1KJ2B

Murine alloreactive scfv tcr-peptide-mhc class i molecule complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
117
structure length
117
Chain Sequence
VTLLEQNPRWRLVPRGQAVNLRCILKNSQYPWMSWYQQDLQKQLQWLFTLRSPGDKEVKSLPGADYLATRVTDTELRLQVANMSQGRTLYCTCSAAPDWGASAETLYFGSGTRLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Allogeneic H-2Kb MHC Class I Molecule
publication title A T cell receptor CDR3beta loop undergoes conformational changes of unprecedented magnitude upon binding to a peptide/MHC class I complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 20
structure length 117
sequence length 117
chains with identical sequence E
ec nomenclature
pdb deposition date 2001-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kj2B00
1WFTA 1ZK9A 5HHMD 3WD5L 1CU4L 5SV4A 4PV9B 1JHKH 5GGSA 1DBAH 2DS4A 2J8OA 5BJTA 2R1WB 1KJVB 1A0QH 2YA0A 1A6ZB 1HILA 4H88L 5EC2A 4JVPA 3BXNB 1YDPB 3REWA 2HRPH 4XP5H 1LNUB 3VFSA 5IP4A 3GRWH 3MPCA 4UBDD 3WO3B 5D7KE 4ODVH 4PJIB 1IEHA 4NPYB 5DD5L 1OW0C 1FLRH 5T1LB 3RKDD 3RZCA 3I85A 5FCSH 3JV4A 5TDNA 4LHUD 5DD6A 2W0FA 1ZA6A 3QXWA 4QHLA 1X5GA 2F58H 2NZIA 4OQTA 1HH6B 4P5TB 2A77H 1NGPH 3IDNA 3E3QC 2FSEA 5GPRA 2F19H 5FGBA 3GFUA 1F90H 3L3GB 4R2GD 1S7SB 2CUMA 1DEDA 4BQ6A 3NFNA 4NIKB 3EO0A 5ALCL 3SDAC 3KXFD 3PV6A 4FQCH 5HHOB 1RUMH 1JN6B 3KYMB 5B39B 1RZKC 5KSUB 2OZ4H 3ARED 4R8WH 4NZRH 1Z5LB 4D9QE 4F15C 5J4MA 5E9DA 4PJ8B 4U3XA 1T1ZA 3HZVB 4LSVL 4Y5VA 4YHZL 5MEOB 1RJZB 3C8DA 1PZ5A 3C6LC 4IRJC 2ARJQ 1R3KA 2OXGA 3B3IA 2D7TH 3HC0A 1CICD 4ODTL 3CSYB 5HTSA 5IHUH 4J6RL 1QFUL 1DSFH 1F4YL 3ULVH 4L4VA 1MJ7L 3VH8G 3KPSA 1LHZA 3HG1D 3OKEA 4KKLC 4NQDE 2QEJA 1OLZA 1WIUA 4U0RB 4GAJH 3R1GL 2R29L 3RVUC 3BH9A 1U42A 2BXYA 2YWYA 3E6FB 1N5YL 2AV7A 5DJCB 5E8OB 3GSVA 5BRZD 5HI3C 1T83C 4OCWL 4GKZB 1MLBB 1HI6B 1BVLB 5FUOH 2KZWA 4MD4B 1A9EB 3Q3GB 4NM8H 3MRNB 4UT7H 1DVFD 2PW1B 3LN4A 2I24N 4NRXA 25C8H 2DL2A 1TVBB 3WIIL 5BQ7B 1JYVA 2BMKA 3DGGB 3RPKA 4KHXH 3QEHA 1IGYB 4RA0C 1MRCH 4A2MA 2PXYD 3FQWA 4XNXL 5L8LB 3N1QC 1G7QA 1GC1C 5GS0D 1F97A 2YHGA 5C8JA 4I0PD 5DQ9A 2VDOL 3DSNA 1RUKL 3QEUA 2ZOLB 4PY7B 4XH2A 4HIXL 4JO3L 4APQB 3SGKA 4IM8A 4UI2A 4FMFA 3LCYA 3S35L 2R8SH 3QIWC 2H8PA 4TTDC 3QWOB 3SKOA 4ZUTB 4GAGH 4JGUA 3PL6B 3PV7A 4NKOB 1N6QL 1XGYH 1I7ZA 1B2WH 2JCCB 1IRAY 3DRTB 2ADIA 4I2XB 5GGUA 4HV8B 2Z8SA 3TN0A 1J87A 1QNZL 3QFJD 5C86A 1MAMH 1X6LA 4ZTOH 4P4KB 4OQ1A 4WJ5A 4N9GA 3GMMA 4H8WH 4DAGH 3BSZL 3QG7H 2HT3C 3FTGA 4L4TE 4V2CB 5CEXB 1N0XL 5EN2A 4D9RE 3BQUB 1WZMA 1II4E 4QRSB 3FN0H 3MYZA 4R7DB 4QF1A 5CGYC 4Z7NE 5J1AA 1HXYB 3PDDA 4LLVB 1QG3A 3KGRA 5IEHB 5C09A 3QEGL 2J2ZA 2NY6B 2IAMC 1X4YA 4Y5YA 2P7TA 1KN4H 2E6QA 1N0LA 1XGPB 4XWGL 1AKJA 4G8GA 1P9MA 1Q9OA 1I9RH 2OR8A 4ZS6C 1TJIL 1RU9H 2R0KL 1WEJH 3RWGB 5MENA 2XTJD 1JTTA 1AR2A 4LKXA 3OKKA 5HGBA 1WUNT 2G60L 3P9LB 3H9ZA 1ADQH 1NJ9B 2ESVB 2K9UA 1SBSL 1J1OH 4ZQKB 5I2IB 4HGWA 2OTUA 3F5WB 3DGCR 2ED8A 4M3JA 5K9KB 2G9HB 3VDAA 4J3TA 4MWFA 1U2HA 4KZEH 2B1AL 1A5FL 1S9VA 3KG5A 2HVKB 2OSLA 2P44B 5HDQL 2VQ1A 4TNVF 4OIIL 4MJ2A 4Z7WA 3FFCB 3OAYK 3LQAL 1EERB 4HXAH 5D7IF 5C0NC 3MA7A 3P30L 2LFGA 3F7QA 1EHXA 3RWEA 1LMKA 4JHWL 4GRWB 2B2XH 3DO3A 5T1DL 3ULVE 1K4CA 3L5JA 2IQ9L 2Y5EA 1OLLA 5I8CB 3MRQB 4BZ1H 5HYSG 4Y4HA 4GW5A 5HHPB 4R97C 4KJPD 3HLAB 4JY6A 2AK4A 3TGXA 1TTUA 3WLWD 1UXWB 3AS0A 4F7MB 4JFHD 1KTKE 2WV3A 3EO1B 2J6EL 1KENH 2R69H 1U8MB 3U7YH 1C7TA 1BAFH 3DIFB 3VXSB 5IEKA 3DURA 1CS6A 3QG6B 4JM2B 2WP3O 1AXTH 5I1IH 2XXMB 2DQCH 4XCEB 4OLUH 1I1AD 1ZHBB 1DN2A 1HIML 3BZ4B 2GJ6E 2X10A 2APWA 5JXAL 4XNZC 1ZVHA 2D31B 4U1HB 2C3XA 1IEBA 1T66D 1IM9D 4TVPD 1MJJB 1FL6A 1Q9LB 2CMRL 4JHZA 1T1YB 3CLEL 5AEAA 1TTGA 3SDDA 1OGAB 2NPLX 2ID5A 1QLEH 2ORBL 5JO5B 4HZAA 3G9VA 1WFOA 3WLBA 4JANA 5HHXH 3AM8C 5INDB 1ZVYA 3KHOA 2X40A 3HTLX 2DLEA 1IGMH 4RFNB 4OLEA 5HYEA 1J7VR 1NFDF 4PLJC 4OFKA 1G9MC 5F7WC 3RIFK 1U3HA 1LDPH 4PRDA 2ICEB 1CLZH 2E7LA 3OF6D 4CU7A 5IFAL 5JZ7D 1OTUC 3GMNB 4UOW0 1F4WH 3LEVL 3VJ6B 4ODUB 3ZT5A 4BKLA 1P4BL 1JV5B 2P47B 2NX5A 5DEFA 3LS5H 4NUGL 3U1SL 2A1WL 5HDBE 4U2YA 1UXSB 3DX6B 4NQEB 4OZHE 5LVEA 1H5BA 5BMFL 2YD3A 4PJBF 3U0TA 4CNIB 3VI3E 4M00A 3WNLA 1DLHA 1ZT1A 4FABH 3RL1B 1AHWC 3X3GL 3LKNB 4OF8A 2WW8A 3CFDB 4V1DE 1JGDB 2PYEB 1F4HA 3ELAT 3VI4F 4EDXB 1VGEL 1NMBH 4JM4L 5A2LH 3IETA 3TO4C 1JGUL 1Q72H 4XP6H 1FNEA 4Z95L 5F1KC 2EDJA 2R0WL 2OJEB 4KKAD 1KBGL 3M1BB 3SDYL 4NJAH 1MIEL 1U93A 3PWPB 1LEKB 3ILPA 2F8VA 5F3HA 3LKQB 4MAYD 3QZWA 1A7PH 5J12C 1KCSL 1BLNA 3HNVH 5JOFB 4Y1AD 2R0LL 3FQRA 1LP9F 3JV6A 3TBSA 4ONHB 3G6AA 1GGBL 4PV8A 3PE9A 5I1CH 4NO5B 2EH8L 3P4LA 3KXFA 2A6JA 5SX4I 5GS1A 1IC5L 5AWNH 4OT1H 1HDMB 3AREA 1F5WA 1A6AB 1NMAH 4F7EB 4NGHL 4PGDA 3IS1X 1RUQL 2FIKB 4KKLD 4XP1H 4PIRF 5F97E 2OP4L 2IH1A 3B9AA 1KNOA 3UTQB 3SJVB 1PSKL 3EHBD 3RY4A 2PN5A 5HI3D 3O9WD 1G0YR 3FHAA 5CZVH 3WEXB 5HHNA 3HG1A 3QEQB 5ITBL 2Q7YB 3AB0C 4EN3D 4HUUB 3SE4C 3BZEA 1YJDC 1VEPA 4L8BB 5T3XH 3BKCL 1J0IA 1C5BH 5BRZA 5D9SB 3WFBL 3P77A 4WUUB 3GUTB 2VC2L 1U3JA 3D3VD 1E4WL 1OGTB 4HWZB 4LSPH 4YXLH 4O51B 3NPSC 5GS2H 4KVCL 1DVFA 2OXHA 2Q76B 1R3JB 1YEFH 5TF1H 4LIQH 4XC1L 2YPVH 1V8HA 2EIZB 1INQA 