1KJ2B

Murine alloreactive scfv tcr-peptide-mhc class i molecule complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
117
structure length
117
Chain Sequence
VTLLEQNPRWRLVPRGQAVNLRCILKNSQYPWMSWYQQDLQKQLQWLFTLRSPGDKEVKSLPGADYLATRVTDTELRLQVANMSQGRTLYCTCSAAPDWGASAETLYFGSGTRLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A T cell receptor CDR3beta loop undergoes conformational changes of unprecedented magnitude upon binding to a peptide/MHC class I complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Allogeneic H-2Kb MHC Class I Molecule
total genus 20
structure length 117
sequence length 117
chains with identical sequence E
ec nomenclature
pdb deposition date 2001-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kj2B00
2ITCB 1NMAH 3WIHH 3CLEH 2MNUA 5IHUH 4P2OB 4Z5RB 4CVXA 1FNEA 2XNAA 3BGFC 5D6CA 2OZ4L 4UQ2A 3V2AR 4PTUB 3MUGA 4GRWB 4JM2B 1MOEA 3QO0B 3KXFE 5SV3A 3D3VD 2GIYA 2YSSB 5TE4H 2W0KA 1KXQE 5HYJE 5HHPB 2NX5B 4HKBB 1RZ7L 2XZAH 4HK3J 1ZMYA 4RISH 5C0CE 1BZ9A 5L2KA 2OL3A 2LU7A 3P11H 5I15L 3NCYS 2NLJA 1S9YA 3EZ8A 1A02N 1JNHA 3T0WA 4QTIH 4PJAF 1DBJH 3VFPB 4X98A 5CWSA 3WLBA 3O0RL 4WWKB 4BH7B 5C2UB 4LEOB 2HVJB 4LSVL 1JPSL 4F8TA 3R0NA 4LCYA 5ID0A 1D9KC 1OY3B 4GBXC 4ZFOA 3PWLB 4MHHI 3L3HB 1XF4A 3AS0A 3GIVA 5LGHH 3TNMA 4Y19E 5HDOA 3EJZD 3DARA 1NUDA 1AC6A 1KJMB 2VUYA 1MCCA 4PUBL 4FRWA 4CNIB 3G6JE 3P4OA 5JORA 3V7AE 4EEEA 4KRPB 1KG0A 3FFCE 3GSUB 4OGYL 3L3KB 4OF8A 3S35H 4HIXH 3UJIH 4UNUA 1T03L 1B0GA 1NJ9A 3MXVL 4K7PL 2WP3O 1LP9F 5D7IA 3LQZA 4YLQT 2MCG1 5CEZH 2VN7A 2ZUUA 1DJSA 1IGJA 4OGXL 5FHBL 4DOHB 4EN3A 3G6DL 1B0WA 3HUJE 4HPOL 5KAQF 4K3JL 4S0TD 3MUJA 5TE4L 4LMQI 3AVEA 3CFEB 3I2CH 2Q8BH 5DFWH 1AHWB 1EJOL 2WQ8A 3LEXA 4Y5YA 2YBRB 3GJFH 4Y4HA 1A3QA 3W9DA 4UIMA 2VLRB 3WIIL 5MEPB 2HMID 3DJ9A 5E94B 2EH8L 1LE5B 2QLVB 4IRSB 1TENA 2G2RB 1J8KA 4P5KA 2VLKD 1AGEA 5TQ2L 3STBA 3VRJB 5I6XC 2FX7L 3AB0B 2BNRA 2I9TA 4Y4KA 3NH7H 5C07B 2ZUXA 1YA5A 2C3GA 1T7VA 2MQ0A 4MXQD 3JWDH 1XR9A 1AO7E 3OAZK 1FV1A 3CCHB 2P8LB 3HI6H 1IAKA 1U92B 1OHQA 3QJFB 2ZWLT 3P9LB 4YJZL 5E94A 1LE5A 2WINB 4LSQH 1CFTB 2AJSH 4G6MH 3U1SH 4NZUH 3W9DB 4PJHF 4X6DF 1FORL 4Y4HB 1U36A 5INDA 2VUOA 1I7ZB 1P4BH 5EZOH 4R2GD 1JGLH 3B8YA 1EEZB 3CFEA 1NCBL 1N3NB 2V9RA 3QAZB 2GKIA 5F1SA 3FB6B 3RUGA 4G9FE 3PNWA 2XTJE 1NMCC 4ENED 5GIRB 2VERN 3HG1E 5IB5B 2IJ0C 3MV01 3UPRA 4NQCD 4OZGF 4P5TD 5F21B 2L4OA 2PTUA 1EUTA 3L3KA 3STLA 4ODSL 1I75A 5EU4A 5I8EB 1MFEH 3MNVA 4MNGB 5LGJB 4GW5B 1MVFA 3KPTA 1MCOL 1PG7W 3P4OB 4Y1AE 5JORB 2ORBH 3DV6B 1IL1B 1XH3B 2QQLH 4ZFFB 3TNMB 2HFFB 3EYVB 1S5HA 1KFAL 3CK0L 3OF6A 5FK9B 1IGIL 1CFNB 1ND0B 2FWOA 1N0XL 4HPYL 1YJDC 1II4E 4LF3B 1ZEAH 3DVGB 1HSAA 4OKVA 2I5YH 1R5WA 3C5ZA 1IRAY 1CLZL 4PRBA 1E6JH 4G80B 5CWSB 3VFPA 3BW9B 1I3RA 5H35B 5E56A 4YBLB 5IMOB 2XN9E 1N0LA 2ESVB 4FN0A 3BKYH 1SY6L 2ERJC 5SWZA 2OL3B 5L2KB 4Q58C 1BZ9B 4PJXF 1LK3L 1Z9OA 1SY6A 4PJAE 1JFQH 4LPXA 3VFUA 5JMRA 5DQ9B 1X5GA 4PJ8A 2YSSA 4DK6A 4O9HL 1KB5L 4MD5B 3DX8B 3GSWA 4CU6A 2GW5A 2M8XA 3I85A 4PTUA 3RUGF 4UQ2B 5C92A 4MA7H 4LHJB 4LLYB 4UDTB 2DQIH 1KGCE 1YN6A 3VD9A 2I24N 3VI3E 3I75B 5I71C 1U8JA 3NIFE 2WBJB 2Q3ZA 4WTWA 1FZOB 2Z4QA 1RZJL 3KYNA 3ARBB 1KB5H 3MRBA 4HDIB 1EFXD 5D1ZA 1RUMH 2O5ZH 3GSQA 3HCVA 5F1OB 3QNXB 1FNGB 3KXFA 2R56H 5C0GB 5KSUB 2HT2D 1REIA 4K9EC 1DVFA 1QUNA 1U8IA 2OTUB 1I7UA 5ALCL 2QKIB 1CLOL 3H3BC 1T21A 5K9JH 4HZAA 4R2GC 1A8JH 2ADFH 1A7PH 4MQTB 3UTZB 1YYMH 4RWYL 2EIZB 3LQAL 4XX1E 5HHVL 5BOPA 4OLXH 1FYTB 3OXSB 1F90L 3PF2A 2VXQH 1DL7H 5J4MA 4XBEL 5C0RL 2VDMH 2VXUL 3ME0A 2NY4D 3QEUA 2X4UB 3IDMB 5E4EC 5CKGA 4PJAB 2FBJL 3UPCA 4PJ5B 1KEGL 4AIZA 2GYSA 4KFZC 4JFFE 1U8OA 7FABH 1A4KB 5J06A 5D71H 3MRKA 32C2B 1JNLL 1IKNC 4RQQB 4OCXH 3SDXA 4NQCE 4I13B 1VFAB 4YHOH 1H5BB 4MAYB 1MAKA 2MMXA 4PJCB 2AJVH 1E6OL 1D6VL 1EAPB 5C09B 5I8KL 2OM5A 3MRPA 4Z7VB 1DLHA 1OAUH 3VXUB 1Q38A 4X6DA 2ENSA 3U4AA 1BFOA 2HWZL 2DQIL 2PXYA 3MV8E 1MRFL 1ZHBA 1F8TL 4QXTB 3QG7L 4PB0L 3WIFA 4QHKJ 3FQWA 5D1XB 4P2QE 2W9EH 4Y8AA 5CBAB 4NWTH 4MVBD 1FE8L 1T4KA 3HPLA 4BUHA 3QIUA 2JKXA 4M6NL 4NQED 3UTQB 4YHMH 3RZCA 4TTDC 5DUMH 3OKYA 4QHNA 2PYFB 3F7PC 5T5NF 5IQ7H 3SBWA 1WQVT 5F9JB 2FGZA 1PQZB 4RAUA 5HHOB 3UTTA 3FFDB 5DEGB 2Z92A 4K07A 4NRXA 3QHZH 4TNWK 1CD9B 5HSFA 1LO2H 4KK9C 4NQEE 1XGQA 1SY6H 2P5WB 3QQ3B 3JWDC 1QNZL 4PV9A 1J05B 3DPBA 4PTTB 4LDOB 5E6YA 2NNAB 2DM2A 2WUCL 1KN4H 2VTFA 1EBPA 2VAJA 2R69L 3LKNB 1G7JA 4D9QE 5I1KL 4KHXL 4QY8B 5GGVY 3OR6B 3WO4B 4XHQA 5F6IB 1IGTA 4DQOH 1NDMA 3CFCL 3V6OE 2DLGA 5C07E 5EIQA 2HH0L 1MCKA 4UTBH 1WZ1L 2VDQL 1B88A 4PIRF 3MGOA 1C5BL 4RA3A 3TV3H 4JGUA 5D93B 1QPXA 2F53A 3IDIB 4X6DE 3ZE1F 3ULVF 4JCMA 1I1YA 3ROLB 4QWWD 5IP4A 2EDOA 4LAQH 1BREA 1DEEA 1IC5L 4X9GA 4JQIH 4JO3L 3S37L 1UWGH 3S88L 2FB4L 3O6FA 2ICEA 4PJDF 4ZUWB 1A7OL 1W72H 5JNYB 3SE4A 3O2VL 5B3JF 1B6UA 1A1MB 1R0AL 4JFDD 1JL8A 2YA0A 1KN2H 2NTFA 1K6QH 4MSWA 4FQPA 3AM8A 3ZLQC 3KLHD 1S8DA 1ZE3C 5A3ID 1IAMA 4A2MA 4WGWB 4PRPD 3R06B 5EN2A 2AGJL 4HIIB 3UPAA 3W0WD 1MNUH 3B9AA 2FYYB 4L3EE 2PXYC 1YUHA 2R1XA 5IBUB 4NO3A 4PBVC 4ALAL 3LY6A 4HWEH 3VMPA 3QUXD 5EU3A 2Y25A 1NFDB 4NQVA 1C7SA 1UXSA 