1KJ2B

Murine alloreactive scfv tcr-peptide-mhc class i molecule complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
117
structure length
117
Chain Sequence
VTLLEQNPRWRLVPRGQAVNLRCILKNSQYPWMSWYQQDLQKQLQWLFTLRSPGDKEVKSLPGADYLATRVTDTELRLQVANMSQGRTLYCTCSAAPDWGASAETLYFGSGTRLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Allogeneic H-2Kb MHC Class I Molecule
publication title A T cell receptor CDR3beta loop undergoes conformational changes of unprecedented magnitude upon binding to a peptide/MHC class I complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 20
structure length 117
sequence length 117
chains with identical sequence E
ec nomenclature
pdb deposition date 2001-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kj2B00
4ZUUA 4WFHD 1AGDA 4K9EL 5GS3A 4LSRH 2QSCH 1BVZA 2NY5C 2O5XH 2X1XR 1HHJA 1A1MA 5GSVA 1JNHB 4TPRH 1EFXD 4MYWB 4AL8H 3A67H 5EA0H 1L9MA 4DZ8A 3U36B 1BD2A 4M5YH 3RL1A 5DWUH 1FJ1A 3RWDB 3LKSB 1CLZH 3OKKB 1CFVH 5ESVB 3U0TA 2FEEI 5DK2A 3NZHH 4IRJA 3S96A 4PPTA 3BWAB 3F62A 1FG2A 4OIBA 1WIOA 1CICB 1NAKL 4U1MB 5CEZD 4NQED 2HG5A 2ENYA 4U1JA 3ORJA 2EDRA 4KY1L 4XBPB 1EGJL 3W82A 2AKRA 2CLVB 2DQDH 1F6FB 1UZ8B 1G6RB 3AM8A 2M2DA 5AZEH 1PKQB 3QPXH 3QIUC 1QRND 4KI5D 4YO0A 2DWEB 4YHIA 4QRTA 2YMXL 2X6MA 2BJMH 5D1XD 1HQ4B 5C70A 4RDQG 3BP4B 5HD8D 2NW2A 4G6FD 5IMKA 3EHBD 4PLOB 4XX1G 2A2QT 4PJ7A 4Y16A 4JJ5B 3WNMA 4TNVF 1OPGL 4GAYB 1ADQL 3IS0X 4F9LC 2P44B 2NX5A 3IDYC 4MXVE 3SDCA 1YC7A 5D1ZB 3O4OC 3F5WB 4IMLB 1A3LL 3RRQA 3H9SD 1ZWIA 43C9A 5DJXB 3CSYA 3VG0H 2ZUUA 5KJRL 3MJ9H 4Z8FH 5I75B 3H0TA 2VDKL 3WKNA 5HI5C 1FZMA 4NBXB 3WHXA 4KZDH 2V7HB 4XVTH 1R3KA 1EO8H 4M48L 3RWFB 1PQZA 4L4TE 5MP6L 4JRXE 4JQVA 2VITB 3DUUB 4ONFH 5T3ZH 3B3IB 5INCA 1G7MB 4UV7H 4KGLA 5GS0D 4EI5C 1ORSB 1PYWA 5C1MB 5IVZA 4LQFH 1UWXH 1AHWA 1FV1B 3TIEA 2CUHA 1D6VH 4Z7VF 3ZKQD 1MFNA 3KVQA 3ZDZF 4K8RL 4U1IB 4YEEA 1MFAL 1GZQB 2F5AL 3PF2A 1U91B 1WBYB 4JFED 1W0WA 4QRRD 4FQQA 2N7AA 3UPAA 3G9VA 1L0QA 4NIKB 3VFWB 5C86A 2KL6A 3BRDA 1YY8A 2W0LA 3HKFA 3CFBA 3CX5J 1RJZB 3IDJB 1MLCB 3SJVE 1K85A 1T3FB 2CKBB 4UINH 5HVFB 2FECL 5GGRY 4FFVC 4PRIA 4R0LC 4W4OC 4BUGA 4Z7UE 4R26L 4HXAL 1A7PH 4PG2C 2KQNA 2KZ1B 2GFBA 3VXTA 2GCYB 3V95A 4OF6A 5ECJE 3BDBA 1KIRA 1J8HA 4WI8A 3QUXB 1WF5A 3MLVH 1BLNB 1P69B 2XY2A 3IDIA 2X4QA 3UJIL 3X3GH 3KS0J 2GJ6E 4G8GA 4NRZA 3TIDB 4NC1E 5C9KA 5FA3B 1FO0A 5D5MB 1PSKH 1NC2D 4FA8A 2ZKHL 4M8VA 2OL3L 2H2SD 3KPSE 5HYJA 4PJXB 2WUCH 4MAYA 4OCNC 2DTML 2DTSA 4Z0XA 1I7UB 4PP1D 3TBYB 4NZUL 4UT9L 4X9FA 3K0WA 4JGMA 2BNQA 5CILH 5IFJA 3V6FB 3PJSB 2HJLB 5FO7A 1QLRA 1NEZB 4NDMB 1UJ3A 4PLKD 2OK0H 3RIFF 2M26A 3NFSH 3MX0A 1QZ1A 3D39B 1FL5B 4HG4J 1S7QB 4JQIH 2IWGA 4I18B 1Q72H 3VMOA 3KJ6L 5DTFA 1R3JA 3VXMB 4WO4D 1UWXK 2X70A 2ITDA 1KCLA 1MREL 1YMHA 2Y72A 3O4LA 4MJIA 5ADOH 4KRNA 4OD3H 1WAAA 5I8OL 5J13C 3O6FB 4Y2DA 4Z18A 4JY4A 1UXWB 3BKCH 2PCPA 2JF1A 2QADC 1CD1A 2H2SC 3O9WA 1VESA 1N6UA 3QDJD 2DQCH 1HSAA 1NDMB 2K7PA 5J57B 3L9RA 3OKOB 5JOPE 3AU1A 4M6NL 2AJXL 5DC0A 1I7ZB 4JM2B 4FN0A 3T0AA 5E1AB 1R5WA 2WSKA 3Q2CA 3MV01 5IJKC 3FFCE 1T5WA 4PJGA 1NCDH 4YNYA 4A6YA 4YGAB 4LVEA 5IR1A 5E6ZA 2NR6D 4CBPA 2FSEA 4PLKC 5F9JB 3FRUA 2Z31C 4N9GB 5C08A 1S3KL 2RIKA 4E5XB 2R2EB 1IC7H 1TETH 4XH2B 4U05A 4DJMA 2O61A 2AK4B 3TJHD 4HWBL 5J89A 3QAZB 2Q7YA 1JZ7A 1CLOL 1H0DA 2CPCA 5D2LA 2IAMB 3R06B 2R1YA 4U1HB 1TVHA 3N1GC 1U8NA 4IS6B 3ALWA 1OGTA 1NLBL 3KYNA 3RGVD 4ZXBD 1RVFH 2E9WA 1A6UL 1Y18B 4GRLA 1JHLH 5D7IF 3S34L 4MGXA 1R5IA 1FVCA 1F90L 35C8H 1PAMA 1KEML 4WU7B 1MCRA 3BE1L 5FM5O 2F9BT 4PJEB 2HLFD 4NP4L 1PEWA 4ETQB 2N1KA 3DX8B 4CL7A 5C0AD 4N8VB 3K2UH 2EO9A 2OR9L 1RD6A 4GFTB 1TJGL 5I8KH 1ONQA 3EUUA 4OUUA 3WFBH 2VKWA 5KW9L 1PGRB 4RA0C 1I3GL 3EGSB 1RUAL 1QEWB 4B7LA 4H8WL 4HWEH 2MQCA 1ORQB 4PLJC 3BDYL 3PABA 1EX0A 4KK6D 1JGUL 2I07B 3QCTH 2APXA 5MEPA 3UTTD 4P46D 2VLJA 3RGVC 3S5LG 1TIUA 1QKZL 1A3RH 1TMCB 3KPRB 5I18L 4YGVA 4F37K 1NLDH 2VISB 2W9DL 3PGFH 1VENA 1LDPL 4U6VH 4PV8B 4LF3A 2F5BH 5IG7B 2FBJL 3E2HB 4NBYB 3OG4B 3QQ3B 4Q6YA 3RDTC 5DFVC 5T3XH 4K3DL 5HHOA 4ZQKB 3PHOA 5D7KD 1ZTXH 4GKSA 1RZJH 4R4FL 5DD1L 5FO8B 1G9MH 1EZVY 1QYGH 3PWJA 2FGWH 4PB9H 3FQWB 15C8L 3IDGB 3DVGB 2GSGB 1OAZH 1KELH 2MCG1 3JV6B 1E28A 1JPSL 1V3MA 1GPOH 3P9LA 1EERB 3OB8A 5IHZB 4K23H 5GRYA 3PWPD 3MA7B 2DICA 4XI5D 1JI1A 4L8DA 5F70A 5JNYB 4M02A 5FOBB 4MWFB 1JWSA 1UM5H 4OFVA 1XR8A 4KKAC 4OKDA 4PJ7F 1CF8H 4KQ4H 3FONB 1MFEL 1NGPL 4F9PC 1TZHB 3DBXB 2G9HB 1TQBC 5EU7C 1F4YL 4TRPH 1NL0H 3OXSA 4GRMA 3UZQA 5KVMC 4JHZA 5E5MA 1EXUB 4P4KC 4E0RB 2H2PC 3T3MF 3QI9C 3QDMD 2BCKB 1B0RA 1NFDE 3CLEH 1RAMA 4M1DH 2GTWB 4YFLF 4YPJA 2CJUL 3BW9B 3VG9B 1KCUL 3JUZA 1FBIH 1ZT4B 4OLXL 4ZDHA 3OAZH 4BH8B 4CW1B 3JWOL 4LMQI 5EORL 3EYVA 4U3XA 2UWEB 4HKBB 3WUZA 3BKYH 3MV9B 1ZGLB 5SWZA 4LSUL 2FWOA 5C07D 1F97A 1I3RA 3ZKMD 4HH9A 3WO4C 1V05A 3TVMA 3QIUB 3VXNB 3MLWH 1HKLL 4GAJL 1SY6L 2BY2A 5FB8A 3MV7E 2Y9RT 3PQYE 2J3SA 4OKVA 4ZPTA 3VA2C 5HYSB 8FABB 1PG7H 5BV7L 3NMEA 1MCCA 3BIAX 5B8CC 5C0FB 1UM4H 5T1KD 3RWCB 4QRQA 3IDYB 4QYOB 4S2SB 4F7TA 3O4OB 3L95A 4FRWA 3CDFA 1VEPA 1UKTA 2P4AB 4AJ0A 3UYOD 1MQ8A 1EV2E 4YBQD 