1KJ2B

Murine alloreactive scfv tcr-peptide-mhc class i molecule complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
117
structure length
117
Chain Sequence
VTLLEQNPRWRLVPRGQAVNLRCILKNSQYPWMSWYQQDLQKQLQWLFTLRSPGDKEVKSLPGADYLATRVTDTELRLQVANMSQGRTLYCTCSAAPDWGASAETLYFGSGTRLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Allogeneic H-2Kb MHC Class I Molecule
publication title A T cell receptor CDR3beta loop undergoes conformational changes of unprecedented magnitude upon binding to a peptide/MHC class I complex.
pubmed doi rcsb
source organism Mus musculus
total genus 20
structure length 117
sequence length 117
chains with identical sequence E
ec nomenclature
pdb deposition date 2001-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kj2B00
3QG7H 4H20L 4PJEF 4CVXB 4JFOB 2EO1A 2FIKB 3TC9A 2X4NB 2EIBA 5CGMA 3IDJA 3O2WL 1EJOL 2E9JA 4ZQKA 4JG1L 4IOFD 4Z76A 2KPNA 1IM9B 3ZTNH 2HLFD 1P7KA 4BZ1H 1T22B 1T66C 3WE6A 4LRIA 1J8HA 4R8WL 1T1ZB 1RV6X 2DM4A 3IDIB 2AV7B 3DX7B 3EFDL 3DWTA 5EU6E 3D9AH 1TDQA 5I8KH 3THML 3MV9D 3DUUB 4EZMA 5JHDA 1X44A 4WEBL 1W72L 3NFSH 1GGUA 4LLYA 5MENE 1FBIL 1QHOA 1RUPH 4Z5RA 3AREC 4GQ9L 4R4NC 1ZEAL 4Q6IC 4ZOEA 3FT4A 4JAMB 4O02L 3U0WL 5IHZA 1OGTA 4MX7B 2RB8A 3BKJL 3QHFL 3HPLB 1WWAX 2EDBA 1AFVH 3GMLB 4WV1C 1MI5E 3E1F1 5L0QC 4P4KA 2IC2A 3DXAA 4LNRA 2ORBL 3M17A 4K2UL 2FZ3B 4P9ML 3JWDL 4OD3L 1CIUA 4XNUL 1IL1A 4N0YL 3RUGE 4PLNC 5FUOH 4LEXH 4CVXA 4JFOA 2FIKA 3WSQH 2X4NA 2EC8A 2QKIB 4Y5XC 4WHDA 2HG5B 3B9VA 1IM9A 1T22A 1FVCB 2EYRB 2GTWB 1T1ZA 5H37G 5D4QA 4Z6AT 1QRKA 5B8CC 3ARBC 5ADPH 3IDIA 3DX7A 4XAWH 1MHHB 3DUUA 4U1MB 4FQ2L 3GHBH 1EO8H 1G0YR 2DMBA 5AYQA 5JZ7C 3T4YA 1GPOH 4RFOL 4MQSB 4QHUB 5CEZD 4JAMA 2C1OB 4XCCL 3PWPE 2D7QA 3DIFB 1CXIA 5IIEB 3T0DA 3KPRE 2W9EL 4MX7A 4P59H 1TTUA 3HPLA 2VZVA 3HMXA 3WN5B 3AS0A 4KJWD 3GMLA 3I85A 1CDCA 4I48B 3U6RB 4JPKH 4XVSH 3SY0B 5CILL 2FZ3A 2OL3B 3HZKB 2JLLA 4JM2F 2QQKH 1BJ1H 3Q1SH 1OM3L 3MJ9H 4OD2B 3F58L 4P3CL 1KBGL 2QKIA 3C08L 1PKQE 2HG5A 1LILA 5I1GH 2FBJL 2B1AH 1QFOA 2PXYD 3O6FB 4WO4D 1GH7A 1FVCA 3KAAA 2EYRA 2GTWA 2FBOJ 4OLYH 2D0FA 1XF4B 4PGCB 1IC4L 4OLXL 4UTAH 3RIFF 3S35X 2ZCKH 1MHHA 3MRDB 4GMTL 4U1MA 5DVOA 1C5CH 1ZOXA 1ZHKB 2V9TA 2PETA 4YFEA 1UJ3C 2E7LC 4ORZC 4YUEL 5FM4A 2BVOB 4N0FB 2KBGA 4QHUA 5JXEA 2C1OA 3QEGL 5F88B 3DIFA 5IIEA 4XPHH 3MGAA 1RFDL 1P7QB 1LO3H 1G9MC 2A83B 4FMKA 4XVJH 1ETZB 3WN5A 1S7WB 3QAZB 3FO1B 4I48A 4YAQB 3U6RA 1ADQH 1FLTX 1F42A 3SY0A 1MAJA 2OL3A 3F65A 3HZKA 4MDIB 1J88A 4F7CB 5HY9B 3ZMRA 4Z7UE 3ZE2F 5ILTH 1T7WA 5JDJA 4OD2A 5GGTL 4BYHA 3C60C 4JFFE 3E8UL 4WTZA 3O6FA 4RIRA 4APQD 5DURD 3MLSH 1QRNB 1XF4A 4PGCA 1N3NB 4KH2A 4MJ4A 4AIXA 3OWEA 4FOMA 1RIUL 2FDBP 1D9KD 3MRDA 1GOGA 1ZHKA 3V0VB 3N85H 3PQYE 2BVOA 2VXTL 4N0FA 2FEDC 5F88A 3ME0A 2IPTL 5HHME 1DVFB 4PRHD 1P7QA 1YEKL 2AVGA 5CCKH 4MNGB 5LQBL 2A83A 1ETZA 1HWGB 1S7WA 4JPVH 1XR8A 3FO1A 4ZFZB 4YAQA 2ZWLT 5E2WL 4CJ0A 1OTSC 3BVNB 4MHHG 4FZ8H 4MDIA 2PF6A 4MA7L 4EDWH 5BV7C 5HY9A 4F7CA 1YPZF 4I77L 2L0DA 1BZ7B 3UYOD 4OJFH 4UT9L 1KCUL 4R90H 1Q94B 1MLBB 2VH5H 3U4BH 2ADIB 1QRNA 1N3NA 1HYRC 2G2RB 4BFIB 4KTDH 3KPSB 3HHRB 3B9DA 2NX5D 5DVKA 1N0XL 4TSBL 1KG0B 1MHEB 1I3UA 3V0VA 2CMRH 1ZTXL 1BQUA 5C07E 4I0PC 5DQJB 2A77L 2V2WB 4I2XB 2IAND 1DVFA 3H7LA 5EZOL 1ONQB 1QBMH 3ZO0A 4MNGA 2NY1C 3I50H 4OZFH 4ZFZA 1X6LA 1UVQB 3QDME 3BVNA 5D5MB 5DUPL 4YHLL 1E4XL 2QL1A 3RU8H 3DVFA 3B8SA 3LS5L 3QXDB 4DKAA 4Y4FB 1BZ7A 3N1PC 2AXJA 1Q94A 1MLBA 3LKOB 3FMGH 3PWJB 2ADIA 2D9QB 4R7DB 4BFIA 2G2RA 4OSUL 3U1SL 1CQYA 3KPSA 1KB9J 2E6PA 5L9DL 4KXZI 1BD2D 3F7YB 1UM6L 3LRHA 3OKMB 4M1CD 1KG0A 1FV1B 5KSUB 1MHEA 3NFPB 4XPFH 2MCPH 4D9RD 4OCSH 3W39B 3C2AL 1RIVL 2VDQH 5DQJA 4GXUN 4RAUB 1QPXA 5CINH 3WLBB 3HR6A 1TJIH 2V2WA 4I2XA 1BFTA 3EYSH 1XIWD 3T09A 3HE6D 4WCYH 1ONQA 1REIA 2K7QA 4K9EC 4P2OC 1YEJH 1MLCB 1DBAL 1UVQA 3AM8C 5E9DE 4WFED 5D5MA 1MFCH 3FFCD 2I07B 1MCWW 4LCYB 5CBEB 4NNPH 4G9DB 3VMOA 5IFAL 2BVPB 2K9UA 3QXDA 5DYOB 4Y4FA 3HTLX 4U6XB 4EXPX 3ZL4H 2JIXD 4J3OC 4GLRH 3FB8B 2V7HB 3PWJA 1AHWC 4R7DA 1Q0XL 1EEQA 3O6MH 1AXIB 1RJZB 3QH3B 3F7YA 1N7ML 3OKMA 1BFVL 5HI5C 1KV3A 2W0LA 5F3HB 3JVGC 1FV1A 3MLYL 5F9WB 3NFPA 5KSUA 4OGXH 4XP6H 4M62H 2AEQH 3W39A 4LSVH 3GIZH 1JE6A 1LK2B 2FWOB 3VI3E 2FYYB 2ZOLB 4RAUA 3WLBA 1UEYA 4O9HL 4L4TD 2VDPL 3UX9B 3EDEA 1UZ6F 4NSKB 4OI9A 3OF6A 1WVZA 3O3EB 2XT1B 5J13C 3L3HB 1NGZB 3H3PL 2K3TA 1MLCA 1WICA 5DD1L 1JP5A 2NY4D 3BD4A 3JUZA 3UTSE 4HC1A 1X5FA 1Q9OB 1JI1A 2YD2A 4XXCC 4JJ5B 3KLAB 2FB4H 2I07A 2XY2A 4LCYA 5CBEA 4G9DA 2BVPA 3P11L 5DYOA 3VFPB 4U6XA 3IKKA 4U1LB 3FB8A 5IT2L 2V7HA 3UBXG 4GKOA 4FFZH 2H2SC 4G3YH 2VL5B 5D1ZB 4I3RL 2NXZD 2WBKA 1RJZA 3QH3A 1ZVSB 5DQDH 2JK5B 2X9WA 1DQLH 4Z7UF 4PG9B 4IRJC 5F3HA 1TITA 4L5FL 15C8L 4L8BB 3OHXB 1MRFH 3WIHL 4U3CA 1LK2A 2FWOA 1GSMA 2FYYA 2ZOLA 1QSEB 5GXBB 1P9MA 1LP9E 4EJ1C 4OFPA 4NSKA 4UZGA 4MGXA 1A22B 4KC3B 3O3EA 2VXQL 1YMHB 1WFOA 3ARXA 3L3HA 3HNTH 1NGZA 3MZGB 4J3TA 4NCC1 3ZSTA 3G9AB 3O9WB 1OY3B 2OJZL 2ZCLH 4PY7B 3HMWL 2PR4H 4JJ5A 3KLAA 5I18L 1ZANH 3IFNH 3U7AA 4ODWB 3BKCH 2PUQT 3DROB 3VFPA 4U1LA 2UZIH 4HX1B 4KI5C 2A74B 4HIIB 1Q72H 4O58L 