5EOQL 3ZKNC 3SPVA 4HUXA 4MDIA 3LH2H 4XVSH 1X4YA 1RUPL 2W0FA 1UKSA 3U7WH 4OT1L 3JVGC 3VRIB 3IS1X 4C83A 5I1CH 3D39B 4OLYH 5FO9A 1HINH 3HG1D 2R4RL 4OZGB 5I1IH 4HAGA 1GJIA 2NY6C 5IHUL 5SWZD 2ZSVB 4LVHB 4JLRB 5DA0B 1YPZA 3EUUA 3CSYA 4HW6A 4G8GB 2WLZA 5J1TC 3VDAA 1MCRA 1T1ZB 1JHLH 3FQRA 4NO5B 4AL8H 3ZO0A 3EFDH 4HBCH 4KZEL 5IBTH 3ZE0F 2G5RA 1XR8B 4DZBB 4R90L 3ZDYF 5KZCD 1SJXA 4KDTC 2A1WL 3EKCA 1P6AB 1Q8MA 4LCUB 5EC2A 4LASH 1TZHA 5IB2A 4FQJL 1FJ1B 4QRUA 5JPNB 4UI2A 1OB1A 5HI4D 2JELH 1AD9B 4YX2L 2ZUSA 5CAYB 4CMHC 1U8HB 1ZS8A 3QUMA 1MJ7H 1JBJA 3MNZA 1ZOXA 3BGMA 1FAIH 1F3JB 4NCDA 3ET9F 2UWEA 1QSVA 4I3GA 3QR2A 1M7IA 2D9QB 1T0NB 1BVLB 4X99B 1HN1A 4P57A 4W70A 5TE7L 3U4EA 1LO5A 5HGAA 4X6CB 5GRJH 3GSRA 1ZLSH 3VCLB 3JV0A 3L5XL 1NBQA 1U3JA 4WI4A 1DE4B 1CK0L 2NY7H 2ZP0T 4KDWA 4NZDA 1JGLL 3VXMB 3VGFA 4FXKB 1RU9H 3H42L 4UINH 2QQLL 3QDGB 1CQYA 4XC1L 3O8XD 5ICXA 3X11B 4U0QB 1J12A 3OZ9L 2HKHH 1NCDL 1JYVA 2X4RB 2PO6B 3GNMH 1SJEA 4A6YB 5FAAA 1SMOA 4K7PY 3T0EE 3SQOL 2P49B 1CLYL 4Y1AA 5JXEC 1XCTA 1NC4D 1RZ8B 3CXDL 1LO3H 4WFFE 2Q6WB 1KN4L 4HX1A 2F54A 3FQXA 3VWJA 4BFIA 5H94B 1IQWL 1TVBA 4G6AD 3CFDA 5FUZL 3DMMD 4IRZH 5IFJA 2X4QB 3GSNA 3MZTA 3CFJB 1KJVB 1QR1B 3PWPE 2YA2A 1MJ7L 4PYGA 1FAIL 3V6FA 1ZHNB 2Y06L 4X5WB 3WIHA 4HAFA 5JHLL 1UQSA 2EYRB 4K3HA 3JWDL 1VGEH 1JF1A 4BFEA 1AE6H 3U6RB 2A38A 4H8WC 4I77H 4PFEA 2QHLA 3CXDH 1D9KB 1ETZA 2BHUA 1F4YL 2NW2B 3IJSB 2AV1A 4LHUA 4J3OC 4S1DD 2ARJA 4NQSB 4F80A 3CFBA 3P30H 2FSEA 5GSVA 5IB4A 1T22A 3EZJB 3BSZL 2R0KH 3G6JA 1QA9B 1J8HD 1CLCA 4WI2A 1IJ9A 1P9MA 3GFUA 1I8IA 4YFLF 3VE0A 4F7MB 1KTRL 2P46B 4BK4A 2O5XH 3RVWC 3ILQD 1LNUB 1RK1B 2VWEE 3VMOA 3WNOA 1TPXC 3CSPA 3ZDXF 4ZOAA 6CGTA 1ITBB 1G9MC 1RUQH 2DYPD 1FG9C 5GGTL 2PN5A 1W0VA 1DBKL 2VR9A 5B21A 4X5XB 5AZEL 3K0WA 4LNVA 4ZPTB 2DI7A 4Z0XA 3V4VL 1QFOA 2R23B 3RWGA 5D7SH 3A67H 3U9PL 3CGTA 4U1MA 3TT3L 1T6WA 4X4YB 1F02I 2JJTA 4LCWA 5EOCL 3O2DA 4HWZB 3VXNA 5F6HJ 3RX5A 5BZDA 4YPGB 1IEBA 2VDML 4JY4B 5E8PA 5E5MA 1AFVL 3FT4A 5LAXA 3RWHA 1UC6A 1CQKA 2E7HA 4JFED 1FPTL 4HWNA 1WFTA 1UM5L 4G8GE 2HP4A 2BFVH 1LILA 2FNBA 5CP7A 4P2YA 3O3BA 3VI4F 3ARDD 5GS1C 1YEKH 3HAEB 1BJ1J 4WHCA 4XNZB 2DIBA 5D1QC 1PEZA 4JGJA 1MFBH 1RZKC 4FTVD 2C3XA 1TCMA 5IVZA 5CLTA 3BD4A 3BP6B 4N9GB 3QFJE 3I50L 4ODTL 3T3MF 4NHCL 2DLEA 3MV7E 5ESVA 5FKAB 2AABH 1RUML 2XN9D 3C60B 5IT2L 3KPPB 1ZVHA 2E9WA 2NR6D 4GT7A 4R9HA 3S37X 3IKCA 3WXVH 1YC7A 2CRZA 2DBLH 4LBEA 5F1NA 3LAFA 2H1PH 4Y4FC 4G6JH 2FR4B 2X1OA 5DJZB 1FFPB 5DS8B 5C0DB 3TIDA 4N8PA 3RI5F 1KJ2A 2DYPA 4NZTL 3CX2A 3PWJA 1AO7B 1ZHLB 2XKNB 3LN4B 4PJDB 4NUGL 2APVA 4HLJA 4HKZA 2PR4L 5T5NG 3C08H 1VEPA 1YNTB 1DQJB 3ULSB 1A6ZB 4XCYA 4M6MH 4NQUA 1HHGB 5HPOA 1H3PL 5EZJB 3ROOA 1DFBH 4JN1H 4FQXB 1ZLWK 1EEQA 2FO4A 1QFWI 3IT8D 5DJYA 5LXGH 4JB9L 5CZVH 4FZ8L 5TH2A 4HJGB 5I19L 2AXHA 3RVXC 1UZ8A 4EDWH 3WNMA 1IGIH 3EO1A 5GS0C 5DDHB 3D9AH 5KSAC 4NO0B 4HXBL 2BX5A 5I30H 4C59B 5GGUA 5IOPB 3BWAA 4FMFA 1E4WL 1I4FA 3FT3B 3L95B 3IVKA 3KPRB 2R0WL 3RX8A 1F3RB 1JPFA 4M62L 4RMVA 3FQTA 1Q0YH 2WWMD 4Z77A 1X5HA 1MWAA 2J88L 4ODVL 1OM3L 2QQNH 4GXUM 4NRZB 4G5ZH 4E42A 4HH8A 2H2PC 1AP2B 4XAWL 2FIKA 2JJUA 4GAYA 1E6OH 1OARH 5HVGB 1I3UA 2R2HB 1A7QH 4PJEA 2R2EB 1B4RA 3TYGH 3VDBA 3K4ZA 1UJ3C 3LD8C 5T1DL 3JTTA 1YYLH 2XZQH 2CDEB 2QADB 1QP1A 4TSAL 1Z5LB 2UZXB 5H2BB 1ZWIA 3FB5A 1NC2A 2UUDK 2DL9A 3C5SB 2IADB 2J88H 4ODVH 2V9QA 4ZUSB 1QG3A 2KDGA 3M8OL 3NABH 5KSBA 3KVQA 4G9DB 1KT2B 3HC0A 2QBWA 2Y5TA 5E8NB 3G5VA 4CUCA 5I18H 4M00A 4TRPL 2AEQL 3T8XA 1NEZA 4F37F 5D96B 3R1GL 1N26A 1BFVL 5T3XD 3OKNB 3RWFA 2JIXD 3WS6A 4GRWF 1RQ5A 4RWYH 2DTSA 4MD0B 4N90E 1CICD 5HYFA 5JLZA 2FL5B 3MV8B 4I0PB 4X4XA 3UCRA 2BZDA 4WENB 1MY5A 1DN0A 4C54A 2UVFA 4NNXA 5C0BB 2JJSC 1GGBH 5HBBA 1IGMH 4JZNA 4ELMF 4R4BA 3FFCD 4TSBL 3QI9B 4MJIE 2J8UB 4ODWB 4WJ5A 4LSPH 1JWSA 4GXUN 1S7XB 5CJQL 1U8NA 4MJIA 3IXAB 4EUPH 2P5ED 4OD1L 4WNQA 5GISL 1HYSD 1DVFD 2V7HA 3MLYH 1A6WL 3MTRA 2VKWA 4NQDA 3WN5A 3O11A 4FFYL 4ERSH 4NP4L 1D6VH 3GMPA 1KB5A 2QSCH 2XA3A 4HKJB 1N6VA 4F58L 1SQ2N 1IGML 2DQTL 5FGBA 4RGNC 3RWIA 1S7VA 4XCEB 2FJGB 4JM2F 2XWJA 3H9YA 3ZL4H 3I6LD 1H8SA 4JG0L 3ZHKA 2YD2A 1YQVH 1NGYB 2X4NA 4QRRD 1MVUA 4P2OD 3MRGB 5DK2A 3VXSD 5T1LD 2D7TH 2YA1A 3OG4B 3ARGB 2ZKHL 5FYKL 3D3VB 2W1NA 2X4PB 1JZ5A 1NLDH 2NX5D 5A2LH 2VAAA 3PWVA 1UM6L 4P2RA 4BQ9A 3L3OB 1FFOA 3IDGA 2E6JA 1IEAA 2B2XH 4QHMB 1S7QB 3SE8L 5CSZB 5EOTB 5CS7A 3MJGX 2IPUG 4YR6A 5FXCH 3X12B 4L8SA 2Z35A 2AK4B 4KK5C 1URLA 5HHXL 3VA2C 1I8LC 4XB8A 3D25A 3S5LG 1R0AH 1G7MA 4GSDL 1J1PL 1JGUL 1U93B 2IALA 3H3PL 2E8ZA 3CNKA 1HK6A 4Z7WF 4NC0B 4OGZA 4PJBB 4QOKD 5ADOL 5IFHL 5FB8A 3IDJB 3PV6B 4ZXBC 1MAML 4XBPA 4U1HB 4NQDD 1YEHH 4D0CA 1CDBA 4TUKL 1FNFA 3RBGA 4POZC 4OF6A 3E8UH 1CDGA 3SE3C 3MRCA 2R29L 4MS8C 2RAMA 1KYOK 4MS8D 4PJXE 5JDJA 4KUZL 1TQCC 4J12A 3RX7A 4NO2A 4OGAD 1U8MB 2BSED 1CGYA 3EO9H 5HJ3A 4OTXL 5MEND 3VDCA 4PRNA 3F58H 2HJFB 1A0QL 1PYWA 5F7UA 1Q9KA 4F57L 3QIUC 4GJTB 4KTYA 3UDWA 4NOBA 2VZTA 3RNQB 3C8KB 5I74B 1CVSC 1FC2D 1RFDH 3P3YA 5D2LF 1RZFL 1R24B 4IS6A 1R3HA 1YEDA 2V5MA 4H26A 5IJKC 2CPCA 1XCQA 5F3HA 4QRPD 3I6KA 1OCWL 2V9TA 4NPYA 3ISWA 2R2CA 1YJDH 