1MUJA 2KBGA 4DCQB 3D25A 1GL4B 4XNMA 3V7AG 3GSVB 1U36A 5EUOB 4AG4L 3LEXA 4NQEB 4NHCH 2BNRD 3V5KB 4I0PA 3DI2B 1U8IA 3IGAB 2ED8A 1A21A 5DLML 1MJ8L 3G5VA 3TBWA 4PTTA 1X6NA 5LG1A 4MD0B 4ZOEA 1INQA 7FABH 2Y07H 4PRHE 3D0VB 4EI5B 1IGMH 5DD5L 5IMLA 1EGJA 1A9BA 2BFVL 1T21A 4GOSA 4LPUA 5TDOA 2F53E 4L1DA 3BN9D 3VRIA 5D1XB 4P9HH 3UROR 1FN4A 2IADA 4WUUB 4JHWH 5IF0A 4I48A 3SQBA 5D1QA 3KGRA 3LH2H 4KJPC 1T04A 1KXQE 3QHZL 1HHKB 1QUNA 4GG8A 2D0HA 1HHGA 4Y19E 1NAMB 1ZT7A 3OAZK 5F7FA 3H42L 1JWUB 1WVZA 2OTWA 3HI5H 3HS0A 5LWYL 3ULVF 2AJSL 1NCNA 1OSPH 1ADQA 3H9SB 4R0LB 5A16B 5CSZB 2KQMA 2PTTA 3NPSC 4EEEA 4YBQC 2COQA 1N7ML 4P3CL 3N06B 1Q1JH 2MNUA 3NN8A 4FXKA 4ZS6D 3THML 2QQLH 4XZUB 4LLMA 3MBED 5SX4I 3LKQA 4YHLL 1K8DA 5CHNB 5JW5B 5J3HD 1IC5H 1WAAF 3HAEH 1HH6A 3IKCA 3HG1A 3CDGB 1XAUA 4OTXH 2IJ0C 2ICWB 4HK0B 1S9YB 2X2YA 4ONGL 5CZVL 3QA3A 5I1EH 4NC2B 4PRDB 32C2A 1EH9A 3BZEA 3K4DA 3VWKA 1E4XH 4AH2B 1CE1L 1U8JB 5D7JA 1L7IL 1VDGA 1BVLA 5IEHA 1G0YR 4U31A 4CN4A 1DBAL 4PJGF 5FHAH 2BERA 4EI6A 4P2OD 3TGXA 2MQ0A 1DQLH 5TGBB 1KYOK 4HS3A 5B39B 4X6BB 3RVUC 3B5GA 3MRHA 4WGWB 4AIXA 4TNWK 4MNGE 4KK5D 2HT3D 2YPLD 1CLYH 5FV2A 3C6SB 5D93C 1F2QA 2DQUH 3RVXD 2A9ML 4EJ1C 5BMFL 2PUQT 3I6LE 1JPTL 3QYCA 4Z6AT 3VWJA 4CGTA 3RAJH 1UVQB 3BJLA 4KKNA 3ETBF 1JZ3A 1IEBA 5J13B 3VI4F 1TCRA 3BD4A 3FQNA 3O3UN 4Y5XA 2QADB 3GSRB 2DL9A 5DHVA 1LHZA 2EIZB 3CVHH 1SJEA 3LIZH 2XYCA 5CBAA 1EJ6A 1R24A 4HUXB 1T2XA 4WEBH 3UPRA 2OL3A 1SYSA 4OLUL 2D7OA 2VQ1A 4XCCL 3M17B 3SCMC 1S7XA 1A1NB 2EH7L 2SEBA 1AKJA 1A5FH 3DX6B 4X80H 1A1OA 1YMMD 2AEIT 1ZANH 1KEGH 4R2GD 5C92A 3MROB 2ZG2A 4C56A 3IVKA 3GHEH 4X4ZA 5E8NB 2Z31B 3SJVD 2RB8A 1FNEB 4KK5C 1I7RB 1K4CA 3SN6N 1RZIB 4H26A 3P0YL 4OCMC 4P2QB 3E6HA 5I1JL 4OZHE 1OP9A 3O45B 4POUB 1MI5A 5FGSA 4N0UB 4WO4B 1XCTB 4QNPF 4IEFB 5TE6L 4JFFE 3VW3L 2AQ3A 4HEPG 1B0GA 2CLZB 3AREA 2OXHA 4HPYL 1Q9KA 2GJ6D 4Q2ZB 3AVEA 4FNLH 3W0WB 3SE8L 3QZWA 3QDJB 1JNNH 4ODTL 4MA7L 4K7PY 2YN5A 4OFDA 5BZWA 4X6CE 1AH1A 5I16A 3E8UH 3KPSD 4PYGA 5IK3A 5I76B 2H8PA 2VAAA 5BS0D 5F96H 4G8IB 3DARA 5K33A 4EBQL 5MERA 2VDLH 3MRMB 1I8LA 1ES0A 4JFQA 2X1OA 2C4XA 3LEYH 4OT1L 4Q74A 5EO1B 2MPAH 3BIBX 2DQIL 3K46A 4O9HH 4NN5B 1TLKA 2R69H 1YNKH 1PG7X 1RZKC 3DV6A 3T3PF 3T2PA 3LY6A 3UZVB 4HWBA 3TBTA 4YXHL 4K71C 1NCCL 3TZVD 2VXUL 3UTPD 4YPGB 5JQ6H 1AO7A 3OR7B 2J6EL 5JW3H 2QQKH 4M1CC 1I9RH 4NC1C 4YIQA 1S5HB 3RGVB 4NQDA 3PHQA 3ZE0E 3S37L 4EVNB 4HXBH 3SGEI 1U3HA 3D2UB 5AG8A 3O3BB 4LGPB 1D5XB 5HHQA 1W8NA 3DSNA 5ENWA 2FR4A 1Y6KR 2UZIH 4NZRL 4QXTA 3STZB 3VGAC 2WUBL 1QSEE 3MUHL 3DTXB 3GSQA 3UBXB 1W72H 1T1YA 1X5GA 2BP3A 5C0AB 5C0NC 3X13A 1M71B 5DO2D 5ISZA 4YX2L 3OKLA 3ZZ1A 2P8MB 4PJIF 3TLRA 4LP4A 4JO1H 3TEUA 1FNGB 4I8DA 4DZBA 5EWIL 4MQXC 1IGJB 3OXRA 3DXAE 1WBXB 5E2WH 4YDVA 2FX8L 1RIHH 1MQKL 4NWTH 5CZKA 3SGDI 1C7SA 1U95B 3TZVC 5GGQL 2PXYC 3BIKB 2D4FA 5SWSB 4PJ5E 5CJBA 1HXYB 2QL1A 5KSBB 2P1YA 4R4BA 3RI5F 4UTAL 4FFYH 5JHDA 1NGQH 1WK0A 2BMKB 2VUYA 2IPKA 5DHYB 1DLHA 3MYZA 4KMTH 5HYIA 5C2BH 2EECA 2BSSA 1AY1L 1DFBL 3MRIB 3JSSA 3ZT6A 3QXUA 3RZCA 4BH7A 1N26A 1QNZL 4JG0L 3V6ZB 3I3DA 5I19L 5BZDA 3NIGF 1AIFB 2IPTL 1RFDH 4KJWD 3STLB 3MCKB 2G75B 1ZOXA 4BFIB 5F88B 4LRIC 1FP5A 4HC1H 3ARGD 3CX2A 5GGTL 5GRJL 1H3PL 1LILA 5I8EB 3RY6C 4NKOB 3WO4B 4EIGB 1LO0H 3QH3A 4F2MA 4HAFA 3T0WA 4I13B 3MNWA 4JFDE 5IW6A 4R96A 2E9BA 4AEHL 5AYUH 4HKZB 4NQCA 4M7LH 3MREA 4M43L 4PP2A 1FORL 1UG9A 3HCVB 2Q8AL 1EZVX 2YD5A 1HHHA 3BO8A 3MR9A 4AEIL 2FJGA 3VGHA 2VLLA 3ARFA 4AIZB 1A6WL 4M00A 2NTFA 5A2KH 5A3ID 1T80A 2XI9A 4R6UA 5FYJH 1EUUA 2AERT 3EYFA 4LCYA 1K4DB 4JFOB 1D9KD 4U7KA 3MACH 3LKNA 1C5CH 1PKOA 3KYAA 4G43B 3OWEA 8CGTA 4BZ1L 3C8HA 4DKDC 2V17H 3FB6B 4LAQH 4U6TA 4GQ9L 2ZOKA 4HKXA 1H8SA 1NGWB 3BVNB 1A0QH 1XIWD 2ATPB 3C60A 3GMOA 5KSUB 3IXTA 1JTTA 2V2XB 2YPKB 1RSFA 1V5JA 4B41A 4XP5L 5JIKA 2NXZD 4MD4B 2NY1C 1RMFL 3TPKA 2GI7A 3VD9A 3I85A 3T0BA 5C7XL 3B2UD 2NLJB 3TA3A 3DO7A 4MAYD 1X5YA 4PD4J 4PTUA 2Z91A 1SY6A 1MWAL 2XA8H 4N8PA 4NCC2 2CDFA 1BJ1H 3GI8H 4POZC 4AM0A 4I4WB 4K7PH 1QHOA 2JCCA 3WEXA 5T1KB 1PFCA 3BPNC 5HY9B 3QXWA 1YY9C 3N85H 4ALAL 5E9DD 3ZTNH 1UQSB 1DE4A 2BNQD 3DYPA 5ITBL 4PBVC 4FQ2L 3O0RL 4ODUB 4TSAH 1ADQH 4FQHA 3HUJA 5JOFB 2EYSA 3WSQL 4MXQC 5EZOH 2NXYC 1JL8A 3MPCA 3F12B 3EO1B 3DX7B 4HWZB 2VZOA 2NNAA 4N1HB 1DN0A 5H94A 5JPMB 4J4PD 3BI9X 5HHVL 2XQYK 2ITCA 2IFFL 1TDQA 3VXSE 3X11A 3U2SB 3L3HA 4K7FA 4JVWA 3UTQA 2H6PA 3SDXB 5MEQA 4Y2OA 5HGHA 2F54B 2DMCA 1J5OH 4JQXC 1FGNL 2ZZUT 3O9WD 1FNAA 4M5ZL 1U8HB 2RR3A 2EXYC 1ZVHA 4UU9B 4ZFGL 1M05B 3MV7D 1F02I 4MJ6B 5FKAA 1T1WB 4MHHG 4XWGL 1JYVA 2IQ9H 2VDNL 3I6KA 4QXGL 4LPYA 2X4UB 5LGJB 1CT8A 3ILPB 4OZFA 3PHSA 3P4NA 2IANA 3KR3L 4KUCF 4OAWB 1IGYB 3NCYS 1L9NA 4JVPA 3U4BL 5DI8A 3C5ZA 3OJDA 4GBXD 5D93B 2H1PL 5ACMA 5DQDH 4LHJB 1NMCC 4N5EC 4HT1L 5HHMB 3SE9H 4IM8A 3G04B 3TCLA 3PGDA 1HXMB 3JWDL 4JPVH 1KNOB 1Q94B 3MJGX 3WIFB 2EH8L 1KIQA 3MRGA 3IDXL 1OP5H 1LO4L 3GMRA 1N4XL 4PRHD 3B2VH 3JWNC 2I26N 4LRNH 2FX9H 5DSCB 3WD5L 5CKGA 1NSNH 3LAFA 3SBWC 3SCMB 3GEWB 2F53D 2GK2A 5F3BB 4JDVA 3PL6A 1OQXA 5KVEL 2DYPB 2HT2C 5IGXH 1AD0A 3F6IA 3TJEL 5F1NB 1K6QH 1MFBH 1FSKC 3D3VE 2BVQA 