2VL5A 5D1ZA 5FCUH 3KHQA 1CLOH 2P49B 5IW1B 3QBTB 4JFDD 5E56A 3A6OA 1WLHA 4XP9H 1ORQB 4PJFB 4IDLA 1ZVSA 3NH7H 2JK5A 3DETD 4HXBL 5DFWH 2FD6L 1KCSH 4GBXC 4PG9A 1MF2H 3QG7L 3HC4H 2DJ4A 4AEHH 5GHWH 3TVMB 4L8BA 1SMAA 5FGCE 3OHXA 1T83C 1HHHB 4XMPL 4K94L 1QSEA 3ZTNL 1C7SA 4WHCA 1TZGH 4BZ1L 4AMKH 4Z0BH 4UI2A 3D2UB 4QXWA 4NKDB 3ARTA 3DECA 1YMHA 3VXSB 3D9AL 1MNUH 5I8KL 3RI5F 4BZ2H 3NFSL 3IJSB 4JPWH 3MZTA 4HFWB 3O9WA 5IWLC 1RUPL 2P48B 2GCYB 5EBGA 3ARQA 4PY7A 5SX4H 4JY4B 3U79A 2AI0L 2APBA 3LPWA 4M6NH 3OB8A 4YGVB 1EGJA 4K7PX 4ODWA 3O8XD 3DROA 3L9RB 1QR1B 5SV4A 5CZVH 4FZEH 2ZUXA 4HX1A 5C08B 3Q2CA 2A74A 4IJ3C 1C5DB 4HIIA 2C3WA 4CRPA 2CKBH 3FO9B 1JK8B 2G60H 1VFOA 5IW1A 1VEMA 1H5BB 2BSSB 4XBEH 1ORQA 4PJFA 3S98A 3HE7D 4TVPD 5C0DB 2XFXB 3B3IB 4NWTH 2HMIC 1ZHLB 4LEXL 3ZTJH 4HH8A 3WSQL 3TVMA 4WI2A 4KRPB 1HHHA 4HUVB 4NN6B 1HE7A 3ARRA 3IS0X 4CJ1A 2APFA 5IKCB 3D2UA 2ENSA 4HQQH 4FABH 4NKDA 2J3SA 3WUWG 1X5AA 4CAGA 4D0CB 1S5IH 5ADPL 5BZDB 4XAWL 3UYRH 3VXSA 1PZ5B 3Q6GH 4Z7WE 5GRZA 3UYPA 3FT3B 3GHBL 2GTZB 1EO8L 3IJSA 3MLRH 1ZLSH 4PRPB 1WAAF 4HFWA 1U8OB 2GCYA 3HAEG 4JY4A 1YY9C 4PJ9D 1U36A 5DDHB 4HS8H 4YGVA 1MSPA 4P59L 3L9RA 1QR1A 4X9FA 4E42B 5GJTH 3ARFB 1G9NL 5C08A 1CLYH 3SDXE 2X10A 3FO9A 4JPKL 2BXYA 1JK8A 5EIQA 1U3HD 3MMEB 1H5BA 2BSSA 5C0DA 4HUXB 2VDKL 2XFXA 3B3IA 4PJXF 3V5HB 4G43B 3AS2A 1ZHLA 2QQKL 32C2B 4X6DE 3Q1SL 1J0ZA 4CU8A 3MJ9L 4FMFA 3QZWB 4H1LB 4HUVA 2VB5A 4Y1AE 3C5ZC 3RY6C 5BJTB 5I1GL 2PKDA 1LNUB 5FO9B 1LO5B 5IKCA 4OLYL 4D0CA 3K1DA 5BZDA 2GT9B 1CTOA 1PZ5A 3C09C 2OK0H 2XICA 4ZTOL 1N0LA 3FT3A 2D7PA 2GTZA 1C5CL 1M71B 4PRPA 3OKYA 1NKOA 2UUDK 3RA7L 3VI3F 1U8OA 1RURH 4LSSH 2I27N 3N50A 1A47A 5DDHA 3ULUC 2MTPA 2VDOH 1I4FB 2P8LB 4XPHL 1AO7D 2V5YA 4R4ND 4E42A 2DQUH 3ARFA 3RKDD 4FG6C 3BE1H 3VG9B 3RRQA 4WGVB 3MGOB 4PD4J 3X3GH 3MMEA 1ADQL 4KFZC 3DMMC 4ZO8A 4HUXA 3DHMA 3V5HA 4G43A 1NCAL 5GS2D 2E6QA 1KULA 3UTTD 32C2A 3A6CH 1F6LL 4HLZG 2IFFH 3QZWA 4H1LA 2C5DC 2IBGA 5BJTA 2FX8H 1LNUA 4F7TB 4RFEB 5FO9A 4JDVB 3MLSL 1LO5A 4LSRH 5I8OH 1JYXA 1N8ZB 1GGBH 2GT9A 5T5NG 2M1KA 1WC7B 5I1HH 4LCCC 1MY5A 4L4VD 1DTUA 4MZ3A 4WU5B 4DVBB 3ARBD 1M71A 1FPTH 3N85L 3C2SA 2H1PH 1J9CT 2ICES 1E4XI 1I4FA 3BPLC 3F7VB 4NDMB 2EEDA 2OZ4H 3LQMA 3ALPA 5CCKL 3MRIB 4Y5VB 2X4UB 4V1DB 1Z2KA 1EMTH 5C0BE 4FQCH 2GIYA 5CP3A 3MGOA 1NJ9B 4PJ8C 5B39G 3Q5YA 1NUGA 2CDGB 3IDUA 3MYJB 1Z9OA 4FZ8L 2IBBA 5JW4R 3LD8C 3NGBC 4EDWL 5JIHA 5HYEA 4B5EA 2EDQA 1Z6JT 1SJVA 5F44A 1VACB 1NFDF 1TPXC 2I60H 3PWVB 4OJFL 4R90L 2OM5A 4PJHE 2VH5L 5F7MC 4F7TA 4RFEA 4JDVA 3U4BL 3SCMC 1MJ8H 1NBZB 4JM4H 2FJHB 1CGTA 1N8ZA 1B2WH 3MNZB 1WC7A 4PJCE 4WU5A 4DVBA 2CMRL 4L1HA 5TQ0H 1NCWH 1RJYB 2RFXA 1WCBB 1NGWB 1EIBA 1XR9B 3KPTA 1MEXH 5J6HB 2YPVH 3MUZ1 4JHAH 3SDCB 3F7VA 4NDMA 3RL1B 4K3DH 4JRXB 1NBYB 1QBML 3MRIA 2JELH 4Y5VA 5CJXA 2X4UA 1URLA 2VDRH 4V1DA 4J3VA 3I50L 1NJ9A 1X5IA 4M43L 4PJ7B 5IG7B 2PXYB 3MYJA 4S1SH 1IKNC 3D39D 3HR5B 3U2SB 5JMOC 3RU8L 1MCHA 4M5YH 3S5LG 1VACA 4M48H 5INCB 3PWVA 3S7GA 2VE6B 5DR5H 5ISZD 5DRXB 3FMGL 4DZ8B 5D7JC 4ODUB 1RY7B 1YYMH 1NBZA 3RWJA 1P6FA 2FJHA 4P3DB 3MNZA 3OAYH 2V5SA 1JZ6A 5A3IC 1RI8A 4L3AA 4X80H 3FQNB 4YFLF 1P84J 4XPFL 2MCPL 4OCSL 4FP8H 1RJYA 3QXTA 1WCBA 1NGWA 1XR9A 4N0CC 2VDQL 5SX5H 5J6HA 5CINL 3ULVC 3SDCA 1TJIL 3EYSL 3RL1A 2GHWB 2FX7H 4JRXA 1NBYA 1UXSB 2FEDD 4XTRC 5FYLD 4PJ7A 2GFBB 1FL5B 5IG7A 1RSFA 2PXYA 5FYJH 1G84A 1KCVL 5DURB 1MFCL 2X70B 3RWHB 3HR5A 3U2SA 3W5NA 3QIWB 3V9FA 1RMFH 1OTSD 4NNPL 3TFKC 4WFFD 1D9KB 1SEBB 5AWNL 5INCA 3MR9B 4LIQE 4HWEL 3ZL4L 2VDLH 5DRXA 4DZ8A 1DQTA 1MHCB 4ODUA 5E2VH 4DUWA 1FN4B 1TENA 4P3DA 5JW4N 4GS7B 4PRHB 1JZ4A 2LU3A 3FQNA 1N26A 4UOW1 3RBSA 4OGXL 4XP6L 4M62L 2ICWI 3I02B 3NACH 1T04B 1YYLH 1MCQA 3GIZL 4LSVL 4H8WL 4LVEA 3VJ6B 1KJVB 3H9SB 4JREB 3MBEC 3SKUD 2APTA 4I0PD 1JN6B 4FQ1H 1UXSA 1NEZA 3DYMA 3TN0C 3MV8E 4LIQL 1C12B 1JL8A 2GFBA 1FL5A 3VXRB 2RBLA 3QQ3B 1CR9H 1TXKA 2NY1D 2X70A 3OJVC 3RWHA 3VFMB 3QIWA 2D7OA 5K9QI 2FB4L 1G0XA 2NX5B 3RVUC 3QUYC 1D9KA 1SEBA 1H3PH 2X4TB 3MR9A 4QHLB 4XGZB 4GKZB 1HIMH 3O11A 2VL4A 3CU1A 1MHCA 1FN4A 4YDLB 4FFYH 3HMXH 3SDAC 1ZT7B 3M8OH 3T04D 2IANB 5DQDL 4RSVA 5L8JB 4PRHA 1DQLL 3IAQA 2J8UF 3VD9A 3U30B 3I02A 5EB9A 1T04A 4XAKE 1MRFL 2VO5A 1NDGB 4BJLA 2Z8RA 3VJ6A 1CFQB 1X6NA 5EZIH 3H9SA 3H3BC 5E0QA 1RK0B 3WHXB 1JN6A 2C9AA 4MJ2A 1KB5B 3HNTL 1C12A 1I85C 1P7HL 3MRFB 5J1TC 4ZNCD 1NCNA 4HPYL 3VXRA 4P5TC 4HGMA 4QGTA 1Y6NR 5HGHB 4P2OD 5ANMB 3QQ3A 3ARVA 3PL6C 3SE3A 3TJEH 3VFMA 4HUWB 3AUVA 1WJ3A 1ZANL 4N0UE 2NX5A 4HK3N 4KI1A 1BD2B 1R5VB 5GGVL 4W70A 2I25N 3WDHA 3BKCL 4PB9H 2X4TA 1HHGB 4PGEB 4QHLA 4XHJD 5D70H 2ARJB 4OQTA 4XGZA 2UZIL 3MNVB 3B5TA 4GKZA 3GMQB 1Q72L 2W9LA 5FCUL 4XCNB 1CLOL 2DM7A 1YNLH 1ZT7A 2JF1A 1KTKE 4NQSB 4XP9L 2IANA 3LY6A 4HBCH 2AJUH 3NH7L 1XIWB 4YXLH 1I1CA 3HE6B 1MF2L 3HC4L 4AEHL 5GHWL 5IBLD 2OL3H 3OTTA 5F96H 5I75B 1NDGA 5HI5D 5BQ7A 1CFQA 5L2JB 1TZGL 1VGEH 5BMFH 3IKCB 4AMKL 1HH6B 4Z0BL 1JPTH 1E4KC 1RK0A 3WHXA 1C5BH 4ZUWB 4OBSA 1KB5A 3MRFA 4LFHD 4OGYH 3VMPA 4P2QD 4JPWL 5BZWB 5KSBF 4F9LC 1B6DA 2FECL 4NBYB 1OAQH 5HGHA 5ANMA 1YN6B 5ECJE 3W0WD 4JQIL 1T2JA 4AM0B 1A6VL 4HUWA 4MJID 