4UT9H

Crystal structure of dengue 2 virus envelope glycoprotein dimer in complex with the scfv fragment of the broadly neutralizing human antibody ede1 c10
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
EVQLVESGAEVKKPGASVKVSCKASGYTFTSYAMHWVRQAPGQRLEWMGWINAGNGNTKYSQKFQDRVTITRDTSASTAYMELSSLRSEDTAIYYCARDKVDDYGDYWFPTLWYFDYWGQGTLVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition Determinants of Broadly Neutralizing Human Antibodies Against Dengue Viruses.
pubmed doi rcsb
source organism Dengue virus 2
molecule tags Viral protein
molecule keywords ENVELOPE GLYCOPROTEIN E
total genus 24
structure length 127
sequence length 127
chains with identical sequence I, J, K
ec nomenclature
pdb deposition date 2014-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ut9H00
5D70L 3MV8A 2D31A 3QXAB 5IOPB 5GSVB 5DMGD 3BN9C 2PTTB 4AM0B 5HVWA 5E8EB 4MAUH 4X5XA 2BVTA 1CFSB 2RFXA 5TDPA 3VFSA 1WISA 1C5BL 2BNRE 4JFOA 2CGRL 3ULSB 3T3ME 1UB6A 1P2CB 3T1WA 2AGJH 3L5HA 4EDXA 5IG7A 3DO3A 4Y4HC 2ARWA 2PW1A 3QCUL 3QUZD 2CRZA 2FGZA 4I0CC 2LV4A 4LCUB 2BSTA 3UP1A 4D9LH 4QF1B 5ESVB 5I16B 3IDIA 1JJUA 3QEUB 5L2KA 4WDIB 3FOLA 4LSRH 5EOTB 3D2UB 1QR1B 2WM0A 3VW3L 5DMKA 4F2MA 1INQB 1MUJB 1SJXA 1J0YA 2DLFL 4RZCA 4GRWB 4MQTB 4OLWH 4PP2A 3VD7A 2BDNL 3M07A 4OZHF 3B9KA 1FRGL 1A6UH 2YA2A 2Y5TA 3PXHA 1HI6B 4P57B 4FFZL 4S10A 3JV5A 1HXMB 4MAYC 2XQBL 4QRQA 3EO9H 4ZOCA 4P59L 4GSDH 2O61B 4PTTA 3QZWG 4AEHH 4RBPK 4ZFOA 4UQ2B 4OGYL 2P8PA 3IDMA 4Z7VE 1YMMD 3TWCL 3NABH 2Z31D 4M48L 2V7NA 5ACMA 3MV9B 4CN6A 4K3EL 4E5XB 4YHKL 2J8UE 4P5TD 5EOCJ 3SJVA 1EH9A 5HHQA 2DWEB 2AJ3B 5C6TH 2IAMD 2AJUL 5C09B 1MWAL 4X0KA 1FHGA 5IW1A 3HA0A 4GW5B 3VFMB 4RX4A 2FB4H 3VE0B 4U7KA 1MVUA 4NPYA 5E9DA 5MP6H 3QI9C 4HH9A 1MH5B 3MO1A 1OT1A 5EWIL 3V8OA 1NSNL 5GRWA 1CR9H 1X5HA 4BQBA 3FQNB 3RWCB 4PJGE 3GI8L 4HMDA 3BEVA 3VRIA 3RWEA 3BZFB 3FZUD 3WD5H 5HHOA 1MQKH 3C6LB 2VERN 4HJJL 4ZXBA 2P24A 2R2EA 1XCTA 2AK1H 1S9XB 3B3IA 4AMKL 5EU6E 4LVNC 5BOPA 4NNXB 3GMNA 1BWMA 3MOAL 2A6DB 3UBXI 1AGBA 1N2RA 1JGDB 2EDYA 1CDUA 3RZCD 3NZ8B 4RWYL 2F9BT 2GT9A 1VFOA 3NGBB 4RGNE 5ISZB 4LSPL 4MA1B 1JPGB 3QWQB 2IBBA 4HCRH 5ALBL 4U6VL 1DBML 4J23A 4NQEB 2DB8A 2BSRB 4JVPA 5C08A 3DYMA 1BD2A 2BFVL 1QSFA 5AYQA 4Z0BH 5EZOH 2FBJL 4DN4H 1EEQA 4Y16C 2AQ2A 1MCHA 4L4TA 3WS6C 2VDQH 4M1DH 5I1EH 2K7QA 4GKZB 4I2XA 4Y5VC 2FEDC 3BRGC 1FO0H 2BC4B 4YNYA 3CFKA 1D6EB 3C2SA 1FGVL 2A9ML 4PJCA 5FCSH 4BK4A 4UTAH 2R0WL 3V0VA 2CDFB 3CFDA 3MRIA 1M71A 1QVOB 3MLUL 2MOVA 4N90E 4EUPH 2C3VA 1P53A 1T0NA 1OP3H 3NCFB 7CGTA 1MCPL 3MYJB 4K8RL 3VFOA 2VSDA 3MACH 3HC3L 4AJ0A 1KB9J 3I02A 3PWLA 5CJ5A 5B39G 4UQ3A 3FONB 1HCVA 4FTVA 1KTDB 5CHNB 2BNUB 3EOAA 3OR6A 1MEXH 3IDIB 1R3JB 4MJ5A 1D5BB 3RAJH 1NFDF 4IDJH 4Z7VF 3SDAC 1F6AA 1U42A 2YXMA 2OJEB 4FHBD 2X4QA 3CFJA 4G43A 3L3OB 2DI8A 4WWKA 3WIHL 3F7VA 2APVA 1Q0XL 3O2DL 3FCTA 4KI1A 3CH8A 5CEYB 2VR9A 3VD9A 5L0QC 5KVGL 2VITB 4XPGH 2VLMD 4R4ND 4KVNH 1KBGL 1LO2L 3G5ZB 3SGJC 4JFHD 4NGHL 4L4VA 4PTTB 4QWWD 4GRWH 3BWAB 4PJHF 1IQDB 1I8MB 2JJUA 3FFCE 4PJIE 3PWPE 4M48H 4KMQA 1U3HA 4Z95L 3ILPB 2J4WL 1DEEB 3E2HB 4BQCA 3L3IA 3T0EC 1EJOL 1FBIL 4M61A 5DRWB 3U4BL 4FS0A 1XIWA 1QFWH 3HI6H 5GSRB 3VFSB 1R5IB 2J4WH 4O2EB 4DFIA 4X7CC 4F80A 4JFYB 2XICA 1A7QH 5DD0L 1PG7H 1RK1A 5AWNL 2YHGA 3PP4L 5FYKL 3HR6A 5T3XH 5C0CB 4P23C 4JY6B 2B7DT 3LH2H 3TJHC 3O2VH 3O9WA 4JFHE 2C1OB 3FQNA 3RWCA 1G7JA 1GGYA 1LO2H 1V7ML 2LTQB 2YN3A 3EJYC 2ITDB 3QCTH 5EC1B 3TJEL 3V6ZA 4M43L 2PETA 5DC9B 3LV3B 3B9EA 5F7YC 3K3QA 4K3DH 3WIFA 2J8UA 2UZYB 1MCPH 4H1LG 5TGBA 3HAEG 5I76B 3T77A 2QADC 2I27N 1LP9A 1MPAH 4OF5A 5IK3B 3AB0C 4G8FB 5IJKA 3QIBC 1SM3L 4UT9H 1T1WB 5DJCA 4PJ8B 4JRYA 3BN3B 1ODAA 5E0QA 3IKCB 2R0ZH 3GBNL 3MRLA 3RWIB 5J56B 1MEXL 3LQAC 1M4KA 4KRPB 3N85L 3FRUB 3FB6A 4X5XB 3KPOB 1I4FA 3CPLB 4NN7C 5E2VL 5EC2B 1WBXB 4R4BB 3K8KA 4PRID 2HKHH 2Z4QB 4HSQA 4NUGL 1XGRB 4L1DA 1J0HA 3NIFF 3FOMB 4XVJL 3CFEA 3OAYK 4LRIC 4HCRL 2P5WA 5T3ZD 4QTHA 3T1FB 3O3AB 4JPWL 3CFKB 1FFRA 2R56H 1CCZA 3QI9B 3QAZC 2O5YH 2Y25A 4WFGD 3EKCA 5D93B 1BBJA 4HDIA 4YDKL 2NXZB 5AAWA 2FECI 3H9SE 1KENH 3IFLL 2FGWL 4MD5B 4LNVA 4P46C 3EO9L 1CFBA 2ATKB 2FD6L 4ZFGH 4Z8FL 2VDKL 3O4OB 4E41D 5A2IH 2AEPH 5KSBE 4JY5L 1NDGA 3GJFK 2GTWA 1P4BH 2DD8L 1A6UL 5FYKD 1HSBB 4GRLB 4I0KA 1K4DA 4QNPF 5FO9B 3MLZL 3U30C 1S9VB 2A73B 3GSUB 1I1CA 5D2LF 4DKFH 1MRDH 4OZIA 1F00I 5L2JB 1M7IB 5DRZB 3TEUA 5FOBB 3HNTL 3UJTL 3QRGH 3FB5B 4CU7A 2V9RA 4PJBE 2OMNA 5C3TA 3U82B 5L6YH 3PV7A 4YHIB 2BP3A 3KPRD 1ZLSH 4FOMA 5I18H 2ZG3A 1AQKH 2W38A 5GGTH 1AD0A 3OGOE 1P7KB 1CGYA 5KJRH 4PJ9D 4R97B 1IVLA 1LO4L 3IETB 3SDYL 1CR9L 5CP7A 4PJDF 2VDLL 3P77A 4KI5D 3RNQA 4PGEB 3PL6A 4K3GA 4XP1L 3VWKD 1T83C 4M3KB 3CZJA 4ONHA 4DW2H 3MRQB 2MNUA 1S7UA 1D5MB 4OQTL 5JLZA 2RHEA 5E94A 2Q86A 5ICYA 1PQZA 1W0VA 2VDNH 4MNHA 2W91A 5JXEC 3ZL4L 3F7YA 4OLVL 5GHWH 1U8QA 3SJVB 3AGVA 2AXJA 3D3VB 3BSZL 1JHLH 3N9GH 5E7BA 1IT9H 2FWOA 3LQMA 3PHOA 5E00A 3D48R 2IWGA 3OXSA 4LLYB 3SKMA 3NCJL 1MCWW 3MUY1 2I24N 4PLOB 1HHJB 2PO6D 4YJZL 5C09D 2CQVA 3O8XD 2VLJB 4QYOA 1WGOA 3D69B 1ZT4A 3G5YB 1QLFB 1IQWH 2DYPB 2GEEA 2WUBL 4R4FH 5GS2H 1B4JH 