3DI3B

Crystal structure of the complex of human interleukin-7 with glycosylated human interleukin-7 receptor alpha ectodomain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
193
structure length
193
Chain Sequence
b'DYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-7
molecule tags Cytokine/cytokine receptor
source organism Homo sapiens
publication title Structural and Biophysical Studies of the Human IL-7/IL-7Ralpha Complex.
pubmed doi rcsb
total genus 29
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2008-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
B PF18447 FN3_7 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3di3B02
2.60.40.1870 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3di3B01
2B5IB 4PJ5A 4IS6B 4OFIA 1M71A 4OQ1A 4GOSA 3NFNB 3G04A 2W65B 4KU1A 4MNQE 3WJLC 3IFNH 3MRRA 3SGKA 3I6KB 2VKWA 3QULA 4ZFFA 1XZ0B 2IAMD 3SDAC 4KVNH 4L8SC 2OI9C 3SBWC 2OTUB 3VRIA 4CNIB 1J0ZA 3OZ9H 1FYHB 2R56H 3QEUA 3D39E 3EYQD 3BW9A 5KG9B 1GOFA 4LLAA 5H35A 1A47A 2R0ZH 3DXAE 4Y5YA 5FCUH 4DGIL 1Q72L 1A3RL 4Z7UF 4WW2C 1PVHA 3GFUA 2Z91A 5KSBB 3VXTA 1WBYA 1YEEH 4MNQB 4FQCH 3TPKA 1RI8A 1F02I 1Z9SA 4OD3L 1D5ZA 4HIXL 2Z92B 1M7IB 4LKCB 5LKNA 5CSZA 5IVZB 3LHPL 1B2WH 4NKQB 1WJ3A 1SMOA 3O0RL 4Y19A 2B1AL 1OCWH 4JFFB 4OZGF 2XQYG 3V0AC 4ZMAT 1WZKA 2V2XA 1CFQB 4PGBB 3ROOA 4AEIL 5CWSB 3HG1A 2AJXH 3BKCL 5K9KA 3QIUC 3L5XH 3QUXA 4Q9RH 3O3AB 3MNZA 1CFSA 1JWUA 3PWVA 4FMKA 4KKAD 4JDZA 3S8WA 4PBXA 3STLB 1JTOA 1EH9A 2FB4L 4DK3A 1LE9B 3IAGC 1T5XA 1VPOH 3UYRH 1ZA3A 4YDVA 2GTWB 4P9HH 3U0WH 1G0XA 1G7JB 5SWQA 1MCWM 5INCA 1MRDL 3TP4A 2LAGB 4MWFA 1NMCC 4RWYH 25C8H 2KH2B 1NSNH 3SE9L 5CLTA 1L0YA 3ARED 4YR6B 2P5EB 4EUPH 1AXTL 4LHQB 5KG9A 1J0YA 2GY5A 1FE8H 1HHHA 3T4AA 1TNNA 2AEPH 4QWWC 4RQQB 4IM8A 1G1CA 3NACH 4JZNA 3BD4A 3FN9A 1G7HA 4Z7NE 2JB6B 5CLWA 5BS0E 4TUOA 3RPIA 1OP3H 3BD3A 3OXSB 5I1KH 1CGUA 3GHBH 1WCQA 3BMVA 5EUOE 4PJHE 5FGBC 5I74B 2DQUH 2OP4H 5KOMC 4KK9C 5F7YC 4QRUA 1UVQB 4KKNA 2AEPL 1NCDL 2HT2D 1ZE3C 3EKCA 4M61A 1AIFA 3MYJB 4QRPE 2QSCH 2F8XC 1CDHA 2CMRL 4GG6A 3QHZL 2HFEA 2PETA 3PP4H 1S7QA 4U6YB 3BSZH 4MD0B 1CIDA 3UDWC 4HJ0D 1N2RA 1EJOL 2AXJA 2FZ3B 3L5IA 2FB4H 4PRNA 2O61A 1V3KA 3MNZB 4IMLA 1QSFB 5D71H 3GSNL 5BRZE 5JQ6L 1R3IH 1I4FB 1TJIH 1KTDB 2DTMH 2MPAL 2PCPA 3CZFA 1ZS8A 1VEPA 2P5WB 3SDDD 3EYUH 5HYFA 5SWQB 5BS0A 4AL8L 4C4KO 3W39A 1B4JH 1FFNA 3FT3A 3IKKA 3LHPH 1FNSL 4F7CA 4LP4A 4NKOA 1MHHA 3BVNB 5DFTA 2N56A 5C0ND 2H2SC 1NAKL 3MTRA 4E9LA 4LNRB 3CAFA 4WO4A 1BVLB 5DF0A 1XAUA 2VSCA 4D0CA 2BY3A 3S37X 4D8PB 2BNQD 1PZ5A 4KVCL 1EHXA 4JPWL 4Y88A 1YEEL 3GSWB 4P5TD 5IBUG 4MJ2A 3NACL 4U33A 2CIIB 4PB0L 2D0GA 3B9KB 1IAIL 3LN5A 3AFLA 1OTTD 3LEXB 4H1LG 2OMBA 3VWKA 4JANB 4BM7A 4K9EL 2FYYB 4R7DA 5I73C 2PYFB 1DEEB 5ITBH 2V9TA 5GGVY 3TBSA 2IANB 2O5ZH 1YMHA 4EN3D 4PTTA 1KIQB 4X99A 3U0WL 3DVNB 1RHFA 4ZDHA 2APWA 5IROA 3WDIA 4PGCB 3OGCA 5ID1A 3MREB 4Y2DC 3AB0B 3CSBA 3RBSA 3BAEL 4ZO9A 3VWJD 4GW5A 4Q9RL 1SYVB 2WV3A 1S7SB 5D2LA 3BESR 3W9EB 4NPYB 4AEIH 4YHMH 4HAFA 1BJ1J 5DGRA 3VE0A 1F3DJ 3WLBB 4U1NB 2FIKB 5B3JE 3I50H 1M6OB 3NTCL 4LCCC 2AW2A 1C8PA 3H7BA 1B2WL 1M6OA 1MPAL 4MSWB 1VFAA 2IC2A 3D39B 4LIQL 4M1DL 4U05A 5FO8B 3C5ZC 1T21B 2H2PC 5E2WH 3TCLB 4KWUA 2D7TL 1I75A 2X1XR 2VDPH 1FFPB 2OL3H 3SJVE 3I02B 3WXWL 3E6HB 3T65B 5CD3B 1Z9LA 2MKWA 4H8WC 2B20A 1ZGLB 3M07A 2BVPB 4JJHA 3QO0A 4I5BB 1BZ9B 5FCUL 3VXSD 5DWUL 1KBGH 4DGIH 3LMJH 1FPTH 2KUTA 2R2HA 4I5BA 4WI8A 4YHPB 5DD5L 1R3LA 3V2AR 4RISL 4L5FH 2EYTA 2I27N 1FLRL 3QQ4B 1I3VA 1WBZA 2R29H 3KPTA 1G9NH 2EDDA 1I1FA 1KACB 5HI4D 2UUDK 4KTDH 1XGYL 3H7BB 4YHZH 4WY7L 5HYSG 4P23C 1LP9B 2OQJA 3V6OA 3ZL4L 4NFBA 1WITA 1HCVA 1MCIA 4LP5A 4TSBL 5JNYB 3KAAA 2YPLE 4WEUD 2YA2A 2Y36L 3V0VA 3TO2B 1H15B 2HTKC 5DGQA 5DO2C 1I85C 2O5XL 4B7IA 3VFUA 4OBRA 8FABA 1NLDL 3EDFA 5HHQB 5GRJL 4HV8B 1GZQA 3ETBF 4ODVL 2CIKA 3ARGB 3V4UL 1VFMA 1KCVH 5ISZB 2DM3A 1LP9E 4LPTA 1Z9OA 1NAMA 3VFGL 1OM3L 1MJ7H 4X4XB 1FL3B 1NCWL 1CVRA 2EC9T 4UDTA 1CXLA 1S7WA 2XFXA 1QVOB 3HC4L 4U0RC 2F53A 3QUYD 5GGSY 1TQCB 3VXMD 1T4KB 5ADOH 2VLJB 3MRKA 4TSAL 2Q87A 4Y4FC 4DVBA 4S2SB 4TPRH 4IRJA 5HSFA 1CTOA 3K3QA 4HKJA 5HGBB 2YXFA 4UTBL 2BXYA 2W9EL 3T77B 5GHWL 2XNAB 3ROLB 3KWWA 3QHFH 1A7RL 3U7WH 1U93B 5IV2B 5KSAC 3V9FA 1UJ3B 4GAGH 1NCTA 1UZ6E 5AYUL 1TCMA 3PGDA 