3HMWH 3MJ9H 1V7NL 3P4NB 3EDFA 5EZJA 2IFFH 2QQLL 4JO1H 3SDCB 2N56A 2YPLD 3QIWD 4YEFA 1NGQH 1QD0A 3CSGA 3MNVA 5CJ5A 1KB5A 3WFCH 4RFEA 5TE7L 1IGTA 1W72L 1AFVL 3S4SA 4F9PA 4LKCB 3ECBA 3U7AA 5FUCC 1TJGL 1AE6H 1J05B 5E4EC 4HEPG 3QNXB 4ZFGH 2HT3D 4MD0B 1EEUA 2FX9H 1CLOL 3QFJA 1YMME 3D85D 4LSRH 1E0OB 4WHTA 3QQ9C 2BFVL 1IILE 3WKMH 5E24E 2HFFA 3ILQC 1JHKL 3RZWA 4QCIA 4PJXF 4Y4FB 1DBAL 2IAMD 3NVQA 3TP4A 3V7AG 2WINA 1I1YA 5KVFH 3GKWH 4PJDF 1A0QL 1G1YA 1YQVH 3ZHKA 7FABH 4F2MA 4ZS6D 3CVHA 4OSUL 1HXMA 2HRPL 5JHDB 4XP5L 3ZLQC 1A14H 1UYWL 1P7HL 2YD8A 4XPTH 3GRWL 4JDZA 2H2SC 3FQTA 3VDCA 1T21A 5BZWA 2D03L 4ODVL 3BP7A 2AJ3B 3MA9L 5D1QC 5T1MA 3NIDE 1I8KB 2BDNL 2OTPA 1FLRL 1UJTA 3AMLA 1AXIB 5EIVA 1MF2H 3BWUC 4HPYH 1KOAA 4NQCB 5TE4L 4DZ8B 1BHGA 1U36A 3V0WH 4XP9H 4X7TB 1CR9L 4G9FA 5C0AE 2OJZL 4K7FA 5C0CE 2KQNA 1F90L 5GGVL 2GK0A 5E8PB 2NY4B 3H9SE 1PD6A 4FQCL 1CDYA 1XGTB 1RUML 3T4AB 3FOMA 4ZPVB 1KJ3L 2OZ4L 4M6NH 4R8WL 3DV6B 3CDGB 5F6IC 4NBZB 4GKNB 5D5MB 4OI9A 1KTLB 4EBQH 3VWJB 3S37X 2D7TL 4P4RB 4XC3L 1LO3H 3RAJH 3STZB 4UAOC 5KOVC 3ULVL 3UX9B 4X7CC 3ES6B 3T8XA 1T5WB 4OD2A 4J3WA 1YEKH 4GO6B 1T7ZA 5D2NC 1R3LB 5IW1B 1RZJH 2P5WE 3N9GH 4JPIB 4JY4B 4NKMB 4JZJB 3ARFC 3EZ8A 4PJGE 3OX8A 3VGAB 3O3BA 5F89A 3DXAE 5KTEH 3D25B 5M94B 5T3XE 2DIJA 5DDHB 1KXVC 3WUWB 2V9RA 4P57B 4IJ3B 5FUOL 1S9YA 4X6DF 1I3UA 4NM8L 4UT7L 3D69B 4MA1C 3VFRA 2A0LD 1GSMA 1FVDA 5TJWK 3HKFA 2VLKD 1DBKH 4TUOB 25C8L 4LIQE 1MPAL 2HVJA 4PJ5D 4OD3H 3MRLB 3MRBA 2JK5B 3X14A 3C5JB 4ERSH 4NRZA 1CLCA 1G9NH 5IV2A 3G9AB 2E9WA 2V2XA 2V6HA 3MLWH 2QR0B 3UTSB 4JFFB 4Z6AT 2VL4A 1IM9A 4K3DL 1U8KB 1IMHC 4KDTC 1K2DB 1OPGL 2C3WA 1P7KB 2P5EE 4GQPH 5H8DA 1NC4D 5ICYB 2F54D 2VKWA 4C4KO 2R8SL 1OTUD 3NZHH 3H2WA 3THMH 2AV1A 3B83A 2VXQH 1DTUA 2QKIB 4X4YA 1UC6A 1EAPA 3S8WA 1XGYL 5I76B 3T0EC 4AEIH 1B2WL 1CIDA 5IM7B 3OF6A 2DQEH 4JLRA 2A6KA 4MXQC 1MRDH 1LQSR 4M8QA 2Z8RA 3E2HB 1NGWB 5F3BB 3B2UD 3T2QA 2PNDA 5AUMA 4LSSL 4ZTOL 4XWOC 1YEEH 3VFWA 1E6JH 4H8WL 5GSVB 2BNQE 2C4FU 5F72S 3MLVH 1A4JB 1K8IB 3EBAA 4ZNEA 4ZSOA 1RZIB 4U1GC 3JTSB 3VRIB 4AYFA 3KYKL 4LLYB 1NDMA 4JRXE 3ULSB 3W39B 5IB4A 1KPRB 4WU7B 5ESVB 1T7YA 4HK0B 1S5HA 1CT8A 4MJ5A 5B39G 3ZL4H 1OW0A 3MJ8B 3T0AA 4HIIA 1BIHA 5F1OB 4NYLA 5DQDH 3PQYB 3LD8C 4QTHA 4S1SH 5GRVK 1RIHH 3GBLA 4HBQA 5C08B 2O5XH 3MV01 4I13B 1K6QL 3KYNA 4M61A 1NGZA 4QXTB 1RU9L 3TCLA 2XV6B 1CLYH 3HC3H 3IF1B 4HGKC 3WN5C 1WEJL 1JZ3A 3SDAA 1IEAB 4DUVA 2R9HD 3MRKB 4LVEA 4M93C 1ADQL 4Y1AA 1CWVA 1R3IH 1N3NB 4Z76A 4PJIE 5SWQA 1IL1B 4K94C 2WBJC 2RBLA 3C6LA 4IRJA 5IVOA 2CLRA 4OB5L 4UIMB 3DX8A 1I7RB 2CIIA 3C08H 1A6TB 5EORH 2Y5TA 5F9JB 4KZEL 3MJ6A 4YX2H 1MCPH 5KSBF 1EZVY 1MWAH 1M7DA 2BVPA 2VWEE 3TNMB 3B9KB 3VMNA 2FWOB 4QRPD 4PJEB 3TZVC 2FBOJ 4FHBD 1SEQH 4I9WE 4JDVA 2DJUA 3O45B 3DX7A 3T3PE 1T2QH 5D8JH 4DKFL 1ONQB 1HQ4B 2VE6A 3RJQB 3STLB 2B2XL 3BW9B 2C7UB 3O9WA 3HMXA 1CFSA 1E4JA 1T83A 1V3JA 3NCFB 5K9OA 2C3VB 3MLXH 2WIIB 1TPXC 3SKNB 3D2UB 3MV8B 4GRWH 4Q6IB 4EN3A 2NW3A 4P9HL 1DANU 5B22A 4RQQA 1INDH 1AP2A 5INCB 2NTFB 3FL7A 5JIPA 3KWWA 3QDJB 2UV3A 5A2FA 2VABA 5D7LB 2FYYA 4HUWB 1J9CT 1A21A 1KENL 2R69L 4KC3B 3U7YL 1BAFL 2VSCA 1JK8A 3O2DH 1PQZA 4YFDB 2FB4L 1ZVSA 1UZ8A 1A7QL 1RAMA 2X4QA 1AXTL 5F96H 3BESR 3BN9C 2DQCL 1J1XL 3NACL 4H0HB 3E6HB 5FA3A 4NOFA 3GBMH 4OLUL 3RX8A 2D7NA 5ESAA 3G6JF 1C12A 3QIWA 2MHAB 2Y07H 2NY1B 1AO7B 5CEZD 3SKMB 4FQJH 5BZDB 4B41A 4W6WB 1CI5A 4DVBB 5HYQA 5IQ9B 4TN9A 2XN9A 4XCNB 1FFPB 3QFDA 2WWKO 3ULUD 1BF8A 1EH9A 3FHQA 3UYRH 3PWJA 1MRFH 5GGRB 2FRGP 1IGML 1VFOA 5CJBA 1YNTB 1BZ9B 5SX5K 4HUVB 1LDPL 4PPTA 3MROB 5EO1B 4PJ9B 1U8HB 1SJHA 1OSZA 1CFTA 1CLZL 2QQNL 3QCVH 2VQUA 3ILQD 4L29B 3VE0B 3EDEA 3G5YA 2K1MA 1ZSDB 2XQYK 5E00A 2ZOKA 1F4WL 4EEEA 1E4KA 3KNBA 4CJ0A 3RUGF 1YZZA 1CD9B 3LS5L 3QUXD 4RNRA 1IE5A 4KK9C 4CJ1A 3IKCB 2JCCE 3AXLA 1LEGB 1T1WA 4I2XE 1A1MA 4WFFD 1ZMYA 4B53A 2HLFC 4CADB 2IAMA 4FABL 1BQHA 4LMQI 2AGJH 2H2SD 1AC6A 4X99A 3DARA 2XKNB 3QA3B 2Y6SD 2J88L 4O58L 4IHOB 4OCXH 4QRUB 1NMBL 3WDJA 1RULL 4WHCA 4B7IA 3O41A 1Q72L 4HC1H 4XP6L 1HK6A 1V5JA 4JKMA 3TFKD 1H0DB 3BP4B 2X4UB 4HK3J 5KSAB 1U58A 4HPOL 4XNYL 3I02B 4PGZA 1FRGH 5BO1H 4F8TA 1A7PL 1I1FB 2NZ9C 5HDLA 4MLIA 1LK2A 3QAZB 4PJCF 4NBXB 1A2YB 32C2B 3QXDB 3FONA 3O11B 4BH8B 3HZYB 5I66B 1EBAA 2BY1A 3LKSA 4G6ML 2VL5B 2YUZA 3G08A 4OT1L 2LU3A 1NMAL 2ESVE 3QHZL 1QQDA 2Z8WC 4P2YA 2QBWA 5HYJB 4GSDL 5K9QI 4XP1L 3U46A 3LEYH 1A22B 4HUMB 1JNNH 3VGFA 3LDBB 2MSPA 4BQBA 1TCRA 5EIIB 1W0VA 2YMXH 3KPMA 1ERNA 1JWMB 4K23H 4XHQA 4XPGH 1RI8A 3O3DA 5C70A 3D1MC 3H42H 3RVTD 5AZEH 4ZO8A 3FFCE 5IJVB 4YZFE 4K3JH 5T3XL 3HZKA 5B8CB 3MRHB 1JZ6A 2R4SH 3QXVA 3TBWA 4GRWE 5IOPA 2HFGH 4M7ZC 1C5BL 2BNRD 3U6RA 1C1EH 4NSKB 2YEZA 3Q48A 4XBEH 1FG2A 1I8IB 4LSPL 1MFEH 4YXLL 5IVNA 3I6GA 1QLFA 4N9OB 5KW9H 4GRMA 5TF1L 4LIQL 1CXHA 5FYKD 1S9XA 4NKDA 2VLKA 4W6XB 5I71C 4YHYC 5JXED 2CGRH 3UTZB 4UT6H 3HMWL 2HT2D 5JTWA 3MJ9L 3PDOA 1WJ3A 4HK3N 1JFQH 2IFFL 4TPRH 4JO1L 1ND0B 4NNPH 1DQLL 4M7LH 1MSPA 3AM8A 4OV5B 3VXSE 2WP3T 3V0VB 15C8H 1NGQL 2AABH 3L3KA 4WWID 4W81A 4WVRA 1QVOA 4NFCA 1SJVA 3T0ED 4YC2C 4WY7H 4X9GA 3BP6B 4NQVA 3ZYOA 4PYHA 3GSUA 