1Z6JT 5FM5M 4MXWH 5BQ7A 2BNUB 1QTYT 1QVOB 4PREB 2PW2B 3MCLH 3GSNB 2CK0H 1MEXH 3RVWD 4AEEA 2G5BA 1CXKA 3O6LL 4JFXB 1NBVH 4XCYB 2ZSWB 5F9AC 5DJDB 1S7TA 1M1SA 5JO5B 4RMUA 5D70L 5C0GA 4XX1E 3DURB 4BSWB 4L4TB 5FHBH 4JRXB 3FO2B 3TM6A 3QQ9D 5SWQB 5T3ZE 2ZUTA 2R2HA 5ACZB 3NABL 4UIKL 1OVZA 2HMID 2WW8A 4LPVA 1V7NL 2CKNA 4X7TB 4FZ8L 5DMKB 4JCMA 1KENH 1T22B 4F3FB 1INEH 2IG2H 2NZIA 3MNVB 5IJVB 3VXRE 1FYHB 1X7QA 4JLRA 4YR6A 3C09C 5IUSA 4M61B 4XGZA 2AJXH 2P5WA 4Y5VC 3MUGA 3WN5C 4FQPA 4KROD 1XGUB 1ZA6B 3S3PA 3VFSB 1JP5A 4CU7A 2JJTA 5HYFA 4AT6B 1IFHL 4BELD 1VKXA 3SJVB 3L5XH 1ZLUH 3G6DL 1YUHA 1NFIA 2F8VA 5TE4L 2D7MA 3OZ9H 2E8YA 3GMQB 4O51A 2EDJA 1BZ9A 4Z7UB 1VEOA 3QR2A 5DQJA 2VTFA 5KS9A 3A6OA 2X4PA 4LDOB 4I5BA 1P4LA 3UTSA 4OLYH 2J8UF 3I6LD 5B38B 4XVSH 4DW2L 4NSKB 2PYEA 4P23A 5H35B 5JMRA 1CLOH 3R8QA 3NCCB 4HCRA 2D7TH 5GGUA 1BM3L 3AXLB 1M7DB 1NKOA 4RGNE 1NQBA 3CFCH 1P2CB 3UDWC 3D69B 3KPSB 1I3UA 4OCYL 4KK9D 3BESR 1NLBH 1ZHLA 3BMWA 3FFDA 2FB4L 4XXCC 1K8IB 3LMJH 2NYYD 5IQ7H 2V2WA 3F65A 2WBKA 2NY7L 4OGAC 3MTRA 3VGAB 3U0PA 3L7FA 4JO4H 5FF6B 2RFXA 1FL6A 1HI6B 2HH0H 2I27N 1VFOA 4QCIB 3FCTA 3TO2B 3WLBA 1TZGL 3O41B 5F8RC 1G7PB 4DFHA 1JYNA 4OZGE 1R3HB 4GSDL 2D2OA 3QFDA 3IFLH 1CDCA 3QFJE 2HFGH 3FT4A 1FRGL 2GJJA 4P9MH 1F3DJ 4KPHL 4K7PX 3EFDH 43CAA 1FNFA 3BAEL 5DS8A 3BKMH 4NPYA 1N0LA 4ZFFA 1UGNA 1KB5B 5CLWA 1T1XA 4JFFD 4JRYE 4YUEL 3TZVB 2Q87A 1I3GH 3NFPB 2CLRA 4NRXB 3Q6GH 5E95B 3CK0L 4B53A 4NQUA 3BDYH 2J6EA 4UNUA 5CEXB 1CGUA 4MVBD 3LN4B 3OG6B 3LN5A 4XNXH 5C0JA 2ERJC 1OARH 4N5UA 4ZUVB 4YDJB 2W9DH 4TUKH 5FV1L 2HN7A 2EXWC 3G5XB 5C0IB 1FHGA 4CUCA 3FFCB 1MJUH 5JDJA 1YPZA 3X12B 3P4OA 2DD8H 2QLVB 3GGWA 4HBCH 2DM7A 1TJHL 1S7UA 4IHOA 5LCVL 4MDJA 2F19L 4N1CA 3RFZC 2Z8VC 5BOPA 2BOBB 5IB1B 4HJ0D 4P3WA 2B20A 1A7BA 3GHBH 1FE8H 2HJFB 3NCJH 2IQAA 2W91A 2JCCF 4G6AD 1OCWL 3V4PH 2W1NA 5D1QD 1WFUA 1FQ9C 2F15A 3U9PL 3QQNA 1VPOH 4J2XA 1NGZA 1BAFL 3I02B 1NCUA 4NO3A 3FZUD 3LS4L 3QUKB 3GM8A 3CXHK 12E8L 2P5EA 5JZ7D 2B0SH 1Z9SA 25C8H 1X44A 3ROLB 3A6CL 1FGVL 4LSVL 3FO1B 1M7IB 1JHTA 2PNDA 2EE2A 3ULUH 4KTYA 1AD9B 4X7SH 5DRXB 1I1RA 4HUVA 1MFCL 4LKCB 1Q9OB 1KC5H 5C2UB 2NY1B 4OUOA 4LQ1A 4APQA 1A6AB 1FIEA 5GGTA 2ZWLT 5E7BA 4OV5B 3B9AA 3ZE2F 3KLHC 1LO5B 1RURH 1HKLH 2NY0C 5FCSH 4MS8C 1TVBA 3U7YL 2PO6A 3QXDB 1SY6H 2O5ZL 4F7PA 5ID1A 3CH1B 3BSZL 4X9BA 1G6RL 1NGYB 3BPNB 4IIQA 4P5KA 3F7VA 4LIQH 3FZUC 2DBLL 3O8XA 4Z7WA 3LDBC 5T3XE 2YD2A 4J6RL 3O3EB 5BXFB 4RAUB 5CBEA 1FNSL 3BP6B 3B6SA 2Y5TA 1P5UA 4ORZC 4DTGL 4P2RA 1AXIB 4LCCA 1DBBL 3VXQA 3GRWL 1Z9MA 3VWJD 3QIBD 3U7AA 1IEAA 1IM3B 1ZS8B 2NXZB 2G2RA 2VLRA 4NNXB 2X05A 1U6AL 5I1HH 5JLZA 4AY0A 4XPFH 5MENE 1MHHA 1MJ8H 3EZJB 4WENB 4JDZB 2VLKE 3OJMB 1MNUH 4OCXL 2RHEA 2JIXA 2HFEA 4JFDD 2E7HA 3ARDC 3SDAD 5E08L 2WBJC 1G7JB 3VRJB 2NY2D 2XY1A 5JDSA 1IM9A 1DR9A 3OKMB 1C5DA 4HUKB 4EOWL 1MWAA 4RX4D 4LCWD 2VDQH 3WNNA 1S8DB 2RQ8A 3HFML 4JY6A 1JHKL 5CLTA 5DR5H 3JV4A 1PVHA 4Q7DA 3HR6A 1BD2E 3AMKA 3MRLA 4NM4H 4QO1A 1CFNB 5DD6B 2AJSH 3MRRA 3P9MA 5EUKA 3J8F7 1NMCB 1MVUB 5LGHL 5GS2H 5D72L 1QBLL 2ED9A 1MLBA 3QIBC 3THMH 4OBSA 1RIUH 3ESVF 4YHLH 1BX2B 1MCPL 1P1ZB 3SKJH 5B4MC 3DNKA 5FAAA 2KDGA 4R9HA 3MXVL 4XWOC 3MLPA 5EN2B 5DUPH 4ZAKA 4XNYH 3GIZL 5CJOL 2YA1A 4OQTL 4RGOH 3WL9B 5KBNC 2YA2A 2IH3B 2XKNA 5B22A 5GZND 1WWWX 2OTUA 5TFSH 3MV7B 2H3NB 1DLFH 3CVIL 3PQYB 4BZYA 3O6KL 2LVCA 3SQOL 4NKDB 1L7IH 5JXEC 2AXJA 5IQ9A 3TWCH 3GJFB 1EJOL 1U92A 3K80A 5D71H 3D85A 2VR4A 1J0ZA 3TT3H 4OCWH 3S35L 1R0AH 3BOVA 4K94L 1A7OL 5KS9F 1OTTD 4GBXB 3AY4C 2NW3A 1TNMA 4GW1B 1CFTB 4NO0B 1YEDB 3FQTA 2EYTA 5ICZB 1S7SB 4OF8A 3W81A 3EOBA 4R8WH 3WXWH 1J05B 4GH7B 4X0KA 4PJ8A 3VXSD 5B3JF 3PDOB 4H88L 1BBJB 2V5YA 1WICA 1KG0A 4MSWB 1SBSH 4DUWA 1DQTA 2F53B 2E9IA 4HX1B 1J0KA 5DJ8B 3SDDA 3PV6B 2YXMA 3K81A 3V7AE 1UENA 1GHFL 3C09B 3VGEA 5T5FL 2CDGB 1KCSH 3FOMB 4X5WB 3MLTA 3MRCB 2Y36H 4Y5VB 4G5ZL 4EUPA 1LP9E 4FQXD 4Y19B 4WV1A 4UV4H 5KVFL 4UILH 1B0WA 5AZ2L 4GXUN 1NAMH 1UB6B 1V3JA 1WTGT 4JM4L 3S8WA 4W6YB 2R0LH 4PRIE 2APFA 4ZMAT 1LD9A 2WWKO 3PP3H 5E94B 2EDKA 2HTKD 3D1MC 2GY7B 2UY7A 3S9DB 1A8JH 4CMMB 5FKPA 1XH3A 3S3JA 1AQDB 3VJ6A 2YA0A 2PYFA 5FYJU 4HMDA 1GGCL 1IT9L 4ODXB 4YE4H 4EIZC 3IAPA 4HCRH 2VC2L 3WJLC 2R1XA 4FZEH 4XCNB 3U9UA 1N6QL 3MC0A 3PP4H 4LPWA 1XGQB 4XPBL 2A1WH 1YEJH 2R56H 1IZJA 1CGTA 3M8OL 5DMIH 3RU8L 5BJTB 1QLFB 4RMWA 5KTEL 5IBTL 1X6LA 3GIVB 2C3XA 2JTDA 3OJ2C 1MPAL 1YPZF 3GMNA 5C9JB 1C16A 4KROB 2DLHA 3PXJA 2FO4A 3KLAA 3RZWA 5IMMB 3VE0A 3R0MA 3LRSA 1YQVL 1F11B 4ZUSB 1EO7A 3R0NA 4WW2A 2HKFL 1DUZA 1RZGA 4JFHE 1RIVL 1BQLL 5FYKL 3CFKB 3MOAL 4M6OL 1GZPA 3O4LE 1T1ZB 3QIWD 3T4AB 4U6XA 4RRPA 3DMMD 5T3ZD 4WNQB 1IKNC 2AVGA 4TSBH 1CGVA 2DQJL 3LV3A 3CUPA 4MDIB 5JUEH 2LABA 2KUTA 1C1EL 5J9PB 2ERJB 1U3JA 4ORGA 3MZTA 5ERWB 2E9JA 3PE9A 3VXRD 2JB6B 5DJYB 4HUUA 3O3AA 3KPOA 4J3SA 1ND0B 1GC1C 4NM8L 3K8LA 1RK0A 2CXKA 3QNZA 1MJ7H 3B9EA 3QHFH 2VDRH 4LU5H 4RAVA 1NUFA 5E7FA 4OFYA 5C08E 4OZHB 2QQNL 3HR5A 4BFBD 3MLYL 2XRAH 1G7LA 2FD6H 2P24A 2YKLL 5JA8B 1VFAB 2VLMD 4V1DA 4DN3L 3WFDH 2VXTH 3IF1A 5EIVA 4KFZC 1KJ3L 5JR1L 5EO0A 1RUKL 2J4WH 5L9DL 5D2LE 5EU3B 3P4MA 3P2TA 5TJWK 