1IGFH 4Y1AE 3ZDYE 1U8JB 5HDQL 3QEHB 1IEHA 3ESUF 5TE4H 5KVDL 1S7VB 2AXGB 2CUHA 3IFOA 3L6FA 1LP9A 2P5WE 1F4YH 2ZOLA 3L5WB 3ARFB 1H8SA 3OKEA 4NQTA 4U1GB 3HR5B 2Z4QB 2X9WA 3FQWB 4RA0C 5HHQA 1MREH 1JPTL 5F89B 3VFTA 1T83A 2R23B 4MA1B 2ZCLH 3AUVA 2FHBA 3AROA 1DQQB 2BSSA 1FIGH 1P4BL 4X6CF 4Z76A 5LJYH 4MNQD 2CLVA 3BQUB 4MA3B 5EZLA 1A21A 3KWWB 1J8HE 4A6YH 3RGVB 3U9UA 5ESVB 4N1HB 3QDGE 3VFRA 5I2IA 4PJ7B 2FEEI 3MLRH 2WBJB 2FX9L 3MOBH 3D39D 4LBEB 1U6AL 1CCZA 1KN4H 5IBTH 3LEVH 2XWJB 3PWPB 4YPGB 3ULVD 1SM3L 1WIPA 4G3YH 4XTRD 1KTRL 2I26N 4ZNEE 5D1ZC 2DQEH 5LQBL 3UBXI 2FGWH 2L7JA 4I18C 5DSCA 4YWGL 1GC1H 4L3EB 3SE3A 1IT9H 4K3HA 1X5XA 3VCLA 3QHTC 2R2EB 2R2BB 5E00A 1ROWA 4OGZA 1MCOL 5C0BD 4S1QL 3IU4L 5GS1C 1YNLH 4KRNA 4Z7UB 4Y2DB 4WU5B 5FYKU 3U46A 4CGTA 4Z7UA 5T3XL 5CJQH 2A74A 2FEEL 2YKLH 3LKRA 1KIRB 1X5YA 2YEZA 3RWFA 2IPUK 4ELKB 1GAFL 2YUXA 2ARWA 4R96A 2NZ9C 3B6SA 3QEUB 4K3EL 3F7QA 1N5AA 4FMFA 2R15A 2CXKA 4LLYA 4P59L 4OB5L 3REWB 5J1AB 2Z91B 1UCBH 4L29A 2DWEA 1U8OB 5LCVH 4OD1L 4XPTH 2E27H 4UV4H 1DQJA 2VL5A 3TZVA 1R3KB 4W4NA 3C08L 5C2BH 1NGYB 4YXKH 3PQYA 4HZAA 5GS0L 4EXKA 4PP1D 4P9HC 4J1UB 3BKJL 1K8DA 1BWWA 2OM5A 4OLUH 4MJIE 1RV6X 3KYOB 4DUVA 5C0IA 5AD0B 1B0WA 4Z7NF 2NY4D 3MXWL 1EEQA 1ODAA 3TN0D 4R8WL 1J5OL 2CJUL 5KZCB 1UWEL 3PWLB 5E2UL 3VXQA 3CSGA 3EYVA 2LAAA 3V4PL 4KK5C 5L9DL 4I0CC 4XPHH 4ZD3L 4FP8L 1NCNA 4X8XA 3MUZ1 5T1KA 3SDDC 3BXNA 5MERA 1N8ZB 3GMMB 1WAAF 4MX7B 4WFFD 2ZSVB 3G5ZB 3GNML 3V79C 1IM3A 2R0LL 1EO5A 4YDLB 4K23L 2V2TA 4UT6L 3VGAB 2P8MB 4YNYB 1ZT7A 4Y89A 1OTTC 4L4VE 1X6NA 1NC2B 4YZFF 5BRZB 2F74B 5EIIB 5BXFB 2R1XA 3WN5A 4RNRA 3FO2B 4U1JA 1MH5B 1O7VA 5TDPB 3RY6C 5LGHL 4BA8A 3O4LE 2OMNA 3U36B 4BH8A 1E4WH 2AABH 5JZ7D 1IQWH 1W0WB 5GGSB 3L3DA 1G7PB 3L5JA 3MV8D 5C6PB 5D7IA 3OXSA 5EPMB 4GG6F 2HLAA 3RNKB 3B5TA 5IBLC 5I1HH 5A3ID 2MHAA 4LVEA 5D7LD 5CZKA 1UVQA 3DPBA 2NNAB 4JFXB 3L3GB 3MV9E 3RZWA 5F70A 4TVPE 3GRWH 1UZ8B 3VG0L 2CKBB 4NZJA 3VXMB 4WUKL 4CJ1A 3VXSA 1U8LB 1A2YA 2XV6B 5CEZD 1NBYA 1PAMA 5IR1A 5CUSL 4TQEH 4MNGB 4I0PD 3OJDA 1MCPH 2CPCA 4ZQKB 4OGYH 4OD1H 4RMQA 3AXLB 5DMGD 2J6EA 3O4OB 4P48A 1X3DA 2W0PA 4JFHE 1VENA 4MWFB 1JWUB 4F33B 2HTKD 1CDIA 3OKKB 4LOUC 4KKAC 3H9YA 3GMQA 1C7TA 3UTSB 5EPMA 2A9NH 3RVXC 1WZLA 5ICYA 3O3BB 2GJJA 5M94B 2KZWA 5IVXF 4X4YB 5DYOA 4PRAB 3W9DA 3RAJL 4R26H 3DV4A 1IKFL 2NY3C 4N0YL 5K9QI 4NBYB 4S1QH 5EC1B 4FQXA 1D5IH 5AUMB 3VMPA 3ARPA 5B3JF 2NY7H 4WI3A 1A6WL 1HILB 3FQUB 4HJJH 1QSEA 1ADQL 4S0SD 5EBMB 5FUZL 1Y0LB 3WFEL 4IDJH 5ENWB 1NJ9A 5CD5C 1Q94B 4MZ2A 4YUEL 1G7IB 4KDWA 1K9TA 3KJ6H 3MRQB 1JWMA 2EYTB 1INQA 1OGTA 1M05A 2DYPA 4I2XE 1XGPB 3NPZB 4JRWA 5D7JC 3QG7H 3A67L 1UKTA 4XBPB 4YHKL 3CFBA 4QNPE 4ZTPH 4F7MB 4GKSA 5DJ2A 3DXAA 4YE4H 3H9ZA 3QDMA 4QHLA 4LU5L 4OF0A 3BZEA 1F4HA 3VFNA 3H3PH 1TITA 4YBQC 4L8SB 4UV7H 5C8JB 2GIYA 1SJHA 1I9RL 1QFPA 3X17A 4JFOB 3WCYA 6CGTA 1BF2A 1CE6B 1CS6A 1AR1C 3KPNB 1FNAA 3AY4A 1NFDE 3KPNA 2B5IC 5KVDH 2X70B 4P9ML 3VFUB 3V6FA 1WF5A 4RX4D 2OL3B 5GGTA 3HI6H 3BGAA 2DB8A 3HE7B 1DEEA 1UG9A 4AM0B 3QA3B 5EIQA 4LARH 2D31A 4Z9KB 4WNQA 5HYQB 4P3DB 4M9PA 2VDRL 4R4FL 1WLHA 4PJAA 5C7XL 4Q58C 1MIML 3VD3A 4IOSD 2WANA 3F62A 1S8DB 1ZEAL 3DHJA 3VGGA 5ISZE 2DDQH 5ILTL 3NN8B 1BZ7A 2R8SH 3C8DA 1DEDA 2YPLD 5EZOH 1BZQK 3P40A 5F6HI 3CDFA 4MLIA 5ADOL 1MNUL 1U8MA 2H26B 1ZAGA 2PKDA 1IQDA 2W9LA 2XZQL 4P2RE 1JYWA 1OHQA 4H26A 1BQHG 4U4BA 4U6HB 1EVUA 1JWMB 1IMHC 2C4FU 4GQ9H 1XGUA 3QUKA 1T6WA 2DD8H 2YA1A 1EVTC 4HD9A 2YPKB 2VYRE 3RKPA 3QXTA 4Z7QF 2XA8H 4G80B 1CICC 5JXEC 3ARFC 1J0KA 3IETB 1QFWI 4IBLT 1Y18B 2N1KA 1MHHB 3BVNA 3U48A 2FHFA 2FLBT 4O02L 4DN3L 3MJ9H 3MV7B 5JMOC 2G2RB 1PG7H 4PPTA 2ATKB 4M7ZC 2ED7A 3MZTA 4XPGL 1GH7A 3OKMB 2EXWD 3L3IB 1KC5H 2EIZA 2V17L 4LHUB 2IJ0C 3V5HB 4HKXA 3L3IA 4XXCA 2LU7A 2IF7A 4QNPF 1QSFD 2LFGA 4UAOC 3NCCB 3LIZH 1U42A 3WHXB 3WS6C 5C0CD 1EHAA 5INDB 4N5EC 5GS0C 1OWRM 4HXAL 4NQVA 2AKRB 3QUXD 4NRXA 1IAKB 5K9JL 3QDHA 1TZGL 2XNAA 1GCFA 3L3JA 4MGXA 4J8RB 4XMKL 5I1JH 1ZVHA 1S9WA 1F6AB 1KLGA 3Q2CA 4WHDA 1FLRH 3EO0A 1LEKA 5ABDE 4NQSB 5DDHA 3NCJH 2MTPA 3BZDA 4HPOL 4HSQA 1PG7W 3MLTA 4HCRA 3QIWC 1INEL 3SCMA 1Q8MA 4MJ4A 4M48L 5DWUH 4OZFG 1C5CL 4OQTH 1S7UB 1NC2D 2AJUH 2UWEF 3D0LB 4U1MA 1NKRA 1C5BH 4NO2A 2VJXA 3MRLA 2VDMH 4P0DA 1BD2E 4BKLB 2OL3L 1YC8A 3WXWH 2VXUH 1F2QA 1KN2L 5E2TL 3GSUA 4MXQC 