2ED9A 5JOFB 2EH8H 4NO2A 3GK8L 5EOQL 1NMBH 2Y36L 5D7KD 3ORJA 3BKMH 1WCQA 4XCEB 1V05A 4OFYD 3MBXH 3QCTL 2ICEA 4YZFE 3TH2T 2FLRT 3CU7A 3DHJA 3HZYA 3MJ8A 5E5RB 2XWJA 4ODSH 5BMFL 3P4OA 4AT6A 4NCDA 3VXOB 4H0IA 2C3XA 1YEDB 3V6OE 5E9DE 4HIEA 1Q94B 3KS0J 2V5TA 4ORZC 3WFZA 1MCSA 3ARGB 4F7EB 4PJDB 4G7YH 2ATPA 3BP5A 3S96A 4KJPD 3ARZA 1J87A 2G75A 5DHYB 1I1YA 1KJ2H 1AFVL 2DKUA 1R24A 4JFZL 5CGYC 1MNUH 5K9QI 1Y6KR 3ZDYF 2GSGB 4H26B 4AENA 3KPSE 5JW4N 3U2SA 3IU4L 4GQ9H 4LGSB 4CBPA 1KCUH 2DWDB 5IB2B 3TYFB 1IC4H 5ITBH 1MHPH 3ALXA 3SY0A 1EFXD 5GIRB 1N5AB 4JG0L 5HI3C 4BUHA 4PP1D 3MCG1 4F9LA 3QIUB 3BJ91 3UTQA 5FHBL 4AIXA 5EIQA 1S9WB 3OTTA 2NLJA 1I9IH 5ESAA 3FKUS 2X41A 2YA1A 1B4RA 3HUJA 3DX6A 5MHSD 2JK5A 1G6RA 4WV1C 1WFOA 1NUGA 2E9JA 4PGJA 3FO0H 5JHDA 4I9WE 1PG7L 1CE1L 2HKFH 3IXAA 2X9XA 3RZCB 1IQDA 1EIBA 5C0DB 4G8IA 1QKZL 1UH4A 1YYMH 2VC2H 1JZ7A 2GJZB 2CDEB 4PRHA 1HH6B 4Y4KC 3P11L 3DXAB 3MRHA 5KSBB 3MLTB 3S36H 1D7FA 3HI1B 3PL6B 3ZE2F 2VDNL 4R4BA 4DGIL 2ADGB 4LOUC 43CAB 4RGNC 3DYOA 4U1MB 1B88A 5DJ6B 3GSOB 1V3JA 1YUHA 3B5HA 3LRGA 5HGAB 4CW1A 2VDLH 1IEHA 2Z93B 3F7PC 1S3KL 3KYKH 3UJJH 2W60B 2UWEF 4HDIB 3QWOA 2BFVH 3U46A 2NR6C 2YR3A 3OXSB 3QQ3A 1ZLSL 2ZCLH 4TVPL 4R4FL 1R5IA 1ZHBA 3ARYA 1FL6B 3GMLB 3S34L 4YHYB 4WU7A 1AHWA 3SGDH 5D9SA 4FFWC 3RKDD 1JZ6A 1MAMH 1IGTA 4Z7UE 2DIAA 3LKQB 4LEXL 1H3PH 3FFCA 3LCYA 5CD3A 1T80A 4DEPC 1KXVC 1MFEL 3VXSD 4ZNEE 4NRZA 3GSXB 1W2KT 1X44A 4GW1B 3BRDA 1FAIL 1O7VA 2VAAA 1U41A 1NUNB 2C26A 5C0EA 2OR7A 2P43B 3K7UA 3LSOB 4Z7OF 2VTFA 3FL7A 2BXZA 5T1LB 1QRNB 5C0IA 4KUCD 1UJ3C 4DKAA 3EYUL 3H42L 2HFTA 4WGWB 3T2OA 4MD5A 4L8CB 4XRCA 5HHNB 4KVCH 4L3CB 5I18L 2DM7A 5FDWB 1ZLWH 2CKBA 1K8DB 3QNXB 4ONGH 4LEXH 3U0WL 1GYAA 2Y7QA 3P9MB 3CFEB 3QDAA 1YPZF 2VLKA 4F7CB 5I75C 3TWCH 1BVKB 1WFNA 2UZIH 5DJDB 2K1MA 2PTVA 3JV0A 4LF3A 3VG9C 5LGKA 2E27H 4TNVF 4X6EB 1ZVHA 3MC0A 4ZOAA 2BZDA 4M6OL 3SGKA 4HIHB 3FT4B 1RJZB 4UV4L 3UTPD 5FYJD 1I7ZA 3VFVA 4JY5H 4FMFA 3VDAA 1F4AA 2HTLC 5C07E 3V5HA 3O3DA 3VXPA 2P8LB 2GTWB 3AY4C 2F54D 5CCKL 5F71A 2XA8L 3RVUC 1JPSH 4HBCH 3JWOH 4LARH 3MJGX 4PRBB 3G9VA 5ANME 1BLNA 4BQ9A 3JXAA 4ISVB 5HVGB 3RZCA 1Q0YL 3RGHA 1RIVH 4LLDB 3MRQA 4G8IB 3OKEA 3GKWH 1T1YB 2XWBB 3TO2A 4FFVD 4PJBF 2H26A 4F7TB 3GIVB 4HIEB 5FXCH 5HI4C 3VFNA 3ZDXF 1J1XH 3OKOB 4OLXL 1NCAH 4PJXA 2C3GA 2CKBL 4W68A 3EO0B 4KK8C 1AD0B 5DK0B 4KTDH 3PP3H 4HUUB 1VKXA 5E6ID 4S2SA 5BS0E 3AAZB 3WUZA 3OKLA 3WSQL 2ARJQ 4PB9L 5DJAB 5I1HL 2LABA 3LN4B 2CKBH 4HHAB 4Z18A 3UYOD 2L0DA 3RP1A 4OFIA 4MA8H 3BVNB 2XN9B 3U7YL 2OXHA 5CEZH 1KEMH 4XP4H 3TYFA 3U0TB 5JHDE 4KROB 4XH2A 4AG4L 3H0TB 1KPVA 4K3DL 1MI5D 4N8CL 3RTQC 4QXTB 3ROOA 5K9OA 3QQ3B 4DKDC 3ROLB 3CDCA 1IL1B 5DC0A 3W81A 3WFDH 1LO3L 1K5NB 1EV2E 3IDGB 1WZLA 2Z92B 3VW3H 1FNEA 3C09B 4KUCF 2EIDA 4QHKI 3B9VA 5FOJA 2PW1B 3MV7D 5HYSG 3HN3A 4P2OB 1G9MC 1BGXH 4LIQH 4HEPG 4JN2B 4HXBH 4MSWA 2DYPA 4F7EA 3BPLC 1VPOL 1QFPA 2B4CC 5A16B 5HGBB 5L2KB 2C7UA 1BFVL 3DIFB 1R3LB 3PGCA 2YN5A 3OG6B 3ZKMD 5C0BE 3SQOH 1PZUB 1XGPB 2CIIB 3HE7A 2WUCH 2NW3B 4P2YA 1ETZA 3CDGA 3HRZA 2XZQL 1I1RA 5ALCL 2QSQA 3MTRA 3S3JA 4FNLH 5BZWB 4APQC 1G9NH 4FRWA 1CD8A 1V5JA 4I1NB 4JFOB 3MYZA 1ZA3B 2NMSA 1ZEAL 1E4XI 1AO7A 2F15A 4JGMA 4L9LC 4P9HL 2D31B 3QXAA 2IBZY 3DBXA 4NYLB 3H42H 4OAWB 5C08D 1A6TA 4PJDE 2GJJA 3I3DA 4KI5F 1NLBL 3AS3A 2X05A 1N4XL 2AJYL 2VLRD 3VG9B 3QNXA 1R24B 1MLCA 4UILL 1ADQH 3RX5A 4L29A 4QHKJ 2BOCB 2FSEA 1S5HA 4PBVC 4JHWL 3I9GL 4RZCB 1ZVSB 5IB1B 4Z77B 1EX0A 3GSVB 5HI5D 4UDUB 4HIHA 5E5MA 3WKML 3IF1B 1AKJA 2VLJD 4MJ6A 2GJ6A 3KAAA 3FOLB 4NHCL 3KPMA 1KJ2B 2VUYA 2HMID 1ZGLB 1BIIB 2AK1L 4AMKH 4DAGL 2VDPH 1NCTA 3JWDL 3HNSH 1DFBL 1UKQA 1VFAA 5TE6L 2EYSB 2R1YB 4JG1L 4M4RA 4XPBH 1MSPA 4D9RE 4Y1AD 3ARRA 5EN2A 3L3GA 1EFXA 1E28B 2ZWLT 5GQBA 1IGYA 2BVQA 4DN3L 1TNMA 3GMOA 4LSUH 2YD5A 3GJEA 3QWRD 3P3YA 3UZQA 5IJVA 1IEBA 3SKOB 3BKYL 2B20A 3KR3L 4JZNB 4R7NA 3HAEA 4U6YB 3IDYB 1KCLA 2GT9B 1NAMH 1U8IB 2ZUSA 5J1TC 1LQSR 3BQUC 4YUEH 1R6VA 4YE4L 4H5SB 4PGZA 4FQ1L 3VE0A 3D0VB 4HJ0C 3W82A 4HX1A 3N50A 2I9TA 2BSRA 2ADFL 4FQ1H 4IMKC 2ICWI 1SEBB 4ZDHA 3GMPA 1E6JH 2AP2A 4AQ1B 3Q5OA 5JDJA 3MUZ1 3BN9D 3TBYB 1DBKH 3VFGL 2YD1A 1MH5A 3MO1B 5F7WC 3PNWA 5DS8A 4M7KL 1EO7A 3QT2A 3ARVA 3UBXA 4DUXA 5DMYA 3UTTD 3PWNA 4FXKA 3QEUA 3HMWH 1WBZA 5GZOD 4XNZB 1CLCA 1YEJH 4E9LA 4Y5VA 5JR1H 4UOW0 1GZPA 1PYWA 3WS6A 3MJ9L 4OGXH 4OFDA 2WIIA 4JHBA 1U8MB 5I8KL 4O5LH 2F5AH 4V1DE 5MI0C 5HYJD 5F7EL 4QY8A 3DRTA 3KDMB 2X44D 3QUZA 4HXAH 4HWBL 4JPIA 4D9LL 2QSTA 2P5ED 1YC7A 4S0TD 3DTXB 1MAML 3OWEA 1FFNA 4HPOH 1I3RB 2YC1B 3K2UL 4ZFOB 1UB5A 4QHLA 2CO7B 3K1DA 4MNQE 3GBML 4PD4J 4E42A 4K3HA 5FB8B 5H35A 4GQ9L 2AS5M 1RUKL 3VFNB 3DXAD 4JKPH 3L7FB 1DQDL 2H32B 5LGJB 2VXTH 3QA3B 5DEGA 2AERT 3KPLA 1KJ2L 5F96L 3L3HB 4M6MH 4U31A 4YQXH 3OZ9H 1FL5A 4JFDD 4G7YL 2XY2A 3WUWA 2OTUA 2DJUA 5EUOB 3FN3A 1U92B 1QRND 5ABDE 5H37G 3NPSC 2NY4C 3D0LA 1NC4B 1MJUL 2UVEA 5DQ9A 2ARJA 4XH2B 1L7IH 2YSSB 2COQA 1VFBB 4WCYL 3WIFB 1II4E 1NH6A 1ZT7A 2W0FA 4DAGH 4TUOA 1JGUH 4F3FA 3VDBA 1CXKA 3AU1A 4LGPB 4Z7VA 3RPIB 3S4SG 5D5MF 4NFCA 5GS0D 2GITB 5T5FH 3GIZL 3PWPD 5J12B 4EUPG 4TOYH 4WENB 4FABH 3Q3GA 3QWRA 