3DI3B

Crystal structure of the complex of human interleukin-7 with glycosylated human interleukin-7 receptor alpha ectodomain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
193
structure length
193
Chain Sequence
b'DYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-7
publication title Structural and Biophysical Studies of the Human IL-7/IL-7Ralpha Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/cytokine receptor
total genus 29
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2008-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
B PF18447 FN3_7 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3di3B02
2.60.40.1870 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3di3B01
1XIWB 1UCTA 3HAEB 1LP9B 3VFVB 5HY9B 5F9DC 4PJCF 1BBDH 2ATPB 1BD2B 3RAJL 1CDCA 3RL1A 4PLKD 4JGUA 1IGMH 3TN0C 1A7QH 2KPNA 3V6OE 1U3HB 4RGND 2Y36H 4I5BA 4IOSD 1T20A 5D1QD 1Q9WA 1A7OL 1Y18A 2E7MA 4I18B 3S36L 4HJJH 4PJIF 3CNKA 4ZSOE 4MAYB 1WICA 3C2SA 2V9TA 3STZB 3KPPA 1IBGH 4V2BA 2VR4A 3V0VA 4R3SA 1CIDA 1MIEL 4CKVX 5J1SC 2AK4A 5B4MC 4PPTA 5D93C 2W9LA 4JRXA 4GAJL 4ZUWB 1YECL 4M7LT 1T5WB 2X4SB 5GGVH 1C5BL 5J9PB 4M3KB 4MJIA 4G43B 3DXAE 4XTRC 2ZNWA 5EOQL 3WKNA 3QWOA 3QCVH 3ZE1F 5EFIA 4YHOH 4MNQE 1PQZA 2IBGA 1U93A 2HKFH 4NWUL 2I27N 4ODSH 3OXSA 1I1CA 4P3DB 1RJCA 2R29H 1T22A 3DX7B 4JG0L 3NZHH 5KVEH 3O2DA 2Z91B 1XCQA 4PRID 3O2VL 2ESVA 3BI9X 1FH5L 4MQTB 1YEGH 5J4MA 3TCLA 2HFEB 3EHBD 4YHPB 5IB5A 5C9JA 5T1KB 2HP4A 1SQ2N 2EDQA 2ZG3A 4LLYA 1DL7H 2WW8A 4XRCB 1HN1A 5DVKA 3WIFA 4NFBA 2YPLB 5HHVH 3C60A 4U3HA 1OARL 4U6XB 4APQD 1YNLH 1E4WL 1S7TB 3GI9H 1HSAA 2XA8L 1E6JL 3WUWG 3HC0B 4RGMB 1FVCA 3IDYC 1YEFL 4NDMB 3VGFA 4PR5B 5F7EH 1E0OB 1FFNB 4PJBA 5HYSB 2VZOA 5E6IC 5K9JL 1KSRA 1LDPH 3GKZA 4OLXH 5TF0A 2E27H 1X5KA 3ABZA 4Y16D 3FKUS 1VGEL 1F00I 4QTIH 6FABL 1NSNH 4RMQA 1YEKH 3O4LB 3TH2T 1KB5B 2WSKA 1LO4H 5JZ7C 2NXZC 4P5MA 3NCYP 4WWKA 2AJVH 4WI6A 4PRPD 4ELMB 4UV4L 4KVNH 4TULL 4PJBF 2HN7B 2YK1H 5E4IA 4J3TA 3FOLA 5ID1B 1KTDA 4UUJA 4YZFF 3U7AA 3I6KA 5I1GH 4WHTA 1QQDA 4DCQA 1BFVH 3THML 3MLYL 4FQCH 2HT4C 3JV6A 1OGAA 1A6WH 4GQ9L 1RUKH 5IB4A 3E2HC 3AREC 5ICYB 4OM1H 3QUZB 1ZT1B 4LQFL 1DQDL 3K1KC 5KSAD 1ERNA 3PDGA 1FDLH 1K3ZA 1C16A 2A6DA 5CJBA 5DRNA 1MHCB 4ORGA 3DX9B 1X44A 4EIGB 3IT8D 4PJ9A 1F3DJ 2FEEI 5CIPA 5D7IE 5F9OH 5JIIA 3OF6A 3CPLB 5FGBC 3P9WB 3JTTB 2JF1A 3ZDYE 2EZ0C 3DIFB 4F9LC 4PV9A 1T83C 4YX2H 1CXEA 3RY6A 1U42A 1UKTA 3BH8B 4ONHA 5HI5D 2A0LD 4M6MH 5SWSE 3RGVD 4DVRL 1I9IL 1CGSH 3JBG7 4OBRA 1U58A 1HINL 3RZCD 1UM6L 3BZDA 4FHBD 4JQXA 3OV6A 5ICXB 1MIML 2EH8L 2VC2L 5CGYD 4TVPE 1NCWL 3G9VA 3JWOC 3MRBB 5MI0B 3CH1A 3QFJB 1UXSA 4UIMB 3FT4B 1ONQB 4WHDA 5K9OA 2FEEL 1GGUA 4Z7WE 4G8EA 1NC4A 3TBYB 4U1MB 5HHOE 4KJPD 3MOAL 5F7MC 2XN9B 2D31A 4O51B 2HT3C 2D7OA 2EDBA 1F6LL 1ADQH 4KDTC 3S4SB 3W9EA 5ETUB 1MY7A 4EXPX 2ICES 3WEXB 2JKXA 3HE6C 4EI5D 1KT2A 4ZD3H 5ALBL 3NVQA 2CUMA 3MUJA 3MV01 4Y19E 5HGDB 4NN5C 4OGXH 5F70A 5H94A 4XPTL 4CRPA 1F6AA 1YEHH 4O2FB 4Z5RB 4QRQB 4Z7UA 3JTSA 3VFMB 4E5XA 2HLFC 4MQSB 1IEAB 3SE4A 4PJAA 2QSQA 2XNAA 4ZFZA 3ILPA 3SKOB 4WTWA 4HKBA 3MA7B 2DQUL 3LHPL 1G7JB 5T5FL 4Q9RL 2APFA 4F58L 3FN3A 1R24A 1LO0H 2AGJL 1G7PB 1J8HB 5DZOA 1J8KA 2EDKA 1XH3B 4NNPH 3BIAX 4Z7UF 1KB9K 1XGYH 3GBNL 1ZA6A 1F02I 2VWEE 5IKCA 4BUHA 3K80A 4PJ8D 1QRNA 3VXMA 4PJAF 3RWIB 3OR7B 2XIDA 1GXEA 2F8VA 1KPUA 3KPQA 3PHQB 3UTSA 4N68A 2MJWA 4XHJD 4PLNC 4N0YH 1EFXA 5CWSA 3QPQD 3N9GL 1G7LB 3D0VB 5GRVK 1JPSH 4GKSA 1JNNH 3GGWA 2PW1B 4YHMH 5BXFB 4N0FA 4XAWH 5HDBE 2DRUA 2NY0B 3WMSA 3MLVH 1QR1A 1YUHA 2OL3H 2R1YB 5KS9F 1U8HA 3QEGH 3CVHA 2E7CA 3LD8B 4HWEL 4YHYB 2JJSA 2IEPA 2OXHA 2JIXA 3N0PB 1TZHB 4U0RC 5SWZE 4RBPH 3U30C 1NEUA 1FYHB 4JFDB 1BQLH 3EYFA 1KXQE 1YQ2A 1JYXA 4J2XA 4HDIA 4Z0XA 1LO2H 4MQ7A 4UOW1 1F6FB 1MCHA 1WWAX 3MCLL 5BRZB 2ZPKH 3C5SA 1JHTA 43C9A 1I75A 2IFFH 4YUEH 4Z6AT 4R7DB 1MHPL 1F3DH 1JZ2A 3IFPB 4JVUA 2YD1A 3SGJA 3X3FL 5L88H 3WNMA 4YWGL 2PCPB 3QIWC 4JANB 4MMXC 4N8VA 4XNYL 1ZGLM 4TUJA 4MCZA 5CKAA 2R2CA 1BFOA 4RNRB 3BSZL 5I1HH 5CBEA 4QY8A 1P84J 2CRYA 4MD5B 2V2TA 3T8XB 1W72H 5F3BA 3NA9H 3IXAB 2Z8SA 1EFQA 5D7JB 4NO2B 5EO1B 2CUIA 4U1JA 1UQSB 2VQ1B 4YFLF 3RWGB 4QHKJ 5GGSA 4OI8A 4OV5A 4YAQB 1A3RL 2A6KA 3ZYIA 3VFNB 1HKLL 3K1DA 1HH9A 1VADA 2BNRD 2OR9H 5KZCD 1ZSDB 4ZYKB 3QI9B 4Z8FL 3KPSA 1K85A 5KSBA 4Y4KC 1IZKA 1RZJL 2ENYA 1UB6B 1CF8L 3NN8A 1DQQB 1YN6A 2VB5A 2G9HA 4P2RA 5ERWB 3DJ9A 3VFRA 1IAOA 2HJKB 4C54A 2X1OA 3G5VB 3S36X 3ZT5A 5EU3B 4BFGA 3VCLA 1OAYL 3ES6B 2NPLX 2Q6WA 2X4RB 3PABA 1RUMH 5C0CE 4V1DE 1OWRM 2DQIL 2EEBA 2IAMB 1KGCE 5C0RL 2ZKHL 3G5YB 3MV8A 1TMCB 1INQB 3AY4C 4P2OC 1GSMA 3FT2B 4YK4B 5J89A 3BDXA 3EDDA 5B22A 4P46B 4NZUH 4H1LG 3ULUH 3VWJC 4C59B 1U8PA 3IU3B 1YN7A 3NFSH 5D9SB 1X5IA 2ZCKL 5FF6A 2YZ1A 4HF5L 1L6XA 3FO2B 4MDJA 2BVEA 3LDBB 5I6XB 2JJUA 4HD9A 3OAZH 3FOMB 4LLWB 2XA3A 3FCTB 3CFKB 3MV7A 1MH5B 32C2B 4EUPB 2VDLH 4AL8L 1VACA 4XMLH 4HXBH 4YHIA 3L3DA 1T4KB 2HFGL 3BP7B 1VKXB 2P24B 1N5AA 4D0CB 3H7LA 5TE7L 1GOHA 2VUYA 1IVLA 3DMMB 5IVNA 3PDOB 1ZT4A 3NIDF 4U1HA 4K3JH 1EEZA 1W0VB 3OL2A 1S7SB 2E7LA 5D5ME 4AT6A 5C9KA 2APXA 