4UT9H

Crystal structure of dengue 2 virus envelope glycoprotein dimer in complex with the scfv fragment of the broadly neutralizing human antibody ede1 c10
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
EVQLVESGAEVKKPGASVKVSCKASGYTFTSYAMHWVRQAPGQRLEWMGWINAGNGNTKYSQKFQDRVTITRDTSASTAYMELSSLRSEDTAIYYCARDKVDDYGDYWFPTLWYFDYWGQGTLVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN E
publication title Recognition Determinants of Broadly Neutralizing Human Antibodies Against Dengue Viruses.
pubmed doi rcsb
source organism Dengue virus 2
molecule tags Viral protein
total genus 24
structure length 127
sequence length 127
chains with identical sequence I, J, K
ec nomenclature
pdb deposition date 2014-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ut9H00
2NY6C 2AK1L 3C8DA 3L6FA 3QUKA 4M1CD 3WDIA 1FFQA 4PRDB 3GSNA 1CR9H 3HR6A 3QG7L 2D0FA 2OK0H 4LQFH 5LGHL 1KULA 1Y0LB 4LLUB 5DWUL 5HTSA 1KCRL 2VABA 2C4XA 1A9BA 4ZPTA 5FGSA 1AXTH 3MREA 2CXGA 1X7QB 2QBWA 1NL0L 5AUMB 3A67H 4OCMC 4WWKD 3M17A 2I9LB 3EJZC 4HDIA 3FFDA 5D9SB 1GZQB 1SVZA 5DJ0A 3WO4C 4I77L 3EDDA 4PREB 4P9MH 5CJXA 1U8LA 5EOQL 4Z6AT 5GS0L 3DPBA 4YEEA 3VFUA 4U6VL 5E03A 5D71H 4DTGL 3O45B 3DO7B 2A6JA 4YHML 1A1OB 2EKSB 4IRSB 4ZUTA 3QJFA 1LVEA 2G2RA 1IQDB 3SQOL 4CVZA 3L7EA 3BEVB 4R7NB 4GAYA 4P9HH 4P2OD 3KWWB 5EDXA 3SKMB 2XQBH 3ZZ1A 4K9EL 1UB6B 5CHNA 3U4EA 1G6RB 5EU6E 1KJ2A 1RIUH 5A3IC 2AEIT 3MRGB 1EEZA 3NFSH 4RQQB 1DLHB 2MCPL 3ZDZE 3C8HA 4N5EC 1QLRA 4U6YA 4LKCB 5ISZA 4UDTB 4XP6H 3D18A 4I3RL 1FO0B 4R90H 1M7IA 1QOKA 2OR9L 2HFEA 3N1MC 4J7RA 5DJ8B 5HGAA 3IJYA 4DZBB 4RAVB 4AMKL 5B4MC 4NFBA 4KGJA 1J87A 5D6DC 1I9JL 2MSPA 3FFCA 2NZIA 5TE7H 3QPQD 3V6FB 3OWEA 5JXAH 5T1KD 4V1DB 3PGCB 1G7LA 4HIIB 4I48B 2J6EA 1FSKB 1MCOL 4HKJA 2HJKB 4H1LB 1DQLH 4G42A 3AU1A 1IVLA 4QRUA 4TQEH 2DQGH 2DQDL 1OGTB 3MGOA 5JW4N 1QLEL 1DEEB 1P84K 3F7QA 3HE7A 1I3VA 4KI5C 4PJFA 4YR6B 4HD9A 2MQ0A 3WO3B 1DUZA 3MLSH 3QQ4B 2AK1H 2CDFB 2LQRA 3HNTL 4CADA 4OLZL 2WZPD 4N1EA 4P2QB 4HUVA 3QG7H 2V2XA 2VN7A 4R2GB 5E8PB 2VDOH 1VCAA 4G9FE 3KLAB 1CYGA 1NMAH 2OLDA 4JRWA 4JDVB 4NQUA 4BZYA 2PF6A 1HDMB 1NL0H 2VXSL 4I0PC 2ZUWA 4D9QD 5I71C 1G6VK 5DDHB 4RGND 1JZ2A 4I2XB 1P1ZB 2G5BA 1W8OA 5GS0H 1YEKL 1YNKL 2Z8WC 5TJWK 4PJ9A 4QRRD 5L2JA 2XG4A 3QG6A 3P11H 1A3LL 5E2WH 1FGNH 3OKYA 3DRTB 3X17A 5JQ6H 2CMRL 4MDIA 4X8JB 3V2AR 1IGYB 3Q3GA 1CIUA 3T8XB 4R4BB 3QI9D 4XPHH 1DDHA 1F4YL 4PB9H 3OKOB 1HOCA 1IAKB 1MRCL 1HHHB 3DARA 4YE4H 5MEQA 3N9GL 2AP2A 3GJFA 1L0YA 3RRQA 5E7BA 2DJUA 2DMKA 4PRHE 5IVXE 1TETL 1O5DT 1EJ6A 2HLFD 1GAFL 3DX6A 5FKPB 4NQVA 4FA8A 1IGML 4EI6B 1CF8L 1U8MB 4CU7A 2IBBA 1EZVY 4HK3N 5D1XB 4G6KL 1K8IA 3VFNB 4AMKH 2XXCB 5KSAD 1GGBL 3MNZB 4ZUSB 4D0BB 4IHOA 1ZMYA 5I18H 4ERSL 1NUGA 2XZQL 1NGZB 5C8JB 2Q86A 5GXBB 4YDLC 2VLKB 3HNVL 3MJ7A 2UVEA 4GRLA 4WEBL 4LSUL 5E5RB 5E2VH 4KK8C 3DNKA 4P4RA 5F7UA 4IMKA 3W39B 1WGOA 5LWYH 4M43H 4M8QA 5FKAA 4N8PA 2WANA 4KH2A 3VXRA 2Q76B 1KPRB 3STLA 3VXNB 2RFXB 4QTHA 1A6ZB 3HNTH 1QR4A 2YPLD 3LV3B 4KQ4L 4MXVE 3Q1SH 3WXVL 1VENA 1PY4A 1A7NH 5SWSD 2GAZB 2GJ6B 2YZ1A 4G8IA 3WUWG 1J18A 2XN9A 2BXZA 3VXSA 4JHWH 3QUXC 4S10A 4Y16C 3G9VA 1DN0B 4ZS6C 2VXSH 4BSWB 1FN4A 2R2HB 5E8EB 4XRCB 4OFDA 4UT9H 3T0AA 3WO4B 3PHOA 2C3VB 1RZJH 5FO9B 1YNKH 2VITA 2AGJH 4R97B 1A3LH 3P9MB 1IC5H 3K7UA 1AGEB 2P24B 1ZAGA 2CMRH 2DQUL 2DRUA 5DURB 3R06B 4NFDA 3QWOA 3VGAC 3ESUF 3MLRH 3FCTA 4ELMB 3SCMD 3BWAA 1INDL 1NMBL 4EN3A 4F7MA 1F4YH 4FQ2L 5DTFB 1MRCH 4P99A 2FX8L 4FFYL 3H7LA 3QCUH 1AD0A 3SDXB 3UPRA 4XBEH 3VG0L 2AJSL 2VXVH 2VSCA 1ORSB 3I75A 4Z77B 5MEND 3BZEA 2FEDD 4JM2D 1IGMH 2AW2A 2QR0A 5FA3B 1OTTD 4GFTB 2EO9A 1CLZL 4NOBA 1P6FA 1JL8A 2ZP0T 5FB8B 4N8CL 2UYLA 3M07A 4IM8A 2XZQH 5LQBL 4A6YH 1MI5D 2WIIA 5LG1A 3BP5A 2YBRA 5MI0C 4LEOB 3FRUA 4LSUH 4K07A 4I4WB 3EYVB 4GMSL 5J8OA 3JVGC 5D7IB 3RL1A 4MQSB 4AG4L 1FYTE 1UB5B 5DR5L 2F58L 3D9AL 4ZFOA 2R69L 3VFWA 4WW2B 4UOJA 1I9RH 3GSRA 1U3HD 1R5VA 4OIBA 5HDBF 2BNQE 1TZHB 4HS8H 5EU6A 3TBSB 3HC3L 1KGCD 4RSVA 2VLRB 3WXVH 3BW9A 1AGFA 4S2SB 2CKBB 4QNPF 1JYWA 3RVUD 1XR8B 2OXGA 1HSAA 2APXA 3ET9F 3HZVA 2HVKA 3BIAX 4I0PB 4KUZH 3IDIA 5HVFB 1T03H 5A1AA 2X4PA 3PP3K 4LCWB 2YD1A 1LMKA 3HRZA 4GS7C 3MLUH 3LEXB 5DHYB 2HP4A 2HRLA 2D2OA 1TVHA 2IQAB 2B2XH 1F90H 4K7PL 2QQKL 5K33A 5F1KC 3IDGB 4MZ2A 2DQUH 3FB5A 2Z4QB 2VDLL 4V2CB 2JB5L 5JXEC 2P47B 5KVMC 4NQCB 1NMBH 1T1WB 1UKTA 3N1GC 1GIGL 3KYMB 2AJYL 2JCCF 2APBA 1MJ8L 3I50L 2OP4L 2FX8H 3BYTA 4MNQD 3RWIB 5KS9F 3P0GB 3T0EC 2DKSA 5KVEL 4MJ6A 5ANMB 4JN1L 2W9DL 1H8NA 1PKQE 4HS6B 3O0RH 1GOHA 4G8GD 2BY0A 3ZYIA 1TCMA 4IOIB 1CFSA 4UOW0 4N8CH 4ZDHA 1ZT7B 4KU1A 4WGVB 2VRAA 4IRSD 4H25B 4LVHC 5E6ZA 2G9HA 3QIBC 3S5LA 3WFDH 5BVPL 4XNYH 1T6VN 4IRJA 4J8RB 1B0GA 3BOVA 2GFBA 2XWJA 4RAHA 3PDOA 4KC3B 1CDUA 4XC3L 4N0YL 1IGIL 2XWTA 5DR5H 3D9AH 2BOBB 4OZFA 1QBAA 4RX4D 3OMZA 4YHPA 2FYYB 1A6UL 2Z91A 1GHFH 2EDKA 2VUYA 4Y2DB 1KJ3L 5JW3L 3GGWB 2DLTA 3HC3H 4Y4HC 4JDTH 3MYJA 4Q6IA 4J3WA 1MCWW 5KVGL 1T3FB 4M9PA 4PRHA 5IVXA 2NY5C 3D6GA 4F3FB 2XTJD 1MFDH 4UQ3B 1B88A 3BX7C 5ICXA 1UM5H 4L8SC 1N4XL 4JPVL 1ACZA 1RJCA 1OW0A 5EB9A 1JZ5A 4X9FA 3LDBC 1LDPH 4L3EE 