1ZTXL 5GS0H 1NC4A 2IEPA 4MXQD 1PEZA 3MV11 5LAXA 2F54A 4MD5B 1NFKA 1XT5A 4R4NC 1HSAA 1Q38A 5I8KH 1JUFA 2E7HA 1NAKH 1BQLL 1IGCH 2X4OB 4XB7A 3BKJL 1S8DA 5DI8B 5JOPE 4ZFGL 1NUFA 3RJDA 1JMZA 1OGAE 4Q9QH 3BFOA 2FX9L 1YY9D 5EO0A 1AHWA 3WS6C 4QHMB 3WO4B 1IAOA 5E2JA 4MA3A 3WDIA 4JN2A 5EO9B 1A7OL 3TO4A 3WDHA 3ME0A 2B7DT 2X1XR 4OZ4B 4YHLL 1YQVL 1UWGH 7FABL 3HZMB 5F8RC 3T3MF 1MVUA 5DTFB 5DF0A 3RVWC 4NQEE 3JWOH 2ZWLT 2WSKA 5GGVY 3PJSB 4G3YH 5E6IB 3WIHA 2Q8AH 2YSSB 4QO1A 3GSRB 2PYEE 5IB5B 4F58H 4J2XA 3Q6FA 1A6VH 4LCUB 2W0PA 1TETH 3BDXA 4HXBH 5CZKA 4HPYL 3F6IA 1DUYB 2NYYC 3V0WL 3P4OA 5F7NC 4XP9L 5IW3A 5I9QC 4D2NA 3PWPE 1I4FB 3OWEA 4Y7MA 2B20A 3K80A 3AAZA 5C6TL 3O2VH 4GBXD 2W65B 3MR9A 4HIHA 2ZUUA 5FO8A 3QNZA 5JW5B 4QLRA 3IDGB 5IK3B 3HCVA 1AGFA 4M6NL 3SPVA 4S0TD 1PX3A 5DR5H 1TVHB 2ATKB 4WW2B 3K8LA 5EBLA 4DEPB 3D39D 3EFFB 4QRPA 4MQXC 3NTCH 2JIXD 3QDGD 4FP8H 4XNMB 1LO3L 5IG7A 3RAJL 3QISA 4DGIL 3O3AA 5GISH 5C9JA 2CXGA 1GGUA 3FFDB 5GGSB 4DWHA 4FA8A 1FNHA 4U7MA 4WI3A 4AIXA 1BBJA 4ONFH 4E9LA 3N9GL 1FNGA 4Y16D 1I3VA 3MV7D 5EC2B 1FYTD 4LASH 1HHHA 2HTKC 3SJVE 1WSST 3WCYA 3REWB 4LLDB 3EYFA 5EOTA 2UZYB 2W92A 2UVEA 3TJHC 3VFSB 3TBTA 3QEQE 5SWZB 1T80A 3DVNA 5DEGB 4HJJH 4MDIA 4QY8B 4BM7A 2MWCA 2O26U 2FL5B 3V4UH 3LQZB 1G0DA 1DBKL 5TDNB 3JV4B 3W5NA 4K2UH 4RAUB 2W0FB 3CFEB 4WUUE 4R4BA 1N6VA 2Q86B 4CN4A 1BIIA 4OD3L 1UH4A 3N06B 2FSEB 4ERSL 1UJ3C 4K8RD 1PFCA 2GCYA 3UROR 1G9NL 1TITA 3MFFA 3NFNB 5EZIL 4DFHA 3MLWL 4KJQC 3PV6B 1AGEB 3LEXB 2E7MA 1EHAA 5DRZA 4Y4KC 5J3HC 3DETC 5E9DB 4Z7NF 2HTLD 4R7NA 1OT2A 3NZHL 3DUSA 5IHBA 3THML 1R3KB 5ISZD 3UJTH 3B3IB 1KGCD 1FO0H 2QQKH 1MCWW 4PJHF 3HC0B 2NR6C 4AEIL 2UUDK 5F7FA 5C0BA 2DQEL 4L4VB 2R39A 3SGJC 4I48A 4N5UA 3KPSB 3UTPD 4E41D 2MQCA 3KPOA 3OKEB 3OKLA 1XAUA 1E6JL 5F7LB 4H5SA 4XGZA 1IQDA 3MLVL 3BH9B 2J1KA 2AV7B 1JPGA 3QSKB 3RBGA 3GSVB 2EEDA 4X6BA 2GFBB 1QSEB 2D0HA 3L3IA 2ZKHH 1CGVA 1NL0H 5E8EB 3QHTC 3ARRA 3S96A 1NEUA 5EBMB 1E28B 2X4PA 1M7IB 1UB5B 4NWUL 1JF1B 5D1QA 1UZ6E 3ZL4L 1C5DA 1XZ0A 3RNKA 1L6ZA 4QOKA 1JYXA 1EGJA 2BMKB 5GSRB 5CINH 2AK1H 5IVXF 1VFAA 1JP5A 1RIHL 2OCFD 3GHBH 4P49A 1EHLH 3GGWA 1G7QB 2O61A 1AH1A 3T08A 3HC3L 1CLYL 5C8JB 2CIKA 3KPLA 5DQ9B 5JHDE 4U4BA 3ARBC 1IM3A 4YDVB 3ULVF 2XI9A 4LPVA 1BFTA 3QEUB 3C6SA 3UPAA 4FZEL 2MKWA 5D1ZD 2BRQA 2I5YH 1BQUA 1R3IL 2ICCA 4KY1H 5SV3A 2P8PB 3C5SA 2H8PB 3K2UH 5DURB 1G1CA 4JE4B 5CJQH 4S1DC 3C08L 4NQCE 5EORL 5ACLA 1A4KA 3VXMD 2ADIB 3QDMA 4MSWA 1BJ8A 4YX2L 3MACH 1D6EA 1MWAL 4AEFA 2HLAB 2H2PC 1R24A 1U3ZA 3IFNH 4WJ5B 3PWVA 5E70A 3GMMB 5GS3A 1MJUL 1IJ9A 1SEQL 3TBVA 3QUMB 2FATH 3ARFA 1T2QL 5D8JL 4OLYH 3FTGB 2ERJC 1BBDH 1EK3A 5DD3H 4TOYH 2FJGA 5EN2B 1YN7B 5D5ME 4K7PH 3BIKA 4BA8A 5ESQA 1FZOB 4QF1B 3WE6A 2XA8H 1SY6A 4PTUA 1EVUA 3KJ6H 3QI9C 2BZDA 1INDL 1D9KC 3OZ9H 1P4IH 5C09B 4NZUH 4Y5YB 2P7TB 1RIUH 4TNWK 3CFKA 3ZDYE 1D5XA 4GXUN 3IJYA 1Q9OB 2LABA 4YWGH 4RX4D 3VFTB 3RTQC 4NC0B 4JRYA 5KOMC 1KACB 4KROC 3O2DL 8CGTA 2R1YA 5DMGD 3ARVA 4LKXB 5F96L 2DKSA 4JFDB 5FECA 4KDTA 5ERWB 5BVPL 3S5LG 3GBML 5HDBF 2DTSA 5FO9A 4OZHF 2OTUB 2Y07L 3V52H 2JJTC 1XF4B 3RA7H 5JPNA 2CKBH 1RV6X 4AIZA 4Z7VA 3D5OF 3T0EA 2DQFA 3RGHA 4M48H 1I9JH 4LMQE 3PGDA 4YHNB 4U1SA 2OSLB 3UYRL 3LQAC 1LO0H 1O7VA 1QR4A 2VQ1B 5DC4B 1MRFL 3O8XD 1MQKL 3IDJA 4RA3A 5ICXA 1GAFH 3UTSE 4JFFE 4HFUH 5CLTA 3MA7B 4I0CC 3TBYB 3RWEB 3KJ4C 5IWLC 1KIRA 3NIGE 1BD2B 1GGTA 4G9DB 1JTOA 3MX0A 4LVHB 3PP3H 2ZPKH 3O4OC 4UV7H 1K4CB 2UWEB 4P3WA 5D7IA 1IAMA 3HE7C 3MC0A 3RVWD 3T77B 3CX5K 2FHBA 1EJ6A 2AK4B 4P9ML 2EO1A 4X6EA 4HLZH 2AGJL 3PP3K 1LILA 3TYFA 2EDKA 4KH2A 4OCXL 5IEKB 3L3JB 3WN5A 1F6LL 1ZT7A 2MFNA 4CU8A 3KPQB 2UYLA 4HC1L 5HI5C 4HQQL 3O3EB 3RBSA 2DDQH 2X4SA 4UT9H 4X6CA 3DMMC 2WBJA 4LVOB 4OZIF 3JXAA 1L0XA 1FRGL 5I18L 5J9PA 3MUHL 4N0UA 4JY5H 4X83A 3F7VB 3PQYE 4MCYB 3DV4B 2NLJA 3JSSA 5ICZA 1FL6B 5L6YH 3SDDB 1F6AA 5C08E 1SJEA 2DWEB 3WLBB 1U8LB 3VG0H 3ZKXC 4MQXD 4LPXA 3TZVA 1MHEA 1WCBA 1U3HB 4PRDB 3P4MB 2W1NA 3QUKA 4Q6YA 3QO0A 3VFNA 4DUXA 4Z7OE 3D39A 4BKLB 4FQPA 2JIXA 2YR3A 2NX5B 3QDGA 5DEFB 1NFDA 2YRPA 3LEYL 3PDGA 5DJXB 3L7EB 4PGEB 2HFTA 2WBKA 2A9ML 3QJFB 3U0TB 1JZ8A 3D0LB 1DLHB 1ZT1B 2YMXL 4K23L 1KYOK 4KI1A 3OAZK 3OR7A 3RI5K 5FA4B 3H42L 4PJEE 5FKPB 2AKRA 1TZHB 1RK0A 2CH8A 4YFLI 5AZEL 3W11C 3NCEB 5L9DH 3HAEA 4GQ9H 4P46C 4M5ZL 4MCZA 3RIFF 4PJBA 2R4SL 1K8DA 3IETB 2DYPD 4GJTB 1C1EL 4XBEL 2AEPH 5FYJU 5JIKA 2WWMD 3HR6A 2V5TA 4U7KA 3MV8E 1U93B 5KW9L 4PRPD 4N0FA 3WS3A 5F3HB 5E8NB 5AG8A 2CGRL 4KJQD 3QDJE 4UT6L 5DZOA 4YHPA 4L8DB 4RFOH 3MJ7A 5D7LE 5DJDA 4TPRL 4HMCA 4JEGB 3FQRB 4NNPL 2ZZUT 3JV6B 4M7LL 3TBSB 2IPUG 3GK8L 15C8L 2YA2A 4PUBH 4D3CL 3KXFB 4XXCC 1HSBB 4YIQA 5GS1B 5FCUH 1WQVT 4WHYG 2N1KA 5LBSH 5DC9B 5C0DB 3B8SA 5DJ2A 1T0NA 1LP9A 5GS0L 1ZGLM 5ALBH 4PGDB 2IWGA 3DTXA 1KLFA 3RGVB 4A6YB 1AO7E 4HF5L 4G42A 5I8KL 1WK0A 1UM6L 2IH1B 4P23C 1NFIB 1IGCL 2WQ8A 1NCNA 3SY0A 1MFAH 4Q9QL 2RB8A 2EZ0D 4JFEA 5HVHC 1ZA3A 3EYQC 1ZGLP 3NIDF 1FSKB 2MQ0A 3MODH 5HHNB 3HG1B 12E8H 3MO1A 3BZEB 4Y88A 3WNMA 1HNFA 4Y0GA 5J6HB 3VFOA 3HPLB 3VWKC 4EUPA 1YQ2A 3P77B 1X5LA 2APVA 2KQMA 4OFVA 4ZNCD 4LOUC 4AK1A 4CVUA 4AEHH 1DVFB 2EDDA 