1CXFA 4QKXB 3ZKNC 2DM3A 4X4ZA 3V4VL 1HSBB 1MVUA 2VO5A 1AE6L 1MPAH 2ZCLH 5BJTA 4UOJA 3ZLQC 3U7YL 3F5WB 4WI3A 3HI1A 2Z92B 3AFLA 3DGCR 4N9GA 4WO4A 1K2DA 4NQCA 3D0LB 5KVFL 1A2YA 2X1XR 3V5KA 2IH3B 4OF7A 2JLLA 4WU5A 12E8L 2UYLA 2ZP0T 4MWFB 2XN9D 3TN0B 2F54E 1TCRA 5IV2B 2OP4L 4OCXH 3HA0A 2FL5A 5TQ2L 1IC4L 2BXYA 4X8JA 4Z7NF 2BCKB 2WBKA 4WW2C 3CH8A 4YHZL 3CX2A 1D9KA 5DRZA 4R2GD 3KXFE 5C0BD 3VXUB 3V8OA 2WINA 1XF2B 1KJ2H 5C6PB 4JB9H 4HBCL 2B1AH 1HIMH 5CD5C 1OAKH 5D93B 4PJFB 4IM8A 1QHOA 5IMMA 4OZ4B 3MROA 3LKPA 1SM3L 4R4BB 4N90D 4OZIE 4DGIH 1QP1A 5DK3A 2VQTA 5FK9B 4BSVB 1S7UB 2J8HA 3KDMB 1U8QB 1EHLH 3H9SB 1NLBH 2ZZUT 3EFDH 2YUXA 3TFKC 4XVUC 3MXWL 4G5ZL 1NL0L 2YD2A 5JW4Q 4KXZH 1NKOA 1A14L 4I3RH 2FO4A 2GJZA 3D85A 5A2JH 3EDFA 4GBXC 3BKJH 3VXQA 4PJHE 3ZKMC 2W1NA 1XGUB 3BAEL 4I2XE 1JWUB 4Q9CA 5FKAA 4NHCL 4GRMA 3MA9L 3ULVL 4P9MH 3G5XB 1EJOL 1TQCC 3HNSL 4DGVL 1FIGL 2O5YL 4L1DA 1OAQH 5C1MB 5JNYB 1K8DA 2BFVL 3HC4L 1KN2L 2DKSA 1RMFH 2NLJA 2WBJB 4N1EA 4YDIH 5E2UH 1KTLB 2AV1B 2HTLC 3IDYB 1QBML 3P4OA 1UZ6E 4HT1L 3GSWB 4PJ5D 2R1WB 1YYML 2VYRE 3QDJE 1QFHA 5E6IB 4NN6C 2QHRH 5GGTA 5B3JF 1T5XB 3SGEI 5I1EL 2NX5D 1BLNB 1TFHA 1QD0A 2PKDA 4G8IB 8CGTA 1S78D 4J8RA 2Q3ZA 3F7QA 5C0GB 4R96B 1U2HA 3EJYC 2VAJA 2X4TB 2PXYC 4NM4L 3O8XD 4QT5B 5AAWA 5B39B 5HGBA 2CDFA 1NAKH 5FUOL 2NW2B 5F93C 1ZANH 1G7QA 1AXSB 4JM2A 3FRUB 2EDYA 1WBZA 5D2LE 3RU8H 3ULUC 3L3GA 3T4AA 3LMJH 4DVBB 1YY8B 4K2UL 3U83A 4ZFGH 2ZUSA 3MLUH 1OM3L 4X9BA 3UZQA 1S7WB 3E2HB 3AREB 3IXTB 5DJXA 2H2PC 4ODWA 1MQKL 4JFPA 3WLBA 1W0WA 2VAAB 5DD0L 1JNLL 3IJSB 2Y07H 3P11L 1EAPA 2CKBL 1FNGA 1ZWIA 5CJQL 1I7UB 4KKLD 1PG7H 4KWUA 1I8IB 2PO6D 3MJ9A 3QHZL 4NQDA 3MNZA 4G6AD 5EOCJ 4ZNCD 1FN4B 3U48A 4E42B 4HMEA 4OB5L 1CLZL 4W81A 3Q5OA 3H6JA 1MFEH 4LSUL 4DGYH 2X2YA 3KPLA 4Y2DC 3WXVL 1FNHA 3SCMD 5C09E 2D0GA 5AYQA 3E6HA 4OZHA 5DJYA 5CEZL 3HZMB 5INDA 5L2KD 1JF6A 1FVEA 2EDOA 5T3ZD 1RHHA 5IOPB 3D2UD 3KLHD 1UWGH 1KEGH 3MLXL 4OCYL 4YFDB 5DUBA 3RUGB 4ZAKC 2HFTA 2QQQA 4V2CB 2IAMD 5D1XB 1KYOK 4I3SH 1A6TB 2R0KL 2Y06H 4Y89A 3FT3A 3UTZA 4GW4B 1J10A 4QXTA 5DHYB 4IRSD 4K8RL 3OJDB 3SDYL 4MSWB 2P5EA 3QDGA 2VE6B 4P46D 4X6CE 1I1FA 4OZHF 4HKXA 5E6YA 1IAIL 3M8OL 3HNTL 2R2EA 4WRLA 1N6VA 1QSEE 3LAFA 3UBXB 4QHUB 4FQ2L 1MELA 5IMOB 1BEYH 2FX9H 5TDOA 4JDZA 5TDNB 2MMXA 3QCUH 3SJVB 1CDYA 5HVHC 4NN5B 4JHAL 1G9EA 3U6RB 2L0DA 4FS0A 4XNUH 1NBZA 2HTKD 2RR3A 5JORA 1UEYA 4OLZL 5F1KC 4F7TB 1QACA 2BVUA 1R0AL 4G6JH 3SDXA 4C4KO 5D72L 1ZXQA 4OBSA 5D7LE 2G75B 2IPKB 3KYNA 4NBXB 5FXCH 1EHAA 4U6HB 1T80A 1U8MB 4ZXBC 1FL5A 2J6EH 2VSDA 4LCWB 4PJEA 5E0QA 1BZQK 5EA0H 4BELD 3IDXL 3IDGB 3MRKB 4PV8B 3GHBL 1RZ7L 4FMKA 1KOAA 4QOKD 1Z2KA 4L9DA 4BFBD 4WFGD 4D9LL 1H3VA 3K8KA 3MFFA 2J8UA 2VXVH 4GMSL 3SDXF 3C2AL 1F3JA 5GRVL 5E8OB 4YIQB 2GEEA 4UQ3B 2GT9B 3TVMB 4IMLB 4GKNB 3MUGB 2EXYC 3B9VA 2A6IA 1QHPA 3L5IA 4PJEF 5IVZB 4ONGH 3WS6C 2VDNL 4LBEA 1RPQA 2R0WL 2ADFL 5IBTL 3CLFL 1KCLA 1JHLL 1XF3A 3NIGE 5HHQB 3C8KB 1FE8H 2Q76A 3VXUD 5FOBB 4CNIA 1RAMA 2J8UF 2P8PB 3O3UN 1A5FH 4MXQC 5E8EB 1SMOA 2G5RA 1Y6KR 1ZEAH 2ADIB 2KQNA 4U1SA 1G0YR 2PF6A 3SE3A 5J3HD 2VDPH 5E99L 4L9LA 1C5CH 2OMNA 1PKQA 1DANT 3GBLA 4YHNA 1K4DB 2WP3O 5E9DB 1D6EB 3K2UL 1UM4H 4MD4B 2CMRH 3MLRL 3H9SD 1P1ZA 2R0ZH 1D6VH 3VJ6B 3B6SA 1L7IL 3EO9H 3GJFH 4NUGH 1NC2D 3LKRB 4LCCC 7CGTA 1T2QL 4LSVH 3UJIH 1IEBA 5EOCH 1CXIA 3WFCL 3QPXH 2EYTB 2YKLH 3QQNA 5D1QA 5FO7A 4FN0A 4OD3L 1CTOA 3H7BB 1DTUA 4HZLA 5SWQB 5FCUH 1FNEA 4NWTL 4X7TB 4AMKL 1CS6A 3B83A 4NRYA 1CFSB 3FB6A 1YNTB 2XTJD 4XCYA 1CLOH 5ILTL 4S1SL 3CVIH 5EC2A 2FJHA 2WBJD 1P4LB 5GS0D 5E6ZA 4H20H 1LEGB 1HHIB 4PJDE 3W82A 2XTLA 1CGXA 4G6KH 1F58H 1MF2L 3O11B 3KPMB 2F5AL 4XCFH 4G8GE 5EPMA 5I9QB 1GPOL 1I8LA 3L3IB 1IC5L 4OTXH 5FDWA 4NNYA 4CMHC 1KLGA 3OJMB 5C6WH 2VXUL 5LGHH 1FLRH 3EFFB 4L5FH 1AGCB 1HWHB 3KLSA 4MNGA 2Z8VC 1KN4H 4Y4KB 4HIEA 1S9VA 3VRLF 3RNQA 3S35H 2AEQH 2HA1A 5D2NC 3WSQL 4C58B 5MHSE 4RRPA 3PHOB 5JLZB 1HYSD 5CJOH 2Y72A 4NPYB 2RQ8A 1DQLL 1K6QL 4LRIA 1IGYB 4JZJA 1MHHA 1L0XA 1CE6B 3U7WH 3VRIA 3BKYL 3I9GH 1KCRL 3W11D 1A1MB 2K9UA 2W0FB 4U1NA 3QT2A 3QH3B 5D96B 3TO4A 3KR3L 1YNKL 2D9CA 4NQEB 4RMRA 3UPAA 1GGBH 4P2OB 2F74A 2YEZA 3GI8L 1S7RA 5FYJD 4ZUTA 4APQA 4UDUB 1T3FA 5HXMA 1PLGH 1NLDH 3VWJB 1WISA 1PW3A 1UYWL 4JFYA 3BKCL 4I4WA 3OKYA 3VXPB 2VDQL 5DURD 5CINH 2ARJA 2EH7L 1TZGH 1FC1A 3VXNB 1OP5K 3KWWB 3PP3H 4D3CL 4E0RB 1QKZL 3EYOA 1FYTB 4PRHE 3GEWB 3M17A 4H26B 5DHVB 5EU6B 1FFRA 4MX7B 1TPXC 5HHNB 4Y16A 1ZE3C 2FWOB 1P4IL 4MS8C 3V52L 2I5YL 1BOGA 1KCSH 4PGCB 4TN9A 3CXHK 4JY4B 3OKLB 1XF5A 1FL6B 4OQTH 3F58L 1QLRB 4PRPA 4X0KB 2CUHA 1EGJA 1K5NA 3GMQB 5DQ9A 4J6RH 3GRWA 3F7YB 3ZHDA 1CL7H 4JDTH 1MCSA 4PP1D 3QQ4B 4YE4L 4PLJC 4HWZB 4CDGC 3MO1A 3U46B 3SDAD 2EECA 3DSNA 4U6VH 1A1NB 3EOBB 5HPMB 1WZ1H 2EIBA 2FZ3B 4JFHE 4PREB 5INCB 5FO8B 1AIFB 2GFBB 2PW2B 1A6ZA 3HRZA 1N6QH 2Y7QB 5KSAA 3BH9B 4JCLA 2CJUL 4LSSH 1DVFB 5MEPB 4ZO6A 4YGVB 3FFDA 1DQJA 4PD4J 1P5VA 1VEPA 2OL3B 3GK8L 4TTGA 3S36H 2Z8RA 2FYYB 4RFNB 3W39B 5BW7A 2PTVA 4DKDC 4P5KB 1BWWA 2AXGB 3L95B 1OTTC 2LFGA 2VN4A 3FQRA 4XMKL 4JLRB 5JOPE 1T89A 3DNKA 5ADPH 1AO7B 4LKXB 4A2LA 5IIEA 