1OTUC 3DI2B 3MV7E 4GMTH 4YBHA 5I15L 3RTQD 1T83C 4ORGB 3H7LA 3AREC 5DEGB 1MPAH 1ZHBA 1ND0B 3B9DA 1FZMA 2DMKA 5IMLB 3PDOA 1NAMB 2EECA 4JRYE 1IL1B 3GGWB 1P4IH 5J12C 4NQCD 4JE4B 2J5LC 1IFHL 5I71B 3ZZ1A 4DTGH 1MOEA 1I3RA 3RPKA 1U3JA 1NGPH 4K7PY 4OD2A 3LZFL 3LKNB 2Z8WC 3MV8B 4IRJB 4Z0BH 5IEKA 2VR5A 2DOCA 4XCEB 5IQ7L 3IVKB 1S9XB 4FQXC 1YEGL 4JFEA 5F21B 4F8QA 1RIVH 1FYTB 4DOHE 1HSAB 2ZUVA 2JK5A 2R4SH 4KJPD 1GHFH 3QIBA 2ZUWA 4PJ8A 4ZOEA 3K8KA 3R0MA 3P9LB 4N8CL 5E6IA 2FIRT 2PNDA 1ZXQA 4J4PA 2EO9A 1P5UA 4MXQD 2EKJA 2PYEE 3N85L 4JHAL 3V6OC 3RFZC 1HZHH 5HHOD 3VFOB 3KS0H 1FIEA 4NQSA 5J13B 2V5RA 5ICZB 4M6ML 1U2CA 5BZWA 1FVCA 5MEND 4R97C 4KVCH 1WK0A 4N8VA 3ZO0A 4QRSA 3X11A 1RSFA 1JZ8A 5KSVA 3OR6A 3QCVH 1U3HC 4YX2H 3O3EA 4LSQH 1RZJC 3VXOA 1KB5H 3BP7A 5JIHA 2WWKT 5GGRA 2BHZA 2W0FB 1HKLH 3TO4C 4XWGH 1JGUL 1JPFB 2GSIA 1MCJA 1QRNB 2MFNA 2JELH 2X4SB 5I17B 5BRZD 4PG2C 3LD8B 1M7XA 5DUML 1QRNA 4F37K 4HPYL 2OJZL 1R3IL 3AB0C 1WFNA 2CRMA 1U36A 3LRSB 2ITDB 4KV5E 4JO2H 4QRPD 3ULUC 4AEHL 1PJ9A 4WI6A 2DWEB 3JV0A 2P8PB 1R3HB 5HXMA 1OPGH 2VLKA 3IJHB 1T20B 2FEDD 4XHJC 3BSZL 5IG7B 2OZ4A 1D6EB 2YWYA 3HRPA 3EJYD 3AREB 3KLSA 4PR5A 4NC1E 3WIHH 4BSWA 1ZOXA 2JK5B 3NZHH 2FJFA 5KZCD 3UPRA 2I60H 3G6DL 2D0HA 4NM4L 4PRID 4CADB 3VA2C 3MA7B 4WV1C 3FO1A 4HFWB 1PG7X 4XRCA 5LG1A 3BPLB 1NBYB 5T5NG 1T1YB 3LKSA 4FTVB 2NY2D 2EEBA 3NFNA 4HUKB 43CAB 2RCSH 3GKWH 4PRPE 1ZTXH 2X41A 1A9EA 4OLZL 1FFOA 1GIGH 4YHYB 2DQIH 2IQAB 4KMTH 2PF6A 2X4PB 4NC2B 4U1SA 2W07A 5EU6B 4HS6B 2V6HA 1KPUA 1FQ9C 4CRPA 1I9IH 1J11A 4ZS6C 4N8VB 3LOWA 3W81A 4HIHA 2W92A 1FE8L 1KT2B 3C5ZA 4FQ2H 3WUZA 1QLFB 3QCUH 4DZ8B 1B4RA 4ODSH 2Q76A 3QUMH 3T2QA 2MSPA 3G9VA 5IB1B 1RK0A 3GI8L 1QQDB 1X4XA 2JJTA 4PRPB 3TIDB 1EMTL 1TMCB 3VFMA 3BKYL 1CBVH 4QRUB 4UBDD 2AEQL 3QXVA 3DSNA 4H5SA 2IALB 2DLGA 1KB5B 4I4WA 4EN3B 5JIPA 4GRWH 3NCMA 4NN6B 1QKZH 4NN5C 4WWID 3ZE0E 4EI6A 5F93C 1WV7T 4UU9B 3VI4F 4LK4A 4K2UH 2X4OB 1CE1L 1AQDA 4GS7B 5FXCH 2W65A 3MZGB 3P4MA 3TFKD 3MLSH 4GAJL 4AT6B 4JDVA 1X5KA 3EOBB 2ZG3A 3PWPD 1GGYA 1OSPL 4Y4FA 2ESVD 5KN5A 2J8UF 1N2RB 4XP4L 4LVHC 4WHTA 2RBLA 5D1XD 4G43A 3X14A 2C3HA 3W0WB 5L2JA 2J2ZA 4L1DA 4YNYA 5BO1L 5E99H 5L6YH 4JG1H 1CTNA 1AH1A 3ZDXF 1OF2B 2J4WL 4I0PA 5FGSA 3L9RB 4JKKA 2Q8AL 3H9SE 5DMGC 2GCYA 4YDIL 5CD5D 1Q72H 1XCTA 4XP1L 4H5SB 3CDGA 4PJ8C 3CJJA 3PJSB 3CLFL 3L7EA 2AQ2A 4JFQA 2DQFA 3MFGB 2NY5C 3W2DH 2V2TB 3X12A 4R2GD 1XF1A 4YIQA 3QI9A 1G9NC 1X44A 3C60B 3SCMC 4QXUH 5GS3A 1CD1B 3EFDL 5EBWB 4B50A 3OAUH 1CU4L 4WW2F 3CX2A 3MYJA 4EDWH 2PO6C 1KB9J 1LO3H 2XWTA 5IM7B 2NY6B 2VRAA 1A4JB 3KPMA 4GMSH 3RTQC 1MF2H 3GIZL 3WFDH 4HMEA 1FNHA 1YYLH 4QKXB 4PJ9D 4U1LA 5FO7B 2DMBA 4UU9A 4BELD 5TDNB 3UJJL 2P48B 3DO3A 3T0ED 2X1PA 1N6VA 4LRNL 4YC2C 2YN5A 2Z8RA 1GZPA 4FABL 2E7LA 3IJYA 4LSTL 2FH8A 2YD3A 4DKDC 1KLFA 1CDCA 3BEWB 3LS5L 4K7FA 4HJGA 3SKNB 4H88H 1HNFA 5D93B 4D0BA 3ZE0F 3J7HA 3U4AA 1MJ8L 3MRGB 3FCTA 4RZCA 3FCTB 5CEXB 3V7MA 1ED3A 5E94B 2AJZB 4QTHB 1HQRA 3VWJA 4OT1L 4AIZB 3HTLX 1M7IA 4XI5C 35C8H 4P3WA 3GMOA 2BZDA 1I7RB 3ARFD 4WDIA 3QPQC 5I75B 3ULUF 5C0EA 1MI5B 4LCWB 4NKMB 2CRZA 3TFKC 4W4OA 1HOCB 2BVUA 4Y5VB 3MRJA 2HLFC 3ZDXE 2ZG2A 2O93L 4PGEB 1NCAL 4ZG1A 3S88H 5B8CC 4Z7VF 4E5XB 3DLQR 1N4XL 4JCLA 1RUMH 2AAVA 2CK0H 3LEXA 4Y5XA 3UBXB 1T0NB 3B9KA 1KYOJ 2D31B 4JRYB 4HWEL 3MLVH 3HRZB 1T3FB 1NEZB 5H94B 3UJIL 1DL7H 1E6JL 3RBGA 1ZHNA 3KDMA 3D2UB 3IDYB 4CU7A 1YEHH 2WMPA 1A22B 4HG4J 2BVPA 4U6VH 1OVZA 4Y1AD 5C08B 5I16B 3X13B 3UJTH 5CIPA 4IEFB 3UYOD 4D3CH 1I8MA 3ZYIA 3E6FB 3DXAD 1L6XA 4LLVB 3HZYA 1VHPA 5DMKA 1QSFE 2ERJC 1MCEA 1UACH 1MHCB 4RGMC 4K3DL 4EIGB 4OIIH 5IUSA 3PIQA 4RGOL 1NAMH 4NC0B 4TSCL 3LB6D 4JREC 4KQ3H 2F54D 4KFZC 4KZEL 5EIVA 2J12B 2EDOA 1XCQA 5ALCH 4N0FA 2DN7A 4NHCL 2QSTA 3UAJC 4NP4L 1H3WM 3B4NA 4PRBA 2MWCA 3P4NB 5I1CH 4KJQC 1BAFH 2DF3A 4XNZC 1AE6L 5J56B 2BOCA 1YDPA 3OJ2C 3UTTB 4FQJL 5HVWA 2VDOH 3PQYD 4JFZH 1DBAH 1FV1B 2VIRA 1WCBB 2FD6H 3ECBA 1PX3A 2FL5B 2H32H 2OX5A 3DVGA 4AG4H 4JM2F 3O45A 3FQUA 1S7RA 3GBNH 5FUOL 2EE3A 3THMH 4GSDH 2XWBA 2DYPD 4M8VA 2FECL 1UEYA 1P7QD 4TUKL 3GMNA 1M1SA 1U8MB 5EZIH 1G7MB 4QHNA 3EGSB 1S7XA 1YEJL 1ETZA 4DN4L 5IW3A 3LN5B 1RZIA 4RAUA 4P4RB 5SWZE 4Y0GA 4P46D 3QDGA 1I1AC 1WFUA 1LDPH 4M7KL 2YD5A 4F9LA 3P0YH 2OK0L 5E0QA 3EFFA 3PDGA 2Y4SA 1J86A 3JBG7 5KSUB 4CU8A 2BRQA 