1JI2A 4U7MA 2ZUQB 4HKXB 3MLSL 5C9JB 1N4XH 4WTWA 1GPOL 2F5BL 2VE6A 2Q87A 2B8OT 4ZS7L 4ZTPH 2CUMA 1MOEA 4LRNH 1WZ1L 5L88L 4Z7UA 4QHMA 2OYPA 2FYYB 4PRIA 1JNHB 1B6UA 1TITA 4ZNEA 1YEGL 2QJDA 1DE4A 5I0ZA 4PJ7A 3BDYL 4LPTA 1CDCA 4DW2L 1I3GH 25C8L 2F8XC 4JGJA 4HWUA 1KIPA 3FQWB 1U8OB 2VZTA 5DRWA 4KUZH 3W5MA 3N1MC 1MREL 3TT3H 2D0GA 3MNWB 3LD8C 2XXMB 4L3EB 1NDGB 5DDHB 1CZ8L 5J6HA 1HKLH 3ARBA 2VLRA 4JO4L 3WDHA 1HYSC 3Q5TA 2D0HA 1OAZH 3TBYA 4HHAA 2QTEA 3ARED 4P3WA 1ZMYA 4N0UA 2LQRA 3HFML 3BIBX 2DYPD 3MUJA 1MFBL 4Y4FD 3WL9B 1PD6A 1SY6H 4HT1H 1XIWC 1KPVB 1PLGL 1EEUA 3DV4B 2AK4A 3ULUC 2G60L 1BIHA 4GUPA 5GRUL 4DQOL 1UJ3A 1BIIA 4NJ9H 4JFFB 1AI1H 5HVFB 1MHPL 3MLUH 5IQ9B 1S7SB 3BX7C 5CJQL 4AEEA 1XR9B 1NGWB 3RKPA 2VRAA 3HZMB 5CLWA 2LVCA 5CWSA 5K9QG 3PDDA 5C0BD 4FQXC 4A2LA 4PRAB 2HT4C 4QRPB 3VXMD 2N7AA 3P0VL 3QUXC 4OCWL 4KXZI 1DBBL 1GGCH 5EZLA 1MJJB 1GCFA 1MJ8L 5E2TH 2DM3A 2V6HA 3FRPG 5E8PB 2BNQB 1VFMA 4Y88A 1NBZB 1NMCC 3NCYP 2FIKA 3ZKNC 1OL0A 4HPOL 2KKQA 4P5MA 5IHZB 3DETC 1ZVSA 4P2QB 1Z9MA 5IB1A 4LU5H 2DQEL 5SX5K 4M1DL 1P4LB 5KVEH 4CKVX 4R0LC 1A6VH 1FVDA 3ULUH 15C8L 2Y9RT 1BFOB 3FB7B 1ZGLA 4P9HC 3VH8G 3HZVB 3STBA 5EFIB 1FL3A 4XAWH 3BP7A 2X1QA 1ZGLP 3SDYH 4OF8A 5E6IA 2F74B 3QHFH 3V5DA 1LDSA 3K0WA 4MNQB 1RK0A 1XF5A 1OAQL 4B7IA 4RRPA 4Y5VB 3TJHD 2AV1B 1T5XB 4N1CA 4MWFA 4WEBL 2AJUH 5GISL 4R0LA 4S1DC 1U91A 5I1GL 1FQ9C 3MBEB 5MEOA 1SJVA 4KV5E 3N06B 1SBBA 4XPHH 2GTZB 3PUCA 4ODXA 1A6WL 4H88H 2E5EA 1T22B 3TN0B 4NC1E 2C1PA 4MA1C 4X6FB 1HYSD 1Z3GH 4PGCB 3VFPA 4M02A 4HUNB 1I4FB 2XZAH 5TPWL 3REWA 3TA3B 3O11B 3QQ9D 4DGYL 3K4AA 1OP3K 5FO8B 1GXEA 3RY4A 2VDQL 4HFWB 3L7FA 3EFFA 2A2QT 4XPAL 3VG0H 2P5WB 4E0RB 4KDTC 2LU7A 5E1AA 4G5ZH 1JRHH 5CSGA 5GGRA 1JN6A 1K9TA 3KWWA 5F72S 3UTPE 4PJFF 1BF8A 3BPCB 1TJHH 2XG5A 1U3JA 4BFIA 2VXQH 4WHYH 4KHTH 5KSVA 2X09A 3B5GA 2OP4H 3EFDL 2JELH 2NLJB 2V5RA 5JORB 3LVEA 4U1GB 1DQQA 4EDXB 3GMQA 2YWYA 1YEFH 4XNQB 4RDQG 3BUTA 4JEGB 4GW4A 3CZFA 1DQLL 5DO2D 1U8MA 4O58L 2Q7NA 3CUPB 1F6LL 1H0DA 1ACYL 1UACH 1QEWB 2DQIH 3EOBB 4XCFH 4WI4A 3FFCD 5IIEB 5DFVC 4DCQB 5JIHA 4U1SA 1RZFH 1RFDH 3D25A 4K8RD 5BRZD 1AGDB 3OKMA 4ELME 2HMIC 4W4NA 3MLYL 2FGWH 4NC1C 1CDIA 3THML 1S9WA 1LO3H 4MNGA 2HFFB 5ITFB 1NANI 1GVIA 2DQFB 3T0WA 3GSNH 4O51B 1RZKC 3MV9E 2AEQH 1I9IL 5C9JA 3P4OB 1T89A 3LOWA 4WEUD 4NHUA 2DBLL 1XZ0A 4G7VH 5DUBA 4RFEB 4KKBC 1YDPB 3DMMC 5D7JB 2FX9H 4NIKB 4D9QD 2FYYA 4LNRA 5ILTL 4P3CH 1C5BH 1MCDA 1YY9C 3NABL 4M7JH 4JZJB 1DUYA 1WC7A 4MQXD 4RFNC 5EPMA 2MQ0A 2LAGB 2OJZL 1KYOK 3FHQA 2MFNA 2ZUQC 2DICA 4RMVA 4FQXA 1TZIA 1VFBA 2ZPKH 4ZYKB 3TCLB 2XY1A 3NACH 4Q9CA 2WINA 3QR2A 2XQBH 4PJIB 3BRFA 1ORQA 2P7TA 3RZCC 1EHAA 2RQ8A 4KHXH 1U8HB 3L3DB 3FO1A 4WY7H 1JZ8A 4ZUVB 1JF5A 2YUVA 3VFUA 3WUWB 4EXKA 5J9PA 2R2BB 1A3RL 5F6IC 3G04A 4OSUL 3QEGL 4KJWD 1IM9B 2Z8WC 3DURA 4OZGB 1ORSA 1Y6NR 4WO4A 1NC4D 3C6LA 3QQ4B 1G7IA 1CD0A 5DMKB 4NZDA 1QLRB 1T83A 4WJ5A 4PLKD 1NMBL 3CD4A 3UTSA 3QJFB 3VXUD 3OAUL 4PRPB 5MEOB 4TSBH 1JGDA 4W6WB 1GZQA 4I4WB 4U1JA 2VXSH 4QXUL 1YQVH 2DQUL 1F45A 4M6AA 4DK3A 4XNUH 1ZS8B 5HGDB 1IBGL 4IMLB 2VLRE 1UXWA 3NN8A 1HCFX 4PS4H 4OV5A 5EBLB 2FJHA 5TDPB 3WFBL 4HV8B 1KIUA 2YZ8A 3QG7L 5J6HB 5I8OH 2ICWJ 3F8UB 5IP4A 2VIRA 5TQ0H 1FZJA 4JO3L 3O3EA 5CSZB 2O5ZL 2LU4A 2EICA 5T5NG 1NJ9B 5BQ7B 3ZT6A 2UY7A 3PGDA 2ZUVA 3VRJA 4Q58C 1BF2A 3BYTA 3PQYA 4KRPC 1FN4A 4OKDA 3UCRA 1FL3B 4L3EE 4KKBD 4IHOA 1I85A 1TZGL 1C16B 2HFEA 4F33A 4NO3B 2J12B 2OR9L 3RU8L 3IDUA 3CIQA 4JHZA 4NRZB 1ZWIB 1G6RB 4LCCB 2EXWD 1OT2A 1YEFL 2JJSC 3B3IB 3QNYB 1G6RL 5AUMA 4GMTL 1Y6MR 4J3SA 4LLMB 4PPTA 2IH3B 1OTUC 4GAFB 3ZE2E 1KPRA 4L8DA 5IVXA 5E24E 2IADB 1Z2KA 4GJTB 5BXFB 1TETH 4RMWA 3SE9L 4K7PX 1UWGH 2ERJB 4JFFD 1F3JB 1QFWI 2NX5E 3CVHH 1FG2A 5IEHA 2UWEE 5E8EA 3MRHB 5KSBA 3MRFA 1E4WL 2OBGA 5F8QC 1T7XA 3ZKXB 3TM6A 1FGNH 2YPVH 4OM0L 1CLOH 4XBGB 4LVHB 2O61A 3BT2H 1C08A 1RUKH 1JHTB 3DOSA 3BIAX 3OKYA 4FG6C 4K23L 5I6XB 4NQDD 5T5NF 3GIVA 3H0TA 3QO0B 3BEWA 3MROB 1V7NH 3UTTA 3RVTC 1BZ9A 5T3ZL 1JRHI 2B39A 4P3DA 3V4VH 5I1DB 3BUYB 2A6IB 3WHE0 5K93A 2AXHA 4NBYB 2EIZA 4J12A 3Q6FB 3QIBD 4F2MB 2Z92A 4UT7L 1F97A 4JFQA 4J1UB 3AREC 5F7KC 1G6VK 4P2QE 32C2B 3WHXB 4M7LT 1KOAA 2LFGA 4CNIB 3RZWA 4JN2A 2IPKA 1S8DA 5F7LB 1IGTB 4J6RL 3EJZC 2A74B 1ZHKA 4FFZH 1BQHA 1KCVH 1RHHB 2DMKA 4M62L 1J7VR 4OT1L 3BO8A 3N1FC 1NGPH 5H2BB 4LCWD 1NL0L 1XGQA 1BLNB 2PNDA 4ZNCD 2HJKB 4ZO8A 4ZS6D 5DK0A 2ADJB 5IMMB 3TPUB 3DGGA 5JXAH 5HHQB 3U7WH 2GK0B 2K3TA 1RJCA 4GXVH 4GFTB 1OWRM 1LE9A 1MREH 3TT3L 5HSFA 3QDGB 4LP4A 2BCKB 1FC2D 2JIXD 5IQ7H 1ZHNB 3TN0D 3GB7A 3MUHL 5JORA 4OLYH 5GGRY 1A7RH 1BQHG 2NY3D 1XGPA 4YHZH 4ZUWA 3PWUA 5D7JC 5D7SL 4KDWA 1DANU 3GSQB 3OJ2C 2R0ZL 2Y7QB 5K9OB 2E9WA 4S1DD 4O00A 4NJAH 4CDGC 3FFDA 2H2SD 4EUPB 1OAYH 4Y1AA 3QXVA 3B8YA 4PTUB 3AS2A 1KGCE 3ARGC 2IGFH 4O2FA 3MNZA 5FUOH 5LAXA 4I3SL 2ZCKL 3TZVD 2DKSA 2GJ6D 4TUJA 3VXPB 3BGFC 4L29B 3VI3F 3OHXA 1S9KC 3I84A 5JW5A 1RZ7H 2YPLA 1TDQA 1NUFA 2ORBH 3EOAB 7FABH 3AVEA 1OM3L 2P46B 1D9KB 4OD3H 1OTTC 1HIML 1YNTB 3BQUB 4WCYH 1KV3A 1UM6L 2ESVD 4OKVA 4HAFA 4G9DB 1G0XA 3CFJB 4G43B 4OZIF 4FA8A 5DMJB 3UDWC 1NCBL 3DUUA 1ZA3A 4LASL 1WTLA 