4XXCA 2R23B 3GMPB 1M71A 1X5YA 2PYFA 1CDGA 3RGVA 3U36A 4GAJH 4PYGA 1YPZB 4JQIL 4CVXB 1NFKA 4JFOB 4RFEA 1J86A 3QIBB 1C5BH 3P77B 4G6ML 4LCWD 5A40E 3ARXA 2JB6B 3FAXA 3ARFD 2EYRA 2OK0H 1H3GA 3T77B 3VGAC 5JTWA 1PKOA 3QO0A 3PDDA 3MLZL 3QEQE 4POYA 3RI5K 4NWUH 1RJZA 4OFYD 3RWEA 4QRPD 3O2DH 1EMTL 5DRXA 4X8XA 2RHEA 3V0AC 5I8KH 1HEZB 5TPWL 4GBXB 8FABB 1UA6L 1OAXL 3QG7L 1MAJA 3DRQA 2EIZB 3TBTA 4LFHD 4NKMB 3WFHA 4EI5A 1A0QL 3H3KA 3NAAH 4HC1L 3WN5A 3TO2B 3ZSSA 4UOW0 1NCTA 3A67L 4ZTOH 2P49B 1S8DB 3DO3A 3QUYC 3BN9C 1BIHA 5IFHH 1K8IA 4F7CB 1TQCB 1ZGLA 4ZSOB 3QQ3B 1WJ3A 4J4PC 5C2BL 5EDXA 1MRFH 2B7DT 1CDUA 4KY1L 3UTPD 1WT5A 3TH4T 1S9XB 3MRMA 4ENEC 5LGJB 2HRPH 4QRSA 1YEDB 4ZS7H 1T0NA 3HZVB 4GRLA 2YN5A 4PFEA 4QHLA 4NN6B 4ZUVA 4L3AA 1EZVY 4J3XA 4JY6B 2DBLH 5K9JH 3BUYB 1XIWA 1PVHA 3HAEA 2N1KA 3VFVA 5HY9A 4L8SC 2VJXA 4KRNA 3Q5TA 1R3JB 5EU4B 2ATPA 3LY6A 2NZ9D 4XWGL 3EOYG 2AERT 1R3KB 3ZL4L 3PWPD 1U3HA 4R8WH 1LEIA 3TT3L 1OSPL 1WK0A 4X6EB 4E41E 3TBVA 4I18A 4UV4H 4EXKA 5EU5B 3JV5A 3BEWB 1SYSA 5BMFL 4FQXD 3DETD 4ZG1A 4P2QB 4H8WC 4HIHB 1C1EH 3DWTA 4N8CL 3STZA 1QBAA 1RIHL 5BO1H 5GZNC 4OIIH 4HUWB 3ZYJA 3B3IB 2H1PH 2IALB 1XR8A 5E8PB 3MXVH 4GQ9H 1GGCL 4M43L 1T5WA 2DKMA 2X4SA 1JUFA 4M5YH 4NSKB 5J9PA 1KENL 1MNUH 4G43A 2M1KA 3ZDXF 4ZO7A 1I3VA 1XR9A 5IFJA 4POUB 1I8KB 4WEMB 5CIPH 4XVJL 1CVRA 1G7HA 1T1ZB 3GIVA 1H9VA 3MRLA 4JFED 1ORSB 3FTGB 4NIKB 5AZEL 3CFDA 2ADJB 3GSNL 4P3DA 3NGBB 3T3ME 4M6NH 2X44D 3I02B 2NXYD 2Z91A 1GHFL 1IGJA 3GFUA 1RZKC 4KC3B 2X4QB 3BO8B 2BMKB 5LCVL 3P9MA 5F96L 3W2DL 4WV1B 4YHPA 5TE6H 4DVRH 5T1KA 2EDTA 1HINH 1TTFA 3BW9A 1R3LA 3P3YA 4XRCA 4NQED 2YPLA 2EH8H 3GSQB 5HVGB 2PTTA 4U6XA 1AR1D 1T21B 4L8CB 5IW3A 1U3JA 1A6VL 3H2WA 5IEKB 3ZDZF 1S7TA 2Y1VA 5F1IB 3ULVE 5IF0B 3HC0A 3VI4E 5DJDA 1VCAA 4UB0L 4UT9L 4PR5A 1Q1JL 4OLYH 4S10A 5ESVB 1ROWA 4OZGF 1KJ2B 2Y6SD 5HYSA 2I07B 5HVHB 3DSFH 2B5IC 1HILA 1N0XH 2FB4H 4F9PA 3BPOB 1KCVH 5D1ZC 1QO3A 1KB5A 1YY9C 2J12B 1HQ4B 1LD9B 3J8F7 4KQ3H 4ELMA 4JO1L 1U36A 4ZXBB 4EN3B 4HLJA 4DQOL 3JV4A 3LHPH 5GS1B 4JFZH 5ID1A 5JPNA 1U6AH 2OBGA 4FXKB 4OF8A 2LU3A 1BQHB 3HLAB 2BNUB 2PYEB 2EDRA 3V95A 5I75B 5F7NC 3BPLC 3S5LG 1H15A 3H42H 4OCLC 3E8UH 5TQ0H 1QFWI 4JPVH 3QUZA 4ELMF 1ZT1A 3UMTA 4FTVB 4GG6B 1SJHB 1FAKT 2ICWI 3QEHA 5GZOD 5EB9A 1P7QD 2GSIB 1GGIL 1OD9A 3N9GH 3SHSA 4PBVC 3CPLA 2JJVA 1SVCP 3KPRE 1YEIH 3RJDA 5L2JB 3D39D 5C08D 4HMDA 3BH8A 1YJDC 5EN2B 1FRGH 2NY1D 2P48B 4DKFH 2R56H 4OGZA 2IG2L 4PJGB 5C0AB 3MBED 3SBWA 2DIAA 1I7TB 1WFUA 1QFWL 3BRDA 5ICXA 2D7QA 1JGLH 1FPTL 4ZS6D 2ZWLT 1ORQB 2QQLH 3FB7B 1N6UA 3PGDB 3QFJA 5CEZE 3LN4B 3FT4A 5I76B 4K3GA 1ONQA 3MCLH 4JGJA 4WWKC 3LB6C 5DFVC 2W07A 3VFUA 4LCCB 2ZOLB 3TBYA 5C8JB 2IANB 4DZ8B 2DN7A 2NY2C 2XN9A 4O51A 3H9HB 4TSBL 2Z31D 3CD4A 4LF3B 3HB3C 5I1IL 2W9EL 4Y1AE 1INEL 3WEXA 3S3SA 1RULL 2DWDB 5HGDA 1HYRC 4O2CB 3P4NB 4OFKA 5C0BA 4TQEH 2A1WH 4DWHA 2DQEL 4CJ1A 4Z5RA 3UO1L 4QRQA 3BSZH 4E9LA 3PXJA 2R4SH 1FGVL 3HPLB 5I30L 2XICA 3LV3B 1GZPB 3UTQB 1IEAA 2B2XL 1R6VA 3WLWC 2UZIL 3F12B 4MMZC 3MA7A 3C6LD 2B1HH 2PNDA 1G7JA 2WP3T 4A6YL 4OGAC 3MGOB 1A3RH 1N3NB 4MXVF 5CHNB 1J8HA 3RY6C 2LV4A 3ME0A 3U79A 3DXAD 1XH3A 4HKJB 3X3GH 3P73B 3GM0A 5K9QI 5TDPB 3IJYA 4JKWA 5ISZB 4L8DB 2YD9A 5HDQH 5D2NB 2GJ6B 4YXHL 2YUZA 1V7NL 4LSQH 1QBBA 2GCYB 3RWIA 1RZJH 4JQXC 2YXFA 1CF8H 2UWEA 3BIKB 3GSUB 4UMGA 3PHQA 5ANME 4CN6A 5FKPB 4BZ1L 1JMZA 5DD3L 2P8LB 4ONOA 1DBJL 4X99B 4IS6A 3D0VA 3T08A 4U1IB 1XF4B 5T33L 1PYWA 5EZOH 1DSFL 3EOAA 1F5WA 3F65A 4TYUA 5BXFA 2C9AA 3BOVA 3B9AA 4JZOB 3WFDH 5GGQL 1F3RB 1R3HB 5GJTH 3ARTA 2NY4B 2XWJB 1WLHA 2YA0A 2UWEF 1MREL 4N0UB 4KUCD 1TZHA 4OSUH 1DCLA 1C12A 4L4TB 5F9WC 1SBSL 2VOTA 4HF5H 4D0BB 1MJJB 5B8CA 3OKNA 3BPNB 4MAUH 4PJ5A 4NP4L 5IVXE 1RHFA 3KYOA 2XWBB 5DJ2A 5K9QG 4BQ9A 1QNZH 1BM3H 2XPGB 5DQJB 5DQDL 3LRSB 3L1OL 5IG7B 3SE4C 1I3UA 2NX5A 3HZKB 4JJHA 2HFGH 5DMYA 2DB8A 2ITDA 4UBDC 4QHNB 3PWJB 4XP1H 2PCPA 4JANA 1S7VB 1NUGA 2AEIT 1OSZB 2F53B 1AFVH 4TSAL 4KMLB 3V4VH 2EYSA 1CBVL 4OM0L 5C0CB 4MNHB 4RNRA 1RUQL 3BZEB 5D6DC 4KV5F 1PBYA 2JE8A 5HI3D 3D9AL 3OZ9L 4EQ2A 2C1OB 3T8XA 4NO2A 5EO1A 5KVFH 1B3JA 1UQSA 2VQ1A 4PUBH 2BNQB 4S1QL 5I74B 5IBUB 5JQHC 1SJXA 3RWGA 1S5HA 1FZMB 1KFAH 4QXWA 5IQ9B 1SBBA 4XNZB 3T0BA 4PGJA 4XCCL 3SE9L 2PO6A 3T65B 1ZSDA 2LTQB 2GQHA 3QI9A 3QIUD 4HPOL 4CN4A 4YHZH 1GC1H 4QTHB 5F72S 4KKBC 2JJSC 3O2WL 1RFDL 4LASL 4R6UA 2CGRL 3JVGA 2FBJH 2XQYG 3SCMA 1I8MB 4MVBD 3TJEL 5KTEH 5ERWA 1ACYL 5JA8B 5EU7C 1SEQL 3G5VA 2VZ3A 4YR6B 4GUPB 4G9DB 3X11B 5EU3A 3D2UA 3ES6A 3BGFB 2X4RA 2V6HA 1DJSA 4EN3D 1KJ3L 5BS0E 5SWSD 4M3JA 1RUAH 2IAMA 5CJ8A 1FJ1B 2OTWB 5BZWB 3G5YA 3GJFB 4R90L 5EUOA 3AAZA 2X6MA 1BWMA 1AGEA 3MRCB 4IRSA 3FT2A 4I9WE 3SGJC 3RDTD 4P46A 4TVPD 3IU3A 2CLVB 1NAMB 4G5ZH 1ZA3B 5FECB 5K9KB 1A14H 5BZDB 5HHOD 4LLWA 4JN1L 5GJSL 2W59A 1JZ5A 3SE8L 3RI5F 5EBMB 3DRTB 2W0LA 1GH7A 3CFKA 5EUOF 1MH5A 32C2A 4EUPA 3T1WA 4PGDB 3BXNA 1T4KA 3MA9H 2Q86B 3BP7A 1VKXA 1CZ8H 2FJFB 1KB9J 4Y5YB 4Y19D 4N0CD 2H41A 3HNSH 5FHBH 3DMMA 3PDOA 3H3PH 1J7VR 1XMWA 1NH6A 2VDRH 3HC4H 1KN2H 4WTZA 3SDCD 3EJJX 1AKJB 1J05B 2JB5L 1QBMH 4HUNB 4LKCB 3BP5A 4X6DB 5GGTH 