3OSKA 5L2KE 3TA3D 1NGXA 1AE6L 4MCYB 4OF5A 2Z92B 4KKLD 4RGND 2BOCB 4X6CB 5I30H 4DAGL 2YC1B 1QACA 1IGIL 1BVKB 5ANME 1XGTA 5TQ2H 4F58L 4UBDC 2DRUA 4PJ9C 4HIHA 3GJEB 1A4KA 1AY1H 5EU4B 2X4OB 4CJ0A 1IQDA 3EBAA 1KPUB 3C6LD 5F21B 3KXFA 1E0OB 3N1PC 4NRYA 4HUWB 4XNUL 4L3CB 5CUSH 1FZKA 5DRNB 4NQXA 4Y5YA 1J1OH 5SV3A 2YOCA 2DI8A 1FDLH 5FYLL 1XGRA 1K2DB 3U6RA 1JNLH 4OCRL 5F7EH 5GGTH 1H3PH 5EU5B 4BZ2H 5D9SA 1YN6A 1RHFA 2H32B 1UCTA 4HF5L 4P4RA 4ODHL 2YK1L 4O02L 5BVJA 2P8PA 2Z35A 3MJ6A 3NTCH 5E1HB 5ETUB 3IS1X 4JGUA 4HJJH 5HTSA 4JY5L 5IV2A 4G6JL 4O00A 4YHPA 4OJFL 4OIAA 5TPWH 3B9KA 3LDBB 3VXUD 4AEIH 3H7LA 2EDOA 4HDIB 1QSEB 2VDPL 1I9EA 5HHOE 4C55A 4YHZH 3C5ZD 4NJ9L 4PJDF 3L5HA 3V0WL 2DQFA 3SEPA 4BZ1H 5HGDB 4AMKL 4OF3A 2FDBP 2AJYL 1CDJA 1PY9A 4CDHA 2BVUA 3ZT7A 5JXAH 3CFDB 7CGTA 3U36A 1ETZA 3QPQC 5EOQH 4R7NA 3OKKA 5ESVA 3DXAB 4XBGA 4Z0BL 5CEZL 5HBBA 4D0CB 1OGAA 4XCFH 4ONOA 1WT5C 2R8SH 3ARDB 2OJZH 2WBJB 2B2XL 4PJ5B 3CFEB 5D8JL 1V3LA 4XBPA 4EDWL 3V5DB 3CZFB 4IMKA 1YEGH 4Q9RL 2CLVA 5I9QC 1QQDA 1G6RA 1PKQA 3MLRH 5FK9A 3MFGB 2VWEE 4WDIA 2R23B 2WBWB 2W0KA 1ZSDA 2A0LD 4OCSH 4U1NA 1RULH 5IHUH 4R7DB 2BRRL 4NNPH 3HC4L 4HQQH 5E56A 3RGHA 1EVUA 4LCUB 4GW4A 1AGFA 2H9GB 1WIPA 2DQTL 4JJ5A 1DBML 4E42B 2VE6A 3QIBB 3TPUA 2QSQA 2WV3A 1DUYA 3QQ4B 2X4RA 3OKNB 4OZ4A 3GRWA 3LOWA 2IFFH 1UM6L 5K9JL 3T77A 1WIUA 5ALBL 1Q9WA 2MKLC 4QF1B 4KRPD 1U8PB 1B4RA 2V7HA 1CFBA 4JFDB 1AR1C 4RMTA 3RWFA 1P84J 4PRPE 3ZE1F 5F1IA 3DUUA 4G9FB 3B3IA 1ZAGA 4X4MA 3NA9L 1L4IA 5GISH 1ORSA 4HIXL 4XWGH 4QRPE 3RA7H 5ICXA 5FYJE 3NZ8B 1UCBH 4X9IA 4QGTA 4Y4FC 5TE7H 3CC5B 5EU6A 4U1IA 4D0DA 5T3XD 4HFUL 1GZQA 3VFUA 1U91A 2EDFA 4C58B 4XP4L 2ZUXA 1B2WL 3VGBA 1KPVB 5J11C 4LEOB 5ESQB 3ECBA 5C0EA 4FQJH 1I1CA 4U49A 4GKNA 3S37X 1MLCA 1BEYH 2P49B 3V6OA 1KUMA 3TO4C 5CIPH 4ZOAA 2PYED 3HC3L 5EH1A 1KOAA 3HLAB 3RKPA 5LQBL 4MD5B 1XF4B 1UEYA 5CWSB 3WS6A 4I3GA 5SX4H 3SGKA 3UYRL 4CJ1A 3IDXH 4LLVB 4HS8L 1FLTX 4YAQB 4LSSL 2ATKA 4U6HB 1PLGH 2IALB 2BVTA 4OQTA 4FTVD 1BLNA 4TULH 5HHNB 3WUWB 4IOIB 4U0RC 3TIDA 4L8SA 3L5IA 1CU4L 1XF5B 3M1BA 5CJXA 5D5MA 1MSPA 1PZ5A 1GGIL 4KZEL 3GBMH 3G6JF 1LGVA 4C83A 3RWJA 3PUCA 3CFJB 1KT2A 3UZEA 3BQUD 3CNKA 4PUBH 1LO2L 1I7UA 4ZOBA 3LB6C 4J1UB 1RZJC 1S78C 1A4JB 3HC0B 5IVXA 4O5LL 1PJ9A 3KPTA 3O6LH 4LVHC 5EG6C 1E4KC 5D2NE 3GMLB 3V6FA 3LD8B 2YRPA 2HJLA 3ARBC 5I1KL 2KPNA 1NEZA 3VFMB 4OM0H 3VXSB 3HG1E 5D70H 4GMSL 4CAGA 2P45B 3D39A 4Q0XL 4WW1B 1S7QA 3C08H 4YXKL 3DVNB 2UUDH 2AABL 4I18A 3VXMA 5HI3C 4Y4HA 4ELKB 1CXHA 1XR9B 4MA1B 3MRDB 1JZ6A 1SVZA 1S5IH 3MLZL 3W11D 3T0EA 2I9TA 3FRPG 5AWNH 2R9HC 4NJAH 4KMLB 4L5FL 5CP7B 1UXWA 4FQXB 2ZG3A 4BSVB 4KTEL 2X4NB 2OS7A 1NDMA 1QFOA 2VIRA 3OKOA 2Z0BA 2JLLA 1T0NB 4JM2A 2Y7QA 3HI1B 1BF2A 4QOKD 3AC0A 4ZUWB 3VU2A 1QFWL 4DGYH 3MV8D 3JTTB 4IRJC 2R4RL 5INDB 4FP8H 5F9JA 4CADB 4N9GA 4LOUC 1ZLSH 1KXVC 4E5XA 2R2EA 4XH2A 1QBML 5GJTH 2EIBA 4OIIH 1RUML 4HIEB 4DUXA 5CD3B 3EDEA 2YUXA 1I1AD 3OAUL 3RWEA 5IKCA 1IGCH 1Q38A 3AM8C 4YZFE 1CS6A 1F8TH 4JFZL 3PGCB 3DI3B 1NCAL 2P8LB 4YWGL 4OI9A 4XC1H 4IS6A 4JREB 4L4VD 4PG9A 1OB1B 2P5ED 1QSFA 5AUMA 3D18A 4KXZI 4P0DA 5DZLA 1OHQA 2VXQL 3D3VB 3WIHL 4CVXB 1Y18A 4Y16C 5I1CL 3D6GA 4ZO8A 4OSUH 1JPGB 2ILLA 1T7ZA 4RISH 3NCFB 4LAJH 3K1DA 4X6DE 2GSIB 3S4SG 2VJXA 4OLZH 1I3VA 3VH8G 4PJEA 2UUDK 5GGSB 3QHTC 5DMGC 2B1HL 2CSPA 4KQ3H 4WJ5B 1TXKA 3NACL 4ETQA 1R3IL 2ADGA 4FQCH 3DX8A 3PXHA 1IAKB 2IPUG 1U8QB 5EC1A 5GPRA 1F4XH 1GOHA 4JQVC 1AP2B 2CH8A 1U0QA 4K3EH 3EOTH 3TH2T 3H7BB 5GSRB 3HPLA 4FG6C 5I66B 1AHWC 1DANT 4U1SA 3VXRB 3O8XD 2I07A 4FQLL 1U58A 5J4MA 3U46B 3IJHB 1XF2A 2ZPKH 3WFCH 3SGEH 5E2VL 3IDMA 4OF7A 4PGDB 4NO5B 1QLEL 2VISA 4KI1A 1IBGL 4LLDA 5EC2B 2A9NL 2B1AH 5IG7A 2EEDA 4ENED 4QTIL 1DL7H 4XP1H 3MLSH 1TTFA 2DJ4A 4YFLI 4ZQKA 1X4ZA 3FQRB 3P11H 2JELH 1WZLA 1UADC 4NO2B 1U8OB 5DD0L 4JFHD 4YHYC 3WIIH 4NFDA 1YZZA 3MRQB 4JFPA 1HZHL 4O4YH 5EBLA 3ZDYF 1CFQA 1GIGH 2GSGA 3LEVH 4RGNB 3C8KB 4XHJC 3QDGD 4XAWH 3DETD 2BXYA 3SOBH 5C09A 1FYTA 3QWQB 5IHZA 4GW5B 3HA0A 5E2JA 5JNYA 2VSDA 5FOBA 4MWFA 1I7TB 3QUMH 3WYRA 1T89A 5CFHA 4XNQB 5L88L 2HTLC 1XF3B 2XQBL 3FONA 4ZS7H 3IXAB 1PX3A 1E6JL 5DK3A 3L3KB 4UQ2A 1PEZA 1TZHA 3JBG7 1F58H 1A6TB 1T0MB 4OZGB 4ODVH 2QTEA 4WFEE 4MNQD 5ISZE 4FFZH 5BO1L 3QFJB 1UJ3C 1RU9H 4S1RH 5I1LB 2C7UB 1M7XA 3FHQA 3SKMA 5IB3B 3KDMB 1FZOA 2DS4A 4PGCA 4U2YA 3L1OH 4HS6B 2GTWA 3OPZL 4IOFC 3BW9A 3Q3GA 4JRYB 3BXNB 5HDOA 3BEVB 5C8JB 4KV5F 2ZSVA 1F3DH 3CU1A 5DJAA 4KMQA 4S1QH 2BSRA 4M9PA 2UWEA 4Z95L 3N1MC 4HKBA 3TH3T 4Y2DC 1ZGLA 3BGMB 4L3EB 5L2KD 4KH2A 4PRNB 3Q1SH 3DROA 5I9QB 3H3PH 1ZVSB 4F15C 3BDXA 3A6BL 1UACH 3LKPA 3VXNA 5IFAH 1UZ6E 2DWDA 3NCEB 4L1HA 3RTQD 3FAWA 1HCVA 3RIAF 5HYSA 2R0WL 5EPMA 4GXUM 1CK0H 4KVNH 8FABA 4KTDH 5T1LD 1SHMA 4FQIH 4L8BB 5K59E 4OI7A 2WMPA 3NCMA 4YXLH 4UIMB 4F9LA 2CRMA 3CFIC 4PRAB 1EFXA 4S2SA 5BRZE 1QSVA 4LHUG 4S1SL 5DQ9A 1SJHA 4PJAE 2XZCH 1S7RB 2EZ0C 3EDJA 5LXGH 4M7LT 1F3RB 1RZ8A 4FXGB 4DCQA 1KN4H 4KK8C 2AK4E 3O81A 1VADB 3G5ZA 4JCLA 4MA8H 3GSVA 2OJEA 3VXOB 2VXSH 5D7SH 3H9HB 4NQEA 4HAGA 3V5KA 4F7EA 2O93L 3K1KC 5D5MF 3WHE1 2F58H 4NQCE 4FABH 5CP3A 1RUPH 5DEGA 4MD0A 4LLWA 