3O3BA 4M6NL 2VXUH 1JVKA 2ZOKB 4UB0H 1QNZH 5GGSA 4PJCE 1X5LA 2LU3A 2WNGA 2E6JA 3ZDZE 3QUXA 2HG5B 3ECBB 3AMLA 3CNKA 2AEQL 2Q76B 1M05A 4JREC 5DRXB 3L3DA 4JZNA 4OCRL 5KN5A 4U6YA 4XVSH 1Y18A 2ED8A 3QO0A 4KVNL 3R1GH 4UUJB 2GSIA 4L4VD 3P0GB 3L3JA 4NOFA 1RAMA 5ANMA 2DLEA 2JJTA 3I50L 1NFIB 1T0PB 3H7LA 4BELD 1FZMA 4P23B 3WFCH 1RVFH 3LZFL 3QIWC 4PRPA 3EOTL 4ONFH 5FGCE 4JFYA 3U79A 2UZIL 3CGTA 4G6FD 4KJPC 4XPHL 4HBCL 4XC1H 4XP6H 4Z0XA 1NGYB 1L7IL 3RIFF 4GKNA 4UT7H 4UAOC 1HHKB 5KOMC 5JXEA 3MRDA 2EKSB 3WFCL 2IH3A 3D2UD 2ITDA 4WO4B 5CINL 5DHXB 2BVPB 3PABB 2NYYC 3EDJA 4DZ8B 1OAQH 3IFPB 4PJ8C 3GI8H 4HWNA 4JLRA 2HJFA 4TULL 3QFDB 3HE7B 3LEVL 1WWBX 3QFJE 4LDOB 1HHIB 3PJSA 4XVTH 1N6UA 2FJGA 2W0PA 3LEVH 4CMMA 1U8LB 5EOCH 1MCNA 2FBJH 4DN4L 3QUML 1U2CA 1YMMB 2E9IA 5I8OL 3TVMC 1FPTH 3MRPA 1KT2A 3R0MA 2AVGA 3B5TA 1ZLVH 3FN0H 3C60B 3W2DH 4HUWB 1FVEB 3QUMH 4PLKC 3DX7A 3C5SA 1NCBH 3EYSH 2V9QA 4NFDA 5FM5M 1HSBA 3RVWC 1PBYA 1K8IA 2DDQL 1YMHA 3AS1A 4R7DB 5DR5L 4PJBA 1XEDA 4NT6B 2BSED 3HG1E 5I74C 4JN1H 1J1PH 3CFCL 2WBJA 4P59H 3REVB 5FOBA 5CJXC 3HE6A 4MZ2A 1KJ3L 4B7LA 1VEPA 3VRJB 4FQ2H 1KN2H 4MHHG 1S8DB 3QDGE 4A2MA 2WQRA 1BHGA 3BMWA 1OGAD 4JFPB 5L0QB 4P2RB 4NKDB 4XWOC 2YC1A 1FVCA 2BVOB 3T8XA 3NZHL 1ZSDB 4MXVE 3ARFD 5DJ0A 3G6DL 1EEZB 4EZMA 1KNOA 1NEZA 4U6XA 2C3WA 1AD9B 1EZVX 3INUH 3LKOB 2Z0BA 3IRZA 1QRNE 3U9PL 1R3IH 2F8VA 2JJTC 5HHPA 3MRRA 1BOYA 2WK2A 4NUGH 4LAJH 1PQZB 3O4LD 3WE6A 1Q9KA 1KLUA 5KVFH 2BY1A 4UV7H 2Q8BL 1KN4L 2J1KA 5I2IB 1AXSA 4DOHE 1U92A 5MENE 3T0VA 4ZODA 1GAFH 4IIQC 5J0BA 3HC4H 4O2CA 4P4RA 3ESUF 5ELIA 4I0PA 3MRFB 3BKCL 4X9BA 1PKQE 4PJ9C 4RRPG 4D0CA 1U8JA 2IFFL 4XMPH 5J11B 4ZAKD 5GS0H 3ZMRA 1N8ZB 3G5YA 1FZOA 4WV1A 1IAIH 4WDIA 1LP9E 4ZS7H 4YK4C 1MI5E 4PY8J 4ZUSB 2PUQT 5TDOB 1Z9SA 3FMGL 3QDJE 1VERA 4OZHB 3QDME 3SJVD 3C2AH 1LVEA 3LH2L 5DD3H 4F7PA 4HWZB 2NXYD 1CE1H 4K94H 2HVJA 5BJTA 4GAJH 1DLFL 1CN4A 4XAKE 5DVMA 5I17A 5DD3L 5D7SH 2PO6C 3O8XB 5CIPA 2MJWA 2VABA 5EBMA 4O58H 3BQUA 4TSCL 4ZO7A 3CC5B 1J11A 3EBAA 4K94C 4N8CH 1AR1D 1I3RA 5K9KB 5C3LD 5I1CL 4XCEA 4LSTL 3MLXL 3T0BA 1EUTA 2MQCA 1T03L 4Q0XH 5EU3B 1JNLL 1WFTA 3HZMA 1JNHA 1RUAH 2YWZA 5DUML 4NWUL 3V7MA 4PRAA 4Y8DC 4EVNA 5H94A 1C1EH 3RUGE 1T2QL 2GQHA 1JPFA 3O2WH 1TCRB 1CD1B 2VL5A 5DI8B 5IROC 4NQDB 5DJ6A 2EDDA 1HHJA 1YY8B 1A7RL 4NO0D 1KB5H 3A6OA 2J6EH 2R2CA 3FB8B 3WYRA 4G42B 4QRSB 5IQ7L 3GHBL 3I85A 4PBXA 3NBNA 4TUJB 5DT1L 5JHDD 1LD9B 4JRXA 2FR4A 4KTEH 2QKIA 5I15H 2AJZB 3DPBA 4WU5A 4Y5XA 1JK8A 3QG6B 3KPQA 2CO6B 4RNRB 4UNVA 1BQSA 1S7SA 3WLWD 1JWSB 3WFEL 5BRZB 4N0CC 3B9KB 5IB4A 1TPXB 1WAAA 3QSKB 1K3ZA 4HK3N 4CMHC 3QXTA 3EOYG 5FUOL 2A38A 1GGUA 4JFFA 3T08A 2X1PA 3QIUD 1NPUA 2DIJA 3SDXB 4YDLB 1JUFB 1LEGB 3F6LA 1G0YR 5BW7A 5C0FB 4M93C 5F3BA 4KY1L 4NRXA 4XB8A 1MJJA 4M5YH 3N0PB 3VFRB 1CVSC 4S1RL 5CILL 4QRUB 5JHLL 3F6IA 4JCMA 1L0QA 4Y16D 2DL2A 1B0GB 4KQ4L 1P84K 2X4PB 2DRUA 4GKSA 4HC1H 4Y16A 2R4RH 2X4SA 3DVNA 2DDQH 2FIKB 1TTUA 3RVXC 3H3PH 5CLTA 2L7UA 3NPZB 3PDGA 3DWTA 1MCWM 4OUOA 3ALWA 4OZHE 4TVPD 1A6ZB 5D6CA 3W9DA 4GW5A 4K7FB 5L6YL 4PRHB 3OV6A 4L8CA 1AGFA 2QQNL 3DXAA 3GZKA 3RTQB 5MI0B 4Y89A 3RVVD 3GFUA 1TIUA 2UYLB 3UTSE 4U1MA 3IDJB 4OLUH 4S1QH 4XP1H 5CILH 4MB3A 1J9CT 1NFDA 1HHKA 3GMMB 4M62H 4CL7A 4YWGL 1CGSH 1FRGH 3O4OC 2YUXA 3JTSA 4U33A 5ICZB 1CIDA 5JMOC 3G08A 3RL1A 1XCTB 1TTGA 4GS7C 3RFZC 2O5ZH 3QPXH 3VXUB 3UAJC 1ED3A 4C56A 4W70A 3MODH 3CUPA 1LILA 1HILB 3SE4A 3WFHA 4LVOC 3REWB 3TA3A 1NEZB 2W9DL 2ESVB 3CLEH 4U1KB 1NGQL 1GC1H 2HA1A 4OB5H 3ARSA 3SJVE 4F58H 4BH7A 4ZTOL 5KS9B 3IAPA 3LKRA 1AO7D 2A1WL 35C8H 2VLKE 5JNYA 3VXSB 1Q9KB 3C5SB 4O51A 3QDJA 1FGNL 1U8KB 2YPVL 4QXUH 1FH5H 3OKKB 4JFEE 4X4ZA 1JNLH 1T66D 2HP4A 3VWKB 4YHPA 1JPFB 2O93L 4DVBA 3KLHD 3ZE0E 1ZEAH 2DBLH 1TENA 3ZYZA 4XHJC 5B3JF 3H9YA 4P5KA 2JTDA 4KKLD 1D5BA 3WFEH 5DFTA 2CKBB 3HC0B 3MV7A 5MEPA 1OARL 2AV7A 5MENA 3UDWA 2WQ8A 1OM3H 4KDVA 1XF5B 3MLZH 4OLEA 4I5BB 3OL2A 4F15B 1QFHA 2PO6B 3KJ6H 1CVRA 1OVZA 4ODVH 4AK1A 3VWJC 4HGWB 4WUUA 4E41A 2ZPKL 3O4LA 3FRPA 3G5VB 4M00A 1IM9A 1UADC 2EDWA 3KPRB 4W4OA 2V5MA 4WI6A 5JW4R 1ROWA 3FT2A 4GG6E 5EIIB 4G8EB 3MRBB 3RKDC 1YEHL 5D7LB 1U3HC 1G9NL 2YA0A 3RY5A 4WFFD 4TUKL 4L1HA 2IJ0C 3SKOA 5JPNA 4BZ2L 4P48A 2UZXB 2YPKB 4PJCF 2HT4D 3CVIH 5ADPL 3IYLW 3C5JA 2GY5A 5EU3A 3MJ9A 1DBJL 3LB6D 2IPTH 1U3YA 5HHVL 2FX7H 3LKNB 3SDCB 3QXDB 2R69H 4F7CA 4X9GA 3WJLA 1BEYH 1KGCD 1CG9B 5E1AB 4OLYL 4WW2A 4D8PB 3IJSB 3BH9A 4KC3B 4RMUA 4ODTL 1P4IL 1QR4A 3PHQA 3HR5B 1CQYA 1HHGB 1T2XA 3TVMD 4YHNB 2H1PH 3DUHA 2KDGA 3FT4A 2P7TB 5D72H 3S4SA 4FQCH 1EK3A 4NQEE 5FM5O 3C2AL 1YNLH 5HHXH 4UINL 3W39B 5IV2B 1TXKA 4ODHL 5BJTB 3WFDL 5FUZL 4OCXL 1HH9A 2FHCA 3D39B 2BERA 1Q0YH 3PWNB 1QSEA 3MODL 1R3KB 1RZGA 4UZGA 1LP9B 2HN7B 4OGXL 4OJFH 2R0LH 1U58A 5F3HA 3PGCB 1MI5B 3NVQA 4IOFC 5K9KA 4J6RH 4OZHA 2BMKB 4OSUH 4N1HB 1MAJA 1N6QL 3AS0A 1NSNH 1X4XA 3QZWA 4MVBD 4U7SA 4Y19D 3TNNB 1UXWB 1XF4B 3NN8B 4HJ0D 3ARFB 2DQFA 3T3PE 3KPOA 2NXYB 4XCFL 2X4UB 1AGEB 1C7SA 5J06A 3RWIA 2V2XA 4QRTB 3JSSA 1I7UB 5DJAA 1S78D 1FPTL 1I75A 4KRNA 5INCA 1NGQH 4R90L 1E6JL 5ALBH 3BGFB 4C55A 2ZOLA 4JKPL 1JYXA 4YR6B 2F58L 5HI3D 4P3CL 2NY3B 