4NJAH 4QOKA 1LE9B 2F8OA 2Z92A 5K59F 4ODUB 4PJ7B 4UAOC 1BJMA 1O0VA 4XI5C 5DUMH 3D0LA 3LRGA 2IH3A 1G6RL 3HN3A 4AEFA 3TIEB 4MWFA 3TN0A 4L4VB 2V17L 5IV2A 3D3VE 3I50H 4TNWF 3CAFA 1N2RA 4FZ8H 1IAKA 4M4PA 1CWVA 3RWFB 3QSKB 3TWCL 4HEPG 3LZFH 1MCPL 4GRWF 1NCDL 5BVPL 4ZPTB 2DTMH 3VXUA 1KPRB 4UV7L 4HUKB 1XF2A 4KH2A 4FP8H 3GHEL 4KKCC 2EC9U 3AB0B 3P30H 5IB1B 4EJ1C 1L7TH 2D9QB 2EE9A 1T0PB 4OZ4A 1BX2B 1YMMB 3G6JB 4M1CC 1EEYB 5DD0H 2ARJQ 2VIRB 1JNLH 5FK9A 3WE6B 4BSVA 5SWZD 3NIFE 1S7UA 3QZWG 5BQ7A 4F57H 3QXTA 1U8QA 3AUVA 3QHZH 3H9SA 5J0BA 2YUVA 4O9HH 4OD2B 2E7LC 3O9WB 4OB5H 3JWDL 1VFBA 2AABH 1ZT7A 1NC2A 3LEVL 4XP9L 1UC6A 4RZCB 1P6FA 3WHXA 3VH8G 2FO1A 2BERA 3SKUD 2FHFA 2VLRB 4WI4A 3BDBA 1MOEA 4PJIB 4JRYE 2GTZB 4POZC 4HJ0C 1XGUA 4WO4C 2GI7A 2VZUA 3L7FA 1ZS8B 1I7RB 2H32H 1IKNA 1JWUA 3RIAK 4CU6A 4OCRL 3ALXA 4KJYB 3QWRA 2OCFD 3FB5B 4YHKL 3G5XA 2J5LC 2R0KH 5A43C 4LL9A 1NUDA 3FONB 4KK9C 2IF7A 5JNYA 4J3OC 1EEQA 2NY4D 5I1CH 2M2DA 1Y18B 2ZSVA 2WBJA 1IFHH 4P5TB 4ZFOL 1KNOA 1FZJA 2XZCL 3HNTH 4OKVB 1NFDE 1IE5A 4I0PC 1D9KC 4RDQG 1WWBX 3P9LB 3WCYA 3GSWA 1GC1C 2R1WA 3KPPB 4WUUE 4KAQL 1YEEL 5E6IA 2NY6C 3V0VB 3BE1L 1OCWL 4ZOBA 4YQXL 2AVGA 4FFVD 3L3JB 1T5XA 2QLVB 2AK4B 4QXGH 3B9KD 4JHAH 3HMXA 1XGPA 5D1ZB 1BLNA 4EI6B 3PP4H 4P9HH 4G8IA 4KTEL 1MAKA 1NGPL 3B9EA 5GXBB 5C0GA 2DLFH 4R96A 1F4YL 2X4TA 1JE6A 1AGBB 3MGTB 4HCRA 2PR4L 5CUSH 5EFIB 2KZWA 2ZG1A 4O00A 3TA3B 3MRRB 1G0DA 1PQZB 1CD1B 2NW2A 1XFPA 3OXSB 5F7WC 5LGKA 1AXSA 5FYJL 3QFDA 1T22B 4IOFC 1B88A 5IQ7L 3K7UA 4FQJH 3DTXB 1LO5B 5C0CD 1YY8A 4V1DD 1RZ7H 1NBQA 1KGCD 1D5XA 2CDGB 4FFZL 3BMWA 5DMGD 1A9BB 2WWKT 5J11C 3IXTA 2DQCL 5C9JB 2IGFL 2VAAA 1EDQA 1CU4H 4JQVA 4JRXE 3HRPA 2VLJE 5DJCB 1I7UA 4NT6B 3HG1E 2VDNH 3R4DA 2ADFH 5IBTH 3MNVA 4LSTL 1FN4A 4E42A 3VRJB 1S9KC 3FFCB 1HZHH 4N5EC 2XQBH 4U1LA 1J5OL 4NKIH 2GY5A 5GISL 2HYMA 1LK2B 2DYPD 1TJHL 4KRLB 4U49A 3SPVA 3QRGL 2HAZA 3HZMA 2BK8A 2F15A 4WFHE 3UTTB 2VQUA 2ESVE 5IOPA 2R8SL 3RUGA 5D1XA 3EO1B 1A6TA 1CR9L 3UROR 3ARWA 3FB8A 5E2WL 1I4FB 4GW4A 3EGSB 3HI5L 5DHYA 1E4KA 3OJDA 4ZNEA 1G0XA 2ZCHL 1JGUH 4MSWA 3MLRH 4LDOB 3DYMA 1L7IH 4CVZA 1A7RH 4UUJB 1J0YA 4JM2C 3UBXA 5I19L 4QHUA 3WFCH 2D7TL 3RUGF 1QQDB 4XWOD 1VGKB 5IMOA 5CFHA 2F54D 5TDNA 4OD3H 3SJVA 2BY0A 5I15L 1OGAB 5H8DA 1FCCA 1WAAF 5IB4B 4YZFE 1U8IA 5DLMH 4AMKH 4H88L 5FYKL 1J1OH 4RMTA 4U7KA 1QA9A 3PQYE 1C16B 5JIKA 4WHCA 5DRNB 4MQXD 2G75A 3OPZH 2IPKA 3T0EE 5ILTH 5JA9A 2AQ1A 2QQNH 1U8MA 4JPIB 4NNXB 4BJLA 3L7EB 1AKJD 2XWTB 4IDLA 2AK1H 4LCWA 3AS3A 4GS7B 4M93C 4EQ3A 4U6TA 1GPOH 3IDGA 3ARFA 3MRKA 4PV8A 3AXLB 4ONHB 4JDVB 5AZ2L 2VXUH 3IDJA 4XB7A 2C3GA 2V7HB 1FSKB 3QUML 5F8QC 4OFYA 5E8OA 3WSQH 4UQ3A 2GT9A 3S37X 3TVMA 5LXGL 4XHQA 4F15B 1EPFA 3MUGA 1JZ3A 4U7SA 4CUCA 2QADD 1C7SA 1LGVA 3BKYH 5IVZA 1KCRH 3GJEA 4TTDC 5K9OB 2M26A 1NC4B 4Z7VA 3GIZL 5HHQA 3C8KA 2D31B 5B4MD 1BJ8A 4BH7A 1X4YA 3GI8H 4GMTH 4TOYL 1FC2D 4LLUA 1I9JH 5E8EA 1T7VA 5IBLD 1KT2B 5KOMC 1MEXL 5JW4M 1UYWH 4B5EA 5I1AB 5F9WB 3LN9A 1ZVHA 3EZJB 1N59B 1TCMA 4D3CH 4KJQC 4OCSH 1CN4A 4NC1E 4Z7VF 4P9HC 5E9DA 1D6EA 3S97C 4MD4A 4P99A 4ZFZB 3NPZB 3QDJD 3RY4A 3VJ6A 4QNPF 1RUPL 3AROA 4M9PA 3B9DA 3VE0B 5J13C 4K23L 5FV2A 3PWPA 2Y25A 1R24B 1GAFL 5DK0B 1AHWB 5CP7B 1X6NA 1EGJH 4OQ1A 2EYTA 2X70B 1GOFA 3F58H 4M61B 3H7BA 3GRWH 5SWQA 3EO0B 4FQXA 1YC7A 2VLKB 4X7TA 1DLFL 4FFYL 5KS9B 1CFSA 3RVVD 3DUHA 4YFEA 1KPUB 3KPQB 4WEUD 1NGXB 4YDJA 5EZIH 2ERJC 1EFXB 3HUJE 5IK3B 3D87B 5CWSB 1P4LA 3X14A 3MJ7B 4KI5E 4G80B 4WI2A 3FHAA 5EOTB 4DUWA 3W5MA 3VXRE 3GGWB 5FDYA 1KIUA 4M7LH 3MYZA 3O11A 3KPMA 5EO9B 4XAKE 5TF1L 2CJUH 5DD5H 3B2VL 5ITFA 1YUHB 1KYOJ 4KRPB 4MXWL 3MRIB 3EFFA 4M5ZL 4JFEA 1D5MB 3T3PF 5JZ7D 4LPTA 1LO3H 5J57B 1UM5H 4L9LC 1QRNE 4NQSA 5JLZA 4JFFE 3RL2B 3Q6GL 3VXME 1IGYA 1OP9A 4HDIB 1NCAH 3BWAA 5C09D 1A1MA 4WI8A 2W0FA 3IETB 3QH3A 5D6CA 1U0QA 1DP0A 3O6ML 1SY6L 3C5SB 2VR5A 2DM7A 4NQEA 3S98A 4O58L 5CBAB 3ISWA 4M6AA 2YMXL 2OZ4A 1B4RA 4UDUA 5T3XL 4RGNC 4NN7C 5D1QC 3VWJA 2RGSA 1J18A 4S1RL 1MWAL 3VXPA 4X4XB 3Q0HA 4MCZB 1RVFL 4P23B 3N1FC 1OTSD 1T7XA 1JZ4A 4E0RA 4XPFL 4LEXL 5HYJE 3U0PA 3FO0L 5E00B 1OAXH 3Q1SL 2VN7A 3QG7H 1QSED 3DARA 4IIQB 4H26A 4IEFB 5DHVA 2BDNL 1DFBL 4MX7A 5EU7E 2HKHL 2J88L 5CSZB 3C08H 4TUOA 3SQOL 3WYRA 1G9NC 2VNCA 5GGSB 5KJRL 4FXGB 2P1YA 5FFLA 4W6XB 4XCNB 4PGCA 2A6KB 4JY4A 3GSVB 3OKLA 1FL6A 2E5EA 1I8LC 5C2BH 5I8OL 1QLRA 4KY1H 2VRAA 3UTTD 4AQ1B 3GMQA 3BGMA 5D7LD 4XVSL 4XPBL 3F7YA 3EJZC 5DRWA 2XG4A 3NPSB 3KJ4C 3HNVL 2FX7L 4UAOB 3VFRB 4LRIC 4JZJC 2HT3D 4NM8L 1A1NA 1JYNA 2V7NA 3EYSL 2E3VA 3EOBA 3V4UL 2Q6WB 2FZ3A 5DUPL 4PREA 3PABB 5INCA 1AIFA 5T1LD 5FO8A 1Z9SA 2GFBA 2PW2A 3H9ZA 5LBSL 1P53A 4XWGH 1Y0LA 5JQ6L 2G60L 3GMNA 1DVFA 5MEPA 4S2SB 4APQC 1OSPH 3FN0H 5JW4N 3LS5L 1U8PB 4GG8B 1DBBL 4KTDH 2FYYA 4YGAB 3TGXA 3W39A 2I9TB 4UILL 4P5KA 4J23A 4OLVL 5DZNA 4EDWL 3L95A 1QSFE 5KSBE 1KEMH 5C08A 1RIHH 1HHHB 3ILQC 4JLRA 1KLUA 4MD0B 2XRAL 4I13B 4LKXA 2R23A 2DBJA 4P3CL 3NOIA 2IFGA 1GGCH 4RWHA 4CVXA 5HHME 4JFOA 2F19H 5D8JH 4M43H 4Y16C 1A02N 2ICWJ 3QIBA 2BRRH 3P77A 5KVDL 4JKPH 2JB6A 3MV8E 3VD9A 2WQ8A 3QHFH 4QRRE 2NY5H 2FD6H 2QSCL 3WNKA 