4KMQA 4G6FB 3DGGB 3KS0J 3RVTC 1N64H 1LEGB 1JWMB 2Z31D 4L1DA 4PGBB 2IPKB 2P4AB 1I9RL 4K94L 1T83A 4ELMB 4XCFH 4MCZB 5I75B 3GNML 4HV8A 1FNAA 3RP1A 3BIAX 1FZKA 3O3AB 4NM4H 2DQDH 3BN9D 4LU5L 4IMKA 1WC7A 3E8UL 3S3PA 1UADC 5I2IB 3ZZ1A 3LKRB 4NJAH 1GC1L 3T2QA 2M2DA 1BIIB 3Q48A 4OAWA 1R3IH 4PJIA 1FRGL 1U8LB 4HUKB 3HHRB 3WJLC 1VB9A 4JFEA 5I1CL 3TGXA 4P2QA 2M26A 3IJHA 4LVEA 5KVMC 1GYAA 2OQJB 4YDIL 4OQ1A 1XIWD 3S9DB 2NY1C 3U0PB 3EJYD 1AD0B 4AJ0A 5I71B 1KEGH 2ZJSH 2X4TB 5EU5B 4LLDB 3W81A 2R2BA 2BNQA 4K55A 1CDCA 1WAAF 4DFHA 3B9KB 4OD2A 3SDDB 5FGBC 2ZOLB 3A67L 1KCVH 1Y0LA 4QCIA 2VB5A 1T7WA 4ZPVA 2MWCA 5E70A 1M71B 4LLAA 3MR9A 5T1KA 3ZL4L 1J10A 4LASL 4GQ9H 5I8OH 1TETH 4L5FH 1YQVL 4NYLB 3VXRB 3CUPA 4V1DD 5BV7H 4KPHL 4MX7A 5DHVA 3MJ9A 3QPXL 3RWJA 1I9IH 4XNYL 1G9EA 1PKQE 3WDHA 2SEBB 3MLRH 4U3XA 3V6OA 4WW2B 4PRAB 2GQHA 3NCFB 3DIFA 4PJFE 3TFKD 1FHGA 3KXFD 2E7MA 1IC1A 4KGJA 1D7FA 4XCFL 4H1LH 2VLJA 3D0VA 4LGSB 5D2NC 3MYJA 1JUFA 3WMSA 4ZQKB 5EBLB 2HFGL 4HIXL 1VEOA 3UJIL 2B4CL 6FABH 2BSTA 5DSCB 5E00B 3VWKA 4FHBD 4CMHB 4CMMA 5DJXA 2PO6C 2CLRB 2B5IC 3ZKMD 5EU7E 4MD4B 3UTTE 1BPVA 5MERB 4HF5H 4PR5A 5IESL 2YK1L 3BQUC 4O5LH 3ZSTA 5F9DC 2F54D 4KJPC 5J6HA 1X4XA 1G7PB 4XPTH 3IF1B 3EO0B 4GKNB 5EBLA 4ZQKA 4PJIE 2BCKA 3RGHA 3MYJB 1JMXA 3LEYL 1OSPL 1QVOB 5AYQA 1S9WB 3VA6A 4QXGL 3KHOA 3DIFB 1KTDB 3C6LB 4U4BA 1AKJA 1NCCL 3BH9A 2LVEA 5JPMB 1BQLL 1TTFA 1BD2E 3B43A 4PLNC 1NC4A 1H0DB 1QFWL 2G5BB 5E4IA 1RULL 2AJYH 2YMXL 4MX7B 4HUVA 3DUSB 4KKAC 3CUPB 2XICA 4APQA 1YDPB 1Q1JL 4KK9D 4ZS7H 3UXFA 5LQBH 1IQDB 5DD1H 5SWQA 4BZ2H 5F3BB 4Z7NE 3L3GB 5DMIL 3LKSA 2EDEA 3QSKB 5EBMA 3LPWA 4FQ1L 1R5VB 2NMSA 3AREB 4PJ5D 3QRFM 3GHBH 1X5KA 3QFJD 3DXAB 2ZOLA 4NNPH 5DK0A 3ZDZE 4K23H 4JE4B 5JQHC 1RMFH 5DEFA 5CSGA 3RVUC 1KCLA 1U8KA 2R2BB 2EDKA 4EDWL 4KDTA 5EU5A 4PREA 3TBWB 4P4KC 3DVFA 1YYML 1IGYB 4XP4H 4XMLL 4N8VG 3QFDA 4ZFGL 4HK0A 3DETC 1R5IB 4YFDB 4NFBA 2CIIB 3OHXA 3O9WA 4Q2ZB 4D9RE 1QHPA 4G6KL 3TT1H 3ZT7A 1U8LA 1FL5B 4XNQB 3KAAA 3QXAA 3E3QC 5AZEH 5I1LA 2MSPA 4OBSA 4TUOB 1K4DA 3TH2T 5D1XD 2YUVA 3LKRA 3PHSA 1OAZH 1JGDA 3Q5OA 2MKWA 4TQEH 5FYKE 3RBSA 3DNKA 2HYMA 1UB6A 1OGAA 1NSNL 1ZLVH 1N6UA 4CVZA 4Y88A 3HNTL 1KLUA 3EYFB 1MI5D 2Z91B 1MJUH 3CSGA 2F5AL 4Z7OF 4LAJH 3T0DA 3BXNA 4KZEH 3GKWH 5F89A 5I8CB 1R6VA 3CC5A 2ICWJ 4Z7UA 5FOBB 3FN0H 4Q9RL 3PWNA 4XNYH 3QXUA 4G6JL 3D69B 3VFOB 5ITFB 4LVOC 4F3FB 3UYRH 1CE1L 2VDKL 1SJVA 1UCBL 1YN7B 3P4NA 1NBYB 2X70B 4NFDA 1A4JA 5D8JL 1JF6A 3CLFH 2K9UA 2JCCB 4A2LA 4OZFB 4G8FB 3C8DA 4ODTH 1YEDB 4FQQB 1WT5A 3EIFA 2YPVL 5DUBB 3WNNA 5ID1A 1OP9A 1D5XB 4FQHA 4IS6B 4WHYH 3SKUD 1R24A 5B4MC 1B0RA 4PRPA 1NGQH 5CBEA 1CG9A 4WDIB 4N0FA 2WBJC 2IMMA 4YWGH 1GGBL 4JHWL 4JDZB 5DXWA 3RGVB 1PYWB 4Z7OE 4YDJA 2BSRB 1WEJL 3C9NA 3KPSB 3ILPB 5HJ3B 1IC5H 4H0GA 1KOAA 1U8MA 4F15C 3MRDB 3F7VB 4EDXA 3LN9A 1BFVH 2XWTB 2ADFL 4BSJA 5HPMA 2HTKC 2V17L 4JFHD 2YKLH 3JZ7A 5CD5C 4Y16B 1W2KT 5JHDB 3VH8A 4LQ1A 3AFLA 3CDFA 3GHEL 4W81A 1FRGH 4J4PD 3SY0B 5C9JA 1D3CA 3IFOA 3DETD 3D5OF 1MCPL 4QRRE 3QEQD 4PJBA 1WBYA 5KVGH 1F6AB 2AI0H 5K9OB 3BX7C 1G7MB 3S3JA 4LDLB 1X5JA 1HKFA 2XY2A 4ZTPL 4AT6A 1F58H 3T09A 2HMIC 4G7VH 4YHNB 3BO8B 4HXBH 2GTZA 2DMBA 3V8CA 4KKBD 1IEAB 3IAPA 4X0KB 4G43A 4JRYE 3PL6A 1U3HC 4P2RB 4JGMA 4QXGH 2R0WH 1JK8A 2DLHA 5M94B 2FJFB 3N9GL 1VGKB 3BI9X 4S11A 4OLZL 5FYLE 3D3VA 3OX8A 2X1WL 4P4KD 3ZHLA 3ARGA 3S5LB 2EO9A 2F8XC 3HG1B 1I7TA 3V0AC 4OI7A 1FSKB 3MRGA 4C56E 3PHOA 3OJ2C 4GRWH 4I2XA 2XTJB 1EZVX 4PGDA 5IHBA 5D1QB 2N4IA 1KELH 1NAMH 2VH5L 1RZIB 4JZJB 3SDAD 4F9LA 5F1IA 5KVEH 3VXRE 3B4NA 5DK3A 1A1NB 3EDJA 4R90H 2WM0A 1H3PH 1FBIL 4NSKA 1VERA 3RWIB 5DJCB 4HKJA 2VYRE 3V9FA 1J8HE 3MACH 3GMPB 4M3KB 4ZAKD 5HI5D 3U83A 3SO3B 1NLBH 5T5FL 1NGWA 4RGNB 1EGJL 4Y5VC 4JVPA 2LU3A 2O93L 1C5CH 3BUYA 4WJ5B 5DMJB 1FO0L 3RDTA 4RBPK 1ZLUK 2VO5A 4JM2C 4JZNB 4LLUA 3MROB 3OR7A 1DQMH 2DD8H 5TFSL 1DN0B 5EO0A 1JF5A 4KJYA 3CFKB 3EFFB 5I16B 3LKOB 3ZDXE 3L5WB 4WI9A 2C3VA 1U3YA 4TOYL 4MD0A 3D6GA 4E41D 1PLGH 1OT1A 1ZGLB 3N0PB 1NEZB 5JO5A 5FHAL 5BJTA 2Y5TB 3UZQA 4G9DA 4MA1C 1LP9A 1UVQA 5AG9A 3QIWC 1OL0A 3F7RA 4ZUSA 3C5SA 3D85D 1MFDL 1T3FB 3UMTA 4NKMB 1ZWIB 5H2BA 4RZCB 3KYOB 1C7TA 1Z5LA 2KZWA 1T66C 5F8QC 5HI3C 3ALXA 1BGXL 3VGAC 2ADJB 4K3GA 1SJHA 4J4PA 5DJDB 4BZ1H 3UYRL 2R2EA 4PJEB 2R2HA 1EBAA 4LLWB 3T65B 1CF8L 2C1OA 2ATKB 4ZDHA 2FIKB 2IMNA 2W0PA 3BP4A 1MLCA 1XF3A 2DM7A 4FQLL 4NJAL 5B3NA 1KTKE 3DMMB 1TVDA 2H26A 3BN3B 3BGAA 4Z77B 1ORQA 4KKLC 1FO0H 3GSNL 1ACYL 1GZQB 3L95A 3FT3A 1S9KC 3RTQC 3H8NA 2K7PA 4NO0A 2W65B 4B0MM 3DV4B 1DQDH 1PKQA 2IBBA 3F12B 5C9KA 4X9FA 3PV7A 2Y5EA 2OBGA 1FVCB 4TN9A 4D9QD 5DC4B 4ETQB 1A22B 4CADB 3LDBB 4FFYH 5E7BA 3PIQA 5C0FB 2J3SA 1GOGA 3GDBA 5EORL 2BDNH 5TH2B 1I9RH 4PJHA 5DJYB 4P23C 2YK1H 2AEPH 1HHGA 2DWDA 3QDME 4XMPH 5ALBH 3FOLB 1A6ZA 1CXFA 1KCSL 1DQJA 1YNTA 1DUZB 3O45A 3DI3B 1LO3L 4XXDA 3FB7A 2KKQA 4PRHB 4PRPE 4WI8A 3HRZA 2XKNA 1AO7A 4PJCF 1H3WM 1U41A 2DYPB 8FABA 1HOCA 4M7KH 2XQBL 4O2EA 4XPHH 5KANG 3ARQA 4UV4H 4M03A 1FFPA 4U1GC 4HPYH 5DS8A 2Q76A 3KYKH 5D7KD 2PYEE 1K6QL 4ORZC 4H88L 5FO8A 4XC3L 4PS4H 4Y4HC 2XIDA 1A7QL 5JW3H 3KPPA 1JWUA 