3HA0A 4HH9A 2V7HB 3O6MH 4XX1G 4IMLA 4LPUA 1PGRB 4X7EC 1D5ZA 4G3YL 1YEIH 1MFCH 1YEDA 1LWRA 5HD8C 4I77H 2PW2A 1T6WA 1SMOA 2RGSA 3BDYL 2Q8AL 3CXDL 3K2MC 1H8NA 4F58L 4CN6A 1D5IL 1A6VL 3BGFB 1TETL 3FRPA 3WJLC 2P24B 4M6MH 4HXBL 4RFEB 1J1PH 5A3IC 3IXTA 3LKRA 2VDPH 1R5VB 5D1ZA 5F9OH 2PF6A 3ECBB 4PJGF 3TYGH 5GXBB 5J13C 5I1EH 1LO5A 3O2VL 3HHRB 4JRWA 3HNTH 4LCYB 3MUJA 1U8JA 2A73A 3GIZH 3VXMA 1NC2A 3QWRD 1H15B 5EU6D 5DR5L 4PBXA 1L6XA 4Z0BH 3QFJB 4GS7B 2DIAA 3NTCL 4H25B 4NCDA 1XIWD 2W0LA 1A8JH 3QI9D 5JQ6L 1JHTA 3OR6B 3RY6C 5ID1A 5GISL 1JWUA 2HFFB 1OAXL 2HFEA 4MYWB 3TH4T 3K3QA 5F70A 4NO2A 4D94A 1AD9A 2YRZA 2WINB 5HYJE 1I1YB 3MLYH 5GRZA 3B9DA 2QV2A 4ONFL 3QPQC 1G6RA 8FABA 4LASL 3WFEH 2F8OA 4ZS7H 2D3VA 2VITA 2CUIA 2PTUA 2VH5H 4K9EH 1HXMB 4KROD 4PJXA 4JFPA 4OF3A 4PJDA 1N59B 1FIEA 4PLKD 1RIVH 4JDZB 2GJZA 4YDLC 5I1LA 1T21B 4E0RA 3BP7B 3BEWB 4QHKI 5T1MB 2CLZB 1WBYA 1EPFA 3K81A 4QWWD 4U31A 1S78C 2GITA 1RURL 3N85L 4QKXB 4YHOH 5B38A 4G9FB 2VR9A 4K7FB 1CGSH 1LE5B 2VLJA 1UT9A 3QUZC 2GK0B 4DK6A 5KG9B 3PWUA 4PLOB 3V6ZB 1MCLA 4L3EA 3FOMB 1NKOA 1JYWA 4KAQH 5TGBB 5BS0D 5JDJA 3PWLB 1WBZA 2VDML 2EDOA 2GQHA 3EGSA 3WS6A 2B39A 1QBAA 4QEGA 3AU1B 4PRNA 2RJMA 3LZFH 1FO0L 3ULVC 2QQKL 2DJSA 4YHIA 4N0YL 2N4IA 1OAUH 1VERA 3S36X 4YJZL 3VRLE 5MHSD 3MLZH 1QRNA 1OTTC 1BVZA 4OD2B 4O4YH 1VHPA 4P59H 1MOEA 3MXVL 1FPTH 2AJSL 2WK2A 2EH7H 2XNAB 2AXGB 2YXFA 4AH2A 3UXFA 4KPHH 5J1SC 1LD9A 5CJOH 5F89B 3ZE2E 1DJSA 1LEIA 5IFJB 4HCRH 4PJIF 4MNGA 5ID0A 3BKYH 1CFVH 2ARJB 5IMOA 2ZKHL 5HI5D 1LO2H 1NL0L 4JQVA 2O5YL 4C56B 2J3SA 3CU1A 2I9TA 4TRPH 1IGJB 1FVDB 4WI7A 2QJDA 3QIBC 2YBRA 3OKDA 4X6DA 5CINL 2EYTA 2EE3A 3GHBL 3VXNA 1TZGH 3MRBB 1F3JA 2FZ3A 3X14B 1LK3H 3IDYB 4NRZB 3T3PF 1CTNA 1ED3B 1QRKA 5CILH 2J4WH 4UUJA 3FAWA 3DUUA 3INUH 4QGYA 1IM9B 3FO0H 4UILL 1B0RA 3DUHA 4HMEA 1ZXQA 4ELKA 1DBJH 2I5YL 4KY1L 2AEQH 3QQNA 4OIAA 1DBMH 2NY3D 4NJ9H 3MGTB 3RDTB 3K2UL 4WWKC 2AV1B 4X4YB 1TIUA 1YMHA 1EAPB 4OGXH 5CJQL 2YD4A 5I1KH 5D7JD 3K1KC 3UPRA 5M7QA 2PR4H 3H7BA 4NQUA 2H6PB 3MACL 4LLWB 3MOBH 2YUXA 5GZND 1OD9A 3W11D 3IFNL 3VFWB 1I1RA 4MB4A 2FATL 4FQXD 5D71L 4AJ0A 5E94A 3LKPA 5D7KD 4ZSOB 5JNYA 3PGCB 2K7QA 4OLYL 1SBBA 2BSRA 1BBDL 5EUOB 2Y06H 4KDWA 5M95B 5DD3L 1NDMB 5CMAA 3KLAB 3ZMRA 2ADGB 2I60H 1JNJA 5IB4B 3QUMH 5DJZB 5D6CA 4HUXA 1S5HB 2XA8L 1CT8B 2I25N 4PGCA 1T20B 1F2QA 2PETA 3LN9A 1PG7H 4ZTPL 3OZ9L 5F9AC 4FTVA 4NYLB 2DYPA 2L0DA 4NZUL 4WFHE 4JFQB 4GAFB 4QTHB 1RIUL 4F57H 3I75A 4IRZH 3H3KA 3M45A 3SCMC 1UJ3A 4KGJA 1YEJH 4YWGL 4PRPA 2JB6B 4M61B 4D9QD 3WYRA 3TCLB 1VGKA 2G2RA 1KLGB 2AJYH 2RCSH 3SDAB 1F8TH 4HS6A 5IBUB 1KXTB 2MOVA 3L5HA 4OKVB 1LE9A 5A1AA 2HG5A 4Y4KA 4LFHD 4HKXA 5DT1H 5SWZE 3G6DL 3LIZH 4RIRA 4F15B 1OOAA 2IPKA 2JCCF 4Z77A 5SWQB 2VDQH 3C6LB 4IRJB 2CLRB 5EZLA 4QHKJ 3RA7L 2CKBL 3DX8B 3VG9C 5LQBL 2BVOA 5ADOH 4P23D 1KEGH 2CIIB 3IFPA 2SEBB 2Y5TB 4LCIH 4NQDD 4M48L 2ZUSA 3C2AH 2DWDA 3SGJA 1M7DB 1KEMH 4YBLC 4EI5B 1HWHB 1U0QA 2BVTA 1X44A 1V05A 3GB7A 3FRUA 4XHJC 1RQ5A 1GAFL 3LB6C 4GRLC 4MXWH 4GUPA 2OMBA 3DX7B 5I74B 1ZV5A 4WI9A 3VWKD 2VE6B 5KSBA 5E9DE 1CFSB 2NXYC 2BVEA 3QIUD 4UV7L 2KDGA 4LOUD 3BISA 4TSCH 1NDGA 4OIBA 4P9HC 2Y25A 1ULVA 1S3KL 2NW3B 4AM0B 4EKXA 3U36B 1AP2B 3GO1H 3VD4A 4L4VE 3KWWB 3EYVA 1T3FB 3KPSE 2ARWA 4H20H 2VABB 4MNHA 3H6JA 3T0XA 4OCSH 3BGMA 4Q0XH 2WZPD 1AXSA 3TVMD 1MCOH 1T03H 1NCDL 1JK8B 2BERA 3MNWA 3ARBA 4XCCH 5C0RH 1FN4A 2MPAH 1QSEE 2X4QB 2FEDD 4EXPX 4G6AC 3BMWA 2DDQL 4XCYB 1MUJA 4RAHA 3B2VH 1JI1A 1QPXA 2AJXH 1YC8A 4JY5L 3ARDC 1SYSB 5FYLH 4DKEH 4R0LC 2XN9B 2BVQB 3WV0A 3G6JA 4YZFF 3VG0L 1EJOH 4L4TD 2X89A 3BAEH 5BV7B 2EXYC 4NHUA 4D9RD 4JKPL 4TUJA 1Q1JH 2DKUA 3QWRA 1GOFA 1OVZA 2YPKA 1SJHB 4FXGB 4WFGE 5FOBB 5EU6A 3LAFA 1JBJA 4M62H 3G5YB 1WITA 5E00B 2ZOKB 3L5WA 2X9XA 3I50L 3KNBB 2RFXA 1B6DA 5IHLB 4WO4C 1UG9A 1HHKA 1XIWA 1NANI 1R5IA 2PO6C 3QI9A 4U1IA 4XCFH 1JJUA 4MA7H 3OB8A 2FHFA 4HWBH 1T1WB 1CBVH 1A1MB 1HCFX 3GJFB 1BQHB 3RUGA 4X99B 5BXFA 4Y2OA 2BJMH 3BPCA 2X2YA 4XNUH 4GQ9L 2CD0A 3P0YH 3FO2A 1PDKA 1IAIM 2FD6L 3ZKNC 3O41B 3PIQB 2AEPL 5HGGS 5DFWH 2X4NA 3CFBA 3FZUD 1XH3A 3X17A 4QRQB 1FZMA 2R2BA 2KH2B 2JJTA 3QUZD 2APXA 4IDLA 5C09E 4UU9A 5DVNA 1S7QB 5I75C 5EWIH 2FJFB 2CRMA 1QYGH 3ZDXF 4MGXA 3FONB 4XTRC 1KCRH 4PUBL 3FQNA 3ULVD 3LKSB 3G08B 4PJCA 5FCUL 5LBSL 4K8RH 3QQ4A 4JFDE 1JWSA 1XGUA 5IWLA 2XZQH 5BS0A 4KK6C 1NCBH 5IJKA 1KJMB 1QQDB 1ZLUH 1OTTD 2FO4A 5CSGA 2CKNA 4FQ2H 3U46B 2IADB 3EYUH 4X6FA 4R97B 4WTZA 1TCRB 4A6YH 3PABA 1MFAL 3KPMB 3NCBB 3MODL 3O3DB 2J6EA 5KSVA 2JTDA 3EOTH 4LNRA 12E8L 1E27B 4N5ED 2Z91A 1Y6KR 4PP1D 3HZKB 3TBWB 1BD2E 1T89C 3U6RB 3BZFA 4EOWH 1N6UA 2YEZB 1FG2B 1WISA 2GJ6D 4P5MA 1OWWA 1PY4A 2UWEE 3JV5A 4BFIA 3I6GB 2YD6A 4AEHL 1QLFB 4X7FC 5E1HB 1H3UA 4JN1L 3VA6A 5EOQH 4GRMB 3DMMA 4NKDB 3O6ML 4YPGA 1WVZA 1CN4A 2AQ2A 4U05A 1YEIL 1MFCL 3PDOB 2WANA 4F3FA 3HN3A 3MRPA 3RVXD 4HG4J 5FAAA 2ZUYA 3PUCA 5HBBA 1T22B 4MAUH 1IBGL 4WWKD 1KFAH 3L3KB 1U41A 4M6ML 4BZYA 4N8VA 1J1PL 4LLUB 2VZSA 1NAMA 2FX8H 5F9OL 5KVDH 2EECA 5FYLE 3OQ3B 3TT3H 2HYMA 5LAXB 3TYGL 1FAIH 1HSAB 5I1EL 1MCHA 4KXZI 5JPMA 3OPZH 3HNTL 3GIZL 4HIJB 2DIBA 5TQ2H 4V1DD 