4DVRH 3QEQE 1RUKH 4XMKH 5DA0B 3GMMB 1BD2A 1R5VA 4M6NL 5CGYC 1UWEH 5T1KD 4RFNB 3VU2A 1HHGA 4PGEA 4OGAC 2ARJA 4KRMB 5DC4B 5CZVL 5HXMA 3OXRB 5IB5B 3MNVA 4NQED 1ZLUH 4NZTL 3GMQA 2WZPD 4LCIH 3PE9A 3QISA 1FFPB 4XCNA 2G60L 2F19L 4CDHA 1FLRH 4XBEL 4JO4H 4L4TB 4NQSA 4NC1E 1XIWA 4NWTL 3HE6A 5FM8A 3UTZB 4DKDC 2CRYA 1QBAA 4G8EB 4K3JL 5MEOB 4IRJD 2NY4B 3U7WH 1E27B 5L2JA 4P2RE 3IKCA 1HH6A 2WIIB 5E08L 4HQQL 1JF5A 1S5IL 3INUL 3UYRL 3CSBA 3Q6GL 4S11A 2YPLD 2VQ1B 5F9OH 1CQKA 5BZWA 4WEUD 4MA8H 4X4ZA 1QSFB 1ZLSL 3AS3A 1FL6B 1KN4H 3UPRB 1YN6A 4AM0A 4ONGH 2VSDA 2NXZB 3B9AA 4DUVA 2VWEC 3KPNB 4D94A 4HS8L 1JJUA 3GMMA 5GJSL 3LDBC 2GAZB 5D8JH 5GJTL 5BS0D 3DO7B 3OXRA 5IB5A 3DYOA 4HUNB 1CLYL 2E27L 3NPSB 4LPCA 5IVNA 1FFPA 2IQ9L 4HWBA 4DN3H 1JFQH 1B88A 4L4TA 5ID0B 4KI5D 3UTZA 4YHNB 1CL7I 2A9NH 3S36H 3JXAA 3SOBH 4G8EA 3ZDXE 4DOHB 1OQOA 3DLQR 4YHYB 3CXHK 4NQCD 4ZD3L 3HRPA 4GBXD 5IUSA 4S0TD 5MEOA 2QR0B 1E27A 5HHVH 3MRQB 1C1EH 2RR3A 4XVTL 1XEDA 2UV3A 3IT8D 2WIIA 5C09B 5CJ8A 2FSEB 2G5BB 2O5XH 1N5YH 3ARUA 4Z9KB 4DEPC 2OK0L 4KUCD 4D9QE 2DLIA 5I30H 1A3QA 2VQ1A 5TPWL 4G8GD 3VWJB 1CZ8H 4G6JL 1QSFA 1FL6A 1U95B 4L29B 2VLRD 3UPRA 5L6YH 3ESVF 1RURL 4LSSL 1T89C 3Q5OA 1AC0A 5BW7A 3KPNA 2VDOL 3SN6N 2CKNA 1MCPH 1OQXA 1CT8B 4MJ6B 2GAZA 4PGDB 3CLEH 3DO7A 3BE1L 2XXCB 4AENB 1WK0A 4O2CB 3X3GL 5F7HA 3BRGC 4ZS7H 5HYJE 2XN9E 5ID0A 3HUJF 5J6GB 4YHNA 3UBXB 2VITB 3A6CL 3MRRB 2VTFA 4JRYD 4UBDC 1HYSC 4HPOL 2HMID 2NMSA 1WFNA 1YC7A 4F57H 2QR0A 3RWDB 4LVNB 3SE4C 2J6EL 4FXKB 1T7YA 3MRQA 1JZ5A 5C09A 5I8OL 2FSEA 1N2RA 1OAXH 2G5BA 1GGBL 1GZPB 1XGRB 3O8XB 4JM2C 3BO8B 4XXDB 5I1HL 3CH8A 4M5ZL 4IDJH 3VWJA 5D7LB 2C4FT 1U95A 5J0BA 2WWMC 1FPTL 1T6WA 2IG2H 4L29A 5E8PB 1OWWA 3VGDA 2H1PL 4GG6F 1ZE3C 3AMLA 2P5EE 3HE7B 1CT8A 2CR3A 4MJ6A 3T0EE 1KJ2B 2Y72A 5MP6H 4JN2B 5FYJU 4PGDA 5FYKU 5FGSA 4Z7OE 4GRLC 1EMTL 4FQCL 4AENA 4PGBB 2E7CA 4O2CA 5DFVC 1I1YB 4U6HB 3WFEH 5J6GA 3UBXA 4LAQH 1JPFB 2VITA 3BGFC 1U0QA 1H3GA 3MRRA 4EVNB 1TIUA 1NBVL 2AEWA 1V3LA 3LN4B 3RWDA 4PJDF 5AUMB 4ODXB 4FXKA 2WUBL 1MJ8L 4PJ9B 2KQMA 4JM4L 3C5ZD 4U05A 1QFUL 4WU7B 3BP4B 4LGSB 1GZPA 1XGRA 3O8XA 4XXDA 3BO8A 4E0RB 4X7TB 5K59E 5D7LA 5IB3B 1NCWL 5E8PA 4G6KH 1MEXL 1U3HB 4KJYB 2YPVL 4N8CH 5GGRB 4JHAL 3CFIC 3G08B 1CE1H 3HE7A 5C0AD 5I1JH 3PIQB 1QG3A 3SKJH 1KJ2A 3TT3L 4JN2A 3VI4E 2VDRL 3ULUD 2R39A 4MXWL 1SJXA 2AW2A 1QSVA 4NO2B 4PGBA 4EUPG 5FIEA 1MAML 2ESVE 4NO0D 1I1YA 4TULH 3W82A 3WMSA 1TZHB 4FG6D 4RDQG 4S1SL 3D1MC 4U6HA 3BZDA 3H2WA 2CUIA 3ZYZA 5IFHH 1JPFA 4M5YL 3DMMD 1INEH 4EVNA 3RX7A 5T1LD 4UV4L 4KKCC 5E99H 1J8HE 3LN4A 3MREB 5DR5L 5JXAH 2L7UA 5AUMA 4ODXA 3EO0B 5FYJE 1YYML 3CDFA 3G6JF 1BQLH 4PJ9A 5JHDE 4OF0A 3SGKA 5EU7C 4WU7A 3WLWC 3BP4A 4LHJB 5HPMB 4X80L 5E03A 4PY8J 4E0RA 4X7TA 1MCEA 5IB3A 2DJSA 5TF0A 4YE4H 2V5RA 1RZKH 4FP8L 3WUWB 1T7ZA 4WVRA 4ENEC 4XT1C 1U3HA 4KJYA 5BO1H 5GGRA 5DJAB 3G08A 3BZFB 3PIQA 3WHE1 4LLAA 2FX7L 3PHQB 5L0QB 5C6TH 2CIIB 2ITDB 1KYOK 5FUZH 3HAEB 1IM3B 1UM5H 5AG9A 4NO2A 3BP6A 1Y18B 3OB0H 5FYJL 2R56L 4GOSA 1GGYA 1TZHA 2R0WH 1F3JB 1TNNA 4QHMB 3KJ4B 5H2BB 1ZA3B 1RMFL 5KS9B 2GITB 3CD4A 4LKCB 3TNMB 1GIGH 3JWDC 3OQ3B 4Y8AA 2HT2C 4L4VB 4NGHH 2A6IB 3MREA 2ICCA 4JG0H 3O3AB 2VDLL 1EGJH 3EO0A 2ZKHH 5E2VL 1IEBB 3HI6H 3GGWB 2Y1VA 3SCMD 5HPMA 1W8NA 5I2IB 3NTCH 3WUWA 1YYLL 5CWSB 1NAMB 4WIQA 2RGSA 4PGZA 1P4IH 4NHCH 1UKSA 5DJAA 4RRPG 3BZFA 7FABL 4P4RB 3PHQA 2CIIA 4FQ1L 2ITDA 3HAEA 5KW9H 1IM3A 2CK0H 2R1YB 4NRYB 1KGCD 2AQ1A 4WW2B 1WISA 1E4WH 4I18C 2CDEB 1F3JA 4UB0H 3HC3H 3B9EA 3MYZA 4M7JH 3LOWA 4QHMA 4YHPB 5H2BA 5C3TA 4OCXH 1OTTC 1ZA3A 5J3HC 4HS3B 5DK3A 5E00A 5KS9A 2GITA 4LKCA 3TNMA 1N4XL 3BX7C 4L4VA 4LCWD 2F58H 2A6IA 3O3AA 5D2LF 5EULV 5F7LB 1S7UB 4FFYL 3HMXL 4QF1B 3M8OL 1WBYB 1IEBA 5HYQB 4YBHA 1J12A 4PJ5D 4PLOB 3RQ3A 3GGWA 5D7JD 4Y2DC 1MQ8A 4M3KB 4JCMA 5I2IA 5CWSA 1NAMA 1NFKA 1A7BA 2FECI 1KEGH 2FO1A 1FHGA 2Z8VC 5EZIL 3T3PF 5SX4I 3RY5A 4P4RA 4RZCB 4N0CD 5GS1C 4QOKD 3IFPA 4JN1H 3ULVD 4R4FH 5F1NB 1PEWA 2HN7B 2NY3C 3GSVB 2R1YA 4NRYA 4M8VA 2F15A 4WW2A 2DQFB 4XTRD 2CDEA 3TJEL 4YHPA 4ACPA 3O0RH 4HS3A 5B39B 4YDJB 2KUTA 3UAJD 1K4CB 4ZAKB 1CD9B 2C1PB 2WANA 1X5YA 5D70L 4K23H 3TFKD 4HMDA 3VFWB 1I1AC 3RZCD 1N5AA 4M6AA 1S7UA 2X7LB 4AEEA 4OZIF 4QF1A 1YNLL 1WBYA 1I7TB 4QCIB 3LKPB 2AJUL 2EDTA 4HBCL 4YXLL 2D4FA 4X6CB 4PRIE 2ZJSH 4RWYH 4CBPA 2XTJB 1MY7A 5F96L 2DRUA 3VFNB 1DBJH 4F7MB 3EDFA 3OG6B 1VGEL 5BMFL 1C16B 3D3VB 5F89B 1QSZA 1W8OA 4H1LH 1JPTL 3FN3A 4RZCA 1OW0C 3OKNB 1C5BL 1L9NA 5F1NA 2HN7A 3GSVA 5I1IL 1B90A 3MBED 4OGYL 5DEGB 5C0RH 2DQFA 4KK5C 5D7IF 1OAQL 2XI9A 3ZYJA 3CJJA 3K1KC 2DI9A 4XMKL 5HDOA 1KLGB 4KMQA 4YDJA 5B39A 1RZGB 4ZAKA 2C1PA 4YXHL 3L5WB 4LPTA 2V6HA 1CGUA 4MCYB 1QRNE 3RVUD 3VFWA 3S5LB 1JRHH 4LCIL 3BSZH 2XQBL 1FLRL 2X7LA 3CNKA 4JO4L 1KCRH 1I7TA 4QCIA 5CP3H 3LKPA 1QFWH 4XPAL 4X6CA 3FQTB 3LEXB 1O0VA 3JV4B 3TH3T 1BF8A 2NW2B 3VFNA 4C56D 1R3LB 4HAFA 1CDYA 4F7MA 3CUPB 3U7WL 1KFAH 2NY1B 1C16A 4MNGE 3D3VA 5F89A 1S3KH 3T0XA 3OKNA 4J3SA 1EFQA 2CH8A 2Q86B 5DEGA 3SE8H 4U7SA 3P4OB 1TCMA 1KN4L 1GGIH 4ONGL 3WS6A 3MV11 1KLGA 4P5TD 3TESA 3D85D 2EZ0C 3O81A 4HFUH 1RZGA 4JO2L 3AU1B 5D8JL 3ZE0E 