1KJ2B

Murine alloreactive scfv tcr-peptide-mhc class i molecule complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
117
structure length
117
Chain Sequence
VTLLEQNPRWRLVPRGQAVNLRCILKNSQYPWMSWYQQDLQKQLQWLFTLRSPGDKEVKSLPGADYLATRVTDTELRLQVANMSQGRTLYCTCSAAPDWGASAETLYFGSGTRLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A T cell receptor CDR3beta loop undergoes conformational changes of unprecedented magnitude upon binding to a peptide/MHC class I complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Allogeneic H-2Kb MHC Class I Molecule
total genus 20
structure length 117
sequence length 117
chains with identical sequence E
ec nomenclature
pdb deposition date 2001-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kj2B00
5TE7L 1Q9LA 1I7ZB 2ENSA 1Y0LA 5L6YL 4I4WA 2HTKD 5J1TC 4FFYL 4YHLH 2R15A 5EZIL 4PJIA 1A7OL 1OAXH 5JIIA 1OP5K 1QYGH 3MRPB 2OBGA 2GYSA 4KK5D 5FYJE 4F3FA 3FO0L 5TF1L 1NDGB 3QEHB 4XP6H 4MQ7A 4RBPH 4YWGL 5CEYB 1EA9C 3O9WD 3NZHL 3M8OL 4XXDB 1R3JA 1X6LA 4R7DA 2Q87A 1U8QB 2VDQH 5CUSL 4I0PC 4FFYH 1YY8B 3H3BC 3KDMB 2OTWA 3H6JA 1CTOA 1KPVB 1NGXB 1NCCL 4JVUA 2C3XA 4K71B 3MRIA 3QEQA 2HFEB 3MO1B 5FM8A 1CDYA 3NCYP 5C0NC 2F58L 3TEUA 4N5ED 3BZFB 4F7CA 3VFGL 4WFHE 4M61B 3PQYB 1ZSDA 4J6RL 4QHKI 5F8QC 4M8QB 2I9TB 4LSPL 1KXVC 4OLUL 2CKBL 1ULVA 5HHMD 1OGAE 5C1MB 5GGSY 3STZB 1KN2H 5E8PA 3UTSD 4OCWL 4YHYC 2XA8L 4M9PA 5TE4L 1IGYA 3S8WA 4LHUG 5HDLA 4XP5L 3JWOL 1H3PH 5I19H 2R1XA 2RFXA 2ADGA 2W92A 3QHZH 1QBLH 3LIZH 5BO1H 2OLDA 5TFSH 2Y06H 2JJSC 1RURH 1M7IA 1J10A 5DQDH 3V4UL 1CQKA 5F6IC 3FT3A 3U0TA 4N0YH 1DSFH 4DGVL 4OZGE 1G6RA 1LD9B 3CXDL 4KJPC 4EI6A 1T0NA 3CSYB 4F33B 1LDPL 3ULVL 3V52L 1FSKB 4FQ2L 3FCTA 5KW9H 2F8OA 2ESVE 3SE9H 4J1UA 4XP4L 3QUYD 1IT9H 3CU7A 5IBLC 4K7PY 3SKMB 1HILB 3ESUF 3L9RB 2YPKA 2CRZA 1M7DA 2DBLH 2PW1B 3QUZC 3S35X 3GGWB 4RGNE 2P5EA 3B9KD 2ZG2A 2NY4D 2IBZY 1M05A 1HILA 3O6MH 3WO4B 4J2XA 3GBNH 1V7ML 3MV9A 2R39A 1N2RB 1BQSA 1MCPH 2NY3D 3ZLQC 3RIAF 4D3CL 1OW0C 1LWRA 2BNRA 1FDLH 1CFQB 5DD6B 3DGGA 3VE0A 4OF7A 1CG9B 2JE8A 4FQHA 4PR5B 1RZGB 5KS9B 3PJSA 3G5XB 4KJWD 4GMSH 4PJ9A 2D9QB 3RVXC 4QTHA 3C08L 5TH2A 1G9MC 2FEDD 2VKWA 3O3AB 5HPMB 3QEUA 3DROA 4BQ6A 5AAWA 2YC1B 3BDYL 5JNYB 2HT2D 4FHBD 4MNQE 4KRLB 5SV3A 1GXEA 1CZ8L 3GSOA 4UIKH 2DIBA 2ED9A 3RA7H 1ED3B 1H3GA 1T5WB 5MP6H 4G8IB 3P9LA 1ZGLB 4UI2A 3O2DH 4PJ9D 5ETUB 1T7WA 5DUPL 3SY0B 3UPCA 4NQVB 1T2QL 3ARXA 2XZCL 1YMMD 1PD6A 2NY2D 1JZ8A 5ILTL 1RULL 3BD3A 1A7PH 3TN0C 4F57L 3C5ZD 3LKQA 1CICD 5F7EH 1MCOH 1HI6A 2BSSB 4LCCC 5DC4B 2A1WL 1ZE3C 4ZYKA 4L8SB 4Q97A 1IAIL 4ONFL 4HC1H 4HAGA 4PLJC 1DQTA 4XVUC 2ZOKB 4ZPVB 3LMJL 4D3CH 1FZMA 1QLFA 1U95A 3D39B 1FVDB 1HXMB 2XG5A 4XP9L 4ZFOL 4PS4H 2X7LB 3H3PL 3MJ7A 3FT3B 3O8XC 5J12C 1QR4A 1U2CA 2D7TL 2X89A 3TJHC 3ILPB 4MAYA 2J7LA 5AEAA 4WVRA 4JAMA 4WFHD 2A77H 4GRLD 2CLVB 1FL5A 2OXHA 3IDXH 3G5YB 1OT1A 3D39A 5CZVH 4Y1AE 3WFDL 4HUWB 4TSAL 4P4KC 3S9DB 1HSAA 4JM2B 1FZKA 5KVGH 4U31A 3ZE1F 4PRBB 5FECB 1U92B 5JO5B 1QRNA 3W2DH 1T66D 3B2VH 5HDBF 1YEFH 1SMOA 1W72B 3BW9A 1T03L 2BVPA 3LS4H 5HYSG 4OUOA 1T1ZA 5C0RH 4XBEL 3DIFB 4KUCF 3H2WA 1P84K 4APQC 1F2QA 4GO6B 2D0HA 3DHMA 4GBXA 4ZNCD 4RBPK 4OLEA 3QHZL 2WP3T 3CVIL 4JN1L 3G6JA 3QXUA 1GZQA 2H3NB 1NAKL 4U4BA 1BFVH 2GUOB 3DXAB 2NY7L 4HBCH 2AEIT 3MNVB 2A6KA 3WJLA 2UZIL 4QHKJ 4OCWH 5IWLC 4DK6A 3L95A 3EYQC 4P3CL 2VO5A 4NRZB 3NPSB 4PREB 4OZFH 4OLZH 3WIHL 4UILL 1RIVH 4FXKA 4P2RB 3H9HA 3TA3D 3IF1B 1FL6B 4O2EA 1BOYA 4OLXL 2Q76B 5FO7A 3D0LA 4IMLB 2VL5A 1BWWA 4PJ5D 5J06A 1QUNA 4F2MA 3MBXH 2YR3A 2GK2A 5IVXA 4UIMB 3P0GB 4HPYH 5EWIH 1N5YH 4M6AA 2B0SH 5KTEL 2OQJA 3FT2B 4R7NB 5D2NC 1ZT7B 2VDQL 2VXVH 2G75B 3IRZA 2R23B 4M7LL 4V1DE 4FABH 3AY4A 3M8OH 1KC5L 5HYSA 4UIMA 4PJCE 5JUEL 3PDOA 3KGRA 4K7PX 3VXRE 4AL8H 4IS6A 3QULB 2YC1A 3FFDA 1D5ZA 4J4PA 5JW5B 5DJDB 2EDJA 4EN3C 3MV7D 3OXSB 4H25B 2F54B 5K9OB 2FR4A 5CBAB 3NIFF 3RWEA 2XV6B 5EUOE 1I1CA 4TUKL 5ITBH 2CK2A 3R06A 4LSTL 3K8MA 3VG9B 3U9UB 2P24B 4MCZB 4D8PB 4MZ3A 1A6VH 1U3HD 4GRMB 4JFZH 1I8MA 4P59L 2IC2A 3QDMD 3LZFH 2HVKA 4J3VA 2QBWA 4ZAKC 1HSAB 3PGDA 1IM3A 3P4OB 2K7PA 4LLUA 3BVNA 4QGTA 5FCUH 2QJDA 3TWCL 1GRWA 3DSFH 2AK4E 1MCCA 3FFCD 3D9AL 3O4LD 4HCRL 1T21B 4LKXB 3SDXF 1DFBL 2PR4H 4I9WE 5EA0L 3JWDC 4FFZL 4OKDA 4MZ2A 4E0RB 2PXYD 4F58L 3BQUC 5SWZE 2W59A 2P8MB 3ILPA 1OTUC 2NZIA 2WUCL 5E6IC 1FFOB 3VG0L 5HTSA 3A67H 1F8TH 3E6HB 3WHE1 5I1JH 5I73C 2SEBA 5ACMA 1R5IA 3EYUH 4M6ML 5FYJL 4GXVH 4DN4L 4BFIB 4HUWA 3QUYA 4OIIL 4OFPA 4BQ9A 2VDLL 1I8KA 2X09A 3GUTB 5DR5H 3IDJA 1P2CA 3GKZA 2XRAL 4OI9A 4ZFOA 1XGUB 1CFSB 2HRPH 1R3KA 2V2XB 4M7JL 1PKQE 2PTVA 3LS4L 1IC4L 3UJJH 3CXHK 3MRRA 1UA6L 2R1WB 3AU1A 5LCVL 5T1DH 4WUUD 3MZGB 1B0GB 3HI5H 3KLHC 5GIRA 4NT6B 2P5WD 2ZG1A 4JM2D 5I1LA 3QQNA 2AEQH 4NP4H 4KRPB 3JBG7 2A77L 3D0VB 3L9RA 3BSZH 5L7XH 3B8YA 1T89A 3BAEL 4YIQA 5BMFH 1G7JB 4WW2F 3L5WA 5ALBL 3ZYZA 1KPRB 1BAFH 4JQVC 4NRZA 3LAFA 4EBQH 1GC1L 1I8LA 4JPWL 5DJ6B 4YIQB 3WL9B 2DN7A 2FX8H 1OLZA 3P11H 1PVHA 1MCIA 4OCLC 5FDYA 2R2EA 3KPRB 5F89A 3NACH 2NCMA 5DVOA 1BLNB 3OKYA 2HT3C 4F2MB 2GFBA 4X4ZA 5E00B 3CD4A 1RU9L 1N59A 3ARGD 4U0QB 