4YHMH 5E8NB 1XGRA 1F58H 5HYJE 4ZPVB 5I73C 4Q2ZA 3EDKA 2AKRA 1RZ8A 5DGRA 4EBQL 2HT2D 3TCLA 4ZYKA 4MZ3A 5FKPB 3UO1L 5I8EA 3U6RB 3MFGB 3F5WA 3MRKA 4FQJH 4HUVA 1ZK9A 3GSNL 1P69B 5C0AA 2XKNB 3VXMA 1QBLH 4KK6D 4BK5A 5IMLA 1KJ3H 1N0LA 3V95A 5DQ9B 1DLHA 1B4JL 3SDAA 3T4AA 1OD7A 4YC2B 2R0KL 3VFWB 5E6ZA 4IIQA 1INDL 4NKMB 4YIQB 3TN0C 3X11A 1UKSA 3U1SL 3BHBB 1INEL 4M1GL 4NQCA 3JWDH 2FSEB 2ZG1A 1QSED 4IM8A 3MCLH 5GGVL 5EULV 3P4NB 5CBAA 1DANT 1QFUL 5C0NC 1I8IB 4KZEH 1BJ1J 3DHMA 4M3JA 1NDMA 3ULVF 4HUXA 3VXNA 2ESVA 5CGYD 1ZA6A 5FYLH 4MA7L 3GM8A 1FFNB 1A0QH 1XGYL 2I07A 1O0VA 3GUTA 1JWMA 4QHUB 1GGBL 4RMTA 5IM7A 2JB6A 1MCOH 1RZIB 2CKNA 1LO4H 2B5IB 1IEBB 3LN5A 2UYLA 3H2WA 3HE6C 4KKCD 5KVDL 4LU5L 2ADJA 3I6KA 3GNML 3MUGB 5C6TL 1DE4B 2HVKB 3PP3K 1AQKL 5TDNB 3H7BA 4JFDE 3D18A 1AR2A 3MV8B 3PWJA 1GOHA 2CR6A 3TA3D 4BZ2H 1CFNA 1FL5B 3SE3C 2IQAA 3LPWA 4FXKB 4K2UL 5LG1A 1WAAF 4C56E 5IGXH 5E2JA 3RWHA 3O3UN 4FQIH 2GFBB 3OBAA 1P9MA 5FUCE 2BX5A 4J3VA 4M8QA 2M1KA 4DKFL 1F2XK 3W39A 3QO1B 1J10A 1LO5B 5FYLE 4TSBL 1KLGB 3VD3A 3BKJH 4MB5A 4LQ1A 3QEQE 1ZANH 4MX7B 4U1HA 5FGCB 3ELAT 4JDTL 3WD5L 3TF7C 4PLJD 4JFXA 5E2UH 5EO0A 1MFNA 1MHCB 4JHAL 2DIBA 4JO1H 2PXYB 4QXGL 3UXFA 2G60H 4Z7UF 5FDYA 1J05A 5GRUH 5KSUB 1LEIA 2ZOKA 3O2VL 4WUKH 4LSRL 4PJDA 1KELL 3IS1X 4OFPA 3HFMH 4HX1B 2H8PB 1M05B 4U6HB 5CKAA 3P77B 1TJGH 4AENB 4PJHA 5FCUL 5GRZA 4LKXB 2P8PB 4JO4H 2OTUB 4OD2B 3BDBA 5FA4B 1IEAA 4GKOA 4P4KD 1JGLL 1GIGH 2D9CA 2D7NA 1G9MH 4MAUL 3H8NA 3OR7B 4GG6A 2VZOA 5ILTH 1LNUA 3VU2A 2DWEA 2B2XL 5D6DA 3B83A 1QO3B 5J57B 4C4KO 3KYMB 5ETUA 4GH7B 4FTVE 1GOGA 1NCNA 4V1DA 5C0ND 2OXGA 5HYSA 4I5BA 3DX8B 1XF1A 5H37H 1ZVYA 5AZ2L 4X7DC 2BOBB 2XFXA 5F7EH 4HH9B 4GQPH 4S1SH 1EXUA 4TNWF 5CEXA 1T1XB 2AK4E 4EDWH 1Q9WA 2XV6B 1Q0XH 5JW5B 1BX2B 5IFJA 1B2WL 3QUZB 4P5KB 1OAYL 3W11C 1JF6A 2FX8L 2IFFH 4X99B 4ZXBB 5TF1H 4PJAA 5AZ2H 1RHHA 5C0DA 5J12C 4BM7A 5IT2H 2VE6B 1T3FA 2NY5L 1WF5A 3KNBA 3QIUC 4GXUN 4K9EL 2EDHA 5IQ9A 1N3NB 4A6YL 3DRQB 3ARDA 4BH8A 5CZXD 5D8JL 5EUKA 3M1BA 4PJEF 4HD9A 2CLZB 5ICXB 2B2XH 3PDOA 4MHHI 4R2GD 1ZHLA 2F19H 2J8HA 1JGUL 5TFSL 2E27L 2OJZH 5IMMA 4E41B 4QRPA 3WCYA 4OGAD 5I1KH 1A3LL 4RAVB 2QSVA 3U9PH 4GXVL 1MAKA 2VUOA 4DEPB 5DO2C 4GBXB 2QHRL 3VGHA 4PGBB 1Y18B 3N9GL 2G75B 5DHYA 3V4PH 3GB7B 1NBZA 1E4XH 3ARBB 2P45B 4G7VL 4D3CL 3P9MA 5EZIH 2G9HB 5B38A 4X7TB 4EQ3A 2FCBA 5D7IE 3VWJD 1GPOH 4XZUB 5EOQH 3B4NA 4NP4L 4LCYA 5JOPD 1NC2A 1RMFL 3JVGC 2C9AA 2EC9T 5AG8A 5EO1A 4OZFH 3UTQB 4KKAD 2UUDH 3O9WC 1OP9A 1BQUA 1BFSA 2D2OA 4BSVB 2ZSWA 5C09E 1TVHB 4XCNA 1XGUA 3MRDB 1AR1C 1QSVA 4HK0A 2NW2A 1NBYA 2X4NB 1XF4A 5HDOA 3DO7B 4YZFF 3OSKA 2JJVA 1JHLL 1JPTH 5DUPL 3S37X 1AXTL 5SWZE 2PYEA 5HDQH 3LPFA 4LBEB 4KK9D 3T0AA 4IRSA 4XP9L 5DD5L 2PN5A 3BZDA 4WI5A 2DQJH 2XWTB 3P30H 1W8OA 4I3GA 4CVUA 1LE5B 5DQDH 5C0GB 3P4LA 5DJ8A 3BAEH 2AJYH 3VMNA 5IB3A 3MV01 5D7LD 4ZPVA 4OIAA 3K4ZA 4HKJB 4X7FC 3O6KL 4HC1A 2ICCA 5GSVA 1A6AA 1A4KA 2FD6H 2BVOA 1YYLL 3TBTA 3UTSD 3HI1A 4HLJA 4ZPTB 1BVLA 1AGCB 4PGDA 2CDGA 2OL3L 1A9EB 3D85D 2XKNA 4IRSC 1IEAB 4RWHA 5DQDL 3VXMB 4U1IB 2H26B 1HNGA 2QHLA 4L3CA 2RAMA 3BMVA 4XXDA 4KPHL 4KMLB 4NQDE 1MLBB 3ZDZF 3HNSL 1AXTH 4KGJA 3KXFA 5IHBA 5DXWA 4LLQA 3LIZH 2WWMD 4R9HA 4JO2H 2MKWA 4DWHA 4R7DA 1RZ8B 1FE8L 3IDGA 4LF3B 4CADA 4V1DD 3H9HA 3JUZA 3MRNA 4OZIE 3OAYH 2NX5D 4OD3L 5CBAB 4NQUA 4NPYB 3VFVB 2BNUA 1ONQA 2VR5A 4Y4FC 3U0TA 1I8KA 4YDKH 5EO9B 3DV6B 4X8JB 1SJHB 5BO1L 5I8CA 1QLRA 2EKSA 4WJ5B 3V5DB 5J13C 4DKEH 1AY1H 5KZCB 4OCSH 2VDPL 1YA5A 4NQEA 2NY7H 1K5NA 4LLWB 4GG6F 4PJIF 5F7FA 3DGCR 1QLEH 2WLZA 4UB0L 3QFDA 4LSSH 5C0EB 5EU4A 3KGRA 1AGBB 5DK2A 4WFHE 1BZ7A 1BM3H 4XWGH 1IILE 3D9AH 4U6HA 1CD1A 5DI8A 4J3TA 3C9NB 3HC4L 4XNUL 1UZ6F 3MFFA 1YY8A 2XN9A 1I85C 5FF6B 3VFPB 1NCAL 3VFOB 5CP3A 1EJOH 5B8CC 2VC2L 2QADB 4JKLA 3X3FH 3BW9B 4GG6B 1DN0A 5LBSL 1NAKH 1DDHA 5IT2L 4O02H 5J1SC 5DZNA 4Q0XL 3E8UH 1JGVL 5JXAL 2A9NL 2N1KA 5T33H 3MXWH 2AV1A 3EDEA 3HUJE 4GRMA 5TDOA 4ZUSA 2ATKA 4XT1C 2YOCA 4X4XA 3BP4B 3PQYB 4JQIL 5CCKH 1FO0B 4HBQA 1S9YA 2FATH 5I17B 5E2UL 4NUJB 3HCVB 4PFEA 1J0KA 2EDJA 3CLFL 4KAQH 4L5FH 2Q3ZA 1R0AL 1RFDL 1OTSD 3LD8B 4PG2C 3MCKB 4QRUA 1MHHA 2BVQB 4N5ED 5FO9A 4UINH 3CFIC 4K3JH 3QRFM 1ZWIA 1CGWA 4WFGE 1OAZL 2K7PA 3WNLA 5JW3H 4LBEA 5AYUH 4FQHA 1N3NA 1I9RH 3UTOA 1MWAA 4YHIA 2NY6C 3LDBC 5B3NA 3L95B 3NFPA 4XWOD 4LCIL 3R8BB 5IUSA 1J8HB 3MA7B 5I1LB 3VWKC 5E8DH 3PGFL 3FN0L 1DEEA 4FQXB 4GAYA 4HUMB 5B4MD 3RUGF 5CJXA 3WNOA 4G5ZL 4XCYB 5T3ZE 3NIDE 2GKIA 2YD9A 4K8RH 3EYFB 5FA3A 3RNQB 2AJSH 3HLAB 2OSLA 4JAMA 4YEFA 3K74B 3U7YH 4LEOB 4UOW1 1U95B 1R5VA 5E5UB 3BPNB 1OW0A 4RFEA 2X4RB 2W59A 4XVTL 5FO7B 3V6OC 4XVUC 2V2WB 5C6PB 4YXKH 4MA7H 1H0DB 4YHOL 3QHZL 4TQEH 5GS2D 3QUMA 2GUOB 1DUYB 1WC7B 5EPMB 5JW3L 3ZTJH 5KVFL 1UWGL 3BPLB 3ARQA 4XC3L 4ALAL 3CAFA 4U0RC 4ZUTA 3ZZ1A 1PYWB 1I3VA 1VACB 2H6PA 3EDDA 3ULVH 1YEEH 4OZGE 4XNYH 2M2DA 3VFRA 2V5SA 4NO3A 3H6JA 4KI5C 5JQHC 2XA8H 5A2FA 3KS0H 4U1KA 2P4AB 4JM4H 1SJHA 3K8LA 1CLYL 4MSWB 1LP9F 1G7LA 4X4MA 1ORSB 1OOAA 4HPYH 1P4BL 2DD8H 4KROC 4F9PC 5E08L 4FQ2L 2XTLA 3QJHA 4WIQA 4YWGH 1VGKB 3VXSA 2XWTA 4UV4H 5EZJA 2VDKH 4B5EA 1CGVA 2E7LC 