2X42A 1DFBH 5DVNA 4MCYA 2AXHA 5C0CD 2NLJB 3H7BB 3C87A 2X9XA 4OCWH 3S5LA 3KPSE 1KN2H 1AGEB 3SPVB 4DN3L 1JFQL 3PP3H 2P1YA 2HJFB 1IZJA 3TP4A 3T2NH 5LXGH 3QO1B 5JR1H 3FQTA 2Q7NA 1G6VK 3LEXA 2A9NL 2X4RB 5E8EB 2NW2A 1AJ7H 4I2XE 2WQ8A 1R3LA 3FL7A 1ROWA 2XQYK 4P2OB 2BNQD 1C1EL 4NN5B 1OD7A 3QUKB 1EAPB 2O5XL 3DSNA 3V6FB 4G7YH 3WDJA 1N5YL 1MCJA 4KDVA 5HDLA 3G5VB 5D5ME 1XF5B 2C3HA 5CEZH 5I30L 1DANT 2Q86A 1CZ8L 1CGSH 1II4E 3MLPA 3P4OA 4H5SB 4NJ9H 4ZO6A 5DTFB 5L6YL 2EICA 2OMBA 4HGWB 2X1WL 4AY0A 5IK3B 1MCPL 2V9QA 1ZS8B 2Y9RT 3AU1A 3BESR 2NLJA 2ZG1A 3H7BA 4TTDC 5CGYD 3S35L 3PDDA 1AGEA 4ZS7L 1CFNB 3SPVA 4NQDD 5TDPB 1IVLA 5EUOB 4TOYH 2HJFA 2Q76B 2OTUB 3AVEA 4I9WD 3QO1A 4XCYB 4FTVB 2X4RA 5IM7A 3LQAH 4LPWA 5E8EA 5GZOC 1M7XA 1IBGH 3PHOB 4P2QB 4ESKA 4UMGA 2WV3A 3MODL 4XB7A 1K3ZA 4P2OA 3W0WB 3BJLA 4MJIB 3QUKA 4MB3A 1EAPA 3V6FA 2D9CA 4FXLA 3RHWF 5T1KB 3QIUB 1DEDA 1KC5L 3G5VA 1XF5A 1T2QH 5MHSD 4IDJL 4Y19D 3VW3L 5C0JA 2VZOA 4NQEB 3VGFA 4H5SA 3P3YA 3QRFM 2IG2L 5DTFA 3UDWA 1CXLA 1GOFA 4HGWA 5H37H 3C5JB 5IK3A 4Z7QE 4EDXB 3HLAB 3SBWC 4E41A 4RGOH 1ZS8A 4M93B 5MP6L 3K3QA 2IFGA 4IRJB 5BRZB 1CFNA 5TDPA 5EUOA 5E8DL 4HKJB 2QBWA 1EPFA 5TE4H 3WFEL 2Q76A 2OTUA 3QXWA 4XCYA 4FTVA 3TPKA 4HC1L 2Q7YB 2YPLB 3PHOA 4P2QA 4MA1B 1DBBH 4K3HA 3W0WA 4MCZB 3TA3C 1HQRB 4MJIA 2F8XC 1ZMYA 1FIEA 3Q5TA 4P5MB 3RKPA 4AZ8A 3LZFH 3GO1H 5T1KA 5ICZB 1PQZB 3QIUA 5BS0B 1K8IB 2HJKB 2DLFL 5HBBA 4WRLA 4NQEA 5MI0B 3GM0A 4GJTB 3JWOH 2D7TH 2YZ1A 3LHPL 4G6KL 2WLZA 4N8CL 3V7AE 3VXNB 1CE1L 3C5JA 2GK0B 5EOCJ 5I1JL 3IVKB 1VFMA 3HLAA 4EDXA 2ZUQC 3IFOB 1K6QH 3SKJL 3EO9H 2JJTA 1GCFA 3A6BH 4X9BA 1ZSDB 5HJ3B 4PJIF 1CICD 4IRJA 4PRDB 3HZVA 4JGMA 5BRZA 5EA0H 2VLJD 1YEGH 4TNWF 4HKJA 4ZO9A 2QQQA 4N0RA 4OUUB 4UQ2B 2ED9A 2CJUH 5F7FA 3B43A 5IVXE 4Z95H 2E7MA 1KSRA 1INEL 5AAWA 3FB5B 3RIAK 1OAKH 2VR9A 1UGNA 2Q7YA 2YPLA 2ADGB 2EDXA 3RX8A 4HEPG 4M7ZC 3RPIB 4OCRH 5E99L 5BVPH 5JXAL 4ZUUB 2VLRB 1X5JA 1LO4H 4UBDD 3VFGH 4MCZA 3U9UB 1HQRA 3DBXB 3LB6C 1BQLL 4K94C 4OQTH 4N90E 4P5MA 3U0TB 2HRPL 3RAJH 4AIZB 5ICZA 3DX6B 1PQZA 1JNLH 1KIQB 4HUKB 3CGTA 1MAKA 5BS0A 1K8IA 5C2BH 2HJKA 2Y07H 1XH3B 4YE4L 1RZKL 1I8LC 1JYNA 4JM2D 1UJTA 4ZUVB 3BH8B 5IB2B 4E5XB 5BO1L 4JHBA 2H26B 2KZWA 3RVXD 3VXNA 2K1MA 2GK0A 1UT9A 4IJ3B 3IVKA 4DK3A 2WWMD 2YMXL 4WFGE 3IFOA 4ZFFB 5HGAB 5C6TL 2HT3C 2W0FB 4NYLB 5FUZL 5ID1B 1A6UH 1O5DT 3WJJC 5TJWK 1UM5L 4ZFOB 4EBQH 1ZSDA 4PJFE 5HJ3A 4PJAF 4PRDA 2ARJQ 2AGJH 1RZ8B 1KB5H 1Z9MA 2R0WL 4GRLD 5F1OB 3PG2A 4OUUA 4UQ2A 4YR6B 3N0PB 4IHOB 5DZLA 3T2OA 5K9KB 1RU9H 5D7KE 1H3WM 3FB5A 4GW5B 4H0HB 2ADGA 1MWAB 2LTQC 4NGHL 3RDTB 3RPIA 4Y5YC 1EGJL 4ZUUA 2VLRA 5IMLB 5JIIA 2ZKHL 3ZDZF 3U9UA 3DBXA 2ZP0T 3VGBA 1M7IB 3UJTH 2WSKA 4D0BB 3U0TA 3HI6L 2GJJA 1A7OH 2HT4C 3LKRB 4Z18A 3DX6A 3VRJB 4AIZA 1KIQA 5HI4C 2BY3A 3NTCL 1XH3A 1H0DB 4DGYL 4IIQC 1P4IL 4NHCL 4ZUVA 3BH8A 5IB2A 1V3MA 4E5XA 3PP4H 1LK3H 3DV4B 1UH3A 5E95B 1KLFA 3OXSB 4XBGB 5C08E 1B4RA 4ZFFA 5HGAA 4J1UB 1I9IH 2W0FA 4NYLA 5ID1A 3QXAB 4LL9A 5KW9L 2CK0L 4ZFOA 4LBEB 1G9NC 1RZ8A 1E4WL 3BD5A 3S3JA 4UB0L 4M7JL 3MV7B 4YR6A 4OCXL 4YZFF 4IHOA 1MIMH 1QLFB 5GRVL 5K9KA 5F1KC 4GW5A 4G5ZH 3L5IA 1MWAA 3CZFB 3RDTA 2F58L 4WGWB 5IMLA 4ZODA 3GMRB 3VD7A 4POYA 1M7IA 2X09A 1L0QA 4D0BA 2JJWA 3LKRA 4PRPE 2EIZB 1J8KA 4R2GD 1JGLH 1H0DA 1UACH 3WLWD 4QNPE 3NZHH 4NO0B 4BUHA 1KEGL 4F37K 3DV4A 5ICXB 3KJ6H 4AL8H 1CD1B 3OXSA 4XBGA 4ENED 3VDBA 4BSWB 4J1UA 4JN1L 4OM0H 2CUHA 4R4FL 4ONOA 3QXAA 1S9WB 3CMOL 1XF1A 4YX2H 1E0OB 5DK0B 4LBEA 1ZHBB 4RMSA 1YA5A 3LCYA 4HUMB 4PJBB 3MV7A 4Z7QF 3EFFB 3O0RL 1QLFA 2JCCB 1QLRB 5EG6C 2YBRB 1KT2B 2VRAA 3CVHL 3F7PC 3CZFA 3GRWA 3ISWA 4O4YH 5IFJB 4K23L 3ZKXB 4YH6A 3GMRA 3OKLB 2HT2D 3OAYK 4UT7H 4X9IA 5EU6D 2NXYB 1DL7H 4MVBC 1KIUA 2FHFA 3KPOB 5I9QB 2EIZA 3IETB 5D96B 2ZJSL 2BX5A 4NM8H 5SX5K 3BPLB 1OLZA 1Q9WB 3NIGF 1T5XB 5B3JE 2AXGB 4NO0A 1DBJL 4EXKA 5ICXA 4XB8A 1CD1A 2DIAA 4BSWA 4YEFA 1L0YA 2IAMC 3TWCH 1MI5D 1A1MB 1S9WA 5L2KB 1KB9K 5F6IC 3TIDB 3CDYA 3CU7A 5DK0A 4G8IB 1ZHBA 1GC1H 3SGJC 5C0RL 4PJBA 2YA1A 2BRQA 4HCRA 4C58B 4OLZH 1EBAA 1SQ2N 3ILQC 4FNLH 3WYRA 4EUPB 1FG9C 4XNQB 2JCCA 1QLRA 3B9KC 4GAFB 1KT2A 3PGCB 3SCMB 1TZIB 4M9PA 5FUCE 1OTTD 2DQGH 2MWCA 5J3HD 5IFJA 4KROC 2HRLA 1QFHA 3OKLA 1EXUB 3HC0B 3P0YH 3BPOC 1OT1A 1X5KA 2M2DA 1KCRL 1PG7H 2V2TB 3K80A 3KPOA 2GSIB 4LLMB 4K71C 1QFWL 5A1AA 5IVXF 3IETA 4KK8C 2DWEB 3KVQA 2CLRB 5I16B 1RZ7H 1Q9WA 3I6GB 2AXGA 4KMTH 3DPBA 4Y2DD 4QRPB 4HULB 3KPRD 2CDFB 1T0MB 2ZNXA 3NCYP 4XX1E 4V1DE 2HFEB 1P5UA 3IB4A 4ZFGH 4Z7VB 1A1MA 3V6ZB 5L2KA 3TIDA 3W2DH 4G8IA 4UOJA 3FQUB 2AS5M 3SE8L 3W9DB 2NY3D 1GGIL 4LVOB 1EEUA 3J8F7 5I71B 4EUPA 4JZOB 1MJ7H 4XNQA 4FQXC 4PJ5B 1Y6MR 4HFUL 3VGEA 3PGCA 3SCMA 4GRWB 3NCEB 2RIKA 1TZIA 1QACA 4XVUC 1DFBL 4KGLA 4TVPH 1FSKB 5CEZE 3LS4H 5KOMC 5CEXB 1J5OH 4OCWL 2Z91B 2O5YH 3TV3H 3MOAH 1KJ2H 1EXUA 1KN2L 3HC0A 4LHUD 3OX8B 2V2TA 4BFEA 2GSIA 4LLMA 4JFED 2DWEA 3GIVB 5JR1L 5DMGC 1N64H 2CLRA 2MNUA 2NY2C 3NMEA 5I16A 1AJ7L 3I6GA 3VRLF 1IC7L 4QRPA 4JRXE 2CDFA 5DC0A 1T0MA 3JSSA 4LF3B 4G9FD 2VZSA 4OIBA 2R9HC 3TO4C 2HFEA 2W9DL 1G0DA 4G7YL 2XG5A 4PJ7E 4Z7VA 3V6ZA 4CKVX 5CEZL 2CXGA 