2HKFH 5CEZH 2NY3D 5J0BA 4NBXB 3OXRA 3G5YA 5DJ8A 1S7UA 4XPBL 2DJ4A 1YEIH 1OQOA 4FQLH 5GISH 5IFHL 1OTUD 1DCLA 3QJFB 3TT3L 2FO4B 4RCAA 4YGVA 1MHPH 5E2VH 2M26A 4PG9B 5IHUL 5A43C 3BUTA 4LHUA 3VH8B 2WINB 2Z4QA 2CGRH 4L9LB 2PYED 1H3PL 2B1HH 3CVHL 2AKRA 1L0XA 4JDTH 1TQCC 2DKSA 4K94H 4KJPC 1WC7B 4TRPL 4FXGB 3G6AA 3K4AA 4WTXA 5F88B 5INDA 3RJQB 2V2WA 3L3HB 3A6CH 3G6AB 4RFNC 4UQ2B 2BOBB 4YFEA 3T3ME 2DLEA 4S1RL 4MNHA 4DKAA 5CCKL 2X4UB 1QLRB 3HZMB 4MJID 1SYSA 3HMXA 4XPFL 1UC6A 5I6XB 2G60L 1JNLH 3RWHB 4G8FA 3MOAL 3PWNB 4DKEL 1FCGA 3WIHA 4Q6YA 4Y5YC 3CVIH 1KCUH 5EBGA 5D70L 1ZGLA 3BO8A 1A02N 3BYTA 1T1WA 5E4EC 1QYGH 4BZ1L 4GW5B 2NY0D 2DJSA 1JF1B 4YK4C 4ODTL 3SOBL 1LEIA 2XKNB 3TCXA 4Z7OE 5DK2B 5JPNB 2AXFA 5FYLD 4R0LB 4PJGE 1R3JA 5DJYB 1RULH 4NOFA 4TUJB 1A6UL 1F45A 2BSRA 3BP7B 3HI5H 3RDTD 1BOYA 1YEJH 2Y7QB 5GSVA 3EFFB 4JLRB 2BNUA 3SE4A 5J8OA 2W9DL 5J13C 2DIBA 1JGVL 5GPRA 2IAMB 1TETL 1RUPL 5FUOH 4DVRH 1W2KT 1CLYH 2BMKB 5EN2A 4KJWC 2EDXA 4FZ8L 2X4RA 2YEZB 2VC2H 2H3NB 1HE7A 4NQEA 1MELA 1YY9C 3RGHA 4ZFOL 3T0WA 3FAWA 4XBEL 3K2MC 4JDTL 4TRPH 3CVHH 1FO0L 2GJ6E 4V1DA 2VOTA 5CMAB 5J1AA 3LRGA 4UMGA 4LLYB 4PJ7E 5DUPH 1AE6H 4N9GA 2Q76B 2C9AA 2Y06L 5A16A 2W38A 2PYEA 5CP3A 3AS1A 3NIDE 3CU7A 3TT3H 1BOGA 4NHCH 2IQ9H 5MEOA 4UILL 4NUGH 3MV9D 4LCYA 4R4NC 5JHDD 5T5NF 1JF5A 2AV7A 4XP6L 3W0WD 1KSRA 1FN4A 3LKNA 3PL6D 4ZS7H 4L3ED 4HGWA 3NIFF 3C5ZD 4Q97A 3GSOB 4GLRH 5HVGB 1LO2H 4WI5A 4MD5A 4GRWB 4BK4A 5C0RL 1JZ6A 3HE7C 3E0GA 4JFFD 4MQXD 5IW1A 1AR1D 3VFSB 5HGDA 1A6TA 5FUCC 3MLVL 4PJXF 3TVMA 5DS8A 1Z3GL 1IGIL 4Y2DA 3BDBA 4OFDA 4PJFF 3GB7A 3THML 5GS1B 4J3TA 1MQ8A 3MCLL 4HK3J 3SKUD 5EA0H 4RNRB 3S88L 3ZT6A 2ADJA 5BRZA 2R69H 4G6FB 3CH1A 3IFOB 3L6FB 4EZMA 1DBBH 2FJGA 3OPZH 2RR3A 3GSVB 1J1OH 1J8HA 3U4BL 5HBBA 4IMKC 5C6WH 2H41A 5KW9L 2CKBH 4EI6B 2RGSA 1ORQA 1D5BA 3VMOA 3B2UC 2NW3A 1R0AH 1MCLA 1ACYL 1UEMA 4MAYB 3WJJA 5SX5K 1QBLL 1TJHL 2G5RA 1JV5A 5TH2A 1ZT4A 3H9HB 1DQTA 4S1DC 1BEYL 3LV3B 4KQ3L 4I3GA 5EZLB 4I48B 3ARDC 4YHOH 3U2SA 2EIDA 4PJCA 2J8UB 5HGHB 3GSXA 5DXWA 4Z76B 3H9SD 4OI7A 1UACL 4FXKA 1IAIM 3FTGA 4GAYB 1ERNA 3W0WA 5L2JB 3DYPA 3F58H 5C0IB 3FB5B 4U3HA 3VFOA 3DARA 4QHMA 2H6PA 5F9WC 4X7FC 1BQSA 5CBEB 1YUHA 2AQ1A 4O2EA 4LSSH 2DBLH 2VZUA 2A1WL 1QHOA 3ULVC 1Z0MA 3PUCA 4BQBA 1NFDA 4Y8DC 2ICEA 3F7YB 3GUTB 3CXDL 3KPRA 4GMSL 1W0YT 4QXTB 4HK0B 2Y9RT 4V1DD 5FB8A 1J88A 2A6KB 1V3LA 3DUHA 3MBXL 3IF1A 1ZA3B 1CZ8H 4YDVB 1TCRB 3SN6N 4E41E 3IDMA 5D7JD 1P4LB 4GLRI 1FJ1B 4FQIL 4OSUL 4UAOB 3WDHA 1JNHB 2XTJC 1KIRA 3FFCA 2NLJB 3STBA 4YXLH 5T3ZL 4CMMA 4OZHB 4I48A 3V5DB 4U1SB 5FYKH 4OZHA 4HKBB 3WSQH 5GS2D 4G6JH 2HLAB 1UT9A 2HKHH 4RMVA 4Y16D 1PLGH 5EU3B 3RNKA 2NW3B 3ABZA 2E7CA 4YFLI 4KK9D 3O3UN 4WJ5B 4X9GA 3BE1H 3X12B 4KKLD 3D85A 4F57L 1JHKH 1OY3B 3JWDH 5ALBH 1FC2D 2Z31A 2YUZA 1SJXA 4LCCB 2J4WH 3TNMB 3WE6A 5GGQH 5IBLD 4X9FA 5CWSA 4EQ3A 5GZNC 3L3GA 3DYMA 4M62L 1T80A 3EDJA 4NO0B 3MJ8A 1IGJA 4RGMB 4QGYA 4F9PA 1UENA 1M05B 4QTIL 3S5LG 3EIFA 1PQZA 1JPSH 1YMMD 4OZFB 2Y5EA 1CE1H 1OAKL 5A2KH 3BXNB 5MERB 1G6VK 4HS6A 2V9RA 3D85D 3BKMH 5ID1B 2QQNL 2PTVA 1XIWB 1HDMA 4A2MA 1QKZL 3HUJE 3CUPA 4GRLD 4M7JH 3KPRD 2VDKH 5CJXA 4PJIF 3C5SB 1P84J 1RZFL 4XAKE 1YJDL 3F7VA 3K46A 1CXIA 1UXSA 3VE0B 2E8YA 3RL2B 5IKCB 3A6BL 2XY1A 3DV6A 4HBCL 3GI8H 1TXKA 3FFCD 3LCYA 1NGYA 4HZLA 3GIVA 1T0NA 2EIEA 2OZ4L 1KJ3H 1E4KA 3RZCC 4ODSL 2WM0A 3HE7A 4JGMA 2P5EA 4J4PC 1J0JA 3MRBB 5DHYA 3QUYB 5FDWA 2D03L 5FO7A 5HI4C 5I76A 4HUXB 1PKQB 1QSEB 2P46B 5JA8B 4D8PA 1CL7L 4MJIB 1HOCA 1CK0H 2Q8AH 2G5BA 2CR6A 1W0VB 3D69A 5IHZB 1JMXA 3BIBX 2KQMA 1QEWB 1IAII 2AJVL 2ZUUA 4PGDA 4ZTOL 1ORSB 1RUKH 3FQRB 4HXBL 1CT8A 1Q94A 3ELAT 3X3GL 3IJYB 2F8VA 3UTPD 2XN9B 4XH2B 1IQDB 1AXSA 3ALPA 1F8TL 1VFBB 3G6DH 4NM4H 4UOW0 5MEPA 3FN0L 4OZ4B 3QEQE 2BY2A 4YDJB 4OZ4A 4P46C 2XICA 4ZAKD 5HYSB 4ODHL 5T1KD 3REVB 2BVOB 4MDJA 3O9WB 4KRPB 5C0AD 1DN2A 2XYCA 2ILLA 1OPGL 1GZPB 5FUCE 5AZ2H 3EHBD 2NY3B 5EOCL 2HJKB 4MAUL 2X7LB 4I2XA 4FTVE 3CLEL 1G7QB 5KS9F 3CXHK 3PWJB 5CILL 4RGNC 2X10A 5JIKA 5J1TC 1YEFL 3G6JB 4GUPA 2VAAB 4UOW1 3P11H 1BVLA 3SGJA 1ZS8B 1E4XH 1KIPA 4PP2B 2GYSA 2FSEA 3C5JB 2IG2H 4XWGL 3VXRA 4LCUB 1DLHA 1JJUA 3DUSB 2APBA 3LKOA 4TVPH 4FQHB 3LRHA 5D1QC 4JANA 4D0DA 5DQ9B 1FG2A 3PABA 5CS7A 1D7FA 5A2FA 1YN7B 2BJMH 4MMZC 3S5LA 1I9JH 3P77A 3S7GA 4PJIE 4YX2L 