4M6OH 2IPUK 3S5LG 3DMMB 5BS0A 5GPRA 1UH2A 5KSAB 1UC6A 4ELKB 2JKXA 1UM5L 5D6CB 3UTTE 1UQSB 2F53A 4OUUB 4OLXH 1Q9OA 4Y4FA 3RGVD 4YUEL 3ZHDA 1QNZL 4TNVK 2ARJB 5LWYH 4PGBA 2R8SL 3P73A 3MOAH 1SQ2N 4WHDA 4P2OC 2JCCB 3HMXL 5E6YA 4HWEH 5DHVA 4XP6L 2EDRA 1YMME 2Z91A 1AJ7H 4HCRA 4OGYH 2EIBA 3MSPA 5D2NB 1U8NB 4DVBB 3SGJA 3QDJD 4G8GA 1MPAL 3A0OA 1JWSA 4ZS6C 5F6HJ 3SE8L 3QUXD 3VD5A 3KPMB 4L9LB 3MNZB 4J3OC 5LAXB 4JE4B 5DEFB 2X4OA 1PX3A 4Z8FH 3SCMD 3VXTA 4ZXBD 1MFEH 5IBTH 4Y19B 2IANB 4OCXH 4NRXB 4JO2L 1MCKA 5GGQH 5GZND 3QG7H 3KJ4C 1DL7L 5DJYA 4PGEA 4JM2C 2R1XB 4ZSOE 1OGAB 4GLRI 4PJXF 5FGRA 4IMKA 3MA7A 3MA9L 5IESL 2JF1A 5ICYB 3HAEB 1KPRB 2OL3H 3O3BB 5DF0A 2YEZB 1CTOA 4QOKD 1I3GL 3SGEI 4YHPB 1N59B 4YDJB 4LASH 4HS8L 3O3EB 5CSZA 2XQYK 3ES6B 1HHGA 3VJ6A 3OKKA 3MNWA 1KC5L 2HFGL 3ARGD 4K7FA 5D7LA 1ES0A 1U95A 4OBRA 1OAKL 1FNGB 4JRWA 4QRRA 5CJQH 2LAAA 5MERA 3HPJB 2KQNA 5JHLH 5A3IC 5D96B 4ODSL 2DLFH 5IR1A 5HGHA 1JIBA 1QLEL 4GMTH 2JJWA 1A3RH 4EI6B 2DJSA 1HHHB 1BQLH 1ITCA 1BQHB 5F7MC 2KPNA 5L2JA 3O6LL 4DKEL 5F7HA 5E2WL 5D5MB 2XRAL 3HPLB 4QHNB 4NN5C 4UNTA 5TE4L 1QYGL 4LQFL 5ITBL 1FSKB 3M17A 3PP4H 3MCKA 4GAGH 5HDBF 4J4PC 4WGVB 3WJJC 1U3ZA 1G7MB 1RIHL 3S34H 5DVOA 3LKQA 4TN9A 1P4IH 4MJIA 3VMPA 1EDQA 2V9TA 1AC0A 5T1KB 4NP4H 1BOGB 1QFWL 3C9NA 1JWUB 1FYTA 1H8SA 4JFDA 3UYRH 4X8JA 4XXCA 5ID0A 5E8PA 4YAQA 1SJEB 5TQ2L 4K7PH 4D0BA 5A2KH 1T20A 4JPVL 3WXWL 3VMOA 5KZCD 4EIGB 3OKNA 4K23H 3U2SB 3BPNC 4H1LA 4PS4L 5C09A 3IKKA 2OI9B 3NAAL 1CICD 2BRRH 2EECA 3QEHA 5ESQB 3LHPL 4Y1AB 3B6SB 5DJZA 3RPKA 1IZJA 2BCKA 3O41B 3MRCB 1PZ5B 4N9GB 3VI4E 4ACPA 4YO0A 1I1AC 1SVZA 1BZQK 4R26H 1AP2B 1CICA 1F4XH 4L5FL 2O5XH 4FG6D 4EOWH 2AJ3A 1V3MA 3FO2B 5DD1L 3NA9H 2C3HA 1FFQA 3B8SA 3S5LB 2X89A 2FHBA 3CMOL 5CZVH 3DI2B 5JR1L 2VAJA 1KG0A 1FFPA 1NL0H 2AXFA 3MNVA 1UJ3B 3NZ8A 1CFQB 4KJYA 1ND0B 3X13B 2W0KA 3TPUA 4L8BA 4PP1C 4CU6A 5HPMB 1YEDA 1E6OL 1FYTD 3FO9A 3KPRA 3VGAC 4Y4HD 4FQJL 1ZSDA 2Z35B 4J3UA 4J8RA 3TZVC 1DBKL 1CL7H 2ZOLB 3BGMA 4G6JH 5D2NC 4MCYA 4LEOA 3WIIH 1R5VB 1PGRB 3JBG7 1JFQL 4EBQH 1I7UA 3WEXA 1A6VL 4LCCC 2VH5H 3GSOA 2VDOH 1F13A 3NGBC 1AFVH 3B2VH 1TJGL 2FX9L 5GGTL 4EQ2A 2W92A 1QFUH 4X4ME 4M8VA 5KSVB 4PJ7B 5ID1B 3E1F1 1HSAB 3N1GC 5D1XD 3MCLL 4S2SB 3OXRB 3VXSE 2HLFD 3RWGB 12E8H 1J8KA 4K3EH 4G6AC 4POYA 1NCWH 5IB5B 1BVZA 3GSWA 3F5WB 2EDOA 4FTVB 1JPSL 1U93A 3OJVC 1MRDL 1KTDA 5CP3H 3FTGA 3MGOB 1XF3B 3O0RH 4XNMA 1U0QA 4NT6A 4UUJA 4YBLC 3ZO0A 1QP1A 4K9EH 2OJEA 4LIQE 5I1IH 3BPCA 4YIQA 3C87A 1RU9H 2XA3A 2OQJA 2C3VB 3BKJL 1GGIL 1UCTA 2DQEH 1I8IA 3H3BC 5DVLA 4ODXB 3PWLB 1CICC 4BUGA 4OI8A 4EDWL 2VL4A 3O6MH 2RCSL 2IANA 1D5ZB 1B0WA 5AWNH 3ULVL 3ARFA 4MX7A 5AZEH 1A7BA 2VABB 4CGTA 1BD2B 3BGAA 1ULVA 1IM3A 4TYUA 4H25A 1WBYA 4NNPH 5D1ZC 4OIBA 3GNMH 3KLAA 3U4BH 4QOKE 3FZUC 3VCLB 4Q6IB 3TH3T 3VFTB 2XTJB 2PXYA 5I9QB 3C09C 4FQXD 5FYJE 4MMZC 4PJCB 4WO4D 4HUWA 4RFOL 1C5DA 1DSFH 2XZAL 4G8GD 5TPWH 3X17A 4HC1L 4G8GE 5FM4A 5IBUG 4WRLA 4C54A 2D4DA 3QWOB 3PWPB 3U46B 4MDIB 4BJLA 3MUGA 3HE7D 3MYJA 3DX8A 1YPZE 3C8HA 1XAUA 2XZQH 4YLQT 2VXVL 4FQQA 4JZOB 4M5ZH 3KHQA 5D7IB 3BWAA 2GY7B 4MCZB 1CF8H 1T4KA 5AEAA 3ARPA 1XF2A 5C0AD 1KELH 4FFYL 5E2VH 1KSRA 2MMXA 2F5BH 3FB7A 3UYPA 1V8HA 3U36B 1JYVA 4EI5A 4LCWE 4X6CF 4L8SB 4ZAKA 3EGSA 2MCG1 2BNRB 4ZSOA 4NKDA 3C60D 3ZKND 5T3XL 3MGTA 3U1SH 5D72L 3ZKMC 1NMCB 4CUCA 3F7VB 3MMEB 5BRZA 2R2EB 1SYVB 1WIPA 2WBKA 4ISVA 1FLRH 1T89C 2DQCH 4M9PA 4HIJB 1MIEL 2D9QB 4PJHE 4I18C 1S7TA 3SKNA 3F12A 1RUMH 1B0RA 2HVJB 1UVQB 3TP4A 2NTSP 1GH7A 5CD5C 2NY1C 3UJJL 5F9WC 1ZS8A 5HGDA 4MXWH 3MGAA 4MMXC 2YMXH 3KYNB 4OCYH 4JVWA 3VJ6B 2NY0C 2CK0L 4PJ5A 5IHUL 4BZ1L 4MVBC 1MJUH 3ISWA 4WNQA 1RURL 1MFAL 4WTZA 3MRPB 1AO7E 1EAPA 3C5ZB 1T7ZA 1LNUB 5FO8A 2OLDA 4WTXA 1D9KC 1HYRC 3QPQD 3S7GA 4PJ7F 1BFVH 1EBAA 1QG3A 4YNYB 2R4SH 1DQDH 1UH3A 4OTXH 4OCWH 4PJBB 3FO1B 2FX7L 5JIIA 2YRPA 4N0UE 1A0QL 1XGYH 3QUYD 4UBDC 4DJMA 4ONOA 3TIEB 4LLVB 4NC2B 3K2UH 4BKLB 2X1WL 1FCGA 4TUKH 2X1XR 3MGOA 3WMSA 4N8VA 3NZHH 2I9LA 4LSVL 3BD3A 5DHVH 3MV9D 4XI5C 1E27A 4IRZH 1CT8B 1G7JB 3F65A 1L6ZA 4WWKC 4G9FE 2VLLB 3S5LA 2DQHH 3V7AE 4AG4H 1YECH 1I3UA 5I76A 4OF7A 4JFXB 3ABZA 3LEYL 4G8FA 1G7PA 3AXLA 5E4EB 3T4YB 5EBWA 1U8PB 3HE7C 3GGWA 5HPMA 1B90A 3GEWB 4OLUL 4S1QL 2XIDA 5C0FA 4HKJA 1FZKA 3FO9B 2IMMA 4HK0B 3EYVA 1GHFL 3GJFB 1A4KB 2IG2L 2YRLA 3FB6B 3DO7A 4KROD 1M6OB 3MJ7B 2NYYD 4XPAH 3LQZB 4HIXL 5EU6B 3RIFK 5B8CB 3EYSL 6FABL 1MWAH 1S5IH 4OZ4A 3T0DA 4M7LH 2W1NA 5JZ7D 4U1IA 4NNPL 3F7QA 3SDDA 1UJTA 3DIFA 4LRNL 2VQTA 3ARDC 2VZUA 5D1ZA 3E6HB 5DZOA 4LCYB 1QSEE 4ZQKA 3WLBB 2A6IA 2QADD 3BXNB 3HG1D 3MJ9H 5SWSA 5KOVC 2W65B 2CXGA 5BZWA 2VYRE 3MLSH 4KKCC 2AJXL 3L7EB 1FN4B 2ZSWB 2BHUA 2IALB 5LCVL 2PYEE 2Z9TA 3QEHB 5ESQA 3RI5F 4DGYH 4Q7DA 2NXZC 4MAYB 3BIKA 1MJ7H 1D5MA 4D2NA 3MZTA 4OQTA 1ZANL 1P1ZB 4NQED 4GG8B 1TETL 1Q9WB 4OZIB 1JUFA 1LMKA 2PR4L 3B9KC 4NSKA 4KI5E 3CC5A 2IPUG 1JV5B 4MXVF 2NZIA 3RU8H 3F12B 1ED3B 5E5MB 1SY6A 5F93C 2DLIA 2FH8A 3DGGB 5C0BA 4CNIA 4K8RC 5IVXB 4HKZB 3S88L 3D69A 4U1GC 3Q3GB 1L9NA 3B2VL 4MD0A 4WEMB 4XP5L 5AD0A 1A6ZA 4G8EA 3SDXA 4PJ5B 1ADQL 3T3PF 2XACC 1KENL 3IFLH 5F3BB 1CFTA 1UEYA 