1N64L 3GSNH 1MVUB 4X9FA 2V9RA 3LS4H 5BJTB 3LKNA 1HEZA 5ABDE 1J11A 2E9JA 5FUCC 8FABA 1GHFH 3RX5A 4UZGA 2EIZA 1G9ML 4NKMA 3VFPA 3MQIA 3TO2A 5F96H 2VXQH 5J06A 1K2DB 4NQCB 3PL6D 1P9MA 1S8DA 4NZRH 4ELKA 2Y9RT 1AQKL 3MV7E 4JAMB 4WU5B 3I2CL 2UYLB 4JPWL 4F7CA 2X4OA 4ZSOA 4DEPC 5KSAC 4X8JB 4BKLB 3RIAF 1T2JA 4OIAA 1A6VH 5F7KC 3VFGH 2AJUL 1S9XA 1UFUA 3WNNA 3C6LA 5AYUH 3IDUA 4I0PB 5LGJA 2GITA 2F58L 1JGEB 4ZMAT 3HZVA 1NGYB 4KHXH 5BW7C 3VG0L 4UB0H 2NY6B 2OS7A 4ODHL 4LGRB 2XKSA 1T89C 3Q6FB 4YPGA 4D8PB 1RIUH 4G8GD 5DVMA 4ZFFB 4XB8A 4XXCC 3LKPB 3DUUA 2Q8BL 4RGOH 3RGVC 2CLRB 1VERA 5EU4A 3FJTA 2J2ZA 4JPKL 4BSWB 1R3KA 5MHSD 5CGYC 5F6IB 1M6OA 1JFQL 3QDHA 3UZVB 2FATH 5HDOA 2F8XC 4QYOB 2COQA 3MTRA 4DQOH 3BEWA 2DQTH 4FA8A 4KJPC 2GJZB 3QWQB 4HIHA 3BP6A 1JPST 2F9BT 1JHKH 2H6PB 1CE1H 5TJWK 5J11B 4HUWA 3B3IA 3CXHJ 5HGHB 5E8PA 4EI5C 2B39A 5I1KH 5DGQA 4LIQL 1Z9OA 4NSKA 2DQFB 4UTBL 1MAMH 1JBJA 3JZ7A 2CR3A 4JFQA 4KRPD 4ESKA 1T1ZA 4WEBL 1KG0B 4LGPB 1MRDL 1GGIH 2NLJB 1NMBL 3B5HA 4PRHD 1WT5C 4Q58C 5JIHA 2DF3A 2AJ3B 4DTGH 2N7BA 2NNAA 3P4OB 1AR2A 5KW9L 1ZAGA 2AXJA 3I02A 4GRLC 2AAVA 4FABH 4LK4A 1GIGH 2X4QA 1UZ8A 3BO8A 3GBML 2BMKA 1JNHB 5EBGA 4HBQA 1PEZA 3GZKA 3IFLH 4WV1A 1XIWC 3VD5A 4PJ8C 2ATKB 3NTCH 1BAFL 4J8RB 3GSQA 3NCJH 1PDKA 1T21A 1DE4B 1LEKA 3KYAA 4YDLB 4L8CA 2IPTL 1AD9B 1U3HC 5IEKA 3VDAA 1GZQA 4XHJC 5A2KH 2DQGH 5HGBB 4JZNA 4NHUB 3O0RL 3QUXD 2IC2A 4TUKL 4BFIA 4OI9A 2BOCA 3QPQC 1MFDH 3CMOL 3OR6B 5DR5L 5F1IA 3CFCH 4OT1L 1FFPB 5FM5M 1PZUB 4P23D 3L3GB 4JFHD 4TSBH 4BA8A 3UJTL 1ODAA 3T4AB 3HPJB 5I1IH 5ESVA 2NW3B 4DOHE 1IC1A 2KBGA 1NMAL 3WLBB 4JFPB 1W0WB 1CXKA 2OJZL 1EAPB 1PG7W 5D7IA 4F37F 1FNGB 2BP3A 3ZKND 4NC0B 5J6HB 4LNRA 2HJFA 4CN1A 1FGVH 5GHWL 4XC1H 1QR4A 3C8DA 2Y4SA 3QJHB 1FFOA 1LD9A 5JOPD 2B2XH 4LMQE 3QDMB 4EN3A 5SWSA 5FB8A 1UENA 5GS1A 2NY5C 4M93B 1N5YL 4A6YH 3AS0A 1JP5A 1YYLH 4H0IA 4LU5L 1HXYB 3QHTC 1BQHA 1RZFL 4P4KD 4GXVL 4LHUD 1X6LA 5D7IF 3RDTA 5INDB 3PNWB 1EUTA 1RHHB 3ZDYF 3BD5A 3RVXC 3G5ZB 3IJHB 4YXHH 4Y4HD 1V7NH 3WIHL 2DJSA 3T2QA 2H32B 4Z7WA 4K7PH 4FTVA 4M9OA 2D7MA 1RV6X 1GOGA 4GG6A 3GUTB 2ED8A 1S5IL 4BZ1H 1MI5B 4K55A 1AGFB 2W0KA 4XNXH 1I1FB 1AJ7L 3ETBF 4NQDE 4HKXB 4BFEA 3MBXH 5T33H 1OP5H 5MP6L 1DSFH 4FZEL 1L6ZA 2VZTA 3FHQA 4RGMC 1YQVH 4CW1B 2WIIB 4G9FB 3ZYZA 3HC3H 4Z7WF 1CLYL 2I26N 2WANA 3Q48A 4OZHE 1MCQA 1MREH 1MJ7L 3IAGC 4GG6F 1WIOA 1Q72H 5C0AA 4YLQT 2WQRA 1RK0B 1M4KA 4F9PC 1I7TA 5JORB 4NP4H 3ZZ1A 2MHAB 3FB7A 3PGDA 3U9UB 1MFCH 5I76A 4HWBA 3DX8B 1OHQA 1EJ6A 1OP3K 2WUBH 2V9QA 2P5EE 4KPHL 3QDGE 1MJ8L 2Z4QB 3P0YL 4EOWL 2ZOLA 3ZKMD 1NCBH 5C8JA 5J13B 4DZ8A 2P8MA 1XGRB 2BSED 2VDOH 3S4SG 5GS2D 1ZVSA 3EKCA 4DN3H 5A2LH 5K33A 3R0NA 3T4YA 4AIZB 4RWYL 1JRHI 4YEEA 4QXUL 5IB3B 2NTFA 3MFFB 2DWDA 4OGYL 1OPGL 4O2CA 3P4NA 3S3PA 4E41D 1EBPA 4U6YB 5C92A 1AXTL 3QUZC 5FV1L 4X5LA 4M1DL 4R0LB 1FO0L 2HTLD 3U9PL 3HPLA 5A16B 1JMXA 1KUMA 2AJXL 3LV3A 1GZPA 2HRLA 3QXAB 3UTQA 4LBEB 1VEMA 2WBWB 1A6AA 2LVEA 3F12A 5TFSL 5BV7L 1XF3B 1OAZL 4FQIL 5FYKE 1CK0H 4WTXA 5BOZG 5C86A 2IJ0C 3RIFF 1A64A 4PJEE 3BZFB 4UTAH 1N3NA 5ICZB 4K94L 35C8H 1PGRB 3MX0A 5CKGA 2YC1B 4HKJA 2BXZA 3P73A 3CLEL 3RVTD 3EJYD 4HX1B 4L8DA 1JRHL 4HS6B 4R4NC 4HZAA 2PXYD 4LVEA 1YEJH 3O2WH 5HDBF 3SBWC 2J8UE 4LASH 3W0WB 5F7YC 2UZYB 5MERB 2CGRH 5HD8D 1A47A 3GSUA 4NGHL 5T3ZH 3IFNL 5C07E 3FRPG 1J1PL 5FKPA 1A3QA 1U8LB 3D18B 5MI0C 5DVNA 2NR6C 3K4AA 2NMSA 4L3CB 3LH2H 1I1AB 2P8LA 5MENE 2FX8H 1U3ZA 4G7VL 4U1IA 1XF4A 2BSTB 1IGCH 2LABA 2VR9A 4AM0B 3VG9B 1A3LL 4JZOA 5D1QB 1R3HA 2HMID 1WF5A 5FO7B 2R69H 4HZLB 1LQSR 3D48R 4ODTL 2VDKH 4L4TA 3OJVC 2DQJL 4D0BA 1MJJA 1MCOH 4R2GC 2HH0L 4P57B 4F33B 3S9DB 1PKQE 3OB0K 3A6BL 3ARZA 2K1MA 4JN1H 3ULVD 5GJSH 2XWBA 4U7MA 4Y2DD 2XPGA 5DQJA 3GKWL 3LRSA 4WGWB 3B9KA 4HS3B 2VH5L 4O5LL 3NACL 4ZOCA 3LEYL 4ZUSA 1LK3H 3RWCB 3VGHA 3IS1X 3K74B 2J6EA 5EPMB 1R5WB 3HI6L 3PWJA 4NNYB 4ZAKD 1N8ZB 3NH7L 1S7VA 2APBA 3BUTA 3KGRA 1M05B 3K81A 4AH2B 2DQDH 2NTSP 4GAFB 3K0WA 4XMPL 1OSZA 2ICCA 5CEYB 4GRWH 2V2XA 5C0CA 5BS0B 1J0IA 4PRIB 4V1DA 3OMZA 2C1OA 3VRIB 3G6DH 5CGMA 1KCKA 4U1NB 2BNQA 3MRHB 3IS0X 5JW5A 4OLWL 4G7YL 1FZMA 1SMAA 3VDBA 3ARQA 1KC5H 2AEPL 3BT2L 4GJTB 5IQ9A 1SHMA 4DFIA 1EV2E 2YEZB 1NBVH 4LCIL 2CIKA 1S7RB 5JDJA 3MOBL 2NY0C 2ICEA 5DMIL 3TWCH 2K3TA 2WUCL 3ZHLA 4NZDA 1MCPH 3LD8C 1NCDH 1T2XA 1CICD 1MCRA 4QTHA 1P7HL 4MNGE 2ARJB 1HQRB 3L5WB 4Q9BA 4BM7A 2W9DL 4UV7H 2P5WE 5B8CC 2DYPA 3GHEH 5FGCB 5DHXB 5J1TC 4W4OA 5CJ5A 3KPRD 3RNKB 3V6BR 4G9DA 3X11A 2XZZA 4Y16B 2DL2A 2FDBP 1UKQA 1U9KA 5D5MA 2GAZB 1FJ1A 2OTWA 4OD1L 4JY5H 5HI4D 3T0AA 1F90L 1TVBB 3GJFA 2YPVH 4MA7L 4TSCH 4WU7B 5I1LB 2E9WA 3MRCA 3ALPA 4MJ6B 2BX5A 3WD5H 4TRPH 4KZEH 2EXYD 4LVOB 4HEME 1FNSL 5CEZD 5C3TA 2JELL 1NAMA 3MV11 4TVSa 4XP9H 1T1WB 1ZA3A 5JXED 5BZDA 5K9KA 1A9EB 5IGXH 4XP5H 3LOWA 2I25N 5D5MF 5T3XE 3MO1B 4WHYG 5EBMA 3DRTA 4M8QA 3SO5A 4M7ZC 3E3QE 4Y1AD 1Q38A 4K8RD 3MUHL 1I85A 4PGDA 2Q86A 1QYGH 2FJFA 4NRZB 4Y5YA 4DEPB 4KMTL 5KSAB 2X4PB 4L1HA 3HE7D 3O45A 4PG2A 2EEDA 5IFAL 3MLSL 4OAWA 3QYCA 4AEHL 2I60L 5GS0H 3FFDB 4KKLC 2CIIB 3ARPA 3PIQB 1MLBB 4ZQKA 2PO6C 1XGQA 1KXTB 4PRPE 3QI9C 