5D93C 4LSPH 3FQUA 2FL5B 3W9DA 4YFLI 3RZCB 4NJ9L 3C6LC 3VFTB 4OKDA 4JZOA 4KK5D 2P5WD 4PJ5A 4OD1L 4JFFD 2Y5EA 1IQDB 2GJZB 3GFUA 9CGTA 3L7EB 1KACB 5C1MB 3CFJA 5CEXA 2Z91A 4ZOAA 2WAHA 3GBLA 1QFWM 3OX8A 5KANG 2WP3O 5JOFB 4P46C 3MFGB 3NN8B 3TYGH 3GIVA 4KDTA 3PQYD 3LQAL 2YS4A 1IBGL 1IGFH 4U6TA 4XWOC 5HHMD 2X9YA 3IRZA 1VCAA 4LF3A 1RUML 4NZRH 4IRSC 4HJJH 4KDWA 1MPAH 1UENA 4H8WC 4MXQC 5FV2A 1RJCA 3B2UC 1WZKA 1LEGB 4XBPB 4RRPA 4NFDA 4X98B 3BP5B 4EI5C 1TETH 2FL5A 1BOGB 4OZHB 4GMSH 3RZCA 3VFVB 1PKOA 5LCVH 1Z3GL 2JB5H 3VFTA 1AXTH 3V8CA 5FXCH 4IRZH 2EDKA 4RGOL 4U1HB 1ZLUK 1IMHC 1IQDA 2GJZA 4G7VH 4U1GC 3L7EA 2AEPH 4C56B 5F72S 1NGPH 2EZ0D 3O45B 5FCSH 4PRHE 3SQOH 3HAEH 1TQBB 1QOKA 2QSTA 1JGDA 4HWZB 5TE4L 5JOFA 1D5IH 1I3GL 2GUOB 5LKNA 3NN8A 1W0VB 2N7AA 2VDNH 5GGVY 5EOTB 1A8JH 4G42B 5F3BB 3H9YA 3H9SE 3WHE0 1DBBL 2BK8A 2XACC 4EQ3A 3MXWH 4JY5H 2VLKD 4KXZH 2EO9A 2KDGA 3DVIA 4P5TB 3RJQB 1LEGA 3LZFL 4HJGB 4XBPA 3GO1L 3VXRE 5JPMB 4KI5F 1B0RB 4X98A 3BP5A 5C0CB 3V5DB 4L8DB 4OZHA 4ZYKB 3VFVA 2NX5E 3JWOL 1G1CA 5JQHC 3C6SB 1CLZH 4OI8A 2NY0C 3ZDYE 4BUGA 5HPOA 1NCCL 2V2XB 4PP2B 1NAMH 3CFDB 4NCC2 2BSTB 4U1HA 1K6QL 3EO9L 2OI9B 3I2CH 5ERWB 2HFFB 4C56A 3O45A 2IANE 4KUCF 4CMHC 1YEGL 3J7HA 2B0SH 5IP4A 2BNQB 4HWZA 4TTDD 2BNRD 3L7FB 3REVB 2GUOA 1W0VA 1VB9A 4Z95L 5EOTA 4U33A 4MB5A 1OAKL 3GI9L 4G42A 5F3BA 5DD3L 4PB0H 4V2CB 4S10A 5BVPL 5EOCH 3NCFB 4XPBH 1LO4L 3VFGL 3WEXB 2NTSP 1YEIH 5GZOD 5KN5B 2XZCH 3C5SB 1I1RA 2BHYA 3MCKB 5JW3H 4P5TA 5HYSG 2OR8A 3TF7C 1GVIA 4HJGA 3RAJL 5JPMA 5HHQB 1JNLL 4HLZH 4MA3B 5E9DD 1B0RA 1SYVB 5ANME 3CCHB 3V5DA 3BEVB 4L8DA 3BUTA 1VEPA 2RJMA 2Y07L 4QRSB 5C0CA 5C2BL 2BNUB 4ZYKA 3V52H 5D6DC 4J3WA 3DUHA 3C6SA 4NQDB 3WIFB 1U8HB 2V2XA 4PP2A 4PJGB 4ZPTB 3CFDA 5GRYA 2BSTA 3P73B 1G9MH 2WW8A 1A6UL 2HFFA 5ERWA 1I1FB 1F13A 3ZYIA 4EBQL 5D9SB 2AGJL 2BNQA 2YXMA 2JTDA 4JFYB 3L7FA 5HGGS 4MQTB 3REVA 3RVTC 3EIFA 4NM4H 1RU9L 3LEYH 5J4MA 2WNGA 1E4KA 5E2UH 1WT5C 5GGQH 2H8PB 1AE6H 1VPOH 4G6AD 5FAAA 4MDJB 3MLUH 2AJSH 3WEXA 5KN5A 3EHBC 4PJEB 3C5SA 5TFSH 1MCLA 1F4XL 2J1KA 3AS1A 3MCKA 4PD4K 3NIFE 4YO0B 3KXFB 1A7OL 3V4PH 5HHQA 4MA3A 2DTMH 4OB5H 1SYVA 2UZYB 3BXNB 3TA3D 3CCHA 3BEVA 3BWUC 4QRSA 2BNUA 3LDBB 4JDZB 1TJGH 2OP4H 4NQDA 4X7CC 3WIFA 3PP4L 4LAJH 1S9XB 1U8HA 1DANU 4ZPTA 4PJGA 3RY4A 3P73A 1QLEH 2AXFB 4NC1C 4X6BB 3BH9B 3EO1B 4MD0B 2Y4SA 1I1FA 2UVEA 4L4TE 5D9SA 4QXUH 5GGSB 5I19H 4P23C 1U58B 5CEYB 1MCDA 1Q0YH 4JFYA 1OAYH 5SWQB 4G80B 2J7LA 1MIML 5JOPD 4X7SH 1PX4A 1IZKA 4YHZH 4K3GA 2H8PA 3FQRB 4MLSA 4MDJA 3ULUF 1JZ2A 4PJEA 4MAYC 2BOCB 4YO0A 1T7XA 3KXFA 1ZVYA 4W6YB 1QSFE 3B5HA 3BXNA 3FRUB 3LB6D 4HWBL 5FA4B 4XNYL 4MYWB 3ZHLA 1JGLL 4JDZA 1CU4H 1CICB 3NZHL 2HJLB 2UWEF 2QSCH 3VWKB 3QEHB 4JFPB 4DGIH 3KJ6L 1S9XA 1OPGL 1I8MB 4QTIH 2AXFA 4X6BA 3BH9A 3EO1A 4MD0A 4OM0L 1FAIH 4R4BB 4GSDH 1T20B 1ES0B 5GGSA 8FABB 3U82B 1A6WH 1U58A 2WM0A 2HT3D 2KKQA 4NN7B 5CEYA 1JRHI 4NC2B 5CUSH 4X4YB 5SWQA 4G80A 3WXWH 1QFWI 2V17H 3GKZA 1T1YB 3FHAA 5C09E 4O4YL 5HI3C 4DFIA 3FQRA 1G7JB 4I8DA 4JM2B 4HK3J 3KLDA 2HH0H 2COQA 4UT7L 1DL7L 3KYKH 1IGMH 4PLJC 3U36A 2BOCA 5E2TH 1ZLWH 4LKXB 3FRUA 1T89A 5FA4A 1BF2A 5KVMC 4YHMH 3T8XB 2HT4D 2WQRA 1CICA 2HKFH 3MX0A 2HJLA 5HI4D 3QEHA 3VWKA 1JHKH 4GH7B 4JFPA 3TCXA 5I1CH 4GRLB 2CD0A 1I8MA 2VDMH 4K9EH 3OB0K 4ZDHB 2R23B 2YUXA 2CO7B 2E8ZA 1GAFH 1E4JA 4R4BA 1T20A 4X83A 5DJCB 1ES0A 8FABA 2YA0A 1CDIA 1GC1L 3BGFB 4D3CH 3QT2A 1P84K 3K4DA 3ZDYF 2XG4A 4X4YA 4OLZL 4FNLL 3T3MF 3OKEB 4PGJA 3ECBB 2NR6C 3BHBB 1FNEB 1BX2B 3SE4A 2R2CA 3IJYB 3HB3D 4PRBB 1T1YA 2IPKB 5I73C 2XXMB 2DQGL 2RCSH 4UTBL 1G7JA 4I3SH 4JM2A 3BN9C 2EDEA 3P0YL 3MACH 3SDDC 1A7QH 1D7FA 2CSPA 4WY7H 2ZUTA 3UTQB 1PG7L 2MCG1 4XNMB 3E3QE 5D7LE 4LKXA 3QUZD 3T0EC 1AR1C 3T8XA 4TVPE 1C7TA 4KMTL 3WNNA 2P45B 5F7KC 4GRLA 4YFDB 4ZDHA 2R23A 3QCVH 4PTTB 2H6PB 5DJCA 3NAAH 1B9ZA 5A2FA 2RQ8A 3AY4A 2CO6B 2DQJH 5GRVK 4GFTB 1NMCC 5D72H 3OKEA 3ECBA 3BHBA 1FNEA 1BX2A 1CDGA 1OB1B 2EEBA 4GO6B 3QR2A 4Y1AD 3IJYA 4PRBA 2IPKA 3WFHB 2BSRB 2EDNA 4R2GB 4TVPL 1CYGA 3LS4L 3V6BR 1J5OL 2NPLX 2O5YL 1YQVH 1KJ2L 1MFEH 1R3JB 1YPZB 2LE9A 1YMMB 3UTQA 4LLWB 4J6RH 1P69B 4XNMA 2W60B 2YEZB 1W72B 1AGFB 2A1WL 3LN9A 3ARDC 1N64L 5DXWA 4ODTH 5ACZB 4MVBD 4LDOB 1D5MA 4P9HL 3QI9D 4KTEH 5IJKA 2VN7A 2CGRH 3VG0L 2QEJA 4AEFA 4PTTA 4HMEA 2DF3A 4LPXA 1BGXH 2H6PA 3CFCH 2R1XB 4LSPL 2IAMD 1DP0A 2NY6C 4LRIC 4OT1H 2NY5H 4GXVH 3O4LD 3S88H 4RMWA 4WJ5B 4HF5H 1OB1A 5TE7H 4JKKA 3WFHA 1P4BL 3ILQD 2BSRA 3FZUC 3MROB 1PY4A 4WI4A 3B9KD 3UO1H 1R3JA 1YPZA 3VD4A 3HRZB 3SE9H 1WFTA 2APVA 1YMMA 1SHMA 4LDLB 1SJEB 4LLWA 4KROD 2W60A 3V4UH 2YEZA 1W72A 1AGFA 4FRWA 1Q9KB 5ACZA 3EJYC 5I1DB 4P4KC 1IGFL 2R69H 5CJOL 1A7NH 4PYGA 4W81A 1B4JH 1J7VR 4HJJL 3DYPA 5C0BD 5I15H 2R1XA 1TETL 3QDJB 5GRWA 5I8EB 4EN3A 4GMSL 5J8OA 4ELMF 2EE9A 4JJHA 2I5YL 3SJVD 2AJVH 3VFOA 5KS9E 4Z8FH 4JFXB 3IAGC 5LCVL 1KEML 2JB5L 1AXTL 4WJ5A 5FM5M 4RBPH 1CXKA 1BJMA 4IRZL 2I24N 5E70A 4F2MB 1XT5A 5DO2C 2AEPL 1CXHA 1QKZL 2ADFL 3MROA 4FQXD 5FGBA 3QPXH 3HRZA 4Y2DB 4QHNB 1NMAH 1A6TB 2AJYH 4XVUD 1KXQE 4TSCH 5KVFH 3N1FC 1SJEA 2Y25A 1IGYB 3K4ZA 4RNRB 1D5IL 2LVCA 3WFBH 3I6KB 2VDNL 