4P2OD 4NO3B 3V8OA 4FMKA 4ZUWB 5D96C 5I0ZA 5EA0H 1AHWB 5EO0B 3C5ZC 5MERA 3QZWG 2BY0A 5HGAA 1MCEA 1P7QB 4LRIC 5E56A 2Z4QB 2DLFL 4P46A 2X44D 3W9EB 4JN2B 3KPRB 4R9HA 1J8HB 3TO4B 1IAII 1YEHH 1KG0B 4BSJA 2NX5E 3SCMD 5HDOA 4RGNB 1C8PA 4RBPH 1MVUB 2ZSVB 5F7EH 3WFEL 4TSBH 4ALAH 2VH5L 4IOFD 4K9EL 2HJFA 3EOYG 3V6OE 5DYOB 1BECA 5J12B 2VOTA 2R1XA 1RIVL 2AQ1A 3OKOA 1CFQA 2WLZA 5E2TL 3WHE0 1Q9KA 4HJGA 4YO0B 3DOSA 1G7HA 2NY5L 2OYPA 4PJ7F 1R6VA 5DK2A 3MRJB 4XXCA 4FFZH 1U8OB 3RZCC 5DUMH 4YHOL 4XPAL 3HS0A 3P4OB 3L3DA 5DZNA 1CGSL 3ZHDA 3Q5OA 3R0MA 4DN4H 2H26A 4XHJD 5SWSA 2VWEC 3MR9B 3LB6D 4GRLD 4U6TA 4P0DA 1UVQA 3MNZA 4HIHB 4P23A 4RAVA 3QNZB 4KK5D 3HCVB 1CXIA 1AGFB 4ODHH 3RY5A 2DQJH 4M43H 4OM1H 4NWTH 2QSTA 4KKCD 3HI5H 2ICWA 5DJ6A 1UZ6F 3ZE1E 1HKLH 2VLME 3FB5A 1T2JA 4H0GA 4PG9B 5KANI 4OLVL 3AB0B 3F12A 3OMZA 1YPZB 1WZLA 1JI2A 5F1NB 3ULUL 5IG7B 2GSIA 1GIGH 1OAUL 3FMGL 3O3AB 3QP3A 3VWKA 5C9JB 3TCXA 4RRPA 1F11A 1RJYB 1OWRM 1KIQA 4O4YL 4LP5A 4P59L 3K46A 4FNLH 1N5AA 1OP9A 1FPTL 3L3OB 2EH7L 1M6OB 5IBTH 4R3SA 2DQHH 1HHHB 4KPHL 3S4SG 4X4MA 1EFQA 3CUPA 5CJOL 2BY2A 3QRFM 5EOTB 4HCRL 3BKYL 4NDMA 1LO2L 3QRGH 1J11A 1ODAA 3DVNB 4TRPL 1TMCB 1GYAA 5C2BH 3WJLA 2C3HA 1W72A 5F7MC 3VH8B 3B6SA 1MFDH 1G9NC 3NGBC 1BIIB 3CFJB 3SQOH 1TZGL 1LK3L 3BT2H 1EFXA 4GFTB 4IRSD 3U79A 5FIEA 3CCHA 2MNUA 2J4WL 5CILL 1CF8L 4ZXBD 1YMMD 3ROOA 4JREB 4G5ZH 1UGNA 1ZLWK 5E4EB 3FO0L 1SHMA 5T5FH 2C1OA 1HINH 1Y6NR 2VAAB 4AL8H 4F37F 1CE6B 4UDTB 4R7NB 4L3CA 4XVJL 4MDJB 2OQJA 1HYRC 4OBSA 3ZSSA 3MLSL 3F7YA 3G5VA 3RNQB 4OGXL 2D7MA 2NY0C 1HHIA 1UM4H 2RR3A 1GCFA 3RY6A 5C0BB 2X9YA 3ZDYF 4ZUSA 4W6YB 2PR4L 4QHNA 4M02A 4HS3B 4IMKC 4I48B 4KK8D 1K5NB 5CLWA 3TN0C 3S3PA 4YGAB 5E2WH 2ZUWA 3IU4H 4PJHA 4CVXA 1IQDB 4P4KC 1OAQH 3UAJD 1JPGB 3GRWA 4CW1A 4X6BB 4LK4A 4KTDH 2Y06L 4WCYL 3NCJL 1U8PA 2E5EA 2I60L 3BD5A 2FCBA 3O6KL 4LSUH 3QUML 3S96B 1S7UA 2X4PB 1FZKA 4LCCC 4HKBB 1MCBA 3ZYJA 1UCBL 5D1QB 1ES0B 4JFOA 3MCLH 1C5DB 1PG7L 1XZ0B 5C0AD 5C0CD 3T0WA 3UZVB 4QOKB 3I9GH 1D5BA 3LHPH 3HE6D 4ELMB 4IRZL 3H9SD 4KVNL 1R3HA 4N0CC 1VFAB 2UZXB 4MNQA 3H8NA 1YEJL 2OK0H 5GQBA 2DN7A 3ARGC 1HE7A 3NIGF 3QUZA 2O61B 5B3JE 2CIKB 2AJYL 2RCSL 3KPLB 2OZ4A 2MJWA 4OBRA 5IVXA 2IG2H 2Y7QB 3C6SB 3HI6H 4J1UA 4P48A 5DT1L 3LIZL 5CEYB 5FYKL 2OR9L 5F6IB 3C5SB 1CGTA 5GGRY 3MBEC 2JE8A 1CDUA 1BFOA 5ADOL 4M9OA 3S36L 1KEGL 4LCIL 3JWDH 2P5WD 3QDMB 4MSWB 2Z31D 3BDBA 4G9FE 1D6EB 5C07A 1KIUA 3NOIA 1EUUA 4ISVA 1KEML 4LLQA 4KRPC 3DXAD 1R24B 3DHJA 5T3XD 3GZKA 5D2NB 5DLMH 3PWVB 2NXZD 1QR1A 1EO7A 3TBVB 3F7PC 3T1FB 4NCC2 4ZOAA 3IDMA 3ARFB 5TPWH 1S7VA 4GMTH 1VFBA 5GS2D 1DQJB 4HWEL 3ZT6A 2BSTB 1F00I 5IFHH 3BIKB 5ESQB 3WE6B 4MA1B 3ZO0A 4PTUB 1I3RB 4KZDH 4ZFZA 3QIBA 3GO1L 4W4OA 4Y4HC 1NGXA 1XEDA 1X4XA 3CFKB 4YGVA 1D5XB 4KHTL 3IJYB 4U6XB 1EZVX 1T03L 4OFYA 2P5ED 4JFZH 4KMTH 1MQ8A 4JRYB 5JIHA 3NH7L 4XCCL 5C0RL 3DX9B 4Z7OF 5IB3B 2R1YB 1MI5A 4S10A 2VZUA 2X42A 3NCYP 5FECB 4PTTA 2DOCA 3QUYC 4C56E 1U8QA 1FGVH 1MFBH 3B2VL 2AJXL 4WWKA 1KB9K 1IAIH 5JPNB 2EIEA 4MQSB 1SJXA 2DI7A 3TLRA 4AIZB 4Z7VB 1IAKB 5FYLL 4DKEL 2DQFB 3EW3B 3LSOA 5C0GB 4FOMA 1DP0A 4G8FA 2BNQD 3LS4H 1ZHNA 5MI0C 4OZHA 4XVSH 4GW4A 5H94A 1EJOL 3RPIA 2QHLA 3OSKA 1D5MB 2V2TB 3BAEL 3V6FA 1UQSA 2GJJA 4JRXD 1Q1JL 3E8UH 5DWUH 3RQ3A 2NY7L 4V1DA 4P2OA 5CSZA 3MRRA 4U1GB 1KLUB 5BV7H 4M62L 5F44A 2Z9TA 3EYOA 2IQAA 5D7IB 2WIMA 5IBUG 5I6XC 5E8DH 4MA7L 4HWBL 3SE8H 1HHJA 1REIA 1A02N 1H5BC 1U92A 1KELH 3LD8B 4X6EB 1S7RB 4GMSH 3SCMA 3TYFB 2BJML 4X7SH 3DPBA 1HQRA 4YDKL 3GJFH 3P0YL 5E6ZA 4ZSOE 3WN5B 1ZT7B 1ADQA 5EUOE 5T1LD 4H26A 5AAMA 4JPWH 4P5KA 2X4SB 4X6CB 4P5TD 4JFXA 3RWIB 2WBJB 4UBDC 3MCKA 4TYUA 3MQIA 5D2LF 2YC1A 2BVYA 2F53B 1WT5C 3MREA 3LVEA 5DRXB 3RKDC 5EWIL 1NUDA 2NLJB 4HT1H 5ICZB 4QXUH 3O4LA 4ZAKB 4DZBA 1F6AB 1E6OL 1QYGL 3DRQA 4I9WD 4OLXH 4OZIA 1KCRL 4POUB 4PJ8D 3TZVB 3MRMA 2ZCLH 5CAYB 1CDBA 4GRLA 5KN5A 4R2GC 1MHEB 2QSCH 1WCBB 5H35B 1C08A 4K8RL 3JTTA 2XZQL 1MHCB 1NCBL 3QUKB 4YUEH 4LL9A 5TDOA 4FZ8L 3SKJH 3STBA 1WIOA 5CCKH 4FQ2L 1JNLH 3EYUL 1YC7A 1NFDB 4DW2H 1PJ9A 3NCYS 2R0ZL 4PRIA 5EZOH 1IARB 1S5IL 1FJ1A 3EOAA 2LAGB 4A6YL 1IGIH 1CZ8H 1CICC 3CZFB 3OR7B 3EOTL 2DQUL 2AKRB 5IMMA 2Y72A 3MYJA 2ITDA 3HAEB 2AW2A 1KV3A 1FH5H 4PB9L 3RHWF 3NA9H 2X1QA 2GIYA 4WI6A 2QSVA 4GG6F 1H3VA 2DB8A 1YEGH 4OLZH 3PWNA 4BSVA 3V7MA 1NKRA 2GI7A 4RMSA 4N0FB 3WS3B 1BREA 1QHOA 1QA9B 2BK8A 5ACZA 3ARDA 1JGLH 1KXQE 4R0LA 5FKAA 5AZ2H 3G5XB 1XR9A 1A1NB 3MJ7B 4LHQB 1U9KA 4UOJA 4N8CH 4IIQC 4IRSA 4APQD 4LEXH 2F8XC 2PXYC 1JPFA 3KHQA 3T0BA 2QTEA 1MHPL 1YMMA 4UTAH 1BQHG 5T5NF 2NY0D 5GS0C 1DE4A 4I0PC 3U9PH 5DA4A 1QFPA 2GYSA 2FX8L 5KVDL 5DJ2B 3TT3L 3MOQA 3DTXB 2EDEA 3MCG1 1B9ZA 1FAIL 4X8JA 2YZ1A 2X5PA 4L8CA 1UADC 3SGEI 4WO4A 1R5WB 3VXOA 2PO6A 4YNYA 4P4KD 2XN9E 3FB8A 1VACA 1WZ1H 1MEXH 3SY0B 1KPVB 4K71C 1OHQA 3TO2B 3UC0L 4JFEB 1YNLH 3G04A 4GKOA 5EA0L 3MUGA 4GG8B 3MBXH 3CX2A 2D9CA 5F1IA 5HXMA 4G6JH 3MO1B 4C83B 1A47A 1DEEB 3BQUD 1RHHA 1P1ZA 5CIPH 5EIQA 2C1PA 3VFOB 2VXTH 4WI5A 5HYIA 4YE4H 4HIEA 5JDSA 1QHPA 1JF6A 4L8SA 1NGYA 2W9DH 4N0CD 1FL3A 4HH9B 1ZLVK 3HRPA 5F7EL 2XWTA 4ALAL 2ZP0T 3T0DA 5C0AA 2KZ1B 3GNMH 