3QZWG 4JRYB 3VGFA 4WUUB 1UG9A 5IHUL 4FQXA 1OAQL 3D85D 3M8OH 4OD3L 1CFQB 1BHGA 4K7PH 3GMQB 1Q1JL 3T1FB 2DJSA 5I75B 4WTXA 2CJUH 2BERA 2E5EA 4AK1A 4MJ5A 1A4KA 1FFNB 2VISB 2VLLB 2JB5H 1BQHB 5ILTL 4P2QD 1KCLA 3HMXL 3VGAB 4PYGA 2ICEA 1JK8B 3PNWB 1IMHC 1YN6B 2XFXB 4YXKH 2OP4H 5ACMA 4XP1L 5ALCL 4CUCA 1SBSL 4LHUA 2ICWA 3VDBA 1IGTB 4UT6L 2W9DH 1JF1B 4LLMB 4X6EB 2B5IC 2VDKL 4Y5XA 1ZWIA 1IGFH 4WNQB 3C5SA 3SQBA 4DFHA 4KY1H 4JKKA 2A6IA 5DUMH 4WO4A 3U2SB 1V7NH 2XZAH 5C0AD 1JNNH 4M4PA 5BOZG 4RBPH 1A3RL 4OM1L 3A6OA 3MUGA 4GXUN 2EYSB 3O3EA 4FQCL 4X7CC 4M9OA 3MTRA 2PO6D 1HKLH 5E1AB 5DVOA 5HI5C 5IBLD 2R1YA 4GAJL 1GRWA 4N0YH 5EU5B 1Q0XL 3BP6B 1C12B 1TVBB 3KLHC 2EXWD 3HFMH 3MCKB 3D3VB 5E95B 1WQVT 3FO9B 2DMCA 2XZZA 5I1GH 4Y2OA 1AI1L 1AQKL 4RFEA 1I85C 2ATPA 3L5WB 3CDGB 2AJ3B 2GW5A 4AL8H 5D1XD 2R0KH 3TYFA 1UWXH 1A1NB 5KVGH 4Y4FA 1KNOB 2VB5A 2FJFB 1I8KA 3MJ9L 2Z31A 2PKDA 1BVKA 1U8HB 4JPVH 4R9HA 3O8XA 4CAGA 4NHCH 2VLKD 1UQSB 2OMBA 4U1IA 5C0NC 1MEXH 2B4CC 3T2QA 2V2TA 1N6QL 4LLDA 3S3JA 2ENSA 4HUWB 1OAQH 2J5LB 2IANA 5B8CA 5CEYA 4JB9L 1W2KT 3QULA 5DJ6A 4X99B 1A5FL 3BAEH 3FQNA 3T0VA 3UTSE 2NY6D 1YUHB 4NC1E 4NIKB 3MRCB 4D0CA 5GGRY 1C5DB 3QRGL 3SBWC 4OZHF 1FZMA 2EZ0C 2FX7L 3WS6C 3GSXB 3LN9A 5ALCH 1SBSH 1FVEB 5IEKA 3UYOD 3CFBB 3VD7A 2GITA 1NC4B 3DURB 2BNQA 4YDKH 1MFCH 3K1KC 2JCCE 5EWIH 3EJZD 1JVKA 5DD6A 5T3ZL 1J0YA 5CBAA 1KEGH 1J8HD 4NC2B 1ZVSB 1KLFA 2GK0B 1GL4B 1CGUA 1HH6A 3KPNA 4TVPE 2SEBB 3CSGA 4LVHB 5JW5B 5F93C 4ZFZA 3PWNB 2H2PC 2KH2B 3L95B 3HG1B 1BFOA 5DURD 3ZTJH 3PWPD 1XGQB 2GIYA 4HBCH 3TO4A 4DK6A 5DGQA 5A3ID 1HQRB 1Q0XH 4ORGA 4NNPH 2H1PL 4P4KC 4DKEH 3O6LL 4N5ED 5H37H 1T1ZA 4N8VB 4KDTA 3UBXA 3RKDC 5DC0A 1ZHLB 1A6TB 2MQ3A 3H7BB 3WUZA 4GKNA 5M95B 4Y4HB 2QV2A 2MKWA 3P77B 3RDTA 2CIKA 4C83A 3WNMA 3TVMA 5D2LE 1SJEB 2H8PA 2JJVA 5B4MD 1WEJL 3O3DA 3GRWL 4PY8I 1FZKA 4L8SB 2FD6H 1K85A 3F6LA 3L1OH 1IAII 4WU5B 5C08E 4XXCC 5HHPA 4JY5L 5J11C 2VWEC 4N0RA 4XNZC 1H5BB 2ZG2A 1ZLVK 1N6QH 3Q6FA 1C7TA 5IUSA 1UENA 3DVNB 1ZT4A 4HZLB 1ONQA 3ZTNL 5IB2B 3O6FA 1FVDB 3SGEI 3BRDA 1PZ5B 4URTB 4PJBE 4KI5D 2NNAA 4JB9H 3GUTA 3BQUC 4WRLA 1N59B 2VAJA 3BVNB 2WSKA 1JYNA 1TITA 3QRGH 3QEGL 4L3CA 4FRWA 2DM2A 4M48H 1A7PH 5GIRA 3S35L 5B3JF 4PTUB 3MOBH 4PJXE 3OAYH 1BZQK 2DYPB 1S7VA 4HC1H 3MUJA 4F37K 1HH9B 4O5LH 1QBLL 3BZDA 4YHIA 4UZGA 4K94C 3V5HB 3V9FA 1G9NC 3CDCA 1AGDB 5DZLA 2W0FA 4I0PD 1EZVX 1IAIL 1XF2A 3VE0A 2B1HH 2MKLC 2DLHA 2XXMB 5C0EA 5CIPB 1F4AA 2ZUVA 5D5MB 3ARBA 5IGXL 1T0MB 1FG2B 5E0QA 1KIRA 4H5SA 1BFSA 1XGTA 4K3GA 5DJAB 4MX7B 4L3EA 4KVCL 4FQHB 3KJ6H 5GSVB 2BVUA 5ESQA 4JJ5B 2NY7H 1MJUL 5BMFL 2OBGA 4PJIA 3NIFE 3NABL 4PJHE 1NBVL 4Y1AB 5ALBL 3MRFA 1CN4A 1FG9C 3MLVL 3IJHB 2WW8A 1FZJB 3OXRA 5I8EA 1WFTA 3AMLA 1K4CB 4PJ5B 5JNYA 3IU4L 4UIMA 1AC0A 4Y4KB 3D39D 3VMPA 4NWTL 5KZCB 4U2YA 3VXTA 4ONFH 4TTDC 1YN7B 1J12A 1MHHA 2FBJL 2X4NA 3BUYB 4BM7A 2ARJA 2FO4A 3MCLL 3O6ML 4M7LH 1SEBB 3H2WA 5C09E 4KK8D 3BGMA 3RNKA 4QXGH 1FHGA 4HCRL 3SDYL 3ARFC 2Q7YA 4WCYL 3U9UA 4OD2A 2AK4E 2QQNH 3GHEL 2FR4B 4ZUWA 2DLEA 4GMTL 5CJBA 2L4OA 4UT7H 4ZNEE 2YSSA 3MO1B 4JRXA 2X9WA 1NFDB 3QEGH 3S35H 1JV5A 5EZJB 1BPVA 5JA8B 4LAQH 2ZG3A 3NCBB 3JTTB 3OKDB 1D5MB 3ROLA 1E4KC 5DUBB 5D7LE 3CSYA 3QUXD 4EOWL 2WV3A 3JWOC 4Y16D 4ZS6D 1YEDB 2ZOLB 5DQJB 3IRZA 4OZ4A 4P3CL 4Q2ZB 1OAKL 4XGZB 4JREC 3WDJA 1UZ8B 1N0XL 5C6TL 3ALPA 3UC0L 3ZKSD 3SE8L 2H2SC 4Y5YA 4JFEE 4LGPB 1RU9H 5JDSB 1D6EB 3SGEH 3F5WA 2QHLA 3GMLB 5IGXH 1JGDA 4M1GL 3LY6A 4MAYA 3GMNA 3WV0A 1KC5L 2ZPKH 5BMFH 3RIFF 1N64H 1HYRC 4LLYB 3SPVB 1KN2L 1MF2H 4UQ2B 1MREL 3NTCH 1EPFA 4WI2A 4XTRC 1LHZA 3IJSA 4O51B 3VG9C 3UZVB 2NR6C 1YA5A 1EMTL 1LQSR 1V3LA 4L9LB 4NDMB 2GCYA 2YEZB 1UM6H 5I1AB 4PJGB 5KVFL 4QOKE 3IU4H 3B2VL 3OPZL 5L8LB 3DX7A 1WCQA 3S4SA 1KG0A 1VFBB 1F13A 4XCYA 4KTDL 4K7PY 1DANT 4Z18A 1NGWB 3VXOB 4B5EA 3TH2T 1XF4A 3P9LA 1T4KA 4OBRA 1YJDL 4XAKE 3P4MA 4HCRH 3CX2A 3DX9A 4NO0A 5IVZA 3SDCB 3W9DA 4NNYA 5L0QB 5CP7B 3PWVA 1AJ7H 4IDJH 3UTTB 1A4JB 3P73B 3MV7B 4JN2B 2DL2A 1IARB 1IM9B 3BQUB 3N85H 4JZNB 4NNXB 3ULVD 3GSUA 4IIQC 4S1QH 3NVQA 2DIAA 4AENB 3V4VH 1RFDH 3GIZH 4DUWA 12E8H 4X4ZA 4L1DA 5DHVH 3LN4B 4O9HH 3QRFM 3DGGB 1EO8L 3SJVB 1XZ0B 5DUPL 3WEXB 5K9OA 2NW2A 1JUFB 1MLCB 1ADQL 3OXSA 4TULL 1X5FA 2OR7A 4EUPH 3MXWL 3PWLB 3OR6A 5D2LA 3RWHA 5EORH 3NZHL 5GRVL 2F74A 4HAFA 4OQTA 3JTSA 1C1EL 2FZ3B 1BD2B 3OHXB 2JJSC 5C08A 1QRNB 5J7CC 3L5JA 4M1GH 5BW7C 2NY1B 4YHOL 1NBZA 4NQED 5EOTB 1R0AH 1TCRB 1KC5H 5JXED 4OZIB 1DANU 1CZ8H 1KN2H 3EGSA 1MREH 1F6FB 4PJBA 1ZHKB 3B9KB 4LAJH 3EYQC 2PR4L 2C4FT 4CNIB 5MHSD 4Z7NE 1EMTH 3T0ED 3QDGA 3ARQA 4KV5F 5BVJA 3B4NA 5KVFH 4WI6A 5SWZB 2YXMA 3B2VH 1JPFA 5CZXC 4AZ8A 4M7JH 4PJXA 5EIIA 5DVLA 2CRYA 4U7MA 5DMJB 1EV2E 3DJ9A 4KRLB 3KR3L 35C8H 5JHDB 1CD1A 4DKDC 3FO1B 1ZANH 3PV7A 3BMWA 2C3WA 2B0SL 1NEZG 3QIBD 1EHLH 3V4PH 3LPGA 3QUMH 2Q87A 1IFHL 3QBTB 4IOFD 1TJIL 1AO7D 2YWYA 1VEPA 1G7QA 1JWUB 2I26N 3WL9A 3TA3A 3H0TA 1UC6A 4X7TA 5GRZA 1KJVA 1E27A 4ELMF 1AGBA 3FN0H 2JLLA 5KG9A 1HHJB 1NLBL 1XCQA 3S37L 3RGVC 3RWFB 5LGJB 4HIXL 3SHSA 4U49A 3QNZB 3JV0A 4Y5VC 2J88L 4PJEB 2X4QB 3SDXF 1DBBH 5IF0A 1MWAL 4NSKB 2LU3A 4NWUL 1IEBB 