5EBMB 3T77B 1I9RL 1NLDL 4Z77B 4GKNA 3R06B 5I1DA 1B6UA 4LPUA 5GS1B 5J89A 5K9JH 5DMGD 5FF6B 4JFQB 2NY2D 3QB7C 3MXWL 3AROA 4JY5L 1UG9A 1MWAH 1YEHL 2YD6A 1EHNA 4JQXC 1A14H 4L8CB 1DLHB 4RMQA 2R9HD 3TO4D 1I75A 3L1OH 3QDJA 5I8EA 5DFTA 2AP2A 3VXOB 3AAZB 3BIAX 3FFDB 4JFXA 4Q9RH 5L7XL 1MREH 4JFEB 4PY8I 1EO5A 2YOCA 4OFYD 3FAXA 3HNSL 3I3DA 3X12B 2ATKB 4F2MA 3C6LD 1FORL 3PP3K 2W65B 4HKBA 4ZXBC 4UAOB 1F90H 4Y2DA 4QHNA 1A6TA 2QSQA 5E5MB 4MHHI 1OGAB 2B0SL 3JV5A 4G9FB 2HYMA 3K8KA 1IGYA 4TUKH 1PAMA 4RNRA 4EIZC 1IAMA 4J23A 2G75B 3I6KA 5DI8B 5EBMA 4MAUH 4YXKH 3T77A 3V8OA 4Z77A 4HSQA 3R06A 1NBQA 3L3IA 4P46D 4B41A 4RISH 4PB0L 3F6LA 5GS1A 1HQ4B 5AZ2H 5IHUH 3IDMB 5FF6A 5EOCL 5GS0D 1WWBX 3OGOE 4JFQA 4XPBL 1BVLB 4Z7UB 5EZJB 5T1MB 4ALAH 5JUEH 2XZCL 3GRWH 4XWOD 4NUGL 5JW3L 4Z7NF 2P5WB 4L8CA 1DLHA 4DGVH 5KZCB 2CRMA 1F5WA 4IRSD 4MXQD 1I7UB 2J8HA 3O6FC 3B2UD 5F7DB 3F12B 4M02A 1FVDB 1N6UA 4L3ED 4ODHH 3VXOA 3AAZA 3SKMB 3ZE1F 4ONFH 3FFDA 1F8TH 4F9PA 2NNAB 2AKRA 4EI5D 3DNKA 4XCFH 1HXYB 4JFEA 2VUOA 1JMZA 1MRCH 3X12A 2ATKA 4XRCB 3PQYB 2W65A 1FGNH 1F4WL 5HHMB 3T0VA 4X8XA 5DJ2B 5E5MA 4FQJH 1OGAA 4X6CE 4G9FA 2C26A 4OCNC 2XTJE 1ZVHA 4JR9H 2G75A 3BQUD 4NM4L 5DHVB 3QAZC 4M3JA 4HCRH 4WNQB 1OARH 5E2UL 1OW0A 2CIKB 5GGQL 1HQ4A 3D3VE 4MNHB 1AE6L 3IDMA 1VPOL 3MLUL 5B4MC 3VFUB 1BVLA 2AJSL 4Z7UA 5T1MA 1JF1B 1A7RH 4MD4B 5TFSL 3MV8D 4JKLA 2OR9H 2BVTA 3NOIA 2P5WA 4XPTH 3EYQC 4OUOA 1UM4H 2DTML 4OB5L 3CXDL 1I7UA 1X5ZA 3EZJB 2AJXH 5F7DA 3F12A 4ODBD 5IHLB 1FVDA 4U31A 3TM6A 2OTWB 4X9GA 5T3ZD 1TJGL 3SKMA 2OP4L 3LH2H 2NNAA 2PYED 1FDLH 1G1YA 5JW4Q 1HXYA 2D7MA 2DIJA 4N68A 2NY0D 4XRCA 3O6LH 4QXUL 5I19L 4V2BA 5DJ2A 4LCUB 2E6JA 3FB7B 3B2VH 1DVFC 1Q0YL 1KF9B 1QBLH 2VLKB 1OAYL 4XAKD 5DHVA 1UKQA 3VGAB 4WNQA 3R8BB 3CK0H 1JWUB 4YHZL 2CIKA 4MNHA 4EUPH 5DF0A 4MXVE 5FO7B 2XWTB 3VFUA 3L5HA 1JF1A 4J7RA 4L1DA 4MD4A 3QQ9D 1R3IL 2AV7A 3SO3B 4B7IA 1INQB 1S7VB 5DK2B 35C8L 3U4AA 4LU5L 3AGVA 3ZT5A 1JZ3A 2OTWA 3S34L 1CU4L 2YD3A 1IT9H 4Q9CA 3D6GA 5A2JH 1DZBA 2QSCL 4WHYG 5I0ZA 3S36X 5I6XB 4DGIL 2BNRB 4QTIL 3O3BB 4GSDL 2EC9U 1A6WL 4LCUA 3FB7A 5CLWA 5FGRA 4U1IB 3PJSB 2J12B 2VLKA 3QNXB 2V17L 1A2YB 2DQHH 2WWKO 3LRSB 1JWUA 1X9QA 2J4WH 1VFAB 4GAGH 4OLVH 4PJXB 5FO7A 2XWTA 3UBXI 4GRWH 2HH0L 5F7UA 3OGCB 4UIMB 4NKOB 2X1OA 4GXUM 1XFPA 1IGML 3KYKL 3RVVC 1INQA 4Y89A 1S7VA 5DK2A 4Y4FC 2AJZB 3EHBD 3IU3B 2R15A 3N1MC 4YHML 3QEQD 3TO2B 2HKFL 5IF0B 4PG2A 1MQKL 4E41E 3ULVH 4RX4D 2DQDH 2BNRA 3PDOB 2VDML 2YR3A 1WAAA 5FV1L 2A0LD 3O3BA 2EH8H 3ESUF 4UINH 1GAFL 4DTGH 5ESAB 5EUOE 4DN4H 2YD4A 3QDGD 2ZOKB 5IJVB 3H9HB 4D3CL 3R0MA 4TTGA 1FYTB 4U1IA 4FTVE 3PJSA 3T1FB 3I75B 2LVEA 1NAKH 3QNXA 4P23D 1A2YA 1QP1A 3LRSA 1CBVH 1VFAA 2NZ9C 4LP5A 3W0WE 3FN0L 2ID5A 3UP1A 1D5BB 2RCSL 2J88H 4PJXA 4LLUB 2WP3T 2X2YA 4I3SL 4Y16B 3OGCA 4UIMA 4BKLB 4NKOA 2WMPA 3MACL 1A7QL 2LU4A 4WY7L 1X4ZA 1CL7H 3V0WH 2DB8A 4NQEE 2AJZA 2XTLA 4OZGF 4W6XB 4KHXH 4MAYD 1T2XA 3IU3A 3GKWL 1YQ2A 2HAZA 5HYSB 3TO2A 3P40A 5IF0A 4HW6A 4WWID 4Q0XH 5LGHH 3MRGB 3OAUH 3P0VH 5F7EH 1OP5H 1QNZH 3PDOA 2B5IB 1PW3A 4BZYA 3RPKA 3K8LA 6CGTA 1LMKA 5JQ6L 5BRZE 3QCVL 2QQLL 5M95B 2F74B 3CX2A 5ESAA 2P7TB 1F97A 4G8FB 1L7TH 1P9MC 2ZOKA 5IJVA 3H9HA 4QRRD 4Z78B 3JBG7 3W5MA 1FYTA 3WIIH 2MJWA 4OM1H 3T1FA 4Q58C 3I75A 1IRAY 1QBBA 2YPLE 2BVQB 1JV5B 1EAJA 5I74B 1OOAA 1UCTA 4H0GA 4L4JA 1D5BA 1BQHG 2Y6SC 1A0QL 4XNZB 5JIPA 4LLUA 5K9OB 2CR6A 4Y16A 2NYYC 5CD5C 1YQVL 2HVJB 1MFEL 4BKLA 2FJFB 4J6RL 5HI3D 1NFDB 3EYFB 4JZJB 1R5WB 2DMCA 1CIDA 2MKWA 1FCCA 3MV01 4HXAH 4PLJD 4ODTL 5HYSA 5D1ZC 3FOLB 2A2QT 1UCBH 1YNTB 4NFCA 4KTEL 1RZKC 4XH2B 5CBAB 3MUJA 5DZNA 3P9LB 1QYGH 4BK5A 5EU3B 2F74A 5HYJD 5GZNC 2P7TA 3CFCL 4G8FA 4H0IA 4Z78A 2XYCA 4OT1L 1HKFA 2NY5L 3H8NA 3STZB 4Y5YB 3RVWC 4CVWA 2BVQA 1JV5A 4HF5L 1O7VA 2LAAA 5TE7L 5DLMH 2VLRE 2ZUUA 2R0LH 2AABH 4M7KH 2NR6D 3O9WC 3H42H 2LFGA 5K9OA 2E3VA 3D25B 3UO1L 1ZHNB 2DQTL 2HVJA 2FJFA 4KRNA 3SE9L 2FIRT 3NCJH 1NFDA 1I8LA 2Z35B 3EYFA 4IIQB 4JZJA 1R5WA 3V4UL 1ND0B 3RUGF 3BN9D 5ACMA 1V8HA 4O5LH 4WUKH 3SDDD 2DIBA 3PXJA 5IOPB 3HI5L 2HWZL 2P5ED 3FOLA 4MXVF 1YNTA 2R69L 3T0ED 1AR1D 1B4JL 3WJJA 1F2XK 4XH2A 2F5BL 5CBAA 3P9LA 1TTGA 3TVMC 5DVMA 3DGCR 1FFOB 1S7QB 5EU3A 5I15L 1XGYH 1Q38A 4KUZL 4XI5C 5C0IB 4Z8FL 4PLKC 1A1NB 2AJVL 2UY6A 1C08B 3STZA 4Y5YA 2VSCA 1CDBA 3BMWA 4NHUB 4A2LA 1FJ1B 3S3PA 4QHKJ 1RUQH 4ERSH 4YBLB 1TMCB 4Z0XB 3QUZB 3N1GC 4XP5H 1NCBL 1HXMB 3LKOA 4UNUA 2GSGB 4ZUSB 3D25A 1ZHNA 4J8RB 4MWFB 3QPXL 1AGBB 1KPRB 1KCLA 3OR7B 3T65B 5KVFL 2FGWL 1KTDB 4LSQH 2Z35A 4IIQA 3WFBL 1ND0A 5F7WC 1JMXA 1E6JH 2VXVL 4MB4A 5IOPA 4QEGA 3VXME 1E28B 1BIIB 4W4OC 1H5BC 1DDHB 5K9JL 3ARDD 4MJ5B 1NCUA 3R4DA 4HIJB 4NCDA 3NFNB 2DLHA 3B8YA 1EHXA 1A14L 1NGYB 1FFOA 1S7QA 2ESVD 4F8TA 4KRPC 4YHKH 3H3KA 1QR4A 4NN6C 1L6ZA 3L1OL 3TBWB 1EERB 1H9VA 3MV7E 3QNYB 4IOIB 5DMJB 5C0IA 5DS8B 4NQVB 1OVZA 1A1NA 1C08A 4Q9RL 4NHUA 1FJ1A 1R5IB 2NY6D 1MREL 1RZJH 1J8HD 4XP1H 5DJDB 4Z0XA 3QUZA 4LSTL 5AD0B 1HXMA 5JHDD 2GSGA 3TJHC 4ZUSA 1F90L 5D1QC 4J8RA 4MWFA 1IAOB 3QI9B 1AGBA 1KPRA 3BAEL 2VC2H 3OR7A 1V05A 4FS0A 1DBMH 1KTDA 3ALWA 1FNHA 1N59B 3FZUD 4IM8A 4LHQB 4Y8DC 3ARFC 