4M3JA 4CU8A 5GZNC 4NC1E 1N59A 4N0UE 4P2OC 5L0QC 2I25N 1XGYH 2IH1A 4BZ2L 1CFQB 3BP6A 4XH2A 3BHBA 1P7HL 5BV7L 5HGDA 4Y2OA 3VG9C 3UYPA 1RJYA 4Q9QH 2C7UB 1D5MB 1RUQL 5IW1A 4KI1A 2OL3H 3EYOA 4P3DA 5SX4H 4JKPL 3O3BB 1CN4A 2QQKH 4KTEH 5CP7B 5DJ6B 5JW4N 1OOAA 2BVEA 3UZEA 2V5SA 2X89A 1SHMA 4FNLH 5CJOL 4XXCA 2LAGB 3MREB 5IM7A 3F6IA 4MJ6B 3QDGE 1ZLSL 5E5MB 5FYJE 2GJ6E 4JY4A 5E8PB 5LCVH 1RIUL 2WSKA 3NCMA 4NN7B 3L6FB 1BVKB 4U1MB 4YK4C 4MGXA 4U1KB 1P7KA 3CIQA 3DX9B 1J5OL 4APQD 5EDXA 2DQUL 2VLME 4XPGL 4ZPTA 3ZTJH 4X5XA 1RHHB 1N2RB 4AENA 5BQ7A 5HI3D 3K74B 2F8OA 1SBSL 4KTDH 3H9SE 2JK5A 1AKJD 1AE6L 4EBQL 4XNXH 2PTVA 4OF5A 3QIWD 2AQ3A 5JA9A 4Z6AT 3CFIC 1NANI 4LSTH 5GRXG 1BVKA 2VXTH 4PLOB 5L2KE 5J6GB 1FYHB 1T22B 4PB0H 2CMRL 4WY7H 4PYHA 4OCXL 2IGFH 1GPOL 3HZMB 5DGQA 3IJSA 4LHUB 4F15B 1Q94A 4OCRL 1K8DB 4I5BA 2YEZB 1D9KA 4KKNA 3SE3A 5ESQB 3EYOB 4P3DB 1RJYB 3B6SA 3BJ91 1OW0A 2J6EA 5HD8C 2QHRH 4YZFF 3UX9B 3HMXH 1HHIB 1MHPL 1WIUA 4X5WA 3V6FB 4PRIE 4RGMB 2VDNH 4JPKL 4OZGE 1CBVL 1MHCB 3WFDL 5KS9A 2W9LA 4LARL 1TVBB 4B53A 3GRWH 4Z7NF 4UBDD 4RFNB 5H94A 2A6IA 3WBDA 3P0VL 1DLFL 1G9MH 3C87A 4NC2B 2Y1VA 2Q76B 4U31A 4YAQB 3HC3L 3PQYA 3QHTC 5D1ZC 3VXUE 3SO5A 5FYLH 4NN5C 1S9XB 2WUBL 4DVRL 5C0AE 1TZIB 2YXMA 3HRZB 3OBAA 3I02B 5HYQA 4JFZL 1DZBA 1DQML 2DD8L 5TFSH 3I9GH 4WCYH 1DUZA 3O45B 3QDGA 4FXKA 5INCA 2I27N 4HULB 3IDNA 3OMZA 1QBMH 1VA9A 5D7SL 2DWDB 3U4BH 2Q3AA 1DE4A 2XXCB 1NFDF 3WD5H 2DAVA 4MCYA 1C12A 1IILE 5JOPD 2R8SL 2LAAA 3VCLA 3O41B 4EXKA 3M07A 5ICZA 3KPLB 3N85L 4DN3H 4CADA 4ETQA 4X6CA 1A5FH 4AL8L 3F65A 3U4EB 3WNKA 1WTGT 4YIQA 4RISL 3ZE1E 3ULVE 2UWEB 2NY1B 1RD6A 3DV4A 4U49A 2GEEA 4F9PA 43CAB 3SDXF 3MBXH 3QUMB 2V5TA 1GZQA 4OZHF 5JIKA 4XTRC 5T3ZH 5DGRA 4OCMC 4LCIL 4MLIA 4HWBL 4NQDE 1ORQB 5EZIH 2H26B 5BVJA 1MCIA 3RZWA 2VDLL 3SOBH 5DUML 1I3VA 2WBJD 1XF3B 4PJGE 5DTFB 3WSQH 1EMTH 3MOBH 4Y5VA 1X5IA 4G6KH 1TFHA 3WEXA 4G8EB 5JUEL 4FZ8H 2CO6B 1IT9H 4TRPH 3KYOA 4JFEE 1ZT7B 3TNNB 2BRQA 3MX0A 2Q86A 4C57C 4XI5C 5DFVD 3BAEL 4OZIB 1RPQA 4FNLL 1GXEA 1E4XH 5DMGD 1YPZB 2EDQA 4ZNCD 2ZSVA 4HS3B 4N0UB 3RAJH 5BJTB 1RV6X 5FO9B 4PGEB 2FGWL 1TNNA 2Z8WC 3E0GA 5GSRA 5J1SC 4C83B 3T0XA 4XP5L 3S98A 3VRIA 2HWZH 2IFFH 2C3VB 2OSLB 2R4SL 4HT1H 1OTUC 4FQCH 4KJYB 5EO0B 5I1GH 5F7LB 4U3CA 2D3VA 1OLZA 2ENYA 3JV4B 1MCSA 4BSWA 5ACLA 4NO3B 4HXAH 5TQ0H 3SDXE 3OKMB 3QCVH 1HWGB 4HIIA 2FBJH 5KVDL 1NGWB 3DLQR 4WFEE 4W6YB 4P2CG 3ARUA 4MSWB 5DVMA 2NTFB 4DTGL 2OR9H 1CDUA 3VXUD 1A1MA 1NCUA 2I60L 4H0HB 4ONGH 4DAGH 4XPAH 2X09A 3WFDH 4D0DA 1I1AB 3KGRA 4TSCL 1TJGL 5DJCA 4KKCC 4ZODA 4WFED 1DEEB 2DDQL 3KJ4C 3NCBB 1DBAL 3MCLH 3P73A 5F1IB 1Z3GL 1RZIA 4JZJA 5MENB 4UZGA 3ARFC 5FYKU 4GXVL 2QSCL 3L5HA 5CILL 5DC0A 2J4WL 4ZO6A 1NDMB 5CJ8A 1S7RB 3LMJH 4QY8A 3S5LA 4OB5H 1XGTB 2E27L 1G7JB 1LE9A 3NCCB 4DEPC 5ACZB 1INDH 4OFYA 1VGKA 2GJ6D 2FJFA 4B41A 2BSSB 1GGUA 3U9UA 3U7YH 1NCWH 4G43B 4IRJD 4X0KA 3PUCA 2P5WA 3QQ3A 1XGQB 1U91A 3PDGA 2AK1L 3MRIA 3CVHH 4G6FD 3MV7A 5DEGA 3UTTB 3WKMH 3GI9L 5HHOA 5HYSA 1LGVA 3N1FC 4RAVA 2BJMH 5FOJA 1MFCL 4LPYA 3W2DL 1UG9A 4RMWA 4AT6B 1A6UH 4JREB 2UWEF 1QEWA 4NBYB 4HG4J 1DUYB 2PCPA 4KU1A 1FQ9C 3RZCB 3UTQA 2Z0BA 4U1LB 2NY2C 4HJJH 1QBBA 2C3WA 2VLMD 4XP9L 2ZG1A 5J11C 5CBAA 2VXSL 4FFWD 1OAKH 5D1XA 1IZJA 4M5YL 4YGVB 2AXJA 4U7KA 4F57H 5C6TL 4X4ZA 1OF2B 2B39A 4X8XA 3LB6D 1MCJA 3QDJD 3ILPA 5A2IH 5AYUH 1BFOB 1T2QH 3C9NB 3Q0HA 1J0ZA 3RL2B 4XPAL 2LTQC 3BMVA 1EAPA 2ZCKL 3RGVA 2EXWC 2AEQH 2VZVA 1YMHB 2NY6D 5L8JB 1B0RB 1NMBL 4PRPB 5GJSH 5CBEB 3TA3D 4G6AC 3BIBX 4RQQA 4U6VH 3UC0L 5GZOC 4J8RA 3K81A 1BP3B 3UTSD 2J5LB 3RAJL 4FQQA 3G5XB 4URTB 4Y19B 4AY0A 4OZFA 1R3IL 2JCCA 4L8SC 1MJJB 3QEQE 3SDDD 1CXEA 2HT4D 5DZNA 5JW3L 3MCKB 3QUXB 1AH1A 1ZAGA 4PJAA 4F3FA 3J7HA 3K3QA 3BT2L 5GRJL 5JW4M 1GVIA 5CUSL 3T4AA 5JIIA 1GOHA 1BQSA 3QXVA 5I1GL 3FMGH 4HLZH 4Z7UB 4YBLC 5FOBA 1FYTA 3OXSA 4KV5F 4GG8B 1WTLA 2E6QA 3BXNB 3JXAA 2IAMD 3UTZA 4I18C 3AS1A 2P42B 5EZOL 1A6TA 1QRNE 5HGHA 3QIBD 1QRKA 4ZS6C 1OGAB 4M4PA 3NA4A 3VG9B 4RFOH 1U8IB 2OTUA 1Z9SA 3SGJC 2D0HA 2UY7A 2CK2A 1CGXA 1LO0H 4XMPL 3EAKA 2COQA 5FA3A 3KXFB 3QXAB 1TZGH 1FL5A 4XNQA 4LSUL 5D1ZB 2O5YH 1V7ML 2WMPA 2YPLB 4GFTB 5I17B 5SV4A 5KZCB 3O9WB 2CIIA 2X9WA 3OHXB 2Z4QB 3OKOA 1FZOA 1J1XH 2LU4A 4JY5L 4O2FB 3QFDB 1TMCB 1ZKAA 4P99A 1CTNA 3O4OB 1MUJA 1MFNA 5E8DL 5IBTL 2WAHA 1DCLA 3AU1A 4GKZA 3TBWA 1WUNT 2ZCHH 3WUZA 4CVWA 1KBGL 2XPGB 1U8KB 1NKOA 2IH3A 3MOQA 1T6VN 3BPCB 4YXKL 1MI5E 3R8QA 3WFHB 2NYYD 2DQJL 4G3YL 1MFAH 4OB5L 1WCBB 3TBYB 1YEEL 4F7EA 2V2WA 1T03H 4PJ8B 1R5VA 4LRIA 4P4RA 4QO1A 1KULA 5EBMB 1ZTXL 1EUUA 3LKSB 5F3BA 3MO1A 3C6LD 5SWQB 1GRWA 4ZSOE 5IK3B 4NGHH 1F6LL 3CZFB 5IMOA 1KUMA 2G5BA 4XNUL 3HZKB 5H37H 1TQBC 1V5JA 5I6XB 4I18A 1R5WB 3C5ZB 4S1SL 4OKVB 4YE4L 3MFFB 3O8XB 2P24B 3ARRA 4IOIA 4YDIH 5JOFA 1N5YL 1KTDA 1OP5K 4Q74A 1CFNA 1ND0A 1S9WA 4M7LH 3VD7A 1KIRB 5FK9A 1S5HB 2AJSL 2BCKB 4ZO7A 1IL1A 3CJJA 3EO0A 4GKNA 3DV6A 3V4VH 3V7MA 3JWOL 4GW5A 3WKML 3BD5A 4KGLA 3RI5K 3MNVB 4MNGA 5HDBF 5C6PB 5LGJA 3HC3H 3STLB 3H9SD 4AYFA 4MLSA 2J2ZA 1MCBA 5BZWB 3TWCH 4KDVA 4ZG1A 1IAIL 5J89A 4YXKH 5IFAH 1IZKA 1MCWW 2DM4A 1QD0A 1T5WB 4FXGB 