1YYLL 1WSST 2AJZA 1XCQB 2VZTA 2MWCA 4PJXF 1QRNA 4C59B 1BF8A 1P4IH 2A73B 4GRLC 1FFNA 3STBA 5CCKL 1VGEH 4Y4FB 2VUOA 1HYSD 5D1XA 4ZTPL 3PWUB 4JR9H 4WUUA 1N8ZB 1B3JA 3NH7H 1JF1A 3VA6A 1D5IL 1OF2B 4MAUL 1AXSB 3IETB 3KPLB 3KWWA 1FLRH 3GMPB 4IDJL 1HHKA 2ICEB 3GZKA 5JHLH 4WI4A 3EO9H 4H0GA 4J3VA 3ULUE 1JWUA 1NEUA 3O2WH 5IMOB 5E6ID 3WFEL 3H9SA 1XGYL 3D48R 5CSZA 4Z76A 3TBVB 1QBLH 1FFPB 4PG2A 1GCFA 2L7JA 1AI1H 5DJZA 1OP3H 5EZIH 4JN2B 4DEPC 4ZYKB 4D3CH 3VI3E 4XZUA 2HJKB 1Q0XL 1T83C 3RWIB 2CGRH 4Q97A 4X4YB 5CHNA 4LGRB 1C8PA 1ZGLM 2L4OA 1MHEA 1JE6A 4OQTH 4UI2A 1T03H 4U0RB 1KJMA 2ICWA 1UWEH 3MLUH 4XPHL 4PIRF 4PRDA 4JB9L 1UYWH 3TV3H 5DC9B 2XFXB 3KPRE 4AH2A 2X4SA 4JM2F 5GRVL 1DQJB 1AGEB 4OD2B 4FMFA 4QRRA 4JFEA 5C0RH 3HUJE 1Z0MA 2ZG1A 3DX9A 4LSPH 3VFVB 1LEGB 4KVCL 4LVHB 1G7QB 5E8EB 5B39A 2NZ9D 4Y4KD 1E4JA 3S5LB 4PY7B 1AJ7L 2IMNA 5GGRB 3ARBB 4E41D 1WCBA 2Y06H 5F6HJ 3GSNL 5TQ0L 3GB7A 1J0YA 4PGZA 1MRDL 4WFGE 3F7YB 3BZFB 3DGGB 5MENB 3C6SA 4G80B 1RZFL 3NCYP 3ARPA 3MJ7B 3SDYL 1A7NH 3EKCA 4S1DC 1NCBH 4P48A 2VLKB 4F7CB 1WCQA 1I8MB 5L6YL 5I1GH 1UVQA 2XNAB 5DJ2A 4PRPD 1AGDB 3VFGL 2E7LA 1IAIL 1NC2A 3GSRA 1CBVL 1IL1B 1LNUA 3CMOL 1GHFH 1LDSA 2VL4A 3FT3A 1CE6A 5E00A 1URLA 3G9AB 5DDHB 3D9AL 1HHJB 1QO3B 3C87A 5GSVB 5I71C 2OMBA 4QRPD 3HI6H 3M17A 4WHDA 4PJEF 1JN6A 1A1NA 1CGSL 1BD2B 4V2BA 4S0TD 1BOGB 2WLZA 4FS0A 3QCVH 2QJDA 4XMKH 2NZ9C 5I1IL 3MROA 2GAZB 3MJ8B 3C2AL 3M45A 4IRJB 5KOVC 4X98A 4LASL 2RBLA 2LVEA 5E8NA 2XV6B 4MB3A 4XMPL 1FNEA 4GUPB 4U1JB 1RZIA 2FX7L 2AKRB 3MV9E 4N0UA 2NY4D 2ORBH 1SEQL 3L3IA 1XCTA 3MBXH 4WO4A 4CNIB 1SVCP 3TVMC 3FJTA 3GUTB 4XC3H 3ZHDA 4ELME 4QRTB 5FUOH 2FEDC 3DWTA 4XPBH 1OWWA 1YEIL 3FO0L 2YZ1A 4YHOL 1JI2A 3W0WA 4K9EC 2VAJA 3QDJA 3MRBB 2F8OA 3FMGH 3RVTD 5I76A 2NX5B 2VZVA 4G8IA 1WC7A 4XP6L 2OP4L 4TVSa 3ARWA 1AFVL 3W9DA 43C9B 1AGBB 3CSYB 3VD7A 5IFHL 3H0TB 1CDGA 4LVNC 3WHXB 3DSFL 3HB3D 5EO1A 4LVOC 3VRLF 2GIYA 4GMTH 1R3KB 2XZAH 5EUOE 1RIVH 4I0PC 2XICA 1IGFH 4OGXH 4OFKA 1GGBH 3TBSB 1I1AB 4GXVH 1KB5L 2E7BA 2CMRH 4AK1A 3RBGA 5IVZB 4XPTH 1AHWB 3TIEB 4YBLC 3BGAA 1RJYA 3W9EB 4KUZL 1FAIL 1LK2A 3B9KD 2CIKA 3OR7A 1G9NH 3QULA 1W0WB 4FQQB 4YFEA 1TJIL 3RGVA 4XNZC 1CG9B 2B8OT 2AJVH 2G60L 2V6HA 1QA9A 4G42B 4JZNA 4EVNA 1FVEB 1U2CA 3RVTC 1JRHI 1W8OA 3O3BA 5EBGA 3WIHA 2OZ4L 4NM8H 1NC4D 1U42A 1ZA3B 4PRIB 5IM7A 4XPGL 5BVPH 3STZA 5KG9B 1V7ML 3ISWA 2C3VB 3DTXA 4OM1H 3UBXA 3ZDXF 2DM2A 3UTSE 3HB3C 5C0AA 3L7EA 1AC0A 1KCVH 4Q9BA 1M71A 1J8HB 3FB8A 5DHXB 2UWEF 1NMAL 4UUJA 3U7WL 4PB0L 2P8MA 4FQ1H 3LQZB 1I1YB 2X4QB 1QFUH 3BRFA 4XVJL 2CO7B 1CICD 4W6WB 1FNGA 2XXMB 1T4KB 3Q6FB 5L9DH 3BUTA 3LHPH 3BISA 1T66D 1DQDL 2VDOL 5HVGB 3ES6A 1IGJA 4NUJB 2RCSL 1WBXA 2E8ZA 3VWKC 4V2CB 5CEYB 5D7JC 2J88L 3BIKA 5SWSA 3UTTA 5K93A 3V9FA 1C7TA 4P46A 4JHBA 2PW1A 3CU7A 5KSBA 4K8RC 1RQ5A 4OD1H 5KVGL 4R3SA 3NCBB 1OM3L 5IBLD 1NCWH 4UB0L 5IFJB 4QHUA 2BMKA 1NBZB 5FO7B 4P3DB 2DIJA 1UJ3B 2V5RA 2Z93A 3MCG1 3MRIA 3T65A 5D1ZD 3CPLA 1DCLA 2QKIA 2FL5B 3DRTB 1CDYA 1QFWM 2CIIB 3V6ZA 2ZJSL 1R3JB 5F7MC 3QEHA 1DP0A 1AIFA 1YMHB 1J1PH 3O4LB 3WNLA 4KKBD 4Y2DB 2G75A 4RMRA 3CVHB 2PCPB 4Y5XC 1CD1B 5F88A 1MFDH 1JFQL 2J2ZA 3QG7H 2YK1H 4O02H 3PWPA 4NKOA 4ZPVA 1J86A 4GO6B 1YNTA 3GMMA 1HSAB 3L9RB 3GFUA 2W59A 4X9GA 4G6JH 4M62H 5HGAA 4MNHB 2A83A 4PJGB 3JUYA 5HYEA 3EIFA 4XVUD 4A6YB 1YYMH 2FECI 2VDML 3FHAA 5T1DL 5IR1B 1BZ7B 4OZIE 4PGJA 5C6TL 5C08B 1O7VA 3QEQE 1T7VA 4OB5L 4WI2A 3QDMA 3VMNA 1K4DA 1KN2H 2O61B 4G43A 3QG6A 1N6VA 2Q7YB 3FB6A 4NWUH 4ODSH 5DJCA 5D2LB 1NGWA 3BVNA 3UO1L 3JTSA 2R1YB 3AREC 3QUXD 1G7HB 3V52H 5L2KB 2V2XA 2YPKA 3HMXL 4J12A 4JPKH 1OGTB 3DV4B 4EN3D 3KYNB 4H20L 5ADPL 2BSED 2C4FU 1J0IA 1CIDA 4MD4A 3AROA 1UH3A 5DRZB 4EDWH 3EOYG 3WXVL 2FRGP 1FVCB 2NLJA 4Z7NF 2I5YH 2Q3AA 4KAQL 4DOHE 2GT9B 5IW1B 4B5EA 3EYQC 3E6FA 1I8LC 4JPIA 1MCOL 5KAQF 5HDBE 5T1KA 4I9WD 4U1GC 1P9MC 1E6OH 2EYRA 2GQHA 4WFED 5EFIB 2GTZB 1RZ7H 4ODUA 3LQAH 3O2DL 4NYLB 4OUUB 3ZO0A 5JOFA 1NCTA 2VN4A 4DEPB 4HWZA 3DX7A 5HPOA 3D39D 3QCUL 3TNNA 4H0IA 4D9RE 4QHNA 1AC6A 2BDNL 2BNRA 1TPXC 3VXMD 1WZ1H 4LCIL 3PABB 1CR9H 1UWGL 1FVDA 1N64H 2I9LB 5JORB 1JZ4A 1NBQA 2DDQH 4EN3C 1QR1A 3SDXA 3HNTL 3GSUB 3V4UL 1EHNA 3O6FD 5GS0H 3DECA 4N8CL 2ZNXA 4YGVB 2F54A 1U3HC 2J1KA 4WTZA 5CS7A 5H8DA 3TN0D 4ERSH 2E27L 4Z7WE 3MUJA 4UU9A 2UZYB 4DGVH 2PTVA 4MJ6A 5HHOB 3HE7D 4NKIH 4W68A 1T1WA 1W72B 4Z7VA 2BHUA 2F8XC 1F3JB 1MH5B 2GEEA 4LHQB 3MRJB 1MF2H 3PWJB 1UB5B 3VDCA 5LGJA 3S88H 4TUOA 2AV7B 5F9OL 1N2RA 3ILPA 4P2RE 5KVDL 3ARQA 4M3KB 1P5VA 5BRZD 4MMZC 4OAWA 1IGYA 3INUL 2HVJA 1BQUA 5I0ZA 4MA3B 2ED7A 1Y0LB 3IDNA 4M6AA 3P9LB 1K9TA 3MBEA 2AK4D 4NT6B 3WNKA 5LQBH 3G04A 3RPKA 4MQ7A 1HXMA 1H8NA 4H8WC 4HS8H 1KNOA 1YEFL 3OR6A 1Q94A 1XR8B 1HILB 2IAMD 4LARL 2AXFB 4XP9H 1XEDA 4KKCD 2MCPH 2L0DA 3C9NA 1XT5A 4GRMB 5I71B 3TN0C 1OAKH 1VACA 3OGCA 4NKQB 5F97E 3HE7C 3BT2L 3LKRA 3MLXH 3QWRD 3RZCC 1B0RB 2JB5H 5F1NA 1LO2H 4HIJB 4QRUA 4M7KL 3N1QC 3ZHKA 1P4BL 3BZ4B 5H37G 4PJHE 4RCAA 2BNUA 3ULUD 3U0WL 1QVOA 1AQKH 2VMFA 4PREA 5FO9A 4DQOL 2PW2A 2YRZA 5CJQH 4NGHH 1IQWH 1D5BB 3F58H 3KPPB 2DI9A 5SWZB 4XCYA 2ZSWA 3QXAA 3CSGA 4R4ND 4HH9B 1YEHH 3TVMB 