3RTQD 3T2PA 2Y07L 3KXFD 1NBYB 5TPWL 3TYGL 5I16A 1Q9WA 4P5MA 2ED8A 3GM0A 3SGDH 3VDAA 2OJEB 3VXUE 1BGXL 1J0KA 2E9IA 3T4AA 3ZHKA 4OUUA 1NFKA 1YC8A 5E8NA 5IM7A 4KUCF 4O2CB 1JGLL 2D03L 3QO1A 2C4FU 5IROC 3G6DH 5DZOA 1AKJD 1CS6A 4NN7B 3HI6L 5TDOB 1IE5A 4JFXB 3T3MF 3OR7B 3MR9B 5EUKB 2P5EB 1NCTA 5EC1B 5E6IA 3T04D 4YDVA 3H9SD 1WSST 5E08L 4K8RC 4WW2F 1YPZE 5C09A 4QHKI 1OF2B 4Q97A 3TT1L 1IGJB 4HZAA 1Q72L 4UDUB 5DS8B 5GGRA 1LK3L 4GW5A 2AK4A 2GQHA 5C0GB 3MQIA 4UBDC 2UV3A 3ZDYE 4LIQL 4YWGH 5TGBB 5BZWA 3VG9B 4ZNEA 1NEUA 5FV1L 4H88H 5LGKA 5FGCE 1FJ1B 3KYOB 3G08A 5I15L 3FRPG 4PGZA 4NO5B 2Q6WA 2ITCA 5C0IA 1HSBA 5SX5K 2E7LC 2FEEL 1H9VA 2AJUH 3BJ91 4L4VE 4M7ZC 2QTEA 4X5WA 3V8CA 4PJDA 3TN0A 4D8PB 2VAAB 2QLVB 1A14H 1NMCC 3K2MC 4JFEA 4XNMA 5HI5D 4JQVA 1FPTH 2VZOA 3V0VB 3CPLA 5IBTH 1AFVH 2UWEB 3KPRE 4Y1AD 5IJKC 4HIXH 3KLHD 4MD0B 4HX1B 4PR5A 3KPPB 2J88H 3QZWA 1OCWH 4MCZA 4PJ8A 4U33A 3U0WL 3PABB 1MWAH 1WCBB 4NWUH 3ULUC 3O2WL 2Y07H 3G5ZB 3WLBB 1IKNC 2YD7A 2X40A 4YK4B 5TPWH 2I5YL 3MRRA 3TYGH 2F5BL 3JZ7A 2KL6A 5KZCD 3GMPA 5H2BB 5KSBE 3KPOA 1BGXH 3FOMA 2I24N 4TRPH 3S88L 3MGTB 4QOKA 1PYWA 3WKMH 1TQCB 2QADC 3CFDB 3C2AL 5C0ND 3HI6H 1S9YB 5GJTH 3FAXA 1N5AA 1LP9E 3DBXB 4X7EC 4Z5RA 5EBWA 4GQ9L 5DF0A 5TF1L 5EPMA 3ARGC 4KXZI 3PJSA 5ICZA 4OFPA 4JG0H 5IJVB 2ZKHL 1G0YR 1PY9A 4NKIL 4QY8A 1U8KB 5DD0H 5F9OL 4H8WL 3TT1H 1FH5L 1Q9OB 1ZE3C 3VI3F 1MCJA 5IR1B 2EZ0D 4JZOB 1FV1A 2V7HB 2X89D 1NDMA 1OSPL 1DSFL 2C26A 4LKXB 3ARDB 4NJ9L 4S1SL 1XIWC 5DMKA 5L7XL 3D25A 4A6YA 3OGCA 3WMSA 2KPNA 4FZ8L 5HGDB 2Y36L 3W81A 1TNNA 4XBGB 2HRPH 2YN3A 5T5NG 3ZDXF 1VKXB 3FT2B 5ID1A 3S34L 1T1XA 4E5XA 4UB0L 3WXWL 4ELKA 1SJXA 4W6XB 1I7UB 5IW3A 1FAIH 2H2PD 5F8RC 3U7WH 3H9YA 4OGAC 2YMXH 4MA8L 2PYEE 4OIIH 2IG2L 1ZS8B 3GI8H 4NP4L 5IW1B 4JANA 4XVTH 1JFQH 2P7TB 5IIEA 1EEYB 15C8L 3PP4L 1HEZB 4GG8A 4P4KD 1Z5LA 4ZTOH 4KRMB 5ETUA 1J0ZA 3INUH 4Y5VB 3RKDD 1IM3B 3MRIA 3QAZC 3X11B 3O2WH 1I7RA 2DQFA 4KPHH 1CLYH 3G6AA 5HSFA 5DRZB 4HV8A 3RWCA 1QSFB 4Z95L 3X13A 4GLRI 3F7VB 3OKNA 1JN6A 4JKPH 3ZSSA 4YHKH 1TQBB 1BVZA 3C2AH 1UCBL 3HB3C 2DB8A 3MZGB 3PG2A 4YGAB 4NUJA 5E9DB 4MAUL 4JFDD 2PXYB 3KS0J 4KK9C 1A64A 1LDSA 4UILL 2ZKHH 3MV7D 5IFAL 3EO1A 3RX5A 5J6GA 3K2UH 4K3JL 4OD1H 5F9OH 5D7IE 1LE5B 5L2KD 1DVFA 4DW2H 3AC0A 1FE8H 1P4LA 4MQ7B 3ARWA 4RZCA 4ZYKB 2EDLA 4YX2L 3SY0A 5FEBA 4MXQC 4GSDL 1XR9A 1OSPH 1T83C 4FTVD 4U0QB 1KLGB 3L7FA 3DV4A 3K74B 2P8PB 3WFBH 2BHUA 4BSVB 4BH7A 4WDIB 1UWEL 2JK5B 4R0LC 3SOBL 2Y36H 3LKRB 4HLZH 1R5WB 3HUJB 3LKQB 4LCIH 3VXUA 3S34H 3RA7H 3D2UB 4M7ZB 3U4BL 1FDLL 4KXZH 2FRGP 3BSZL 4FXKA 1V7ML 1KJMA 4UV7H 1QRND 1Y18B 4M5YH 2N1KA 4JZJA 3QHFH 1FIGH 4HPYH 1NMCB 2YPVL 4MA8H 2IG2H 5DRWB 5FYLD 1QSEE 3HN3A 1PX4A 3MRLA 1BBJB 3T2NH 1SM3L 3LD8C 2ZJSH 4JFZH 3PP4H 5BQ7A 5T3ZE 4MB5A 3FB8A 1S7RB 3TIEB 4QXTB 3ZKMC 1YPZA 4NQCE 4K3DL 3HHRB 5GHWL 4ZPVB 2ZOKA 2MMXA 1X3DA 2PW1B 5B21A 3E3QC 2JIXB 2QSCL 2VSDA 1FORH 1EAPA 4PRNB 3WKNA 5F6HI 4MHHI 3LKNB 5MEPA 2Z35A 4ETQA 5T5NF 4G6JL 5HDLA 3LPWA 1CGYA 4X98A 1UM4L 2CDEA 1CD0A 3BO8B 4F7CA 2CO6B 3G6JA 2VTFA 3DTXB 4K7FA 1ZLUK 3LSOB 4L4VA 3DUSA 3ARFD 5HGHB 2PCPB 2VERN 4JFOB 1U91A 4N0UE 4PRID 3RZCC 1BBDL 3LPFA 2DN7A 5D7JC 1ZEAH 2XZCL 4IRZL 3NCYP 1JJUA 4MXWL 4FMFA 2Q3ZA 3CC5B 3GHBL 5KANG 2F8VA 3TO2A 3OX8A 3ALXA 1GC1H 4MJIB 3ZMRA 3VCLB 2E7HA 4YHNA 4D9LL 1RZJC 3FO2A 4M93B 1N5YH 1G6RL 3THML 5D70L 2EDHA 5EUOB 3ZL4L 4CMMB 1ETZB 4NC0B 3DMMA 3DI3B 5JW4M 5KSBA 4LHJB 1OAZH 3LS5H 4K7PX 1JYVA 4UU9A 3U4BH 1FDLH 4HFUL 4P23D 3EYFB 3WLWC 3AS0A 1CL7L 3BSZH 5DMIH 1PEWA 5EFIA 3AROA 5ESAA 1V7MH 5IWLA 2YC1B 4WFHD 3QXDA 1G7MB 2FLBT 4R26H 2P43B 1LP9A 4P48A 4PRPB 2FWOA 3C8KB 1MHEB 3EFDL 2E7CA 4KMQA 2AKRA 2IEPA 1ZT1B 4XTRD 1Z3GL 5JTWA 3ELAT 1NCCL 4LSRL 1YMMA 3FT3B 1FNGA 3GO1H 1FBIL 4EDXB 5GHWH 1S7TB 3QXAA 2ZCLL 3IXTA 4LSTH 3TBYA 3GSOA 4D9RE 1WBYA 2CLZB 4KTEL 4E41A 5FO7A 3MRKB 3SDDB 4DGIL 4O2EB 3BPNC 1M05B 3CVHL 4N90D 5C0FA 1HWGB 1V3KA 4YC2C 5F21B 5D5MF 5C6WH 2AXJA 1SYSA 3QIWC 4X7FC 4JG1L 1P9MA 1K6QL 4NBZB 3CFJA 5HYJD 5KN5A 2PN5A 2CK0L 1Z0MA 2CSPA 5DRXA 1NGPH 2BZDA 3UXFA 3OKKA 4MD5B 4NRXB 3HMXA 4RWYH 5D2NE 3HS0B 4RIRA 2NTFA 2XZCH 5EO1A 1RZKL 2LABA 2PYEA 2YD4A 2R29H 3KYNA 5GQBA 3UTPD 3RQ3A 1AY1L 2DWDA 3NH7L 4O4YL 4OCWH 2COQA 3O41A 1KUMA 3DIFA 1NCWH 1GZPB 1RUKL 1TPXB 1NCDL 1A2YB 1KPVA 3QJHA 2E3VA 1KBGH 1ZLWH 4EKXA 3DX8B 4Q58C 3LQZA 1G6RH 1T2JA 2MTPA 3DXAD 1RK0B 1NKRA 2NXYC 2QJDA 1LD9B 4NGHL 3VWKA 2EDTA 3L3OA 3AREB 2I07B 5LXGL 4X80L 5EBMA 3U7YH 1N6UA 1D5BA 5KAQG 2ITDB 4ZSOA 5HY9A 4EDWH 3JV6A 1NFDF 3I6GB 2DBJA 5GGUA 2BNRD 3ARSA 5AZEH 5CUSL 1JPSH 1PAMA 3A6BH 3EYQD 3CNKA 3F65A 1DBML 5FGRA 5EC2B 3OKMB 1EH9A 2H26B 2MOVA 2EYTA 2ZCLH 3BIKB 1XF3B 3MJ9A 1TZIA 2YN5A 4H1LH 2K7QA 4WHTB 5HYEA 1BZ7A 1JZ6A 5CZXD 4DGIH 1KCVL 3VRJA 1PG7L 1I1YB 4LCUB 4YHZL 5I8OL 3WN5A 3NOIA 4NRZA 2ATKA 1MFAH 3OAZK 4JFFE 2NY4B 4PP1C 2LFGA 4NUGH 5JO5A 1FVCB 2GTWA 4XC1L 1OOAA 1CQKA 1I7ZB 3ARYA 3EKCA 5DD3L 4U4BA 3U30C 4BH8A 3BUTA 4JG1H 3MFFA 5D7KD 2HJLB 2XPGA 2VYRE 2WWMC 1TZGH 4LLWA 2M8XA 5IESL 1MLBA 3RWEB 5IMKB 5BV7L 2V5SA 4AIOA 1QR1B 4IS6A 3UTOA 2DQTL 2ZWLT 1PBYA 4AYFA 4F9PA 3RZCB 