1FVCA 4G5ZL 5FA3A 1JNHA 4TPRH 5I76A 4L4TA 4QTHB 2HJLB 4Z8FH 3O2DL 1PGRB 4G3YL 2JCCA 2EYTA 4ZPTB 1EGJH 1FNHA 1ZHLB 3OAZH 4K3GA 5BRZE 1CZ8H 4ZUUB 2ZSWA 4K8RC 4PTUA 3TVMD 3HC4H 3LPFA 4U6YB 2E9IA 4HEME 3LHPH 3TLRA 1ZS8A 5F6HI 3NH7H 3SDXA 5GS1A 2AQ1A 4UBDD 1UFUA 4PJ5E 4LCWA 4LDEB 5FUOL 5IQ9B 3C08H 5GS3A 4I13B 4NJAL 5C6TL 4HFWA 1AGEA 3BH9B 5HY9A 3C60A 3QIBA 1T0MA 4MNGA 5FUCC 5DI8B 2XKNB 3PWNA 4F15C 3E0GA 4DJMA 4MAYC 2EDFA 2E9JA 1A0QH 1RVFL 3MOBL 1QPPA 2P46B 3PL6B 4HIIA 5IMKA 1VKXA 3DX8B 3TBWA 5J6HB 1W2KT 4NCC1 1KUMA 4DGYL 3SGJC 4Q6IB 4PJEA 5BV7B 5D5MA 3U7WL 2E7LC 1MY7A 5E9DA 1NFIA 1FZMB 1AR1D 3QIBD 2R56L 1QFOA 2XI9A 2YXMA 5JXAL 1X7QB 4P46C 5IK3B 4LQ1A 2IGFL 1UCTA 2IBZX 4EIZC 4F80A 3L3IA 5EU7E 1WFTA 4Y19B 4ZQKB 1VFBA 5EBWB 3S97C 3QQ9C 4QRUA 2BVEA 5JLZB 2NTFA 1D5BA 4BSVA 2EYSA 3EO0B 3P0YL 3JWDH 2WWMD 5EBGA 4DKEH 4CAGA 1HKFA 4HLZG 2AKRB 5C71A 2HKHL 4ZODA 4PTTA 2NNAB 4OV5B 3EJYD 1SBBA 4QRPE 1IBGL 3OF6D 3TJEH 1DL7H 3HC0B 1Q9KA 3LSOA 3MLYL 4Y16A 4DFHA 4TNVF 3MRGB 1L7TL 4MDJB 3T4AA 4JZOB 1XFPA 1A6PA 4H1LA 3F7VA 1HYSD 4LSVL 3D18A 3VH8G 5ISZA 3FB8B 1XIWB 3WKMH 3A0OA 1VB9A 2OXGA 4WU7A 1FFPB 3C5SA 4JLRA 4PRIE 2FJGA 1JPGA 3E8UL 3EDDA 3S35L 1BQHG 1EHNA 2CKBH 1CD0A 5I16A 4OLUH 4WGWB 1G7MB 5B3JF 1NCTA 4R4ND 3PWPA 4YHOL 1TVBA 4N8CH 3RI5F 3D1MC 1KPRA 2PO6D 3CDGB 3MRDB 5F7DA 3OGCA 1ZEAH 5DJ2B 1PZ5A 4R8WH 4XHJC 4K9EL 1MRCH 1Q1JL 5FGBC 3VXOA 3MACH 2YUXA 1W8OA 2AVGA 2BNUB 3GBLA 4NO3B 3BN3B 5C0DA 4I18B 1D3CA 3T2NH 3VRIA 3FN0H 1QACA 4EQ2A 3OGCB 3O3BA 5E6YA 1SM3L 1WBXA 3V6FB 1WWWX 4NFDA 3QXAB 1G0YR 1YY8A 2R23A 4X7FC 4XC1H 1PAMA 3L3HB 2DD8H 2VLLB 1WAAA 2DS4A 5D8JH 5J9PB 3JV5A 3DURA 4HXAL 2FB4H 1BJMA 3EYFB 4I48A 3BPOC 4Z7QF 2CUHA 4K71C 1HE7A 4GT7A 2R0KL 1FE8H 1FN4B 4QRPB 2F53D 1AGDA 3R06B 3OJDB 3DURB 3OB8A 1I85C 2I5YH 4JFOA 4R4FL 3BUTA 4WWKD 3I75A 1D5XB 5GGRB 4OGAD 3QCTH 4OT1L 3U83A 3AS0A 5FYJU 3X13B 4HJ0D 1ES0B 5D1ZC 3U30B 2AJZA 3MNWA 2AI0H 5DRNB 2E5EA 1G0XA 2E9BA 4M48L 1U6AH 4JPKH 4ZO8A 1FRGL 1T2JA 4NC0B 3TT3L 5I1EL 2XFXB 3HAEA 4TUOB 4P23A 4M3KB 1A47A 3PNWA 5E9DB 2M2DA 4WDIB 5DEFA 4PG2A 2OZ4H 3BIAX 4QRRE 5CEZH 2HA1A 3OTTA 1QFUH 4P2QA 4LCIL 2VE6A 4I8DA 2GJ6D 5E8PB 3ILQD 4G8EB 1MWAB 1CD1A 3JV6B 4ZO9A 5DK0A 5F1IB 5KN5A 4LDLB 1A21A 1B90A 1YJDH 2EXWC 5IEKA 4NQCD 5IM7B 4LASL 5DFTA 4RFEB 1HK6A 2NNAA 4WUKH 4OV5A 3SKUD 2RFXB 1NMBH 1NGQL 1A7QH 3KPLA 3VXTB 5ADOH 5GZOC 2A9MH 2LVEA 4GBXC 5BV7L 1OQOA 5IEHA 4MJIB 4WO4B 4PJBF 4PJHF 5EUKA 4JFDD 5EO1B 5JOFA 1A6TB 5JDSA 4ZNEE 1KLGA 4UB0H 4YC2B 4PJGE 1AXSB 3R1GH 3TF7C 2M1KA 1C08B 2Y5TB 4A6YB 1A3RL 1CFTB 2BNRB 5HDQH 4KKLD 4OCXH 4QHMB 1J0YA 1BX2A 1PLGL 1CICA 1G7JA 2LABA 4OJFH 5GGTH 3G5ZB 3C2AL 2ZPKH 5I8OH 4GRWB 2VL4A 1NCAL 4C4KT 1RSFA 1SJEA 1OTSC 1LO3H 1X4YA 5MERA 2BHZA 4AEIH 1TVBB 3D25B 3UTTD 5C0FA 2V7HA 1A3QA 3IFLL 5E7FA 5H37G 1NH6A 3AVEA 4PY7A 4Z7VF 3MYJA 1PY4A 1QKZH 5L2JA 2B7DT 5LQBH 3DECA 5I8OL 4KROD 4XNXH 5ESAB 4UV4H 4P5TC 5I1DA 3VXNA 1U3HB 4S1SL 5EUOA 5J1SC 3BEWA 4LIQH 1AKJA 4ZXBA 4KI5D 1I4FB 2OSLA 3S3SA 4PJDA 3TA3A 4DN3H 4XZUA 2CK0H 3CX5J 4W6YB 4Y5VB 1OGAA 5CILL 5C0IA 3OXRA 4Z18A 5CBAA 5IESL 2GITB 2YPLB 1KIPB 4FQCH 4BJLA 2BJML 4PRPA 3PNWB 1U91A 5I74B 1WT5C 3MV11 3RWIA 4M8VA 5ADOL 2PW2B 4ODWB 1RMFL 1S7XB 5GSVB 3X12B 1PG7H 2O5YH 3LD8B 4DKFH 1YY9C 1QSEA 1N64H 1WITA 5ETUA 1FVEB 1Q9WA 4MXQD 1LMKA 1NUNB 1NCDL 3IDYB 4XWGH 2AJXH 1ZANL 3ARED 3BD5A 5KJRH 1NANH 1CDUA 1T21A 3QRGL 4YEEA 3MRKB 3OV6A 4BZ2H 4H8WL 3I6KB 4RFEA 4TNWF 4ZS6C 5E94B 1BQUA 1QO3B 1RJYB 1CGUA 4PJXB 3V4PL 5AUMB 4ZSOB 2Q86A 2R0WL 5EO1A 3MA7A 5JOFB 3KS0H 2X7LA 4JVWA 4L3ED 5KANG 4AYFA 2BY0A 2IMMA 5BOZG 2K3TA 2QADD 4HBQA 5BV7C 4MAUH 3SDYL 2PW1A 5E0QA 3IDMA 3DX9A 2JJSA 1C12A 2BNRD 4O2FB 4L8SC 1ZGLM 4YZFF 2XZAH 3V6OC 4PYGA 1H3VA 1AD0B 3LS5H 1RPQA 1RZJL 2GJ6E 5BS0E 2E7CA 1G9MH 5IUSA 4PREA 1VACB 3RWDB 3SDCD 1FL6A 4X83A 1OWWA 5JDSB 4LFHG 5T33L 3QI9D 5L8JB 2DD8L 1RZGA 5SWSD 5KS9A 1GGCH 3MOAL 5K59F 2CPCA 4YDIH 4YHKL 5CP7A 2DLTA 4QOKD 4Y5YB 4PBXA 1GAFL 4B50A 2DQHL 1J18A 4PGJA 3TPUA 4MA3A 3I6LE 2NXZD 2H45A 2Y6SD 2X4RA 1MELA 3RGVD 3VWKB 1DQLH 3ZDZF 1E4XH 3OB0H 4LSSH 4UOW1 1FPTH 4NQVA 2J6EA 1J05B 4PD4K 2J6EH 4YHKH 1JHKH 5DJDA 3WS6A 4RDQG 1IL1B 1EBAA 4M93B 3QUML 3QIUD 3BZEB 1OSZB 3QDHA 3CFCH 2OP4L 1RK1A 5DD1L 3EAKA 3MOAH 4PJIB 3VXPA 2VLRA 5HYIA 4A6YL 3RZCB 3LB6D 4PJGB 4TQEH 1J0IA 2FL5A 5B39A 4JHAH 4XZUB 1U93A 4TVPD 3P9MA 3UBXG 2G75A 4MXVE 4BH7A 3OR6B 3JV4B 5TQ2L 3TPKA 1HXMA 2IANA 3QIBB 4WI2A 4PJAB 1OSZA 4WFED 4CW1A 2NQCA 4HJJH 4XC3L 5D7IF 3P4OA 2Z0BA 3C8KA 2X4TA 4MB3A 1TVHA 1TZGL 5BOPA 5E94A 4ZAKB 5KSBA 2D7NA 2R2BA 3U79A 1JIBA 1U91B 4RX4A 2IAMD 4JDTL 3B2UD 3TJEL 4Q6IA 5MEPA 4LFHD 5HHOD 1TNNA 1U8LA 4N8PA 3TBSB 5HGDB 3CDCA 1C5DA 3TVMB 2BVQA 2DLEA 2V5YA 1NBYA 4NWUH 4UOW0 3HI6L 3MRNB 4R97C 3JWDL 5C2BL 1YA5A 2OJEA 2IG2L 2XN9A 3K46A 5D96C 4MXWH 4QEGA 2R0WH 5HHNB 2YEZA 3WFEH 3UO1H 2K1MA 3F65A 5I6XB 1EVTC 5E6IB 4DCQB 2CGRL 1P1ZA 1SY6L 4K3EH 3ULUH 3DMMA 3MNZA 4ZFZA 3SKJL 2P1YA 3IJYB 4XH2A 5FOJA 5I0DA 4XI5C 1YEEH 4YBLB 3O6FD 4H8WH 4X6DB 3VFVA 2YWZA 5KZCB 5DHYB 3SBWA 3UTQA 5JZ7D 4IRZL 2R56H 4X7CC 1S7QA 2CJUH 