2AJ3A 4PRPB 3NIFE 4IRZL 1CZ8L 3QNXA 1KGCE 4OKVB 5H37H 4JDTH 1IC4L 3BPOC 4ZD3L 1UA6H 3O11B 3IU3A 4O58L 5ACZA 1CVSC 1DDHA 2AJUL 3RVVC 3MUY1 1OWRM 3ARFC 3KPRD 4X7TA 4F7TB 5DMKA 1T22A 4F3FA 3B9DA 5F7DA 1YMMA 5IJVA 2DQHH 1HE7A 3T8XB 5FCUL 4NCDA 2IFGA 1MUJB 3ARZA 4M61A 2GY5A 3D25B 4G6KH 4LLUB 4PJBE 3TC9A 3RBSA 4X99B 3WV0A 3MRNA 3ULUC 3SJVA 3B43A 3RPIA 4I0PB 3UMTA 1U8IB 4WFGD 1LEKB 4KDVA 4Z7UA 3TBWB 3JWOC 2W9EH 2Q86A 1B90A 4DKFH 5IMLB 3I75A 5FGCE 4DKEL 1U8KA 2Q76B 1HQRB 5B38A 3C5JB 3OKEB 5TDOB 2GKIA 3N9GH 4YBLB 5EZLA 3NIDF 3E3QC 4NSKA 5H35A 4G8EB 2YBRA 3TT1L 4D94A 5HJ3B 2GJ6A 2R0ZL 4NFBA 1Q0YH 5KSBF 4KDWA 3KAAA 4XNZB 4JAMB 4BQCA 2VB5A 3FN0H 3IFOB 1INDL 3D69A 5L7XH 3KPSA 1HHGB 2N56A 5DGRA 1CD9B 1M4KA 5BS0A 2OTWB 5BV7C 3HS0B 3WIHH 4C54A 4Z7OF 1K8IA 2ZCKL 4LDEB 2M1KA 2C3HA 2PTTB 5D7IA 1EHLL 1FC1A 1T2QL 1BQSA 3V0VA 5FF6A 1OAYH 1HI6A 5D6CB 5EIIA 4QCIA 5D2NB 3BKJH 1BGXL 3LKQB 1K8DB 2B1HH 3O41A 2JJWA 1LEIB 5C71A 1FPTH 1R3HA 4JO2H 3HG1B 1S9XB 4U0QB 5I17B 3DIFB 1FFOA 1HINH 3QA3B 4MLSA 1ACYH 5DD3H 3MV9D 2QHRH 4R90H 4X4XA 1P84K 3MO1B 1KB5A 1T2JA 5D7JB 3TZVA 1BVLB 3QIUD 3I2CL 3BH8B 2VABB 4XPAL 1IAIM 3FQUA 1C08B 3ULSB 3EYSH 4RZCA 3PWVA 3QXTA 2R1WA 1EPFA 2IGFH 4HS3B 2EDNA 3MNZA 3KYKL 3LN4A 5DT1L 3K74B 1NC4B 4XBEH 3GI9L 3MODL 1G6VK 6FABH 4HK3J 2OZ4A 5J06A 3DRQB 1JRHL 4RFOH 4AENA 2DI7A 4HD9A 3G5XA 1HH9A 5C0IA 4MQSB 2AGJH 2C26A 2EE9A 2BK8A 1KV3A 5JW4R 5GJSL 5HHME 3TYGL 2IH1B 5HI5D 1AXTL 4HK3N 1UXSB 4WY7L 2E5EA 5ALCL 5DD0H 1A6VL 1IEBB 3FQNB 4ZTOL 4H0HB 4OGYH 2BOBA 3CXDH 1SJEB 1ZT1B 1R24B 5TF1H 2FNBA 3UPRB 4EI5D 2OL3B 1SYSB 2AK1L 2HJFA 4MQTB 2AI0H 2R29L 1S7XB 4N0CD 4UT6H 3ZTJG 4M4RA 5JA9A 2YUWA 2DMBA 3PL6C 5IT2H 1A1OB 4WUUD 3SKUD 1LE9B 1KJ2H 5F6IB 5HPMB 2GYSA 1B6UA 1N5YH 2B7DT 5F9DC 1GC1H 3IVKB 5IESH 1YN7A 3I02A 4H5SB 3CLFL 1WGOA 4X6DB 4HW6A 3FO9A 5F7KC 4H26B 3E6HB 4FFVD 3ZTJH 3ROLA 1S7WB 4P2YA 3FO1A 3GK8H 4YHKH 3WKML 1ZHNB 3T09A 4UTBL 2ZNWA 5GGVY 1ZEAH 3V8CA 2EKJA 3AREB 5GRUL 2VR5A 4QRSB 1MAMH 3SDXF 3I9GH 1KBGL 2VL5B 1YJDH 1OOAA 2FLRT 4LKCA 3ARGA 2GK0B 2LV4A 1BBDL 1DEEB 3P40A 4CVUA 5I16B 2QR0A 1XGPB 4UT7L 1A6AA 1WZKA 3P0VH 2H8PB 2VAAB 3OQ3B 4N0CC 4G7VH 2C1PA 2Z8RA 1CYGA 1LO5A 3MYJA 3WJJA 3CIQA 3QXDA 1ZLWH 1ES0B 4DGIL 3CH1A 4JFQB 2OQJA 1NGYA 4P49A 3X3FH 5MEOA 2X44D 2JJTC 1YEEL 3EJZD 5E6YA 1FH5H 4C4KT 5K9KA 5JIPA 2VXVL 1HNGA 1BQHG 3P30H 2JE8A 2W60A 3S36L 1D9KA 4ODWB 1C12B 5LBSL 2P7TB 4TSCL 2HKHL 4RAUA 2FJFB 5E2TL 4G8FA 3TYFA 1XIWA 4P23C 1KFAL 3QISA 5TDPB 2D7QA 4JZJA 4EN3B 5FUCC 4NQDB 3FTGB 4LSQL 1NDGA 2PR4H 5DUML 1LO3H 3HMXA 5E99H 4L29B 2QADD 4JQXA 2R39A 3EFFA 1HIMH 5CD5C 5FDWA 3SKNB 4LBEA 5ENWB 5FYKU 1JZ8A 2FR4B 1CL7I 1G7JA 3HZYB 3VRJA 1GOGA 2ZCHL 1MCLA 2NQCA 3P9WB 1MIEL 3DVIA 4JO3H 1T1YB 5HHXL 3EO0A 4MXVF 4I3SH 5E9DA 3X13B 3EJZC 1S8DA 4KHXL 3GBNH 5ISZB 5E8PA 2XN9E 5DJ0A 1DBJH 4M6ML 3ME0A 3QEQD 2X7LA 2Z31D 4YHNA 4XXDA 2DQGH 4DZBB 4KJQC 4PJFA 5DD6A 5AD0A 1A7QH 1NFDA 3LRGA 3WFEH 1K5NA 3O2DA 2EKSB 4P2QD 4J4PA 1MVUA 2FZ3B 4YDVB 4U3HA 4U2ZA 4QXUL 4ZFOB 1WTLA 4X6EB 1KIPB 1ZLWK 5E4EC 5KSVB 4Q58C 3UJTL 4PFEA 4WHYG 2MSPA 2W07A 1IC1A 5EN2A 5FECA 5E2UL 5C0CE 4HLJA 3W0WD 2FJHB 2IPKB 4XPHH 3TN0B 3SBWA 2DKSA 4P59L 2EDWA 4G7YH 2BSSB 3MV7A 2H3NA 3WE6A 1OAXL 1JV5B 3HE7B 2JK5B 3X14A 1YNLL 3BH9B 4NKDA 4BH7B 3GJFA 5F9WC 5BZDB 1SM3L 4WHYH 5BRZB 3T2NH 4Z7UF 5IIEB 1N0XL 1BZQK 5E8DH 3ELAT 1AJ7H 4PJAB 4GBXA 2OTPA 1A7RH 4ZSOA 4GG6E 1CFTA 4ZNEA 3GO1L 3I50L 2XXCB 3RNKA 3IU4L 5ICZA 1S7SA 3QH3B 4F2MB 2D3VA 4D9RD 1DBKH 2A77H 5IW6B 4R96B 2Q8BL 4LPTA 4KRMB 5IP4A 1J05A 1F42A 5HDQH 4NQCB 3BPOB 4PLJD 4PP2B 3IYLW 4I77H 4PRHA 4KV5E 5GHWL 4TOYL 2FYYA 1HHHB 2EDBA 4MSWA 3BO8B 3MRKB 4X7FC 3KNBA 2F53A 1EMTH 5DJ8A 3CMOH 3FB7A 3REVB 3PV6A 5ILTH 3D2UD 4LSRL 2QSCL 3D9AH 1G84A 5EU6E 2CDGA 2O5XL 4WI5A 3FOMA 3RDTD 4X5WA 3VXPB 5DFVD 3MRCA 5C0BE 1BIIB 4Y5VA 3RNQB 5E24E 1P7QD 2OR7A 5ESAB 3A67L 5EA0L 3N0PB 4HIIA 3I84A 4M5YL 5DWUL 2A74A 2EDQA 2DM3A 1J10A 1CFVL 3P73B 5F1OB 1D6EB 2X4TA 3NZHL 1H5BA 5B21A 4RWYL 4MMXC 4APQC 3H9YA 5GGVH 4CMMA 3ZYJA 3DOSA 4N90D 1OAUL 3L5JA 4ODXA 1CI5A 3HZMB 2DQDL 2Z91B 3KYMB 4AM0B 2CDFB 4KKAD 3BEWB 5AZEL 4XCNA 5SWSD 1JGEA 2PO6C 3QPXL 4TTDC 4MJ5B 2XTJE 3FO0H 4G3YH 4XAKD 2BVOA 4IIQC 3QUYC 5T33H 1XGQA 4KU1A 4D9LH 1IKFH 5BV7B 2BJML 1BOYA 1G9EA 1GAFH 4LDLB 2V5TA 2W0PA 2VH5L 1QLFA 3T2QA 2CO6B 1H3XA 2YPVH 3HUJB 4P4KD 4X6FB 4BFGA 5C9JA 3HMWH 5T1MA 3RIFK 2H2PD 5IVXE 3QI9D 5H94B 1KIUA 4O2CB 4M7JH 3IFPB 5IVOA 5IMMA 1OSZB 1J1XH 4LCCC 2ITCB 2K7QA 4MNGA 5DVMA 1EA9C 3T4YA 3MJ9L 4Z8FL 3L3HB 4IOSD 1MRFH 3UTQB 4KZDL 5MEQB 4XVTL 1JZ2A 5HGHB 1ZMYA 1EO8L 2FGZA 2IF7A 4JANB 4FFWD 4TN9A 1ZGLP 1C5BL 1HSBB 5T3ZL 1E4XI 1NJ9A 3T0EE 4UV7L 2AEPH 1KGCD 4MZ3A 5FKAB 3T4AA 1CFSB 4WNQA 1FAIH 4LQFL 4LNVA 1D6VL 1MHPH 3P4NB 2G60H 4OLVH 1RUQH 3ILQD 3MOBH 5GRWA 5EDXA 1RHHB 2X41A 4YH6A 5DI8B 3T0XA 1F4WH 2CUIA 4HGWA 4KXZH 2JB6A 3TCXA 5DJYA 1CDHA 1ND0A 2B5IC 4RNRA 1V7MH 4JZOB 3TCLB 4P5MA 3PGDB 4WUKH 1CWVA 1A7PL 1MCKA 1CTNA 3QT2A 1NANI 4OZHA 1ACZA 2HWZL 4PB0H 4QKXB 2GJZB 3GMRB 4PJIA 4QLRA 5DYOB 3MLVL 1VFAA 6CGTA 4XVJH 3KG5A 4ZAKC 4F57H 4JFFA 