4OT1H 3DUHA 3RGVD 1RZGA 5ADOH 4CRPA 3L6FB 4GW4A 5D7JB 1RZKH 5CJ8A 3GSNB 3MLPA 1F4WL 2Q20A 2IAMC 4HWBL 3ZYZA 4UNTA 1EVUA 1LEIA 1MCKA 4HPOL 1QSEA 3NH7H 4OCYL 4O4YH 2X70B 4PGCA 1ITCA 4PJGF 4EVNA 2VABB 5C0CD 1A9BB 4ZPTB 1MNUH 1LO0H 3MREB 1RUKH 3TPUA 5DJZA 2B39A 5HPOA 2XKUA 1YY9C 3M17B 3FOLA 4HDIB 4JEGB 3FFDB 2IADB 3WFZA 4LPCA 1D5IH 2YPKA 3H3PH 5DJ0B 2D7TL 4W4OA 3WYRA 2YA2A 3VFUB 5GJSL 2EO1A 4ZFGH 1CG9A 3JV5A 4ZUTB 2YD9A 3RFZC 2WUCL 3QJFB 1URLA 4NZTH 4CVZB 2YRPA 3L7EB 2CGRL 4GAYB 4LHQB 2VLJA 4G7YL 4XNUL 4GRWH 5CGTA 5D4QA 1LE9B 3I3EA 3U4EB 5CHNB 3RU8H 4JLRA 1KJ2B 4K8RD 1OAXL 4JFYA 3M1BA 4RFNB 2DDQL 1EEZB 5D93B 4QEGA 5AG9A 4DQOH 1QLRB 3P30H 5FXCH 2ENYA 2I9TA 4U6YB 5D1ZC 4UBDD 2HMIC 3D18B 2MHAA 4QRSA 1M7IB 5HJ3A 3JWDH 2HFEB 4X6CE 5HGAB 3IJYB 1HINH 3RJDA 4OCRL 3VFVA 4GG6E 5C92A 1KCVH 1M71A 1XFPA 5DLMH 4NFCA 3FFCB 1RJLA 2ED9A 3N1QC 3DVGA 3BISA 3EJYD 1G7LB 4ODTL 1EVTC 3IDNA 4ZS7H 5D1QC 4YXLL 5KVDL 3GB7A 4G42B 3AU1B 1GGCL 4RA3A 4QRUB 1ZGLP 2C5DC 2EDEA 1J0HA 4EXPX 5BRZB 2P5WE 3MGOB 2XQYK 2UY7A 1NC2A 1T2XA 4PJFB 4OZIF 4UMGA 4J3VA 4NOFA 4ODWA 1DUZB 2J3SA 2X44D 4CADB 3MXVH 1CICC 3IGAA 3C60A 3HR5B 4HUVB 4XP4L 1F4WH 2V2XB 2XIDA 4XVSL 4HKBA 3ZT5A 2X42A 3SE9L 2DQCL 2EE3A 3LQMA 4ALAL 4M6OH 3VI4E 5GSRA 3ZT6A 5JW4Q 4WHCA 1OB1B 5GGSA 1AHWC 3HAEG 4AEHL 2C7UB 4R8WL 4HJ0C 1RPQA 5DYOA 1UFUA 2JE8A 1NCAL 4DN3H 2D7TH 2G5BB 4WI7A 3X3FL 2QADD 3BKJL 1KB9K 2WQRA 3U9PL 1I1FA 1UJ3A 4PJ9B 4MHHG 3QG6B 5FYKH 3L3KA 4JR9H 2EIZA 3W0WB 1T5WA 4OSUL 3ARGD 4MDIB 1FGVL 3FRPA 2XG5A 4DVRL 1FL6A 3LQAC 1S8DA 3HZYA 3MA7A 1YEJH 3Q3GB 2VQTA 4GUPA 4PJEF 5FGBA 3S35X 5CINL 2DDQH 1OQXA 4BZ2H 3MV11 1OL0A 4TUJA 5KJRL 4WHYG 4POYA 1HOCB 4HGKC 5MEQB 2W59A 4QXWA 5D2NA 2AV1A 3GJFB 4XMPH 2CK2A 3NIGE 1OD7A 4LARL 3DX6B 4I3GA 2X1WL 4NQVB 1XIWD 3QUYA 1BEYL 4WVRA 3QEHA 4RDQG 1K8IB 2NX5D 3OL2A 3MV9A 1ZGLA 2RHEA 5IT2H 2VDPH 1UWGL 4DAGH 4BK4A 2YRLA 1JIBA 3TNNA 1IEAA 5SWQA 2YD5A 4G6FD 4HCRA 2Q86B 3MJ7B 4GRLB 4OGYH 1NCNA 1YYMH 4IRJC 5KVDH 4P4RB 4KJYB 1ZA6A 2IMMA 5FKAB 2CKBH 4LIQE 4M8QB 4OGAD 3RJQB 2XWBA 3BH9A 3TP4A 3VXRB 5AYUL 5DC9B 4H26A 3STLB 4FQ1H 2NYYC 3WJLC 4QTHB 3L3JA 2NY0C 4LSVH 4LP5A 1HI6A 4WTWA 4Q9RH 4TSAL 4M61B 1I1AA 1DQQA 4XZUB 3GKWL 4ALAH 3KLDA 4G8IB 5C0JA 2XN9B 1T1YA 3VXSB 3OAUL 3R8QA 4AEHH 4WIQA 1FN4B 5A40E 4PJGE 5DEGA 1HCFX 4UAOB 3PHOB 1C5BL 4M4RA 3MBEA 3HB3D 4D9QE 1KIPA 5I1KL 2VITB 4RMQA 2BFVL 1FQ9C 4RGNE 4JFFA 3LEYL 1I75A 5M94B 3IS0X 4ZO7A 3QEUA 5ITBL 1JHKL 1P7HL 3AY4C 4OLWL 4KK9D 2UWEF 3ARPA 2NLJA 1D7FA 3MV8D 3PQYE 5F9AC 3BRFA 5FM5M 3O9WA 3EHBC 1RUQL 3QWOB 4M7KH 1NUNB 3FCTB 5CINH 3KPSE 1L9NA 3BWAB 4EN3B 5KJRH 3UTTE 5F1SA 4B53A 1DBKH 1MIML 4XPGL 4ONOA 1L7IL 2R0WH 1AD0B 1A6WL 1OHQA 5J06A 4MXQD 3EO9H 4PUBL 2FB4L 4ZQKA 3I75B 2WUBL 3ZE2E 3BZ4A 3BZEB 5TH2A 3EYSL 2QR0B 5ACLA 3QCVL 5GRJL 1BEYH 2AJZA 2IPTH 4FABL 7FABL 4EXKA 1VFMA 2UYLB 4DGYL 4QTIH 4DEPB 2WIIB 3RL2A 3BP5B 3ULVL 2YBRB 4UNVA 2ESVE 3FRUB 5D8JH 2ORBL 5E99L 1CGSL 3L5HA 5DMYA 2V2WA 2WLYA 3QIUA 4XPAL 2W0KA 5EA0L 5FCUL 2R56L 4OKDA 4XAWL 1S5IL 1KELH 4FFWD 1L7TH 4ZFOB 1OARH 4PJAE 5GGTL 3VFWB 2YKLH 3GSRB 1R5VB 4LSSL 3REVB 3LS4L 5EU6B 3ZKMD 4XT1C 3LAFA 4OZIE 3NACH 3TZVC 4NHUA 5I9QC 4PGEB 4HUMB 3BW9B 2WINA 1AGFB 5DJ2A 5CBEA 4NO3A 2OSLA 2YPLE 1ADQA 5B38A 4B41A 3FQUA 1HSAB 2NW3A 3OAUH 4JGJA 1RZ7H 3HZVB 3IDXH 3PIQA 1A6AA 2H32A 2LVCA 4Z7QF 5SWSE 3C08L 3IDIB 4LSDA 3QEQA 3FQTA 4X6CA 3F7YA 4NZDA 1VFUA 3SDAA 3I9GH 2X4PB 1IAOA 1QPPA 4JVWA 4GG6A 2O93L 1A6PA 4TSCL 1B9ZA 5FYJD 5DD1L 5I17A 2ZUXA 2IC2A 4XCFL 3SKNA 1W0WA 4XHQA 2VE6A 1P7QD 3FB5B 3RZCD 3NGBB 4X9BA 5D7JD 5T1LA 4DCQA 5I30L 1YEIL 4P5TC 2P5WA 1IT9H 4HIHA 2Z8SA 5I1DA 5EBLA 1PW3A 2FATH 4XPGH 3HPJB 3BP7B 1HXYA 5JQHC 4MJ6B 4RISH 5HHVH 1IBGH 1IKFH 5IW6A 1OT1A 1HHKA 3CLEH 1T5XA 3QCVH 1BX2A 1BJ1J 5GRJH 3RIAF 1JMZA 1VFOA 4CDGC 4G9FB 3C87A 4ZNCD 2R4RL 1P53A 4J3OC 1M6OA 1A1MA 4ZDHB 3ARRA 3U4AA 2G9HB 3KPQA 3S5LB 5HI3C 3WLWD 3NFNA 4ZODA 1BJ8A 4HMDA 4IRJB 4WWKA 1B0GB 1MI5E 2OQJA 3B8SA 2GFBB 3NA9L 2H6PB 1RUPH 2XWJB 3W5NA 3PDOB 3H9HA 5F96L 3EDKA 3HE6C 3QXVA 1S5IH 4YFLI 2XWTB 1MWAA 1SJHB 3S98A 4OZFB 2NY5L 5C2UB 5JPMA 4YHPB 4KFZC 5FFLA 2Z91B 4K71C 3LS4H 4X4YA 3MODH 4P2OA 4XXDA 1MVUA 2FJHA 3GBLA 3TVMC 4R4NC 2R4SH 3MYJB 4Q6IB 4K3HA 4PRHB 5IVXB 1UVQA 5ICXB 3HUJF 1I9EA 3C08H 3AXLA 4UTBH 3G5XA 3QYCA 3QIWD 1I8LC 4TSCH 4C4KT 4L5FL 4I18C 4YHYC 4FQXB 4PS4L 3FT4A 4XNXH 5DD1H 5LJYH 1KF9B 2BSTA 5BRZD 1R3KA 1KSRA 1XGUA 1V5JA 5F89A 5HHXH 1KV3A 4D0DA 2GJZA 4MJ5B 1A4KB 1L6ZA 4LVNC 4ODUA 5T1KA 3PV6A 5TQ2L 5ENWA 2APVA 4U1KA 3B3IA 1TJGL 2ICEB 2W0PA 3ULUF 1SMAA 3BT2H 3NN8A 3KDMA 5IFJB 4LHUB 4WU7B 2ICWB 3DYMA 2ARJQ 3PL6C 3ROOA 2NY3B 4L8CA 4MNQE 1GSMA 4GAFB 1FFOA 4QT5A 1ZWIB 2MWCA 3SE3A 3C5SB 3QQNA 2NXYD 1BAFH 1OTSC 2A6IB 1U6AL 2IMNA 4WO4B 1J0JA 2EYRA 4KRPC 4PFEA 1PVHA 4G8GE 4HUXA 4ONGH 2D7QA 2HN7A 3W0WD 1RIVL 3MUGB 2VN4A 1OGAE 4NZRH 3K1DA 2IALA 2R1YB 5F96H 4ZAKA 3BKML 3TV3L 2OTWA 4XI5C 2F53E 1D9KC 3BKCH 2OJZH 5KW9L 5C07D 5KBNC 2YA1A 3NAAH 3RUGE 1CDIA 3GEWB 4CKVX 2CRMA 2O5ZH 2BJML 1F4XL 1WAAF 5I1IH 4PJCE 4RFEB 3VRIB 1LK2B 4F33B 4B7IA 3TYFB 1QP1A 2IPKA 2HFGL 2LE9A 