1BREA 3AY4A 1FH5L 1S7WB 1JYWA 1RZJH 1OTSC 1U6AH 1W0VB 2ICES 3BW9A 1QRKA 1QZ1A 2N56A 1A9BA 4GSDL 5KVEL 4QHMB 4Y16B 2E3VA 1N6VA 2EDQA 4LP5A 5EA0L 4U4BA 3LKSA 4LLQB 5INDB 4AT6B 3TZVA 3SGKC 5IMKB 2GK2A 2FR4B 4ZO6A 3SKMB 3Q6GH 3BH9B 4JFQB 1U8OA 4IJ3C 3UBXB 3PHQB 3ZE1E 4EN3A 2ZUYA 4H5SA 3O4LE 3L3KA 3ZTJG 3OXRA 1DVFB 3V0AC 2VXSL 4YFDB 3D85A 1T7VA 1SEBA 2DLGA 4JQVC 4QRPE 1IGML 3GMPB 4PG2A 3QEQD 1DUZA 4ODVL 1GC1C 3MGTB 2FO4B 3WFHB 5E70A 1VSCA 3WLWC 3AC0A 2NY5H 1H3UA 1E4JA 1L6XA 5EO9A 4TSAH 3T09A 2OM5A 2QEJA 2AK4B 5GGVY 1R3HB 2SEBB 3X3GH 4IEFB 1EAJA 1PX4A 5EWIH 2YBRA 1DQJB 3G08B 1CLZH 1EHXA 4JG0H 2B0SL 3JWNC 5BXFA 1I1AA 4WFFE 5DQJB 3PWPA 5B8CA 3DX9B 3UAJD 4A6YB 3GHBH 1GAFL 1TQCC 4HULB 4LPYA 4NM8L 4R2GC 3IJHB 4CVZA 4M7LL 3KPNB 2B4CL 3GSQA 1EBPA 4RQQA 4WI2A 1OTUD 1EVUA 1TVDA 2X89D 3VRLF 1G9ML 5JNYB 2QQLL 5ANMB 2HKFL 4H26A 1B9ZA 4LL9A 3WS3B 2BRQA 2A6KB 3KPSB 3CVHA 3IDXH 2KBGA 4EJ1C 3O6FD 1LHZA 2ICWA 3BP4A 5HHMD 3MLXH 4NKOA 3WJJA 2R0LL 4MDIA 5B38G 5DFVD 3FQRB 4Q9BA 5GIRA 2P5EA 3RVTD 1A4JA 2MCPL 4P5TB 4HQQH 3CDFA 1X5YA 1KCSH 1LK2A 3CX5J 4IOIB 4WUKL 4XB7A 4TTGA 3AMKA 3G5VA 2EXYC 3VFWA 1T6WA 1RUML 4CVXB 1F11A 4KMTH 4HG4K 3FQUB 1NC4A 2EDFA 4ETYA 2W60A 5IFAL 3WXVH 1IQWL 1UCBL 4GAGL 1RUPL 3K81A 5DR5H 4ZFZB 4NN5B 3TBSA 3FAWA 3W5NA 1YPZA 3IXAB 3OF6D 2H9GB 3NH7L 3U30B 3GJFA 2FJGB 5BOZG 3DNKA 3LRSA 3BDXA 3O4LB 1QBMH 1A22B 2DL9A 4X5WB 1V7NL 3CSPA 2E6PA 1Y0LB 4GRLD 2NY4B 1KT2B 3HLAA 1ZHNA 5HGAA 1A7OL 1OAUH 2JB6B 4R2GB 3VGBA 1I1YB 4I3RL 3EO1A 5DDHA 3IB4A 4NGHH 4CN4A 4YDIH 4JFEB 1KEGL 4JM2A 1HQ4B 5IF0A 4HXAL 2AKRB 5ISZD 4UTBH 4GBXD 3R8QA 1QVOA 5FIEA 2BNQE 3JWDC 1RI8A 2WSKA 3QAZB 3ME0A 4EKXA 3SE9H 5C0AB 1FVDB 1QBAA 3IT8D 3UTZB 1T66C 1ITBB 4Z76A 1MRCH 3O6ML 2ESVE 1DVFC 4YBQD 1VESA 4KZEL 1YJDC 3HS0B 5KS9E 1FYHB 1DUZB 2DM4A 3EYVB 4F15C 3BHBA 4FZEL 3ZT5A 5F7DB 2DMCA 1WSST 2APXA 4NHCH 3BSZH 1KUMA 1H5BA 2G5BB 1PY4A 3QH3A 1L7TL 1PAMA 3J8F7 4P0DA 5F21B 3IFNL 5T3ZH 1MQKL 4R0LB 4DGVL 3GJFH 4R4NC 2Q8AH 2BC4A 4BZYA 2APFA 1RZGB 5SWSD 1DTUA 4OZGF 1UM5H 5DJ2A 3CJJA 3LKNA 1HEZA 1W0WA 5JIKA 3QXDA 1A7NH 3O45B 5GRVL 5I1AA 1DSFL 4OGZA 4ZFFA 1T0NB 4Q2ZB 3DX9A 1H9VA 4NCC2 2PTTA 4AM0A 1ZTXL 3OKLB 5EB9A 1U36A 3BKYH 3SCMA 3BH8A 1SMAA 2JB5L 1OPGL 2LTQC 4L3EA 2E8YA 4D0CB 3P0YL 3RWFA 2X42A 2XT1B 5E9DB 1OTTD 1FG9C 4NO0B 2WV3A 1KFAL 5ALCH 4WI3A 3ULVE 2GCYA 4LCIH 5FDWA 4XP9H 2IEPA 1IBGH 3KVQA 4H88L 5C6WH 2FJFA 1HH9B 5HBBA 1DL7H 4OQ1A 5CSBA 2WINB 4HUKB 1JPTL 1GJIA 1T0MB 2X40A 4L9LA 3FAXA 3KPRE 8FABB 3TYGL 5FYLD 3STZA 2R2HB 4PRNB 5AAMA 1X9QA 2P8LA 1WIUA 5IFHL 4HZLA 1S7VA 4OZFA 4RA0C 4ENEC 1N2RB 4ODWA 4QXWA 3OPZH 2Y5EA 1KTKE 1NDMB 4GG8A 3VXTB 5EBMB 2X4UA 3CMOH 5DURB 1FYTB 5D93C 3ZDYE 1B2WH 2DMBA 1OAXL 4OLZH 1A02N 3RDTB 1P7HL 4PJAB 3QEGH 2FLBT 4OF0A 3V6OA 4MNQA 3L3OA 4P4KC 1G9NC 3B2UC 4PRBA 1KFAH 1J05B 1SBSH 1VEMA 4P9HH 1JV5A 1IAII 2MPAL 4H1LB 5D6DC 4E5XA 4U1JB 3OB8A 1ZHLB 4PJ8A 2VXUL 5A2JH 5J8OA 1ES0B 3UJIH 5KSAA 2I60H 4O2CB 3EYUH 1F90L 2H8PA 2NY6D 1CFNB 4P2QA 3MZGB 3OKOA 4PJXB 3VXRA 2YXFA 4HLZG 2H2PD 4HMCA 4G80A 3V6FB 4XWGL 4RCAA 1IE5A 1JMZA 4JFZH 4JZJA 1HQ4A 4NCC1 4I8DA 3MBED 1U3HB 4LSQL 5IM7B 3NTCL 5I71C 3QIWA 3K1KC 2V17L 3FJTA 4WWID 4R8WH 3X11B 3GSNB 2ZCHH 4QHNA 2AQ3A 3DROA 5DSCB 1RQ5A 4NN6C 4M43H 2A77L 3T77B 3G9AB 3JWOL 1KJ2A 4LARL 1P84J 3F58L 1NGXA 4MD4A 1XCQA 1U91B 5T1MB 5SWZB 1TNNA 1D3CA 2EXWC 3KYAA 2BVUA 1CXFA 1CS6A 3WIHA 3UPRA 3FRUA 3RAJL 5T5FL 3V6ZB 2ZCLL 5JTWA 4IOSD 1ZA6B 4JB9L 1FJ1A 1LEKB 3GSUA 3J7HA 5EUOE 3X3FL 3IVKB 3NACL 3PG2A 4UIMA 4FP8H 5LQBL 4W6YB 1F42A 2R15A 2CH8A 2CIIA 2J88L 5DJ0B 4MJ2A 1ERNA 2CLZA 5ICXA 2OP4L 25C8H 4WW2F 1T20B 2BJML 5DLML 1PJ9A 4L8BB 2G5RA 1IKNC 1NLDH 1A1MB 2HTLD 2NXYC 4UTAL 3G6AA 1GL4B 1PKQB 2CIKB 3B6SA 3BE1H 4LSTH 5DJZB 4BFGA 5D1QC 3P11H 2RR3A 1RULH 3NCCB 4B53A 1KC5H 3LQAH 2CPCA 1TJIH 9CGTA 3ZLQC 3QNZB 1QPPA 3NH7H 3EHBD 3MREB 4PB9H 5HYFA 1EXUB 4U6VH 5CEXB 1PZ5A 4N9GA 3MA9H 3SDCD 3SQBA 3I6GA 4XNMB 3FB8A 4M7ZB 3B2UD 4YO0B 4P3DB 4Y5YC 2D7TL 5TF0A 3UJIL 4DGVH 1IC5L 3BUYA 3DJ9A 3BP6B 4CAGA 4DVRH 4HS3A 4KK9C 3WXVL 3V0WL 1CWVA 1UG9A 3O8XC 4URTB 3HUJF 1QO3A 4L3ED 2ICWB 2K9UA 5I73B 4ELMA 2DTMH 1FE8H 4YGVB 4DOHB 4ORGB 4OF6A 3UJTH 2EDNA 3MR9A 4ESKA 5FK9A 3BZ4A 4LAQH 1QD0A 3M1BB 4HJJH 3M17B 4F33B 2D03H 1XR8B 3PNWB 4KPHH 3X13A 5L7XL 3DTXA 3NIFE 2IBGA 3TESA 4IRSD 2BK8A 5F1NB 4R7NB 1CLOL 4GMSL 4Q6YA 1F8TL 4MNHB 2IADA 2YUWA 3GJEB 4M6ML 4YQXL 5H8DA 4Q9QH 2FEEL 4QEGA 2AABL 2ZKHL 3MJ8B 4HS8H 3OR7A 4DUWA 2WWMC 2XTJE 5E00B 2O5YL 5DK2B 3V4VL 1ZLWK 5I66B 5CP7B 3ULVD 1U8IA 5MEND 3MRMA 1F90H 1BM3L 3U4EB 4J2XA 4HMEA 4QO1A 4AY0A 2HT3D 3INUL 2MTPA 2F54B 5CD5D 2B0SH 1P5VA 1QBML 3PGDB 3LS4H 5EBLA 5DVNA 1J0ZA 5EU5B 3KPTA 3AREA 4YFLF 4X4YB 5C2BL 5BVPL 1WBZB 3ARBD 3QXWA 4JRXB 3T2QA 4KQ3H 4ZFGL 3UROR 3QHFL 3V5KB 5HY9B 3QBTB 4UDTA 4RGNB 3RWDB 2W9EH 1T5WB 1XGTB 3MOQA 3QULB 4DN3H 3MRNB 4LVNB 4NDMB 4RGOL 1B0RB 2B1AH 4PRNA 4M5YL 4LHJB 2YUZA 4OJFL 4ZG1A 1EHLH 4Y2DB 1CXLA 1QLFA 1CTNA 5C0RH 1GZPB 1HEZB 3VXRE 4YFEA 1I8KB 3DSFH 3QUKA 3VFGH 5TQ0L 1HILA 1E4KA 5JOPE 5I1JH 3ARDD 3QUYC 4UBDD 1KIQA 1E28A 1HKFA 3IETA 1JE6A 