2JJUA 3QO0B 4PLOB 5D1QA 3RWDA 3U30C 4HZLA 1RJLA 1R3IH 1ZANH 6FABH 1EJ6A 3DJ9A 1EEYB 3K81A 4JJ5B 5IBUB 3L7EB 5KSUA 3T2QA 3S3PA 5GPRA 3NVQA 1RQ5A 1RVFH 1TCRA 1F90L 1YEKH 4ZFGH 4GRWE 4V1DD 1CQYA 2EE9A 3O6FA 4HWBL 4NQSA 1O7VA 3QSKB 3WEXA 1CFNA 5B38G 5HJ3A 3ARBB 3P40A 4FQ1H 3NZ8B 1P5VA 3OMZA 3RWHB 4ZUTB 3G9AB 1T0NB 1RUQL 1CS6A 3CSYA 2CIKA 4ZXBD 1D5MB 2X4UB 3CSPA 1T7VA 4MQSB 1DZBA 3ZKNC 3QJHA 3D87B 2UY6A 32C2A 3AU1B 1T1WA 1QQDB 4RGNC 5EC1B 5JHDB 4YJZL 2MHAA 2O26U 5D7LE 1M7DB 1MEXL 3UTTA 3MROA 1EH9A 1IGIH 4G3YH 2P5EB 3O9WA 4XBPB 4HGMA 4BFEA 4FG6D 4WGVB 1LNUB 4U1IA 3RIFF 1K3ZA 3QDME 1BX2B 1BLNA 5IFAH 2BNRE 4S1DD 2XA3A 5LQBL 4G5ZH 2O61A 3RKDC 3QCUL 4PB0H 5L2KD 4Q9RL 1AD9B 5DJ2A 2OM5A 1RY7B 1IM9D 3MV9B 4RAUB 5DJAB 1NFDF 4N1EA 4QF1A 1HXYB 2F9BT 4HH9B 1KSRA 4FTVD 4AEIL 5F6HJ 3F7QA 4NHCL 5K9QI 2C3WA 4NO2B 3B3IB 4EVNB 1DEDA 1KG0B 3SDDC 4BH8A 1DBJL 4HMEA 3GRWA 1U3JA 2OL3H 3VWKA 1UENA 1MIEL 4X9IA 4NGHL 4DGIL 4LVHC 5EPMA 2F5BL 5F93C 4L8DB 1JI1A 4NBYB 1LE9A 2AAVA 4L3AA 2BOCA 3DARA 3CFEA 4Z7WF 1YNKH 4LF3B 4ODTH 5ESAA 3UJTL 3DETD 3EO9L 3Q1SH 5HDBE 2R2EB 1LO4L 4XTRC 4EUPG 1D9KC 4HKXA 5FHBL 2H8PB 5E4IA 4X7DC 5J6GA 2NY0C 4XCYB 4QRRA 1G9EA 2VAAA 1JVKA 3V4VL 1EERB 3MBEB 4KVNL 4ZO7A 3T3PF 3PGCB 1CT8B 4P2QE 1EFXD 4XPHL 3MMEA 1B6DA 1A6UH 2PYEB 4NPYB 4U1MB 1GJIA 3WN5C 4Y16C 5A16A 3RP1A 4O58H 1M7XA 3RTQD 1T2XA 4G6JL 3QUMA 1JPSH 4P5TB 3IJYA 2O93L 3O45A 3WDIA 3GJFH 4POYA 5F1NB 2XRAH 3RPKA 3VXMD 3KPMB 3IU3B 4ELKA 3HE6D 4HZLB 2FX9L 3CLEL 1K4DA 4R7DB 1J8HD 5KSUB 4HKBA 1OAKL 3MRNA 1FGNH 4BZYA 4ZUVA 3WFCL 4QRPD 3KDMA 4FQLH 5D2NE 3MLTA 3IU3A 3MJ7B 3TH2T 1RUAL 3ULUL 1TIUA 4BSWB 4MJID 3S3JA 5ICYB 5EO0A 3PIQA 1G6VK 2CLVA 1I7RB 2VR4A 2WV3A 1HHKA 3EO1A 3W39A 5I75C 1B4JH 1K5NB 3CFIC 1Z5LA 1H0DB 1UYWH 4AG4H 4I3SH 4E42A 4R4FH 1SJVA 1AIFB 3SOBH 1P7QB 5GRZA 3MV9E 3O6FB 3LN4B 4EN3A 2HTKC 4Z7VA 2OR9L 4CN4A 5CFHA 4MNHA 3N1GC 3BPNC 3QDMB 4EDWL 5GGUB 4KK5C 2P5EE 4JHAL 1E27A 2X6MA 1N3NB 4NNPH 3O6KH 3S36X 4XMPL 1X5XA 3KHOA 1HOCB 5BRZD 5MEQB 5C08D 2CIIB 4QRTB 5HHQB 1T1WB 4OD1L 5DK2A 1SM3H 5A43C 1U42A 3L5HA 4Q0XH 3SEPA 3VXQB 5I76B 1OTTD 4WJ5B 1HHIB 3BXNA 2Q8AH 3RVTD 2J6EL 2ESVB 1UJ3A 4M6OH 4LSSL 3RUGE 5CGMA 5IF0B 2ZSWB 1RZ8A 1CFVH 4O2EB 1I8LC 3QXTA 3KYMA 2C7UA 1GOHA 3MGAA 4N5EC 2B5IC 2YPLD 3IGAA 3V8CA 3ARDC 2DKUA 4X4ME 4XWOC 5HBBA 3IRPX 4OGYL 3ULSA 3FQRA 1ZA3A 2VITA 3SDAD 4UILH 2DYPB 3MRLB 1QBMH 2FCBA 5EFIB 3GSOB 5CAYB 5F1NA 3E8UH 5DMJB 1FIEA 3WSQH 4I18A 4ODXA 3O6KL 4I0CC 4Z7NE 1FP5A 4LHUD 2B1HL 2QSQA 3GJFA 3D2UD 3RWFA 2OS7A 1E4KC 4NQCA 4Y4HB 1ONQB 2B8OT 4LSVH 5FYLH 3PJSB 3RU8H 5F1KC 1CT8A 1UZ8A 4XPFL 4Q2ZB 4WW2B 1NGWB 2D7QA 4WWID 5F8RC 3OJMB 3LRGA 3ULUE 2OYPA 1T1YB 4C57C 2HP4A 1DL7L 1UQSA 1BHGA 4M93C 4ZPVA 2BX5A 1SY6A 4K3DH 4XMKL 4KJPD 4WW1A 3O45B 3RPIA 1B4JL 3QNZA 4Q2ZA 1DUYA 5KVGL 2VZOA 4EXPX 4PJ8C 1YQVL 2QV2A 3QA3B 4YDKL 3I02A 2XWTB 3I75B 5FF6A 3IDXL 4ZTOL 3UPRA 4WUUB 4I2XB 5HHVH 3OHXB 4KK6D 3UDWC 3X12A 2XG4A 2XPGB 1E6JL 4LPWA 4XX1E 4PS4L 2P7TA 1GPOL 3MV8E 1KT2B 3CLEH 1DBKL 3TYGH 1J0ZA 1MJ7L 4L3CB 1VESA 2VDPH 5IR1A 5IV2B 1URLA 3LMJH 3OHXA 1N7MH 3RL2A 5IHZB 4JRXE 1KLGB 2Y25A 1EIBA 4JFFD 4Q7DA 4JHZA 1BBDL 3QIWC 1XF2A 4OGZA 2R2CA 1UXWB 5F7EL 2D31A 2V2XA 4M7LT 3D85B 3AREA 2BSTB 2DLFL 1RULH 4YXHL 3RWGB 2VABA 3TZVB 5KVMC 1N8ZA 3V5HB 1MHCA 2L7JA 1II4E 1U9KA 3O41A 1NC2D 1CICB 4GAYA 1GGIL 1QBAA 3NH7L 1FC2D 4JDVB 1FZKB 1KXQE 1NAMA 5KANI 2NPLX 4RMTA 3TBTB 3VGBA 3V4VH 4EDXB 1IGFH 2CDFA 3LRHA 3AAZB 4L3EA 3MLUL 3OPZL 4UIKL 5C0AE 4FQXB 1IGTB 5DVMA 3ET9F 5JPNB 1TZHB 1CL7I 4FFWC 5MERB 1QNZL 1TVDA 4PJ9C 3DIFA 5F9JA 2XTJE 3BH8A 4P2CG 1LP9E 5F9AC 1J86A 3MGOA 4NGHH 3UTZB 1EHLL 1MUJA 3QXAA 1YZZA 1DBJH 4TTDD 4G42B 4HPOL 3VWJB 4XB7A 2DI7A 2D03L 1G9NC 1K8DB 5EU3A 2EDHA 5HYQB 4POUB 1UM5L 5IB5B 1JL8A 1P84J 1J8HA 4LARH 1A7NL 1MUJB 2YMXL 1SJEB 2AK1H 3EDJA 1V7MH 4G8IA 3P0VH 1FL3B 3EDFA 1UB5B 3U4EB 3W81A 4FXKB 4P2RA 4B7IA 2YOCA 4GXUN 2BSRA 5CGTA 4YHIA 2IJ0C 5ID1B 1IGIL 3O8XD 1UB6A 3QPXH 4JM4H 4CU6A 3SDCB 1CI5A 1MEXH 4MDIA 5HHOB 5B39G 5JW5A 3LKSA 4QOKA 1C5BL 1FLRL 4P5KB 4IMLA 4UNVA 1CWVA 3NFPB 2OK0L 2UWEB 4WI3A 5I1GL 3UYPA 3WIFB 4Z7OF 1J1XL 2CSPA 4P4KD 3IKCA 1HINH 1ND0B 3CX2A 2VLJA 3JTTB 3ZHDA 3LD8C 1VGEH 4D8PA 4PJDB 3TA3B 3KLAB 5MEOB 5MEPB 5D5MF 1HWGB 3BWUC 2RHEA 3QIUB 2J4WL 1YEKL 4ZFGL 4WUKL 3ZYOA 4HWUA 5DJZA 2GSGA 2DJ4A 1UQSB 3EYOB 2R1YA 5HHPB 2Y72A 2Y06L 2VN4A 1JZ7A 3SE8L 3I6LD 3VI4E 4BH7B 5MHSD 3BESR 4I5BA 5D2LF 2QKIA 5C0CD 1QFUL 3BRFA 1I3RB 1KELH 5CEZL 5ABDE 3I2CL 1OARH 1FYHB 4OBRA 1SY6H 3VJ6A 5IMLA 1GZPA 3H7BB 1A4KA 2CRMA 2IAMA 3W0WE 4MD0A 3D9AH 5CS7A 5I9QB 4HUUA 1F4WL 2I9LB 2V2TA 5KSAB 5GRXG 5HI5D 2W9DL 2FBJL 4BK4A 5TGBA 3BDBA 1E4WL 1J1OH 4X7TA 5FB8B 3TBTA 4KAQL 3RWCB 2BZDA 2DQDL 2OJEB 3DYPA 3CFBA 1A4KB 5GGQL 4OV6F 3T0EA 1PZUB 3CGTA 2NTSP 1JZ3A 2I60H 3RL2B 4P2RE 2YPVH 4QHLA 4X0KB 5I71C 2VLRD 3H9SD 5BXFB 4Z95L 2A6KB 4FOMA 5HXMA 2AP2A 1RHHB 5CUSH 4CU7A 1DANU 2HT4C 1JHLH 4H8WC 1WF5A 4Z0XB 3RHWF 3O41B 5E9DD 4DWHA 4P57B 1HKLL 4XP6L 1MHEB 5DEZA 2BNQD 5IGXH 5ACLA 4P2OC 1DQQB 1MH5A 2A0LC 3KWWB 3QAZC 2ADFL 4FZEH 4M7LH 4LCWD 4LSRH 