3PNWB 1XGYL 4CMMB 5D7IE 4GG6F 5E00A 3MUY1 1N3NA 4M61A 5E4EB 3NFSH 1PX4A 2YRPA 3MODH 1JUFB 3D0VB 1DBBH 1UZ6E 2VLJB 4N9OB 5INDB 1AGBA 1JNNH 1TNMA 3D2UA 4S10A 4QWWC 2EDYA 2EEDA 1Z9LA 5C0CB 1CFTA 4RGMC 4F8QA 3C5ZC 4OCYL 1JGEA 2SEBA 5C86A 3QJFA 2AABL 4GKSA 1HDMB 2MQ3A 5DHVB 1FV1B 3CCHA 4BQ8A 1KGCD 3BMWA 2BVOB 4NN5B 4XPBL 5HGBB 3SJVB 3O3EB 2Y23A 5EIIA 4WEBH 3VGBA 2BNRB 2I9TB 1PG7L 4DKAA 4JFOA 4U6YA 3CH1B 4YHLL 1CDJA 3MR9B 1DANT 1SEQH 5T1KB 4BFBD 1FFNA 5K59F 1IC7H 3NBNA 1BZ7B 1NUGA 2YD7A 3BE1H 4HC1L 5DZOA 1U2CA 3SDDA 3BRFA 4OD2B 1EGJA 2VLRA 1BVZA 3B9KA 1VADA 4UIMB 4TSAH 5L9DH 2VITA 3ARYA 5TGBB 4D9LL 2YBRA 3SQOH 4P49A 1CLYH 4LLDA 1AHWA 2X4TA 4IOSD 4OFVA 1AD0A 4MB4A 4LPUA 1ES0B 2R15A 1RZGA 2QV2A 3MV9E 3QISA 4FQ1H 2R4SH 1XGRA 1HINL 5E2WH 1IGFL 3P40A 5LBSL 1QBML 2APFA 3H2WA 4EI5D 1IGJB 4JFEB 4FFZH 1NJ9B 1KTLB 3NMEA 3NACL 4JQVC 3GO1H 1U2HA 3GSUA 2X1PA 1KG0B 1F4XL 4OAWB 3GSXB 4PJIB 2KBGA 1R3LB 1P53A 3KPNA 4U1SB 1H3XA 4CNIA 3MLUL 2VMFA 1H8OA 4IRSC 3LZFL 4WHYG 3I9GL 4WCYL 1OD7A 1YMMA 1A3RL 2CXKA 3VRLF 5F96L 2XG5A 3PWLA 1FZKB 3O3AA 5ID0B 1AGCA 3WFCL 1A9BA 1SM3L 4ELMA 3GRWA 1ERNA 3SE8H 1NPUA 4G9FD 3HTLX 1LDPH 4BH7A 4ODBD 4WEUD 1JWMA 1OAYH 2VQ1A 3QEHB 4K3EH 4MNQE 2CD0A 3MA7A 4AK1A 2WWKO 2XOTA 4NM8L 3S7GA 2NLJB 4NPYB 5FYKH 4YNYA 3TESA 2HRPL 4HGWA 1JHTA 1WFNA 1MHPH 3LEVH 5LWYL 2CLZB 4TPRH 2E7LA 2HT4C 5HHPA 3SDDC 4Y16C 2I9LA 3I3DA 4YDKL 2CH8A 4JM2A 1TITA 1RZJH 4JRYD 4HJ0C 5C08A 1HHJA 5D6CB 1Q9KB 5IVXF 1FNEB 4UOJA 3B2VL 2HLFC 1EGJH 1BWWA 3HLAA 1OAQL 4K3JH 4QEGA 3VD3A 4TUJB 3T4YB 3K8MA 3QO1B 2J5LC 3MRCB 3IRPX 3OAYH 1FNLA 3L3JA 3VWKD 3FKUS 4X6EB 4YDKH 3DRTB 4OIAA 1D5IH 2IPTH 1N7ML 4JY6A 4JQXC 5FM5M 1TZGL 4U1HA 1MRDH 4ZAKB 4R8WH 2R39A 3WD5L 3N1MC 1BBJA 5D7JC 2BRRL 2R0ZH 4YDLC 3D25B 4J3TA 4YDVA 5E8OB 1A0QH 1TIUA 1DBML 2Z35B 3IFLH 5D7LB 4YR6B 4PJ9C 4L3AA 4MJ5B 4K2UL 4MNHB 3UAJD 4Y0GA 4U1JB 3S36L 4E41A 1S7QA 1RJCA 3IDGB 1BFSA 4QHMA 3O2DL 3T0AA 5M95B 5J13B 4DAGL 3ZMRA 2R29H 43C9B 4XRCB 3EGSB 2VAAB 2F15A 2Y7QA 2NY2D 1L6ZA 2X4PA 3HAEH 4HMEA 4Y8DC 3NN8B 1JPTH 5B39A 1EEYB 4PY8J 1CFBA 2DF3A 2CKBB 3TBVB 3DI2B 1C5CL 1U58B 3FO0H 4DGVL 3GMRB 3BUTA 3I3EA 5I1KH 1MCHA 1Q72H 1GAFH 2X4NB 1EZVY 1NGYA 1WZMA 3K4AA 4LVNB 4C58B 5IJVA 4HEPG 4NT6A 4RIRB 4UTBL 1UZ6F 5E2WL 3W9EB 1R3KB 3W39B 5EU6B 2DKMA 2OI9C 4L3ED 2FJGA 4IRJC 1S7VB 2C9AA 3BAEH 3ESVF 3HN3A 2PTTB 3D9AL 3IXTA 1MEXL 4ZTOH 1KJ3L 2DLIA 1C08B 1MWAH 1KB5B 5C0RH 4H8WH 5SX5H 1KELL 2VLRE 3E6HB 5D72L 3EOTH 2ZKHH 4K94H 1A2YA 2H9GB 4M7ZC 3QHZL 1SVZA 1U8QB 3AAZB 5ERWB 2FHCA 3PHQB 1JWSB 2UVEA 3Q1SH 1YC8A 2IANB 3TVMA 1HHKB 3R8BB 3BRDA 4WRLA 3MLSH 3PE9A 4R4BB 5TPWH 3MA9H 4NKDA 2ADIA 2OJEA 4RGOH 3PGCA 3TBSA 1IM3A 2E7CA 2IBZY 4X4XB 3MODL 2JB6B 1HHHB 3BIKB 2KZ1B 4HBCL 2EE2A 3ZE2E 5IV2B 5D2LA 4ONHA 4UBDC 1WGOA 1HIML 5BRZD 1IGCL 2EXWD 3G5VB 5E8NA 3Q1SL 3G5YA 1KT2A 4DGYL 3MV7D 4MNQB 3RWCA 3MRLA 2IADA 4GRLA 1NC2B 2NY0D 4X6CF 3F5WB 3OKEA 4JKMA 3RNKA 1ZSDB 1KEML 4DKFH 2P5EE 1MFEL 4N0RA 2CDEA 2NXZC 1QYGH 3X14B 5B8CC 1KJ3H 4WHDA 1XZ0A 1RIHH 1KC5L 1VPOH 3MUHL 4DEPB 1MI5A 5EUOF 3LRSA 5TE7H 1VSCA 3LQAC 1AP2A 3QPQC 4Z76B 5JTWA 1BIHA 4NRZA 1T0MA 4OZ4B 4DVRH 1PZUB 4LPVA 4QHLB 5HI4C 5D7JD 3GMNA 2VRAA 4QOKB 5TDNB 4IMLB 4KVNL 3SKMB 3OKKA 2XYCA 3KPRA 3QWOA 3IVKB 1SEBA 2C4FT 3G08A 1I4FB 3BWAB 4C4KO 1UM5H 3L5IA 3WHE0 5GGUB 1Q9WB 1MRCH 1G6VK 3VXSE 2MOVA 2VXSH 2ICCA 4LRNH 4M6OL 5JXED 3N50A 3KG5A 4JAMA 2WK2A 1N0XH 1OQXA 3Q6FB 4QTHA 3TO4D 4E0RB 4O5LL 2HKFL 1S7SB 3ZKND 4XT1C 4F37K 1YNLL 4J3UA 1UZ8B 1W8OA 3WV0A 1B2WH 5GGSY 1FLRL 4P59L 3BKML 1XF5B 4OQTA 1I1FA 1KLGA 1ZK9A 2PF6A 4GAGH 3TC9A 5EZJA 3NGBC 1DBKH 5DLMH 2CO7B 2VIRB 3EHBD 1D5BA 3DTXB 2QJDA 1WZLA 1FG2A 2AXFA 4JFPA 5A2JH 1UJ3A 4QRPB 1ZHLA 3PWJB 1KENH 1KJ2B 1T5XA 2F58H 3ARXA 1B6DA 1EHAA 5CD3B 4FG6D 4H1LA 5FKPB 5C0DA 3BKMH 1N8ZB 2AERT 5DJZA 2YC1B 4G8IB 3QUZD 3QQNA 1NBVL 1T1XA 4MA1B 3IKCB 1NAMA 4HWEL 2WWKT 4PJFA 4PJXB 5GRVL 5CEZL 5J11B 3ZT5A 4MDJA 2EYTB 5ESVB 1A9EA 3UBXB 5D9SA 3TIEA 1K2DB 2PUQT 5E1AA 1FVDA 4EOWL 1OTTD 4R4FH 1G0XA 3AXLA 2LV4A 2HG5B 2K1MA 4KHTL 2VE6A 1JJUA 4JHAH 6FABL 4JPVL 2EIDA 1T83C 4U6XB 3A6CL 3O2WH 4JM2D 1HXMA 4JZJC 1P1ZB 2E7LC 2A73B 3D39E 3VFVB 1B4JL 4J7RA 4UNTA 1IEBB 4YPGA 3MZGB 5BZDB 3VXNB 3CK0H 2VDOH 1U0QA 3OKLB 4OZIF 5E9DA 3VFMA 4PGZA 3H0TA 3FCTB 3RKDD 3UJTH 5CFHA 1RULH 2AJYL 4NBXB 5I75C 1OAXL 3H7BA 3OB0K 4I3RL 5C0AA 2R56L 2NY5L 4F33A 5CP3A 2CUHA 1H3TA 5DRNB 2YWYA 2BMKA 3AY4C 4L9LB 1BWMA 3SKNB 4CU7A 1UJTA 3CDCA 3V4UL 4D8PA 3ZE2F 3DVNB 3WNLA 1WJ3A 4NZUL 5IEKA 4KJPD 2DBJA 7FABL 1QPPA 1PKOA 4ZSOB 4F7MA 2QSTA 3LRGA 3VE0B 1CU4L 4B7IA 1RHFA 1XAUA 2OXHA 4I48A 5L8KB 4OLWL 4J3SA 4NOFA 4N68A 2VLKA 2IEPA 4KROD 2J8HA 2FSEB 4HKXA 3K8LA 1CI5A 1NAML 1U3HA 5C0IA 3L3IB 4JM4L 2NX5E 4F7PA 5C7XL 2NW2A 2YHGA 2BVUA 4BH8B 4P3WA 5DJ2A 1PG7H 1QSEE 5DD6A 1QSED 3IAGC 5I76A 3OKDA 2VC2H 5I76B 4EUPG 2C26A 3U6RA 5JQ6L 4R96A 3ZYOA 4PJBF 3GGWA 4K3DH 5L0QB 3D87B 1EJOH 1JGVL 2R1YA 1KJVA 1QR1A 3CFJA 3MRQB 4UILL 2I5YL 4PBXA 3VJ6B 3WIIH 2A77L 12E8H 2QADC 3L3DB 2F54B 1TJHL 1K4CB 1WWBX 4HCRA 4WIQA 2VLKB 5IMKA 4NQTA 2EDNA 3K2UH 1EO8L 1VFOA 