1KJ2A 5C0CA 1V7ML 2X09A 3WFHA 1HWGB 1IFHH 2PW2B 2X05A 2RIKA 3FO9A 2BSED 3FB7B 4J3VA 5E95B 2ESVD 3S9DB 4TSAH 1IZKA 3A67H 1OTSC 3WIHH 5ANMB 5DUML 4LCWA 5ENWA 3LKRB 4NN7C 2PTVA 4Y19E 3ZE2F 1TZIA 3UJJH 2WLYA 1O5DT 2A73B 1NC2B 4PD4J 4ODHL 1XGRA 2DQJL 3FFCD 4M43L 1BX2B 2YWZA 1LO4H 4OM1L 4YHMH 2XZAH 5J1TC 4PJGA 5DVLA 1HKLL 3O3UN 4NZTH 3DXAA 1F4XH 4NO0B 2VERN 1PLGH 4MVBD 3GHEH 1AI1L 5IB1A 4OGYH 3EOBA 3ZYZA 1GIGL 5ID1B 2DICA 1JWUB 1T89A 3FQUA 4NN5C 4PJAF 2HFEB 3BEVA 4NO2B 5IR1A 4XMPH 5GGTL 5FGSA 2X1PA 4UOW1 1G6RB 1WF5A 5IBTL 2DQHL 1EHNA 5FXCH 1L4IA 2VISA 4JKKA 3MJ9A 5I71B 4YHYB 2D4DA 1MCQA 4JFPB 3VXSD 4KJPC 1BVKB 4PJDB 2CRZA 3QRGL 4JM2D 2GJZB 5I1LB 1GRWA 3WLWC 2LAAA 4NUJA 4I3SH 5BVJA 2XFXB 3CFCH 3GSOA 3IU3A 1HH9A 3FOLB 5IHZA 3QYCA 2GITB 3TNNB 3H0TA 4YC2B 3MTRA 1MFDL 4EJ1C 1V3LA 4OZGB 2XRAH 1PX4A 4JAMA 5B38B 1MJ8H 1I8LC 3BT2L 5JOPD 2C4FT 1JL8A 2VLJB 2IFGA 3UBXB 5AD0A 1OGAD 1I1AC 3K0WA 3CVIH 3NN8B 4G5ZL 4WW2F 2ZCKL 4UQ2A 3UTTA 4N90E 4L3EB 4KWUA 2QADB 1AY1H 1HINL 5IIEA 2BNQA 5B3NA 4AL8L 4RDQG 1WBZB 1T66C 5HGDA 1F3DJ 4EVNA 3EGSB 2HMID 4UTBH 5DK0A 1MHHA 1N64H 4MJ6B 3BPLC 1MIMH 3MFGB 4LRIA 3RWCA 2VDLH 1OP5H 1UM4L 4YHIB 4OKDA 5C0EA 1YN6A 5I15H 4KMLB 5C6WH 4JHAH 2CO6B 5J6GA 4NQED 1QRNB 2VAJA 1FORL 4XPBH 4DN3H 5GHWH 5JZ7C 5E2WL 3IU4L 2WUCH 1OAQL 1A6ZA 1LD9B 1AQKH 2PYED 5ACMA 4KTDL 4MNGB 1Z0NA 5ID0B 3D18A 3QPXH 4Z78B 1LNUA 1NEZA 3AGVA 1RZGA 2I9TB 4PD4K 2DTMH 1J0ZA 3C60B 4QRRA 4YEEA 3KPRE 4OCLC 1J8HE 1GVIA 2FDBP 3PWPD 4PJIA 3DVFA 4NPYA 1TLKA 4MJIA 2A6IA 4WI8A 4ZFOL 3I9GL 3LHPL 4X6DB 1YNKH 3VXNB 5L2KB 1AD0A 4RGNE 5DJYA 1F3JB 2FZ3B 2OK0L 3W82A 1HH6A 1RPQA 4KKAC 4O2FA 1IC4L 1EGJH 4OF7A 3ULUF 1EUTA 3L3GA 4UUJB 3DUUB 3Q6GH 2DMKA 4L1DA 4UV4H 4MAYC 4X5WB 4MQ7A 3IT8D 2IG2L 4P3CH 1W8OA 1TDQA 1JN6A 4O9HH 4JQIH 5KSUA 3IJHA 1Z5LA 1EIBA 1FE8L 4FFVD 4WUKH 1DANT 4ETYA 5MEOA 3ESVF 5CP3A 1RJZA 1YMHB 5FO7A 1GOHA 3GM0A 3JWDL 3UPRB 1JPSH 1RFDH 3H7BB 1XCQA 1ORQA 2VDNH 3SJVD 3CSYA 4N1CA 4G6KH 3ZYIA 3QH3B 2VLRA 5FHBH 1RHFA 3MRGA 4JGJA 4XI5D 1PVHA 5IROC 3GMQB 3VFUB 3QEQD 5E94B 1F3DH 3LKPB 1D6VH 1KTDA 5TPWL 5CD5D 2BSRB 3LMJH 2EYRA 1I8MB 3EHBC 5E8OA 5CMAB 4DUWA 1S9WB 3C8KA 3O9WC 4JPVH 4WUUD 5DMKA 5D6CB 4HUXB 1BVLA 1YPZE 3B43A 4PGCB 3Q3GA 3BVNA 2HKHH 2JJVA 1AGBA 2LU7A 3MRNA 4FFWD 5C0JB 4KZDL 1A64A 3ZDZE 3DROB 2QHRH 3MXWH 4Q6IC 4FTVB 4EN3C 2DYPB 4YFLF 4D0CA 2VZVA 3HB3C 3SGEH 1SY6H 1TVBA 3GMPB 4PRPB 1IGYA 4XMLL 4CMHC 3SDCD 3OKNA 2FX7H 4JFZL 1VGKB 1L0YA 2G2RB 3WFDL 2QQQA 1YUHB 4KI5E 5J11C 5DJ8A 1H3GA 4HS6B 5I17B 5KJRL 5GRUH 1LE9B 2HG5B 4Y4KB 4HKXB 4RIRB 4YXKH 2ZOLA 4PY7A 3CXHJ 5FGRA 1X6NA 4ODBD 2IPKB 3WIFB 4Z77B 1FGVL 1MFBL 1Q0YH 1QBLH 1GPOH 1IAIL 5I1HH 5GRJH 2NY1C 2BVOB 3IFPB 3L1OH 3LS4L 5IBLD 4XVSL 2JCCA 4IMKA 3WJJC 1ZHKA 2XWJA 4KTYA 3KPTA 4R90H 5FUCE 3GB7B 4RSVA 1BWWA 4GUPB 2YUWA 4P4KA 3U0PB 5JLZA 3I84A 3CK0H 3DVGA 6FABH 1L7TH 5ETUB 1B6UA 5DK3A 4OTXL 5JOEA 5BV7L 1N2RA 1VCAA 5JMOC 1O0VA 5CEXA 1NDGB 4KUCF 4LCCA 4GKSA 2FEEI 5DS8B 1OD7A 1E4KC 5C0BE 2FH6A 3MUY1 2XACC 4F7CB 2GTZA 1MFNA 2VUOA 5CSBA 1KELL 3EYVB 1Z0MA 3BHBA 3NMEA 4GMSL 5JHDD 4M03A 3MGOB 1EXUA 5IGXL 2X6MA 3BGMB 3LV3B 4X7SL 3UBXI 3ARGA 5EFIA 4O2EA 1D7FA 3ABZA 3MNWB 3O6LH 5CBAA 3VA2C 1W0WA 3ARBB 1OTSD 1ZS8B 1FNSH 2JB5H 3CD4A 4PREA 2DQIH 2XPGB 4F8QA 4NQCD 5EUKB 3P9LA 1MUJB 4NNXB 1NJ9A 1FNLA 2ESVA 3MBEA 4XZUB 3HUJB 1BZQK 2X70A 2YN5A 4ZQKA 5EDXA 4HHAB 4QOKE 3D9AH 4ELME 4HT1L 1MWAA 5LGHL 4QXUL 2BVUA 2NY4D 1WICA 5MEPA 3G6JB 4OLXL 4RISH 3QAZC 4M9PA 5ITFA 1VSCA 3VXUA 1AQDA 4NHUB 2ZCLL 4O5LH 3S88H 2R23A 2QSCL 4UMGA 2CXKA 3EDKA 3FCTA 4BZ2H 4TUJB 1J5OH 1QBBA 2UWEF 2IBBA 3VWJD 1YYMH 2DJ4A 1UACL 2YPKB 3BE1H 4M6AA 2ERJB 2ILLA 3W0WA 2H32A 3SKJL 2ADJB 3OJDB 1G7LA 2EEAA 3L5WB 4NNYB 3DVIA 1OAZH 5CCKL 1JNLL 1YA5A 4P2QB 3ETBF 4FQLH 2ZCHL 4JKWA 5JMRA 1QSZA 4G7VL 5CHNA 1HHKB 4U1IB 1T5XB 3QI9B 5JW4R 5EZOL 2AVGA 1D9KB 3VRJA 5I8CA 3QDME 4J3OC 4BFEA 2GTWA 3LDBC 1IGIL 4NM4L 1CZ8L 4LHJB 1ACYH 1SYVB 1XF3A 4OF0A 4EI6B 3HLAA 4OV6F 1YECH 4J4PD 5D2NE 3RUGB 5GZOC 3H9HB 4X0KB 3VFPB 1MH5A 2X41A 3BPCB 3O2DA 3QXUA 3RTQB 4CU6A 1QLRB 3EO1A 3NA9L 4NRYA 2Q6WB 1OARH 3FO2B 4KROB 3GM8A 3VXSA 4RWYL 4YLQT 2X4NB 3QG6A 3HAEH 3CFBB 3OV6A 4KTEH 1XH3B 5TH2B 4OLZL 4CVWA 3QUYA 4YR6A 2R2BB 3VXRA 4XCEA 4IOSD 4BFGA 3FT3B 5E1AB 1E4XI 2HJLA 3KDMA 4UU9B 2A0LC 5F7DB 1JGLL 4DGVH 1UA6H 4FQ1H 4OFDA 5AZ2L 1NMCC 3UTSD 1GGCH 3HFMH 4JFFD 2VB5A 4U1HA 3CGTA 1MJJA 1VB9A 5HHVH 2VNCA 4OFIA 2YKLH 4JRYE 1X3DA 3FQNB 5ILTH 1JF5A 4O02H 5DA0B 4PJCB 2FBJH 1IT9H 4ONGH 3RKPA 3IDIA 3KJ4B 1MCKA 4Q9RH 3EUUA 1I3GH 2FO4B 3O4OB 4PJFE 3RU8H 1M05A 4X6FB 3AY4C 3HE7B 4PLNC 4Z7VE 3VJ6A 1QSFE 1JV5A 1WZ1L 1MEXL 2DLTA 1NLDH 5E99H 1UXSA 4Y2DB 4NQEA 5CJ8A 1YNLL 4BELD 2LE9A 5KSVB 3IYLW 5DVKA 1JPST 4G6JL 2Z91B 3B2UC 4HWUA 5JORB 5JW4Q 3S6CA 3WO4C 4HC1A 2AXFB 2VXTL 2P43B 1JGDA 2PYEA 3JV0A 5T3ZH 3IVKB 3BZFB 4GW1A 4F7TA 3CFIC 4RGMC 5AYUH 3IFLH 4P5MB 2W9DL 4XPHH 2MKLC 3PQYD 4KRMB 4BH7B 3DMMB 3V95A 1KT2A 2OL3B 1CYGA 2APBA 4YPGB 5C08D 3GNML 1NSNH 3F58L 1MY7A 3PWPA 1LEKA 1WT5A 4ACPA 3ZE1F 3LKQA 1IFHL 1JRHH 4MA8H 4LHUA 4QNPF 4F3FB 3M8OH 2WUBH 