1KJ2B

Murine alloreactive scfv tcr-peptide-mhc class i molecule complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
117
structure length
117
Chain Sequence
b'VTLLEQNPRWRLVPRGQAVNLRCILKNSQYPWMSWYQQDLQKQLQWLFTLRSPGDKEVKSLPGADYLATRVTDTELRLQVANMSQGRTLYCTCSAAPDWGASAETLYFGSGTRLTVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Allogeneic H-2Kb MHC Class I Molecule
publication title A T cell receptor CDR3beta loop undergoes conformational changes of unprecedented magnitude upon binding to a peptide/MHC class I complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 20
structure length 117
sequence length 117
chains with identical sequence E
ec nomenclature
pdb deposition date 2001-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kj2B00
2CIIB 4JPIA 3DBXB 4LFHD 5FOBA 2EDNA 3B4NA 1S7QB 1MWAA 3WHE0 5TDOB 2VXUL 2BNUB 1BIIA 1BFSA 5I15H 4S1QH 4I3SH 3CX2A 3RX7A 4S11A 1IGTB 3ULUD 1KCRH 5BRZD 3FFCA 4LGSB 4P2RD 2QSVA 2YPLA 1RJYB 1ED3A 2FBJH 3BE1L 2VN7A 3A6BH 4LFHG 1XIWC 1CFQB 1CXIA 3CLEL 1EUTA 2H2PD 4Z7VB 4DW2L 3NAAH 2ZCHL 4YBHA 3O41B 4YFEA 4IHOA 2ITCA 4Y4HA 2WUCL 1KCSH 1YMHB 5E95B 3BH9A 1HHKA 3KJ6H 3NIFE 5HD8C 4K8RH 4LSRH 4PS4L 1KN2L 1G7IB 5IMLA 2GJ6E 3TGXA 3MUHL 5KVGL 3ARBA 5D70L 2GW5A 2WQ8A 4JO3H 1S7RB 43CAA 2Z92B 2QSQA 3BI9X 4PJAE 3BZFB 1RHHA 3IRZA 3MXWH 1MRDL 2G9HB 5CP7A 3RWIA 3IU3A 1F6AB 5EU5A 3KYOB 1DQDL 2IC2A 5IVZA 1F4YH 3SGDH 3QEQE 3F7QA 1CGXA 1OP5H 5C0RL 1OARL 3MRJB 2AGJH 2COQA 5IW1A 3OKOA 3STLB 3WSQL 2R23B 4PGEA 5ABDE 5KVDH 2FECI 1F2QA 2Z91A 2CMRL 5GJSL 3QNYA 2FJHB 1IAOB 1HHHB 5CD3B 2NY6C 5J6GB 1J8HD 2OQJB 4JFZL 4KUCF 3M17A 4OCXH 2Y5TB 4NKIL 3W0WD 1IC5L 4IS6A 3MJ9H 4JFHD 4NCC2 2VDPH 1KJMB 3ZMRA 4OZ4B 4LU5H 1DN0B 4AT6B 4RDQG 4OTXL 4PG9A 1UM4H 3SKOB 1JZ2A 1HNGA 3I3EA 3DYOA 3RY6C 3B6SA 5I1GH 3FFDA 3LKSB 4PRNB 1PZUB 1MVFA 2DQHH 4QGTA 5GGVH 4Z8FH 3H6JA 3OJ2C 4LLDA 1R3HB 2D4DA 4YDVB 3VU2A 5F88A 1AIFA 4HWBH 3H9YA 1G7QB 4E41B 2Y6SC 2HKFL 2XXMB 3MBED 1NCWH 1MRCH 5HI5D 3SJVD 4ZUWA 5LWYH 3FJTA 2HVKB 3O2DA 1RU9H 5TDNB 1T1XB 4LVNB 1FP5A 4QY8A 5DJXA 5F7LB 5TE6H 3UTZA 4IJ3B 5EOCH 1S5IL 5EZLA 4NO3B 5F9OH 4OUUA 5DFVD 4R4BA 3VXME 1RZFH 4YXHL 3MUZ1 4PBVC 4ERSL 1LEKB 1HXYA 1ODAA 5BZWA 4ZTPL 1HOCB 3LRGA 1MQKL 3HMXL 1AXSB 3B5GA 1H3UA 3FOMA 1BREA 1IEAA 4LVNC 2DQIL 4U6VL 1T20A 4L8CA 3QEHB 3FQWB 4O2EB 4ZNCD 2ZJSL 4M1GH 1U8OA 2IANE 2DBLL 1A02N 2NXYD 3LPWA 5C0EB 3U0WH 5E56A 3NA9L 4QXGH 1IM9D 1A2YB 3MRKB 3QP3A 2FSEA 4DN4L 3HTLX 1S7VA 5I30H 2V2TB 5SWZE 5F7EL 3BJ91 4JHWL 1UCBH 4WFGE 4XCNA 5EO1A 3WFHB 3GMOB 1CLZL 3L7FA 4MJ6A 4QHLA 2DQJH 3MLUH 3O9WA 1JPGB 1K2DB 3CZFA 4E5XB 1HYSC 1CICA 2VSCA 4PJXB 2D3VA 5E94A 3PF2A 4U1LB 1XMWA 5D5MB 1JGVL 4OZFG 1T0NA 15C8H 1WTLA 1XZ0A 3EYSL 5D1ZC 3L3OA 4Y1AE 1NMCB 1D5IL 4GAYA 3PE9A 4JB9H 8CGTA 3SGEI 5CLTA 4JVWA 5C08B 1J88A 1Z6JT 4U3CA 3K81A 4WTZG 3EJYD 3PWNA 4N90D 5DJDA 1C1EH 3P11H 2RR3A 5DD0L 3HR6A 4M6OH 3JV5A 3HE6B 4MAYB 4YQXH 4M6NL 3FO0H 5CIPA 2L0DA 5ESAB 1AO7A 2HYMA 3K4ZA 4IRJB 4HUXA 1N59B 4NO5A 4RBPH 1KTDB 2FLBT 3KYNB 4LHUG 4WCYL 5EUOE 5IESL 1ZT1A 2BVQB 1CDCA 4XMKH 3UC0L 2VE6A 3OKNB 3HE6C 1T2QH 4MAYC 3SE9H 1AJ7H 4YO0A 3ECBB 3DIFA 3QG6B 3AVEA 4P5TA 2E5EA 3KNBA 4ZS7H 1NCCH 4OUOA 2G5BA 1BECA 2CRZA 4R0LA 3HAEG 3PWJB 2VLLA 1U95B 4PJ8D 3QNZA 1ADQL 1GGCH 1VADB 1FVCA 1OAQH 3VD7A 3ISWA 5E6IB 1ACZA 5E8OA 3DWTA 2OTWA 3RDTA 4IIQB 2BXZA 2LV4A 3JV4A 4WU7B 5BS0B 3EFFB 1RUKL 3TJEH 5GQBA 4WFED 2BSTA 3AREB 2ADJB 3DV4B 3BO8B 1BZ7B 1UEYA 1IGYB 2C3GA 5CZVL 5E6IC 5IIEB 4ZMAT 2ID5A 4FHBD 3PWLB 1MH5B 5JO5B 3NBNA 4OZGB 1AC6A 4HUWB 1BD2A 2BVOA 4LSUL 4Q0XL 1N3NB 3AREC 3QDMD 4AH2A 4CGTA 1A6TB 5D7JA 3LB6C 1WZLA 3HRPA 1TJIH 4LOUD 5T3ZH 1V3MA 4X5XB 4I3RL 4JZOA 5IMOA 2Y06L 4G8FA 2IAMA 1DL7H 4O9HL 1CI5A 4IMKA 5F7UA 5GRZA 1N8ZA 2IPKA 4YBLB 5D7KE 3HC4H 5KVFH 1ZS8B 3SGEH 1EHXA 5HSFA 4IMLA 4E42B 5D8JL 3S4SA 1Q8MA 2FX9H 4NQEA 1JPTH 3UTSB 3OPZL 3OXRB 2AW2A 5DJCA 5DK0A 4YBLC 1RZIB 4N0UE 3IDJA 3U46B 4EXPX 3R8BB 1I7UA 3PHOA 2ZG2A 3OB8A 3AC0A 3D3VA 1QA9B 4HX1B 4GKSB 4QRQA 4HUUB 4C4KT 3S5LG 1NC2A 3QWQB 2C1OA 2NXZD 3T0EB 4RMVA 5I66B 3HA0A 2OJZH 3D39D 3CXHJ 1UCTA 3WLWD 4EDXB 3P73B 3OHXA 5JW4R 3OKEA 1XGQB 1ES0A 3ET9F 3CX5K 4I77H 5H2BB 5EIIA 4C4KO 2O61A 4BKLB 5JORB 1I7RB 2JCCB 3T0EC 4XNUH 5EA0H 1MELA 3UDWA 1JYVA 4Z7QE 3LHPH 1P4LA 5KTEL 2M26A 5A2LH 1A6VH 2H2SD 3SBWA 5DSCA 5I15L 1L6ZA 4S1QL 3WFDH 4I3SL 2BOBA 1FNAA 4GW5A 2JK5A 4NQXA 1SQ2N 1KCRL 4I4WA 1J5OH 5KSUB 4X7FC 2FBJL 5MI0C 3QR2A 3A6BL 5T1DL 3QXDB 3RQ3A 1YNLH 4XXDB 1JGEB 4PREA 3NAAL 2BDNH 1H15A 3RNKB 1OT2A 4LP4A 4KMTH 1KCSL 1YEGH 3OAUL 3KJ6L 5ICXA 5IM7A 1EHLL 1BBJB 4IEFB 1ZA6B 2NNAB 4R96A 1AP2B 1WICA 2OP4H 4LSRL 1G9MC 2UV3A 4KZEH 3QA3A 2F53B 4U2YA 2HVJA 2A9NH 3FCTB 4LPTA 1KCLA 1WZKA 2RGSA 3IFLH 2H45A 1P53A 4JO3L 4JY6B 1AGFA 2BVUA 5GGUA 1OGAD 3VFWB 2LU7A 4Q2ZB 3MXWL 4NZTL 1G6RB 3DVNB 4O2FB 1JZ4A 1QKZH 3BOVA 1D5BA 3GJFH 5HVGB 2YN5A 4L4VA 4RCAA 4QRPA 4XCYB 2HRPH 5DEGA 1F4YL 1GZPB 1Z3GH 4NC1E 3PWVB 3VI4E 3OX8B 5MERB 4P2CG 2AGJL 2XTJE 4KTEH 4AK1A 5C07B 4U49A 3RUGB 5KVDL 4C54A 3H3KA 3VA2C 4ZOBA 3PWPA 5J89A 3QHZH 5T1MB 3U9PL 2BX5A 