2R1WA 1SMAA 2W07A 2AI0L 2WLYA 1HKLL 1QRNB 4I48B 2CLVB 4A6YA 3RWDB 2PO6A 2X4RA 4WY7L 5EUOE 4HFUL 4BZYA 4GS7C 3X11A 4C55A 5KSVB 3DVNA 4IJ3B 2LVCA 5F9AC 5TE6L 2BMKB 4O00A 1FO0B 2DMKA 3GMLB 1K8IB 4TNVF 4QNPF 1R3JA 2HRPH 4Y4HD 4LKXA 3VXTB 2EDWA 1KCUL 5AYUL 3VFMB 2R9HC 2XN9A 3OKLA 3TVMC 2X1XR 3QUYD 4Z18A 5DWUH 1LMKA 3DROA 3ZYIA 3BPOC 4P57B 1BVLA 4X99A 5HY9B 1P1ZA 1M7IB 3ZDZF 4PJHE 3P9WB 1L0QA 5KW9H 3P0GB 3QCVL 1NKRA 3MNZB 2CKNA 1ZS8B 4HUUA 3P9MB 1U8HA 5KOVC 2WZPD 2HG5A 4QF1A 1WBXA 1FL3B 3NABL 2FIRT 3M8OH 1AXIB 1OB1B 4OV5A 1HYSC 2ZUYA 5BS0E 1IM9B 4QRUB 2VL4A 2C4XA 1TZHB 5IB2B 3EJJX 5EC2B 4HT1L 4LCUA 5I73C 4QLRA 1P7QB 4X4ME 2CR3A 1TQCB 2EYTA 1C8PA 2DQHL 1I9EA 4UT9H 4GW1B 4JFFA 4M02A 3KS0H 3QNZA 2C1PA 1T1XB 1ZA3B 5L9DL 2EC8A 5CCKH 3KPMA 1ZT4A 5DUPL 1K9TA 3IJYA 4KHXH 12E8L 4Z9KB 2NY4C 2OX5A 3MMEB 5CD3A 2FEEL 3OJMB 2IFFL 4L4TA 2DI8A 4JLRA 3WSQL 1EO8H 3IFPA 5FYJU 5IMMB 1UJ3B 4QRPA 3SDYH 1FNSL 4OCSH 2ZNXA 3HMXA 2DRUA 4EIGB 3RPIA 3DTXA 4N8CL 1D5BB 3MLTA 4TQEL 4U2ZA 2X2YA 4ZFZB 1KLGB 1I1FB 4MDIB 5F44A 3RGVC 1UXSB 4J6RH 1ADQA 2VDLH 2LE9A 1HH9B 3EOTL 3EFDL 2P44B 3TCXA 3HUJB 4MQXD 5IWLC 1YUHB 2R1XB 4OCSL 1MHEA 3Q6FA 4QTHB 4E0RA 1OTUD 1JIBA 5BCAA 1A21A 1QBLH 5CEZE 4FFWC 4HK3N 1LDPL 3P4MB 1Q9WA 4U7SA 1S8DB 4HWBH 1BJMA 3QPXH 4CAGA 3OKKB 3UC0H 3ETBF 3KPSD 5TDNA 3HE7D 4BM7A 4BSVB 1K3IA 1RUPH 4WTZG 5M7QA 4QOKE 1XEDA 5BW7A 4Z76A 3QUZA 2H32H 2HTLC 4Y16D 2L7JA 4PJ7F 2EC9T 5D7KE 5DMYA 1FH5L 1T04A 1KCRH 2DQHH 2AAVA 2AXGA 4EQ2A 2IBZX 4RRPA 1E4JA 2DN7A 3AB0C 1FL6B 5ICYB 4XP9H 2ZUWA 4PRDA 1AQKH 1ACZA 3UTSB 1WISA 3HNVL 1FIGL 3H7LA 2HN7A 4NHUB 5IESH 2NNAA 2EDHA 4HWBA 4ONHB 2YPKB 5IV2A 5E7FA 4MNGE 2XTJC 4X9HA 4WU7A 4ZYKB 3TA3A 2Y6SC 3FO2B 3FQUA 1GH7A 4JFXB 3BIKA 3N1GC 4FQJH 2JB6A 4MAYD 4YZFE 3FFDA 1YPZE 1PQZA 2Y4SA 4RAUB 3TFKC 3F6LA 2OJEB 2A9NL 4OKDA 1QFPA 3OGOE 1UWEH 1OAKL 4JN2A 1NL0H 3VXPA 5I1AB 3THML 3BYTA 1HHKA 1QYGL 1L9MA 5GZOD 2R0LL 3MGAA 3QIBB 5DC9B 4Z8FH 2CDFA 4N90D 1NCAL 4BQCA 1U8QA 3AAZA 5ERWA 2H9GA 2FD6L 1A2YB 5BOZG 1G7IA 2AV7A 5D1QD 1P4LA 1E4XI 3QZWG 3E6HA 1RURL 3FZUD 3QDHA 1MAJA 3UJJL 1F3DH 3C5JA 1ZHBB 2WBWB 3CLEL 2K3TA 3IXTB 2PTTA 3QCTL 1Z3GH 2ED7A 4FQLH 4FTVE 4P5TC 2FHFA 3W39A 1R3KA 1UA6L 3RVWD 3RY4A 2R0KL 1CR9L 1ED3B 4PJCA 3NAAL 4WU5A 2J4WH 4NT6B 4RIRA 3MRRB 4GG6A 2LFGA 4AIXA 4HQQH 4J4PC 3BP5A 3DSFL 4LQFH 3W11D 4DK3A 4JPIA 5CEYA 3LV3B 3RA7L 3AMLA 5AD0A 3CZJA 3QUML 1EEYA 4UTAH 4ONOA 3GEWB 4PP1C 5B39B 3E3QE 3IDMA 3QEUB 3EGSA 2X4SB 2QQQA 5CMAB 3ILQC 3ES6B 43C9A 4NIKB 4N8VB 1FIGH 1A7RL 2C3HA 4E41B 3TP4A 1T20B 4U1JA 3ZTNL 3GBML 2X40A 4MNHA 3Q3GA 4OLZH 4ELME 4X7EC 5D7LA 3WS3A 4YHZL 4X7SH 4YDVB 3TV3L 4L4TE 4L4TD 3BT2H 2HLFD 3D85B 3DMMC 5AEAA 1K5NA 1BBJB 3IU4H 2DQDL 4HGKC 4I0PC 4X7TB 3EDDA 2F8VA 5KSUA 5C0GA 5CKAA 1PVHA 1Z0NA 4ZAKA 5F70A 4YHYC 1OM3H 3IDYC 3DGCR 4PRIB 4JFFD 5FO7A 4KY1L 4HDIA 5GGQL 1ONQA 2C5DC 4M6AA 1KC5H 1VPOL 4X6EA 3ARBA 4PS4L 4X4MA 3VFRB 2WP3T 2AJXL 3GBNL 3QQ4A 2J8UF 3BQUA 3QO1A 4LSSH 4TUJA 4M93C 1C1EH 3I75A 3HLAB 4M1DL 4F2MB 1N5AB 3B8SA 4K7FA 4JHAL 3VRLE 1NLBL 4UDTA 4LLYA 3NFPB 2CXGA 4HIHB 1FORH 3DSNA 1M7XA 2MJWA 5C08B 4NN7C 4PJ7E 2VDRH 5GZND 3DX8A 3GSWB 1CBVH 1B3JA 4MD5A 4EVNB 4GRLD 4XGZB 4JKLA 3HZVB 4M7KL 1OVZA 4ZUUB 2Z8VC 1U95B 3NCEB 2IQAB 2V7NA 4H5SA 4M6NH 2EDBA 1CZ8H 5JHLH 3U30C 1AY1L 5C0CD 1HILA 1JHTB 1TXKA 5SWZB 3VG0L 5K9QG 2UYLB 2ESVA 1QTYT 4OZHE 1V3JA 5DUPH 4KC3B 3MA7B 2ZG2A 1UKQA 2PW2B 4Y4KC 2J7LA 2VQ1B 3BW9A 4NBZB 5H35A 4FMKA 1JRHL 3TPUA 4IDLA 4ZNEE 3F8UB 5EO1B 1NQBA 3MPCA 1JTOA 4KXZH 1T2XA 3SJVD 2HVKB 1HSAB 1E28A 3RU8L 1D5IL 4Y2DC 3UEZA 5IG7A 3IKKA 4Q97A 5DZLA 1A9BB 1AGCB 4LF3A 4WUUE 2FWOB 3OXRA 3MBEC 1JNJA 1KACB 1YMMB 1JV5B 3ECBA 2HFFA 3EYVA 5DURB 1DEDA 4GRMB 1XH3A 2BOBB 1BGXH 3LOWA 2H6PA 5JZ7C 1ZHKB 1R3LA 2ZCKH 3GSXA 5I8EA 4GAGL 5EU4B 2Y9RT 2O61A 5DEZA 3ESUF 1KTLA 3MRJB 4MXWH 2DBLL 1T7XA 1NL0L 5GIRA 4K8RD 1MIEL 2ZPKL 2DQUH 3FB6A 3LS4H 4LARH 3UTPD 3UTPE 4KZDL 2B1AL 1ES0A 1EHLL 2EE3A 4K7PX 3BPLC 5C3TA 4XHJC 2NY3B 1I7ZA 3S4SG 5ILTH 3DYPA 4N1CA 5TGBA 1T0PB 5T1MB 2VITB 4NZRH 4O2CA 2QHRL 1V05A 1VADB 1CYGA 4WHTB 4KVNH 2WINA 3GHBL 1GOFA 4IIQC 3P9LA 4DN4L 1CU4H 1U3HD 3ALWA 4M43H 1U92A 1FFNB 2P8MB 1IAKB 3K80A 3TZVB 2E6PA 3CH1A 1D5ZB 4XC1H 2QR0A 1XR9B 3P0VH 2E9IA 1YEIL 3O3EA 5HGBA 5HHOE 1OTSD 1CT8B 3U7YL 2YMXH 5C07A 4Y4KB 1YZZA 5JMOC 3LSOA 3VRJA 4NP4H 1HDMA 4U2YA 5DQJA 4GKSB 4CKVX 4P5KB 2G2RA 4Q6YA 4AM0A 4WUUA 1JGEB 3PABA 5C0CA 5MEPA 3MLWL 5J57B 3IDXL 3SDCD 4LSPL 4GBXB 4QRTB 3PP4H 3UO1L 2R4RH 3JTSA 5CZKA 3D2UB 5JQ6H 3VW3H 4Y5YB 2CQVA 4ZXBD 3LEXB 1SBSH 4WI5A 4ZOEA 4M61B 1VGEL 1WV7T 4LNRB 2R69H 4I2XE 3UDWC 1BAFH 4P9MH 4KJWD 4FXGA 2VISB 4EN3B 2VH5H 3DUHA 1OD9A 1QSFB 4NKIL 2F5BH 3LQZB 5D7IB 4UT6L 4LSTL 4HHAA 5JR1H 3LIZL 1FNSH 3MRHA 4J3XA 3T77A 1DFBL 3VWJD 1PW3A 5CJXC 2N56A 2W9DH 2X05A 1NUNB 2RCSH 3SO3C 1KJMA 1UH2A 4Y5XA 2IG2H 3FOMB 1QR4A 1KIRA 3L3HA 4ZFOB 4XB7A 3WHE1 4YHML 1XF2A 4IOIB 2HVJA 4ZFGH 5JOFB 3WNPA 3BDYH 1A3LL 3O8XA 4LEOA 3EYQD 3MFFA 2GY7B 2YXFA 4UIKH 3KPRE 1DDHB 1V8HA 2BOCA 3HZKA 3WLBB 1BQHA 4X98B 3WE6B 2DMCA 1INEL 2Q8AH 4LKCB 1Q0YL 5IK3A 4WW2C 