4FFWC 1RJLA 2EC9T 3X3GL 2VO5A 1OTSC 4ELMB 3ABZA 3OHXA 4PRBB 5HI4C 1VA9A 1FCGA 1QFPA 1QPXA 1AD0B 4KJPD 2WUCL 2Z92A 1A64A 1G0DA 4X6CA 4PS4H 2BVQB 2GITB 4GAGH 5BQ7B 3HPJB 2YC1A 3ILQC 1YECH 4LGSB 4NQVB 1BVKA 1G1CA 4UB0H 1FAKT 2ZOLB 2G5BB 3PIQA 3GJEA 4NBZB 5CILL 5EU4A 1S7TB 3DLQR 4YQXH 2X4OA 1A2YA 5FM4A 2OK0L 5C0GB 1KPUA 3NFSL 3OBAA 4XRCB 5I1AA 4JQIL 4Z5RA 4HUWA 3JWDC 1TZIB 4PJ8C 3EJJX 3WFHB 2J7LA 2R2HB 2J8OA 4Z7QE 4BA8A 4OD3L 3LS5H 2F54D 3EAKA 3SDDC 5EU5A 3BKCL 3R1GH 3CDYA 2H32A 2VNCA 5D6DA 1X7QB 4YR6B 4LEXH 5DF0A 3IRZA 3MUGB 4I3RH 3NVQA 2HT4C 4WV1C 1VKXB 1DQQB 3RVUD 3SE3A 1EEZB 3NAAH 5JMOC 1NFIB 3CH8A 1II4E 2RAMA 4PJFF 1T20B 1NFDF 4HDIA 1D3CA 1NCDL 1XFPA 5C6TH 2R0KH 4TQEH 2A6JA 4I5BB 5TDNA 3OMZA 1P4LB 3UTSB 3VFRB 1T5XB 3BP7B 2Q6WB 4N0RA 5HHMD 5HGDA 1IC7L 1TETL 1OT1A 5CGTA 4P23B 1UH4A 3GKWH 4GAFB 4YK4C 1NUNB 5CMAA 3EOAB 2ADFH 4WIQA 1MHCA 3P77B 1FO0H 4QWWC 5C09E 3UC0H 4D0CA 1NPUA 2ESVE 1ZHLB 5ITFB 5BW7A 3RX5A 4N0YH 2V2WB 3O3DA 4X5XB 3CFEA 3SCMD 1RVFL 3SKOB 3TNMA 3L7FB 4M1GH 1JHLL 3V5DA 1WEJH 2FBOJ 3CZFA 3ARTA 4ZO7A 2DYPD 3H3BC 3HRZB 3FCTB 4QT5A 5D7LE 3RY5A 1MCQA 1NMBL 4UOW1 4R97C 2R23A 5GZOC 1K3IA 2D03H 4WW2C 43CAB 4LCUA 1WISA 3ULVH 3K2UL 4NOFA 5I8KL 3W5MA 3QIBA 3T1FA 2D31A 3WFBL 4WWID 2O5YH 5E4EB 4L4TD 5K9QI 1TTUA 4LCIH 4JRXD 4HWEL 4YHMH 2OCFD 4QF1A 5KOMC 3QCTL 1WUNT 4JFDA 3SDAA 5C0JB 2YD6A 4TVPH 4WFHE 3S6CA 2HN7B 1HWHB 4O2EA 1NLDL 3VD5A 4RX4A 3PGFL 4JPWH 5F9WB 3K4ZA 2P48B 4U6VL 2F5BL 1CL7L 4LCWA 1MJJB 2R4SH 3CSPA 3V79C 1FIGH 2J8HA 2ZP0T 4OZIB 5T3XL 1KYOJ 1RI8A 4A6YH 3QEQB 1S7UB 1PDKA 4H25A 4MDJB 1ZTXL 3CC5A 2DB8A 4U1LB 1RZJL 4YDKH 1CGYA 1G9ML 1QYGL 4JHAH 1YDPB 2FGWL 4PB9L 1KPVA 2MMXA 4FHBD 4LEOA 5ESQA 3MA9H 1OAZL 1KELL 2AXHA 1B4JH 3RKDC 4HJGA 4J8RA 1GPOL 5EIQA 4K23L 4DWHA 1XF4A 2CUMA 4M1CD 3IRPX 1H3UA 4U6YA 4LLVA 1UM5L 4NUGH 1QRNE 1NGZB 4KI5E 4NO3B 4D2NA 1S9WB 2AEQH 2IALA 3L3GB 5EBWB 1CF8L 3UP1A 4KQ4L 4DOHB 3T1WA 1BREA 4KHTH 4IOIA 1KTKE 1WV7T 1XF5A 4TRPL 3LZFH 1NL0L 3HNVH 4DVRH 3GM0A 1L0YA 5IB4A 1L7TH 5C0ND 2XWJB 5A2FA 4M7KH 4AQOA 2XN9D 1I9JH 1IZKA 1NUGA 3CLEL 3WDHA 2Y6SC 4J3UA 4M1DL 1SYVB 3K4AA 1JVKA 3RUGA 2ZUQC 5IB2A 5E8OB 1FBIL 3HC0A 3DVFA 5CSBA 2V7NA 4MQXD 3U79A 5EOCJ 4JN1H 3QO1B 3BKYL 1KCRH 1CQKA 1BJMA 1MRCH 3KPNB 5E03A 3VXSA 1Y6NR 2PXYD 5JOEA 3EDKA 2PO6B 3UXFA 5ID1B 4WW1A 5I8CA 2CR6A 1ED3B 2C1OA 2C3GA 4W4NA 3MLWL 4IIQB 3QUYB 3MGTB 4KRLB 5C0CD 4ELKA 1NUDA 1XR9A 2CRYA 4Z7WB 2AJUH 2X1WL 5L8JB 1F4HA 1PG7L 3RDTB 4QRRE 4JFEE 5JOPD 5IWLC 2XPGB 2KKQA 5CP7A 1P7QB 1UM4L 4FQXA 4I2XA 4BSVA 3B6SB 2Y5TB 5FCUH 3FFCD 1E27B 4P2RB 2X4NA 1JGLH 1KCKA 3VXQB 5IHBA 4NQSB 4OZHF 3UJJH 1TTGA 3TFKC 1IEAB 1T0NA 1W0VA 3AS0A 4XMLH 3W5NA 3GSOB 5F7NC 1CXLA 4NHCL 3EYUH 1LK3H 4PY8I 1JMZA 1QBAA 3T2OA 2PF6A 1CIUA 4DKEH 7FABL 2J8UA 2Y07L 3ZKNC 4CADA 4OLWH 4BKLA 1IGML 2B4CH 5JDSB 5L2JB 4X6CF 1N59B 1MCDA 4EQ2A 4LHUD 2WIMA 2R0ZH 4HIEA 4IMKC 4P9HL 1TQBB 4JHWL 5FUZH 3LH2L 4XHQA 5J6HB 3PGCA 3JV4B 2Q7NA 3G5YA 2P8LA 5KN5A 3D87B 4P4KB 5MHSE 3MRLB 1Q9LA 5FEBA 3P9MB 3QI9B 1OB1A 3HI5L 5C0BD 1OTUC 1T2QH 1WBZA 4CVXA 4CKVX 2BVYA 4PJHB 4POYA 4HHAA 5AAMA 1MLBB 1Q1JL 1PZUB 1U3YA 3X17A 2QQLL 3NGBC 1I4FB 1XF1A 3MJ9A 1F4AA 1I75A 1IC5L 1BWWA 1DSFH 4WJ5A 4Y1AE 4ZAKB 2ARJA 2ADJA 1J0HA 1SEBB 3BN3B 2NY1D 1IAKA 4OTXL 2J5LC 2FO1A 3ZE0F 3ROOB 5I1EL 1MY7A 3QIWA 5EOCL 3DMMA 1SJVA 3IJSA 1E4XL 5IQ9B 4G9FE 4POZD 4WRLA 3D85B 2ICES 3H7BA 4K9EH 5B8CB 5ID0B 1YY9D 4LLAA 5IOPB 1JWMA 4ZFZB 3VXRA 1DQLL 2NW3B 3U46A 3IJHA 5GS1A 4PJBB 4MXQD 1MCWW 1IGTB 2CR3A 2NXYD 4PGDA 5A2IH 1P7KB 3L6FA 3B5HA 5CIPB 5EC2A 2X9XA 4FMKA 3V6OC 4X0KB 2EEAA 1TCMA 2DQUL 4PJ8B 4OI8A 1EVTC 5ALCH 5FGCB 1NAKH 5T5NF 3RAJL 2IMMA 3FQRA 3ZSTA 2JJUA 3SGKC 4NO2A 4LNRA 4KY1H 1U8OA 4QY8B 1EGJH 2Z4QA 3MRQA 5AG9A 4PR5B 3ARYA 3PDDA 1DN2A 3CVHL 4QHLA 2EXYD 3GNML 4Y8AA 3MLTB 4WEBL 4L8SC 2YMXH 2XTJC 3C8KA 5JQHC 1EAJA 4WV1B 2UV3A 4BQ8A 4PJCE 5BCAA 1ZANL 1M6OB 4O2FB 5GIRA 3DUHA 3NPSB 1OPGH 3MXWL 3CCHB 4XNQA 1U9KA 3GHEL 1XF3A 1A3LH 1O7SA 3RL2B 4IRSC 3C6LA 4N5ED 3UAJC 1A6TA 5FKPB 1T0MA 1XH3B 4OZGA 3L5WB 3VJ6B 5KJRH 2PYFB 2VDKH 3QFJA 1A9EA 5KSAD 2C7UA 1KXTB 3TF7C 4GKZB 4M48H 5MP6H 2JJSA 1H9VA 1ZXQA 4Z77A 3C5SB 3LPFA 4HGMA 3FB5B 3QJFA 3BXNA 4Y4HC 1WT5A 1FC2D 3KYOB 5EO9B 3BEVA 3T0EC 4FNLL 3UTTE 1JNNL 1MCIA 3HZKA 3PQYD 2P47B 3E8UL 3REWA 2HT2D 4Z78B 2WWKT 4K8RH 5F96L 5A2JH 2V9RA 1MFAH 2F5AH 2X1QA 4DGIH 2W0FA 3VXUA 4HMEA 2VDLL 2NY3C 3HE6C 4BK5A 5J1TC 4PV9A 2V5MA 2XWBA 3LEYL 3OKYA 4WW2B 1P53A 5D7KE 3SGJA 1RZGB 2MPAL 1NFKA 4O9HL 4NO0D 4R26H 4HXAH 3JVGA 4RFEB 1GZPB 2DLGA 2R69L 3QEUB 1GGUA 3KPMA 1YNKL 4KGJA 5KSAC 2PTUA 2C5DC 1S7RA 4DN4L 4GRWF 4FXGA 2GUOA 3H2WA 5I1DA 3LV3B 1VADA 3CUPB 3UJIH 5DHVH 3PWPE 2EE3A 5JQ6L 1CGXA 5JW3L 2QQKL 5DURB 2ZKHH 2OL3H 2YR3A 1RPQA 2D9QB 2BVEA 3CGTA 4UQ3B 2XACC 1YQ2A 4HUUB 2ARJQ 2DTMH 4NZUH 4UT9H 3UTOA 2A73A 4Y19D 3RUGF 3PWUA 1I85A 3C8DA 1N8ZA 1W72L 3HR5B 2XTLA 4H1LA 1N5AA 1G7LB 3KPLA 3QZWG 4NNYA 1D5MB 2ICEA 1RK1B 3FT2A 4RQQB 3IF1B 4Y89A 4F7MA 4JO1L 2LAAA 5EO0B 1G0XA 1VGKB 4HZLA 3KJ6H 3CMGA 4P57A 3S4SB 1MREH 1RIHL 3TP4A 4X7CC 5C07E 4F33A 4NWTL 3VH8B 