 4CNIB 3QJFA 4YDKH 4KJPC 5KSAD 4L1DA 4NZJA 1CR9L 3FO2A 1CDUA 3SQOL 2F54B 3FO0H 3F5WB 3ARGC 5FYJD 2E3VA 1VPOL 3L3JB 3T3ME 4B5EA 3RWHA 1PBYA 4HAFA 3ULVL 2CJUL 1MFDL 1HKFA 1XGYL 2P5WB 4RA3A 5KBNC 5F7EL 2FHBA 4RRPA 2GUOA 4XBGB 4O02L 3KXFE 4L4JA 2CLRB 4Z7VA 4FS0A 4LIQL 1OLLA 3D9AL 2FEEL 1UH4A 4Y4FB 1P4BL 2X1WL 4ZUWB 1YEJL 1QSVA 4HFUH 3U7YH 5CEYB 2GJJA 3BESR 4HPYL 3NCEB 3VMPA 4K9EH 3DLQR 4L4VB 1F42A 2JCCF 3L5WB 3GJFB 5JIHA 2OK0H 1RUQL 3LN5A 4KJYA 5D7KE 3IFNH 3KPSE 4JDTL 4ZSOA 1SJXA 4NC2B 3VGDA 5DRWA 3OR6A 5FCUH 3BKYH 2C7UA 2VAAA 3EDEA 5MI0B 3O2WH 3TT1H 4KKLD 5BZWA 1OP9A 4UUJB 5CGMA 5D2NB 1L9MA 1LP9A 1YYMH 1F58H 3O8XB 2ICWJ 3GB7A 1C5DB 1XIWC 1NCAL 4YXHH 5LXGL 4MXQD 2AV7A 5BJTB 2G60L 1MJUH 1VFAA 5FYKH 1NFIB 2AERT 5IR1B 2MNUA 3D3VA 4K8RH 2R0LL 2A83A 4ONHB 2CIIB 4KI5C 3NN8B 5CJ8A 2F15A 3TO4A 5F1KC 2Q8BH 2XRAL 3LKPA 2RAMA 2WV3A 2J8UF 2OR9L 3UTQA 1WCQA 3MBEA 4NZUL 1Q38A 5D5MF 4R7NA 4H26B 3VXNB 2YEZA 2V2TA 3TJEL 5B38A 3VJ6B 5DJXA 5I8CB 4D9RE 1KTDA 5DMKB 1XMWA 4UILH 1E4KC 5JHLH 3LHPH 2BRQA 4GW5B 3KPLB 5EU6A 2X4QA 4HV8B 1CDIA 3D0LA 3KLHD 3A6BL 2F74A 2J8OA 3HPLA 4XPGH 2IAMD 2X44D 4J6RH 1FZOB 1QYGL 1KCRL 4XVSL 1RMFH 1QR4A 1IM9A 1R5IB 3MV8A 2VZOA 4PJHA 4P9HC 4I48A 3H7BA 4I2XE 3PWUB 5F9OH 1FFOA 4YXKL 1EJOL 2HKHL 4HBCH 1L0QA 3G6AA 3ZL4H 1DUZA 5DA4A 4J3OC 3IDUA 4WFFE 2CLZB 3GK8L 4TNWK 1F3DH 1FGVH 4OF0A 5HHNB 1M6OA 5FKPA 2VDPL 2XPGA 3EOAA 2M8XA 1FFRA 2ZG1A 3CAFA 3JUYA 5FYKD 1E0OB 5DDHB 4GXVH 5C8JA 4Z7VF 1FL6B 2Q6WA 4CMHB 4K8RD 3WNOA 2AI0H 1YZZA 3NIGF 2VLRA 3IDGB 4N5UA 4QRPB 3EYFB 5L2KA 4R0LB 3S96B 2SEBB 1W72A 3ESVF 1CL7H 2CIKA 2H1PL 3FZUC 5C09D 3F7YB 4KDVA 5MHSE 