4FXGB 4ESKA 5KVDL 3CC5A 1OPGL 3P4MB 4ZOCA 4P57A 2CIKB 1A1MB 2QTEA 2YUVA 5DSCB 5H35B 1DQLL 1Q1JH 3FO2A 5DXWA 3OX8A 5F7DB 5ID0A 4ZAKD 3CC5B 3NOIA 2AV1A 4W81A 2GAZA 2DWDB 4KAQH 3FO1A 4M02A 4ZG1A 3RZCC 1ADQA 2VH5L 4FNLH 1UM4H 1CGTA 1MI5A 3F62A 2IQAB 3W0WA 3DTXB 4QF1B 1EHAA 5CSBA 3PHQA 1I3VA 2PXYC 3I2CH 4I77L 1XF3A 2EDRA 3PDDA 4MQ7B 4JZJA 4D9RE 1DN0B 5E9DE 1HHGB 1NBZA 4GLRH 1JFQL 1G9ML 5LBSL 4H0HB 2WAHA 2FGWH 2IQAA 1ZWIB 2IF7A 4IIQC 3X3FL 1IM9A 4FS0A 2X2YA 1I7UA 2NZ9C 2NY3B 1YNTA 3MLYH 1UKQA 1PEZA 1E28A 5I18L 2XZAL 4JFED 4LSUH 3MJ8B 1CLOH 2BXYA 3NN8A 4LBEA 1D5XA 2VZ1A 3BE1L 2HKHH 3BP6B 3BMWA 1YNLL 3FO9B 4JDZB 3C2SA 4MWFA 4Z0BH 2VZUA 4N5UA 3KLHD 2L7UA 5JA9A 1MNUL 4OCRL 5CZVL 4HIJA 1KCUH 4HEPG 5DMKA 4WFGD 4YBLC 1HQ4A 1VFBB 1IILE 4JO4L 3STZA 4GAJL 2VXUL 3MRMB 1NBYB 1JWMA 2IQ9L 1JV5A 4OFYA 4ENED 1DQJA 4PB9L 4NNXA 3TO4B 4GS7C 4CVUA 1ZXQA 4HIJB 5AAMA 3HB3C 1ZVSB 2IBGA 1LO0L 5KJRL 3FQWA 3NZ8A 1JF5A 2R4SH 2I9LA 4FQQB 5D7JC 2P5ED 3B9KA 4H5SA 3HNSH 2IALB 4J3TA 4QGYA 3LKNA 3QQ4A 1FIGL 3IDUA 1N6QH 2CRYA 1CXIA 1KBGL 1INQB 3SPVA 3ZKXC 1RZKH 1WVZA 3T3MF 2BJMH 3DX7B 3VGGA 4QRRD 4XNUH 5IW6B 2MOVA 1P9MA 4WO4A 4RGNB 2V5SA 4FQCL 3VXME 1LEGB 2C3GA 4EI5A 3UROR 3QFJD 1BIIA 5IESH 3LHPL 1GSMA 1NAMB 4Z0XA 2BVOB 4HGWA 5I8EA 1ZLVH 3WL9A 5KG9A 4R90L 4W4OA 4NQCE 4XNXL 3T4AB 3VFSA 4AH2B 5ALCH 2O5ZH 1IKNA 5DLMH 5JW4R 5I1KL 3UEZA 1I9IL 5E08H 5I8EB 1FAIL 1FNSL 5GGUA 1WZ1H 2VXSH 5C0EA 1J0HA 2Z8SA 3HLAA 3QZWB 2X4PA 3TNMA 1HIMH 3THMH 4HAFA 5FGBA 3TYFB 5C0BE 3AUVA 1MJ7H 5HI4D 2ADJB 3TIEA 3O6ML 2P49B 4U7MA 4YHNA 1ACYL 3NIDF 4XT1C 3MMEB 4GSDL 1CDHA 1OP3K 3VU2A 1TNMA 1ZHKB 2ZUQB 2IQ9H 3MNVA 5HY9B 4PRHB 1C5DB 2VXUH 1ONQA 4JCMA 4K7PH 3KYMB 4OZHA 5FUZL 1WSST 4YDKH 1ZTXL 4IDJL 5JOPD 2HFFB 4RX4D 1DLFH 3BMVA 2Q20A 4OM1L 3ULSB 2HFEA 3B9VA 3VD3A 3IYLW 3AS2A 5GGRA 1ZHNA 1AI1H 2UWEF 1YEJH 3D39D 3HHRB 3U36A 4HFUH 2AJYL 4M7JH 3CMGA 5AZ2L 5D2NA 4KJQD 4GUPA 3FT2A 2FZ3A 3QEQE 4R2GB 3HG1E 2UY7A 5HVHB 4LVHB 4FQQA 3OKOA 1HYSC 3RNKA 2IPKA 3QUMB 5B8CA 2AJUH 2WUCH 3TIDA 3JWOH 3H9YA 3BRDA 1KTKE 3PDOB 4CVXB 1KJ3L 1A7BA 2XPGA 1PYWA 2BOBB 2X70A 5TE4H 3WFHA 3QCVH 1DFBH 5I75B 3MRMA 4HX1A 1KN2L 1K4DB 2GKIA 5EZOH 4PJHA 1N0XH 4PJBA 3RVWC 3TIDB 4NM8L 4Y16B 3P73A 4C55A 5FCUL 5I1EH 5LG1A 3X11A 1CGSL 5CHNB 4MJ5A 3VFWA 4N0UB 3BP7A 3RY4A 5B8CC 5D7JA 1EO7A 2F53B 2AQ3A 3KPLB 3VXTA 2ZSVA 3MROB 2I27N 5MHSE 1CE1H 4O2FA 4M43H 1BFOA 4HIXL 4NWTL 4U1LB 4D0BB 5DJXA 1DBML 5ITBL 1ZGLP 4U0RB 1KCLA 4D2NA 3SPVB 4X4MA 4F7MA 3VWJD 1U58B 1WFNA 1IC5H 4HH9A 1S7RB 2OL3B 2ADFH 1G7MA 2FB4L 4HXAH 4DEPB 2ESVA 3E6FB 3HNVL 4KQ3H 4O4YH 3RUGA 3QJFB 5KVFL 1R5WA 5IEKB 3TYFA 2W0FA 1LO2L 3O9WC 2VWEC 1HH6B 4JFYA 3IVKB 1R24A 1JWSB 2YD4A 5FKPA 5JPMA 2CUIA 4Z5RB 4CRPA 3TZVD 4R0LC 4Q9CA 2HAZA 1QSFB 3HTLX 2B0SL 1K8DA 1RJZB 2ZUSA 1F02I 1KXTB 3UBXI 1S7TB 3TPUB 2CDFB 2VL5B 2EEDA 2PCPB 3P77B 4M7KH 2NY1B 4Y8AA 1D6EB 1H3UA 3FB7B 1H8OA 4QXTB 5IVXB 5I15L 3N1FC 3HC3L 4QRQB 2VRAA 5BQ7B 2EC9U 4S0TD 1NMCC 2RB8A 1A5FL 2RQ8A 4R3SB 4RISL 1TQCC 1FZOA 1LK2B 2Z9TA 1EFXA 1X5KA 3V7AE 2NLJA 1KJ3H 4U1GC 4IHOA 4LVNB 3OG4B 3SQOL 4IMKA 3KHQA 2DQUH 3C9NA 2BP3A 2Z35A 3DI2B 5DT1H 3VA6A 5KBNC 5LGJA 2AK4B 4KXZH 5FV1L 2WQRA 1N5AB 3KJ4C 3MLTB 3MV8A 1T7YA 5IBTL 1T80A 1S78D 1AHWB 3DV6B 3WFBH 4PJAF 4K8RL 2EICA 2PN5A 1BFSA 2AJYH 1I3GH 1KOAA 3BQUA 4TSBL 5FV2A 1MFAL 1WZKA 2Z4QB 3QO1B 5EIIA 1TFHA 2D2OA 2FATH 5GZOD 2OTPA 3B2VL 3QT2A 4MCYB 5T1LD 4I5BB 3WNNA 1FJ1B 1TTUA 1KPUB 1OT2A 1D9KA 1DLFL 4MSWA 1U8OB 2X4NB 3B43A 4UINH 4XB8A 3MSPA 3QUYC 2P48B 4ONGL 3E3QC 4X99B 5IBLD 3OQ3B 1ZLWK 1CU4L 1OLLA 2F53A 3P0YH 1S9XB 2BCKB 2X1PA 1Q72H 1AE6H 1XF5B 5DK0B 5F1IA 4YHML 1AJ7L 3QIUA 5FHBH 3EYSL 1JN6A 2IGFH 4MHHG 4Z78B 2GY5A 3FOLB 5SWQB 2WQ8A 2VQ1B 3N1PC 3K2UL 4KQ4H 5BS0D 3DVNB 3ZTNH 1S7QB 3QO0A 4UTAH 5AG8A 4L1HA 4DGYH 3C8DA 4WRLA 5ACZB 5DK3A 3S4SG 1YUHA 4HC1L 2BDNH 3U0WH 3MRQA 2CLRB 5DHVH 3GIZL 2D03H 1VA9A 3SCMB 2R0LH 1RI8A 3MRIB 3QEQB 3RFZC 1J88A 4OCSH 4KMTL 1VFOA 3QCUH 2XZCH 2H6PB 2VDRL 3TM6A 3FN9A 3NPSC 5DUPH 3HPLB 1UZ6E 2FEDC 4ZNEA 1RJZA 2DQIH 4PJ8A 2APVA 2JB6A 2VUOA 4U1KB 5TDOB 3ULVE 1X44A 2EDNA 4Y19A 1W72L 4NC2B 5CP3A 4G43B 3RBGA 2JIXA 3BJ91 5FIEA 2DM4A 3DXAE 3ETBF 4JRWA 2EE6A 2AXGA 2EIZA 2H26A 2DQGL 4J1UB 5CD5D 3MV01 1GGIH 3PGFH 3I84A 2EIBA 1QVOA 5EFIA 2WBWB 1I9RL 1K4CB 5J13C 3MBED 2WINA 3TN0D 4WNQA 2GSIA 2EDWA 3C5ZC 4NM4H 1KBGH 3JTSA 1DQDH 1QSFA 2EDEA 1HXYA 1YY9D 4X6CB 3NMEA 4JB9H 1OGTA 3D6GA 5FO9B 1NCWH 2ICWI 3HNSL 4YR6A 4PLJD 1Z9LA 5SX5K 1S5HB 4XVUD 4MXQC 4YFEA 3TO2A 3V0VA 6FABL 4UTAL 2QR0B 3NIGF 5D70H 1GPOH 3SHSA 4IRZH 1E6JH 4R9HA 1T22A 1QSFD 1S7VB 3QB7C 2F19H 4KI5F 2NY2B 4TOYL 1MVUB 5HD8D 5E8DL 5ERWA 4C56D 4GRLC 5FYLD 3QNZB 4NP4L 4PJ9B 2MPAL 4JQIH 4PJCA 3T0ED 3RAJH 3A6CL 4G7VL 5DJZB 3OKDB 2GK0A 3QHFH 2BNQE 5HDOA 5LWYL 2HFFA 2X1OA 1X5JA 4QOKB 4L8BB 4XMKH 3T2OA 5JTWA 4LCWE 3LPGA 3NABH 5DVNA 1OWRM 4LSUL 3OKLB 3FO9A 5IFJA 5DA0B 5DURD 3V4UH 3MREB 4DUWA 4JY5L 3QG6A 4JRYD 3SY0A 2V2WA 3H0TA 4WHYG 3N50A 1DLHA 4PGBA 3TV3H 4D0CB 5DMKB 2Y1VA 1EMTH 2DQUL 4NQEA 4QXGH 4F37F 3SDCC 2AEPL 5D5ME 3ARFC 2CO6B 4X9BA 3VRJA 1A8JH 4X6DA 