3ULSB 4MA1C 4YPJA 4XNYH 3QEGH 3U9UB 1G7LA 4OCXL 3F5WB 3V0AC 5IB3A 1ZT4B 3MJ9L 2X4OB 1VESA 1YN6B 5GGTH 2VDPL 3WIHH 2EDOA 2DICA 3MNWB 4P57B 4PJ9D 2GITA 4PGCA 4F2MA 4LU5L 1G0XA 1BLNA 1G7MA 2CLRA 1TETH 2Z31C 3U4EA 1WFUA 2HMID 5BZDB 5E8PB 2P5EB 4MCYA 3SDXA 4XZUA 2CK0H 3G08A 2DQHL 5DHXB 5GGVL 4Z8FL 4MAUL 4CN4A 1RUAL 4UV4H 3HRZA 4L3CB 1AXIB 3FMGH 5DRXB 1OOAA 3IYLW 2YRLA 1NCWL 1MRCL 2Y9RT 5LWYL 4JR9L 3BH8B 3IFPA 4F8TA 1ZHNA 5CD5C 1WBZB 4WHCA 5TE6L 3MLRH 4O58H 5SX4I 2BOCA 3VE0B 2DM2A 2GK0A 3GKWH 5F7FA 5F9OL 3IB4A 3IDGB 2QBWA 4Y89A 3JTTA 3FQUB 1RZFL 1EERB 5ITFB 4AEIH 1QZ1A 1WZ1L 2G75A 3CDCA 5FEBA 1IQWH 1I7TA 4OGYL 2ADGB 1ZWIA 3AY4A 1MJUH 2VDRH 3TFKD 1JN6A 1RZKC 4ZPVA 4MS8C 1HH6B 5C0BA 3A6CH 4MNGA 4P59H 5T3ZE 5E0QA 3VXRD 5I74B 4PJ5B 4QXGL 2DQGL 4RQQA 2VTFA 4Y16A 4KK6D 2JIXB 3BVNB 3R8QA 5I30L 5TE4H 3SDXF 1IM3B 4FQHB 3W5MA 4PRAA 3TZVA 2FYYB 1UCBL 2EYSB 4Z7VE 5DJ0B 1JF1A 1NAML 3TYFB 2DQJL 2EXYC 5DJ2B 3VMPA 5LQBH 3GB7A 3GSNL 4NZJA 1U41A 1GZQB 4RMSA 3TNMA 3D2UB 3OGCA 4CVZA 5F72S 1CVRA 3QQ3A 2V5TA 1QQDB 1CGYA 1WCBA 3U7WH 5T33H 2D9QB 2FATH 3INUH 2ARJB 2HLFD 3ZE0F 4LIQH 2GEEA 4HKJA 5GIRA 4JB9L 1R6VA 1JUFA 3EYQC 4MSWA 5CMAB 3JWDC 4I0PB 5D71H 3PABB 2X1OA 3VDAA 5CLWA 1C08A 3ARGD 5H37H 2FJGB 5B8CC 4LRIA 4RISH 1U3HD 1C1EL 3L5WB 3VFMB 2H26B 5F3HA 4M6OL 4XAWH 2C1PA 3VG0H 1T83A 4AEHH 4R7NB 3STZB 2YA1A 1ZVSB 5D2NA 5B38A 3FO0L 4HJGB 2YA0A 4P5KB 5F6HJ 5BVPH 3ALPA 2Q86A 4PY8I 2GFBA 1GXEA 5K9JH 4XVUC 3OWEA 4XMKL 3T0XA 1T2QL 5LXGH 3SE9L 2NY1C 2Y4SA 1FZJB 2FH8A 1OD9A 3VXQB 3FB6A 1RHFA 5ALCH 3RL2A 5JUEH 1J11A 4TSAH 1NCCL 4O5LH 3QUZA 3V9FA 1PQZA 3WKNA 1FC1A 4YLQT 5LGKA 1FNGB 2GJ6D 1GGCL 4X9BA 5FM8A 1OAQL 1B6DA 3L95A 1FYTA 2GTZB 3AB0B 2X70B 4E9LA 2YWZA 1EEQA 4PD4K 2OL3B 2IALB 1JV5A 3I02B 5TDPB 4PGBA 3TJEL 4QWWD 3QRFM 4Z7WA 4LNRA 4QTIL 2V9RA 4E41E 5IWLA 1KJVB 3FB8B 3QEQD 4IOIA 4NZRH 2H32B 3ZKMD 2A74B 4YWGH 1Z9OA 3TBWB 1S7SB 2MPAH 3WNOA 2B7DT 3CDFA 3T4AB 3U7YH 2HT4D 5DJAB 2IMNA 1WZMA 4PB9H 3V7MA 1MCSA 1MHCB 4X5WA 2BSSA 4LPCA 1FLRL 1PJ9A 2HG5A 1TJIL 5J1AB 3MLTB 2WWKT 1SMAA 1TPXB 2P8LA 2ARJQ 3NVQA 5T3ZL 4APQB 2GJZB 3D69B 3SEPA 3CFCH 2XWTB 5BRZA 4P2RA 1DL7L 1NEZB 4BSWB 4F3FA 3ZE1E 1G9MH 3HC4L 5E6ZA 5KVFL 1TZHB 4W70A 1QSEB 3ZDYE 3ARVA 2GTWB 3PP4H 2J4WH 4MJ5B 3GHBL 2WWKO 5EC1B 4APQC 3P4NA 5FIEA 1MCOH 4XPBL 3VFNB 4BFBD 4Z7WF 4UT9L 3OKDB 3RWDB 3V5DB 2Q7YB 4KRMB 1O7SA 4C83B 1QYGH 3HE7D 4PJXE 2MNUA 4X4XA 4XBPA 1ACYH 3OMZA 2Y36H 4X7DC 1T04B 3OZ9L 4ODSH 5D5ME 4YXKH 2MHAA 3CK0H 1QHOA 3MOQA 1ORSB 3OKYA 4FFYH 5FCUH 1G6RH 1ZAGA 5ID0A 1FIGH 2C7UB 3HUJA 1LP9F 3QCUH 4NQSA 5DZLA 5JXED 2OJZL 3AFLA 3KS0J 4X7TA 2CD0A 3VXMD 5C08E 4UBDD 1JHTA 3W11D 4I77L 3RY4A 3ULUF 2X5PA 3I75B 3V8OA 3WDIA 1AD0B 4ZO9A 1A7PH 2ZCKL 1UQSB 5FYKE 5CUSH 5KOVC 5KZCB 4XNUL 1X5LA 2JE8A 5EA0L 1RURL 5D6CA 1A5FL 5E5MB 1U8JB 2IAND 1ORQA 3T08A 3LHPL 5BMFH 1J8HA 4ZOCA 1A6VL 3DGGB 2MFNA 1CCZA 4HS8H 3BN9D 3DHJA 3WFDL 1UB5B 3W0WA 1FZMB 3C6SA 5SWZD 1KV3A 4WFGD 1J5OL 1F00I 1HKLH 3J8F7 5FGBC 2K9UA 3OR7B 1YNLL 3HR5B 2JKXA 3P4MA 3EDKA 4KMTL 4NM4L 4JJ5B 1YEGL 5DR5L 4KI5C 1A6WL 3HUJF 1YY9C 3MCLH 5JW5B 2OP4L 4MQSB 2DBJA 1MCPH 1RZ7H 4KZEL 3GBNH 3TO4D 3UBXI 2FWOB 4FQXD 1TITA 2A9NL 4Y1AD 1OB1B 4FZEH 2E6QA 3IFLL 3MBEA 3EBAA 1EO8L 5DYOA 3SJVA 3RI5F 4PIRF 5BS0E 5LKNA 1GGBH 1QBBA 1R24A 4FQ2H 3SE3A 1QKZL 3GMPA 4LIQE 1RZKH 4ORGB 5F93C 3HFMH 2HRPL 3D5OF 1F3RB 2X09A 1HSAA 4YHIA 1XGRA 1Z3GL 2X1XR 3WKMH 2JJVA 3PNWB 4OZGE 4OIIH 5FA4A 1L0YA 3VXSE 4KTEL 3MRPB 5DO2D 3NPZB 1KPUA 3HNSH 1VEPA 2G2RB 4N0YH 4WI2A 5CWSA 1R5VB 3QHZL 4Z78A 3IDYB 2DLFH 3C87A 4XNYL 5B4MC 1IM9A 5T1LD 3QEGL 2W1NA 3TP4A 3SY0B 3CGTA 1MCLA 3G5XB 5DRZB 4Z77A 2BCKA 1I7ZB 5J4MA 5B3JE 3C2SA 3L3KB 4HGWA 1KG0B 2FB4L 4RFOH 4DVBB 4Y8AA 3D25B 3WIHL 4RA3A 4PTUA 1JWMA 2H8PB 2LVEA 3EO0B 4LLQB 4QCIB 4ZFFA 2VLRB 3LPFA 3BN3B 1DBAH 3UTSE 1UFUA 3PP3K 1TETL 3VXOA 3O81A 1MREH 5FECA 3JWDH 4CW1A 4PRBB 1NLDH 4JPKH 4NC2B 3GSRB 3PGCA 4TTGA 4WTZA 1N4XL 1NDGA 2A77H 1JIBA 2XXCB 3D1MC 2FGWH 1IZKA 4Y7MA 2CK0L 2E8YA 5EOTB 4UV4L 5KSBF 3BIKB 1IMHC 2NR6D 4PBWD 3T0EE 4MD4A 5IQ9B 1OGTA 2A6JA 5EU3B 5I1DB 1DLHB 3MLRL 4O58L 2HFGH 4KKNA 1QVOA 1S7XB 2ZPKL 3GKWL 1CFNB 1WQVT 5FYKL 4F7EA 4Z7OE 1LK2B 2A6IB 3B2VL 5F1IB 1TZIA 4LGRB 1WEJH 5DTFA 4OF6A 4AEIL 5HGAB 4G80B 2JCCE 1OAUH 1IQWL 5HVHB 1MJUL 3U4BH 1A9EA 1E6JH 3ARFD 1CD1B 2D03H 2VDRL 3GJFK 1AXTL 3HAEA 3WLBB 4D9QE 5D7KD 3FQTA 12E8H 3KPSB 2OK0L 1CR9H 4P59L 3HLAA 3C5ZB 3R06B 4NO0D 5TE4L 3RVXC 5HVHC 3GBMH 4NNXA 4WGVB 5J12B 1X44A 1F11A 4Q6YA 1GAFH 3KPPA 2X9WA 1QR1A 5EBMA 1UXSA 5LQBL 4PJ8A 3EZ8A 1HHJA 3OJDB 4AQ1B 3SHSA 2F74B 2PO6B 2EE2A 1ZXQA 2KPNA 4J3TA 2Q3AA 1PDKA 3HI1A 4KH2A 4DUXA 3QPQC 4M5YH 1H5BB 2X9YA 1YQVH 2VQ1B 5J12C 3TF7C 4JANB 1IBGH 2F53E 3W9EA 5IEHB 1W8NA 3TT1H 4JKKA 3U7WL 3NCMA 3V4PL 1G6VK 5T33L 2FATL 3MUY1 3INUL 2EDWA 2YC1A 4LIQL 4XTRD 3FQXB 3OKMB 5D7LB 4ZUUB 2PO6C 2QLVB 3OKLB 2ZUSA 1QR4A 1Z5LB 1FRGH 2H32H 1Q72L 3KJ4B 5D71L 1FFRA 2VR9A 1H5BC 4Y4HC 3MV9E 1KEMH 3SO3B 1H3TA 1EFQA 4A2MA 4RISL 4GW1B 2CK2A 3QIUB 5DEFB 4CDHA 1F58L 5IB1B 3QFDB 4FFWD 3QDMA 4OSUH 1CS6A 3VG0L 4AEHL 2AV1B 4RGOL 5C07E 