2FX7H 3TBTB 1OB1A 1OLZA 3OKMA 1JYXA 4Z0XA 5EU4A 1X7QA 2NW2A 1QOKA 3GKWL 3GMPB 4PRHD 2W91A 4U31A 5DMKB 3QP3A 4M02A 3F8UB 4N68A 4KROB 3NA9L 2OSLA 2MMXA 5F7MC 1OW0A 5DMYA 5IESH 2WP3O 1IC4H 1DDHB 1HZHL 2IANE 3KPLB 4RMTA 5DT1L 1HSBA 4GW1A 4PJEF 3NZHL 4KROD 3DVFA 4OFYD 4N8CH 1KUMA 1A64A 2FO4A 4RAHA 1MVUA 1S5IH 3UTSD 2F54B 5I66A 1NGZA 4NM8H 1KJMA 3QZWA 4Y2OA 2FJHB 2XPGB 5HI3C 3K2UH 3EDKA 2XRAL 3MJ9A 4OFPA 5FK9A 1F58L 3WFBL 1T21A 5C09D 3SE8H 5E9DD 1E0OB 1VFAB 4NGHH 3RUGB 3KJ4C 1NGPL 4JQXC 5D7LE 32C2A 4P2OA 5C0JA 4CJ0A 4LF3A 4PJHF 2DS4A 2JELL 1EJ6A 4LAQH 4LSPL 2C4XA 1P5VA 4OM0L 4HUVA 1T04A 4G6MH 3QXUA 2I9TB 5TQ2L 5CJBA 1A9BB 3L3JB 1LD9A 1S7XB 5ISZA 2QADC 4BSVB 4KDTC 1TPXB 2CIKB 3QCTL 3KXFE 4K8RC 3TH4T 4J3OC 4PJDB 2NCMA 5JXAH 2GQHA 5DD3H 4EOWL 4PRIE 3JWOC 4PTTB 1JVKA 3ZKMC 4NQDB 3DVGB 2AV7B 3QUZC 1I85A 1T4KA 1QSZA 2YUWA 2BRRH 2V7NB 1NPUA 1A7PL 4NBZB 4RFOL 5F96L 5FYJU 4XAWH 5J89A 2MQ3A 2VL4A 3NCJL 2VLLA 2OQJB 4CL7A 3QISA 5GRWA 5BOPA 1AKJD 1P9MA 4Z8FH 3EYOB 4HGKC 3HZKA 1ZHKB 1XCQB 4KHTH 4WENB 1NMBH 1VFUA 3NA4A 1TJGH 2AVGA 2EKSA 5FYKD 2PO6D 4DK6A 5IMLA 2BMKA 3BP5A 3LZFH 1OTSD 4MVBD 4U3CA 3TCLA 1T22A 1BJMA 2GSIB 1L4IA 2UWEA 5EO1A 5CMAA 1SYSB 1X5AA 3P4OB 3QO0B 4ZOCA 5C0JB 1A1MA 4GKOA 4WHCA 4HBQA 4I3SL 4N8PA 4MNHB 1T2QH 4OCXL 2XXMB 4QWWD 2VH5H 4U1IA 4KJYA 3K0WA 4ZO6A 3VD7A 1QO3A 1A0QL 4JO3H 1LE5A 5DRNB 3ES6B 3HAEH 3QIBB 1IM9A 1MFBL 1RZKL 1HSAA 1PKQE 4JFEB 1W72H 1G9MC 3ZTNH 1D5MB 3RWEB 2VZ1A 3UO1H 2VDML 4LKXB 1C5BL 2HJFB 5E4IA 2IADA 2QV2A 2XKSA 4O4YH 5J9PA 3ALWA 4JPKH 4X4ME 2RFXB 4QRQB 4HPOH 3J8F7 4QHUA 4Z7UE 1YPZA 2NXZD 5IFAL 2E7MA 4F37F 3R1GH 4HKJB 3WNNA 1ZEAH 5DSCB 2W0KA 2A6DB 5CINH 1RZ7H 1TZGH 2PXYB 4Z7WA 2FECI 2VDRH 5ACZB 1ZHLB 4HXAH 2VLRA 4JN1L 2E5EA 4YHIB 1Z5LB 5T1MA 4XCFH 3RIFK 3MV8A 2L4OA 3SDXF 3HI6L 1BLNB 5GZOD 4BK5A 1K3IA 2IPUG 2V17H 4LVNC 1KC5L 3U7YH 1FYTA 4U0RB 4HUWB 3ARDD 1VKXA 3A0OA 3M17B 1PG7L 2IH1A 5DVNA 4KI1A 3RWFB 4RA3A 3HI1A 4O02H 4DN3H 4XZUB 5M95B 2VLJA 4JO1H 4B0MM 3MCKB 5DEZA 4F9LC 3MRIA 2E7LC 1EPFA 2VWEC 1G9EA 1FH5L 4JFDA 5ELIA 1JFQH 3EOBA 2P5EE 5HGBA 3DVIA 1JV5B 5TH2B 4OCRH 4KRLB 3TNMA 3A67H 2H2PD 4LVOB 5JR1H 4U1KB 2NY2C 5A1AA 3ARBD 5ACZA 4W4OC 4PJBE 5GGVH 3QEHA 4CADA 5I8OH 1CLOL 3PGDB 4GKNB 1MRFL 2V7HB 5EZOL 1OAYH 3Q6FB 3FQTA 3O6FB 2R0KH 1T0PB 5DFWH 1HHGA 5FUZH 1WGOA 1OAZH 3NFSL 4CMMB 2NY7L 2N7AA 3FO2A 4U1JB 1YJDC 4G9FB 4MA7L 1UCTA 1MFDL 3EYFA 3QR2A 4JKPL 5EC2B 2ADIB 4CDGC 3K7UA 3VXUE 3ZE1E 1Z5LA 2GTZA 1Q0YL 1CFNB 1TCRA 4EKXA 1G7PA 2EH8H 4PUBL 4G43B 3X14B 4YIQB 4ELME 4JRXE 5T1DL 3S3JA 1I8LA 4TUOB 1W8OA 4P9MH 5FYJE 3RPIB 2QHRL 4NNPH 1PEZA 3V95A 4GBXA 2KZ1B 2YMXH 4JQVC 3TWCH 4I4WB 1OW0C 4EN3A 1R3KA 2C3WA 3MSPA 4JKWA 4RMWA 4YH6A 1GL4B 4APQC 3KGRA 4K71C 3V4VL 3DWTA 4ETQB 3PF2A 3BGMA 1TZHB 1OLLA 1JZ4A 4P5TC 3F6IA 3PHQB 4LU5H 3TBVB 2Z35A 1KCRL 3MCKA 4GAYA 5BV7C 5IMMB 5IK3A 1YEKL 3OKOA 1IJ9A 2VE6B 1MHEA 5ENWA 3E2HC 1MJUH 2COQA 2PN5A 4MB3A 4ZUSB 1GGCH 3FFCE 2PW2B 2ID5A 5EO0A 5D4QA 5C0FB 3INUL 4NQCE 1GVIA 4FTVA 4LLMA 4LPXA 2ZJSH 2CRYA 3WFEH 3WFHB 2ZCKH 3LS4H 3CXHJ 3PP3K 1A6WH 2WUCL 1AHWB 5TE6L 4PJ8D 1WIOA 2MOVA 1SJVA 3RY4A 4M5ZH 1FFOB 5CJXC 2Y5TB 4UZGA 2R9HC 3LEYH 5C0CB 5I1IL 1IQWL 3FO0L 2BNRA 5FKAB 1WUNT 1HNGA 1N64H 1S9YB 2XTJD 3GSRA 4MHHG 2AJ3B 4U2YA 1KJ2H 1YC7A 2NXZB 3V7AE 4LIQE 5IMKA 2VLKB 2R39A 4MJIA 4LCWA 4KUZH 3HHRB 2NY6C 1P2CB 4WRLA 4XCNB 4Y5YB 1AGBB 3GO1H 3O41B 2A9NL 2DQDH 1IE5A 4Q9CA 3D3VE 3GHEH 1G9MH 4HC1A 1UH2A 5IHBA 3WIFB 3GIVB 5L2KB 2JF1A 3JWOL 4CVUA 5DMJB 3PHQA 5D72H 3Q5OA 3QYCA 4M6NH 5MENE 3KNBA 1F42A 1MIEH 1JUFB 4XMLL 5T5FL 2AK4D 4JHWH 1WWBX 4YDKL 3DRTB 4JFEE 5CKGA 1DLFL 2XZAH 1I1AD 1U41A 4IIQB 5CUSH 4HDIB 5HDBF 2IH3A 1UM6H 2LU4A 5D6DA 4Z78A 3S37L 1AGFB 4WUKH 1FL5A 1SJEB 4WFGD 4LLVA 3RVTC 3CSYA 4HFUH 4L4TE 5MP6L 5GRUH 4RDQG 1HYRC 4FA8A 2D2OA 4QYOA 2AGJH 1KJ2B 2PW2A 2A6JA 3CUPB 3MA9H 1IGJB 15C8L 2Z31D 5C2BL 2ED9A 3OX8B 4NIKB 3EUUA 3JV4A 4OIAA 3QUZA 3JXAA 3NIGF 3DVNA 3NCEB 5BQ7A 1MI5D 4ZSOA 5HTSA 4TNVK 4OLYL 5IQ9B 1K85A 4XPTL 2V5SA 2EEAA 1XCTB 5LCVL 4N5ED 5E70A 3SDYH 4UOJA 4PJEE 4PRHE 1I7TB 3N0PB 3HN3A 5DJAA 3TO4A 2P49B 5LGHH 4K3EH 4H0HB 4WV1A 1G7HB 1X5FA 1GAFH 4JZJB 5HHMD 3O6FC 4LAJH 1PZ5B 3WLBA 3JWNC 5GSRA 5HJ3A 5EZJB 5MHSE 3CFDA 3SO3C 4WWKC 2DAVA 3QRGH 5FM5O 5IVXB 5T3XH 3H0TA 