5CEZD 5DQJA 3RWGA 3TZVA 3FT4B 4L29A 2I07A 5GHWH 3HR5B 1JUFA 3EYQD 4H26A 1LEIA 4IRSB 3QUMH 2OR7A 3DSFL 4X8XA 1D5BB 3TA3C 1HH9B 3DYOA 1XGUA 5HVHC 2HJFA 5I15H 4S11A 1Q38A 1A14L 3VD9A 4JFHD 5KS9E 3UTSA 5HSFA 1S9VA 2Y6SC 4S0SD 4HWEL 4JANB 1BGXH 4ODSH 2C26A 1PKOA 4LLMA 1CFVL 1NC2A 2IH3A 2E3VA 5F7WC 1NCCH 1HHHA 4M6OL 1QLRB 3RGVB 4TUKH 3UBXB 2H32B 2GSIB 3TO4D 1MREL 4WWKB 3RDTA 4HXBL 3ZHKA 1L6ZA 3MGTA 2R8SH 2EDLA 3FONA 4ZTPH 4X8JA 1JTOA 1KLFA 3BN9D 4IDLA 4S1QH 3TBYA 5TF1H 3WD5H 1MI5E 1VSCA 1WFOA 1EJOL 2QR0A 2RGSA 2W0FB 5MENE 4G43A 5JHLH 1FFNB 1UKTA 1D5IH 1X5FA 1GZQB 4KK9C 3SGKA 3VXQA 5KN5B 1DDHB 35C8L 3CSBA 2YPVL 3U0TB 1R3LB 5I30L 3RTQA 4BH8B 3PHSA 3PWPE 1QRNB 3NCYS 1INEH 3LCYA 4LU5L 4UDTA 2P43B 5DC9B 1FNGA 2HFTA 4XCEA 3FQXA 1U41A 3OL2A 4NYLB 1J1OL 3O9WB 3NIFE 4NM8H 4PIRF 1NL0H 1TITA 3EIFA 1TJGH 1CFTA 3MRLA 2UZIH 4R0LB 1LILA 2WUBL 3I50H 3VD7A 1YECH 3MCKA 3C6LD 4R2GD 3BQUD 4PBVC 4WCYH 4XI5D 4ERSL 1YDPB 3MV7B 1FGNL 3TFKD 3MPCA 4NO2A 3VFTA 3F7RA 3CVIH 3KS0J 4JN1H 5JQHC 3RWFB 3EOYG 2C4FU 5JW4M 4JDZA 4MWFB 4QT5A 3TIEB 3KPPA 4GOSA 1JJUA 3SDXE 2X4SB 5IB1B 1V3LA 4PG9A 1UH4A 3FHQA 4PP2B 2ICES 4HFUL 4UTBL 1T03H 3BP5B 1QSZA 3INUH 2JK5A 3CZJA 3BZFA 3W2DL 4HKJB 3AFLA 3HZYB 3O2WH 4QNPF 5K93A 4DTGH 2VZ3A 2E8YA 4R4BB 4ZXBC 4GG8B 2LAAA 4M8QA 2I9TA 1UWEH 1NCBH 1G7LA 1IRAY 2AXFA 5IOPA 1GIGH 3FQWB 2CXKA 5GXBB 1FLRH 5D7SH 2WWKT 1ED3A 1BZ9A 2VDOH 1O7SA 3LQZB 3PGDB 2IFFL 5EDXA 1PQZB 1KTDA 2ERJC 5FO8A 5D71L 4QNPE 3NFSH 2CD0A 1RHHA 1A9EA 2APFA 1RZFL 2FZ3B 3QFDB 2KQNA 4PRDA 3DUSA 3D2UA 4MX7A 5EBLB 2NX5E 3MYZA 1LO5B 1NMAL 2DWEB 3OR7A 4NC1E 2AJVL 3K1KC 4PRID 4NZTL 1IAIH 4ONFH 5DJXB 4P9HH 4L1DA 3NCMA 5A2FA 3BPOB 3N9GL 2C4XA 4WTZA 1MFBH 3MTRA 5I1KH 2ZWLT 1ZHBB 4RQQA 2RCSL 3P4MA 1L4IA 3UTTB 4E41E 3AREB 1EHLH 5IT2H 5HHOE 4HS8H 1WC7A 3T0AA 2VZSA 4R90H 1PLGH 5MP6L 4TRPL 4AH2A 5GZNC 2EDBA 1BVKA 4HT1H 2C9AA 5HDQL 3TN0A 7CGTA 1UVQA 1A3RH 2Y23A 5GGSA 4ODBD 2E27L 2NY0D 4WV1C 4IOIA 3AAZA 1T83A 1RZJC 1BQHA 5C0CB 2NYYC 1IAOA 4UBDC 5I1LB 4ACPA 4Y16D 4F9LC 4QCIB 3T0VA 4MLIA 2EECA 5C0GB 3VXOB 1WCBB 5D6CB 2ZZUT 1NGQH 1D6EA 5D1QD 3BIKA 4MB5A 1CGXA 1LP9B 3QWOA 3GBMH 4ZUWA 1KJ2H 4H1LG 3O3EA 4BFGA 3RTQB 1MRFL 5C0FB 5ISZE 4C83A 5BZDA 4BKLA 3HG1A 3RJQB 3TYGL 4ODHL 4UQ3A 2VDNH 1AR1C 1MCJA 1W0WA 3H8NA 1RUKL 3ZHLA 5JPMB 2EH8H 3HE7B 3E1F1 4PRPD 1GGYA 4GH7B 3HLAB 4XAKD 3LQMA 4UT6H 5HPMA 3FTGA 3OJ2C 4RFNC 3MZTA 4JQXA 2DRUA 4JO4H 1WZLA 5C08B 3PWVB 4CUCA 3HMXA 4MXWL 1MCWM 1ZK9A 3KPMA 1YQVH 2WWMC 1ZHKA 4GKSA 4X5LA 1U6AL 4JPKL 3BT2L 3DV6A 1QRKA 5IJKC 4KTDL 5CIPB 3RNKB 4ZS7H 2VISA 1ZLSH 4G9FA 3W11C 4FFVC 2P8LB 2ZNXA 5L2KE 1IAII 1J5OL 4ALAL 3BPCA 1CIDA 1KGCE 4J3WA 3TO4A 4LLYA 4XPFH 1FFRA 5E8NB 3B9EA 4IOFC 4FTVE 2DQTH 4GRLB 1TZIA 3GNMH 4PJDE 4LNRB 5T1KB 3BZ4B 3BEVB 4PJHB 4PJBB 3BIBX 1JI2A 4QY8A 2VLRB 1TMCB 4PJ7A 1UZ8B 5IIEB 1G7IA 1A6ZA 2VN7A 4I0KA 5D8JL 1ZVHA 3SCMD 3MV8B 3VRJB 4JM2F 2BSED 4NCDA 1QO3A 1RJYA 2R0ZL 5DD1H 3VMNA 2ICWA 4AK1A 4MA7H 3H7BA 5B8CB 2JCCF 2LV4A 4O51B 3FN0L 2IFGA 1M4KA 3QI9A 4XVSL 2VZTA 3G6AA 1JP5A 2HWZH 2PO6C 4J6RH 4HQQH 4PJXF 1WFUA 3MACL 4X80H 5CJ8A 4MMXC 1ZVYA 4MJIA 1UKSA 5CJ5A 1JZ6A 2YBRA 1HNFA 4YXLL 5C8JB 1N6VA 3AM8C 4XWOD 2MKLC 1SYSB 4NO0B 3V79C 3BP7B 2A38A 2VXQL 4LAQL 4OKVA 3UAJD 4MA7L 1K9TA 5E56A 1ITBB 3UYRH 2XTJB 4U1JA 3S35H 2JIXB 2GJ6A 3A6BH 1MF2L 3ARWA 5GJTH 1QA9A 3QH3A 3MGTB 5F9JB 1FORH 5C0AB 3T4YB 2NY6C 3QRFM 4EKXA 4S2SA 4KY1L 2LU3A 5E2VH 2CDGB 4ZOBA 4F7TB 2XZZA 1OP9A 2Y07L 4GW5A 4N9GA 3MUGB 1X5HA 1R5WB 3SOBL 4ALAH 5FO9A 4M1DL 4YNYA 1MHHA 5KSVA 4WWKC 1GH7A 2YSSA 2A83B 1Z3GL 4M6NH 4HJ0C 5D1ZD 1G1YA 2W65B 4NJ9L 3EFFB 4YK4C 1N6UA 1SBSL 4ORGB 5DGRA 1T04A 4OD2B 4PJ8D 2DWDA 3CK0L 4NQCB 4PJFF 4Y4HA 5DDHA 5DJ0B 5EU5A 5CWSA 2HVJA 2F53E 4P5KA 4LNVA 1JF6A 4XPGL 2RBLA 1YC8A 1TJIH 1RUAH 4KK6C 4OLYL 2JKXA 2GITA 2YPLA 4IM8A 5HYSB 4KMQA 4GRWF 1R6VA 1KELL 2J2ZA 3C6SA 3J7HA 3QQ3A 3PABA 1XR9B 3QULA 4GRLA 3PF2A 4WUUE 1JYWA 4OLWH 1VFUA 4P49A 4ETQB 5CJQH 4FQHB 4YPGB 1AQDA 4OCYH 3QXVA 1MLCA 3TESA 1RIHH 3C09B 3TCLB 2AXJA 3OKLA 3S34H 2EXWD 2X4TB 4L4VE 5CJOH 3QIWD 4DQOL 2GT9B 2DI9A 3LKPA 2NY1C 5E1AB 4XCFL 3U1SH 4G6JH 2BVYA 3OKNA 1NC4A 3UZVB 4MD5B 4NOBA 1KJVA 4OB5L 4MJ5B 1NBVH 5C6TH 3ARSA 3WXVH 2OTWB 4G6KH 2C3HA 4R26H 1J1XH 4QRSB 3CFDB 3O11A 1GGBH 1U8PA 3PG2A 1EEZA 4QRRB 5AUMA 1Z9SA 4HUMB 4JE4B 4XNYL 4NQDA 4GG6A 5DMGD 3EFDH 1S9WB 4DOHE 2ATPA 1BZ9B 4XVJH 2CLRA 5JQ6H 3MJ6A 4X7TB 5FB8A 4QTIL 4RA3A 3QEUB 1UWXK 2X9YA 3HMWL 5EZLA 1DQJB 1MIEH 4PRHE 1RU9H 2AK1L 4JHWH 1YMME 2OL3L 3L3OB 1ZLUK 4WFFD 4MVBD 4BFBD 4TTDC 1KN4H 1I9JL 3I3BA 3O3DA 4RSVA 1UM5H 2FWOA 3WMSA 3N9GH 1B2WL 1EZVY 1J11A 3OR7B 3S88H 4QHLB 4TNWK 5J6HA 1HHJA 2W0KA 4NKMB 1OP3H 1U8MA 1IEBB 1RK0B 3T3PE 1E0OB 4W6XB 4ZDHB 1QFWH 4KJYA 3KLDA 4PJFB 1BD2D 4JY6B 1NCNA 1BAFL 3MUGA 2RAMA 4QTIH 5GSRA 1TQBB 1S7TA 3T08A 2HJFB 3DYMA 2VDOL 3GHBH 2PYEE 3MUY1 1RK0A 3HS0B 5D7SL 4EI6B 2NTFB 3HCVB 3QHTC 1BF8A 3N06B 1G0DA 5HVWA 5GGTA 2VB5A 2YXFA 3SKMA 2F74B 1HSBA 5T1DL 4BQ8A 4YXHH 5BV7H 3LEXB 1ZAGA 5FA4A 1CXHA 4NZRL 4GW5B 3G6JB 2OX5A 1MWAA 3B5TA 3SDCA 5EZJB 3FONB 3U6RB 5B38A 4OIIH 