5FGCB 2FATH 2EE6A 1GGIH 4OB5H 3WO3B 2WP3O 1Z5LB 4X6CA 1RPQA 1NUDA 2VDML 3HE6B 4OD2B 4PRIB 3TA3D 1IKNC 2WBJD 1KELL 2RR3A 1VEPA 4LPUA 4NT6B 3BWUC 4B53A 4Y1AE 1SJHA 3V9FA 5DUPH 1KTRL 1NEZG 4P23D 2NY1D 1Z9LA 5TDNA 4M7JH 4WV1A 4RGOL 4Z78B 4PJCB 1LP9F 3GSWB 2FLRT 1DQQB 2F58L 3BN9C 3ARUA 4NWUH 3O4LA 1XR9B 4NZRH 3DHMA 2R1WA 4U6HB 2WQRA 4EVNA 3H8NA 1MCIA 1RHHA 3OJDB 4YGVB 3E6HA 4XC1H 2K9UA 5K59E 5E2VL 4FFYH 4RAUB 1WQVT 3TIEB 4HWBH 5EB9A 1QR1A 1KG0A 4P2RD 5IMOA 4NFBA 2BCKA 4ZQKB 5FYJU 4OCMC 3HC4H 1DBAL 3HI6H 4HIIB 1AI1L 2BNUB 4C58B 2APBA 4XPHL 1A21A 3MFFA 4KRNA 1Q9LA 1BBJB 3P0YH 1U3HA 1O0VA 1FFPB 3C6SA 1H15B 4FTVB 4QOKE 4AL8L 1KYOJ 3BX7C 5DQ9B 5F7MC 4PJXA 4J3WA 3FQXB 4M1DH 2LTQB 5IFHH 5JOPE 1MCSA 2OL3L 2HG5A 3LKNB 3QUKA 1EX0A 5BMFH 2EH7L 3CH8A 1QOKA 3FB5B 3P11H 1N6QH 2WINA 4MNQD 1T7VA 1JHLL 4MA3A 1K4DA 3RVWC 5JUEL 4LVOC 3PWPB 5KVMC 4PJHF 4YHIB 5LBSL 4UNTA 1FG2A 3OR7A 2DRUA 4OD1L 4PJ9C 4FQIL 4JGJA 3BKJL 3FQTA 4P2QB 1UH3A 3LS4L 2FZ3B 1AGDB 2XXMB 5FGRA 1WF5A 4XCFH 1CXKA 3C5ZC 5IM7B 3TN0A 5EWIH 3TVMC 1C12A 3O6KL 3KPSA 2I24N 3BWAB 5HHXL 3WSQL 1OTUC 4RFNC 5D1QA 3DX6B 5HVFB 3IB4A 1TJIH 4P59L 4M8QB 4ISVB 4F57H 3DVNA 1CT8B 1J8HA 1IAKA 3DGGB 4O2CB 1JV5A 1JWUB 1M7DB 2VDOH 3TNMB 4JPVH 3OKNA 4ODSH 1REIA 3FOMB 2H9GA 3G5XB 1IFHH 5C0FA 3QNYB 1A6ZA 2D9CA 4LDLB 3HZYB 1AD9B 3O3AB 1RV6X 5DD6B 4QNPF 2QQLH 1R24A 2A9NH 4IHOA 2F5BH 3B9DA 2CDFA 3S9DB 1CWVA 3OHXA 1B0GA 4U2ZA 4KMQA 1TZHB 1S9XB 4U1HB 1A7OL 4JN2A 2ITCB 1RHFA 3MJ9L 4G6FD 4ZAKB 1Q72L 1H0DA 1ORSB 3DSFH 1YEKH 2GQHA 4NUGL 4W4OA 4LSQH 1BHGA 4OFYA 3WEXB 4NKOA 3QWRA 1T03L 3IDMA 5TE4H 1JI2A 5L88H 4JN1L 3DYPA 3MJGX 