3TYFB 2Y06H 3EDJA 4MNQD 4YXKL 4MAUL 4YBQC 1TVBB 1E28A 1BIIA 4RISL 2ZUSA 1INDL 3G5YB 5IHUL 1DDHA 4Q2ZB 4CVZB 4POUB 1I9JH 4MJ5A 5EIVA 3U46B 5F6IB 3EJYD 3O4LB 4FQQB 3MRMB 5JUEL 2Z4QB 2J8UB 2AK4D 3GRWL 4HIJA 4ALAL 3G6DH 2ILLA 3ETBF 4ZTPH 3LN5B 5J12B 4DGVL 3K0WA 1RJLB 5C9KA 4ZO7A 2YK1H 3TBWA 3RGHA 3QNYA 4IOIA 5DS8A 3QHZH 3B9KB 4K7PY 4NQVA 4ODHL 5D2NB 2AK1H 4F33B 1FCGA 2JCCE 1Q9OA 4ONFL 1F8TL 4N9GB 4KROB 3DGGB 1R5IA 4XCFL 3R1GH 1MRCL 5DJDA 3S3SA 5AD0A 4Y4KC 3I3BA 1FGNL 4L9LC 5IQ7H 1IAOA 3QI9A 2HVKB 3A67H 4FQJL 4Q74A 5DO2D 3BMVA 4XC3H 1N59A 2ITCB 3DX9B 3TYFA 4JR9L 3ET9F 3VG9C 3WV0A 1A9EB 4HCRL 1OARL 1TVBA 2C3XA 3G5YA 4Q2ZA 5F9AC 4CVZA 3P77B 5F6HJ 3SJVB 3U46A 3O4LA 4FQQA 3MRMA 2Z4QA 2J8UA 5KAQF 5L2KE 5IGXH 4YJZL 2OR9L 5FA3B 1CGWA 3LN5A 4XPTL 1NMBH 1RJLA 1UM4L 2E9IA 2F53B 5AYUH 1O7SA 3STLB 2AJXL 5SV3A 4FQXB 4N1CA 3B9KA 5D2NA 3RTQB 4F33A 2OXGA 1A6PA 4N9GA 1FDLL 1X5XA 3DGGA 5KSBB 4DWHA 2PO6C 1JPSH 1AFVL 2GI7A 3O6LL 4DKEH 2HVKA 4GG8B 3B2VL 2NY2B 1CGXA 4ZXBD 2ITCA 3V95A 3DX9A 3B5GA 4Y5VC 2FLRT 2OXHA 5CJXC 5FUOL 5IMMB 3DI2B 3MOQA 1A9EA 4QRPE 2HKHH 3CK0L 3TO4B 3NBNA 4XMLH 2PCPB 3EAKA 3RL2B 3P77A 5E8OB 3SJVA 2MPAH 3IDYC 1RD6A 4K8RD 1TFHA 4Z7VE 3P4NB 3BPCB 2E5EA 5FA3A 4BQ6A 3OBAA 2F53A 3C6LB 3STLA 3GK8H 4FQXA 3X17A 3KPMB 3RTQA 3IXTB 4KHTH 2DKSA 1GPOL 1LE5B 1IT9L 4PJ5E 1YJDH 5F21B 2IWGA 4GRWE 3OG4B 4WUUE 4NQXB 5HD8C 3SKOB 5KSBA 1NDMB 3V79C 5EN2B 3NA4A 4P46B 2ZG3A 1C5DA 3MLXH 1CFTB 2FLBT 2Z31B 3SDCC 2XV6B 1D3CA 4GG8A 4RMRA 4PRID 4XVSL 2DYPD 3ULVE 4JVWA 1ACZA 1AD0B 4ETQB 4OIIH 5IMMA 2DQHL 3IU4H 1DN2A 5HVGB 3TO4A 2J4WL 4YDKH 2GY5A 3O2WH 2B1AL 2PCPA 4L3EB 5E8OA 1VDGA 3P4NA 4EI5B 5D7SH 2HTKC 2IPUK 3BPCA 4UTAL 1NC4B 4LRNH 2ZCKL 1T66D 5B4MD 3WO4B 1AIFB 2I9TB 3C6LA 4JDTH 4HG4J 3EKCA 5HHOB 1TNMA 3KPMA 3EYQD 3IXTA 1W72H 4JEGB 1LE5A 2YN3A 3UROR 4U1GB 3ULVL 2DQDL 1BFOB 4NQXA 4RGNE 1JIBA 2EYSB 3SKOA 1QRND 3ARED 3PWLB 3U0WH 1JHTB 1LO3L 3A0OA 3BQUB 1NDMA 4R9HA 5EN2A 4XVJL 5KBNC 4GT7A 2EH8L 1YUHB 3DOSA 4P46A 4DTGL 4DN4L 1CFTA 3QDHA 2Z31A 5EUKB 1EO7A 2DS4A 4C59B 1F58H 3Q6FB 1PJ9A 1OAZH 1NAKL 2VISB 4LSDA 3PDGA 5JW4M 3BKMH 1AD0A 2ORBH 4IMLB 3TH4T 4ETQA 3JWDH 4WFHD 5LJYH 5ILTL 2XIDA 1DVFD 3MV9B 2IPUG 4XNUH 4N0YH 2B20A 2J88L 4L3EA 3HUJB 2X89D 3QIWC 1CFBA 2PYEB 4EI5A 1CGYA 3ZSSA 5E4EC 1NC4A 3MLZH 1D9KC 1CL7L 3V0WL 4UNTA 4OZHE 5FO8B 4R0LC 1AIFA 2NY0B 2I9TA 2O26U 1BVKB 5F8QC 5HHOA 2IMNA 4LVHB 5DGQA 4F7EB 5J57B 1HWHB 1MJUH 4Q0XL 5LGHL 1BJ1J 4GS7C 3WD5H 1LP9F 3OAUL 2P8LA 1DUYB 3P0VL 4NUJB 1BFOA 2JKXA 5F7EL 5JZ7D 2EYSA 3JWOC 4M8QB 4C56E 3EJJX 3PWLA 1G7QB 5EBWB 1DQDH 1JHTA 3BQUA 4XCCH 4CMHB 3UJJH 1YUHA 3HFMH 4JPVL 2BY2A 4GG6B 1X7QB 1A4JB 1L7TL 1F6FB 3EOBB 5EDXA 5EUKA 3VD5A 4A6YB 4JREC 3BD3A 3WIIL 5HYIA 4OM1L 3Q6FA 4JQVA 2VISA 2V5MA 4HD9A 4IMLA 2F54E 3MV9A 4KVNH 4QTHB 1PBYA 2HP4A 1JGUH 1DUZB 3F58H 3HUJA 3SE3C 5J06A 2IF7A 4N0UB 4NNXB 3N1QC 2FBJH 2PYEA 2YSSB 1HZHH 4KTDL 2IALB 2OSLB 5JLZB 5C0CE 1F3RB 5FO8A 2B2XH 4NZUH 4PJDB 4Q6YA 1BVKA 1UH4A 1T3FB 4HXAL 2P46B 4F7EA 4Y4FD 3BKYH 1UCBL 1OCWH 1FZKB 1DUYA 4NUJA 4I13B 5HDBE 4M8QA 3QEGH 1G7QA 4KQ4H 4TSAH 5EBWA 1QYGL 4U0RC 4P49A 5CKGA 1EV2E 4GG6A 1X7QA 1A4JA 1U8JB 2XNAB 3EOBA 3V0AC 4A6YA 2CDGA 4WO4B 1E6OH 2YRPA 1CDUA 5DLML 4QTHA 2R0LL 2AABL 1DUZA 3ARYA 5I1EH 4N0UA 3QIBC 4NNXA 1ZLWK 3MRHB 2OX5A 2YSSA 3C60D 3SDYH 1WSST 2IALA 3NCJL 2FRGP 2OSLA 5JLZA 2Q20A 4O5LL 4PJDA 2K7PA 1T3FA 1NL0H 1JYWA 4NQDE 3CSPA 3G6JB 3QDGB 4PJGE 1AP2B 4NC0B 5DJ6B 1XIWC 1FZKA 3HE6C 4YNYB 3RWCB 4WCYL 4P23B 5ITFB 2XY1A 3FN9A 4Y88A 4Z7WF 1YEJL 3UCRA 1YEKH 1EHAA 1U8JA 2XNAA 4AG4H 5FM5O 4WO4A 5FYKH 4APQB 4X4XB 1QTYT 1WT5A 4ZPVB 2BVYA 3TNNB 4TQEH 5I66B 4CN6A 1F4AA 4XP5L 5GSVB 4MAYB 2VE6A 4I77H 1S9VB 2HLAB 3CDCA 4PJEE 3SDXF 3KXFE 5AG8A 1KCUH 3MRHA 3BIKB 4RX4A 3O6ML 3O3DB 2AQ2A 1RULH 1CFVH 3JTTB 2Y6SD 4LSQL 5E5RB 2NYYD 4CU7A 4C4KO 2XKSA 2BERA 4X6DF 4F7PB 1R0AH 1Q9LB 1Z9SA 3DVNB 1E6JL 1N0XH 2DQEH 4TSBH 2AEQL 3G6JA 3QDGA 1H8SA 1AP2A 4QRRB 5DHVH 4OAWB 5DJ6A 5GRJH 3QG6B 4YNYA 2DKMA 3RWCA 1NCDH 2G5RA 1T7VA 4BQBA 4P23A 3CH1B 2X4QB 2DKUA 5ITFA 4YHKL 2F9BT 5EZOH 1NUDA 5LVEA 1IGJB 5KOVC 4NBXB 2PN5A 3WXVH 4MMZC 4APQA 1JI2A 4X4XA 5GZND 4Y2OA 1MIEH 4ZPVA 5DUPH 4YHLH 3TNNA 1G9EA 3OZ9H 3V7MA 5K33A 1RZJL 1N6VA 4XP1L 5I66A 1XMWA 1K8DB 2XPGB 3HG1D 5DZOA 5GSVA 1ZGLP 4MAYA 3RVWD 2HLAA 3LS5H 1F4HA 3EOTH 1AQDB 4FFZL 4N90D 5C92A 2NXZC 5IHBA 4G3YL 5BW7C 3BIKA 4UT6H 3O3DA 3IRPX 2VC2L 3JTTA 3O9WD 4LFHG 4CMMB 1DBML 2A38A 4BELD 2ZSVB 4F7PA 3U1SH 1Q9LA 5D2LB 1ZKAA 1UM6H 3DVNA 3QFDB 1MCFA 4QRRA 1AY1H 1FC2D 4F15B 2X40A 3QG6A 1RHHB 1I9JL 5SWZD 3EYUH 1KJVA 3C2AH 1RIVH 1ZLVH 3G6DL 3CH1A 2X4QA 2V9RA 3L95B 4ZTPL 5F9JB 2X4PB 3OMZA 4YHYC 4I1NB 1IGJA 3OKDB 5GRXG 1FE8H 3TVMD 5EFIB 1HNGA 3QHZL 2ZCLL 4EKXA 5D7KD 3V6OA 3HZMB 1GC1C 2PR4L 4XI5D 1RZIB 3IFNL 3R1GL 3DTXB 4PLKD 1K8DA 3VWJC 2XPGA 3RX5A 3SDDB 4OGZA 1ORSB 3BIBX 2J6EA 4RA0C 2P5EB 1AQDA 1EA9C 3IS1X 3QCUH 4X6EB 3WKMH 4QXGH 3E2HB 5ENWB 3DETC 2WWKT 3L3DB 4CMMA 4XC3L 4WEMB 1BQHB 1J1OH 4DZBB 1KCSL 2ZSVA 4JKPH 5D2LA 1N7MH 3QFDA 3IDGB 1AQKH 4IOSD 1FNGB 3Q0HA 4OZIB 4PJHF 4POZC 5C08D 