3GMLA 4PLKC 4RDQF 3QXDB 2VDPL 1AO7E 3DWTA 2W0LA 4NUJB 1XF4A 2UWEA 4OFVA 1F8TL 4LL9A 3VG0H 1AHWA 3IU4L 3UTPD 2Q1EA 5LXGL 1AH1A 1TLKA 3VE0B 5CSGA 2MQ0A 4BYHA 4Z9KB 3LQAL 4LLVA 3F8UB 4JZJB 4XNZC 4JFEE 1TJIL 2WUBH 2J8UF 3D3VA 4X9HA 1MFEL 3UO1L 3PV6B 5I0ZA 2X4NA 4NN6C 4UUJB 5HI5C 3CFDA 5F7YC 1OCWL 1S7VA 4U1MA 2QADC 3O8XA 3V6BR 2HYMA 1AGBA 4LPVA 3ORJA 2YK1L 3BZDA 4G6MH 5LAXB 3QCTL 3FAWA 3BUYB 1JN6B 3HZYA 4V2CB 2F5AH 3IXTB 3ZO0A 5C0DB 5IVZB 3NTCL 4Z7UE 5E99L 4ZOAA 2ZCKH 1TZGH 3L3JA 4HUKB 4JKKA 3KNBA 4BZ1H 4AMKL 1BOGA 2R0KH 4L8BA 3MRPA 1ADQH 5LAXA 4KY1H 1G84A 3RWJB 3BEVA 1WV7T 5C9JB 5E7BA 4ZUVB 1DBAL 5F9DC 3QI9C 3STLA 3WKNA 1KC5H 43C9B 4X6EB 2Z8RA 1I4FA 2OSLB 2OP4H 4Z76B 3AS1A 3WFHB 2JK5B 1QBML 4JEGB 3S96B 4RRPG 2XIDA 3U46A 4X98B 5I1AA 1S9WA 5F97E 3WHE0 4KRMB 4U2ZA 4AIOA 4OF0A 5ESVB 1KENL 1U8KB 1FHGA 5LJYH 1TCRB 3LN5A 2R2HA 4HPYL 5EWIL 4B41A 3FJTA 1N5YL 3QWRA 4MD4B 3BO8B 1E4XL 3NCFB 4JFXB 2MCPH 3RGVC 1YPZA 4G80B 3LKRB 3X3GL 3DUHA 3RDTC 5BW7A 2AS5M 3F12A 5BRZA 2HWZL 2IEPA 3KAAA 1A14H 4DZBB 1QVOB 5IROC 1KTDB 4ODVL 2ITCB 4G8GD 1Q94B 3RZCD 5CKGA 2Z93A 4Z7VB 5E5UB 5I8CA 3F7YA 5FGRA 3UC0H 1ZT4A 5DRZA 2UVEA 1B0WA 3VFOB 4YPJA 4K7FB 4PJAE 2NY7H 1MJUL 3ZKMC 3QUZB 3FOMB 3QDGE 2DB8A 4HMDA 1YYLH 4NRYB 2B4CH 3QNXA 4JAMB 5D9SA 3MFGB 1MCEA 4LEXL 4LKXA 4OFDA 1FNFA 2YZ8A 4Y4HD 1WZMA 2X4PB 1J5OH 4IJ3C 5IW3A 3D3VB 4P48A 1N0LA 1JF1B 3KYNB 1VADB 3NABL 2FO1A 1IBGH 1YEFL 2QQQA 4GKOA 2ZUVA 2YK1H 3WJJA 5EOQL 3DBXB 3GSQA 3QEGL 1RIUH 1OCWH 3AC0A 3A6CH 4G7VH 5D7IE 4YXKL 5E2TL 2WM0A 5D7LA 3VFTB 1A22B 5J6GB 4WEBL 2FEEL 2FHBA 4JGUA 2EZ0D 3HUJE 1V8HA 4HK0B 1MRDL 1JNLL 3MRCB 4ODXB 3UYOD 3O6FC 1BPVA 3WFCH 4BZ2L 3RX7A 5JXAH 4D0CA 1YJDC 4HV8B 2EH8L 3UTZA 5T1KD 3KVQA 4YGAB 4DVBB 3VDAA 4GMTL 1UZ6F 5DEGB 4YK4B 5D7JD 4YPGA 3CH8A 3AGVA 1F4XH 5E2UH 1EV2E 4AEHL 1MCKA 3C5JA 3OKEB 5BS0B 2FL5B 5B39B 5IB5A 1R5VA 3IETA 1DQDL 1F5WA 1A0QL 1BJ1H 4HGKC 4ZFFA 4UZGA 3S6CA 2DTSA 4NBZB 5E8OB 4O58L 4XCCL 1I9RH 2CLZB 1KB5A 1CXEA 2Z92A 4QYOA 4ZAKA 5KSBB 3KXFE 4XPHH 5MEND 2XFXA 1Z9MA 3FQUA 3QDJA 5L8KB 3WDHA 2HVKB 4RGND 1P7HL 5JIHA 3KYOA 3CDFA 3EO9H 3Q1SL 2D7OA 1S7WB 3CLFL 3ULUD 3VFUA 4Q58C 2FX7L 4X6BA 2JJTA 4P4KB 3RKDD 5H2BB 3CFKA 3MLZH 3I6GA 4POZD 4PTUB 3BGMB 4ZD3H 2BRQA 1V7NL 3GIZH 1P7QA 4YX2H 4KRNA 1NKOA 1FFOA 3QFDA 3AXLA 4NKQB 3KPOA 2J8UB 5GGSB 5D1QB 1TENA 1MCPL 4ZQKA 5EBWA 4HX1B 1R3JB 3O4OB 3HMWH 3SJVD 1N3NA 4OJFL 5J1AA 3HAEH 4NZUL 2ARJQ 1T4KA 2DM7A 4XVJL 5JQ6L 3DETC 3PP3K 3DX6A 3HUJB 1AJ7H 2Q3ZA 2DMKA 2YPLE 1R3HA 2NY4B 2EDTA 4RGMB 5C0EB 4H0IA 4YDVA 1CU4H 3LV3A 4TSCL 5D7IB 3QNYA 3SQBA 1Q9KB 3LSOB 3SO3B 2P42B 1LVEA 3QNXB 5FUCE 5LCVH 1LDPH 3RTQC 4F7MB 3L3IB 1W72A 2ATKB 3O2WL 3FMGL 1R3HB 4YHNB 4HG4J 3BPLC 3NBNA 4HDIB 1JHTA 2R29L 3BKCL 3AB0B 4NN5C 3FCTB 3RUGB 2CQVA 3K3QA 3C8HA 5J3HC 5T3XE 2AJSL 5CJBA 5BO1L 1F58L 4RFNB 4L3EE 4R96B 5ENWB 3GIVB 4M1CD 1CF8L 5KS9F 3C6SB 1OAQL 4CVZA 3GJFB 4MDJA 4HKJA 3SGKC 4GJTB 5KSVB 3SGDH 5E8OA 3MX0A 1YEGH 1N4XL 1RJCA 3GM0A 5EC2A 5C6PB 3RVWD 4QYOB 5JXEC 4TYUA 5IJVA 1IGJB 4F33A 4G6AD 3QWRD 3CFEB 2X89D 1DR9A 4D0DA 3ISWA 4Y5XB 3WIIL 3VD5A 1EHXA 4ELMA 3LZFL 4Y2DA 5L0QC 4MJIE 3FFCE 4M1DH 2I26N 3QISA 4P2OA 2A6DB 4NQDE 4GG6E 4ETYA 2ZUXA 1JMXA 2UYLB 1TTFA 5DS8A 3S5LB 3ARPA 4HFWB 2Y07H 4PUBL 4MJ4A 1BM3L 3IFPA 3GMPA 4MA1B 3KNBB 2YD5A 1D5IL 4WFFE 3VWJC 4NN6B 3MODL 2GW5A 3ARGA 1KFAH 3X11B 1YYLL 4X6CF 3MJ9L 1OF2B 5KVFH 1RUPH 5SWQA 5GJTL 3P9MB 1C5CL 3STLB 2JIXD 3BYYA 1IC5L 2PO6B 3X14A 1OTTC 4H26B 1L0YA 3OKNB 3TZVC 4YHYB 2XY2A 5L6YH 1K6QH 4JREC 4J8RB 3JZ7A 3MRQB 5GS0H 3WS6C 5TGBB 4ZYKB 1KACB 5IQ9A 1CGWA 4HIXH 4NWTH 3IB4A 4LHUB 3QP3A 4OSUL 1S8DB 3DX9B 3MBXL 4X4XA 4ZDHA 4X80L 5D1XB 4FQPA 3SGJA 3ARDD 1S3KH 2VLKA 4KV5F 1CVRA 1GAFH 4NKDA 4YHOH 3QI9B 1I1FA 4LIQE 1MCRA 4S2SB 5CEZE 4A2MA 3HRZB 4P2QB 4EOWL 4LGRB 5F6IB 4TNVK 2VXTL 5IVXF 4PY8I 5IKCB 3F7YB 1P7KB 4N9GB 5A3IC 1G9NH 1Q9OA 2G5BB 1X4ZA 4NQXA 5KSBE 4X9FA 5J4MA 1ZLWH 1WIUA 5IMMA 1BQLH 2M8XA 1U36A 1K2DB 1BFVL 5GRYA 1DANT 2YD6A 1NBQA 3GIVA 5JLZA 2YD9A 1K85A 1BD2B 3C5SB 4ZUSA 4E5XA 5F9WC 1T04B 3EJZD 3VH8A 5BQ7A 2WBJD 2E6QA 3NTCH 4WIQA 5IB2A 2WLYA 1CN4A 1H5BC 5HJ3B 2YPKB 4Z7NF 4ZS7L 5AYQA 3ULVD 4YFDB 2A9NH 3KPSA 4MAUL 1KJMB 4R6UA 1V5JA 1DEEB 3AMLA 3QDJD 1RZIB 3QHFL 4PRIB 4Q6YA 4TSAH 5C70A 3JVGA 2H1PH 3H3KA 3RI5K 3EOBA 4WI8A 5EU6A 2X4QA 5SX4I 5D7LB 4KPHH 3FB6A 2A74B 1RK1B 5E8DH 4Z77A 5I71B 3QUKA 4Q9QL 4G6FD 4WY7L 1M1SA 3ROLA 5B3NA 4NIKB 2O61B 3T3ME 1EXUB 1HQRA 3QRGH 4PJFE 1GGUA 1U8NB 1AXSA 3U7WH 1A6ZB 5C09D 3S37X 1NEUA 1HHIA 3BXNB 1FNAA 1FQ9C 1HIML 3THML 4F15B 3QUKB 3ZDYF 1N26A 2Q6WA 5CEXA 3P4NB 1WBZA 3WUZA 5JMRA 5CBEA 1I85A 1U8NA 5DLML 5ILTH 2XWJB 5I9QC 2FJHB 2ATPB 3TBVB 4X6DE 4F9LA 4K55A 4OI8A 4CMHC 3IFPB 4PRHA 2Z31A 3RA7L 4F7CB 5HHNA 2JJTC 2Q76A 2YBRB 3CX5K 4WEMB 2HG5B 4HUUB 15C8L 1Q8MA 4FFWD 2XWJA 2PYEA 4NPYA 4S1SH 1R0AL 4Z8FL 3IDNA 3HFMH 1Q9WB 3O11B 3WFZA 4XNUL 3BEWB 1FGVL 4U1JB 2ZCHL 3UPRB 3CIQA 3PQYE 5CP3H 3BX7C 3WO3B 4OF5A 1NC2B 1F00I 4PJGF 4DZ8A 3ELAT 5FHAH 2GY7B 1K2DA 5B4MD 2YA2A 3ES6B 4F7PB 4L4VB 1PG7X 1T1YA 1EZVX 5DD5H 4PGDB 1H3WM 5CD3A 4WENB 