3MV11 1CL7H 5E8EA 3Q5YA 4D3CL 35C8H 2MQCA 1F13A 4I3SH 1HCFX 3BKCH 3FRPG 4LDEB 3QHFH 5D2NB 5I30L 2IBGA 5TDPA 4F7EB 1IBGH 3QO0A 1BMGA 3WHXB 1WCBA 1RU9L 1RIVL 3H42H 5EFIB 3MUGB 3WFHA 3BPCA 2XNAB 2IH3B 4CVXB 4Z5RA 1KPUA 1A64A 1YMME 2CIKB 4GKZB 5L7XH 4AQ1B 2ITCA 4LIQE 2Y36L 2NCMA 2BHZA 1TTUA 3MJ7A 4FTVB 2QEJA 3MBEA 1DBJL 1G6RH 2BNQD 5EU6D 5JOEA 2XWBA 2XFXA 2JELL 2BVPA 4HCRL 2BRRH 3TH3T 2R0ZL 2D0GA 4PPTA 1ZT1A 3GJEA 2XQBH 4LP4A 4QRSB 1QLFB 3PP3K 3C09B 3SGKC 4CGTA 2MPAL 5FA3B 3K4DA 1FVEB 5EU7C 3MRFA 2P1YA 1UB5B 2AJUH 3HMXL 4JHWH 4LCCA 4WEMB 4I4WB 3O6FD 3HNSL 4RFNC 1GIGL 2XQYG 1X5XA 5ETUB 1AO7D 4KMTH 4Q0XH 2JCCF 3W0WE 1HE7A 5JW5B 5KVFH 1A6TB 5DHYB 2BVQA 1OGAE 5MI0C 4LIQH 4WUKL 2WW8A 1JPGB 3H6JA 5IMLB 5MEQB 4GG8A 1JGVH 4LLVA 4V1DE 5KSAA 5HXMA 2DQEL 1EH9A 4G7VL 5FGRA 4Z8FL 5BO1L 2GITB 1TCRA 3T4AB 1NFIA 2JIXA 1BJ8A 3QUXA 3MCKA 5GJTL 1AY1H 5KVGL 3K1DA 1YEGH 4RAHA 3G5XA 3BZFB 4J8RB 1ADQL 3WJJC 5HYEA 4N8CH 1PEWA 4DKEH 1YMHA 2RFXA 3SCMD 2A9NH 2FX8L 3SE9L 3HI1A 1MHHB 4H20H 4XVSL 3ZKMC 3O2VH 1WSST 3LB6C 4LSVH 4MQ7A 5HHQB 4ZUTA 1RUKL 5D7JA 1F97A 4S1DC 1LO0L 1ZEAL 4LGPB 4NQCB 5GGTA 3V6BR 4HC1A 1A7NH 2EYSA 2ATPA 3INUL 3TCLB 1UT9A 3VXQA 4E41E 3MQIA 4YGVA 5F7EH 3ARBC 1A6AA 1UGNA 2EH7H 2ZJSL 5CEXA 5DJ8A 4XWOC 5BXFB 4QHUA 2G9HA 4U1LA 1KEMH 2EE9A 1AGFB 5F7HA 1JE6A 4I8DA 5F9OL 4U6VL 4WW2F 4JJHA 4TULL 5T1DH 1WWWX 4JKPH 2FEEI 3RWEB 1KCKA 5GS0L 1F4HA 1NANH 3UTOA 5BS0D 1EDQA 4L3EA 4XCCL 5E2TL 4KRPC 5FEBA 4N1EA 3E6FB 4OM0L 3G9AB 4UB0H 3K8KA 5DD1L 1O7VA 3MRIB 2EH7L 2JF1A 4OZFG 3VFTA 4GLRH 3K2MC 3FN3A 2CK0L 3QRGL 3CPLA 4KUCF 4OV6F 2BVTA 5L2KD 3U9UB 3MLZL 2XXMB 4JFQB 4M7JH 5IW3A 2HJKA 5IVXB 2IWGA 5CLWA 3IETB 5ACZA 3GSOA 1LE9B 1XGTA 3TN0B 5AAWA 1A14L 2GJ6B 1F6FB 3MJ8A 5C70A 2WIIA 1IC7L 1A7RH 25C8H 4IRJB 4RA0C 4NWUL 4K8RL 1M05B 1ZA6B 2ZUTA 4LLMA 3VFSA 5IKCB 4KHTH 1CFVH 4DW2H 1L0YA 3AY4A 2P5EB 3ULUD 1H5BC 1NBVH 4MAYC 4OCNC 4R8WL 1JHKL 4X7CC 1MEXH 2W60B 3WXWL 5EUKB 3TBTB 5DT1L 3ARZA 3IS0X 2D7MA 1OGTB 1I1AA 4D0DB 2A83A 1H8NA 3VW3L 4PJBE 1Q9LA 4EI6B 2GTWA 3ARTA 1RUAH 2YOCA 3MOAH 3VFGH 2Q1EA 4JDVA 3KPQA 3ULVH 3SDAA 2UY6A 1OGTA 4MJ4A 2HFGH 5DD5L 2F58L 2NY3C 1MJUL 3GM0A 3TPKA 5F7NC 1OAUL 3OKMA 4ZUVA 1JRHH 2W38A 3A6BL 4X80H 5C08E 1J1OH 3MFGB 4FOMA 5FECA 2OYPA 4BSWB 2P5EA 1ZV5A 3JV4A 4LK4A 3OPZH 1J9CT 5GRUH 4GMSL 5IKCA 4H1LG 1FYTD 3VFWB 3KYKL 3U7AA 4NKOA 2OSLA 4Y7MA 2NY6B 1OAXH 4R97B 3QDMB 1JN6B 4OSUL 3BP7B 4DZ8A 3O4OC 1WF5A 3BH8A 1UM4L 4R3SB 4GQPH 2EZ0D 2ZNWA 1FSKC 1IE5A 4N0UA 4HS3A 2VXVH 1RSFA 4OF3A 4U6TA 3CPLB 1I1RA 4OFDA 4OIBA 4XPFH 4XAKD 1H15A 1TVHB 3CDYA 2J8UE 2Q86B 3TNNA 3KJ6H 1WEJH 1ZT7A 4P5MA 3WL9A 3BOVA 2OCFD 3DRQA 2P8PB 2RBLA 1P5VA 5MENE 1QKZH 4WWKD 4G8EA 3MLXH 3WEXB 1HXYB 1L9NA 1X5YA 1DQLL 2IAMB 4ZFOL 1TTGA 4WGVB 2DQFB 3HE6B 2O5XL 5DMIH 4JEGB 1KBGH 1CE6A 1KIPA 5EZLB 3TYFA 3P0YH 1DQDL 4TVSa 1OAQH 4QHUB 1H3VA 4EKXA 5BVJB 4NJ9L 4DUXA 3VU2A 1P4IH 1NFDE 2J6EH 3VXQB 4C4KT 1ZVYA 4JJ5A 5I74C 1EFXA 1UENA 3QQ9D 4NQCA 2ZSWA 3QQ9C 4G5ZL 1PSKL 5IIEA 2FECI 4L8CA 1CXKA 3MLYL 1UCBH 2ZUQC 4QYOA 3UZVB 5HHQA 4OM1L 3ULUH 3ULVL 4YIQB 5I1DA 1MHHA 4PB9L 3U2SA 1FZMA 3LEYH 1FZJA 3KPLA 3GKWL 2CUMA 3MXVH 1K85A 4MCYB 2AJUL 3S34H 3RVUD 3WUWB 3RHWK 1X6NA 2AW2A 4M43L 5GGVH 3IDNB 4IRSD 4O58L 5INCB 4G42B 2UV3A 4YXLH 5C8JB 5LGHL 4D0BB 2RR3A 2AJXH 3GBNH 1BAFL 2GITA 4P9ML 2F19H 5HYQB 1HH6B 2EEBA 3CVHB 5MEOB 5E2VH 4C56D 1M6OA 4LLVB 5KSAB 4XMLH 4M1DH 5MEQA 5IMLA 5MP6L 4EUPA 3BEVB 2AKRA 3PQYB 4ODSH 5JW5A 3QG7H 4RGNE 4JDTH 3RPKA 2F74A 3S8WA 2FCBA 1QQDB 3MBXL 4XNMB 1HZHH 4NGHL 2VZOA 2B7DT 3U36A 1CGUA 2Z31C 5I9QB 3L5JA 4KRNA 3BKCL 4L4VD 1HHIA 4O51B 1MFBL 3VWKC 3GB7A 2BNUB 3GJEB 2W59A 3QCUL 3TLRA 1MPAH 1S7WA 3I3BA 4JFZH 1MCPH 1IVLA 4UT7H 3MBEB 2YEZA 1HQ4B 1YEFH 1QSFE 2A9ML 2FJHA 1Q94B 3B9KD 2XRAL 1NGXA 2G75B 2ZUQB 3RU8H 4R6UA 5C3LD 2CIKA 2W9DL 1RZKH 1QLEL 4APQC 1YEKL 5C0EB 2ZPKH 5DWUL 1P7QD 2WQRA 1HNGA 4H88H 5J6GA 1EIBA 4F9LC 1GC1C 4MMXC 4OZHA 4S0SD 5TDOA 7CGTA 3L7EA 2B1AH 4JZOA 3NPSB 1I3GL 5D2NA 5T3XL 3JWNC 2YPVH 2XZZA 2N7BA 3D39D 1G7QB 3ARPA 3VXOA 1GHFH 2O5ZL 4AMKH 3L9RB 1WVZA 1PD6A 3O6LL 2JK5B 5E8EB 1IFHH 1I8MA 4YWGL 3AC0A 2YUZA 5DRXB 4LKCA 1I85C 5BQ7B 4AENB 5KG9B 1RHHA 3WE6A 1QLRA 5T3ZL 4EOWH 4U3HA 2BOCB 4V1DA 5EULV 5HHMD 1UWXK 4KKAD 3DX9A 2AJZA 1DDHA 3J8F7 1OTSC 1P7KB 5FGSA 1C5DB 4IHOA 4OD1H 5GISH 2IPUK 3EJYC 4FQ2H 2J12B 2GAZB 3SKJL 3L6FA 2GY5A 4K9EL 5J7CC 4R7DA 1XF2B 2FDBP 4UV7L 5T1KD 4L3CA 1CR9H 4MJ6A 3FOMA 4L1HA 1QBAA 5KANI 3HNSH 5IR1A 3I2CL 5L88H 1Q9OA 4QRQA 1LEIB 5DJ6A 2AS5M 2QSQA 3PWUA 5KVFL 3FO1A 5GGSB 5I1IL 3U4BL 1GGIH 4HHAB 5IW1B 1D5MA 2C7UA 4KTDL 3OAUH 3JUYA 2D31A 4LLQB 3S3SA 1QSFA 4OBRA 2VISA 3BHBB 3TJHC 4P23B 1F5WA 1HI6B 3FO0L 2ICWB 3GMMA 4EI5B 4UDUB 5GGRA 3HE7B 4LRNL 4M6OH 3ARBD 5T3XH 2BC4B 3SOBL 1FCGA 1L0XA 5D72H 2H32B 1ZGLP 1FN4B 4JFHE 4Z78A 1YNLH 1IFHL 5FO8B 3JTSB 1LO4L 4GBXA 3QEGL 1QLEH 3AROA 1MIMH 3B9EA 4IJ3C 1T1YA 4OLWH 2UZYB 2YN3A 3PABB 1HOCB 5HTSA 4OQTL 4WUUB 5L6YL 1T7ZA 5IBUG 4DUVA 4KZDH 5SWSE 5DQJB 1Y6MR 4HXAL 5TQ0L 3LSOB 2P7TA 3HR5A 1I1CA 5J9PA 1YY8B 3V5KA 1CT8A 2PO6D 1WIOA 3V6ZA 4KY1H 2CGRH 1NGQL 