3QI9A 2YK1H 5EUOF 1FYHB 1KTDA 1I8KB 2Z31B 1BVKB 4PP1D 4Z7UE 3O8XB 5IMLA 3VA2C 4NZUL 4U1IB 2KKQA 5K9JL 2XTJE 2VZ1A 2V2TB 2WQ8A 2WWMD 4UINL 1NQBA 1N6VA 1K3IA 1FNHA 1CFVL 5IEHA 5B8CB 2ZCHL 8FABA 4PYHA 3BWUC 2P8MA 4XHJC 1T89C 5KSAA 3OJDA 1M7XA 25C8L 3QULB 5DJ6B 5DGRA 3QHTC 3FQNB 5F44A 3VWJD 2J4WL 4U0RC 2OZ4H 4D0CB 1RI8A 1OP9A 4P5TB 1FZMB 2IAMD 5LBSL 5CIPH 4ZTPL 4PJAA 5E70A 2QQLL 4Z0BH 3VRLE 5I1CL 2GITB 2FJGA 3C6SA 2BNQB 5GRUH 1LO4L 1P7KA 1YY9D 3WE6A 5E2UL 4OTXL 5DD6B 1T20B 5CBAB 2YPLA 2I60H 3P4NA 2E9BA 1BOYA 2RQ8A 4OZHA 4XPFL 1RK1A 4Y5YC 1XF5A 4OLVH 1U6AH 3KPNB 1F58L 4OI9A 5SWSA 5HVHC 2VDQL 5F1IA 4J2XA 3VXMD 5JLZA 1T0NA 1S7WB 2XNAA 1BFOB 5E9DE 5C0AE 2OL3B 4PBWD 3TO4B 3TLRA 2EECA 1FZOA 3DVFA 4RGOL 4JY4A 4ORGB 3DUUA 5KW9H 4CBPA 1JF6A 4MNGE 3U7AA 1FNLA 3RGHA 3CSBA 2DKMA 4BSJA 3HZKB 1T1ZB 3RVVC 3UBXB 1A7RL 4NC1C 5D1ZD 2BJMH 1TTUA 1RZIA 2HMID 4NQDD 5AYQA 1F4XH 2B4CH 5T1DH 1DBAL 3RDTB 2CIKB 4LASL 4LLVA 4YPGA 3TVMB 1F6AA 1QA9A 4GRWE 1RZFH 2H8PB 4UOW1 4YDIL 3LHPH 3SCMA 3O3DB 3NPZB 4ENEC 1BJMA 1FZKB 1Q9KB 1SY6H 1HILA 3IKKA 1XGYH 4J1UA 2H41A 4F7PA 3ILQC 5FM4A 4NRYA 1QNZH 5D1QD 5MENA 4JFPA 3Q6FB 4JM2A 4KZDH 3BJLA 4UINH 4YHYB 4W6WB 1CFVH 1FFRA 1ZT4B 1HE7A 1ONQB 3O6FB 1YNLH 4EJ1C 2ZCHH 2N7BA 3VH8G 4LQ1A 4QHLA 25C8H 4FQJH 4K94L 1G9NL 4J12A 4YJZL 4LVNB 1MI5A 2V9RA 1CICD 3C5JA 1NSNH 4L3CB 5GIRB 2O5YH 4QKXB 3MLXH 2QQLH 1S7VB 5D72L 5I1CH 4P2RD 4ZXBC 1LO4H 3TBTB 1K3ZA 4XB8A 4LEXH 2W0FB 1FFPA 3A6CL 1IAMA 4HJ0D 1E6JH 3VE0B 4OLYL 2X7LA 1U3HA 3CXDL 3NIDE 1VERA 5FYLL 1QZ1A 4OFKA 3GMRA 2C1PA 5C0EB 5HVGB 1T6WA 3V4UL 1J8HE 3ARBB 4U6TA 2RCSH 4YQXL 1KIRB 4H5SB 1XGTB 4G6ML 1WZMA 4L3EB 2O61A 4UI2A 5ESQB 3QHZH 3SO3C 1B2WL 3L9RA 2V7NA 2VDNL 2XQYG 4YUEL 2OYPA 3CDFA 3UDWC 4PJIB 3PWPE 5JIKA 1W8NA 4YZFE 2BHYA 4QHNA 2ADGA 3RWDB 3TT3L 3E6HA 2DBLL 3OXRB 3WFEH 5I8EB 4G7VL 1WFNA 4U3XA 1EBAA 5JNYB 2GSGA 4UIMB 1JNJA 2B1AH 4G9FD 1C7SA 3VXTB 1MHHB 3DETC 2X4NB 4MNQA 2ARJB 2FO4B 1NAML 4WV1A 1QKZL 3G04A 1IQWL 2BX5A 1KN4L 3BGMB 3RNKB 3TA3C 3MLWL 3VMNA 1KB5B 4PG2A 2A0LC 2GSIA 3IXAA 3W2DL 3HAEA 3U9UB 4G8GA 4OD2B 4E0RA 4ZUWB 2NYYD 1OAUL 3JWOL 3KAAA 3NZ8A 4IRSA 1K2DA 4PRPE 4JRXB 1WC7A 2NY0D 3CFEA 3QDMD 4FP8L 4M1DH 3UAJC 5I0ZA 4KI5E 4MB4A 3UJJL 1VGKA 3BEVA 2WNGA 1JV5B 2AQ2A 4Z0XA 4OFYA 2R0ZH 4HGWA 5TDNA 1G6RA 1UKSA 3NPSB 3RUGA 1GGUA 3ROLB 2KBGA 3F8UB 3GI9H 1HXMA 1A7OL 1INEL 4EIGB 3MRGA 3WS3A 3CSYB 1KB9J 2VDML 2A9NH 1T04A 3MA9L 1T21A 4PJCA 1UYWL 3A6CH 2BVPA 4RX4A 4OZ4B 5JUEH 1EXUA 5F7EH 1L0QA 5FYLH 4PLNC 4UDTA 2HWZL 5HYQA 4X7SH 5CZKA 4K9EC 1SEQL 4Y5YB 4ZMAT 3QFJD 5DJ8A 4ODSH 3F5WB 4Z7UA 3QQ3A 4OGXL 5HVHB 5GS2D 1JGDB 4M6NL 4PJFF 4NCDA 1F6LL 1JGUL 1H3WM 4MAYB 5GS1C 3GMNB 3EHBD 1QVOA 2HJKA 1JHTB 3IJSB 5DO2C 3D85A 3TJEH 3UTSB 1CQYA 2GCYB 2HG5A 3CVHA 1JI2A 3ARXA 4YR6A 1BF8A 4EI5C 4NM8H 3X3GL 4BZ1H 3DX7B 4TN9A 2W65B 3S4SB 1KG0B 4QO1A 4P2QA 4TNWF 1I7TB 5D6CA 4XCYB 5I1LB 2X1OA 3D39E 4XCEA 2NZ9C 4XMKL 1E4JA 1IQWH 5FUCC 2EE6A 5E00A 1ZKAA 3P9LB 2R8SH 1T4KB 1MAMH 2LV4A 4R4FH 1S7QA 3WUWB 3P4MB 4TYUA 5L6YL 3DX9B 4NO0B 5IVZB 5SX4I 3W9DB 2G75A 4TVSa 4F8TA 4NNYB 1P1ZA 3PWVB 4K3EL 3V6BR 2V5RA 2E6JA 2BVQA 2XT1B 4PJ8C 4JM4H 1NANI 1MHCA 1X5ZA 5C0AA 1CI5A 3GSUB 4MCYA 4LCCC 3UJJH 2VJXA 2HYMA 3MLTA 2YWZA 3TZVD 3X12A 2X9YA 1CBVH 2VXQH 2PO6A 4BFIA 5J12B 1IGYA 3CU1A 2X4RA 4MNGA 4AH2A 1CLOH 2XA8L 1A7OH 1INEH 1QLFA 4PG9A 5IOPA 4ODVL 5K9OB 2NW2B 3OKOA 3DLQR 4IJ3C 5DVMA 3BDYH 4DK3A 3OXSB 2XA3A 5HHOD 2ZSWA 1BIHA 1NFIA 5GS3A 3IU3A 3DSFL 3SGKA 3OR6B 5D2LB 1WIPA 3RWHB 3DYPA 5IFHH 3QDJE 2F74B 3JTSB 1FNSH 4Z7WE 3T77A 1J11A 2ADFL 3ME0A 5C08B 5EOCL 2IGFL 1Z9MA 1NAKL 4ZO9A 5IQ7L 2VLKA 4P5TD 3PHQA 4YGVA 3RBSA 5I1EH 1AR1D 1FYTD 4PJBB 4GBXC 3TJHD 1W0VA 1BREA 4YBLC 5FUZL 5C2BL 1YZZA 1NGQH 2AXGB 3HI1A 1G9EA 4L4TD 2Q76A 4Y8DC 3QDGB 4ZG1A 5BVJB 1DL7H 2VC2L 4PGBB 4CVUA 1JPFB 5I73B 5CLTA 4PJXB 4JO4H 5EIIB 1C5CH 5DD5H 1MQKH 3QNYB 4XMLL 3F58L 1CD1B 2CKNA 1S5HA 1KXQE 1PLGH 4FQPA 4Z7VA 5F9WB 1IZKA 1RSFA 3Q5OA 4YHLH 5HI3D 5T3XH 2A77L 4DN4H 4D94A 5L6YH 3WL9B 5DFVC 3TA3B 1C16A 2A1WH 4X7TB 5J9PA 4XRCA 1FP5A 5ACZA 1KJVB 5MEOA 1E27B 1Q38A 1AGBB 1J8HA 1MCEA 1S9VA 3HE6D 4HWBA 3DECA 5KG9B 2M2DA 1XCQB 4CU8A 2BVOA 1WBZA 5IF0B 1AGEA 1U3YA 2E7BA 3IAPA 2R1XA 2ERJB 3WNLA 4Z78A 3PWPA 1EJOL 4PJHB 3SGJC 3ULVE 2YUXA 4FNLL 5I16B 4R4ND 1Q9WB 4P5MB 5ISZE 4ZUVA 3LIZH 2BRQA 3T4AB 4ODVH 4OUUB 4E42A 5E8NB 5IM7B 5I1HL 3MOAH 3QO1B 1RIHL 2HJFA 2PNDA 3TCLA 1ORSA 4U1GC 2C1OA 2DM7A 3LEVL 4H20L 1TTGA 1MHPL 2B20A 3GMMA 2IPUK 1YEFL 2VIRA 5DQDL 4NJAL 5HDQL 3R0NA 4XH2A 5E6IB 1AP2B 4I9WE 4YDVB 1PJ9A 2XKSA 3UCRA 5D6DA 1HQ4A 4LVOC 1NAKH 1NANH 5JMOC 5C09B 1DVFC 5BJTB 5GS1B 4OCSL 3I6LD 5GGRB 4XP5L 3B5HA 4GW5B 2AK4B 1A7BA 3ZDZF 3IDUA 4NQEE 4N9GB 4Y88A 5C2BH 3FMGH 4QXUL 5BZWB 3ZKNC 3BPOB 1YMHA 3PL6D 1EERB 2VR5A 4AEFA 2JELL 2W07A 3G08B 5MHSE 4RGMB 2Q6WB 2H9GA 2GUOA 2ITCB 1BFVL 4JGMA 1HSBB 5C0IB 3T0EE 1CT8B 1KEML 2DL9A 2A74A 1OTSD 3F58H 3QQ9C 1U8QA 4X5WB 4KRPD 1M7DA 4HK3J 4MWFA 5LCVL 3TN0B 5F6IB 2ICWJ 4I0PA 4JFEB 5C0BE 4XNMB 4G3YL 1WTGT 4HQQL 1N8ZB 3WIHL 1S9WA 1Z0NA 1BWMA 1FSKC 3CPLB 4XI5D 1WJ3A 1D9KD 3HKFA 