2H9GA 4IIQB 4RCAA 2DQCH 2R9HD 1WEJL 2BY2A 3NA9L 2UUDK 5HHME 3VH8B 1CBVL 1RZFH 2K9UA 2IBBA 4K7FA 1YN6A 1XIWC 5K9QG 1DE4B 43CAA 5INDB 2YSSB 4HWBA 4XNYH 1P4BH 3BSZL 3D69B 4PJIE 3HUJA 4UT7L 2IWGA 5IKCA 4JY6A 3QUXB 4HS6B 1R5IB 1NGPL 3GMNB 3MXVH 4LPYA 1IM3B 3HI5L 5INDA 1MQKL 2D4DA 4DTGL 3HNTH 2VE6B 1QHPA 3HCVA 2FATL 1WCQA 4XPAH 1WCBA 5D6CA 1NAMH 3ZSSA 3FN3A 4KK8D 1YN7B 3WLWD 3U7YL 8FABA 1NQBA 1E6OL 1XZ0A 5ICXB 4I18C 3T1WA 5IB4A 1FG2A 4Z7UA 5F7MC 3QWQB 5CJQL 4JO1L 2C3VB 4KKAD 3D5OF 1MHCB 3SQOH 3ARFD 5J11C 2V7HB 2V7NB 5EOTA 2KDGA 1QFPA 3PWLB 5KVEL 4PV8A 4PJEF 3CSGA 3L3GB 2IAND 3T2PA 5EO9B 3NAAL 3FQNB 1KJVB 2A74A 1A3LL 3H42L 1IKFL 3ESVF 1VCAA 3GB7B 2J12B 5KAQF 3HC3H 5T1MB 1CYGA 1IGJA 2D9CA 3QDGD 5F71A 2X40A 4DVRH 3HZKA 1N2RA 5BJTB 3P77A 1P4IH 3HMXL 2J8UE 1KIPA 4UUJA 5I30H 2FD6L 3MJ9A 5D1ZB 5F1OB 3D25A 2VUYA 3IF1A 4M5YH 1MPAH 1ND0A 1G7HA 3GZKA 3WDJA 4JFDA 1OPGH 3IFNH 3O3BB 3L3OA 1LEIB 4MHHI 4URTB 3TO4C 2NXYD 2WBKA 2HT4D 3ARTA 4JFQB 3LH2H 4ZSOE 3BHBA 4FZEL 4X98A 5I1AB 1CDCA 5KSAD 2DTML 1UJ3C 2OTUA 1EJOH 4AIXA 3ZT7A 4L9DA 4NUGL 4QHUB 1A6AA 1FZJA 4D9QD 5IIEA 4IHOB 3IT8D 3L3JB 1HKLH 1UT9A 4I48B 3S36H 4XC1L 4NUGH 3VFUB 4Y5XC 2A0LD 2VLRE 3UYRL 4HXBH 1TETL 2HLFD 1NPUA 3MRKA 3TBSA 4GRWH 1X4XA 2H32H 4KK9D 1K8IA 4GLRI 1A9BA 2ZJSH 1N59B 1I9EA 3GKWH 2J88H 1DBMH 4HH8A 3QDAA 4JQXC 2CR6A 4K2UL 3BQUB 4CNIB 3VXSA 3HMXH 5C86A 4OZ4B 4PJAA 4RWYL 3RQ3A 4DVRL 2BSSA 4YFLI 2V2TB 1KPUA 4FQIH 3EOAA 1M6OB 3SE4A 4ISVB 5DJYB 5SV4A 3T65A 4L4TE 1Z2KA 3OB0K 4GRMA 2CKBB 1BZQK 4OQTA 1YPZB 4I2XA 4F7EA 4AQ1B 4Z7WA 1QLEL 1SEBB 5K33A 3U0PB 4NQED 3LKOA 3EOAB 4R2GC 3CNKA 5BCAA 2XACC 4JKMA 4KWUA 1AQKL 1JF1A 3KYNA 1IC1A 2AJUL 4LMQI 2Z93B 3BWAA 1I1RA 2C3VA 3CH1A 2ESVD 2X9WA 4Y4KC 4DK3A 3BP4B 1NFIB 5CCKL 3L1OH 4HF5L 5T3ZH 3G04A 4BK5A 4QXWA 2XICA 4E41D 2YZ1A 5IW1B 4C83B 2AXHA 3D85A 3UPAA 1I7TB 1JPFB 2J4WH 5EU7C 3CH1B 3VI3F 1AI1L 2DLGA 1G7QA 5LWYH 5CP7B 4QXTA 4HHAB 1JNJA 3OWEA 2IPTL 2QQKL 2VDML 2RR3A 1IQWL 4JR9L 1NGPH 5L88L 3BUYA 5T5FL 4OZHB 2RJMA 2B20A 2W9EL 4FMKA 5I1HL 4NQTA 4WHDA 2QLVB 1G7HB 2ARJA 3GGWA 5I2IA 3C5JB 3VI3E 3QPXL 4JM4L 1KIQB 3MLSL 1S7UA 2JJVA 3H3PH 4LDOB 5GGVH 1ACYH 1PSKH 2VDNL 3DRTA 1JPST 4JFFB 3HB3D 3D0VA 3ARRA 2VISB 5DD5L 5I74C 2EH7H 4XAWL 4X9GA 2E7LA 2X4OA 1BVLA 1XGTA 2YHGA 4YE4H 2BOCB 5IB3A 3FFDB 1CLZH 5M7QA 2NR6D 5FO7B 3LN9A 5HGBB 4NM4L 4Y2DC 2X4RB 1DCLA 5D1ZA 5FO8B 2AV1B 5J57B 3U9UA 4C58B 4MD4A 1U8JB 5TE6L 3LKSB 4MS8D 1INDH 4JY4B 4DFIA 3HC4L 5C2UB 4G9DB 1Z0NA 3MLUH 4HT1L 4PJCB 1EGJL 2LU4A 2NYYD 1Q9LB 4V1DB 4B5EA 3MRBA 3NIGE 4E9LA 3IDNB 4XCCH 4GMSL 1TQCB 2EYRB 3RRQA 1OHQA 1S9KC 1OY3B 4X4XB 1ES0A 5D1QC 1N6QL 2ICEA 1ZSDB 2HMIC 4EJ1C 3O3DB 1FYTD 4NOFA 1B6UA 1YUHB 2JTDA 2R1YB 3WE6A 4NZTH 4WU5B 4YE4L 3W5MA 3VXSB 2E9WA 1GC1H 4DAGL 4AZ8A 5IQ7L 3HAEB 2UV3A 1D6VH 5EG6C 1RHFA 1KCVH 2BXZA 5IW1A 4KC3B 4HIIB 5TDPA 4OI7A 3T4YA 4EEEA 5TDOA 4IRJD 1ORQB 5I1HH 1JUFB 3SO3C 3SBWC 1AE6L 3CVHB 5DQ9A 1GIGL 3V9FA 1BBJA 1NGZB 2YRLA 2MFNA 3B83A 4JR9H 3HC0A 1IT9L 3CAFA 3T77B 4PRBA 5FECA 5L2KB 4Z0BL 1QSEE 1YEIH 3E6HA 3IXAB 4P0DA 3IAQA 4K3DL 5CINH 3UJJL 4LRNL 5DQ9B 1P5UA 1CLOL 4JRXD 1UEMA 4N90E 2XZQL 4YAQA 2HRPL 3L7EA 4KJQC 3ARDA 1CLYL 4C56A 5GRUH 1MCFA 2YD8A 4DVBA 3R8QA 3VFSB 1XMWA 4GXVL 4DN4H 1VGKA 3LIZL 4IOFD 5JDJA 1FYTE 1T3FA 4JZNA 2FEEI 4LLDB 5GJSH 1FCCA 3DNKA 4NN7B 4Y1AB 1L7IL 1BQLL 3SCMC 2QEJA 4LSDA 5INCA 1KEML 5CMAB 3ALPA 1TJGL 3HG1D 1S9YA 4HCRH 2PETA 5TPWL 3TWCH 5ISZB 2XTJD 5KG9B 3MCG1 3I3DA 3FQUB 3QDJB 1R3LA 4K23H 5E8NA 4KGJA 5EU4B 3OKKA 1CG9A 1CXFA 2FSEB 5ADPH 5DJCA 4MD5A 3FQXB 1C7SA 1ETZB 4U6VH 5J11B 4WJ5A 4LCUB 4OZGB 2EDKA 4LSTH 3MLWL 4UV7L 3SGEH 5FYKL 4XBGB 1JYXA 4FTVA 3TP4A 4U1NA 2XKSA 3VWKC 3H0TB 1J87A 1F6LL 2XKNA 4ETQA 1ZT7A 2PO6A 4JCLA 4R0LA 5D96B 3MUJA 4H1LH 3L5IA 4JG1H 1CFBA 3NZHH 3Q5TA 4PJGA 4FZ8H 3RWJA 4YWGH 1OVZA 4HIEB 4N9OB 3KPQB 5JORA 2H41A 4O4YL 4QHUA 3PP4L 3V0WH 5GS1C 2YN5A 1WLHA 4UAOC 2VXVL 4KKBC 2C1PA 4BM7A 4PY8J 1U3YA 4PUBH 1P7QD 4X5WB 1ZT1A 4BZ1L 2AW2A 1A9BB 5KTEH 3C6LB 5LGHH 4RAHA 4M9OA 2FBOJ 2YD3A 2VERN 3C60B 3PWPD 3LN5B 4XXDA 1P4IL 3SKOB 1AGCB 4D94A 2PYFB 3GSUB 5ADPL 4D9RD 1SJHB 1T20A 4QOKE 2HG5A 4LLMB 3HZMA 2FDBP 5C09E 1EK3A 2BNQB 3CJJA 3F7PC 5C07D 4D9LH 3MRFA 3IXAA 2PF6A 4NZDA 4PJEB 5DJ8A 4L8CA 4OLZL 3MO1A 2P7TB 1KB5H 1MFEH 3D69A 1IARB 1AGCA 5DUML 4NSKB 4HBCL 3WUWG 3G5YA 2H2SD 3S98A 4YO0A 5AZEH 5KVEH 4W6WB 2JJWA 1NAKH 5HYFA 3DUUB 4PG2C 3TV3L 4KJYB 4PJFA 2MNUA 1DEEA 4KHXL 4NQXB 3Q5YA 2FJGB 5IHUH 4TVPE 3N0PB 1S78C 4OBSA 3WHXA 4BFIA 1NUDA 5CWSB 3GJEA 3M17B 4G8GE 4N0UA 5DSCA 5ECJE 1FNEA 1EAPB 5FYLE 4HULB 4IRSC 4NZRH 2DMBA 4Z77B 4G8EA 3SDDB 2BHUA 4ZUSB 1BFOB 2O5XL 3VMOA 3R8BB 1FBIH 3GMNA 4IDJH 4JVPA 2CMRH 4HUXB 3DXAA 5FM4A 1HQRB 2MPAH 2XNAA 1J0JA 3MRHA 3WLBB 1X5ZA 2BVOA 2V17H 2YUWA 1C5BH 5H94B 4RGOH 4TOYH 3SE3A 1GOFA 1N8ZB 1Q0YL 3DV4A 5DMGC 2NY0B 5F3HB 5AD0A 1LO4H 5DHVA 4H20L 5I2IB 1NEZA 1YDPA 3P0VL 2YKLL 2DQCL 5CBEB 3K4AA 1FSKC 3IJHB 4MVBC 1XF4B 4FQXA 4M00A 1WIOA 1VERA 3DV4B 4ZUWB 1PKQB 2GJZB 3ARBD 2BMKA 4KZDL 5FHAL 3X14B 1PZ5B 2GCYB 2AK4A 1I9IH 3MLZL 4RWHA 4KTYA 4UQ2A 1QFHA 3BHBB 