1EEQA 3ZKXB 3LQMA 5JOFA 1T4KB 3P40A 4TSAL 1BPVA 3L3HA 4X7DC 1YY8A 3A67L 3WIHL 3U83A 4RCAA 5E5MA 1NCWH 3OG6B 1NAMB 3GSNL 2DAVA 2R9HC 3WKNA 3HAEG 3EFDH 4X6CE 4RWHA 1MCFA 2CK0H 3GDBA 5JPMB 2F53E 3B9KD 4KU1A 2FIKA 1HYSC 2ZJSL 1SQ2N 4HDIA 4FQIH 1LO4L 2C9AA 1CICA 1XF2A 2IF7A 5MERB 4YAQA 2KKQA 3OJMB 5MEQA 4NZTL 3U4BH 1F4XL 3GI8H 5EU7C 1OP3H 1SVCP 2WNGA 1J12A 3WEXA 5HGAB 4WW2C 4TUKH 5F6HJ 3GHEL 4P46B 3QEQA 4OGYL 4XAWH 3D2UD 3MV8D 4HUUA 3BKMH 3BOVA 4XMPL 2UY7A 3HB3D 4J8RA 3MLPA 5D9SA 4NN6C 3QDJD 1NFDE 4K9EC 2B8OT 5D7LD 3LPWA 4P2RE 3IAQA 2Q76A 2HJFB 4PRHB 4NZJA 5TFSL 1QFHA 4Q9CA 3L5XH 1G6RH 3BPOB 3OKOB 2NY5C 4LEOB 1GL4B 1CFQB 4IIQA 4MMXC 2DI8A 1CTOA 1G7HB 2PXYA 1OSPH 4FS0A 5F71A 1HZHH 5DK2B 3CFCL 4O2CA 2NY1D 1AO7D 4WW1B 5DVMA 1I85A 2CRIA 4I0PA 4M1DH 2M1KA 3HS0B 1QEWA 2W07A 5JHLH 3L3DB 3BIAX 3HNSH 4QRTA 1BM3L 1CGUA 4PJ7A 1EAJA 2H26B 5FYJH 2R2EB 5EULV 4MHHG 5SWSB 4I8DA 4RAVB 3VDBA 3RX7A 4M5YH 3V5KB 1AY1L 3EKCA 3NZ8A 5EU3A 3L6FA 3VFMA 2EDNA 1LVEA 4PJ9D 4Q74A 4UTBL 4MLSA 3ULUC 1MIML 3F12B 1NLBH 2VDLL 3O0RH 1EA9C 2GSIB 1HOCB 5CBEB 3OKYA 5I15L 5AG9A 5J89A 1F11B 1KIQB 3FRPG 1C16A 4MX7A 4XPBL 4DN3L 5GHWL 1N5AB 2YD2A 2WUCL 4R3SB 3D0VA 2ZUQB 3QUXC 4OCMC 2P8LB 2RAMA 3CUPB 1GZPA 4DK3A 2OLDA 4JFEE 5T3ZE 1WWCA 1PAMA 4UB0H 3NAAH 2F5AH 5KSAD 5H2BA 5A16B 2ICES 2R15A 2Y6SC 3I2CH 2AJ3A 5J6GB 4JVUA 5I73C 3B6SB 1YNKL 2VMFA 5FOJA 2F58L 3TFKC 1EFXB 2A77L 1NGPL 2AP2A 4JG0H 5C0FB 4ZYKA 4X7TA 2F19L 1EGJL 3ROOB 3Q6GL 2IPTH 2OI9C 3EAKA 3UO1H 5IMKB 4G6FB 3U7WH 2C1OB 3GI9H 4XBGB 3T2NH 3GEWB 3QCTH 4JQIL 2AAVA 4L3CB 4NZRL 1WFNA 3HI1A 4WUKL 5L0QC 3DV6A 3U0WH 3CDGA 4LSTH 3F7YB 3BUTA 3U48A 5HYJD 3V7AE 4GKNA 3B5GA 5ANME 1HHIB 1EX0A 2EDWA 4OM0H 2V2WB 1RFDL 4HJ0C 3KLSA 5L2JA 1CU4H 4G6KL 4URTB 5IHUL 1DSFL 1E4XH 4Z7UF 2ADFH 1DLFH 2Q87A 4Z5RB 5GZOD 1T5WA 4X5XA 3QDAA 4PJHB 3BO8A 3MV9B 4PR5A 4CVXB 3UYPA 1MCCA 1R3LA 1D6VL 3ZHLA 5B38G 1QKZH 4GAJL 4CW1B 3MSPA 4PBVC 3UBXG 1N26A 3FO1A 5DHYA 1CXLA 4JPVL 4YDLB 1FZKB 3WUWA 2E7CA 2FGWH 3U9UB 3RVTC 2HKHL 4JFOB 4E42B 2Q3ZA 4P99A 3MXWL 1PKOA 2EYSA 2QHRL 5DD5H 5I16A 3TA3B 2YK1H 1D5BB 3K4ZA 2GAZA 4TUOA 4YBQC 4D0BA 2CDGA 3WHXB 4MNQB 1I8LA 1ZE3C 4KHXL 1MRCL 3TH2T 2J8HA 2JK5A 2FX7L 2LTQC 1I1AA 3C5JA 4LDOB 1T1XA 1NUGA 43CAA 5IVXB 1ZHLB 5JXEC 3UTSA 1JGVH 4JFFA 2B5IB 2F9BT 5HY9A 2HT2C 5IMLA 4YXKL 1U8KA 1P5VA 1FO0A 1DFBH 1CQYA 1QBLL 1CGXA 1GPOL 4YHZH 1BFOB 4LSVH 5GRJL 4H1LB 5I1HL 5FYJE 3U2SA 2ITCB 5T1KD 2JELH 3L1OL 4GAGL 4OZGE 1G7IA 5C07B 4ISVB 4U1MA 4J6RH 1QFUH 5IM7A 2VLJE 2V7NA 3O6FB 4R90L 1MJ7H 5FF6B 1NGWA 5EUOF 1QR1B 1MAML 4L3EE 3IDMB 1K85A 1M1SA 3S5LB 3QQ3A 4DAGL 3CK0L 5GSVA 2R29H 4LF3B 1L7TL 1K8IA 1N5YH 1RUPH 3QG7L 3R06B 1UKSA 4BUGA 3CDFA 3JTSA 4LVHC 1YY9C 4LLYA 3ULSA 2G75A 4BK5A 3HRZA 4S1RH 1X5YA 3FN0L 3QIBB 3BD4A 2DQDH 4MB3A 1QACA 2X4TA 1NGXB 2J8UB 1QRNE 4D9LH 2IMNA 3I6KA 2APTA 4NQSA 4F7PA 3PQYA 4UNTA 1KN4L 1CE1H 5E6ID 4E5XA 1RJLA 5C08A 4XNXH 3O6LL 3FT2B 1I9RL 5TF0A 3HR5A 4QXTA 4MAYA 4MNGE 1MI5B 5DRWB 3IF1A 1RUAH 2DQIL 1F42A 3MRKA 4PTTB 1U8QB 2H9GB 1Q9WA 2W60B 1J1OL 3KVQA 1VKXB 4BUHA 1IL1A 4LVOC 1HYSD 3LSOB 4X6DE 4G8FB 5L2KE 1ZHNB 1Z6JT 5F9JA 4RISL 5H94B 1I9EA 1R0AH 5IROA 3N1MC 5EB9A 5MP6H 1UQSB 3TNMA 4O5LL 1ITCA 5FGCB 2FWOA 4BZ2L 1J5OL 4GBXC 1YYML 3BE1L 4HXAL 5CSZB 5K93A 3MRRB 1DQTA 3ARUA 5HHOE 3BSZH 4NC1E 4R26H 1NCTA 1ONQA 1HQ4A 1DQDH 3EYOB 2C7UA 3B8YA 4UQ3A 4WFHD 3GMOA 2IQAB 1NCCH 2AXHA 1MVFA 2C3VA 2OBGA 5LKNA 3WXVH 3BP5A 2M26A 3B5HA 4Q6IA 4BZ1L 5E4IA 4OZFB 1ACYL 5INCA 1VENA 4D0DB 3V6OC 4F80A 1B0GB 3D3VA 2X7LB 4WTWA 5D7LA 2IALB 1HQRB 5SWZD 1OARL 4Y16C 1Q0XH 4C58B 3HPJB 3BD3A 5KZCB 3F6LA 5JIIA 1V3MA 5I1IL 2G60H 2CKBA 2A6DA 2W9EH 4JFXB 1INEH 3MCKB 2YPLA 1MAJA 1WTGT 2GUOB 2DD8H 4FTVE 4DOHB 2YC1B 4WEUD 2MHAA 2NNAA 3D48R 4FQ1L 3QXTA 3O4LB 4DZBB 1J0JA 4D8PA 3OB0H 1GGCL 3HFML 3DRQB 5HPMB 3PF2A 3WJJA 2B1AH 5HHVL 1A5FH 4OZIB 1H3WM 5HGHB 4POZC 5D2LA 1QLEL 4ZFFA 4K8RC 3MRMB 1OB1B 3K4DA 5GRXG 5HHXL 5ILTL 4O02L 5KN5B 4NT6A 5GRWA 5HDQH 5CKGA 2DBLH 1IT9L 1C08B 5GGRA 3JTTB 5DHXB 3LQAH 2E8YA 5TDOB 2NXYB 3E0GA 3MROA 4ZOBA 1U8HA 4PRAA 4L4VD 3SE3C 3VFVA 3CC5A 2HTLC 3D85A 3KPSD 1A1OA 2IQ9H 1CDJA 4PRIB 4JZNB 2OMNA 1FJ1B 5L8KB 1NLDL 5E99L 2BOBB 3Q1SH 2IANB 1B3JA 1TQBC 1MY5A 1OM3H 1CXEA 4GXUM 1QSED 3I3EA 5HI4C 4ENEC 5IMMB 3QA3A 5T3ZL 1FHGA 4IHOA 3CDYA 4OGAD 5C3LD 5AYUL 3IFLL 2CDEA 2VR4A 1MLCB 4XPHL 2CLVA 4BSVB 3QNYA 2X4UA 4L3AA 5DJAA 5KSAA 4NJAL 2DQTH 1NSNL 1MELA 5ACZB 3I02A 3ARDB 4K3HA 2J12B 3K7UA 4R0LB 3VGHA 4GAYA 4GG6A 1XR9B 1I1FA 5JXAH 2OL3H 4HKZB 5D1XB 4RMQA 3HNVL 5E5RB 2F74B 3CLEH 2L4OA 4U6HA 4WFGD 4YDIH 5C0IA 3C9NA 1JPFB 4Q58C 4LGSB 3N1PC 3O11A 5CP7B 4BH8A 3BPNC 1DE4B 5DURD 3QHFH 5I1CL 3A6BH 1NCWL 3X13B 4HJ0D 2VQTA 5AWNL 4KGLA 5D1ZC 1NUNB 3DWTA 3V6BR 3HUJE 4L8CB 4G8IB 3FQXB 3EJYC 4WO4B 3VXOB 1NAMH 1FC1A 2PO6B 3LEVH 1VACB 5J57B 3U4AA 3ARPA 4FQIL 5IVZB 4CKVX 3G6JE 5IUSA 1BOGA 3IFOA 1FCGA 5FV2A 4FQHB 4Z8FH 1AC0A 5F1IB 1FV1A 5CZVL 4EXKA 4TUKL 4ODXB 1RHHB 1P1ZB 1PZUB 4OCRH 2VKXA 35C8H 3BKML 3ZKMC 4ZO9A 4HIEB 5JDSB 4YBQD 1T0MA 4X9HA 3TIDB 5C09D 4L9LC 2J5LC 1JGUH 4FQQB 1NGYB 4KUCD 