2Y6SC 3DV4B 2OR9L 1WTLA 4WW2B 3TA3B 1G7IA 4W6WB 1NFIA 3LEYL 4XVTH 1KF9B 2L0DA 1XIWD 2JCCE 1U95A 4KRPD 5C09A 2APTA 5C07A 3QUKB 5E9DE 4YWGH 4ZD3H 3UAJD 4XVUC 3IFLL 4JAMB 2JKXA 2WUCH 3FONA 1RJYB 2D7MA 2P5WA 2DLFH 2IH3B 1F4XH 5CGMA 5HYJD 2OSLB 2ZCKL 5F3HB 2WZPD 3LB6C 1J5OH 5IFJA 2NR6D 1U6AH 2X42A 3BP6A 3TYGL 3MACL 2BERA 4PJBB 2UZYB 1TDQA 2VLKD 1EEZB 3B5GA 3DYOA 2NYYD 4PYHA 5F1OB 1GGCL 4NKDA 2JB5L 4TULL 4ONGL 3MLRL 4GUPB 3G6JA 1A7BA 3E1F1 5HI5C 1AGDA 1GOHA 2Q1EA 1YPZE 5TFSL 4UV4L 4EI5D 3UTSA 1KIUA 3V0VB 4FQHA 3Q6GL 2BVQA 1QNZH 2HN7B 1UCBL 3RWCA 4FRWA 1ZT1A 4M4PA 4IRSD 4LMQI 5IM7A 1UQSA 2X70A 1LNUB 3G5YB 5DJ8B 3T0XA 2GJZB 5FOBB 1IL1A 5DD0H 3TYFA 1QBML 4IRZH 4XI5D 3T2NH 3O45B 4KMQA 2D7PA 1PKQA 4EBQL 2EDNA 4Z0XB 3HAEA 3LQZB 4X5LA 5SX4H 5CJQL 5GS2H 5E6ZA 2HLFD 4ODXB 5KOVC 3DX7A 3ULUD 1W72A 1MCWW 3D9AL 2APFA 3UBXA 1EA9C 4HUNB 1A8JH 4NQVB 1PSKL 2Z8SA 3HZYB 4MDIB 1RU9H 5HI5D 4QOKB 1MEXL 1IT9L 3QQ3B 1K6QL 3QIWA 4P57A 3IAQA 3L7FB 5IOPB 3KPSA 1FNFA 4KMLB 1EGJA 1LO5A 3QHFL 4IMKA 1L0QA 2YPKA 3Q5YA 4OM1L 5I8CA 1KN4L 2BSTA 3BIAX 1OAYL 2C3VB 5IBTL 1MRFH 4FQPA 3HLAB 4CN6A 2OXHA 1EO8L 6FABH 1YPZB 4TSAH 2N4IA 3SO5A 4YXHH 4OCMC 1BFVL 1MCHA 1SMAA 4AENB 4ACPA 3L3KB 4X6CE 5KVEH 3DGGA 3QQ9D 1C7SA 2BNQB 1C5DB 3HZKB 4P3CL 2M2DA 2VLRB 4U1NA 3SQOL 1KCVL 3V4UH 3GDBA 4GRLB 2HVJA 4X7TB 5MENA 1RHHB 1QA9B 3O6FD 2VDQH 5KVMC 4EVNA 4LDEB 1XFPA 1WICA 3PWUB 4P2CG 4ZUWB 2YC1B 3HMXH 4NQDA 3Q5TA 3C6LD 1IILE 4OD2B 4PLJD 1R6VA 4YK4B 4NZRL 2QJDA 3OAYH 3SQBA 2EC8A 3ZL4H 4HG4K 1MUJA 5DVMA 1BREA 2PO6B 2X4NA 2JJSC 1RUQH 1E27B 1DQML 2JJUA 3EJZC 5AYUH 1NMAH 4HT1H 3CD4A 4GAGL 1MLBA 3QO1B 1CG9A 1MWAH 4JN1H 4J7RA 2BSSB 1TTFA 1O5DT 1A7RH 2B8OT 1JBJA 4MXWL 1LO5B 3O9WC 1IGYB 2Y7QA 4P57B 3AS0A 3R1GL 1D6VL 1N6QH 2BSRB 4BKLA 4ZYKB 5IFAH 2R2BA 5DVOA 5DK3A 3SO3B 5IEHB 1H9VA 3MRCA 1UKQA 4PJ5B 4RISH 4ISVB 2FRGP 3TPUA 1KGCD 3LMJL 3PGCB 5SX5H 1GGIH 1F3RB 2D0FA 1AJ7H 1OGAD 1LWRA 3FB8B 4NYLA 2VUYA 5D7KD 2NX5D 5L0QB 1HI6B 1YEDB 4HH9A 4GRMA 3HR5A 4V1DB 5LGJB 4XVSH 3HCVB 1S78D 5C0DB 3W11C 3WFZA 1WTGT 4PB9H 3GBLA 1MFAL 1A9BA 4J3VA 3VXRD 5DLMH 5F7WC 2IGFH 2H9GB 3LAFA 1DQQA 2NYYC 2J88L 3QNZA 2IAMC 3SDAD 2ESVA 4YHML 3ZE1F 2QQLH 3BZ4A 1AY1L 2VISA 3AMKA 3GSVA 1SVZA 4PJXB 4Y19D 3S35X 4KKCC 1REIA 3PGFL 4YFDB 1ES0B 1A7QL 4L4VB 1AP2B 5HGGS 2WBJA 5BJTB 3VXUD 4FFYH 3D0LA 4U1MB 3MRPA 3HNVH 4ZUUA 4OF6A 1ZGLM 3HZVB 2I25N 4P46A 2APXA 3I85A 4XNUH 4LKXA 5HGDB 1MCQA 5E9DA 3C5ZB 3IF1B 4L5FL 1CLCA 1K4CA 3FOLA 1J8KA 3T3PE 3UROR 4RFOH 2ERJB 1YNKH 3O2VH 5ITFB 4ZUVA 5K9QG 2EE9A 3QXDA 3FZUC 2R1XB 1A7NL 1BLNA 4JCMA 4NQCB 1U2HA 3OB0K 3ARDA 4M4RA 1HI6A 3QCTH 4HH9B 5D2NC 1KEGH 12E8H 3LN4A 3WUWG 1QVOA 5I73B 1NGWB 3LQAH 4DGYL 5TQ2H 4JFPB 3RI5K 1BVKB 5E8NA 2GSGA 4PRHA 4BSWB 3CFIC 2J8UA 5HGHA 3LQMA 4PR5B 4NT6B 3IDYC 4HHAB 3LV3A 4HHAA 1D6EA 3VDAA 4HMDA 4G7VH 4OAWA 2JIXB 1ZWIA 1TJIL 5F7UA 1T0MB 3UTPE 5D7IE 5JQ6H 1IBGH 3LKSB 4XZUA 3MNVA 2BC4A 2GITA 3VXNB 5I75C 2CLRB 3L3DB 1PEWA 1YN6B 4G5ZL 2VTFA 3MA7A 1A2YB 1N59B 3O6KH 1MSPA 3MLZH 4PJDE 2PUQT 1CVSC 2E9JA 4P5KB 2OTUA 1BBJA 5DZLA 3K4DA 3GI9L 3GMMA 4MX7A 5CJ8A 2P47B 5ITBL 3PHOB 2V2XB 3ROOB 3I6KA 2CMRH 4K9EH 5T1LD 3C09B 3IGAB 2F19H 1IM9D 5FA4A 5B39A 1HDMB 3TVMB 4X7SH 1JGLH 3WN5C 1SEQL 5E9DB 1LE9A 1U3HB 3EO1A 2GJ6B 3U1SL 2V9QA 5E6ID 3HMWH 3OV6A 3O41A 4PJFB 1P53A 2HG5B 2Z31C 4DKFH 4P5TA 1M7DA 4JY6A 1R5WB 1LQSR 5TDPA 1PGRB 2X2YA 4FQXD 1EV2E 1FNSH 3EJJX 4ETQA 5JORB 1ORQB 3KXFA 5E8EA 1ZLVK 4ZNEA 4OGXH 5DJDB 5H35B 4KTEL 2F19L 3PL6B 1NSNL 25C8L 5K93A 4RWYL 5C09E 5KSBE 1MRDH 3HPJA 3EYUL 4LSDA 5HHMB 1R5VB 4TNWF 4WFEE 5DYOB 1DR9A 2ZSWA 1P6AB 1VPOL 3UYRL 4M93C 2CIIA 2AK4B 1QLEH 5AZEH 3SJVA 5FYJL 3HR6A 1DBJL 3RUGE 4G5ZH 3KG5A 5EO0B 2EDKA 3I9GH 1UA6H 1UA6L 3ZYZA 1VGKB 5EOQL 5SWSA 3MRGA 1TZIB 1CD8A 1T5XB 3BKCH 1KENH 1A3LL 4H8WH 2ZWLT 1EEUA 2GJ6D 3KXFD 4MMXC 2FX8H 2NY1D 3FN0H 3ZSTA 4FFZL 4HWZA 4CNIA 2HYMA 3MFFB 1F8TH 1GJIA 5MHSD 2EDYA 1IC7L 3F7RA 4QXTA 3TA3C 4LQ1A 5JORA 4HKZA 4HXBH 2BNRB 12E8L 5FKAA 1NCCL 2HT4C 3ARTA 4G7YL 3UEZA 5HHPA 5I1KL 5GQBA 4HX1B 4OZIB 3BH9B 3P9MA 4O2FB 2GKIA 3TIDA 1A7NH 1B0GA 3U1SH 5DC0A 5GJTH 3V6ZB 4ZS6D 1A3RH 2C5DC 4L3EE 5DZNA 3TJEL 2HVKA 2D03H 3W82A 1YNKL 1D5ZB 4Z6AT 4C55A 4LCWD 5HPMA 4JRXA 5EU3A 2HTLC 2G5BB 4TVPD 3CFKB 1FV1A 1AFVH 4NQXB 5SWSE 1CFBA 