1OT2A 3G6AA 1AKJA 1J05A 2XZCH 4JFXB 4J12A 4X6DA 2ZUWA 3JVGC 3SCMC 3LQAC 5IIEB 4PJ7A 1ZVYA 3BE1H 3RA7L 4LRNH 3TNMB 1BGXL 3HMXH 2PYFB 3S6CA 1YDPB 5TGBA 3RZCB 3KLHC 4RFEB 3TIEA 2OMBA 2KUTA 4RCAA 1EEUA 2IAMC 2P44B 5TH2B 2EYRB 4PTTA 3QISA 4IRSC 3QO0B 1TJGL 4X6DF 1A1OA 2CSPA 5LWYH 4P46C 3RBGA 4ZPTA 3DROB 3VXTB 2MQCA 4PJ7F 4Q2ZB 3DVNA 5FYJH 5J56B 5DRXB 1GVIA 4JO3L 5IQ7H 3LDBC 4DKEH 5I6XC 2HVJB 3DRQB 5IB1A 1KACB 3IKKA 2C4XA 3RPKA 5BCAA 1BX2A 4BZYA 1YMMA 5DD1L 3OJ2C 3DI2B 1ZGLB 3WE6A 4PJHF 4Q9QH 3L6FA 1NEZG 2CK0H 1QRKA 3F7PC 3DMMC 2WLYA 2M8XA 3HFML 3CK0H 3BYTA 3ZO0A 4WUUB 2V5YA 3QDJA 2EC8A 4OD2A 4WI5A 1K4CB 1MCFA 3O9WA 3HTLX 5I0DA 4QRSB 3VGBA 3NCCB 1T0NB 1X7QA 2VITA 1OW0A 4RZCA 2YRPA 1RURL 4AEEA 2VLRA 3BHBA 2WIMA 4OZFG 1IQWL 5JXAL 5TE4L 1RZ8B 1UZ6F 1ZS8A 1I7RA 4PJ8B 2R8SH 4WI7A 1I1AD 3VXSE 1EBAA 3ARDD 4ONFH 4KK5D 4XP6H 2B0SH 4KJYA 1U8NB 1F4AA 3FB5A 1FNLA 1CR9H 3G04B 4XPAL 3NABH 3FONA 4UT7H 5D2LA 3HI5H 1LEIB 2DDQH 3ESUF 4GSDL 1NKRA 5DMKA 1FAIH 1KELL 3TBVB 3B5GA 2EKJA 4P5TA 1SYSB 1Q0XL 3TLRA 5IHUL 4OKVA 2PN5A 3LKOA 4HULB 3O6LH 4HXAH 2ORBL 4XCEB 3P9LA 2D7TH 3M45A 3R1GL 3FQTB 2VLJB 3U1SH 1V7ML 1QG3A 1ZHKB 3L3JA 3D1MC 5I15H 1XR8B 3CUPB 4HCRL 3HCVB 5D2LF 5D1ZA 5J3HC 4EI6A 1LP9E 1DBAL 1JUFB 1WEJH 4H88H 5FYKH 1QOKA 1WWWX 4UQ2B 1XR9B 1BD2E 2EO1A 1KJMB 2A9NH 5IFJB 1AGBA 5LAXB 4FG6C 3MGTA 5C09A 1IQDB 1G7HB 3GIVB 5DXWA 1HHGB 3O6FD 5B39G 3MRLB 3TA3A 3MRRA 1IKFH 5EG6C 1CD1A 1L0YA 2RCSL 5GGRY 3QB7C 1EERB 3CFDB 4KKAD 4IBLT 3OKDA 4B50A 3ZDXE 4JO4H 2HLAB 3DTXA 4Q6IB 3DHJA 1LO5A 3GSNB 4NZTL 5BS0D 1IGJB 2IMNA 2UZXB 3RGHA 1T7WA 2CDGA 5SX5H 2FJGB 4PB9H 3P9MB 3DOSA 1A9BA 4Y88A 3IF1B 5E5MB 2RFXB 4LSPL 4I9WD 2EDXA 5A2IH 4OZGB 1IKNC 4XT1C 3BW9B 5E2VL 4S11A 4WENB 1R3LB 1AD0B 1VFAB 5DJCA 3UPRB 2PTTB 1B2WH 4NT6A 2XTJC 1QSEA 2EDWA 2FIKB 4NO0D 1OTTD 3WUWA 4P0DA 1UJTA 4LP5A 1E6OH 1ZLVK 4HIXH 2R4RH 3LQZB 4FQLL 3VRJA 2WBJC 3GIZH 5GS0C 2ITCB 3FFCA 4LIQE 4IMKA 5DJ8B 1S7QA 5DJDB 1LK2A 2C3VA 3JWOL 2BNRB 3C5ZD 5KZCB 3PQYB 1HILB 3UTTA 1AY1H 1MEXH 1IGML 4P59H 4DUVA 5M94B 4F2MB 3V0WH 2Y36L 3S96A 2Z9TA 3ZT7A 2DLIA 3CU1A 3EO1A 1QO3B 2MFNA 1I4FA 1HYSC 3EGSA 3GMLB 2YPLE 5K93A 4HJJL 3VDCA 3MRQA 2FBOJ 1CGVA 1DBKH 3W11C 2ZOKB 3ET9F 1IBGL 2A2QT 2K7PA 1BP3B 1RUPH 3JV4B 3L5XH 5ESQB 3WBDA 5JPNB 5KVGL 1MFAH 1TVHA 3S5LB 3QUYD 1VENA 3BN9D 1VGKA 5GGVL 3D3VD 1CYGA 4J3SA 4RAVB 2BJML 3ALWA 5C0ND 1H15B 1OAUL 3QCVL 5A1AA 4FFYH 4OF0A 3RX8A 4JQVC 4OUOA 4YHOL 4M7KH 1U8OA 3N50A 4HV8B 3SQBA 3BESR 3O4LE 4OLUH 3QEHB 5KVEL 4MA3B 4JPIA 1CGWA 4NNXA 3NFPA 4RMUA 3L7EA 2XWTA 2NYYC 4EBQH 1DZBA 2X7LB 5IESH 5TF1H 3AXLA 4HG4J 4L29B 2XXCB 4JDVA 1V3JA 1DL7L 1TNMA 3NIGF 2V7HA 3MYJB 3V79C 4D9RE 1OLLA 1F2QA 1YNLL 4TPRH 3C09B 5EZLA 3GI9L 2QHLA 3QA3A 4PP1C 5D1XC 4X7FC 4DW2H 4HUVB 3T0XA 1LE5B 1QEWB 2CK2A 4OJFL 1ZK9A 1E4KC 3MV9B 3PL6A 5JW4R 1BJ1J 3KPOA 4MA1B 4NKOB 1AQDA 2ICWB 4IOIB 5F7EL 3VFUB 3DHMA 4JRYD 3O6MH 1SY6H 2OZ4H 2G5BB 1QPXA 1LDPL 3KHQA 3SDDB 2H3NB 4OLXL 2GIYA 4WVRA 5T5NG 2E27L 2YS4A 3BD3A 3WO4B 1IT9H 4Z7OF 5CEXB 1NSNL 2V5MA 1YEKL 2Y5EA 3N1GC 1LO4L 5I1AA 5C0BB 4R2GB 3HUJB 1RVFH 1X5GA 1N59A 4BZ2H 1T7ZA 4PJDA 5DHVH 5C6TL 3CDGB 4NYLB 3F7RA 3VXRB 2YK1L 3V6ZA 5HYFA 3GM8A 4WUUD 3QFJE 3O3DB 3SQOH 1MCWW 2OJEA 5I1GL 2DIBA 3ZTNH 3OHXA 5B38G 1BFVL 2X41A 3VE0A 3CDFA 3FZUC 4FQCL 3WDHA 2XN9E 5DK0A 1RUKL 1AHWA 5CP7A 3DVIA 4A6YB 2X70A 4GAGL 3ARFC 1ES0A 4OM1L 2R2BB 4NUJB 4M61A 4ETQA 4PJDF 1S7XB 3IJYB 4N1HB 4FQHB 1FDLL 3EO0A 3OQ3B 5F1SA 2VLKA 5KS9A 3QO1B 4LAJH 2W0PA 4MXVE 5D6DA 1NBYB 3TVMC 1FL3A 2UWEB 4JR9L 4UIKL 1NGXA 2FX7H 5H35A 3ARUA 2LAGB 3EYSH 3QNYB 5IK3A 4YX2L 2D4FA 4F7EB 3AS1A 3MJ7A 4G6FB 4IS6B 1F2XK 2GUOA 4G80A 4M6ML 5EOTA 1PYWB 5I71C 3EOAB 3KJ6H 5EO9A 4OF5A 4JRXD 1JF1A 1DBMH 2LAAA 2VLJD 1IEHA 3MRIA 5HYJB 3FQWA 1J8HE 1D5MA 4MDIA 3HG1D 4K3DH 3LS5H 1DBBH 4JCMA 4Z95H 1MQ8A 1C12B 4UILH 4WFEE 4OLVH 5B8CB 1WFOA 5IJKA 3OKNB 4EDWH 1UWEH 4PJ5B 3RL2A 2BVQB 4KK6D 4L4JA 3TZVD 1CDHA 3KYOB 1MCJA 5DJ2B 4XPHH 4AG4H 4YDVB 2R9HD 2DQHH 1C08B 3ARBD 4P3CH 1WIPA 1ADQL 4LSRH 2NX5B 3IETA 4HH8A 4X4ME 1XT5A 4WFHD 4ERSH 1H3UA 2ESVD 2ITDB 2NZ9C 5CS7A 2EIDA 5CBAA 4OGXL 2P45B 2B4CH 3O8XB 3BP4A 3QUXA 3MACH 3C60D 4X4XA 1CI5A 1CDIA 3C5JB 2EYSB 3D5OF 4FQXC 3DETC 4HLZG 3TYGH 4P23A 3RVUC 4JFDE 5E00A 1CT8A 4IIQA 3F7VB 4UNVA 4M7ZB 1G9MH 1IM9D 5L9DH 5CSZA 3T0VA 3VFWA 1LO0L 3KYMB 5JDSB 1S5HB 4RQQA 4NQVB 3C8HA 1AH1A 3CDYA 5BRZE 3I2CH 4FXGA 4NNPL 4XCNA 4KU1A 1VPOH 3A6CH 1BVLB 1BJ1H 3GSVA 5I9QC 1QSFB 3UP1A 5DSCA 2PO6B 3ARRA 2AJUH 3P4MA 3PQYD 4LAQH 3VFTA 5IR1B 1VDGA 2FEDD 3GDBA 3T0ED 4HWNA 4WWKD 1Q8MA 1EO7A 4N0YL 3SCMB 5JR1H 4ODHH 3SN6N 4P4KA 2NY2D 5DYOB 1JPSL 5L2KB 1JNNL 2A74B 1HDMB 4YHML 2QSVA 3D2UB 4XAWL 2FH8A 5FYLL 3VD7A 4XBGB 4QRRB 5GRUH 4Y4HA 4HAFA 2D7NA 2OL3L 4LHUG 3I6GB 2YSSA 1EZVX 3QEGL 5D96C 5JMRA 4JPKH 2D7PA 4H1LA 5DDHB 2EO9A 5EUOB 3AAZB 5C71A 1AGEB 4Y8AA 4IRSB 3VI3F 4S2SA 1RIVL 4AYFA 4X4YA 4LHJB 1BQLL 3GSRB 2DL9A 4GG8A 4IRJB 2I9TA 3BMVA 4HS8L 3WLWD 4P2CG 1QBLH 3TP4A 4YXKH 5E1AA 4PJ9D 1HHHA 3I6LE 4MD0A 3TBWA 1FZOB 2ZPKL 2AS5M 4KROB 2Y6SC 2Q8AH 2LQRA 1N7MH 1A4KA 4G3YH 