4PR5B 5E94A 4KKCD 3QZWB 2DMBA 1CXFA 1F45A 4MCZB 4PJ8B 5F97E 1U92B 2IQAA 3QWQB 1I4FA 5EIQA 1YEEH 3FAWA 1QUNA 5HGGS 4LRIC 2Z4QA 1EJOH 2D0HA 4HEPG 1OM3L 3MRRB 5FK9A 2EDDA 3GMPB 3KXFE 1CR9L 4G5ZH 3FOMB 3QCTH 2X5PA 4R2GC 4HIJA 4LQFL 3B9VA 5I1HH 4K8RH 1PYWB 4QOKB 1OD9A 1RIHH 3IFPB 1AXTL 1DN2A 4H20H 3LEVH 5SV4A 4U6HA 1N5AB 1MHPH 1EFXD 4NO2A 4Z5RB 5EBWB 3CFIC 3D39A 3Q48A 5EPMB 4NKDA 4KHTH 2VNCA 1E4XI 3PJSB 5ICZB 4MGXA 4XHJD 4P9ML 4EBQH 5CSZA 1LEKA 1U8IA 4QY8B 3FB6A 5D71L 3C09B 1WFUA 4OCSH 1ZOXA 3H9SE 4XP5H 4P9HL 1WZLA 1FV1B 2XQBL 1NDMB 2UVFA 5DA4A 1RIUL 1FNAA 5IVXF 1BMGA 1G9MH 4C56D 6CGTA 1ZLSH 3NFSL 1ZGLM 3D25B 3OGCB 2FYYA 1SHMA 1KXVC 4M6MH 3CVIH 3W82A 1X5YA 4XP6L 5ID1B 5MERA 3AAZA 1KOAA 1T1XB 4R90L 4E5XB 4ELKB 5J57B 2X4OA 1OVZA 1E4XL 5LCVH 4HH9A 1LEGA 3ULUH 3STBA 3ZSTA 3QUXA 4Y16A 1BOGA 3QDJA 4X4ME 1ZXQA 1FNEA 5JXAL 2GHWB 5H94A 4JANB 3WIHH 2QHRH 5IIEB 2WAHA 4GG8B 2ZSVA 1Z5LB 3JWDC 2X05A 5ETUB 2BXYA 1DQLL 3VFGH 4TUKH 3UTSD 2QKIA 4TQEL 3RVVD 1YQ2A 2DQGL 3BH8A 4MNHA 3MRIB 2FECI 2DQFB 4MXVF 3G6AB 4CN1A 3SE4C 4HV8B 1FFNA 3RWCB 7CGTA 3MLSL 2VKWA 2D7PA 1MCDA 4AT6A 1BQHA 1SJVA 3UJIH 3OKNB 1JN6B 1YN6A 4Z7OE 1VACB 4ENED 2VDOL 1IZJA 4C55A 3GKZA 1MCWM 4X7DC 1NMAL 5EU4A 3ILQD 1IGTA 4MS8C 5DRNA 4NUJB 4U1GB 4QRPD 4LLMA 4AIXA 4TVPD 2CDGB 3I6KA 4IBLT 3TCXA 1JP5A 4OF6A 3F62A 2WWKO 3EO1B 5J6GB 2GKIA 3U2SA 1JTPA 1MFEH 4LVOB 4R97C 3VXPA 5AWNH 5MP6L 1KCSH 1DVFB 3P11L 4N9OB 5E2WL 4M5ZH 1FGNL 1P4LB 2FECL 4WI3A 3VFSB 4GW1A 4RZCB 3E2HB 5JQ6L 3LKOA 5IG7A 3SY0B 4K2UL 1XR9B 2W1NA 5F7MC 3JVGA 3L7FB 1EGJH 4XPHL 3DV4B 2FGWH 3BP6A 5I8CA 4ZXBD 4U7KA 4PB9L 3RHWF 4YE4L 4BH7B 3L5IA 1VEOA 3O4OC 2CXKA 3VXUB 4CVWA 1W72B 1E4XH 1VESA 4FXKB 5DJXA 1KJMB 2FJFA 3CLFH 4JZJB 5GGTA 1X4ZA 1F5WA 4LF3A 5I18L 5EOCJ 2F54D 4F7EA 4M7LT 1OPGH 1KPUA 3MRLB 5AD0A 1WIUA 3BKYL 4PGDA 2E6QA 5E2VL 1YC7A 4ACPA 3FB8B 5LWYL 4HXBH 4M43L 1YPZB 4NKMA 1UA6H 2HLAA 5FCSH 3UTZA 2ZOKB 2HT2C 3R0MA 1PX3A 4RBPK 2PTTA 1DP0A 4X99A 5EZLB 3GMOA 4WW2C 3K3QA 1YEGL 3VH8A 3HRPA 4NQEA 1MCSA 1EAPB 3WN5C 3BEWA 3C6LA 5JXEA 4I5BB 2BMKA 5MEPB 2Z35B 3DETD 3Q1SL 5FGCB 2D3VA 4ETQB 2EDFA 5CAYB 5C6PB 4HUNB 1A7NL 2EEBA 2HT4C 4BFEA 2FNBA 4NBXB 2AEWA 1N2RA 4HJGA 4X98B 5FIEA 3T0EA 2CDEB 4JHWL 3O2VL 4F7CB 2JTDA 3G6JB 4K7FB 3VXQA 3TA3D 1KCUL 1P4BH 4L4VB 5J6HA 3DUSB 2A0LD 3T2OA 1B6DA 4UT9L 1EK3A 1MCIA 2VWEE 4JFDE 3W11C 1UWXK 1RZJL 4NQTA 4RRPG 2OTPA 2AGJL 5MP6H 4OZGE 5C0BA 3UAJD 1IC5L 3QIBA 2W60A 3WCYA 1CCZA 2IJ0C 2HKHH 1AO7A 4ODXA 1XGQA 1E6OH 3OX8B 3TO2B 3KPRB 3D0VA 4K2UH 5L2KE 4DKFH 2BK8A 2AV7A 3BP4A 3MLRL 2IH1A 4YHNB 3BDBA 3FO2B 3KLSA 4FTVE 3WNKA 3QCUL 5I19H 4XBEL 1A6TA 3DMMB 2VXVL 4MA7H 3PGDA 3RTQA 5KSBB 2UZIH 3KXFA 1S9XA 2QSVA 2Y4SA 3CFCL 4OB5H 4UU9B 1RZ8A 2XKNA 4YAQA 2NTSP 2V17L 2VO5A 3KVQA 3STZB 3DOSA 4KI1A 5EFIB 5ESAB 4OLXH 1A6VL 2J8HA 3QXDB 1KIUA 3QDAA 4YIQA 5TDPA 1LP9B 2FWOB 4A6YL 4KK5C 1CXKA 1RURH 3G5YA 4BQCA 3U83A 1X5IA 1AKJA 3BKYH 4JKLA 5IHZA 3E6FA 1CD9B 3OJMB 1FNGB 1OP3H 3WNPA 5TQ0L 3QXAB 1F8TH 3H9SA 4EI5D 3TBYB 1YEHH 3GSOB 5FYJH 1WBYB 3S4SG 1A3QA 1YEGH 3BYYA 4E41B 5FO7B 1I9RL 2VQ1A 4Y2DC 3VFMA 2Z8RA 5C0FB 4HS8L 4U1JB 5KSVA 3B9DA 5D7LD 4PRBA 3IVKA 1U36A 5CJQH 4WJ5A 2Q8BH 1HHGB 3GSNH 1R3HA 2NZ9D 2GK2A 1HH9A 3MUY1 5TE6H 2WBJC 1DQDL 3O2VH 5CJOH 3CFJB 2Y6SD 5KN5B 1CFTB 1KCUH 5DRXB 5EO9A 3OKKB 4KUZL 1FL3B 5DK0A 1T03L 4PJIF 3T3PE 1X6LA 4RIRB 5DA0B 3WHE0 3MLUL 2NTFB 3KYKL 3C60C 2PYEB 3KYNB 4X4MA 3BDXA 1T0MA 4PRIE 2B2XL 1F90L 4HFWA 1QSZA 5HYSG 1A8JH 2DI7A 4MX7A 3O41B 5I75C 4FQHA 4P59H 4JJ5A 1U0QA 2K3TA 2A6DA 2DQHL 1KPVB 2AERT 3QJHB 4O00A 2A73A 3HPLA 4Y1AA 1KJ2H 4QOKD 1OAYL 1KTKE 1F00I 2BY2A 3UJTH 5F8QC 1OY3B 3O4OB 1VSCA 3G9AB 3VWKB 1I85A 3CFCH 4Y19D 2OXHA 1CXHA 2V17H 3L3OB 3O0RL 3EDEA 2RR3A 4ESKA 3OAYK 1A6VH 2DM4A 1D5BB 2D31A 3V8OA 5HY9B 2IANE 3JV6B 1OP5K 3WDHA 5JOPD 4WFHE 3FKUS 5GGUB 3WFDL 5D2NC 4PP2A 1U8OA 2EEAA 3K4ZA 4GBXD 4XNYL 4ZO6A 4BFBD 1H3VA 4KROB 2J6EH 1TJHH 1U8PA 5TQ0H 1FLTX 2EYTB 1XT5A 1UJTA 1JZ7A 4PTTA 4PJ7E 3MLYH 1BZ7B 4PGJA 5HXMA 2GY5A 3TH4T 3VRJB 4LPWA 1GHFL 3WN5B 4XX1G 4NRZB 5JPNA 2ATKB 3SBWA 5JO5B 3GBMH 3WS6A 2DQEL 2GTWB 5BO1L 3IF1A 4JDTL 5FM8A 2NPLX 2X89A 5AZ2H 1QD0A 4N90E 4BH8B 3MFFB 1MFBH 2XPGB 1DQDH 1MFDL 4LLWB 5DQJA 1N3NA 1UM5L 1MLBB 2PTVA 5DFVD 4PV8A 1ND0A 4CMHC 1UZ8A 4IS6B 2GTZA 4QYOB 5F9JA 3PE9A 1X44A 1LDPL 5HYJE 5HVWA 4R7DA 1RZGB 4GW4B 3WD5H 4OM0L 5K9QI 3KYKH 2J5LC 3M8OL 1EDQA 5DVNA 4OCXH 3HZMA 5K59E 3VFTB 1LEIB 1ORQA 4JQXC 1QSEB 4JCLA 4PGCB 5HHNA 5FO8A 1A9EA 1JWMA 5BS0D 2CJUL 1JNLH 3ZKXB 1CVSC 3UTPE 2DQHH 3TPUB 5DJZB 1XEDA 1P5VA 3FOLB 43C9A 4RMRA 4P4KA 3MC0A 4YXKL 3SO5A 1OAYH 1PSKH 4NDMA 2QEJA 4X6DE 2YEZA 5CEZH 2ZUQC 1RV6X 1QRKA 5I1AA 1CG9B 3DXAE 3GJFH 5J1SC 4QHMA 4JDZA 4GXVH 2BCKA 3PWJA 5F9DC 3VJ6A 1IGFL 3ZHDA 1CE6A 2X09A 4KY1L 4N1HB 5DUML 4XCCH 1DQTA 3Q0HA 4JLRB 4JFYB 1JGVH 1V7NL 3M1BB 3U46A 2XZAL 1JNNL 4AQ1B 5FHAH 3N0PB 4TUOA 1AXSA 4XXCA 1F3DH 4N0UB 1GJIA 1NEZB 4JFDA 4Y89A 3IAQA 4FFVC 5IKCB 1HKLL 2I9TB 3H42H 3ZKND 2BNRE 2MHAB 1J10A 4QRSB 4OZGA 5HJ3B 1H15A 3MV7A 4NQXA 5CKGA 3HFML 3VFVB 4JZNA 5L2KA 1M71B 3RY6C 2E7MA 3ECBA 3CDYA 