2ZOLA 1T5WB 3MV11 3PXHA 5HJ3A 3RUGE 1WITA 3BP4B 1A3LH 3ARBC 1TXKA 3SO3C 2FEDD 5TH2A 1MCJA 1DQQA 1W72B 3FTGA 5J11B 1BPVA 1H8SA 3MYZA 3QIUC 1DTUA 5K9JL 4WW1A 3TV3L 4ZUSA 1KN4H 4Z95H 5EC2B 3B2UC 1W8OA 3S35X 5LXGL 1MPAH 1SJEA 1T22A 1B9ZA 2BSRB 5IB4A 4ELKA 4X6CE 4OKVA 4Z7UB 5JUEL 5I8CB 1JWUB 4LCWB 4O5LL 3BDXA 2C3HA 1XCTB 3RWCA 2IQAB 5MEPB 4DKEH 1F4HA 3AUVA 3VGAC 2P5EE 3VWKB 1RUPH 1M05A 5BVJA 3G6JE 5C0JB 2JJTC 2F58H 5GZND 3HZKB 1M4KA 1C5BH 5E08H 2OMNA 1DJSA 3D39A 1UJTA 1GSMA 1NBYA 3BQUB 1SJXA 4U6TA 1S7WA 4D9RE 4X9GA 1K5NA 1IL1A 2W59A 4GW4B 5GRVL 5IG7B 1QPXA 3VWKC 2DIBA 4NZRL 4OZHA 2XTJD 4DTGH 1QEWA 4HUKB 4C57C 1WC7B 4YWGL 3KWWA 2QQNL 3E2HB 4G43A 4GBXD 5HGHA 1WAAA 5C0FA 4J8RA 4RMQA 3MGAA 3U7YL 4PB9L 5GJTH 3CFDB 3G04A 1D5MA 3B3IA 3GSQB 1S9VA 4XC3H 2ATPA 5I1LA 4K7FB 1BX2B 5JPMA 4HSQA 3CFCL 4N8VA 4YPGA 3E2HC 2HFFA 4KVNL 1HEZB 2AEWA 4MGXA 4D0BA 3FZUC 1G9ML 4PJ5E 3LKQB 3QHFL 3SDAB 1K4CB 2J4WL 1ROWA 2OSLA 1KUMA 1Q9KB 1MCOL 4MJIB 3NOIA 3MLXH 4CVWA 1WT5C 1EA9C 5D1XB 3EOTL 4PLJD 5I0DA 2ICWB 1X5KA 4U1JB 3I6LD 3VRLF 2NY2B 1D5XA 1KENH 1RZ8A 1TTFA 2X4QB 4MA3A 4BELD 5TGBA 3SDAC 2YZ1A 4JZJA 1QYGL 4OZHF 1ACYL 2Y36L 4ODSL 4YXKL 3QDAA 1YEKH 1OGAA 4D2NA 2X4UA 3U1SH 1WAAF 3QJHB 4UB0H 5FCUL 4XCEB 1G6RL 4WI7A 1FIGL 3NCEB 1JWSB 4P2QB 3QCUL 5F96L 3IFOA 1EAPA 3DX7B 4M6AA 4QYOA 4F9PA 4NUJA 1LNUA 3FB7A 3VFVB 3P40A 5HHXL 4AMKH 1A7PL 1CU4L 4ELMB 5CUSL 1CICC 4LASH 4DKDC 1Q9OB 4WV1B 1RI8A 4P49A 1ZLUH 3UPAA 2GIYA 5DC9B 5BMFL 4LSQH 2I60H 4N0CC 1HQRB 1WK0A 5T3ZD 4TUJB 4D3CH 3LRSA 3BW9A 4HS8L 4PFEA 1BFOB 4YZFE 5HD8D 3E6FA 3GRWH 1CDBA 5IB5B 1XGPA 3B83A 1FN4A 5DD6A 1B0WA 1HKLL 4JQVA 4PJ9A 4KQ4H 4ISVA 3MLWL 1YEHH 3CU7A 2YMXH 3TO2B 5EO9B 4OQ1A 4AY0A 1DEEA 4PJDB 3QNXB 4LHQB 4OLVL 2DWDA 3CSBA 3UTTB 4PJBF 4JN2A 3LD8B 4UV7H 1MCPL 1RZ7L 1YPZE 3GBNL 1JPSH 1DUZB 3BAEH 1ZGLA 1LDPL 4FZEL 4XCCH 4N5UA 3GGWA 5I1CH 3KPLA 3A0OA 4LCYA 1N26A 4YHNB 1UVQA 2DD8L 1GGBL 1U58A 3P4LA 1N5AA 4G3YH 1NH6A 4QTHB 1RZKL 1NGWB 3LN4A 3HFML 2YD9A 1SVZA 1KNOB 4R0LC 2GK2A 1PY9A 3KPOB 3MMEB 4M4PA 4OIIL 5MEOA 2P5WE 3QQNA 3WIFB 3BKJH 2VMFA 5T3XH 3HNSL 3K7UA 3D18B 3W9DA 4KKBC 4HIIA 3RDTC 2FBOJ 2OLDA 3VXNB 1LE9B 3VXRA 2DLFL 5F7NC 2RAMA 2VAJA 5I8EA 5INCA 3EYFB 4YHKH 1YNTB 3FQNB 4I1NB 3QQ4A 5FDWB 3WUWG 3F7VA 3FONA 3KPQB 4U7SA 1A1MA 4AZ8A 4TVSa 1QSEE 2VKXA 4RFOL 1BQUA 3BWAB 2CGRH 5LBSH 3ARQA 1T7ZA 2WV3A 4MJ2A 3OJMB 1DBAL 4LSVH 5D9SB 2GT9A 2VXSH 5CKGA 1JHKH 1OLLA 1MREL 3JWDL 5D7JC 1NLDL 2W0FB 4JPKL 4LP5A 2MKLC 4X8JA 3HPJB 4MDJA 2A77L 2VR5A 2FGWL 1IC7H 4UNVA 3RWJA 1OP9A 4K71B 2QSCH 5HYQB 3AROA 4KVCL 1NJ9A 4Y5XA 1C12B 2AJ3B 1MCHA 4JFDB 3GSWB 5I1KH 3KPMB 3ARGA 2HFGL 5JMOC 1U93B 1U3HA 3UAJC 3U30B 5F8RC 1T7WA 1VA9A 4G9DB 3O3EB 1MFCH 3MRRB 1ETZA 3VWJB 1I8MB 4NGHL 1WEJL 3HMXA 4EI5B 4MD0B 4YUEL 4PY7B 4FQCL 2HA1A 5C0AE 5DHVB 3UYPA 1Z0MA 3U4BL 4JHZA 1I1FA 1W72H 1E6JL 1XFPA 3L7EB 1RPQA 2D03L 3U30C 3DUSA 1U8NB 4OI7A 12E8L 2EC8A 1CR9L 5AZ2H 4D8PB 5I1AB 4KI5E 1HYSD 4F57L 1YDPB 4EI5C 1EO5A 4G6JH 2PR4H 3GBML 4HDIB 3MRBA 5FKPB 1RULH 4CVXB 3PGDB 4XRCB 2CIKA 3GI8H 4Y19B 1FFNB 2GJ6A 3ZZ1A 4KK8C 2F19H 3O8XB 5I73C 3TEUA 4POYA 3QUYA 4YIQA 4A2LA 4M5YL 3SBWC 4PJAA 3PHQA 4EI6A 5D4QA 1IBGL 4PV9B 5DRWB 4H1LG 3T04D 2DMBA 3TT1L 2DTMH 4X6BB 1B90A 4NRYB 3ZYZA 2CDFB 2W60A 3QEQA 5C08D 3V0VA 5FV2A 5EBGA 2RFXB 2EICA 3T4YA 4X9IA 3REVA 2BY3A 1QFUH 5HI4C 5HDQH 3T1FB 5SV4A 1KEML 5FYKD 1X5FA 2MCPH 5EU4B 2AJYH 1UWEH 1CK0L 3HE6D 4MAYD 1TTUA 4OSUL 4JPWH 2I9LB 2VC2L 4TNVK 1OVZA 4IRJD 1TZGH 3NIFF 5CJ8A 2DQFB 2DWEA 3U6RA 1A6AB 1A3LL 3CFJB 2VQUA 1OTTC 3PIQA 1IGMH 1FQ9C 3V6BR 1CG9A 1GOFA 1H3VA 2XKNB 2NW3B 1KN4L 4GQ9L 4H26B 5IF0B 1F6FB 1MPAL 4NQCB 4PJAF 1BJ1H 3BHBA 3M45A 1JNLH 4U1HB 3VA6A 1WBXA 2VDML 2ENYA 2VDNL 2VLRE 1ADQA 5DQDH 4NN6B 4ZO8A 3WNNA 35C8H 5ID1A 1J0ZA 4XP9H 1U92A 5E6ID 4DKEL 3HE7A 5HYSB 5FO9B 5DVNA 2HT3D 3OGOE 1RUPL 5BS0D 1X5AA 3T77A 2YUXA 2BY0A 3O0RH 4PGDB 1X5YA 2F58L 1R3IH 5KS9B 3N1MC 1CXHA 1PFCA 5JXEA 5E08L 1C5BL 2BY2A 3ARED 3H7BA 3MRGB 3VXMA 5AEAA 3UXFA 1I8IA 5L8KB 3GMQA 4LF3A 1HIMH 3B9KB 4QRRB 4AENB 3VXSD 4D0DA 4DTGL 4Z5RB 1FH5H 4JFFB 5CEXB 1HHIB 5I1HH 3H9SB 5I17B 3MRCB 2PUQT 1TVBB 4PBXA 2A83B 1QFWM 1INEH 2FHCA 2IANA 1IVLA 4YDKH 1N2RA 2YPKB 1RZJL 3TBYB 2R0LH 3B9KC 2NCMA 1J0JA 2EKSB 4XC3L 3N06B 3VGEA 5T3XE 4NNYA 3AAZB 5SWZA 1I75A 1P4IH 2I07A 3GZKA 3ILPB 3KPSE 4ODWA 5GSRA 1HINH 5DVKA 2H3NA 2Z8VC 1BP3B 1U8IA 1EVTC 3MRFA 1KT2A 3L1OH 3UTSD 1JPFA 3MNZB 3REWA 2DQCH 4KPHH 3MLXL 1VFAB 1ZKAA 1TJHH 3QUKA 1EJOH 2OR7A 4NO2B 1KENL 3TO4A 4FQXA 2NW2B 4Y1AA 1LK3L 5F8QC 2BZDA 1G7PA 3UJJL 3DXAB 3Q6GH 4D94A 2FIKA 5ESQB 3S35H 3T0ED 4KJYA 3OB0K 4Y16C 3U1SL 1FJ1A 4YEEA 4QRSA 4UB0L 1NC4B 4BZ2L 1EX0A 3D85B 5E7FA 4Y0GA 1WIUA 5D7LE 3PWUA 1PYWB 4GSDH 4RWYH 1UWGL 1D5ZA 2A0LC 5LAXB 1E6OH 5KAQG 1IILE 1WBYB 4HWNA 3RTQB 3B43A 5J9PB 1LO4H 4LASL 3RAJL 1BOGB 5EUOA 4D9QD 1PEWA 4URTB 3QO0B 4H0GA 4LSQL 3CZJA 1MHHB 1U3JA 2I60L 5ICYA 2VXQH 4D3CL 5T1LA 1I1AB 1D9KB 2HJLA 1IKNA 5HGDA 4GKNA 4KROB 2EH8H 3PL6B 4FQ1H 1FCCA 4LRNL 3RTQC 3GRWL 4RIRB 3IDUA 1AGCB 6CGTA 1ZE3C 3WD5H 1V7NH 4LCCB 4GAGH 1YEDA 1U42A 4KQ4L 