4F8TA 3BXNB 1I7ZB 3DUSB 4UTBH 1K3IA 3E0GA 5AD0A 3BN3B 1ZOXA 1IC7H 3QULB 2A9ML 3K4DA 1EVUA 2JCCB 2DI8A 4AENA 1XEDA 4KVCH 5I1HL 1NMBH 2VXSH 4UT6L 5EULV 1W72L 1HWGB 1B6DA 4K3EL 4D2NA 4PTUB 3BP5B 1P69B 3EAKA 1MUJA 1OTUD 4GRWB 4QOKB 3WJJA 1URLA 4C55A 5DTFB 3GBMH 2DLTA 3B2UD 2UVFA 1TXKA 2NY3D 3MV9D 4E41A 5C7XH 4JAMA 2OR9L 1IM3B 4YHLH 5JHDE 1F97A 3SDDD 5FM8A 1N2RB 1PD6A 3V5HB 4N0RA 1IAKB 4WY7H 4BKLA 1DVFC 5GZOC 3X17A 2IQAB 3PWLB 4S1DD 3O0RH 2BVYA 2AKRB 1HE7A 3RTQB 4TUKH 4I0PA 1JGEA 4OT1H 2DAVA 1P2CA 4RFNC 1NGYA 3FAWA 3UJTH 4KI5D 1VFMA 1NJ9A 3ZE0E 1U95A 4HH9B 1RUML 3VXRD 3Q6FA 4D8PA 4XAKD 1ZKAA 4ZFFA 3QZWB 1TVDA 3MBEC 2CLRA 1FQ9C 1J9CT 4BSWA 3QIBC 3ULUL 1II4E 5BQ7B 3NFSL 1RJYB 2Y23A 3HS0B 1QRND 5GHWH 4JFFD 5ALCH 3WDJA 5E94B 3VXMD 3W9DA 4QYOA 1U91A 3PWVB 4CAGA 1VFBB 2HFFB 1OF2A 2B4CC 1ZT7B 1NC2B 1JF5A 5J12B 3RP1A 3WHXB 3K8LA 4QHMA 4M6OH 2VDLL 3B8SA 4TVPH 4XMLL 2H6PA 2H9GB 3LPWA 5D7SH 5HGHA 3L7FB 4JO2H 2YA2A 3T3MF 4PJFE 3X13B 1X5FA 1P9MC 4AEIH 4G6FD 1IAMA 4K3JL 3EDEA 2DQFA 2BY2A 2XTJB 1D5BB 1V05A 1T6VN 5JHLH 2CQVA 2DOCA 2X10A 1MPAL 2ZCLL 4M1GH 4DAGL 1KG0A 3WDIA 2P4AB 5HYJD 4DZBB 2ZSVB 3U0WH 4DOHB 3INUL 1CQKA 4XNQB 4QO1A 1IL1B 1KNOB 2FLBT 3GMRA 2AJ3A 1FZJB 3C6LC 1QFWM 3WL9B 1Z3GL 1CLCA 1EX0A 4ZFOB 4MJ4A 4YNYB 4UNUA 1F8TH 3MZTA 1JNHA 1CLYH 2O5ZL 4L8BB 1NGZA 1OQOA 1MJ7H 3ULVF 2ARWA 4BQ6A 3R06B 4I77H 3VI4F 1XGPB 4BYHA 2ATKA 1RQ5A 4IRZH 3BDYH 4UDTB 3TT1H 4F8QA 5ITBH 4HWBH 5SV3A 3QEUA 1DE4A 5DVLA 3MRPB 4Q0XH 3HR6A 4GT7A 4KK8C 1AD9A 4KXZI 1JZ6A 5JW3H 1KJ2L 4NHUA 1MLCB 1NCCL 3SY0B 4GO6B 4JVPA 2V5RA 1JGVH 1UJ3A 4KPHH 1MJ8H 3P0YH 3OR6A 3QFDB 4XPGH 4C83B 1FFPA 5ACLA 2X4UA 4PBXA 5E08H 3OKEA 5E8DL 3HPJA 2NW3A 1D5XB 4KZDH 5KSVB 1IGTB 4MHHG 1U8KA 4QXUH 3OKKB 4PP2A 1OPGH 5DURB 4Y4FB 1INDH 1C5DB 1EHLL 1Q94B 3LRHA 3MMEA 3NA4A 1AXTH 1NLBL 4PRNA 3EFDL 5J6HA 1FO0H 4FMFA 4LSDA 3IVKB 2CKBA 3P0VH 3U9PH 4NKDA 1QSFD 3OTTA 3QJHA 1GGYA 2A6JB 5DT1H 3MNVB 3QDMA 4YJZL 5BV7H 1F4XL 1IAII 3BKJL 3GSXA 3W5NA 4U1LB 4XI5D 1B9ZA 3NGBC 3DVGB 5HHMD 3SO3B 3UJJL 1HXYA 3ARVA 3GO1H 4K94H 3SPVB 2H26A 2KQMA 4GW5B 1TJIH 4P9ML 3MRDB 3PNWA 2Y5TB 3MV8D 1JRHH 2AJYH 1ZHLA 3G5ZA 3IJHA 4QRRD 5I1DB 4WV1C 1OAQL 5JXEA 2H32A 5IW1B 1J87A 3FB8B 1RMFL 1A7NL 3IFNH 1XGTB 3GUTA 2IADB 2QQKH 3SDAB 4WJ5B 1MI5A 1AGFA 1N26A 1MCIA 5L7XL 4Y1AA 1ZLWK 1FGNL 4X83A 1JGDB 2OYPA 4CVZB 5A3ID 4G7VH 2QHRL 4IRJD 1P6AB 2K7QA 1JPTL 3CC5A 4P4RB 3HE7A 4IDJH 1A3LH 4CW1A 3CFIC 1HHKA 2WIIA 4G9FA 2AJSH 5I1JH 4KROD 4YC2B 1NGWA 1FP5A 5KAQG 3CXDH 1T66D 5IM7B 1RK0A 1U8IB 2MQ3A 3BPOC 2HH0H 1MCBA 3RUGE 5L8JB 1QA9B 1NAKL 2IPUG 3DBXB 2MHAA 1ZANL 1UWXK 2V2WB 3U9UA 1HH6B 3DX8A 5FUZL 2ZJSH 4ZO9A 2VH5H 3LMJL 2APTA 1N4XL 4JG1H 2Z4QA 5SX4H 2XY1A 4EN3C 4ZFGL 4POZD 3LEYH 4WO4D 5ESAA 5GS1C 1XGRA 3STBA 3ARFB 3HI6H 3IDJB 2Y07L 4XP4L 4AIZA 3T0DA 3RDTC 5I75C 5IB3A 1WUNT 4QRPB 3SJVE 5J6GA 4U6YA 4MCYA 1PG7L 3QUMB 1M7IB 4R0LA 4LOUD 4P2YA 3ZKQD 5A16A 3QXAA 4BH8B 1MFEL 4DGYL 4ZO8A 4JKKA 3GJEB 3VU2A 3S88L 1JTPA 1MHEA 3E1F1 3WKMH 4Z7VB 3RTQD 2FLRT 4XX1E 5I71B 1E4XI 3BT2H 1WBXA 2OQJB 3UAJD 4N0CC 3RZWA 4BH7B 3BZFA 5ICZA 1KEGL 3VWKD 4LLUB 4U1KB 4XXDB 2YC1A 4JHZA 2AV7B 5DMIH 5IVXA 2BZDA 2WUCH 4JGMA 3C9NB 2Y06L 4HX1A 4HS6A 4GKZA 4X6BA 4ZTPL 1TETL 4WFFE 3EYUH 5AWNH 3W0WA 3ZTJH 5MERA 5EIQA 4AK1A 1UT9A 1LWRA 3PV6B 1U8LA 3D18A 5CZVL 5CZKA 4AQOA 3QDAA 4L3CA 1I1AA 3S34H 3RWDB 4PJXE 4XZUB 2FX9L 5IVXF 5J7CC 1E4XL 3QCUL 4OD1H 2BSTA 1F90H 2VWEC 3ESVF 3KS0J 3O81A 3PWPB 4MA7H 4AM0A 1BVZA 2OXGA 1U92A 1JCKA 2ENSA 3GNMH 5L6YH 4ZOAA 2A83B 4QNPE 1IGIL 1NAMH 5LKNA 4WHYH 3RPIA 3OG4B 1FNSH 4FQXB 2J4WH 1OY3B 1I9RL 1RD6A 1S3KL 4LARH 4P57A 1ZV5A 3UYOD 4F33A 1B4JH 3F8UB 4YDJB 3S3JA 4UU9A 2X1QA 5E9DE 1QFUH 4HS3A 1NUNB 5AEAA 4H0GA 3X14B 3R0MA 1ED3B 3RWCA 4RFOH 1R5WA 2A77L 2VXVL 5IFAH 5ITFB 2UV3A 2P5WB 4AEHH 1N8ZA 4FQ1H 5F44A 5I2IB 3LEXA 3O6FA 4JFEB 1M05A 3UC0H 3V4PH 4AH2A 2AI0H 2EE2A 5J8OA 5CEYA 1WCQA 5JUEH 1UH4A 4BQ8A 4ONGL 1JK8B 1CDBA 4NQSB 1AI1H 1H8SA 3J7HA 2VERN 5BS0A 4CMMA 2NXYB 4PRIA 3CSPA 4X7SL 4MZ2A 3BWAB 3I75A 5D70H 3T3PE 4JM2D 1BGXH 1FE8L 4WCYL 4ETYA 1GYAA 3MRHA 5IBUG 1ZLSL 1A5FL 1TZIB 3IYLW 5D6CB 3DV6A 3EYQD 3BQUD 4LNVA 4KUZH 4R97B 4PG9B 1CD0A 1ZEAL 1CD8A 4K9EH 2D03H 4R4FH 2WMPA 2XG5A 3V6FA 5F71A 3AMLA 2XI9A 1TJGH 5HHPB 2P42B 2LE9A 2NY4C 4XVTL 4K71C 1DQMH 3UPCA 4Y4FD 1HQRA 5T1DH 1F4WL 3L5WA 1MWAB 4NQDD 2BVOB 1EK3A 2R0ZL 3BPNC 3U0PB 3EO9L 4OFVA 4NUGL 4QRTA 3C5ZA 3RNKA 4TUOB 4NJ9H 4LSVL 4FFVC 2MPAH 1OOAA 4JRWA 3I3EA 2FGWH 4R9HA 5DD1H 3B9KC 5JOFB 4KHTL 1UH3A 2YKLL 3FQNA 3QPXL 5IJVA 5CCKL 2GAZA 4X7CC 1TVBA 4HK3J 4WU7A 3U4AA 3QRFM 5I1LA 4MJ6A 3HFMH 3M07A 2EDLA 4F7PB 3BGMB 5GRWA 5CLWA 1CLOL 1T1WA 5DRWB 2P5ED 3QDGD 1A9EA 3CVIL 2A38A 3OKOB 3NCYS 3GMOB 1IGFL 3QG6B 4H20L 5E56A 2X1PA 3D3VA 1RJLA 1FYTE 4G6KL 3MGAA 1F58L 3DYOA 2V7NB 3JUZA 5EU6E 5TE4H 4QWWC 5L8KB 1CFQA 5I74C 4YDKL 5LGHL 1FLRL 5L8LB 4L5FL 4NRZA 3RAJH 1Y0LB 2X4PA 3GMNB 4XNZC 2NY7L 2X1WL 2AEQL 3S35L 1P7QB 4GSDH 2CIIA 1LNUA 2LVCA 1MLBA 3PIQA 1A7OH 4Y5XB 5CJOL 3KS0H 2LTQC 4XBPA 3FO1A 3U7WL 4JFXA 1G7MA 3U2SB 1DQTA 4HGWB 3D39B 5C08B 1KLUB 4L3EB 