2NXZC 1AE6H 3IDNA 3LKOB 4ENED 1D6EA 2WIIA 3BYYA 2CO7B 2G75A 5I6XC 4M5YL 1U8IA 4OF5A 4I0PD 3TZVB 3E3QE 4MXWL 4S1QH 3HRZB 4JO4H 2VXTH 1N2RA 4FQPA 3MROB 2FLBT 1AC0A 4O58H 1H3WM 3QQ9D 1UWEH 4JY5L 4M9PA 4KUZL 1YY9D 1CICD 1QO3A 3PL6C 3QRGH 1INEH 3QFDB 1X7QB 3PHSA 3TBVB 4URTB 2A6JB 4UQ3B 2C3VB 5JXED 4PJXF 3EW3B 1EA9C 4R26H 4U49A 5GRUH 5D70H 1ZANL 2IQ9L 4HHAA 4U1MA 4B7IA 2VLLA 1R5VA 5DRXB 1ZTXH 4TUKL 5F9WC 5A43C 4TTGA 1HSBB 1DBKL 2XN9D 3JBG7 4WI9A 3HE7C 4R3SA 3QEQD 4HIJA 5INCA 3Q5YA 3LRSA 3BYTA 1JYNA 4X7FC 3DMMA 3V0WL 5JMOC 3X11B 3DYOA 5IBLC 1KCUH 3P9MB 5E2UL 2UZIH 1MFBL 4LCCA 3RGVD 5GS3A 3EYVA 4X7EC 5MEOA 1B4JL 1NH6A 3SE3C 2PTTA 1XF2B 1G6RL 1W0VA 3UTTD 1AR1D 4LBEA 1A7BA 1RZGB 3BQUB 3MGOA 3EFFA 5DHVH 5DEGB 4FZ8H 1MFEH 3OV6A 4POUB 2B39A 3BRGC 1C5CH 4Y1AA 3B2UC 1BF8A 1Q94A 1GOFA 1N59B 4GXUM 1CBVH 4OCNC 5T1KB 2BNRE 2OZ4L 3FFDB 3OX8A 2CKBA 3MA9H 4U1NA 4NN5B 4U2YA 1SJEB 2Q86B 2HLAB 3IFLH 5ANMB 2PO6C 3S34L 2FSEA 2BVUA 1H5BC 2G9HA 2W0FB 1R3LB 4NQSB 3L3OB 3H9HB 2VR4A 2D0FA 4V1DB 3RUGB 1KB5L 1UM4L 5IMLA 1MLBA 4JG1L 3AFLA 3BGMB 1PZ5B 2ZUWA 3MRGB 3UXFA 2W9LA 1P1ZB 4C59B 4TVPL 1I85C 2E8YA 1ERNA 1PX4A 4A6YH 2I9TA 1M7IA 3HI1B 1I7TB 3A67L 1SM3H 4S11A 4LVHC 3EO0B 3LB6C 1NCDH 5HYQB 5IHZA 3L3DB 3VG9B 3NOIA 4DGIL 3BZ4A 1OTTD 1EMTH 4CKVX 1CDHA 2AXGB 4P3CH 1BFSA 4OI8A 2FB4H 1T04B 4QOKA 1KJ3L 1ZEAH 2NY0C 4ZO7A 1V8HA 1T4KA 4WY7L 1UM5L 1QRKA 2M26A 2BNQB 5EZLB 2YSSA 1S9YA 3TO2A 1CU4L 4X9GA 4YXLH 6CGTA 3LDBC 4PJFE 1C5BH 1AP2B 3TYFA 2QR0B 4TNVF 3NCMA 2XZCL 4JY6A 4FOMA 5C71A 4RIRA 3V6ZB 3RIAF 4I77L 3VXSD 3MA7B 4R90L 4X6EB 4XWOC 1G9MC 2FD6H 3LD8C 3ZE1E 3HCVB 4LLAA 3F12B 3T0ED 