3VH8G 1RHHA 1NH6A 3FRPG 3FFCB 1J86A 3QSKB 4O9HH 3L95A 5F9JA 2X4PA 3MGTB 1MNUL 1YEEH 4PJCF 3V2AR 5M94B 5ITBH 1NMCB 5AYUL 4X99B 4BZ2L 4LVNC 3OKDA 4NJAH 2JIXB 1PG7X 5EFIA 3H3PH 3GSXB 4RBPK 3TEUA 1JF6A 3HZMA 2VN4A 5C7XH 1RZIA 1CGVA 3Q48A 1G7LB 4TN9A 1NANH 4BQCA 3DTXA 1HHKB 2EDLA 5D7IB 3SDDA 1ORSA 5BOPA 4FZEL 3ZE2E 1IKFH 5A16B 2X4OB 4X6EA 4LGRB 2CKBL 1J0HA 4DKEL 4PRPD 4S1DC 5ENWA 5IT2H 5IROC 3L3DA 1BQHA 3TJHD 2H2SD 3WNMA 4IS6B 5D1QD 4DZBA 4Y4HC 1UWXK 2EEAA 1GZQB 5ABDE 1UEMA 3WFCH 2YUWA 2HKHL 3IDGA 1FNGA 4OZIA 5EU4B 2IEPA 3ARFD 3LMJH 4BFGA 1DQJB 1JUFB 3BPNB 3S37H 2MPAL 3FFCA 4P9HC 4YBQD 4FABL 4M03A 2GJ6D 4UQ3B 4ZUWA 2XA8H 2IQAB 3MGTA 3PHSA 4X99A 3MLWH 2JIXA 3MLRL 4LQFH 3GK8L 3GSXA 2EE6A 3JUYA 1FP5A 1H3UA 3SGKC 1R6VA 1YJDL 5HYFA 5LBSH 4OF8A 1G7LA 2ARWA 1HHKA 4OLUH 5I18H 4MNQB 5D7IA 1YPZE 4ZSOB 4WI6A 5HGBB 5A16A 1YMME 4EI6B 2X4OA 3MLXL 4B50A 3DURB 1YNKH 3KG5A 1J0IA 4Y4KD 1HSAB 2APXA 4RGMC 2AK4B 2QV2A 4IS6A 4C54A 1GZQA 4OIIL 4NOBA 3IU4L 2FD6H 5DMIH 5EU4A 4YDKL 1DQJA 1JUFA 4XMPH 3L5JA 4K94H 3KYOB 4IMKA 5D7SL 4NWUH 4UQ3A 4LRNL 2IQAA 3FHQA 1VADB 4JDTL 4ISVB 3ZT6A 2VAJA 4JFDB 1RPQA 3T4YB 4F80A 1OSPH 1BFSA 1CDHA 3RKDC 2AI0H 3GMNB 3O6KH 4MNQA 2DQUL 3M1BB 4ZSOA 4KAQH 5HGBA 1SMOA 2EH7H 4EI6A 5J56B 2A9MH 3DURA 4KKAC 1CCZA 2PO6D 1LE9B 3T2QA 1HSAA 1IGTB 1F58L 2AK4A 1OAZL 1Z0MA 2CPCA 3BKML 5C0GB 3NPZB 2IFFL 2JJSC 4V1DD 1X5HA 2FX8L 4LQ1A 5LWYH 1BVZA 2APWA 3KJ4C 4LSRL 3KYOA 2DI7A 1WBXB 3MLZL 3QDJE 2P4AB 4J2XA 1VADA 2P8PB 3EYVB 4ISVA 2YWZA 1CLCA 1B3JA 2EDOA 1UA6H 1NKRA 1MJUL 4JFDA 5KSAC 3WD5L 2M26A 3TZVC 4ZXBB 1NEZG 2OZ4L 2H41A 4CGTA 1DQDL 3GMNA 1Z9LA 1YY9D 1U42A 3UJJL 3B4NA 3M1BA 3HFML 1WGOA 4WI7A 5HD8D 1G9NH 4OCYH 1LE9A 3CPLB 1IGTA 1CTNA 3QYCA 3FJTA 1HNFA 4A2MA 2R4RH 3SDCD 5C0GA 4KMLB 2VDKH 2HTLC 4KVNL 4JRXD 3LV3B 4WW2C 2I60L 1JGUL 5MEPB 4JQXA 1IEHA 4TNVK 1S8DB 3JWNC 4XPGH 1HZHL 4RIRB 1WBXA 5C0FB 1B2WL 2VLME 2E9BA 2EXYC 1UZ6E 2VQUA 3RWEB 2B2XL 4NZUL 2P8PA 3EYVA 4U0QB 5CP7B 2HTKD 5TQ0L 4ZTOH 3BKYL 5DJYB 4JFEE 1OCWL 4PRIB 3RA7H 2DYPB 4ZXBA 2YUZA 4K3DL 4R26H 5JORB 3VRIB 4RCAA 1EH9A 4KQ4L 4TSAL 1OF2B 2JELL 1U8PB 1OGAE 4G9FE 1VFBB 3U7YH 1XR8B 1E6OL 3CPLA 3CX5J 1FH5H 1CDJA 2Z8SA 4PJIB 4X9HA 1NCAH 3LV3A 4NZDA 4M48L 3WJLA 2GK2A 5MEPA 1WTLA 3QFJD 4H26B 1SVCP 5I1EL 2EIDA 1S8DA 2P5WE 3O2DA 1FO0B 1MJJB 5FYKE 1P5VA 3SDYL 3IGAB 5DQ9B 5C0FA 3TPUB 5J1AB 3U48A 4ZAKC 1AO7B 3AREB 3QIWD 3RWEA 1K4DB 4Q6IB 3L6FB 5CP7A 1NL0L 5DJYA 2VXUH 1MCWM 1CE6B 5LGKA 1HK6A 4YQXH 3F62A 2FX9H 4PRIA 4F3FB 2X05A 2DYPA 2W0PA 4WV1B 2Q1EA 5JORA 3VRIA 1OF2A 3UTTB 2XTJC 1U8PA 3DXAE 1K85A 2BOBB 1CWVA 4UIKH 4AG4L 1VFBA 3UTPD 5FYKL 1KLUB 3RIAF 3NCCB 1F45A 4Y5XB 3VMNA 4FQHB 4PJ8D 2EDJA 4TQEL 5A2LH 3H9SD 4LMQI 5KG9B 1U8KB 4PJIA 4PJAB 3LSOB 2R2HB 5B8CB 3VXQB 3ARBB 4H26A 5ETUB 1TVHB 3WS6C 1JNJA 1FO0A 1MJJA 1J0KA 3VXRD 1RULL 1CFVL 3IGAA 5DQ9A 5J1AA 3ROOB 3TPUA 2B4CH 1AO7A 4X7FC 3EZ8A 3AREA 1K4DA 2W91A 4Q6IA 3L6FA 1R0AL 1SYSB 3ZDXF 5DHXB 2DQEL 3UJIH 3NACL 1LGVA 1OD9A 4I0KA 5HSFA 1OP5K 3EGSB 5ADOH 1CE6A 5GRJL 1KTLB 4F3FA 3QWQB 2GQHA 1NCDL 4WV1A 3PV6B 4X4MA 3WCYA 3ZKNC 4H88H 5KVGH 3UTTA 2VOTA 1FRGH 1GGCH 4YK4C 5L88H 2BOBA 1Y18A 2VLKE 3WXVL 4GUPB 5A2IH 1KLUA 2X89A 5SWSD 4GQPH 2MFNA 4M43H 1CR9L 4M9OA 4Y5XA 4FQHA 1S9KC 1MIEL 2YD1A 4ORGB 5E6YA 2ZPKH 3OZ9L 3PV7A 2OQJB 2NTFB 5KG9A 1JGEB 1U8KA 1H3PL 4PJAA 1MCBA 4JANB 3LSOA 5D6CB 2R2HA 2IADB 5B8CA 1T80A 3VXQA 3ARBA 2XA3A 5ETUA 5E6IC 3EOTL 2H3NB 1HIML 1TVHA 3QRGH 4LK4A 4NZJA 4NOFA 4UT6L 2PW2B 4W68A 3ROOA 4RMUA 1UJ3B 3ZKSD 4X6FB 3QIBD 3GBNH 1A64A 1SYSA 1D5ZB 3S6CA 4JB9H 1JZ8A 5J11C 3EGSA 1XCQB 2BNRE 1BIHA 5A3ID 1AY1L 1KTLA 1GRWA 5GQBA 3TLRA 1WAAE 3EYUL 3D39B 3PV6A 5CSZB 4OV6F 1YZZA 2D2OA 1RAMA 3FOMB 1RIHH 4Q9BA 3WFZA 1FE8L 5ISZB 5J1SC 3D87B 4GUPA 4NN5C 4UUJB 2YD5A 3OKKB 4ORGA 3C60B 1KCVH 1VEOA 2OQJA 4BM7A 2NTFA 1JGEA 4K07A 4XHJC 4KK9C 2VAAB 4JANA 4PJXE 4PB9L 5D6CA 2IADA 4Z7OF 5CJQH 5AWNH 2H3NA 3QCUL 3UDWC 3GSNB 3WKML 2DQCH 4QXGL 4HWEH 3RBGA 5B22A 2PW2A 3DI3B 5HYQA 2DTSA 1WV7T 4DAGH 1UJ3A 2E7LA 4X6FA 1J1OL 5JIKA 3VXUD 4JKPL 5IBLC 3GBMH 4F37F 5GS0H 1D5ZA 2OL3L 1AQKL 1M1SA 4ONHB 1XCQA 1UYWH 1MRDH 4ZS6C 3D39A 2H9GB 4H8WH 1I3RB 5CSZA 1BMGA 3BZ4B 3JZ7A 3FOMA 1X4XA 1YEEL 3AB0C 5K59F 5ITBL 1FYTE 3S9DB 5BV7B 4NJAL 4JZNB 3IJHB 5ISZA 4LIQH 3TN0D 4UUJA 4W6WB 3OKKA 4DVRL 3C60A 5TE6H 1RUKL 5C7XL 3QIUC 1UWEL 3REWB 3VI4F 2VAAA 1K4CA 3DO3A 4KPHH 2YRZA 1IKFL 3D48R 3QUYD 4BH7B 2AQ3A 2R4SH 3GSNA 3ALXA 1QSFD 4HKZB 3MNWB 5LAXB 4M93C 3X13B 3KLHC 4HS6B 1MCNA 3MBXH 4OTXH 4I0PB 2VABB 2JJTC 3L3JB 3SDAD 4ODVH 3GSOB 3WFCL 5I1KH 2ICEB 2Y7QB 4ONHA 3LMJL 4QWWC 1S5HB 1DEEB 5JOPE 2O5ZH 5IVXB 2H9GA 2EDRA 3S37L 1I3RA 2DDQH 3BZ4A 3EYOB 3VE0B 5T3ZH 2XA8L 3KYAA 4NPYB 3HG1B 4GAYB 4MA1C 5F9OL 5I8CB 4ZOCA 3MLWL 4JZNA 3IJHA 2BFVH 4LQFL 4MA8L 3KLSA 2PW1B 2VXSH 1CD8A 4BSVB 2LV4A 5B21A 3OPZH 4HPYH 4KZDH 3VA6A 5LBSL 2OR7A 5BCAA 4QT5B 1ODAA 2NY5C 5C09D 3REWA 1WQVT 3PL6D 4OLUL 1F02I 5MI0C 3L5WA 5GGVH 3VXPB 5FFLA 5EO1B 4BH7A 4RQQB 1NFDE 5LG1A 1IC1A 3VWJD 1YNKL 1M05B 4HKZA 2R1WB 1P1ZB 5SWZB 3MNWA 5LAXA 3X13A 4HS6A 4JKMA 4ODSH 4I0PA 2VABA