5I1GL 4L8BA 1WZ1H 3CK0H 1RJLB 5D2LF 2BSRA 1YJDC 2DQEH 3DVGB 1BZ9B 3QQ9D 5BO1H 2DS4A 3I2CL 4AL8L 3RPIA 2R0KL 3IDNB 4FTVA 4I8DA 3DSNA 3FB7A 4MLIA 2WBJB 5A2KH 1X6NA 2IPUG 5J56B 4NHCL 1F11A 4V1DD 1V3MA 1NC2B 5D7KE 3RWGA 4PB0H 1IC4H 1MEXL 4KJWC 1H5BC 4PJBF 4NYLA 4OM0H 2AABH 4M62H 3IGAB 3C60B 3UEZA 3MMEA 4PJIE 4WY7H 2EIDA 4HKBB 3HCVA 3BAEL 3TIDB 4PJXF 5GSRB 2PW2A 2W9EL 5GGSB 4Z8FH 2C9AA 5I66A 4F57H 1EIBA 4R2GD 5C0CE 5E4EC 4B7LA 1JBJA 2Y72A 3LQAL 5DYOB 1KYOJ 1U3JA 2JF1A 1I1FB 4FXGB 1UJ3B 4YDKL 1MFCL 3L3KB 4X4XA 4RFOH 5EWIL 2EIZB 1T5WB 4KMLB 1KEGL 3N50A 1FL6B 1S8DB 3HZYB 2E6PA 3MA7B 3FO1A 2XY2A 4GUPB 2XI9A 1WUNT 5A16A 4S1DC 3REWA 4TUJB 1J9CT 2P8LA 3NCEB 3NIFF 5D2NB 4W81A 4PJHF 2AV1B 3KPRD 1LGVA 4HBCL 4JRXE 3UZEA 2CD0A 3ARFA 5LAXA 2P1YA 3LRSA 3QWRD 1HHJA 4PRIA 4NNPL 3QUYB 4DKEL 2CUMA 1E4WH 4LGRB 4HXAL 3MV9B 4KKBC 4TNVF 1NAMA 4A2LA 3U1SH 1ZHNA 2GI7A 2P44B 1HIML 1IEAB 5SWQB 4Y4KC 3I2CH 3AM8C 5AAMA 1KTLA 3QSKB 2OJEA 3CU7A 1E4KA 3BZFA 4DGVH 4FG6C 1CDYA 1LO5B 5A43C 2DF3A 2XWBB 3BH9B 4NPYA 2FD6L 3L1OL 1MJ7L 4H26B 2ED7A 4CMHB 1J1PH 4RAUB 5EU7C 3L3JB 4JFXA 1HI6B 4P23A 3O4LE 3QNXA 2VL4A 1I1AB 1N26A 1DQQB 5IK3A 2ADJA 1U2HA 4JE4B 1OF2A 2OI9B 5C0JB 3RKPA 1AXIB 2W9EH 4UDUA 4M48L 1A7PL 2DLFH 5DEGB 3LQAH 5T5FH 3MOBL 4HC1L 4PJ7A 2GJ6D 4O5LL 1FLRH 1VFAA 1DUYA 2ZUQB 4JFFB 3QEUB 1K8DB 2LU7A 3IFNH 4NM4H 2B1HL 1Q9LB 1QHPA 2NLJB 4MB3A 1RY7B 5TF0A 2A83A 3AB0B 4HWEH 3O9WB 2N56A 5FUOL 3HC0A 2PYED 1T2QL 4HT1H 3IFOA 4NT6B 4WFFD 2L7UA 5HYJA 3KJ6L 1VDGA 3RY4A 2NY7L 3UPCA 5GRVK 3BZ4B 2VR9A 4U1MA 5TH2B 3PHSA 5JORA 4G9DB 4Z76A 4HX1A 2AJZB 3VFOA 5FYKD 1J1OH 4HXAH 4L8DA 4L9LC 3S36L 4IIQA 1B6UA 1UH4A 2FX9H 3RI5F 4OZFH 3G5ZA 5CILL 1HIMH 4BYHA 3L3IA 4PY7B 3WNOA 2NX5E 4N5UA 3RL2B 1XGPA 3ZYOA 4S1RH 2HFTA 1AR2A 5H2BA 1SQ2N 3CCHB 5I8KL 1Q94B 4ONFL 2V2WB 3N1FC 3QIUB 5CP3A 4AM0B 4X6DA 5AG8A 4TPRH 3WBDA 4KUCD 4ZAKC 1FNFA 3DXAA 4W4NA 1MJ7H 1R3LA 3V6OE 1S9YA 4M7LL 1KFAL 1DE4B 3SDCC 4QXGL 1AQDA 5L0QC 2VZVA 3P0YH 4NHUB 4KZEH 2JJSA 2WINB 5DJ2B 2QQNL 2HT2D 3NCJH 3QR2A 5AAWA 5CBEB 3BXNA 4NO3B 2OSLB 3EOAA 3MX0A 3NCYS 4UT7L 4F58H 4LSPH 4P49A 3FQUB 5GS2H 3QDGE 3MBXH 1UXWB 1A6AB 3PIQB 2H32B 2BNRA 4HULB 2VLRD 2FDBP 4LAQL 5E4EB 2HVJA 2Q8AH 3QEQB 3FQTB 4X6CB 1WBXB 3F7YB 4X83A 4K55A 3SDAB 4HKZA 1IAOB 2HT4D 4GG6B 1FAKT 2ZUTA 4XX1E 5I17B 2VH5H 1BQLH 3IDYB 3SKNB 1W0WB 2APFA 1WWBX 4LCWD 4Q9QH 1VKXA 3W11D 5T1LB 5FOJA 5FUOH 2BOCA 4DCQB 3L3DB 5CD3A 1RU9L 4LPXA 3E8UL 3MLZL 2P5WB 4HIHB 1T2QH 5E4IA 3MV8E 5EBLB 5HPMA 5EN2A 4UTAL 2NY1C 1AIFA 1HXYB 3TNMA 3C9NA 3VGBA 4NQCD 2ZPKL 4Z7NF 3H6JA 1N64L 5IW6B 4V2BA 1HHKB 4DZ8B 1T5XB 1MF2L 1BX2B 1QFWH 2OL3L 3B9KC 3NTCL 3RGVA 1CWVA 5B39A 5T33L 1U8JA 4Y5VA 1G7PA 3D87B 4BQ8A 3CAFA 4H0IA 2FHCA 3S36H 5E56A 1M6OB 4D3CL 1A1MB 3OB8A 4XVUC 5CILH 1UACL 4JPIA 5J13B 1UM6L 5DRZA 5C0CA 4XVJH 3NFNB 5I8KH 1HNGA 4WWKB 2OQJB 3EW3B 4N0FA 4MA1B 3H9HB 1R3JA 5J1AA 1QYGH 4KK5D 1MWAB 5IROA 1P84J 5L88H 4OKVA 5JPMB 1KFAH 2AJVH 5J4MA 3P0VH 3V6ZA 3D69A 1CDGA 2OCFD 3LB6C 4OGZA 1H3PL 4X4YB 4M6AA 4POUB 4DUXA 3ETBF 4P2OB 1AJ7L 3O3AB 1MVUB 4IDJL 4XXDB 2FJHB 4X6FB 3L5XL 4JKMA 3N85L 4RMTA 2EC8A 4QF1A 4S1QL 4RRPA 4Y2DD 3V4VL 5CGMA 4MQ7A 1RFDL 1MRDH 3GIZL 12E8L 4ZYKA 3I3DA 5IMOA 1MJJA 5ID0B 5C7XH 3E3QE 4O9HL 3G5XB 4LBEA 3UO1H 4FOMA 4W6YB 2WBJD 3FT4B 4K23L 1OSZA 2BSTB 1R3KB 4U1HA 5C9KA 1XGUB 4PJDE 5I2IA 4GH7B 5A2FA 2E7LA 4NN7C 2DD8H 4D0DB 1NGYA 3QUZC 2GJZB 4JRYD 3S3PA 1R5WA 4WUUD 3QXTA 4KVNL 5EORL 2YD2A 3PF2A 4ODUB 5T1KB 3PV6B 3C60D 4OJFL 1YPZF 5ENWB 3U36A 1GGIH 3E8UH 3MLZH 3B3IB 3LMJH 5JR1L 3ISWA 3LN5A 4UTAH 3HC4H 5H8DA 2FHBA 2EE2A 1J88A 3NN8B 3KDMB 1DQMH 4RWHA 2BY3A 5FHBL 5DFTA 2D9CA 2EH8H 5I0DA 1DFBH 4PLKC 1R0AL 3ZDYF 3ROOB 2IQ9L 4L29B 1MRFL 3LKSA 4JO3H 1DBJL 4L8CB 3O4LA 1CZ8L 1R6VA 1FFOB 2OL3H 4QT5B 5CZVH 5T33H 1S7RA 1XH3A 4D9RD 2KZWA 3ZTJG 2HKFH 4D3CH 3RWJA 4ZPVA 4XCNA 1UACH 3G6JF 1IKNA 2EYRB 2PW1A 4HUXB 2R0LH 3WIHA 4M7JL 3FL7A 4H0HB 1IL1A 5H37G 3SGDI 3K80A 1UKQA 35C8L 1J05A 3AMKA 2IALB 3OKEA 4RGNB 1ZANL 4NKQB 2CLRA 4ZAKB 4ZD3H 3OB0K 2CRIA 1EHLL 3V4PL 3QUML 1VPOL 5DVKA 2EICA 3PQYB 5TFSL 5CKAA 3LSOA 2D4FA 4QWWC 1H3PH 3KPSB 3ARGA 1I9IH 3FN0L 4YXHH 1RHHB 1KB5L 3L5XH 2IPKB 3W5MA 3D3VD 1GPOH 5JHLH 1E28A 5KSUA 1WISA 3KPLA 1DBBL 4X5XA 4DUVA 5KSBF 2BSED 5CMAA 4YK4C 5IMLB 4WV1C 3Q6GH 3ZE0E 4CL7A 3BHBA 3MRPB 3VFRA 5HYSA 5F3HA 1QEWB 5DQ9B 3GSWA 5H35A 1FC1A 4K23H 1XIWA 4PG2C 2HTLC 4Q9BA 2AI0H 5IEHB 2JB6A 5K93A 1LP9F 1TQCC 2NX5A 8FABB 3HNSH 2DQJL 2P8MB 2ESVB 1ETZA 3EYUL 3OJDB 3G6DL 4C4KO 4X9GA 4KVNH 4WUKL 1MIEL 1MCNA 1B0WA 3PXJA 4OJFH 3S3SA 5JR1H 2ZUSA 3KNBA 3CMOL 1HZHH 4TSBH 1IC7H 4PJAB 3V6OA 4M00A 1MH5A 5FHBH 3QT2A 2FJGB 3C6SB 3W9EB 2IQ9H 1MRFH 1DBJH 3WE6B 5JW4R 2Z93A 2YPLB 2AQ3A 3ARDC 3CGTA 4YWGL 1U41A 1RK1B 1XF5B 1NC4D 4H88L 2EDRA 3FHQA 3FN3A 5SWSB 4G8EA 5F1IB 4MYWB 5JLZB 1T0NB 1M05A 2XNAB 1BVLA 3FQWA 3V0WH 2AJUL 1NCUA 1FZOB 4JO2H 4JY4B 5HHME 3DUUB 2MQCA 2EDJA 4J4PC 1VPOH 3HG1D 4PLJC 1A14L 2O26U 4BUHA 5TFSH 3ES6A 1RZIB 5C07E 1TENA 1FPTL 3K4DA 1CXEA 3PWUA 5IBTL 1AFVL 2IFFL 1X9QA 3MV8A 1KB5H 1D3CA 4OFIA 4YPGB 3MNVA 1F6AB 1VADA 1QA9B 1OCWL 