4JVUA 4LRIC 3H0TB 1XAUA 1YEHL 1D9KC 2YMXL 3D0VB 2QR0B 4LKCA 2DLGA 2VUOA 4Z7UE 3IKCB 4Y88A 4LCWE 1XR8B 3TPUA 2F53D 4XH2B 3VG9C 3GSUA 4LCCC 4UV7L 4I2XB 1XCQB 4ONHA 1JPSL 3BAEL 3FQRB 5F7YC 3T0BA 1AC0A 4LDLB 1ZSDB 5I1CL 1W0WA 3S36H 3TH4T 2AJVH 5I2IA 3EGSA 1R3KA 3T8XA 1FC2D 5EUOF 2YEZB 2BRQA 3MV9D 3NZHL 3CVHB 3F58L 3WN5B 3EOAB 1FG2A 4KHXH 1PD6A 4ODTH 1QFWH 1A1NB 2X89D 4EBQL 5C07D 4NBXB 3BPLB 1F3DH 2D7PA 4RMRA 4LLWB 1CXKA 5DHVH 3BP7A 3GK8H 1T1ZB 1QD0A 2ILLA 5T3XL 1VFBB 3NCYP 3P3YA 1A0QH 2V9TA 4BZYA 3RWFA 3ARFA 3SKNB 4HBQA 4YBQC 1X6NA 3FT4A 3HN3A 3RZCA 2EDFA 4DK3A 4F7TB 2Z31D 3ZTNH 2V2XA 1U8LB 2WBKA 1K3ZA 3MQIA 5IWLC 1NLBH 3BGMA 4YHKL 3IXTB 3MJ9A 4KAQH 3QO1B 2JJSA 3I3BA 1U9KA 1UKQA 3T65A 3F7YB 3VD3A 4XBGB 4PY8J 4K3GA 4JKLA 4BH8A 4N0UA 4GO6B 2CGRL 4TRPH 5FA3A 1I8LC 4JFOB 5LBSL 4LEOB 1NGZB 4J6RL 4C56B 4HS3B 3BKMH 1DUYA 1KLUA 2GSIB 2P5ED 2UUDH 5IW3A 5TE7H 1JHKL 3U79A 5CD5D 3KLHD 4J3UA 1YY8A 3H9ZA 5EU6B 4ODVH 1IGJA 5K9OB 1PZ5B 2HTKC 1IC7L 1T89A 5CCKH 1FZOB 4W4OA 1EH9A 3K4AA 3MFFB 2A6KA 3DRQA 5JOFA 4D9RD 2L4OA 3VFPA 2QSCL 3WJLC 2XPGA 3ARXA 3QEUA 4V2CB 4R26L 4ODHH 2DIJA 1T0MB 2H1PH 4NT6A 4L8BA 4WDIA 4P2QE 1QRNB 1CL7H 5I1KL 1CDHA 4BH7A 4P9HL 4PJFB 3TBVA 1CGWA 4M93B 3NZ8B 4M7ZB 8FABA 1MAKA 1R3LB 3S9DB 1MFCL 3DO3A 4EZMA 4CNIA 4ELME 1WGOA 3O3BA 1YC7A 4LK4A 4TVPH 3E8UH 4Z7NE 4I3GA 2EXYD 4RFEB 1W72L 2H41A 4M93C 2Q20A 4XCFH 1MJ8H 4PJ5D 5GRWA 3E0GA 2WIMA 1NBZA 2RCSH 5AZ2L 3DTXA 3MTRA 1XF3B 4NWUH 5F7DB 4G6JL 2RHEA 2PR4L 4P4KB 2HKHH 1GGUA 4L29A 1NAMA 4ZOEA 4JRXB 1NAKL 1FVDB 1RULL 4WFFE 5CAYB 1CD9B 4M61A 3GSNA 1P1ZB 2IADA 3RPIB 3GI8L 4WHYG 1KLGA 3MCG1 4H5SB 3F6IA 3F8UB 3D2UD 1MIML 2AABH 2F19L 2VDQH 4PJDE 5A43C 2R0KH 4WW2A 3UTTE 5A2FA 1PKQB 3MX0A 4POUB 32C2A 3C5JA 4Z7QF 3V4UH 3LRHA 4YH6A 1BWWA 2CR6A 4LCUA 2DTML 2IF7A 1BBDH 3BZEB 3WIIH 3U36B 4LKXA 4I0PD 4N9GB 3EIFA 1I3VA 1XGTA 5CZKA 4U6YB 1CQKA 3O6LL 1QFUL 4KRNA 5EDXA 5HDQL 1NMAH 5D2LB 4GBXA 2ZSWA 2MCPL 1BVLB 5I76A 5CBEB 2AJYL 1MIEH 3LPGA 2GCYA 1UWEL 3DROA 3U4AA 3V95A 5CHNB 5I75B 1A22B 4JPWL 5FYJE 2EH7H 4FZ8H 3HPLB 4Q6IB 4PRDB 1TZGL 4PB0L 5F9JB 3MBEC 3E3QC 5HI5C 2YSSB 4P46B 1T3FB 4MQ7A 3RZWA 5C09B 1IGML 5FK9A 1Z2KA 2AAVA 4NQVA 2VL5A 2D31B 3K3QA 3FT3B 5I75C 4EUPG 3FHQA 4Q6IC 4WW2F 1TENA 2EEBA 3MBXH 2H6PA 4U1GB 4LL9A 1JNLL 3UBXG 3MGOA 4FQPA 4P46C 4UMGA 3SN6N 1ZANL 5F7HA 3IJHB 2VLKB 5DQDL 4M8QA 4ZUVA 4HMDA 35C8L 4OZFB 2IWGA 4XP9L 3CFIC 3BEWA 4ZQKA 3VI4F 3WBDA 4HLZH 1U0QA 1SBBA 1HI6B 3P2TA 1B0RB 3L6FB 4U1GC 1FNSH 4HKZB 4M48L 4V1DB 3FN9A 3O0RL 1R3IL 3MCKB 1FPTH 4WUUB 1T1WA 4HS6A 2JB6B 3ZHLA 1P2CA 2OMBA 2WANA 3X14A 1NKRA 5K9KA 4NZDA 5HHNB 3VFGH 3DX9A 4F7MA 2ZSVA 4JFDE 1S5HB 1HIML 5FV1L 2APBA 1DANU 1PSKH 5I1EH 2HFEB 1IGFH 4KXZI 5L0QC 1FH5L 2DRUA 2P5WD 2CIIA 5I1HL 4JM4H 5H35B 3DBXA 4LVEA 3LEVH 1FNHA 1URLA 5I1JL 1S7QA 1INEL 5TDOA 4YDKL 2BNUA 2IEPA 4JO2H 4LHUB 4Y4KB 1H0DB 1FNEB 4APQD 1GOHA 4F80A 1INQB 1IGTA 25C8H 4L9DA 4OLWH 4XPAH 5E4IA 4IBLT 2Y72A 5F1OB 3EDJA 5C9JB 3QWRD 1QHPA 1RJYA 3I9GH 1P4IL 5E9DD 1N6QL 3SDYH 5HHOB 5AG8A 1CFQA 2B39A 4Z7VA 1QSED 2XFXB 3S96B 1HINL 4GLRI 3O41A 4Y4KC 2J1KA 1YMHA 4HWZB 1FGNH 5ITBH 3L1OL 1IAKB 2WIIB 4KPHL 4OLUH 5KSAC 1EEZB 1G7IA 1EJOL 4Y19E 3U7AA 1LVEA 3LSOB 3M8OH 3JSSA 5CSZB 2VB5A 4OD2B 1S7RA 2Z92A 4JG0H 3BZFA 3S35L 4K07A 3QUMB 3ARYA 2E9IA 4HK3J 1I4FB 3NCJH 1F6AA 1S7UB 3MV8B 3KYOA 3CVHH 4DJMA 4FQIH 2VH5H 3VMNA 1MAJA 4GSDL 3MRJA 3KPNB 3Q0HA 3STLA 5JW4Q 1G7HB 3NABL 2R23A 5KZCD 5FYJL 1W0YT 5C0AD 2FJHA 1KC5L 4Z7VF 1IAOA 1HHHA 4AIOA 1TVHB 5CD3A 4ZFZB 5J3HC 3MROB 5J6GA 2R56H 2OQJA 2R2EB 2ZOKB 5DD1H 1DE4B 2VXQL 4TVPE 4KI5D 4K2UL 4HUMB 5EO0B 3O3AB 3H7LA 1YY9D 2EH8L 4FQ1L 1J12A 3RY6A 5EU7E 3SO5A 4BJLA 1UH2A 2N56A 3SE8H 4AEFA 1MFDH 3WD5L 1KJMA 4JKPL 3BPOC 4OZ4A 5E4EC 1DN0A 4NQCE 3G9VA 4AT6A 5JHDB 5HYIA 5F97E 3SKOA 4OLEA 2WBJB 3CU1A 2DKSA 3CMOH 4BQCA 3LKSA 4PRNA 3HC3H 4HF5H 1EDQA 5ANMB 4CL7A 3S5LB 1R3HA 4LLUB 4YDVA 5F6IB 1EUUA 1KF9B 1IGIH 4E41A 1G7QA 3IVKB 2YRPA 1X3DA 4S0TD 1ZA3B 2GKIA 2WBJC 2HVKA 4NHUB 5TDNA 1T1XA 5KS9E 2AJVL 2CXGA 4NO3A 3GJFA 4P3DB 1LILA 3HMWH 3I6GB 2G60H 4EN3B 4KHXL 4ODTL 2J8UB 5B4MD 3WXWH 1QFWL 2OI9C 2W38A 5DEZA 4QRRE 1LEKA 1HOCA 4LSPH 3ULVH 1AXSA 1VKXB 3H9SE 2EYRB 5JW3H 4YGAB 2PYEB 3QEHA 3FQWA 3GK8L 4O2EA 4AG4L 1A0QL 4NN5B 5C0EA 4G9FB 4MMZC 3LKOB 2E9WA 2R4RH 2J88H 4P2OB 1A2YA 3MRKA 3ZL4L 3ZTNL 1R3JB 4PRPB 2VR4A 2V2TA 1TJGH 3U0PB 1WV7T 4KAQL 3FHAA 3WFHA 3GMOA 1CZ8H 2XYCA 3WIHA 1LMKA 4NN5C 2VLRD 1JPGA 1SM3H 4TRPL 4P2OC 4E5XA 1SEBB 4M7JL 5ADOL 5EG6C 5GRYA 3BKML 4MDIB 4PJXA 1B3JA 4WI3A 4U1LA 3VFOB 1A7NH 5TE7L 5D5MA 4X99B 5DA4A 1RY7B 3OAZH 1S7TB 1TQCB 1MUJB 2AJZA 4HUNB 5CCKL 4RFNB 1M6OB 1RZGB 3DXAE 4HIJB 3TIEB 1MLBB 1XEDA 3WDJA 5C08A 2C3XA 4NFDA 5JQHC 4KK5C 2XKUA 2H1PL 5ETUB 3ZE1F 1TQCC 1I9IL 1CDYA 1I9RH 2R39A 4Z0XB 2OYPA 5E6YA 5IHZB 3ZDYF 3HE6A 4MAYA 4YC2C 2X1PA 3NCFB 5GS1B 5E70A 5ESAA 2E7HA 1UENA 3RVXD 1U2CA 3CVIH 4IRJA 2ADIB 1N59A 5DJ6B 1XF5B 4JZJC 4TVPL 5T3XD 1KTDA 3E8UL 3KYNA 1M7IB 3C8HA 2DJSA 1FDLH 2BVQA 5CEZH 1IAIM 3EYVB 3KPSD 1J0KA 5GRXG 3OKNA 4KKLC 1SYVB 4PJXF 2RCSL 3ECBA 3QG6A 1CE1H 4NWUL 