4P2QE 1I8IA 4Z95H 3P9WB 3R4DA 1AGCA 2XWTB 1VEOA 4W68A 3SDYH 3BUYB 4ODSH 1KJ2B 1YEFL 1OQOA 4ZD3H 3WFHB 5I75B 5DJ0B 1H3XA 3RWFB 2YPVL 3K8KA 3L5XL 1G6RL 4AT6A 3RUGE 3SDXF 3UTZA 1OY3B 3MRIA 4PJ5A 4JFDD 1IVLA 1OSPL 4RMRA 1KUMA 1RSFA 1HZHL 1H9VA 4LCWB 4M1DL 2EH8H 3QDHA 3WFCL 3KR3H 3A6CH 5DMGC 2FEEL 1IC5H 3HNSL 4PS4H 2Q20A 3P73B 3P0GB 1TZIB 5FYJL 1JE6A 1EO5A 3AY4A 1RUQH 2B1HH 4WIQA 5T1KA 4M5YL 4DGYH 1AE6L 4M7JH 1XGRB 2HKFH 2OP4H 1PSKH 4PJGB 5DI8A 1HNGA 1BD2D 3DXAB 3AS1A 4KJYB 1NLBL 3KPNA 3O0RL 1I7UA 4LSRL 4PJCE 4YFEA 3O8XC 3EOBB 2I9LA 5ITBH 1JNHB 4Z0XA 4TTGA 3OAUH 2XXCB 3FQUB 4LAJH 2D7OA 2IH3A 3WKML 4RDQF 3BKCH 3GSXA 4HWNA 2ZNXA 4WU5B 4N8VG 5KVFL 3GKWL 3IAPA 5FM5O 5FM4A 3HZMA 1SEBA 4PJAA 3A0OA 3N1GC 5CJXC 1SVZA 1P84J 2BX5A 5EOCJ 1A14L 4UB0L 1NBZA 3NAAL 2GT9A 2F5AL 1V7NH 4XPTL 4NUJB 1EEYA 2XG5A 3KPPA 2YSSA 4JQVC 5DFVC 5FYLD 2OR7A 4DQOH 5LJYH 3I2CL 2KPNA 3GSRA 3GSOB 3IU3B 3L95A 1FP5A 4LCUA 2CR6A 5D93C 5CZXC 4ZDHB 1OAYH 3VCLA 1MF2L 1OF2A 4XAKE 4JAMB 3Q5YA 3SDDD 2Z8VC 4JG0L 4J3UA 5KS9B 1AFVH 5DRNA 1PKQB 4YPJA 4UQ2B 1VFMA 2IPTL 3UTTB 1FVCA 5K59E 2W65A 1P6FA 3GI9L 1YPZF 1Z9OA 3QCTL 1XFPA 1Z3GH 4NZDA 5D96B 5HGDB 1BJ1J 1P69B 3C5ZB 5LCVH 3RFZC 5DK0B 1MHHB 3U0WL 1TVHA 2ATKA 4WW2A 2DQGH 2NX5D 5GIRA 4EBQL 5C0EB 4OM0L 5A43C 4XNMA 1BWMA 1E4XL 4WI2A 4YK4C 5DC0A 2ADFL 43C9A 1DLFL 3FFDA 4KI5F 5BJTB 3MZTA 1RY7B 1YEKL 4LFHG 1RZJL 1HILB 3M07A 1QKZL 4XNQA 2YUVA 2EC9T 5FYKU 4OSUH 3TPKA 1F2XK 2Q3AA 4LLDA 5KTEL 3D18B 4QXWA 1NEZB 1UYWH 3U30C 1RZGB 2FGWL 5SWZA 4QRRB 2EE2A 1Y0LA 1XF1A 5DEGA 4F37K 5DMYA 2D03H 4QY8A 3MA9H 4MJIB 2A6IB 2FL5A 4K7PX 1RZ8A 2BDNH 2YK1L 4P2CG 3LQZA 3RZCB 3UP1A 4RAUA 5DD6B 3CFEA 1AD0B 5DJYB 1VFUA 1ZA6B 4QHLB 5TE4H 1D3CA 2Q86A 1U95A 2WWMC 3ZSTA 4K3EH 3IDNB 3FT4A 4O2FB 4POZD 1CR9H 4RRPG 2OJZH 4PRHE 2AI0H 5GGVH 2VLMD 5EOCH 2XYCA 5GRYA 3EO0B 4MQ7B 3PHOA 1AGEA 1JGVL 3LEXA 5J56B 3T3ME 1UKTA 1KJ3H 3IJHB 3RP1A 1DFBL 2A74A 2K3TA 1G7MA 3ALXA 3JWDC 1T1ZB 3RGVD 4Y5VB 1PZ5B 5FO7B 2VXQL 1P84K 2JELL 1W2KT 3LKOA 3EJJX 1XCQB 4XC3H 1ORQB 4H1LH 2VLRB 3H3BC 2O5ZH 3MRGB 1MRDL 5IW6A 4ENED 5HI4D 2ZUVA 5SWSE 4EI5C 3CH1A 3VW3H 4HCRA 1YEEL 1BJ1H 3QUXA 1S9KC 1KTDB 5F9WC 1FFNA 1RUPL 2D4FA 2EYRB 5I74C 1U8IA 5EU4A 3C8KB 2EZ0C 2GFBA 5DMKB 1QSEA 4ELMF 1P6AB 5E8EA 4S1RL 5EBMA 3BVNB 1E28A 1AGBB 1M7IA 1UB5A 2DQDL 1GGYA 4ZUVA 1JF1A 3LN4B 2IMMA 4U3CA 5KVMC 5H37G 3SBWC 4D9LL 4D0CB 1JZ7A 4NRXB 3NGBB 4S2SA 5DQDL 1MPAH 1KTRL 4S1SL 5GSRA 1CE1L 3QEHB 2BSSA 2XY1A 1FL5A 3OKNB 3FQWB 2O5XL 2FLBT 3FN9A 4X4ME 4CRPA 2FO1A 5IB2A 5DJ8B 1S7WA 1RUAL 2GY7B 1WAAE 4YDVA 3S7GA 1Z2KA 4K3DH 4XH2B 1UH3A 4Z7QE 1OPGH 4U7SA 3V2AR 2P8PA 3EJYD 2NY0B 4L4JA 4LQFH 3SKOB 4KKNA 4TQEH 3NIFE 1I7ZB 4XVUD 2C5DC 1ZHKB 4ZG1A 2XWJB 4F33A 1R0AL 5GGUB 1MCPL 3TN0B 5MP6L 3H3PH 2HLAA 4LSSH 5BV7C 5JLZB 4N9GB 3S34H 2QL1A 5FV1L 3DVGB 1UH2A 3ZKMD 3QUMA 3ZKQD 2I27N 4R26L 1N2RB 3OKMA 1DQDL 2D0GA 3KYKH 4LCCB 4GKSB 1NCCL 5I8OH 3RVVD 1YN7A 3MLXL 3WXVL 3TJEH 1IQWH 4X9BA 1FZOA 1ZLSH 1XIWC 2GTZB 5J1AB 2V9TA 2H3NA 2BNRA 3BHBB 3X12A 5CGMA 4BJLA 1EXUB 4H1LG 3V8CA 4PJHE 3MV9E 3ARGB 3TWCH 4OZFH 1AKJB 2VN7A 4G8GB 4UNUA 5EFIB 2BHYA 4O2EB 1Q0XL 1K6QH 4X4XA 5CBAB 1W0WB 3VFTA 4PJFF 3LPFA 3WMSA 3MLTA 1FYHB 1ZKAA 4LVNC 4WGWB 5JXEA 4PREB 1N4XH 5MENB 1TENA 4Z7VF 1TTFA 3OKKB 5HGBB 4JFDA 4PLKC 5ERWA 2W9EL 1INEL 1WBXA 1EBPA 3MBEB 2BY3A 4G9FD 2X70B 2DD8L 4HGWB 3VI3F 3OAYH 4OB5H 1XF4A 1MWAB 4FQJL 4QWWC 1CXKA 1UWEH 4MNQE 1MAKA 5MEPB 4MWFB 1X5XA 2DL9A 5ITFB 1S9VB 4KRPB 3VXUB 4YHNA 1NBQA 1T0PB 1AQDB 1HKFA 1W8NA 4I18C 2R23B 5DHVA 3FCTB 2DBLL 5IVXE 1JGEA 4Z7WB 3TPUA 3RWDA 3TBYA 3W0WB 2H32B 4DKFH 2B0SH 5IJKC 1G7LB 1BD2A 3QCVL 4G9DA 5JA9A 2M2DA 5CHNB 3JBG7 1ETZA 2UWEA 5EBWA 3VRJB 1WGOA 2GTWB 4GW5B 4Y4HB 4P9HH 4GOSA 3Q1SL 5C07E 4UDUA 2ZUTA 5I0DA 3T77A 2CSPA 1XF3B 1OM3L 2ATPA 4JY6B 4HKJA 1MH5B 4OLWH 2XZCH 5DFVD 4PG2C 1U2CA 4NRYB 4C56D 5TQ0H 4ZO7A 1VADA 2DM2A 3V0AC 4X6CF 3DURB 3L3JA 5CZXD 5TDPA 3CMGA 2FB4H 4WHYH 3KPQA 1A7QH 3QUYB 2Y36H 1OCWH 4XPFH 4YR6B 3NACH 3VXRB 1J1XH 1X5FA 3O3EA 1W0YT 1BP3B 2HJLB 2DQTL 3KDMB 2MTPA 1K9TA 2HT4D 2IPUK 2CDFA 3CH8A 2J8UE 2E7BA 5BO1L 3DNKA 3F8UB 4R6UA 3F7VA 5MI0B 4MCYA 1K4DA 2OL3L 3DV4A 2V5RA 1IEBB 3VU2A 2ZSWA 4YDIL 4JJ5A 4CN1A 1T7XA 4OZFG 2DWEA 1U8LA 3RDTD 4JANB 2H41A 3LRSA 1FLTX 1MI5E 3QHFL 4GBXA 3A6BL 3IDIB 4M4RA 2PCPA 1CL7I 1QO3A 3CAFA 3RHWK 3P4MA 4AMKH 2ZUXA 2QQNH 3NCCB 5D4QA 2NY3C 1M05B 3UDWC 4HWBA 4N1EA 5I6XB 1VPOH 1NAML 1ZGLA 4BQCA 2I26N 1JNNL 5DJXA 3L7EA 4PGEA 5HHMB 1TQCC 5D7JC 1H5BB 1UEYA 3QJFA 4Z8FL 3D0LA 1X5KA 2JLLA 3V6OA 4XPGL 3MRCA 5GZNC 4G80A 5FA4A 5FGCE 5DZLA 4OCRL 5FKPA 1TZHA 4QGTA 35C8L 2W9LA 4Y16A 2J88H 3MV7A 1FYTA 1WWAX 4GW1B 4O58H 4F7TB 4FQXC 4K3JL 4U1NA 2HFGL 4LLMA 1RULH 1FNEB 1MFEL 2LVCA 1KT2B 4RGOH 4RGNC 2AS5M 5JQHC 4ODSL 2B4CH 4HPOH 3ILPB 4XNYH 4ZD3L 3SGDI 3EDDA 4DJMA 5E8NA 2APFA 1UWXH 3QZWB 3O81A 3SDAD 4FXKA 4LHUB 1Q8MA 4L8DA 4KV5E 1KJ2H 1BLNB 1JFQL 4JVWA 4Y8DC 3UCRA 3L3HB 1YY8B 4R2GB 5GJSH 3WSQH 3G6AB 3C6LD 4IRJD 4PV8B 2AABL 5I8EA 1FQ9C 5KBNC 5E5MB 2A6JB 1HSBA 4G6MH 1UWXK 3KR3L 3UMTA 3A6CL 4PS4L 5C0DA 4WY7L 3KYOA 4LPYA 3AREB