3WFBL 5FYKD 1HNGA 2NY1B 1BVKA 1X5XA 4W4OC 2XQYK 3TCXA 3TNMA 1JI2A 5KSUB 1MIEH 1P7KB 1GGBL 1YDPA 1FZKB 4F3FA 3MBEB 1Z5LB 3PUCA 1YECH 3RZCA 3BGFC 1D5ZB 1PLGL 1Z9MA 3RKDD 4M62L 5TH2A 4H8WL 1XAUA 4KGLA 5EOQH 5JPMB 3CFJA 1VFUA 1TZGL 3HMWL 3VW3L 4X9HA 5C07D 5FYLE 2RCSH 1M7DB 3DROA 4JRYA 3VXTA 3UEZA 4Q2ZA 3NIFF 1A6UL 4Z0BL 2Z31B 4JG0H 3LKNB 5AUMB 5MEND 2L7JA 2HVJA 3O2VH 4XWOC 3VD4A 1FH5H 3TYFA 3VFPB 1FLTX 4QEGA 1AO7E 4RA0C 4ELKB 4RMVA 4HC1A 3ZKXB 4OQTL 4HUUA 1H3PL 3DX6B 4F7MB 1I85C 1R5IB 1YPZE 2X4OB 3AMKA 4LGSB 4I0CC 4Y5YC 1NFDA 1OARH 1ACZA 5HDLA 1RZKL 4PG2C 3ULSA 7FABL 4J6RL 1BFTA 1CL7L 4WUUA 4JDTL 1E4WH 4MQXC 3HZYB 3C6LB 1K4CA 4FQLH 2GITB 2XA8H 3DI3B 1E6JH 4U6VL 1UACL 3CDCA 1ZTXL 4GLRI 1YEFH 4FFWC 4HIJA 5DJ0B 1WZ1L 3WNPA 4WWID 3JWOH 3DXAB 3O4OC 4YPGB 1OP3H 3RHWK 1N6QL 3ZE2E 1NFDF 1RZ8A 4PJ8A 3DUUB 4JN2A 4LSSL 5CZXD 3V7AG 4MNQB 1HOCA 1VGEH 2XZQL 1U8NA 6FABH 3G9AB 1DUYB 3G04A 4MB5A 4J7RA 1M6OB 4LPWA 2DS4A 2HT2C 2QADC 4KJWD 2AW2A 1TQBB 2YD3A 4K9EC 4TULH 2YWYA 3TV3L 1H3XA 1CXHA 5ADPL 1WC7B 3CJJA 2QKIB 5KVGH 5DJAB 4XCEA 3BP6B 4Z77B 3RRQA 3FQTA 5SV4A 2VLJA 2CR6A 4JREB 3AB0C 2FGZA 3THMH 3MLYH 2OTUB 3KYKL 1ZHKA 2BJMH 3HG1A 5IBLC 4CBPA 3CUPA 1DN0B 2HVKA 3HCVA 1OAUH 1JYVA 2OK0L 3VGEA 1BECA 3CSYB 1T0MA 5LG1A 4LQFH 1DQDH 4UQ2A 3TZVA 1ND0B 3L9RB 5IW6A 1KJMA 3EJZD 5LAXA 2P5WD 3O2DL 3PV7A 4JFQB 3DECA 1IQDA 3IB4A 1HHGA 3ARBA 5I8KL 2MKWA 1PG7X 4LVHC 1R5VB 2AXFB 2NNAB 3O9WC 3NAAL 4Q6IA 2HLAA 5I17B 3ULUE 3GSNA 4ZTOL 5HHXL 1OW0C 4P2QE 1H8NA 3TO4D 1UZ8B 5IFHL 2FJGA 1JTOA 4YBQD 2YD4A 3IF1A 4X80L 5E5MA 2RFXA 3REWB 1I9IH 1WBYB 2X9YA 5GRJL 2DICA 4OZGA 1UM6H 4KQ4L 4A2MA 1MRFL 1CFTB 1AD0A 1MIMH 3VMNA 3RVVC 1VFAA 2VC2H 3OGOE 3UPRA 1LEKB 1NCWH 5DD6B 4C56E 4DK3A 2HRPL 4ZS7L 4M7JL 1IM9A 1YJDL 1BZ7A 2FIKA 4OJFH 1GZQB 3TBSB 2QR0A 4JZNB 3IDNA 4R7NB 3ILQD 4ZDHB 5T3XD 3LQZA 4Y5VA 2WWKO 4BFIB 4CADB 2BOCB 2ITCA 4P5TC 4Q97A 3MOAH 3OGCB 2DBLL 3LVEA 3H3BC 3OB0H 4JKMA 5DJ8A 4HJGA 2BNRA 3BKML 3PQYA 2E9BA 5GGVY 1NFIB 3QIUB 5ALBH 2X9WA 2XKNA 5A2FA 4F2MA 3T0EA 4R8WL 4XPTH 5D7IB 4HQQL 3JXAA 1KIRA 5C6TH 4LNRB 2HJFB 1WSST 5DA0B 3T0WA 3GMLA 2UVEA 3SGDI 5FCSH 1FFOB 5F89B 1C1EL 2ZOKA 3B4NA 3TA3C 2LU7A 4ODXB 2VL5A 5BO1L 5SWSB 5FB8B 3AVEA 1UGNA 2DQUH 4OIIL 5ESQA 1QSVA 5T5FH 2H1PL 4Q9RH 3S8WA 3S5LA 4F58H 5CMAB 3MXVL 2CD0A 4Y0GA 2AGJH 5GRXG 3NCBB 4GAGH 1JPGB 5DJZB 3RDTB 4RAVA 4M5YL 1MNUL 3GBNH 5D7KE 4LCYA 3TIDB 4WNQB 4O4YL 4M00A 2WZPD 4Z7WB 1OTSC 5HHOB 2NQCA 4HV8A 5C0IB 1DN2A 4JR9H 4UIKH 3IDIB 4QRUB 4M6NL 5I16A 1BIIB 4W6WB 4QCIB 4MA3A 3SGKA 2W91A 2VZSA 2CH8A 5C0EB 4LQ1A 1H8OA 4Y19B 1NDMB 2X7LA 4WDIB 4IMKC 5E8NB 1V3MA 5TE6L 4NQTA 5GGUB 4ZUUB 5GPRA 4L3ED 4L29A 2GTWB 3IU4L 3M1BA 3SDCB 2PYEE 4HWEH 4JJ5B 3MYJA 3MODL 1LMKA 3QUKB 2YZ8A 4HUVA 1LHZA 1NANI 4FTVE 1LE5A 2RBLA 3SOBL 2PUQT 1QEWA 4GG6E 3MV9A 1DUZA 4NKOA 2ICWA 4IOIA 4OLYL 2P8MB 3DLQR 2G5BA 3DSFL 2AQ2A 3SDDA 2H3NA 3VXSD 1N0XL 2FB4L 1MHPH 4HLZH 3KPTA 3X3FH 1L0QA 1ZVSB 1P4BL 1KCVL 3K4ZA 4YWGH 3ARGB 5CEXA 3T4YB 1QPPA 3PJSA 2HWZL 2NTFB 1Q9KA 4XNYH 1V3KA 1BMGA 3HUJA 4PJGE 5C0AE 1V5JA 4NQXA 4KQ3L 3CDGA 3KPNB 4NYLA 3VXRA 4JKLA 4JFZL 1U6AL 2YUWA 1FO0B 4GRLD 3O3DA 1A6AB 2BOBB 2VDML 3TC9A 5BV7B 2QSTA 5SWZB 4Z78B 1XIWD 2IANE 4GS7C 3H42L 3VD3A 3E8UL 5TQ0L 4A6YA 3HUJF 4JFFA 1HKLH 2R2BA 2EKSA 4JPVL 4NUJA 1BD2D 4KI5F 1S7XA 3KAAA 4HAGA 3MUY1 4Z8FH 4FQHA 3CX5K 1FSKC 1U3HD 3DPBA 4MNQD 3QO1A 3F6LA 1YMHA 5FHAL 1NBYA 3S35X 1I1YB 2VMFA 3NZ8B 4F15C 1GGTA 4YFLI 3QBTB 4MAYD 1WCBA 3TNNB 3QNYA 1MFBL 3CVHL 1YEIL 1OAYH 5FYJU 5FYLH 4F7EA 3PL6C 2D0HA 4H1LH 1FRGL 2DQIH 5C0RH 4DKFL 2ZKHH 1WIUA 2C26A 1KTKE 5H37G 2R56L 4NCDA 5C0JA 2V5SA 4AZ8A 1RIVH 3LKQB 4YH6A 5HYJA 4K71B 1JGLL 5DF0A 3QR2A 1UVQA 2O26U 2AP2A 2ZCKH 2QQLL 5HYQB 5DO2C 5ISZE 1DANU 4QGYA 5D2NE 4BQCA 2XOTA 2GJ6E 4HS8H 4EZMA 2BVQA 2E8ZA 4MYWB 2VABA 4YDVA 1C08A 3B9KB 4HWUA 4AL8H 5F1NA 2OI9B 4LCUB 4ZUSB 3VFSA 5TE7H 3GMMB 3RVXD 1MFNA 5CD3B 4GKOA 1G1YA 5T1KD 1AHWC 2A9MH 2JK5A 4TQEL 2A1WL 3O8XA 4LLQB 2YPLD 2EICA 4N8VG 5T1MA 1MCDA 5GSVA 4N8PA 4UT6H 2R4SL 4KRMB 3C5JA 1TLKA 4N0UE 1AE6H 5GS2H 3O3EB 4K3EH 2V2XB 3NCMA 4L4TE 5CAYB 3U7YH 4V1DB 1VB9A 2AXHA 2B1HL 3F7VA 2ZNXA 4BSJA 5JW5B 4LP4A 3KYMA 5JDSA 4NQVA 12E8H 5MEQB 3X3GL 2EXWD 2XV6B 5I8EB 1AP2B 1BVLA 2OP4H 5HDQL 2CIKB 1D3CA 5TQ2H 3S37L 1IC4H 1QSFA 3CCHA 2X09A 1NMCC 4LSQL 4YBLB 1FVDB 4UINL 2ICEB 5JO5B 4KRPC 3O4LD 5IR1A 5KVMC 5FYKU 1OB1A 4WW1A 2F53E 1MJUL 5DC4B 2CXKA 5IJKC 2DYPB 2GY7B 4HBCH 4YPJA 5DYOA 4IJ3B 4LVNB 5L2KA 2A74A 3IDMB 5EZOL 1HDMA 3EDKA 1RU9L 1DEDA 3PF2A 4XBGA 1SM3H 4QRRA 3WFDL 5KSBF 3I6GA 5D5MB 1H5BB 2BNQE 5GJTL 4G8FB 5HYIA 3U0TB 1UCBL 4PRAB 4D9RD 5DDHA 1IILE 5I18L 4OSUL 3LSOA 3PGFL 4DN4L 1FNAA 4J1UB 4MAUL 3QUZD 3ROOA 5DS8B 1Q9LA 3GSRA 3CGTA 3QUXC 4JHBA 4ZODA 3MXWH 4IRJA 1NL0H 1QNZL 1BM3L 1HI6B 4JE4B 4P23C 4PGBB 5JHDB 1FZOA 2F54B 1J88A 4M8QB 4IIQC 1ZLVH 3BAEH 4OLEA 3QAZC 4HSQA 2VLLA 3IGAB 3NFNB 3JUYA 4NHCH 4XP1L 1I7ZA 3OXRA 3ULVH 3DUSA 3RY5A 1EJOH 4R4ND 3O45B 3KXFB 1AFVL 4OAWB 4DGVH 1QVOB 4HKZA 1FIGH 2O5YH 1ZHNB 3QULA 3MJ8B 4NOBA 2BFVH 2JCCA 4DAGH 2YWZA 2DD8L 4PRDB 4ZQKB