1CFSB 1D5IH 1IQWL 1IC4H 3QO1B 4PJ8A 5CZXC 2AJUL 2WBWB 1KJ2A 2VIRB 4JFPB 4WNQA 1N6VA 3QXWA 3KJ6H 4JY4A 3UBXI 5E8OA 2PNDA 4FZEL 3UYRH 1AGFB 5IB5B 2L7UA 4Y4HA 4K7FB 3QXAA 1UCBH 4AY0A 3CSYA 3VFOB 4WW2B 3B9KB 4MQXC 3AU1B 1IC5L 5FDYA 3SE8L 1TVHB 1Z3GL 2HKFH 4TSCL 1E6JL 5E9DE 5CCKL 2XWTA 3O9WA 4IRSA 1JBJA 3GSXB 1MCDA 4CMMA 2DLFH 3QFJD 2HA1A 3GBNL 4XNMA 5C07B 5KOMC 4EUPB 4Z7UB 3T3PE 5IK3A 1Y0LB 5FYJE 4CU7A 1DVFC 4JVPA 1A6VH 4DUVA 3I75A 4JFYB 2NY5H 3G04B 4GG6B 1TJHL 1KN4L 1MIMH 1KJMA 3IRZA 5GSRB 4X4YA 3VCLB 5CSGA 1S7RB 3DTXA 3V52H 5CZKA 3KHQA 3HKFA 1OT1A 1T1XA 2GEEA 2WANA 2CDGB 4BQ6A 3NIDE 3O2DL 4PJDE 3HFMH 2XZAH 5D7JC 5ILTH 4IOFC 1KCVH 3O6FB 4JDVA 3OAUL 1CQKA 5I1KH 2Z93A 8FABA 1YDPA 4DVBB 4PGEA 5K59F 3VWKC 1AIFA 1KBGL 2HFTA 2ZUQB 3TCXA 4HPOL 1QBBA 2YXMA 1T7WA 4MS8D 2YD6A 3RVXD 1C1EH 4JRXB 3H9ZA 2E7HA 4Y7MA 1J11A 4PGBA 4YHYC 2YMXH 4BFBD 4AIOA 3JTSA 5GZNC 3S88H 1MIEL 3PIQB 3RWGB 2X7LB 3W9EA 1DN0A 3ABZA 3AC0A 4AM0A 4D8PA 2X4RA 3QIUC 4H20H 2NW3A 4AQ1B 4PJ7A 2WWMC 3P0VH 1S9KC 1T80A 1F4YL 3UX9B 5DJZB 4KV5F 3DHJA 2Z91B 1XGQB 4M93C 4UQ2B 2NW2B 3QHFL 2NY3C 3E0GA 3AUVA 1GZPA 1MAKA 4B41A 3QUMA 5HI4D 4D9LL 1JVKA 1BFTA 4S2SB 3UJIH 1UJ3C 1J9CT 1RZJC 3F8UB 4ODBD 3PGFL 1H3XA 3ARYA 1FJ1B 5IVXB 1U3ZA 3IFOB 4G80B 5BW7C 5DD5H 3RWFB 5I1GH 3TNNA 3NCBB 1FNGB 5JDSA 4AEIH 5L6YH 1DL7L 3UAJC 4JFFE 1MF2H 2IF7A 2MMXA 1CL7I 3H9SA 4N0FA 4XMPL 1ZLWK 3MACH 3MRIA 1OAXL 2BNRA 3HNTL 1NANH 1XZ0B 1HILB 3QH3B 1F5WA 3SDCD 1NUNB 1CG9B 3NCYS 3U30B 5EU3B 1WFUA 2P48B 5IB4B 4QKXB 2EDRA 4JHAH 4QO1A 3D5OF 2GAZB 4NHUA 5K9KB 1WTGT 5IFJB 1TETL 1ZHBB 2O26U 5HVWA 1PQZB 4UT6L 3E8UL 2OP4H 5ICZA 3PF2A