4OLVH 2AEWA 2ADFH 1AXIB 4Z78A 2IFGA 1REIA 1CFVL 4MJID 3I75A 2D7PA 5KBNC 3FOMA 1UVQA 3UC0H 4Q6IA 2QQLH 3VFTA 3L5XL 2GJZA 3FB5A 2DQUH 1NAML 3OGCA 1QQDB 1NAMB 3FT3B 1SEQL 4F7MB 1F4WH 5EUOF 3TT1L 3KXFB 4GRLC 3O45A 1ZTXH 4X9HA 1BBJB 3VD4A 1JTOA 43CAA 1ZT1A 4PV9B 3RTQA 1CGUA 4G6MH 1NFDE 1DN0B 4PUBL 1XF2B 2PCPB 4DQOH 3GSNA 3MRJB 2L4OA 3H9SB 5DD1H 4TTDD 5JZ7C 5D2LA 3VWJA 3R4DA 1MLBA 1MFBH 5AYUL 2HWZH 1MUJA 3QIUA 3CSGA 2W0FB 4TUOB 4F3FB 4Z7WF 5SWZA 5BCAA 4WU7B 5FEBA 4L8DB 3AROA 4UIKH 2ZZUT 3OB0H 4JDZA 1HH6A 4JHWH 1CGXA 1IC4L 3L5WA 1BPVA 3MLTA 4P57A 3DX6B 4C83A 5BVJA 2FX8H 4P9ML 3FFCB 1RZJC 3VH8B 5GS1A 2JELL 4P99A 4OCRH 5FKAB 2HLAB 3MFFB 5F44A 3DV6A 1YNTA 1WUNT 1G7HB 1KCKA 2R1WB 1OSZB 4Z7NF 4GUPB 5E03A 5DURD 3S35H 5FV2A 3WXWH 1U8PA 5I19L 4JQVA 2GYSA 1IRAY 5IOPA 3D87B 1MCJA 1F4HA 4L4TE 3R0NA 2QQQA 2EIZB 1CLZL 3DROB 1M7XA 2CXKA 3PHOB 3VWKA 4JRYD 3PL6D 2FO1A 3S96B 5LQBH 3X12A 3I6GB 2NY5C 5KANI 3TIEA 1XMWA 2EC8A 1ZT4B 2WMPA 2F74A 5IWLC 3RA7H 4NNYA 2VLKB 3HUJB 1YMHB 4J7RA 4B50A 3K4DA 4R96A 2VZ1A 2FL5A 1U58B 5F3HB 4UIMB 1FDLH 1NCDL 5BO1H 1A7PH 2W07A 3WN5C 2BY0A 3F58H 2IALA 4ZMAT 3KYOA 3GHEL 3B9DA 2XOTA 4P4KA 4JR9H 5HHOE 1TJHL 1MELA 1I7TB 1IT9L 2DLTA 3AB0B 2X4TB 3BPOB 1HK6A 1XCQB 4Z0XB 4ZO9A 5T1MA 1ADQA 2C5DC 2DQDH 1NFKA 4IIQB 4NKMA 1GGTA 5LGHH 1HWGB 4XCCH 1P9MC 1Z5LA 5BZDB 1OF2B 1GGBH 1NANH 5CGTA 4Z78B 2PTUA 1K8DA 1DR9A 2HJFB 5EZLB 3IAGC 1MFCH 1HXYA 4JRXE 2XWBA 3TO2B 4JPWH 5IHZA 4HKZA 1BD2E 2A1WH 35C8L 4JANA 4X7SL 3ZT7A 3SDAD 3VXUE 2GHWB 3EYQD 1JRHL 4XNXH 4V2BA 2IC2A 4L8SC 4HS3B 1M7DA 3WBDA 3L3KB 1SBSL 3R06B 4H1LH 3TO4C 3PIQA 4GRMB 4Z5RA 5T3XD 1T04A 1YNKL 3N85H 4PV9A 3DI3B 1VACA 3O3DB 3QB7C 1I9EA 2OSLB 5KANG 3WV0A 1RJYA 4HUVB 1NCCL 1P4LA 3MR9B 3WIIL 5HJ3A 3GO1H 5FV1L 1RK0B 5B21A 4G3YH 4N8VB 3T0EE 4XHQA 2P24B 1NCCH 1HHHA 4KY1H 2D03L 1DQML 3STLB 3CU1A 5E6IB 3T04D 1FCCA 3BP6A 5HYEA 1DQJA 2HTKD 5KSUA 4OLWL 2GTZA 4AZ8A 4Q6IC 3VGDA 3C60C 5BV7L 3OJMB 2F53E 5SWQB 3EFDH 4L4VE 1LK3L 2DJ4A 1UWXH 3BISA 2CUHA 4A6YA 2QQNH 2YD7A 2FO4A 4IJ3B 3LMJH 3BYYA 1RIUH 5DT1H 5A16A 5CWSB 2UVFA 5J13B 4O9HL 1OCWL 1RZIA 3L5IA 1OGAA 5A1AA 4P23D 3ULUL 4MS8C 1E4WH 5F1NA 2AEPL 1DBBH 1GGCL 2AXGA 2DM2A 1E0OB 3WO4C 4P46B 1OGTA 3HRZB 3CVHL 1A5FH 3DXAE 3JZ7A 4GW1A 4JY4A 3UO1H 4M7JL 3OKDA 5C07D 3S3PA 3RDTC 4D3CH 3A6CH 4BYHA 5DHVB 2KUTA 3ES6A 4X4YA 3O9WD 1CDYA 3EO0A 4O9HH 4PJIA 1A7OH 3V4PL 2ZNWA 5IMKA 4O2EA 2J5LC 2EYRA 2BHZA 5HPOA 1AO7B 2D0FA 2IBZX 4OF3A 5DUBB 4ZUTB 1NKRA 3L7EA 4RWYH 3D85B 3Q0HA 3SN6N 3U6RA 4JPVH 2D7MA 4MJIE 1D6VH 4WEBH 5GISH 3QDMD 1TTFA 4YFLI 6FABH 4NQCE 1YN6A 1G84A 5A2LH 2Y1VA 2C4FT 2HH0H 4WUUE 2ZSVB 3C5ZC 1T2JA 4V1DB 2IH1A 5C08B 3VXRD 3QJHB 2QBWA 1UZ6E 4MJ6B 5IFAH 4RGMB 5EZJB 5FECA 5ITFA 1LGVA 3MRRB 1JP5A 3HE6B 4HT1L 1SY6L 2HJLA 4LPWA 2ZCKH 3CMGA 1I9JH 2HLFC 5IBLC 2MCPH 3QIWD 1HDMB 5EN2B 3MACL 1RULL 3VXNB 1IMHC 2VOTA 5AD0B 1JTTA 3BE1L 1FIGL 1AXSB 3BGMB 4Y19A 4HS6A 3UTSB 3K2MC 1NCUA 1CZ8H 4XBPB 2BJMH 3RI5K 4UNUA 1YPZB 5F9OH 3MV7E 1S7QA 3C60A 2PF6A 2DLHA 4I9WD 1TZIB 3IU4H 2A83B 4EI5D 1EMTH 4FZ8H 1S78C 1MJ8H 1L0YA 3H9SA 3QI9A 3WN5A 3DVIA 4NKOB 1YEGH 5I74B 1A21A 1Q9LA 1JTPA 4X6EA 3P0VH 4F58L 3BI9X 4FZ8L 3EJJX 4LIQL 4ETQB 4BFIB 1SMOA 3MLWH 2APTA 1RJYB 2IF7A 1UCBH 5CS7A 1FNGA 3U7WL 2FDBP 5I30L 3T0XA 3V5HB 1A4JB 1J88A 2FZ3B 2GW5A 2Y06H 3MBXL 4P9MH 5L2KD 4JHAH 3TIDB 5GS1B 2B5IC 1G0DA 5FKAA 5JOEA 1SYSB 2RJMA 4F9PA 4RNRA 3HC3H 2H45A 1KNOB 4U6XB 4WY7L 4LSVH 4XAKD 5FHBH 2NY0D 3WIHH 4IDLA 1BAFH 4POZC 1FAKT 3ARDB 1CDJA 4RA3A 4JQXA 4PG9B 5FYJL 1PY9A 2NW2B 2OZ4H 2X4NA 4M61B 5EUKB 5EU7E 2P1YA 1KXQE 1IFHH 3DRTB 1MF2L 1XH3B 2R9HC 4MNGE 4B0MM 5I75B 1AC6A 2A6JB 4K2UH 5IGXL 1WBYB 3AM8C 4MJIB 4GKSB 4ZXBC 3EAKA 1KULA 5T1KA 3E2HC 4PREA 4ENED 2NY6B 3LDBB 4NM8H 2UWEB 4FQLL 2DF3A 5D2LE 2Q86B 2HRPL 3RHWK 2EE3A 3MOBH 5HHVH 1JHKL 1J0IA 2EDEA 4LHQB 3ZL4H 4TVPE 2W9DH 1KF9B 4HK3J 4KWUA 5KVDH 3EZ8A 4QRSA 3W9DB 5HD8D 2KZ1B 1DJSA 4NKQB 2WIMA 3G6DH 3QPXL 1AIFB 5CKGA 1PKOA 3KYMA 5ETUB 5D96C 2DOCA 3UC0L 1A5FL 2UY6A 5ISZE 2PYED 4EVNB 2GIYA 1A8JH 3RJDA 2YRZA 1URLA 3C08H 2BSSA 1P6FA 1I7TA 1WTGT 3ARBC 2ID5A 4YDLC 5SWZD 5BVPH 1S9VA 2A73A 2WP3O 4IOIA 4LCCA 2V5YA 4YDVB 1JNJA 2EYSA 2R1YA 5BW7C 4YBHA 1MLCB 3L3GB 1PFCA 3DARA 2QV2A 5SX4I 4U0RB 1TZHA 4GRLA 5JDSA 1OF2A 4JFDB 3AM8A 1EGJL 4S0SD 1FYTE 4HIJA 2B1HL 3U9UB 2Y07H 4Y5YB 2WIIB 5I1AB 1CDHA 1VB9A 3VXOA 1UXSA 3CDYA 3LEXB 1LE5A 1MJ7L 4OCMC 4KJWC 5F1IB 5C0CE 2CMRL 3TT1H 3RWFB 1MCBA 3VXME 5HYJA 4DFHA 2VXTL 3QUZC 3D0LB 1A6TB 2Z35A 3RWGA 1YN7A 2GSGA 2R56L 1WBXA 5IESH 4PJXE 3T65A 4IRJA 4X6BB 3TNMA 5C2UB 2EEAA 1PDKA 4JKKA 1EUUA 4DUVA 5I1DA 5JLZB 2AJSL 1CXEA 5HDQL 3IDNA 4U05A 1GC1L 4Y1AE 2QKIB 1P7QD 1S5HB 4EIZC 1WWAX 1P7QA 2R29H 4X7SH 2EH7L 2Y07L 3D1MC 4RBPH 3V7AG 3U0PB 2Y4SA 2EE2A 3OB0K 4ZFOL 4N5EC 4X6DE 4AIOA 2P44B 5D1XB 3MV8D 4UT9L 2RBLA 4PY7B 4JJHA 4FXGB 3NFSL 1BAFL 3HMWL 2YK1H 3KDMA 1IGYB 4LDLB 3G5XA 4EUPA 1D5IH 1F2QA 1KIRA 1INQA 1JNNH 1YZZA 4OD1H 1JBJA 4PJ5E 2BMKA 4IRSB 1FNAA 3QPQC 4HFUL 3W11D 4E42B 5D1QB 5FB8A 4Y2DC 4WFEE 4X6CE 5GS0L 5FYKH 3EYFA 2AEIT 5DWUH 4UAOB 3LQZA 3MLWL 1FJ1B 1LEKA 4AIZB</