5I8OH 4JN2A 1KLUA 2HJKA 1PX4A 3RWIA 4X4YA 2ESVD 1ZHBA 4Q6IC 1XGTB 1G9NC 4HIHB 4OGAD 1NGQL 1A4KB 1IAOB 3DPBA 4M6NH 1Z3GL 4KMTL 5C2BL 5D7LD 2XFXA 4L4JA 4CVZB 3WS3A 1VFMA 2AP2A 2E3VA 4OD2A 4NRYB 3C2SA 4GJTB 1XZ0B 5ABDE 3FAXA 2E7MA 2ZUQB 1I8IB 1B88A 1N0XH 3WHE0 1OP5K 1S3KH 4NQXB 5E8EA 1RFDL 3GSXB 1E4KA 2Y5EA 3S5LA 3U4AA 4PY8J 4PY7A 4NZJA 1XGRB 1DVFC 3GO1H 3VFTB 3G6AA 3ARBA 1N3NB 4HWBH 4ODBD 4K71B 2QSTA 1YN6B 3F7YA 4HC1L 3BZFA 3A0OA 3DGGA 2Z35B 3BRGC 1VCAA 1LO0L 4JKPL 2C3WA 1W2KT 4LLYB 2VLKA 5IVNA 5GHWH 5AYUL 4YHPB 1X5ZA 4M7LL 4FTVA 4NHUA 2XNAA 1EBAA 3QUMB 1A6UH 3KS0H 3S7GA 5CZXC 2ADIA 5DA0B 3BD5A 1T89C 3S34H 4BQBA 5C0DB 4S10A 5I2IB 2EXWD 5FDYA 1IL1A 1F90H 4Z7VE 1R3LB 4K3JL 1KEMH 3ZDZE 1U2HA 3BE1H 2DQFB 4ZO6A 5FYJL 5DDHA 1HDMB 1QO3A 2IBGA 3W39B 4HKJA 2YD1A 3I6GA 2XN9B 4NP4H 2JJVA 3MACL 1C5CL 4P5TD 3BQUA 3PWLA 2V17L 4RDQF 1SMAA 1ETZB 4LAQL 1BOGA 3FOLB 4R7NB 2OR9H 4YC2C 1TJGH 4B7IA 4XBGB 2GAZA 1A0QL 2Y4SA 3MJ8A 5HHPB 1OGAB 3WLWC 2MTPA 3VG9C 2VSCA 5KW9H 2YS4A 4RWYH 2EDYA 2PXYB 4GUPA 5E5UB 2WWMD 1RUAH 4H8WH 2C9AA 1ZHKA 1FNHA 5DXWA 1OAUH 3T0DA 4L3EE 1JGUH 4AYFA 5C0CB 1NBYB 4CNIA 1QQDB 3SO3C 5FK9B 1ZLUK 3GUTA 4WDIB 1X5IA 2XA8L 3HHRB 3GI8L 1QKZH 1ZSDB 1FFQA 2QHLA 3BYTA 2OBGA 4U1NB 4YDIL 1MCSA 2AQ2A 5I18H 4K7PL 4NZTL 1W0YT 1LDPH 4M93C 2VH5H 4I0CC 3N85L 4GW4B 1AGFB 2FBJH 3CX5K 3ZTNL 2R2BA 2IBZX 3MRBA 4K3DH 2DKUA 2VE6B 2A6IB 4TSAL 3TPUB 4P5TC 4R4FH 5DD1H 1DUYB 5EZOL 2X4RB 4OZ4B 2YPLE 1JPFA 3NGBB 2FH8A 4GG6B 2G5RA 1AGBA 15C8H 4QOKA 3T77B 4XB8A 1Q9WB 3MV8A 4LK4A 2J5LB 4PGBA 3U82B 3UYPA 1JPSH 3GBLA 2WWMC 3GSWB 3IAGC 5F1IB 2D0FA 4LHUB 1C5BH 2CDEA 1CD0A 4JGJA 3S36X 3U4EA 3KLHD 1J5OL 3TBSA 1JTOA 2NY0D 4MCZB 1I1AA 4MS8D 1IVLA 5LAXA 4KI5C 1S9VB 5ICXB 3W9EA 1MFEH 3QNYB 5TF0A 5D1XC 2IQ9L 1NGPH 5EU6B 3QSKB 5IROA 1F4YH 4L4VA 3VFUB 1YMME 4D0DB 2XZQL 5HD8C 3Q5TA 5C0BB 3EHBC 3VFNA 5CINL 4LSTL 1CG9A 1LP9A 1QSED 2W65B 2BSTB 3ECBB 4G42A 4OZGF 5C3TA 5C0EB 1FVEA 4GKNB 2QEJA 1NH6A 3NPZB 2CJUH 4ZOCA 5DQDL 4HG4K 1ZA3A 3LQAC 4CN6A 1KCUH 1QRKA 1SBBA 4OLXH 1MIML 3SE9L 5KG9A 3JWOH 2C3VA 1OY3B 4HUMB 4NQTA 5EORH 2WAHA 3HZVA 2BC4A 3ZMRA 4JPVL 2HWZH 3HAEA 4G9DA 2ATKB 3DXAD 3U83A 4LSUH 5LKNA 3OKDB 2YWZA 2HYMA 5J6GB 3LQZA 1I1YA 3B2VL 3M07A 3ARDD 2WBJD 4L8SB 3Q6FA 1T4KA 3M1BB 4LRNL 4PJ5D 2XTJB 4GAJH 5GS0C 2FX9L 1NSNL 5F3HA 3O6ML 4NUJA 1PZ5B 3V8OA 4RFNC 3I3EA 2NCMA 5BS0E 5CEYA 4C83B 5BV7H 5IGXL 3RWJB 4WWKD 1KT2B 1K6QL 1MFBL 5D7IE 5MHSD 3HTLX 4F37F 4MXWL 3FN9A 3CXHJ 4N0FB 2NXYB 5IVXB 1EEYA 2BRQA 1BFOB 3OF6D 1OD7A 4IRSB 3MCLL 1JYWA 5FFLA 4QHMB 2CK0L 1MEXL 1NBZA 3PNWA 3S97C 3T04D 1E4WL 4P3DA 1NBVL 3FKUS 4RMQA 1GOFA 4AG4H 5B4MD 2FL5A 3DRTA 5J0BA 2CIIA 4OZFG 4XWOD 4Y1AD 5DLMH 5FHBL 4Y4HB 2ICWI 2DN7A 1OQOA 2HFFB 5DD5H 3T0EB 3UTPE 2I9TB 2MJWA 3VGDA 2BFVH 2E7LC 3BUYB 3CVHA 5DA4A 4CDGC 3QDGA 3MFFA 4G9FD 5JXED 3ARSA 1KENL 1INEL 2IG2L 1F6AB 1MAKA 2NY3B 3OGOE 3QHZH 3HE6B 4TUJB 4UDUA 4LPCA 4OZFH 4DFIA 2VIRB 4WWKC 1MELA 4XCEB 4L9LC 4PP1C 2Y7QB 3H42H 5F8QC 5LWYH 4J3OC 1KLFA 4MNHA 3ZL4L 3L5XL 3MRFB 1EAPB 2D4DA 4ONHB 3OZ9L 1N7MH 4P3CH 4MNQA 5JIHA 2CKBL 1Z5LA 1L6XA 4PBWD 1BZ7A 3D0LA 5KSAB 4PJDA 1VFUA 1X5XA 1EBPA 2XG5A 4OLYL 4XVSL 3L3JA 3IFNL 4HULB 4WO4C 3RWEB 5IKCB 4ONGH 5CZVH 2D7TL 3OX8B 4WGVB 3K8MA 2XG4A 1K3ZA 4H1LG 3Q5YA 4U4BA 3CFCL 1G7HA 5L2KA 1CE1H 3VFOB 4PG9B 2Q3ZA 3DV4A 4X8JB 1H15B 1QSFB 5AUMB 3D18B 3I3BA 1FSKB 3LMJL 5IQ7L 1DBAH 4PJ7E 5DRZA 5FXCH 4U7SA 5ANMA 1X9QA 4JO4L 3K2MC 2NX5E 1NMBH 5ELIA 2DIAA 3RTQA 4MB4A 2HH0L 2GT9A 1KACB 5IW1A 4H1LH 5T1LA 2ADGB 2YWYA 3IFLL 3T3ME 2NR6C 1ROWA 1T6VN 2HFGL 4P9ML 5EC1B 5EFIA 1WITA 2A9MH 3EFDL 1T7YA 2GTZA 3RJQB 5BMFH 3JV5A 1JPTH 4NN5C 2A6DA 3BKML 4NYLA 3TJHC 5DVKA 3HPLB 1T83A 4ZFOL 5J56B 3NFNA 4JFYB 3Q6GL 4Q6IB 5TH2A 4M8QB 4U1SB 1U58B 5DJ6B 5JORA 2I9LA 4OLUH 4XCCH 3SPVA 1WLHA 1XF2B 4ZXBC 5F72S 3GSUA 3UTZA 3IDMB 4XNXL 2EH7H 3WN5B 1OARL 1DJSA 4LLDB 4WFFE 4TUKL 1CL7H 1KTDA 1MJUL 3LKOB 2HLFC 1QFWI 2DD8L 1W72A 4GT7A 4D8PB 4GLRI 1F3JA 1MH5A 4L8CA 4HBCL 3MRJA 1UB5A 3P0YH 1DVFB 5FM8A 2AV7A 5I1JH 3V5HB 3MRPB 4JFPB 3KPQA 5E6IA 2YZ8A 1J8HE 5EBLB 3RWGB 1CFQB 5TE6H 5F93C 3VW3H 4MA3A 5HGBB 1A47A 1Y0LA 3GHBL 1WWAX 4G8GE 3ZT5A 1FE8L 4HPYH 3NCJL 5C09B 1FYTB 4NT6A 2ESVB 3QRFM 1VFBB 2K9UA 1JGVL 3SE8H 5HYJE 4KK6C 4ODTH 4MA7H 3V4PL 1DTUA 1HILA 4P46C 1GRWA 1VPOL 2AXFA 5E4IA 4EBQH 5D7LB 2EE6A 4JKKA 1BFSA 4UQ2B 5E9DE 2BNQE 3D3VD 2B0SL 4PBXA 5ICYB 25C8L 3UBXI 3QDAA 3BMVA 4OT1H 2H26A 3G6JA 3VFPB 4PGEB 3SKMB 4WHCA 4PJFE 2DQIH 4YC2B 1X5LA 3WMSA 1FZOB 5K9OB 3ULVE 4PGCB 4Y4KA 3ULUL 5J12C 4X7SL 2E6JA 4HIJA 4EDXB 3Q3GB 4E41A 3BZ4A 4TNWF 5HYQB 5F7LB 2ZSVB 1ULVA 5DJAB 1KC5L 4KJYB 4MJIE 2BSRB 1D5BA 3BP5B 1WAAE 1HCFX 1S7VB 3AAZB 3DUSB 3KPPA 1WWBX 1WFOA 4HC1A 1NCCH 4YXHH 2X10A 2VXUH 3DROB 3SO3B 2J6EH 2VN7A 3W2DL 3LKPB 4XI5C 1RURL 4TVPE 4D0BA 1HHIB 4PRPA 2DWDB 3S37H 2MOVA 2WIIB 1LP9F 4M93B 3VGFA 4UBDD 5EPMB 3O11A 3PP3K 4PJ9D 4LIQL 1HOCB 3BPCB 1XMWA 3MGOA 4ZUTA 4NZRH 4PJGE 2WUBH 3LSOB 4QRPA 2L7UA 5DEFB 4P5TB 1EFXB 1WWCA 3EDDA 5J1AA 3WNOA 2F74A 1X4XA 5DQ9B 1SJHB 2OSLA 3T8XA 4ZSOE 1RZ8B 4YX2H 4ZNEE 4LLUA 5DUBA 3G5ZB