3DVFA 3QQ9C 5D5MF 3IDNB 1D3CA 4P9ML 1OAKH 3N1GC 2D0GA 3MGTB 3PWJA 3NCBB 1XF2B 1U95A 2ZCLL 3NACH 1VADA 3OXSB 1I1YB 4PJGB 3V6OE 4IRSB 2H9GB 5IR1B 2PO6D 2BNRB 4OZFH 5E6IA 4WRLA 1U8KB 2AABL 2GI7A 2VDQL 5EOQH 1BEYH 4S2SB 1B4JH 4IIQA 4WU7A 4UTAH 5BS0A 3EFFA 2R0KL 1O0VA 1J0IA 2P8MB 3CSYB 1NGQH 3V4UL 2W92A 3AREA 2ADJA 4R2GB 5FO7B 4H20H 3DV4A 4IRSC 5D7LD 3BO8A 1BZ7A 1BBDL 1IGYA 2B2XH 4JQXA 3THML 3S37H 5IIEA 4ZTOH 3PWLA 4JQVC 2W07A 2YPVH 1MH5A 4PJ9C 5JO5A 4JDVB 2AQ3A 4GUPB 4OZGA 3IAPA 3MA7B 5BXFB 2WW8A 4HUWA 4NHCH 1NMAL 2HMIC 3QIUD 1N3NA 4Q9RH 1MIEL 4XI5C 3R4DA 4R2GC 5FYLH 2FO4B 4G8IB 1A6TA 3B2UD 4BZ1H 3MRMB 4M43H 4DUWA 3CXDH 4X5XA 1FL5A 1QSVA 2EH7L 4FZ8L 4W4NA 4KUZH 2N1KA 3QCTH 4FTVB 1CLYH 3EFDH 5E2UH 1ZS8A 3QDGB 1A9BB 3ZKNC 4XP5H 3ZKXC 2F54B 3LQZB 4HQQH 3HAEH 3UCRA 5IHUH 1VEOA 4OD1H 5FUOH 3UTSA 4W81A 1JYWA 3OXRA 4LCWD 2AXFB 1RZIA 3U46A 4F7CB 1ZLSH 2O5YH 4C56E 3A67L 2R69H 4BA8A 1JTPA 3VWKD 1QA9A 4HX1A 4MZ2A 4GKSA 3P77B 4OZGF 5FGSA 4HUUA 5EU6E 3QRGH 3UROR 3QUMH 3T0EA 5I66A 1FNSL 2KDGA 5J1TC 2FSEB 1JK8B 3U0TB 1DANT 3WL9B 2AQ1A 2QJDA 1FPTL 4EDXA 3P73A 1CFSB 4OCLC 4DZBB 3DUUB 1GL4B 1XGQA 3GMNB 5H2BA 3VFGL 3WFEL 3DJ9A 3F6LA 2V5RA 5FO8B 5GRJH 4BKLA 3Q2CA 5JORA 1QRNE 1I7RA 5B3JF 5JOPE 2JCCA 3NIDE 3CZFB 1PSKL 4J1UB 4PJFE 1X5HA 5HGBB 3TCXA 4ZD3H 4KK9D 4P3WA 1JHLL 3ULVE 1ZVYA 5ILTH 4JO2L 3L5XL 4MJ4A 4XBEH 1CDJA 4U6HB 25C8L 4XPAL 4OLWL 3MUGB 2IH1B 3RBSA 5INDB 1AQDB 3FT2B 4NKOB 4P0DA 3I9GL 5KSUA 3SDYL 3QXDA 1LGVA 2DLIA 2FHBA 4XXDA 1JGEA 4CU8A 3SDAD 3ARGC 3RNKA 4LMQI 1U3HC 4S1SH 4LLMB 5KAQF 1BBJA 1ZA6A 2NNAA 4JRXE 5D1XD 2QHLA 1AP2A 3C2AH 1OHQA 5FUCE 1H8OA 4UTBL 2NY2D 4DQOL 3I6KB 4BFGA 4Z7OF 2F53A 3ZT5A 3GHEH 4HUXB 1BFVL 3FCTA 4XVJH 4X0KB 4ODXB 3SKMB 2ZUTA 2JCCF 4JY6A 3I2CH 3VFWA 5M7QA 4JG0L 3TT3H 4Q2ZA 4Z6AT 1G6RA 3DVNA 4O2FA 4NQDB 3GMLB 4JM2B 4P2QD 1JZ8A 3NCJL 5JXAH 3MV9A 3BD5A 4XCYA 3CVHL 5ERWB 4FQIL 2VH5L 4N0CD 1RK1B 1GZPA 5IEKB 2DQDH 2X89A 3OX8A 4F15C 2CDGB 5MERA 4RAUA 2PW2B 1ZGLM 3MLYH 5FFLA 5C07A 3V79C 5CGYC 5IUSA 5D2LE 3RUGA 5AYQA 1BJ1J 4JM2C 5BO1L 2ZZUT 4ZPTB 3QUYC 5HDOA 4A6YB 2ICWJ 5T1MA 2I27N 3B9DA 3ULSA 2R56L 3VFTB 3MUJA 1KJ3H 3K46A 3U9UA 4XP6H 4NCDA 4AL8H 1U6AH 1YUHA 3IDMB 5DD1L 3F5WA 3MZGB 4UUJB 3O3DB 1ZT4A 2V7NB 2X4OA 2R4SH 5CEZE 5CJBA 2BMKB 4YEFA 1YN6A 3BPCB 5C09E 3SE8L 1MFDL 3LKNA 3MNWA 4P57A 4Z76B 1PG7X 4WFFD 1X5IA 1K6QL 2EDRA 2B4CC 3MV7B 5BZDA 2V7HB 3WO4C 5K59E 4FNLH 5E8PA 2XN9B 2HT4C 2P5EA 1SEQH 2P4AB 1UACH 4AH2B 3TA3B 2B1HL 3CMOL 3UTTD 3T3PE 3HC3L 5HDLA 2DB8A 2XY1A 4QOKB 2DAVA 5CSBA 4L3CA 4DZ8B 1IGIL 5DRXA 1NUGA 2RQ8A 3H9HB 4HKBB 2MMXA 3RUGF 3BH8A 2NY3B 1IT9H 1WBZA 1RSFA 3TA3C 2CUMA 1BAFH 3VE0A 4WUUE 3IDGA 4KKBD 2F15A 4PJ7B 4KTDH 3HMWL 3FQUA 2G60L 4LSTH 3WXWL 5ITFA 4QRUB 5D96C 1CN4A 2GY7B 3H3BC 4LSPL 4WI8A 3ULVL 5FYJD 2NY3C 4N8CH 4X6CF 1I7UB 5JW3L 1CLOH 5FYLE 2XQYG 4ZUTB 1HH6A 3G5YB 4KY1H 5I71C 5MHSE 2I9TB 4PJ5A 2R4RL 4QKXB 3DX8B 1E0OB 2JIXA 4HK3N 3BVNA 1AH1A 1IM3A 3GSOB 4FQHA 1TJGL 2FYYA 3G6JF 4YHYB 2EYSA 5ISZB 5DJ0A 1CZ8L 3TYFA 3GMMB 2O61B 3P30L 5DJ2A 4LCIH 3MJ8B 5KSVB 1GZQA 5IGXH 5IHBA 1KB9J 3D2UA 2V17H 3S34H 3D0LB 2W0LA 1A7NL 4YHYC 4I0CC 2ESVB 1QQDA 3BN9C 3UAJD 1PX3A 3OG4B 3QYCA 4GW5B 2ARJA 4NQXB 4V2BA 1FG9C 4PS4H 5CP3A 2R2CA 5DD5H 4ZG1A 5JIPA 2EDKA 3QSKB 3T0WA 1PAMA 5L9DH 1MHPL 2UZYB 5CMAA 4I0PA 3NTCH 2X4RA 3PABA 5AAMA 4JFDD 5KVGH 1VACB 5D70H 1BJ8A 2FJGA 2IJ0C 2PXYB 3Q5OA 3L5WA 1NC2D 1I9RL 3VFMA 2H26A 4BSVB 3DVIA 3STZA 1ZVSA 4HG4J 2IGFH 4EI5D 4HJGA 2AK4B 5KG9B 2EE9A 3IAQA 3BPNB 5JZ7C 4P5KA 1NL0L 1FV1B 2PXYC 2P48B 1EEUA 1FDLL 1AGFB 2CMRH 5CEZL 3FN0L 2ICCA 3GSXB 2KKQA 1FZJA 2BP3A 3EOBB 1FAKT 3WNMA 1CE1L 4JFZH 3VXQA 1AI1H 3BPNC 4ZODA 4HIHB 1OAKL 5SV3A 2D7QA 2UY6A 1AR2A 4XB8A 2LABA 4RRPG 4Y19D 1A3RH 1FNGA 3RI5K 5JHDE 3FRUB 3NACL 5GGSY 4F9LC 3O8XD 5DMJB 5FGRA 4YR6B 2GTZA 3MRLB 4HPOH 1JGLH 2X70A 2EDQA 5EOQL 2OL3A 1Y0LB 5HI4D 4L3EB 4NPYB 4UTAL 5ANME 2IALA 1YEEH 4PP2B 3I02A 5TDPA 2X1WL 5DZOA 5F9DC 1KJVA 3FB8A 1XH3B 1KELH 2VNCA 1ZHKB 3L3HB 4R4ND 2B2XL 5A16B 4KRLB 2IFGA 3S37L 4ZTOL 2H32A 4YZFF 1RMFH 2A74A 4BQBA 2YPVL 1J1OH 3S3JA 3TBWA 2P5WA 1S7SA 3OAZK 4X98B 3MR9B 2V2WB 2J8UE 1N6UA 3T4AA 3T1WA 4Q9RL 2DKUA 5FYLL 1F8TL 1U8HB 1MHCA 4BZ1L 2JTDA 4M43L 5J1AA 4HWEH 3MLTA 1CFTB 4APQA 3CXDL 1MEXL 2GJZA 3PV7A 4TVPD 2PYEE 3D69A 1F5WA 3SE4C 4KUZL 2XWTA 2GHWB 2NR6C 3QCTL 1NEZA 3QWRA 4BSWA 3IS1X 4OF7A 4G9FE 1CLYL 1UZ6E 3EFDL 5E2UL 1TZHA 1YPZF 2DQIH 1QSEA 2GTWA 1Q0YH 4PRPE 4PYHA 2ZJSH 4UAOC 4MJ5A 2DLTA 4U6XB 2DBLH 2Q8AH 2GK0B 2YKLL 5EC1A 4JKMA 4NQCD 4HQQL 3FL7A 4LQ1A 1BQLH 5IHUL 2NPLX 4NFBA 5JLZB 4OD1L 4G7VL 5FUOL 4BK5A 3VFNA 3KPRB 4XAKE 3OKDA 4JHWH 3RWDA 3V5DA 2Q7YA 3N85H 4JFXB 1CLZH 4W6YB 1ZLSL 2O5YL 4C83A 3UPRB 2R69L 3ARFC 1T04A 4M03A 4JKWA 5D7SL 2BHUA 3RZCC 5JNYB 1ORSA 1CT8B 1INDH 3QRGL 1EK3A 1EBAA 3QUML 4YFLF 1B2WL 4QGYA 4ONFH 2C7UA 3RIAF 2RJMA 1JF6A 2JJSC 4DKFH 4UI2A 3P9LB 5L7XH 3EYSH 3B9KD 4OJFH 4QRRD 3I75A 1T03H 2VABA 1AD0A 1E4KA 5GRJL 5HHQB 2J2ZA 3AU1B 3ROOB 3H9SD 1UQSA 3QDJB 1PBYA 4OCYH 1AFVH 2CSPA 4LMQE 1FSKB 4KRPB 5E5MA 1U8JA 3X17A 3CDYA 4A6YH 3X3GH 1HYRC 