1VFBB 3ARED 3LZFH 3FOLA 2HH0H 4HUMB 4KJQD 2YD1A 4X8JB 5B39G 3TZVA 4W4OA 2CUIA 4KROC 4P9HL 4WO4A 3ZSSA 2P8MA 4PJHB 5E6IA 2NQCA 1HZHL 1WWCA 5C0FA 2XTLA 4WHTA 4PP2A 3FONA 1JI1A 4YHIA 1FVCA 2DQGH 5T1MA 2HFEB 2Z93A 1JZ8A 4KUCD 2D7OA 2W65A 5E9DD 4QGYA 1V7NL 2VDPH 2PW1B 3KJ4B 3MV9D 4RMQA 3ZYJA 3PDOA 5C09D 4L4VA 3VXME 1RVFH 5D70H 3TT1L 5SX4I 5JUEH 5KBNC 3BKJH 2QSVA 3DMMA 1WIPA 3MRJA 3EDKA 4QT5B 3BRGC 3BP4B 3CAFA 3TZVC 2ATKA 4ZDHB 5DVKA 3T65A 1ZHKA 2DOCA 3E2HB 3QA3A 4RGOL 2V5RA 2D7QA 3BKYL 3ECBB 1SJHB 1IAII 2FX7H 3D0LB 2ADJA 4NKIH 5DRZB 3QIWA 4C56A 3Q5TA 4JFYB 1U9KA 3S35X 1J7VR 4E5XB 5GS2D 4U6HB 4RZCA 3V95A 4NKMA 1T3FA 3V5DB 2CRYA 2CRIA 1HQRB 3MJ9H 1RZFH 5HDQL 4NHCH 4OM0H 1A6VL 4UB0L 5JO5B 2PW2A 2VXTL 5AZ2L 2MCPH 4OCWL 5HI5C 3L5WA 4PG9A 1HILB 3CSBA 2NY7L 5TF0A 1S7TA 3X13B 1KPRA 3SGDH 1U95A 2IQAA 2V7NB 4J3WA 3BWUC 3GSNH 3HZVA 3OR7B 3EYSH 4EVNA 4LLUB 1G7HB 1Q1JH 5JIHA 3DX6A 5I8OL 3T1FA 4DUWA 4MA3A 4PY7A 5E1HB 3F7YA 3TJHD 3N1QC 1CF8H 2ICES 4Z0BL 1N5AA 4K7FB 3QUMH 4F2MA 1DVFC 3EOYG 3O2WL 3QI9C 4X6FA 1P4BL 3KHQA 3G6JF 3BQUB 1CLOH 2FATH 4H20L 5FGCE 2VSDA 4YHKH 1MLBB 2Q7YA 3GRWL 1JYWA 4L8DB 3EYSL 1OW0C 1ONQB 4HC1H 4NSKB 1MFCH 4IDJL 4J23A 3LHPL 4S2SA 2YUXA 2Q7NA 4XPTL 5CP3H 2WUBH 1YEGL 3VGHA 3HI6L 1KPVA 5IQ9A 4UQ3A 3RTQB 4KKCD 5F7FA 4K71B 2JB5H 5D1QA 1K5NB 1PLGL 3D85A 5FIEA 3S97C 5AAMA 3PHOB 3W0WB 3O8XC 3ZKQD 1UWGL 5KN5A 2FBOJ 4JPWH 5IGXH 3WS3B 3NCJL 5ABDE 5C08D 3KDMB 2QQNL 4HIJA 5GS3A 4F7TA 2X41A 3M17B 1XMWA 3OX8B 1T20A 3ARFD 1GPOH 1M7DB 3GIZL 3IFNH 4UU9B 4RNRA 1NSNH 3ES6A 1J11A 1JK8B 2EO1A 4Z7QF 3ZTJG 1FLTX 5GGRY 5CMAA 1A6VH 1RJLB 2WIMA 4KMTL 5E2JA 4DN3L 2JB5L 5A3IC 3BO8A 4YHNA 3FHQA 5BRZB 4WV1A 4XPGH 5CEYB 1J1XL 3GMQB 4JPIB 3NCJH 3CU7A 5FHBH 1YY9C 5L2JB 2X7LA 2VDRL 4O58H 2K7QA 4GG6B 1F6AA 5K9OA 3MRRA 3MLXL 3D1MC 4GQ9L 3IFOB 2ID5A 5C9JB 5BS0A 1N6QL 5D2NE 4GW4A 3P77A 1NGZB 3RJDA 4Y16A 4XPFL 2YRLA 5HHNB 4OUUA 1WWAX 2OL3L 4K23L 1DBBL 5JHDE 4L4JA 3F7VA 4EDXB 4CRPA 1TPXB 4W4NA 1NAKH 2UZIL 3RVXD 1P4LB 3MGTB 1V7NH 1G7IB 2WWMC 2YD4A 3KPSA 2CKBH 3R1GH 3QIBA 4JDZA 4N0FB 3IAQA 3JSSA 4WDIA 3VXPB 5I1AA 3O6KH 5EWIL 4N5UA 2JJVA 5J1AA 4X7SL 2M1KA 5IROC 4KQ4L 2VQTA 2P5WE 2LQRA 4DJMA 2A74B 1A4JB 1MQKL 1NBYA 1UACL 2EKJA 2X70A 3P4NB 4JFXA 3B9DA 3FO2A 3FQUB 1YN7A 4WU7B 4ZYKA 3A0OA 4Q9QL 2YPKA 3QEGH 5ITFA 3HZYB 4WI3A 1YEIH 2E5EA 3D69A 3N1PC 4TTDD 4Y4FD 2YUWA 4KV5E 5DJAA 1F90H 1ITCA 1MFDH 3UTSA 2ZCHL 3CC5B 1I85A 1CGTA 5I8CA 5F89B 3JV5A 3PGFL 4HH9B 1XT5A 4Y4KD 4W68A 1FL6A 5ICYA 3QI9D 3EYFA 1GL4B 4XTRD 1F4YH 3TO2A 4EIZC 4U1IA 1NLDL 1UB6B 3OV6A 1T04B 1JGDB 1YJDL 3MUZ1 3S4SA 5IEHB 3T3PE 1K4DB 3QUZB 2BY0A 5I1LB 5DJ0A 4HUNB 5DO2D 5FCSH 4YHLH 4ZXBB 1P2CB 5FYJL 3ALPA 2HLAB 4UUJA 3KLAA 1FE8H 1AXTH 1G84A 4HF5L 1KENL 4OCYH 1JVKA 2NR6C 4ONFL 5DD0H 5EBGA 1UWXH 4IIQB 4Q2ZA 4M9PA 4I9WD 2DQJH 1PZ5B 1JZ7A 3QBTB 1R5IA 4HK0B 4ZD3H 5I9QC 3HE7C 3BN9C 1VACA 2MHAB 3P4MA 1IGYA 3BPLB 1EXUA 2FH6A 3OJDB 4OJFH 4JKKA 4RBPH 3W5NA 1WT5C 3MACL 4YFLI 4HGMA 1MHEB 4WFHD 1OWWA 3PL6C 1INDL 5T1LB 2A2QT 1CCZA 1OAZL 2GK2A 1NGPH 2YN5A 3X17A 1A6WH 4OFPA 2YWZA 3DBXB 4KK8D 3MXWH 3RFZC 2D7NA 4XNXL 3QNYA 3L3GA 3HNTH 4JRYA 4ZFZA 1IQDA 5IWLA 3LDBC 2NXYB 3O3DB 3X3GL 3MLTB 1YDPA 5DHVH 3RPIB 1RZJC 3O6LH 4HUVB 5LG1A 1H0DA 5D71L 2AK4D 3R4DA 1RZKL 5IMMA 4TNWF 5HHVH 2VLLB 5JPMA 5JIPA 4OLXL 1TJGH 3BH9B 3MMEA 3LQMA 3T0BA 2DICA 5B38B 2HRLA 3BEWB 2NW3A 2V17H 1ZA3A 3WO3B 3VMNA 4OGAC 4RCAA 1J8HA 2GSGA 2F54E 3SDCC 2EDRA 2A9MH 2W92A 5C2BH 3IF1A 1G7PA 2GK0A 3RQ3A 4FQCL 5JOPE 3LN5B 4X6BB 3NA9L 4PR5B 1MIEH 1IM9A 2RGSA 4OV5B 1G6RB 3MC0A 4HIEB 4MWFB 3REWB 1CD0A 1FL3A 4MD4A 3L1OH 1WBXB 4QF1B 2CLRA 2XA8L 3S88H 2D03H 4NQXB 4PJ7A 4YQXH 4DKFL 5FCUL 3KR3H 4JO1H 3U46B 5I73B 1KF9B 5DSCA 2BSTB 1QSEB 4B50A 4M93B 3NACH 5CGMA 3QUKB 3D18B 1A7BA 3U79A 4JPVH 1EO7A 3DYMA 4JDTL 3NZHL 5FUCE 4NUJA 3PWPA 4U1NA 2XN9B 4Q0XL 3WFZA 4OJFL 4ZOBA 4K71C 2VZ1A 2V5YA 4WW2A 4NN6C 1Y18A 5T5FH 1R3JB 4FABL 5I1EL 3RWJB 3PXJA 2OI9B 1FO0A 3BZ4B 2ZZUT 1QRND 2BNQE 4NYLA 3WJJA 3PGDB 3T08A 3EYQC 5EUOB 4G9FA 1DSFL 1S5IL 1MJ8L 5KSVA 3GI9H 1KJ2H 4AMKL 2AJ3A 5A16B 5C07D 4PGCA 5I1JL 3RWDA 1UYWH 5LKNA 2CLVA 1QRNA 4ZPVB 1ZVSB 4JRXB 3QUYC 1DR9A 5TF1H 4LHUD 4XHJD 1X5AA 1K4CA 3L3DA 3P4LA 4YHOL 1GCFA 4ODUB 4NUGH 4RWHA 1JZ2A 3VJ6A 4LIQL 3QCTH 3SCMB 2Z8RA 3WO4C 3SN6N 2OQJA 3IJHB 3GGWB 3N9GH 4KAQL 5C2BL 1CDIA 3H3PH 4R2GB 4ORGB 1NCNA 3V4PH 1SVCP 3V5HB 1T7YA 5DVLA 1PX3A 4HUWB 1BOGA 3KLDA 3NFNB 5ACMA 2NXZB 4FQIL 4GS7B 1E27B 3SDCA 4KPHH 4F7PB 3S96A 3L3IA 5GS2H 5FYLL 4FZEH 3HPJA 1CICC 3DX7B 5E6ID 3V52H 4XBEH 3QULA 2CJUL 2I07B 2FZ3B 5C0JA 4M4RA 3O6FC 4RRPG 1RUKH 2FHBA 3TN0C 5LXGL 4PGBA 4LQFL 2EDDA 5IEKB 1LEGA 5F1KC 4D8PB 2X4OA 1EJ6A 2FO1A 1NDGB 1F00I 3SKNA 4L9LA 3HAEG 1XFPA 5CINH 5F3HB 1XCQB 4F33B 4JRXE 5C0AB 4H26B 5TQ2H 1R3HB 4OFYD 1YNKL 3TN0D 4M1GL 3EHBC 1PG7X 3H9HA 2NPLX 3MV8D 4I0PD 1L4IA 3M1BA 3C8HA 1IGCH 5JDSB 2EIEA 4PJEF 2A73A 3VFVA 2HJFA 4PRNB 1MRDL 5ISZB 4M5ZH 5LVEA 3OTTA 1YEEH 3DWTA 3STZB 2BXZA 4NO2B 5AZ2H 1T80A 3ZDYE 3SJVE 1T66D 4ESKA 3KR3L 4JO1L 3H9SA 3LKQA 3BGFB 3QZWA 4Q6IB 4WW1A 1RUAL 5T3ZD 5FA4B