1AIFB 1PBYA 2EDHA 5EBLB 1SBBA 2VE6A 5GSRB 1KULA 1JGEB 5JPMB 4MS8C 2CQVA 5GRVL 3GMNB 1F00I 2Z31B 3HB3D 2VDKL 2FZ3A 2O61B 2ARJB 1NKOA 3OKYA 5D96B 4XHQA 1U3ZA 4Z7WE 5EORL 4XH2A 4WUUE 1U8LA 3LY6A 1YECL 3G6JF 4PRIA 1RZIB 4RAUB 4MYWB 3ZHLA 3FMGL 3A6OA 4XBGA 4XBPA 1IEAA 2GW5A 3B83A 4URTB 1Q9LA 2NQCA 1R24B 3E6FA 2B1AH 5CGTA 4LPVA 3X13A 1HH9B 4QXWA 1L9NA 1MFAH 3I3BA 2DLHA 4DGYH 3HUJB 4MD0A 2NY4B 1QBBA 4NKOB 4M62H 3RUGF 4NO3A 4L3CB 4K8RD 3DSFL 3VW3L 4WV1B 3QI9B 3S4SA 1RZ8A 2GAZB 5E8PB 2JCCA 5DJZB 4Y5XB 2CR3A 4KUCD 1IZKA 1IC5H 1GGIL 5TPWH 5JOEA 1J0HA 2FBJH 1KFAL 1JZ7A 3TVMD 3VJ6A 2HKHL 3ARBC 3WIIL 3OGOE 4GW4A 4Q6IA 2HFGL 1AC0A 4X6BB 3UTQA 4Q9QL 3WSQL 3BWAA 4XNUL 5EOTB 1CR9H 3OZ9L 3DX6A 1R5IA 3RWIA 1MI5A 4KVNL 4YXLL 4CVWA 3N1GC 4XCCL 3G9AB 5JDSB 4FFWC 5HI3D 4MXWH 4PJGF 3HNVL 1MWAA 4DOHB 3D5OF 3CFCH 1JGEA 3AM8A 2WLZA 3HNSL 5EBLA 3OGCB 2FR4A 3TLRA 3BJLA 4W6YB 2H26A 3QNYA 2DKUA 3VGAC 1G84A 2NTFA 5A2IH 4ORZC 1T89C 5IJVB 2XACC 2BFVH 3T0VA 1FG9C 5ERWA 4D0BB 3QPXH 4NRZB 4R90H 5BV7H 3MLUL 4TTGA 1RK1A 5J6HA 5TQ0L 2DBLL 1QRND 1AGDB 2X05A 2IGFL 3QIBD 1Q9KB 5IB3B 3G08A 3OF6D 2EDRA 1JK8B 3OKLB 4Q74A 2NPLX 3BWUC 1AXIB 4I77H 1F3JB 5I1AB 1BGXH 1Y18A 1NC4D 1S3KL 3MJ7B 4GKSB 5J3HC 3UP1A 3IETA 1HN1A 3VXME 5EB9A 1C5DA 3CPLA 5K33A 4WEBH 4D0CB 2E6JA 1N6UA 4P3CH 3WKNA 4B41A 2EH7H 1AJ7L 4HF5L 4PJAB 4X80L 3P0VH 4JFOA 3GJFH 3UTZA 5KSAD 4RIRA 4R2GB 1QBLH 5KTEH 2FL5A 1CI5A 3S36H 3T65A 1A6AB 3FQRA 4Y5VC 4S11A 3DX8B 3FRUB 3UX9B 2EKSB 4EVNB 1T04B 1WEJH 4M43H 2P5ED 3V6FB 3ISWA 5F7KC 3N1QC 1DQDH 4X99B 4QHKJ 2BVYA 4TUJA 4LSRH 1A1MB 3HFML 4K94C 4ZPVA 1VA9A 5T33L 1LK2B 4HT1L 4HCRL 3U6RB 3IFPB 2B2XH 2YS4A 1J0IA 1RUQL 5HHOA 1Z3GH 1JF1A 3PE9A 3MLTB 5AAWA 1E27A 5DQJA 1FHGA 1T1WB 3QUXC 5ERWB 1L6ZA 4KPHL 1I8IB 5JIIA 5C0RH 1MVFA 3VXRE 4KI5D 3RNQB 4AYFA 3BUYB 1VFOA 5D5MF 2EXYC 2FIKA 5JHLL 1F6FB 2YPVH 4JB9H 4KAQL 1EFXA 3FRPA 4QF1A 1DFBH 2G75B 1A1NB 1QBMH 4IRZL 3IDNB 4OCSH 3SDXB 1BM3L 1NMCB 5DK0A 5JW4Q 2OJEB 3PWUA 2WSKA 1WC7A 2A77H 4UB0H 1H3TA 3C8KB 2DQTH 2NX5B 4P2QB 4OIBA 2KDGA 1QNZL 5GRVK 4X4ZA 3I2CL 1K5NB 4C59B 3TBTA 4WVRA 1II4E 2ZCHL 4IOFD 2ZKHL 4KJYB 1S7WB 2GHWB 2XFXB 4AMKH 1XMWA 1TQBB 1BFVH 4PJHB 3CMGA 2ZOLB 4LGPB 1YYMH 4XPAH 4NZTL 4WHYG 5I30H 1Q0XL 2JB5H 3C9NA 4TULH 1NL0L 4XC1L 2ATPA 3EGSA 3KPPA 5FA3B 3MACH 1MCKA 1LEIB 1UWXK 4XNYH 5C0BE 4OM1H 3O6ML 4WTZA 4PS4H 1ZK9A 4R97B 2EXYD 1OWWA 4J12A 3FHAA 5BVPL 4QT5A 1CLYL 5DJXB 2P24B 4L8CB 2K9UA 1MEXH 4TTDD 3TPUB 1P9MC 2QKIA 1GSMA 5C9JB 4YBLB 4XNXH 3QUMB 4ZSOE 1U3YA 2VLLB 5HD8D 2MJWA 4P5KA 3O2DH 5D9SA 1RULL 4U49A 1WSST 4CVZB 4N90D 2IAMA 3TBYA 2XQYK 1G6RB 4EBQH 5GZND 2YD1A 2ZOKA 5HHNB 5FECA 5I1GL 1H15A 4RDQF 4YO0B 3U82B 4ZOBA 3MRDA 3OJMB 4Y1AB 2MCPL 3TN0C 4KKLC 2VDNH 5D70H 4PY8I 3CVIL 4WHYH 3SDYL 3KVQA 1P84K 4JZOB 1BQHB 2Q8BH 4NT6A 3BQUA 2AS5M 3QWOA 4PV9A 4OLYH 1OAXH 5F9OH 3BPNC 4D9RE 5KAQF 5BXFA 2QL1A 2F5BL 4ELMA 3BRGC 1F90L 4LRIC 3MA9L 4L8DA 3OAZH 5IWLA 3QEGL 4K94L 1DVFB 1TVBA 2YWZA 3S98A 3TYGH 1A6ZB 3MRFA 3MLYH 3KPSE 3FJTA 4APQA 1HXMB 3ARBB 5E6IC 2AV1A 1MHPL 3NGBC 4JPVL 5E2VL 3GSOA 5ECJE 4MB4A 1NDMB 3VWKD 3PV6A 1DLFH 3EZ8A 1Q9OB 1MAJA 4LHUG 1UH4A 4YDKH 4IHOB 4TNVF 5JW4R 5CJ5A 3GM8A 5J9PB 1FGVL 4WW1A 1J1PH 2K7QA 4NQEE 4JN2A 1H5BB 4WIQA 4X83A 3U79A 3STZB 2BDNL 2Z8VC 2HKFL 5EULV 5AD0A 1WT5C 2A6IB 5CEZL 3JWOH 1XH3A 5KSBF 3QRGL 2A6IA 4OZHF 1FVCB 3LKRB 1SVCP 2XT1B 2OK0H 4JM2C 3GHEL 4K8RH 1GPOL 5GS1A 4XT1C 3KHOA 2W0LA 1SEBB 4JY4A 1O0VA 3ALXA 1MCSA 3SE3C 2AJ3A 2YN3A 1YQVH 3CX5K 5E08H 1LO0H 3EHBC 1H3VA 3LRSA 4JY5L 4G6KH 1AD0B 5F72S 3PL6C 3UZEA 4QEGA 1I1CA 3HPJB 3ARRA 4P5TB 4M8QB 3GBNL 1X5JA 2VL5B 3QUXB 1T1ZB 4G42A 15C8H 4XP5H 2FD6L 4Q2ZA 1DSFH 1OARL 5J1SC 3INUH 4Y4KC 1E4XI 3MRIB 5EUOB 5FHBL 4PJ7A 2VLMD 3TJHC 2VLJD 5C6TL 2P8PA 3CMOH 1QFWL 3LKPA 5JA9A 3CC5A 3C60D 3KYOA 3SE4C 4F3FB 5KVGL 3V5KA 1JI2A 4OZFA 4ZODA 1EBAA 1FGNL 2AI0H 4JR9H 3PWVB 4XGZB 2YSSA 3QJHA 4XMLH 5T5FH 3WS6A 2Q20A 1NAML 4RGOH 1KV3A 5K9KB 2DQCH 3IDXH 4M5YH 5DHVB 5E6YA 2V5YA 2QQKH 2C1OA 1MFCH 5C0FA 2A73A 2DLIA 4O2CA 1WFTA 5GGRB 2W59A 5MEPB 3GSQB 1HYSD 5I71C 1G9ML 5C1MB 1WISA 4OZIF 1F5WA 3QFJB 2YBRA 3RY5A 1C1EH 1YEHL 2YPLB 5CBEA 4JY6B 1YZZA 3CDCA 3BISA 4LVOC 3MBEA 2WWKO 2X9XA 4KUZL 4OLXL 5D1QB 2YD7A 5CZVH 2XI9A 1OGAA 4UIKL 3FO0H 4OTXH 1Q0YH 1BP3B 