1OAXL 5E2JA 5FB8B 4DFHA 4NYLB 5ILTL 5DD0H 1JRHH 3DGGA 1J9CT 2B4CH 1T89C 3DVGB 1OQXA 4W4OC 1UB5A 1FZMA 4P2YA 5T5NF 4TN9A 4MZ3A 3TNNB 3GUTB 1K8IB 4FXGB 2X10A 5A40E 3OR7A 2MOVA 5KANI 3HR5A 4WCYH 5IESH 1A4KB 5GISH 4Q9QH 3FB5B 3F65A 3UC0H 2EEDA 4JJ5A 4NP4H 1A8JH 1KYOJ 4FFWC 3GM0A 1MLCB 3V5KB 5JW5A 3C2AL 4L8SB 3IDXL 4PJGE 1ZOXA 4KFZC 4POZC 2BNRE 2FWOA 4R6UA 3GHEL 2DS4A 1WWWX 4L5FH 3HZMB 1OB1A 4XVJL 2A0LD 4Y5VB 3DXAD 5E8EB 1ADQH 2XWBB 3MJ6A 2X4SB 3I2CL 3S7GA 1T4KB 4GG6B 3TT3L 1FVEB 3QXVA 3D85D 4L8SC 4UOW1 3UTOA 5KVEH 1JI1A 4ORGA 2QQKL 1QBAA 1S9YB 1RUKH 4JO4H 4XPFH 4WFHE 4X83A 2GUOB 4KI5F 2NY4B 3JVGC 4Y5VC 1CVSC 5BV7B 4UIMB 3PNWA 4YAQB 4GH7B 3FN3A 3IFNH 4FOMA 3MLYL 1SJHB 3MRPA 3RTQD 1U3ZA 3VRIB 4D9LH 2MJWA 4PV8B 2G2RA 5AWNL 1JNJA 1R5VA 3CH1A 4ZSOB 5IT2H 3CSPA 4HXAH 4CBPA 4KWUA 4Q0XH 4XP6L 1BF2A 1D9KD 2Q87A 4AL8L 4ESKA 5BV7C 3SY0A 1U6AL 5DRZA 1ZLWK 1LO3H 3PL6D 1GC1C 1I7ZA 3GRWA 4FTVE 3L3KA 1KG0A 4I3RH 4KTYA 4LNVA 2R4SL 3NCCB 3NFNB 2F5AH 4DVBA 1Q9WB 1VFUA 1P4BH 3D25A 2XTJC 2F54E 2H8PA 3EO0A 4LLQA 5E8NB 4QCIA 4BQ9A 2VLRA 2Y5EA 5E1AB 1G0YR 2XKSA 3VGHA 5KBNC 4WI5A 4EQ2A 4PRBA 1LP9B 4FNLL 5TQ2H 3GSRA 5D8JH 1SEQL 1UACL 4LLVB 1TLKA 3P9MB 3OPZH 1BVZA 3RKPA 4O02H 4HCRL 5EOTA 3CXHK 4F37K 1H3XA 5J06A 3BIKA 5DA0B 4F3FB 3FRPG 1IGCH 2LFGA 5IQ9A 5C1MB 3O2VH 2HTLD 5EU3A 5I1DA 1IT9L 1DLHA 3DO7B 5EZJB 1BAFL 1S7XA 4WI9A 5GSVB 1CFNA 5IVXB 4YBQD 4HJ0C 1LK2A 2A6IA 4KTDL 5F1IA 3V6FB 2HP4A 4JG1H 1EVUA 4I18B 5HGAA 3TBSB 4G80A 4YHMH 1JBJA 4WWID 3U82B 4L8DB 4N8CL 1CLOL 4XBPB 1JGDB 1CD1A 3WLBA 3ESVF 1K8DB 3S3SA 1UYWL 3KPSA 1NPUA 4KY1L 1OAYH 5ID0B 1KIRB 3C5ZA 3R06A 5KTEH 2CRYA 3F12B 3BSZH 2Z93B 2HTKD 4LCIL 4Y2DB 3OJDA 3ABZA 2F74A 2Y7QB 4C56D 5T1DH 2PO6A 5EZOL 3VFUB 1BVKB 43C9B 5IGXL 2V17L 3UEZA 1LO2L 2B1AH 3S34L 1H5BA 4L4TB 2VQ1A 3L3IA 5EU6D 4JANA 1FCGA 5DI8B 3OAUH 5IEHA 1EHLH 1C7SA 4QT5A 2EDJA 4GRLB 4Y2DC 3UZVB 4MNHB 5C2BL 3FQXA 3OKMA 5D7LA 4ZUUA 3OKLA 5DD5L 4OGXH 4O51B 2PYFB 1Z5LA 2B5IB 5L9DL 4BM7A 4NQDE 3NTCL 5E03A 1QRND 5LVEA 5JOPD 2FGZA 2PTTB 4GW1A 1A3QA 3QIUA 4NZTH 5DEFA 3PV6B 4GRLC 5IB1A 2CXKA 3QFDA 2AV1A 3CFEB 4FG6C 5ICZB 3ULVD 2IGFL 1FIEA 1T5WA 2B5IC 3BRGC 4FXKB 3ZHKA 3BP4A 3HNTH 5LJYH 2Z9TA 3T0AA 2PN5A 3PHSA 1W72A 4GXUM 4HD9A 4G5ZL 3WUWB 5F3BB 2R1WB 4PLKC 1MCQA 3RGHA 1R24B 5DFWH 3KVQA 5EC2A 1T7XA 3W5NA 3U9PH 4U1KB 4L4JA 1AI1L 1DN2A 2BSRA 5F1KC 2E6PA 1YQ2A 2W9EH 4Z7UA 2JJTA 5BJTB 5I8CA 1SJVA 2I25N 4JRXD 3RRQA 4BFIB 3OSKA 1JWUA 4LCWA 2C5DC 5KSBB 1XCTA 1FYHB 1A3RL 2IQAA 2AEPH 3DV6B 5MEPA 3MV7E 4PGJA 2XN9E 3OAYH 3VWKA 4HPOL 4JGMA 1JGLL 3QFJB 4J4PA 1M7DB 5C0IB 1A21A 1FNLA 1RIHH 4WHTB 5C0JA 3IJSB 2P8PB 3MREB 4FFVD 1YEEL 5DQJB 3HZKA 4QOKE 3GI9L 3BQUA 2NZ9C 4PJIB 4JO1L 1JCKA 5SWSE 4GW4A 1YN7B 1KELL 5IG7A 1S9XB 4MAUH 3UJIH 4WO4B 1RUAH 1RMFL 1WC7A 1J1OL 1U8PB 4MX7B 2OXGA 4PJ7E 2FD6L 4JJHA 4JR9H 2DLHA 2KL6A 1FE8H 2CH8A 2VLME 4U7KA 3CFDA 5AYUH 5DK3A 2N4IA 2EIEA 2ZUWA 3MLVH 4AIXA 1J1PH 3GSQA 4HWEL 3X11B 4Z7UF 2EDDA 3LEXB 2AP2A 3TIDB 3LZFH 4K7FA 1BX2A 5CBAB 1WZ1H 1J18A 1WT5A 1F13A 4OGYH 4P46D 1HEZA 3CMGA 3Q3GB 5CEZD 5C09D 5ACZB 4IJ3C 4LARH 3LKQA 4ETQB 1Q0YL 2OCFD 3SDAA 1K4CA 3IS0X 3U83A 2Q8AL 3QXUA 1Q9KA 4AJ0A 1BQLL 2DQGH 3K80A 5ISZE 4MJIA 5D1XA 5I9QB 2ICWA 4U1JA 1NFIB 5C92A 4TYUA 3QI9B 1KB5B 3C8KB 3N85L 4LVOB 2X4QA 3DSFH 1NAMH 1J1XH 4H1LB 4MXQC 3DUHA 4NJ9H 1RIUH 3CH8A 3GSNH 4GKZB 5C0DB 2ESVE 4DUVA 3QJHA 1L9MA 5ELIA 1INDL 5HI3C 1NGXB 1JWSA 4ONFL 3QI9C 4WIQA 4BUGA 4P2QA 4WUUD 2HN7B 3DX7A 4LVOC 3TN0B 1L6XA 4DKFL 4C59B 5L7XL 3MJ7B 5BV7H 3KYAA 4OJFL 3RX5A 3VFVA 1GC1H 3VH8G 1CYGA 1T03L 2LU4A 5F89B 4ELMA 5I8KL 1P6AB 2K7QA 5DMYA 3I50L 4OCYL 2ATKB 4YX2H 1AFVL 1Q9OA 4WV1A 2WBWB 5FYLD 4A6YL 2KBGA 3TN0C 4PYGA 4LHUD 4Y4KD 3X3GL 5GXBB 1HQRA 2AK4E 4TUJA 5MHSD 3IDIB 2DYPB 5JDSB 5M94B 1JRHL 4ODUB 4NQUA 1NMCC 2B4CL 1BFOA 3NH7H 5KSAD 2BVTA 4X6EB 5IB5A 4K9EC 2EO1A 4GJTB 1TQBB 4UDTB 1I9JH 5GISL 4Q9QL 5DUBB 4NZUH 2GAZB 3TO2A 5EO9A 4NP4L 4PJDA 3QNXA 2YK1L 2HLAB 5HTSA 4IRJC 3UTTA 3NMEA 1SVCP 2WLYA 1DUZA 1KBGH 2VWEC 4L5FL 3MYJB 4L3EE 5DJ8B 4ELMF 4Q97A 1CLCA 4YHNA 5DUPH 3G6DL 4GT7A 4Z7NF 4WVRA 7FABH 5J3HD 3TBTB 4QTHA 2LVCA 4U7MA 5KVEL 1NGWA 3KG5A 5DURB 2LE9A 4OBSA 2DMKA 2CLVB 2DQTH 1MHEB 2PNDA 4JO4L 4XPFL 1KNOA 4UOJA 4QTIH 4K3DL 3JTSB 3KPOA 3MMEA 1DDHB 1FZKB 3IFNL 4FQQA 1WCQA 3WIFA 5IHLB 4D9LL 3D18A 5C9KA 3OR6B 1A6PA 2AEQH 1RV6X 1XR9B 4IIQC 2HT3C 4YNYB 3VXNA 1LE9A 5IT2L 2UZIH 4HXAL 3FO2B 3RU8H 3EYFA 1YNTA 4PJDF 1LO3L 4PLOB 5FDWA 1FLRH 3KPQA 3DMMB 3LY6A 4JQXC 1K5NB 3L5IA 2Z8WC 2CUIA 4HAGA 3DETD 2F5AL 1P4BL 3BWAA 5JHDD 4YDJB 5E2TL 3O6FB 5D9SA 4CADB 1T0PB 3KPRE 2WBJD 2XWJA 3C9NB 1RIVH 3GHBH 3DMMC 2W0FA 5TQ2L 1S8DB 4KZDH 1FORH 3HPJA 5HHPB 4XPBH 2JELL 2CDEB 4O02L 1HXMB 4UT9H 1A64A 2BSED 1S78C 4G8GB 4JFEB 5HYQA 1HZHL 4UZGA 3O6FC 1IGCL 1C12A 2AJ3A 5F7KC 3ARZA 4JFDA 3O2VL 2MSPA 3GSWA 3OZ9H 5JPNB 3KPMA 3VGDA 3X12B 3V5HB 1U93A 4G9DA 3O3EA 3MRRA 4QNPE 3VWJA 1I8MA 4DK6A 1G9EA 3BFOA 5L8JB 4JG1L 4EI5A 5IKCB 4YHML 4MD0A 4PY7A 3QDJE 3WFZA 5DHVA 2PYED 4JAMB 4U1MB 1LO5B 1NGPH 4ZAKB 2QADB 1C5DA 3L7EA 2ZCKH 4RRPA 4G9FD 1D6VL 4P2OD 4D8PA 