1EGJA 2DQFA 1DUZB 2P47B 1VPOH 1UM6L 2DQGH 1XR8B 2KKQA 4JFOB 1QNZH 2IADA 2HJLA 5EULV 5F3BA 4U49A 4Y5YA 1O5DT 4KVCH 1U93B 3MBEA 2FJFB 2GI7A 4PJ5B 2P44B 1XF1A 3CZFB 3IFOB 3N85H 1D9KB 4HIEA 4MSWB 5JORB 2LAGB 5CD5C 5DJ8B 2VDKH 4YHIB 4AT6A 1WWBX 1I1AA 3EYFA 3S7GA 1F2XK 1S7WA 2DQEH 4J3UA 3UTSB 5E8EB 3MBEC 1OP5H 1I8MB 1MFNA 3ULVF 3OKMA 4U3XA 2CH8A 1NFKA 2HH0L 1FIGH 1CLZL 2BVQB 5D2LA 3U82B 1M6OA 4ODUB 3G6DL 1QEWA 3VDCA 3IJSA 3EHBC 4NNYB 1RIHL 3SE4C 1SHMA 3KPSD 3BD4A 1SVZA 1LO0H 4L3CA 3RY6A 5IR1B 3F6LA 1DBKH 1XGQA 1PSKL 1X7QA 4QO1A 5IK3A 2F54A 4NKOB 3W0WD 3IDIA 1EUUA 3K8KA 3GHEH 3O4LE 2B4CC 4DOHB 2APWA 2ID5A 1IZJA 2MJWA 3GEWB 5HD8C 4NNYA 3CMOL 1KLUB 4NRYA 2C4FT 5EU6E 2J1KA 3L5XL 3TN0B 4Y88A 4QWWC 1MSPA 3T0DA 3ALWA 5D72H 2KL6A 5L88H 3P2TA 4HK3J 4TVPH 2IG2H 3T0EC 3IDIB 5B38B 1CDGA 4JDVA 1AD0A 1P2CB 5ICXA 1SBSH 1YNLH 2N56A 3V52H 3CXDH 1NJ9B 4JFEA 1VENA 1ZOXA 3REVA 1FNGB 4XCEB 5CGYC 4N0YL 4MD0B 1JWUA 4JDTH 1J1PL 5SX4H 1SEBA 3JWNC 3Q6GL 1NEZB 5IBTH 4BSJA 3ARDB 2WIIA 3T0EE 3V5DA 1EO8H 2XXCB 3V7AG 5I19L 2B4CL 3VXMA 3MCKB 2ITDA 3DVGB 4XP5H 5MENA 5FYKU 1FORL 4HUXA 4I77H 1YEDB 2HLAA 1MJUH 3HE6A 4XBPA 2GCYA 1G9NL 3D0LB 3TO2B 3V0VB 2FIKB 4RISH 3ARZA 4NQSB 2PYED 4RMWA 1UB5A 3U4EA 4ELMF 1CDJA 4YHPA 1CXLA 4A2LA 1B0GA 5T3ZD 5E2JA 1FPTL 2L4OA 4ZXBB 1ODAA 4YXLH 3WS3B 4RA0C 2CO7B 4KFZC 5I17B 12E8H 3UTTE 4E41B 3L3KB 4Y5XA 2W65A 3D3VD 3VXPB 3RDTD 3L7FA 2LQRA 1A6AB 1FZJB 3MLXH 1FNLA 1GVIA 2ERJB 1S5HA 4CJ0A 4JN2A 3RX5A 4CMMA 2NX5D 4G9FD 3U46B 1JCKA 1TETH 1CDBA 1K8IB 3DLQR 1AO7D 4CJ1A 1Q0XL 1IM9B 3MV9D 3GRWH 5EUOB 3QG6B 3BN9C 4R7NA 3FO0H 3ROOA 1F4HA 2WW8A 1QLFB 4N1CA 2DTMH 5CEYA 3D39E 5E2WH 1U8LB 2WSKA 4JFHE 3ECBA 3HPJA 4NQEB 4EUPH 5E00A 1FAKT 3IFNL 4J3XA 2ICEB 4Y4HC 4M5YL 3STBA 3OKDA 1NLBH 4LCCA 5TE7H 5IMKB 2COQA 1T0PB 1ZLSL 3QIWB 1NANI 3OJDA 3WIIH 1FO0H 4M4RA 5K9OA 1DUYB 4E0RA 3X13A 5IHBA 1T6WA 3P30H 3FOMA 1OAUH 5AWNH 2FBJH 3GM8A 2WLZA 4EUPB 3SDXB 5GS1B 4X4YA 3MLRL 3CFBB 2GIYA 5EZOL 1N4XH 2B2XH 1BEYH 2SEBB 2C1OA 4RFOH 1AXTH 1TJHH 1AGEB 3BH9A 2OL3A 2Y4SA 2Y5EA 1YN7A 1QP1A 2EZ0C 5C0CA 3C6LC 1T83C 4CVWA 1OAQH 1DVFB 1IGYB 3QR2A 3TFKC 1QBBA 3IU4H 1U8IB 1I7TA 1JPFA 1RUKH 4PJBE 4PJHE 5GGRY 3AS3A 1INQA 2I07B 4ODHH 4HKZA 3MA7B 3UZEA 3EKCA 2VQUA 4G7YH 3SE8H 1IAKA 4NQUA 2FYYA 3GI9L 5IM7A 4XX1G 4P5MA 1GYAA 1L9MA 3O81A 1NAML 1A7RL 3WHXB 2DKSA 1OAZL 1RMFH 1X6NA 5GRJH 3REWA 4LLDA 4HKZB 4NRXA 5DZNA 3RNQA 4QXUL 5DD3L 1XIWA 2JELL 3R4DA 2ARJB 1EEYA 4N0FB 1J9CT 4XNMB 5EUKB 3OSKA 3B6SA 1MHPH 1JPGB 1S7SA 2OK0H 5CMAA 2B39A 4YGVB 5DRXA 2X4QB 5FEBA 3MXWH 1P4BL 4ZMAT 3VFPB 4LMQE 2HKFL 2X4OB 1UG9A 5MENB 5T3XL 5I1CL 1B9ZA 2QSTA 3HZVA 1J05A 4TRPH 4I3RH 5BVPH 5F3HA 1RUML 3QZWA 3ULUC 1IL1A 3B3IA 1HDMB 4UV4L 4XHQA 4EVNA 1LK3H 1M05B 1QKZL 1VGKB 3RHWK 5JHDA 3OG6B 4HJGA 4Y2DB 4POZC 4X6CA 4RZCA 1MFBL 3EOTH 4YX2L 4PGEB 5DUBA 2VTFA 1FAIH 5INCB 5HGAA 4JHWL 1AD9A 3L7FB 4AEFA 1NCAH 5E5MB 3KPTA 5IFAL 3KJ6H 4GQ9L 3NFSL 4LGPB 4EZMA 5GZND 4X5XA 5TDNB 3MXWL 4YEFA 1J8KA 1OGAB 3F58H 1CGVA 1JNHB 3QXWA 3HRPA 1ZGLA 3M1BA 3MA9H 4XBGA 5FM5O 3WXVL 1RUQH 4EIGB 4K94H 5D5MB 4AT6B 1ROWA 2DLFH 2W0PA 4GXUM 4NQDD 2DYPD 2J8HA 5GRJL 2PYFA 3F6IA 3U0PA 2MWCA 3INUL 2VLKE 1NMBL 1UH2A 1F90H 5EB9A 5IVZA 1IGCH 1A7RH 4DQOH 1P4LA 5C7XL 5JOEA 3S34L 2V2WB 3GI9H 4M5ZL 1ORQA 4PRDB 5J3HD 4KZEL 3I02B 3CU1A 4RIRA 4OQTH 4J4PD 4YHZL 2FH6A 1U8QA 3DOSA 4PB9H 1M71B 4ERSH 1GHFH 4X5WA 1XCTB 4Q9QH 1JNLH 5ANMB 4CN6A 5GGVY 1DE4A 4YZFE 43CAB 1G7LB 4EI5C 1CFNB 1JGVH 1G6RH 2IAMB 1AP2B 2CGRH 1BVZA 5E6IA 2DM3A 4MAYB 4BQBA 4ZTOH 4RFOL 4HWZB 5F9OL 4JPIB 1U8HA 5F7UA 2B2XL 3PL6C 4HKBB 1MNUH 2CR3A 1M71A 2FHCA 2PTTB 4OCRH 4E5XB 5JXED 3GMOA 4G6AC 5C0JB 5GS2H 3MRGA 1QZ1A 3P30L 1MHHB 3HRZA 5EOQH 1PYWB 2BOBA 1J12A 1FNEB 5ISZD 1AP2A 4G80A 1JGEA 4LU5H 4C54A 4KUZL 3HE7D 3W11D 4FFVD 4NHUA 3GUTA 4JO3H 2DBJA 1HHHB 3V5HA 3RBSA 1JWUB 1IAOB 2AKRA 4NN7C 5DJ0A 4XAKE 5DO2C 2VC2H 4TN9A 3VXRD 3RU8L 2A73B 5DJ6A 3WIHA 5E2WL 2FLRT 3RVUC 5HHXH 5D1XD 3MV7E 3VXUD 5AD0B 1HZHL 4N1HB 4HUVA 3QQ3B 4M62L 3SGDI 3TH3T 1MH5B 3KWWA 1KNOA 3ZDZE 3PWLA 4LQFL 1MFDL 2XWBB 3M17A 4LKCB 4MQTB 5CSZA 1I8IB 1FVCB 1GL4B 4AQOA 4LGSB 1CE6A 4LAQH 1QFWM 5C0BB 4L8DA 5DTFB 1LE9B 3ARVA 1IEHA 2ED7A 4I3GA 4ODVH 1ZHLA 1P6FA 2Q6WB 1KGCD 1S3KL 4GW4B 3RVVC 4NO5B 1ZA3B 2VITB 3WN5A 4AJ0A 5T1LA 2YA0A 1AO7A 1U0QA 5C0GA 2MCPL 3IDGB 3DVIA 3GSQB 5K59E 4L4JA 3JVGC 1LP9A 3QWOB 3MREA 1VFAA 1T0MB 4MNGB 1I75A 4YDLC 4KDTA 3VGDA 5HGAB 3C9NB 3UAJC 5DRWA 4U6XB 3DTXA 5ANME 2FJFA 3KR3L 1WQVT 3VMPA 2D4FA 1N5AA 4MJ6A 3IJHA 3BGAA 3BKYH 4LSQH 2APBA 3CZFA 1DBAH 1KPVA 4XMPH 3W5NA 3MJ9H 4ZPTA 2ED8A 3RGHA 5C9JA 1TDQA 2J8OA 3UJIL 2NY6D 3RZCA 1KFAL 5IWLA 43C9A 5D6DA 1JHLL 4L29B 1ADQL 1J8HB 1IC7L 4M61A 1WBXB 3V6FA 1BM3H 3C60C 3G5XA 4CL7A 5E5RB 4ODWA 2BNQA 4FMFA 1A2YA 2ZUYA 4PG9B 3EJZC 1F6AB 5C09B 4L5FH 5E99H 3Q6GH 4AM0B 1IEBA 3EYOA 3NN8B 4LBEB 2R2BB 3HUJF 5GGQH 1UYWL 1FV1A 2DDQL 4CNIA 3CVHL 3ULVC 2I24N 2PTTA 3BKML 3SDYH 4MXVF 2VLJE 1ZT1B 3ZKXB 4GG8A 3EO1B 3W39B 3BT2H 3TVMA 4WW2A 1AGDB 2VIRA 3RAJL 1HQ4B 2F8VA 1SEQL 2AEWA 3BKJL 1X3DA 3T65B 1CLCA 3MLVL 1HYRC 1C1EH