2VQUA 3SCMB 3D0LA 3MRDA 4Y4HD 1HILB 3WNNA 4J1UB 2ZUYA 3IFLL 3S96A 4F7PB 4HKXA 4PPTA 1T83A 4NRYB 4JFPB 4JM2B 4TRPL 2W38A 1PFCA 1TQBC 5F1NA 5EU3A 3BE1H 4R0LA 2DQJH 3WKML 4QHLB 3EYUH 1GGYA 4KJWD 3QUZB 4WUKH 5GJTL 2IH3A 4J6RH 1MIEH 1RJYA 2PXYC 1MI5B 2PTUA 1UXSA 5D7IF 1BIIA 5IHLB 4BA8A 3CMOH 4HIEB 4JG0L 1V3JA 2ITDA 3ESVF 4LPYA 4O02H 4C58B 5DD0L 3TESA 1NKOA 5INDB 1U93A 3OQ3B 1FFPB 1BQUA 3ZKQD 1S7UA 2DYPD 5FDWA 1GVIA 3EFFA 3GMRB 2QSQA 1YECH 3ZHLA 1MCQA 4PY8J 3IDMA 2FL5A 2CRZA 1LO2H 4AIZA 2NMSA 2HRPL 2O61B 3G6JE 4WGWB 5JMRA 3L9RB 2V7NB 1I7ZA 4LFHD 4S1DD 1P4IH 3VXME 1ZLWK 1PGRB 2X4UA 3OTTA 1G9MC 1FAIL 5BXFA 4OCNC 1DTUA 2ADGB 4RMUA 3U7WL 3JV4A 3PDGA 1H3XA 2YMXL 2A9MH 4BKLA 3E6HB 1PD6A 4OIIL 3GI8L 1DLFL 1F3JA 1RUML 4MDJA 4XVTL 1JFQL 1P7QA 2IFFH 1UH3A 3RZCA 2GSGB 2EDOA 1T0PB 2M26A 1CTOA 5FYKU 1R5IB 4TVPH 4ZTOL 5D7JA 4LLAA 1JWSA 4NQDE 3INUL 5TE4H 1IGCH 4KKBD 2F8XC 4J3UA 1ACYH 1Z2KA 1PDKA 2X70A 4PJ5D 5BV7C 2FH8A 4MNQB 4KPHL 1CLYL 4Y4KD 4WV1B 3IFLH 5DJDB 4WI5A 3G04B 3PGFH 3B8YA 1NDGA 4FG6D 1K4DA 2IADA 4JKPL 4YHKL 1U95B 1ZVHA 2GSIB 3MRQA 3NCMA 3IXAB 3X14A 3HAEB 3MV01 4G8GB 1NGXA 4E0RB 3GSVA 1R3IH 4F9LC 2EDYA 5DI8A 2WWKT 1OGAB 3NZ8B 1K2DB 1WC7B 3CFEB 3T08A 1VGKB 2MJWA 3G5VA 4Z0XB 5GGVH 1LE9A 1ZA3B 2F53B 4OQTH 3UYRH 4HGWB 4EUPG 3RIFK 2Q7NA 5TDNB 4YDJA 3K2UL 1REIA 3RUGB 4OD1L 1YMME 1HXMB 1MCPH 1X5AA 1QQDA 2VUOA 3WS3B 4DW2L 1FE8L 2MPAL 1T04B 1XMWA 3LZFL 1HN1A 1T21B 4PJCB 2BVPB 1EXUB 4E41E 1CDBA 1NJ9A 4P2RE 1NLDH 4XPBH 5HYQB 3EOBA 4M93C 1YY8A 4HMEA 3BN9C 2WM0A 3WFBL 1C08A 4CN6A 2EH7H 4Z7UB 4OUOA 4KQ3L 3QQ3B 2HH0H 1S7SB 2DTMH 2YHGA 2XTJB 4LCIL 1J86A 3RA7L 1H3TA 1QVOB 3F7PC 1F42A 4HWZA 3DO3A 3QIWA 4GKOA 4YEFA 4UV7L 4M5YL 5IB5A 2X10A 3D85B 3B5TA 3QHFL 1FIGL 4HPYL 5FECA 4X9IA 5BRZA 2XTLA 1DLFH 1RUMH 5IMMA 2HG5B 3CVHB 3WSQH 1PQZA 2DM3A 3T2NL 5JOEA 2W92A 2ZJSL 4JFZL 2J8UE 2XV6B 3TC9A 3DV6A 3HR5A 4DVBA 5D6CB 2DWEA 5LGHH 5GRXG 1RMFL 1ZHBA 5DWUH 1KCRH 4HWNA 4XCEB 4F15B 3SDDC 5DK2A 1OB1A 1FORL 5E00B 4R3SA 2C7UA 1S7QB 1WF5A 2FHFA 2G75B 4RNRB 3ZE1E 4ZAKD 4I77H 4S0SD 5EOQH 2XICA 2BVQB 3GSQA 1YNTA 4U6VH 2CH8A 3VDCA 4ZSOE 4DTGH 3PQYD 4YHMH 1MHCB 5C0AB 3SDCD 4B0MM 3OKLB 4MCYB 3W0WA 3SQOH 1TTFA 3BI9X 3MLTB 3KPSD 2KQMA 3X12B 5B38G 3UTTD 2IWGA 4X0KA 4K9EH 2PO6B 4P46A 4BFIB 3QDME 2X4RB 4MNGB 4AH2B 1ZEAL 1IM9D 1KT2A 3BQUD 1QLFB 3WJJC 4PG9B 5IOPB 2MPAH 2MCPH 3RPKA 3Q2CA 3LZFH 1U58A 5KTEL 5C07A 5F7LB 5CS7A 2ZSWB 1NFIB 3I3BA 1GC1L 3IU3B 3SJVD 4I3RH 3H3BC 1TPXC 4GRWB 4QHUA 2ZUUA 1LNUA 2OR9H 1N5YL 1G7HA 3T77B 5JOFA 4KQ3H 4MMZC 2ESVD 4OV5A 1I9JH 3QFJE 4DKAA 1II4E 4U2ZA 3T0XA 1OAZL 3LS5L 1SYVA 1WVZA 5L8JB 5IB4A 1H0DA 3AREC 1BD2D 1MCOH 2FLRT 2W9LA 3PHQB 4YGVB 5DMIL 5DJCA 5E2TL 4KJYA 5ECJE 1W0VB 2NY1D 4R26L 2DQDH 2Y5TA 3O11A 3HI1B 1QLEH 2OR8A 3RAJL 2XYCA 2ID5A 1JHLL 3B9KD 5C0DA 2NY6B 3VWJA 1YDPA 4OLZH 1U2CA 2O5XL 2VDRL 4PD4K 4M61A 3GO1L 2IAMA 2RAMA 1RMFH 1S5HB 4XVUD 4Z7VB 4BK5A 4LSTL 4XZUA 4GAGL 1EUUA 5BV7B 5SWZD 4M02A 3JBG7 2NY4C 4TTDD 3WFHA 5JHDD 1XCTA 3VMOA 1C16B 5J9PB 5ACZB 2R2CA 4GT7A 5MEOB 1S9VB 2YXFA 1J8HB 3S7GA 4XWGL 2VLJE 4Y8AA 1YEKH 2BVOB 1K5NA 5CSGA 4APQC 1DJSA 4OF7A 3B9EA 1WBZB 1NGPL 3LB6D 1A7QL 3VXMA 2R1XB 4RWYL 4Z78B 3PWPB 2FBOJ 2IBZY 1JMXA 4ZUVB 4UIKL 3BD5A 2R29L 1JYXA 4E42B 3H8NA 3B9AA 5SV3A 5KTEH 4LOUC 3P4LA 3B2UC 4HK0A 4OCWL 3N9GH 2BNUA 2AEQL 4ZFFA 2HJFB 2WK2A 2LTQC 1TETH 1NCWL 5D1ZA 3TCLB 5HD8C 4NQDA 2C1OB 1GAFH 5C1MB 3UX9B 4LRNL 3GMMB 2CIIA 2X2YA 5HHOE 1CF8H 1KBGL 2VIRB 4G6KH 4XH2B 1GGBH 1G7JA 5CJXC 4YH6A 2XY1A 2LAGB 1HQ4B 4ERSH 3QUZD 2H2SD 4GQPH 1G84A 3HNVH 1HK6A 4M3KB 4ZOBA 4WEBH 4ISVA 2P5ED 3KG5A 5D1QA 5E2TH 1FO0L 3U7YL 5B22A 1W72L 1JE6A 1H3GA 2AAVA 4RFNC 4EDWL 1YMHB 4PLKD 3RAJH 5D93C 3CH8A 5AZEL 1JHLH 4N68A 3ULVC 2H9GB 2GUOB 1JPSL 3A6BL 1H3UA 3EYOA 4X6CF 4L4TE 3REVA 4GG6F 1CICA 1U8NB 2O5XH 2NR6D 2VDRH 4KQ4H 2A74B 2CQVA 2DQIL 4PGEA 1U8QB 5IB1A 2BVYA 4GAGH 1M7DB 4MWFB 3SKOA 1T22A 4P2RA 1AHWA 3QXUA 4FMKA 1MFAL 5I71B 4NUGL 3P9WB 1S9WB 4DOHE 43CAA 4XWGH 3K0WA 3TM6A 4OBSA 4WEUD 5E94B 1TZGL 4JHBA 2FIKA 2EDQA 5IB3A 5GGQL 1I4FB 1I3RA 4QHKJ 3HE7C 1A7QH 3EOYG 4QWWD 4QRQA 1WWCA 1ERNA 5FK9B 3U6RB 4OT1L 5ADOL 3C6LC 3RY5A 4UIKH 1INDH 3VI4F 4FQ2H 1WT5A 4HIJB 5K9KA 5T3XD 4YBHA 3U82B 3HPJA 4FFYH 4Q9CA 1AD9A 3BP7A 2AEQH 2B7DT 3MV9E 2J8UA 1F02I 3VG0H 1MNUL 2AJSH 4WFED 1LO0L 1DQJA 1U9KA 5INCA 4U6HB 4LRNH 3GIVA 3MRNA 4NO2B 1TLKA 3FZUC 4F37F 2HTLD 1L9MA 5BCAA 2UUDH 3D39B 1CLZH 1D5IL 3H3PL 4NKDB 4G9FA 1QBBA 3TBVA 5CSZB 1LEKB 1U8IB 4PJ9C 1OGAD 3FB6B 5LQBH 1G7IB 3IKCA 3IAGC 4ZFGL 1HYSC 2A6KA 4YDLB 4IOFC 5ICYA 4NZTL 4OFYD 2F53D 1FO0H 4GMSH 1AGCA 1TDQA 1W72H 2H3NA 2H6PA 2VL5A 3RU8L 3I6LE 3WIFB 4HLZG 1U42A 3NIGF 4AG4H 1SJHA 5BOPA 2F58H 4AJ0A 2VXUL 3F7RA 2R69H 3FQXA 3MRHA 3WJLA 2YOCA 4AEEA 4DQOL 5C86A 5DJYB 4S11A 3P30L 5E5MA 3QDMA 3RTQC 4FQIL 3ARDD 3U0PA 1D5ZA 2DQIH 5MERB 3AAZB 3JWDL 3IB4A 2X4OB 2DJ4A 1HINL 4HH9B 1LEGB 2L0DA 4EQ3A 2BC4A 3QUXB 5DLML 4Y16B 1BOGB 3TEUA 2IFGA 3QDJB 3KYAA 1FNEB 5H94B 4LPTA 4Z7WB 1UEYA 5GGVY 4GRLC 4X9HA 5I6XC 1HWHB 3CZFA 4MVBC 4QCIA 4ZS7L 2ZSVB 4J4PD 4IMKC 5F70A 3QFJA 4PLJD 2QKIB