5I1AA 1RURH 1OAYL 1A5FH 4PRPD 1YDPA 3TH2T 1FL6B 4PJBB 1QLFB 3Q5TA 4HDIA 3SGJC 4ZAKC 3BSZL 5FKPA 2QADC 4CVXA 3PGDA 4XRCA 4XAKD 1AE6H 5FF6B 4Y19A 1FFNA 3GMRB 4RNRB 2X4PB 2DF3A 2PKDA 3O8XA 3IETB 3LV3B 1N0XL 5K93A 1V3JA 2EIZB 3U2SB 3KPTA 3F7PC 4KK5D 2B1AL 4NM4H 4XC1L 2VKWA 5DR5H 4PV9A 5DRWA 1A6WH 4OZIB 1T66C 3VJ6B 1EGJL 2AK1H 4X6BA 4NRYA 2EZ0C 5EBLB 2CDFA 2DQEL 4J3SA 1ONQB 2EC9U 4ENEC 1C5CH 4GG6E 2YD1A 4OGXL 2JB5L 2RFXA 4U0QB 1EO8H 3T1FA 3GFUA 4NCC1 5CKAA 4J2XA 5EU4A 3TCLB 4KKLD 1DEEB 1MFEH 4JY4B 5D7IB 2CKBB 2I9LA 3QQ9D 4JRWA 4XX1G 2C4FU 3R1GL 2DQFA 4UINH 1MI5B 3WFCH 1A6AA 3CFJA 1MCNA 1ZVHA 3HNTL 4DKAA 3P9WB 2NTSP 2A9MH 4ZSOE 2VZ3A 4MMXC 4MQXC 3VI3E 2NW3A 4AM0B 1UKTA 3FO9B 4H26A 5E24E 5IF0A 4JE4B 4QEGA 4OBRA 4NQCA 4HBCL 4EKXA 1MRFH 5ESVB 4U1HA 1X5JA 3FAXA 2W9EL 2FR4B 2ERJB 1J10A 4WNQB 1RQ5A 1OT1A 3AXLB 1KB5H 4IRSD 2FB4H 2AEPL 5HYSA 1JL8A 2LAAA 1BQHB 1BF8A 5EH1A 1RD6A 4ZFGH 3NFPB 1RIHL 4PGDA 5KS9A 3EJZC 3BDYL 4XI5D 4R2GD 4R3SB 5BQ7B 1N4XH 1EJ6A 3FONB 4OV6F 3MRGA 4RSVA 4WFHD 3B9KA 4QRRA 3UJIL 4AENA 4Z5RA 4JFFA 5CEXA 1HHIA 3H9SA 5I17A 5IVXE 2ZUQB 3MRCA 1TVBA 3BMVA 4K9EH 5DJYB 4PGZA 3Q6FB 1FL3B 3KLHC 2FH6A 4NC0B 3DPBA 4OCSL 3ZKND 1FE8L 2YPKA 3ZE2E 2ZPKH 5AYUL 5FYKH 3TBYA 2BJMH 2VDOL 3B2VH 3MLVL 1J1PL 2EKSA 1AY1L 3VD4A 3PXJA 3AAZA 4PLNC 1QG3A 3LZFL 4GKOA 4F33B 4FTVD 2ZUQC 1Q9LB 1A7RH 4LARL 2F54D 4N1EA 4N0FB 1AXTH 5ADPH 5L88L 3NN8B 2OK0H 1KIUA 5KS9F 2D0HA 3MNZA 1OP5K 5C8JB 1VFAA 1KTKE 4ZXBB 4NO2A 2R1XB 4RA0C 3S88H 1AHWB 4GXVH 1J86A 3VXPB 1LD9B 3DSFL 4GRWB 4FP8L 1J1XL 2E9JA 3HNVH 3UZQA 3FKUS 1A4JB 3DXAA 2W9DH 4L4TE 4MD5B 4NJ9L 4RGNB 1RIUL 3AMKA 5ESQA 5I74C 1U8QB 3SCMB 4ZXBC 1NC4A 2ITDB 3D85A 3K8MA 2FECL 1H3WM 1GPOH 1AHWC 4HMCA 4JFHE 1PYWA 3ZT6A 3F62A 3V4PH 5LAXA 5BV7L 4RGNC 4M1DL 1GC1L 1WBYA 3RTQA 5J9PA 2NTFB 1Q72H 4YX2L 1BOGA 4HIEB 3MRNB 1DBKL 4P5MB 1X5ZA 3QO0A 2Q3ZA 1MCEA 4R8WH 1MHHA 4OI8A 1I1AA 1D9KA 1F58H 4B53A 5FDYA 3RVVC 3PL6A 4RGOH 2X1QA 3NH7L 4RIRA 1AGCA 1V3KA 1IEBB 4EUPB 4I0PC 1FFOB 4LCCA 1OWRM 1WF5A 5DS8B 1I9JL 2A73B 2O5XH 1KFAL 3UBXB 3IGAB 3H0TA 3V6OA 2DIAA 3D9AH 4UOW0 3ZSTA 5LGJB 1V5JA 2VZSA 2WAHA 3D0VA 2QR0A 3MZTA 4NZUL 4OD3H 3TV3H 3ZYJA 3IKCA 3L3JB 4RWHA 1N64H 1XR8A 4M00A 4DGYH 4XH2A 3MRHB 5SX4H 3KLAB 4X4ME 4I2XA 1XCQA 2C3VB 2CLZB 1KBGL 3MNVB 3QFJE 3L3GB 3FQRA 3GEWB 1UZ8B 1YNKH 3DI3B 4R90H 1WWCA 4OCWH 1ZSDA 5SWQB 4I8DA 1L7TH 5CGYD 4QRTB 5DUPL 3EO1B 2YXFA 4NQDD 4JM2D 2YEZA 3QUYD 3ZYOA 7FABL 4PJIE 3CVHA 4N5ED 2FZ3B 3WN5A 3EOAA 4R4FH 2VJXA 4XPTH 1T21B 1A1NA 3IRPX 2DQTL 4JN1H 2QV2A 1U8MB 2P24B 2AV7B 5L2KB 5IMMB 4CMMB 3FOLB 1QBML 4LLWA 1VFOA 1IZJA 3MO1B 4HEME 3KYKL 1U92B 1OF2B 1T1ZA 3AB0C 2MTPA 4EDWH 1VFBA 1P7KA 2P47B 3SKNA 4XWGL 1OL0A 1VPOH 4TSBL 1E28B 1DLFH 2AEQL 4J3OC 1MQ8A 2QQNH 1SBSH 1I8LA 4F7TA 4JZNB 3JUZA 5E2WL 2UZIL 1OSPH 1U8LA 5C7XH 3RU8L 2FHFA 1AGBB 3IXTA 1GIGL 3QO1A 4J7RA 4ZDHB 3F7YA 1JI2A 4XBGA 3OL2A 1IQDB 5FOJA 2P7TB 4KVNH 5I6XB 3W39B 4JFOA 4LEOA 1NGZA 4C56A 4HS3A 3WJLA 3MV7D 5C2UB 2VUYA 2XNAB 4GFTB 2XN9D 2GSIA 3QHFH 1W2KT 3QG7H 4W6XB 5GGRY 3TA3D 1RIVL 5EU6A 1TPXC 4KZDL 1FORL 3AMLA 2WWMD 4UU9B 2XZZA 5K9OA 1L7IH 1PZ5A 2YD6A 2F8XC 1VENA 1FZOA 3EOTH 4NNYB 4QOKD 4RBPK 5I6XC 3MFFA 3LKRB 5SWSD 1MCKA 3K2UH 2NY3D 1T0MA 2YXMA 1KTLB 3LH2H 5EBWB 2Q1EA 5HVWA 1QRNA 4I9WE 2DKMA 4NSKB 4PJFA 2HT2C 3NZ8A 1R3LA 2VLMD 5F96H 5CINL 2EXWC 2FL5B 1FGVH 1QSZA 3HB3D 2OS7A 5DK2B 3S4SG 1XGYH 1NGPL 4RFEA 5HHXH 5IJVB 3N50A 1CU4H 1J05B 2CUHA 4JEGB 3RGVB 3X13B 1OY3B 1RJLB 5EIVA 5F7DA 4DVRH 3J7HA 3QZWB 4LQFH 4JCMA 1A14H 2FEEI 3C60B 5ISZD 4JDZB 1Y6KR 4JRXA 3JWOC 1FVDA 3WS3B 4JHAL 1E4KC 2VWEE 1AE6L 3RGVC 1P1ZA 3RPIA 5E7BA 4H5SA 1DP0A 5DC0A 3HZYB 5JQ6L 1NCDH 5IFAH 3NIDF 1RZJC 2EC9T 3MLWH 5ALBH 3C60C 4PRHB 4PJFF 1WLHA 2ESVD 1DBJL 3V4VH 3RVTC 3VRJB 2JF1A 4FQJH 2FLRT 2AK1L 4OLVH 3ULVF 3CFKB 3BZEA 5DHYB 5C70A 3U36A 1C5CL 4N9GA 4HFWB 1II4E 5JZ7D 4OCMC 2DMCA 1LDPH 3GIVB 2EDYA 4U6YA 4HIXL 3VXTB 3MSPA 1OTSC 2PXYD 2WUBH 5IP4A 5D2LA 2C4FT 4JCLA 3H42H 1NGYB 1BVLA 4OT1L 4FRWA 5CBEA 1JTOA 1A47A 1XGUB 2DD8H 2J8HA 1BGXH 3BXNB 3WE6B 4X6DB 1J0HA 5KOMC 1MFAH 5DMGC 1MFEL 3SPVB 5FKAB 2AK4D 4Q6IA 3HPLA 4PRDA 4RDQF 4HHAB 4I5BB 5F9JA 4KKCD 3BKCH 4UINL 4JLRB 3WFCL 3QCVL 2YSSA 2VLJB 5KANG 4P46A 1T3FA 3OKKB 2A9ML 5C09A 2D31A 2NY0B 3ARPA 1WVZA 4KV5E 1NFDB 3FT3A 1KPVB 5MP6L 1FG2B 4WHYH 1MRFL 2GSGB 1MFNA 1UADC 4FXLA 2VAAB 5TF0A 3QPXH 3IJHA 2AQ2A 2VLKA 1FO0B 4YGVB 5D93B 1KB5L 2NY0C 4OZFA 4GRWH 1GOGA 4PJHB 1K85A 4UQ2B 2DDQH 1HI6A 2NLJB 1TMCB 5DQ9B 2IMMA 3IDYC 4L3ED 1B0RA 3L6FA 2VL4A 5D2LF 4HKZA 4ZFGL 4WWKB 3QXTA 4UQ3B 1G9NL 1KXVC 3MCKA 4NO0B 4G8GE 4JFEE 4WUUA 5C0CB 2JB6A 4YXLH 2WQRA 3CLFH 2VZ1A 5HHNA 4U2ZA 1C16B 1S5HA 5MENB 2X42A 4TULL 5CP3H 2HFEA 4X80L 5L2JB 4KVCH 4OFVA 5H35A 1E4WH 3WNLA 4K9EL 4AEEA 5IK3B 1EZVY 3LDBB 4Y4KA 4LHUA 1H0DA 1ZHBB 1FNEA 4L9LB 1INQA 2BJML 5K59F 4NGHH 5C9JA 1C7TA 1BOYA 2ZG1A 4R7DB 4MNQB 5KSAA 4YUEH 1NDMB 3PJSB 3T3PF 4EUPH 4FQCH 1LHZA 4U1SB 1A7RL 3T2OA 1QO3B 2XFXA 2YD4A 2KQNA 2CRIA 3S96A 4DEPB 5DMKB 4HFUL 5HYJB 3BUYB 5K9QI 4HWZA 5ADPL 3TBVB 1KIPB 3RZCD 1IAKA 3KPRD 4NKMB 4QXUH 2WIIA 4F57H 2ICEB 5GGSB 1EEZA 5C3LD 3OQ3B 1HDMB 2C4XA 3S88L 3LSOA 4XPGH 5CGMA 1NMBH 4GXVL 3L3DB 2UY7A 5HY9B 5CSZA 3HNVL 4OD2A 2W9DL 1AKJB 1E4JA 3TM6A 3QUMA 1CDGA 5EZIH 5F9WB 3C5ZC 4OZIE 1I4FA 4XP4H 4MLIA 1S7UA 3MV8A 3GBLA 1NKOA 2OL3H 2R2HB 1GPOL 2UVFA 5TJWK 1X9QA 3KPNA 3AS2A 4NM8H 2VERN 1EEYB 1G7HA 3QDJD 5F9WC 4DCQB 1MJ7H 3ARRA 1NCNA 4KRPD 1TVHA 4ZFZA 3MROA 3UYRL 5D7IE 2EEAA 2R2EA 4QF1B 3TYGH 4R8WL 2ZOKA 4LDEB 2C26A 5CFHA 1CK0H 1DE4A 4HT1H 4BFEA 1MI5E 5EO0A 3DLQR 3O3AA 3QXAB 5GS0C 2VIRB 3ROLB 4RX4D 2VC2H 2YWYA 3EDEA 3KJ4C 4LPYA 2EDHA 4POZD 1EO7A 3P0YH 1CDUA 4RGMB 4TTDC 4P9HC 2O5XL 5JHDA 1BIHA 4G8EB 2BVEA 1D6EB 2ZSWB 4KHTH 3D9AL 3EUUA 2GCYB 2WBJA 4OD3L 3NPSB 4GAJH 4GQ9H 2E7LA 3HC0B 1NCTA 1N64L 3EKCA 1LEIB 2X4NB 4DGYL 5ANMA 3GJEB 5F1NB 2KZ1B 3S5LA 4LLUA 3EJJX 5DD3H 4B41A 4KC3B 2VDMH 5J11C 3IVKA 2VDNH 3TESA 1YNKL 1ZA3A 4R90L 2O26U 4OCWL 3NPSC 4NHUA 1L7TL 3M07A 4KJPD 3SGDI 5B38G 4P3DA 1KXTB 5LCVL 4AYFA 3AM8C 3I6GA 4OKDA 3LS5L 4R4FL 2J8UA 5IBLC 2WLZA 1CXEA 2NY4D 1BHGA 4XPTL 2IH3B 4JN1L 5B3NA 4ZYKB 1VKXA 2R1YB 2EYRA 2DQUH 2PYEA 4EDWL 4J4PC 1XT5A 4F37F 3JWOH 1UM5H 5K33A 4KJQC 1VPOL 4G9FA 1DLFL 3LKOA 3MRIB 4P2OA 1SBSL 4W68A 1R3JA 4PRPA 3HZVB 1OSPL 1H3PH 3BQUC 5C7XL 1YMMB 3U0PA 1TTGA 3MLZH 2R0ZH 1RZJH 5CZXC 4DWHA 5ACLA 4P4RB 5AUMB 2Y23A 2V5SA 2X4TB 4NUGL 2YBRB 3GM8A 1SEBA 5IW6B 4MDIA 1XIWB 3K8KA 1LE5B 1Z0NA 4KK9C 2AKRB 3VFOA 3QG7L 4X99A 1P7HL 2YN3A 4XP1H 5FM4A 1S7TA 4GS7B 3CFBB 1MUJA 2J8UF 4HJ0D 1BM3H 2VISB 4HCRA 2Z35B 1L7IL 1ZHLB 4GRWE 2PW1B 1M6OA 1RZGA 4HIJA 2DM4A 3C08H 2P1YA 2RIKA 3BD4A 4RGNE 1LWRA 3TIEA 1MLBA 1IKFL 3HI5H 4DOHB 2HJFB 4TPRH 3K2UL 2YS4A 1LK3H 4PG2C 5T1KB 5J1SC 3UJJH 5ETUA 3HHRB 3LH2L 3S97C 3C5SB 4GS7C 4H88H 3VCLB 1UZ6F 2BNQB 4Z0XA 5IHZA 5IROA 4BQ6A 5D1XC 5GS1A 1KJ2B 4BZ2H 5LGHH 2NY2C 2CKBL 2XA3A 3K8LA 4B50A 1FGVL 1UWGH 2ADIA 4F58L 4CVUA 5DJ6A 1XF5A 5EIQA 1M7IA 1XGYL 3EYVA 3ES6B 4WGWB 1F3JB 1SYVA 2R0WH 3RAJH 1MOEA 1QFOA 2NY6B 3IDNA 4JGUA 4DVRL 2BXYA 1PG7W 4LQFL 2OM5A 1A14L 5GRVK 3V8CA 2R15A 3RVWD 4L1HA 4G7YH 1KIQB 2BFVL 3MGTA 1XF2A 3PUCA 4Y2DD 3UO1H 5C6WH 4LRNH 1FO0H 3OXSA 1I1YA 4PJGA 4IRSA 2H9GA 5IR1A 2BNRA 2F8OA 4X4YB 5IOPB 2W65B 4WV1C 5A2KH 4TNWF 1U8KA 4MVBC 3RL1B 3G5VB 1NCDL 4S2SA 4L4TD 5IFAL 1DQJB 5GS2H 5ALBL 4QHUB 1IRAY 4DFIA 4MXWH 2P8MA 1N5YL 3E6HB 3V4VL 3CSYA 2YD3A 4GRLD 4Q9CA 5FO7A 4FQJL 3DURB 2C9AA 4FG6D 3WNPA 3T2QA 3QIBB 2ED9A 5A2JH 4HGKC 3UX9B 2CJUL 3WHXB 4K23H 3RNQB 2J5LB 3IJYB 4JDVA 4GUPA 4MYWB 4OAWB 3MA7A 1R5WB 2J6EL 3K4DA 4IDLA 5BXFA 9CGTA 2WUBL 5KN5B 3H42L 5CJQH 4DN3H 4JFPB 1EXUB 2FO4A 4OM0H 1BGXL 4PLKD 4G8IA 5L2KE 3NZHH 3MRMA 1UJ3B 1MFAL 3F58H 3QIBC 3BYYA 4WJ5B 3WEXB 5BCAA 1UXWB 3LD8C 3HS0B 3QT2A 3CNKA 1G7JB 2J5LC 3BZDA 4EBQH 3BKCL 4X6FB 1MCIA 4FABH 4EVNB 4FTVA 3DOSA 5DT1H 4PJGF 1A1OA 3M1BB 3QDGA 4WHDA 1A9BA 2F54A 4XNMB 1KTRL 3LQZA 1UJ3C 3GJFB 1N7MH 3ZT7A 2NY7H 1W0VB 3QULB 2AXFA 1VHPA 1BZ9B 4NRXB 5DF0A 2G5RA 3ZKSD 2NZ9D 3QPXL 4F7CA 5CEYB 5DLMH 3F7RA 4KKAC 3QFJD 3KGRA 3P77A 4RMWA 2DDQL 5F7WC 2QEJA 2Q76B 1QFPA 4J6RH 2X05A 4M5ZH 2B20A 5I18L 2W9LA 5J7CC 5EPMB 1K4DA 2A6DB 1JK8A 3U0TA 3NCYS 4JQIH 3WL9A 1I1RA 1CFSA 4YXLL 4DZBA 2ENSA 3DUUA 3CLFL 3GMNA 1MJJB 4WO4D 5D1ZB 2FEEL 5FO8A 3T3ME 4E41D 5GS0H 4HLJA 4J1UA 4UNTA 4R26H 5CILH 3QBTB 5HGBA 1E4WL 4Q7DA 3VDCA 3MLPA 5J6HB 3MRDB 3SDDB 4P9HH 3WCYA 4NDMB 3BEVB 4EQ3A 1XF4B 4U6HA 3G6AB 2AJZB 2FX8L 3MUGA 4WEUD 4K71C 3JBG7 2IH1A 5INDA 5FHBH 1AQDA 3FT2A 4NKOA 1HSBB 1DVFB 3O6MH 1K9TA 4WI6A 3IXAB 5ENWB 4OQTH 3TVMB 3PDOB 2NX5B 3SDDC 4MQTB 4MXQD 1U36A 3DRTB 4LLMA 1CGTA 3VWJC 1T5XB 4QXUL 5HI3D 1X7QB 1VDGA 4F7PB 3QI9D 5C0NC 3I6KA 1DVFC 1VGEL 4MLSA 4MA7H 2YZ8A 3TVMC 1UH4A 4CJ0A 4XPGL 4X0KA 1NAKH 1A7QH 4MWFB 1NMBL 4ODXA 5IBTH 5DFTA 3VXUB 3SKMA 3VFRB 4PRHE 1MIMH 4XXCA 5DRNB 5BW7C 5EZIL 4NQDA 2NZIA 3GMLA 4JM2A 1M71B 2I24N 4XP4L 1MCRA 3BZ4B 1P9MA 4I9WD 3SDCB 2Q6WB 1X6LA 2I26N 5ERWA 2OL3L 3TN0D 1RK1A 3G5ZB 5IEKA 1QNZL 2IBZY 2CDGA 1YEJL 2M2DA 2PW2A 1ZV5A 4NM8L 4ZO6A 4ZFOB 3O8XC 2V5YA 4Y4FB 1RK0B 3ESUF 1MJ7L 4ZPTA 4X6DE 3SDCC 4A6YA 4JHBA 3O6LH 1A6UH 3VFTA 1SY6H 1REIA 2DYPD 3LN5B 3TYGL 4K55A 3IDMA 4TQEH 4HT1L 4UUJA 5ECJE 3O3DA 4I0KA 2V7NA 1AGEB 2VLJE 4Y4FC 3RIFF 4R4NC 4OB5L 2BMKA 3BPCA 4PB0H 1NFDE 4Z76A 3P0YL 3VXSB 1QSFB 2D9CA 1SYSB 3MV7A 4Z0BH 5F70A 2V7HA 4KHTL 4JVPA 1QRKA 2XN9A 2BC4B 4LPUA 1H8NA 4GAJL 4JM2F 3TA3A 2OR9L 5HPMB 3QUXB 4OI9A 4OF0A 3IT8D 1FL5B 4ORZC 3PQYB 1DFBL 4PJHE 4OCRH 4QOKA 5DD3L 4DZ8A 1ZANH 5EU7C 1MVUA 3H9HA 4M8VA 4HKBA 5SWSA 2HAZA 4LAJH 1RFDH 3QUXC 5C0CE 5DURD 4B7LA 4PJ7A 2VZVA 4JFYB 4M48H 3C6LB 2ZNXA 2J8OA 1KJ2H 4QRUA 1ERNA 4BQ8A 5MENE 1IEHA 3BP6B 4NN6C 1ND0B 2WNGA 3WJJC 3C8DA 2DQUL 1GHFH 1JMXA 4ZUTA 1NEUA 3MFGB 3G5YA 3HCVB 3JWOL 1UM5L 3C6LC 1JF5A 5MEQB 2I9TA 2NMSA 4OF5A 3DX8A 5IVOA 5I1JH 4ZS6C 1WFNA 3GSOA 1H3PL 4XMLH 1FFPB 3DMMD 4MNQE 3MLZL 2R0ZL 3FO1B 4X7EC 2Y07H 3KXFB 5ISZA 3GMMA 1F02I 1FHGA 4JREB 1KGCE 5HYJE 3MJ8A 4HKXB 1S78D 4LLYB 1N6QH 4XGZB 5KSVA 3O6FD 4MHHI 3UZEA 5MI0B 1HH9B 3TJHC 3RIAK 7CGTA 1Y18B 3D0LA 1JNHB 2AEIT 4PJ7F 5HHMB 2ESVA 4XP1L 5GHWH 5AD0A 3PP3H 5IB2B 3EDDA 4JREC 1BM3L