3RVUD 3MLXL 2VSDA 4M5ZL 3NABH 1FZKB 1INDL 4I0PC 4EUPB 2VAJA 1V7MH 3Q3GA 3NFSH 1OAZL 3Q0HA 1FJ1A 2OR7A 5KANI 1NANH 2CRIA 2OYPA 4M8QA 2VN4A 4AT6A 3C60A 2ZJSL 3WL9B 4MQ7A 2ZG1A 2X89A 4KGJA 4ONFL 5E2JA 1DQLH 4I18A 5F6IC 3BHBB 1CLOH 1KTLA 3DBXB 5FDYA 3T8XA 5T3XD 1QUNA 4NO0A 4POUB 3MNVB 4FFVC 4IOFC 3OTTA 4NZUH 1OP5K 3TT1H 4D9LH 1LK3H 1MJUL 4MQSB 5A3IC 4R6UA 4BQ6A 2HMIC 1ZLSL 2B0SH 4XNMA 2CUMA 3NGBB 1RVFL 3EYVB 4BZ2H 4EQ2A 1HWHB 1UM5L 4U6YA 3BX7C 3QBTB 1FVEB 1B0RA 2XZCL 2YA0A 3LS5H 4GFTB 5D96C 1P7QA 1T3FA 2CSPA 2HRLA 4QXGH 5CEXA 3ZKQD 3V4VH 2VQ1B 2DQFB 3U0TA 1RUAL 3FKUS 1B0GB 2WUBH 4G9DB 3UJJH 4MNGE 4DGVL 4YHLL 5GIRA 3SGDH 3RWCB 3GJFB 4NNXB 2CO7B 4LASL 1RIHH 2LTQB 3AXLA 5T1DH 1KXQE 4GRWE 3WFDL 2YRLA 5ISZD 4PRAA 1BFOA 3W9DB 1N5YL 1PD6A 3FQXB 4JEGB 4LLQA 5B22A 4NWUL 5C0EB 1QPXA 4KHXL 4M7LH 3S5LB 4WJ5A 4NHUA 1MFDH 4UNUA 1EGJH 4YHYC 4MHHI 1FAIL 1CU4H 5D7IB 1U8PA 3T4AB 4PJIB 2YD6A 4H20H 5CINL 1FZKA 4PJGA 2F58H 3D69B 2NNAA 4JFXA 1N0XL 3P9MB 3H0TB 3W2DL 3UBXG 3O3AA 2DKMA 5DRWA 3IJSA 2R2HB 4YHPA 5I8OL 3CLFH 3ULUH 3G5XB 4O9HH 3D2UA 2VXTH 3FB6B 3IDGA 4NQDE 4OZGE 1CDBA 5DR5H 4JPKL 4UIMA 3KLHC 1NCBH 1R5IB 3I02A 4KY1L 1I1FB 2R0WL 2WP3T 3N9GL 5DC4B 2PCPB 5IMOB 5CEYB 2OXGA 3ZTNL 4TOYH 1ZANH 3QDMB 4D9QD 4GXVH 2OBGA 1PYWB 2MCG1 3GEWB 3CDGB 5JDJA 3BDXA 5FYJD 2NZ9D 4JO3L 1JNNH 4JO1L 1I3GH 2IMNA 1OGAE 3JWDC 1RZ8B 1N3NB 1YNTA 4AENA 2A6JB 1OSPH 2DQJL 4WUUA 5FGRA 3RNQA 3D1MC 4DAGH 1CLZL 3T3MF 4Z7VA 3D2UD 5KVFL 2XQBL 3WS3A 5F9JB 3MLSL 5EH1A 1XGRB 1HEZA 2BSTB 4K2UL 2BOCB 1BD2A 1EBPA 1PY4A 4ZSOB 2GY7B 3HE6D 4HUMB 5AWNL 3DX6B 5T3ZD 3G5VB 5HGAA 3MROA 4XNQA 2FWOA 3MRBA 4KKBC 4OGAC 2YC1A 4QOKE 5EU4B 4FHBD 5KS9B 2V2WB 3L3HA 4Y5VA 4HKXB 1FFPA 4DZBB 4BH7A 2A0LD 3TVMC 1FO0A 4Z78B 4WEMB 3S35L 1N0LA 4GRLA 2Y25A 3FFDA 4M7ZB 4ODXA 4X7TA 2H45A 5DA4A 5ANMA 3QUML 4G8EA 2GEEA 3GJEA 3WFCH 1FNGB 2BVTA 1KG0B 2NXYC 2ZPKH 5JOFA 4NRZA 1A7PH 1KPRB 3BMWA 5CIPH 3DX9B 1U93A 3L7FA 4OLVL 5DK2A 3UO1L 2HJFA 3P30H 3CZJA 5JO5A 5ESAB 5DD3L 1NEZA 1JHTB 3E2HB 4BFIA 1ZTXL 4G8GB 2CD0A 3OXRB 2XTJE 3BYYA 1F3JA 4XCYB 5I1AA 1RMFL 4JHZA 5EDXA 3BO8B 3PGCA 5HHOB 4XVUD 1XR9B 2VH5L 5FHAL 3AGVA 3OR7A 3BZEB 3DMMA 2K7PA 4I3SH 3C6LB 4MD4A 3TBWA 2Y23A 4PTUB 3JV5A 2M1KA 3WIHL 2H3NA 4NQEB 1HIMH 4HIEA 2GT9A 1DP0A 3C2AH 5E8OB 4X8JA 3ARGA 1JK8A 3OKLA 5D2NE 5DVKA 3PV7A 3BP5B 4NN7C 2BVQB 1ZHBB 1RQ5A 5C07B 3KYNA 4NM8L 2VLRD 5E24E 5E5MA 2OJZH 1S5IL 1SY6H 5F7EL 1P7KB 2HFFB 5DUMH 4X7EC 5LWYL 4F7TA 2I5YL 5FGBA 2R2CA 2X4UA 4L4TD 1Q9WA 1TENA 2NY0B 1AQKH 5F96H 3C9NB 4M6OL 1BBDL 1S7TA 1H5BC 4U0QB 2ZUXA 2AV1B 1IGCH 3GMLB 4JVWA 3S96A 5DA0B 2ZUTA 3C60C 1KJVA 3SCMB 1MI5E 2J7LA 2OTWA 3PWPA 3NPSC 5FF6A 4LEOA 4EOWH 1ZVYA 3HKFA 5F9DC 5DD1H 1G7LB 2R4RH 3QQ4A 3MRLB 3O8XB 4HQQH 3GK8L 4QHUB 4Y16B 1IARB 4ZUVB 3GBMH 3UC0L 4RAVA 3DURB 1BBDH 3GB7B 1S7VA 3PDOB 1I7ZB 1MJJA 1U8NB 5CSBA 5J6GA 4LAQL 4LSPH 5H2BB 3P2TA 5DEFA 4NYLB 2AJSH 4ERSH 5DEFB 3T08A 4LMQE 2ZOKB 1ITCA 5CILH 4YZFE 4JO4H 2YHGA 2BHYA 3V6BR 1TTUA 2DM7A 3KPPB 1BQHA 4MAUH 5DRNA 4Z77A 3ILPA 3T09A 3ILPB 2OS7A 4U1IB 2D7NA 1X5GA 3H42H 3FT4B 1HIML 1JPGA 1J05A 4QCIA 2SEBB 2EEDA 1OT2A 5HYJE 5E7FA 3RRQA 4PRPD 3O4LB 4LCYB 1LEKB 3EO0B 4YQXL 1KLGB 5L7XL 3GBML 3QNXA 3WLWD 4ENEC 4LLDB 4FQQA 4IRSA 2WIIB 5EWIL 5HYEA 1RMFH 4GMTL 2R4RL 1QD0A 4ZTOH 5KSAA 2B4CL 5DD1L 3ZDZE 5B39G 3P30L 3IGAA 1I8IA 4RGNE 1G7LA 1FFQA 1SHMA 3PHOA 4YHIA 5T1MB 1GGBH 1CL7H 4LEOB 2BJML 1BIHA 3IYLW 2AJUL 1IGCL 4XRCB 4L3EA 3BW9B 4XNZB 4JG0H 1SBSL 3VI3E 1VGEL 2X4QB 4TVPL 3FZUD 1IM3B 2QSVA 2P8LA 1JPFA 2IG2L 4C54A 3OMZA 1ITBB 1EAJA 1E4XL 2MKLC 3FHQA 4HBCH 1CF8H 1YEFH 4L8BB 1EXUA 3IS1X 1PKOA 5D6DC 5C0GA 1DBKL 2Y72A 4LPWA 3I6GB 5I1DB 1SEBA 3CLEH 3WO4C 4Z7WB 4Y2DD 5EUOF 3FB8A 1QLFA 3U9UB 4DZ8A 5L8LB 4ZUTB 3T0DA 3HI1B 4PYGA 4XC3L 5AZ2L 2ESVE 3QNXB 2D4FA 2HAZA 4HWNA 3C2AL 3R8BB 2PYEB 1QTYT 4Y4HB 4ZUUB 1CFSB 2VUOA 3X3FH 4EI5A 1EFQA 1UWGH 3P73A 1I1YA 2BXZA 5KVFH 4XPGH 1QR4A 1JPSL 1FVDB 1F11A 3U0PA 3MJ9L 2HRPH 4JQXA 3WNPA 4IS6A 4HFWA 1RJZA 1BBJB 3RQ3A 3T0EA 4ESKA 3MJ6A 1I1AB 4CBPA 3HC3H 4EJ1C 4PJ9B 3SDXE 1V3JA 4ZFFB 5K9OA 1TPXC 2R0WH 2RJMA 2H2SD 2M8XA 3GSNA 4I9WD 3BE1L 5IT2H 4P46B 5JQHC 3M8OH 1G1YA 1JYNA 2HTLD 2VXTL 3OKEB 1VGKA 4G9FA 5DFVD 2XZQH 4E0RB 1IGTA 3KLDA 1V8HA 1UADC 4QHKI 2OZ4H 2C7UB 1M7DB 1EX0A 5CHNB 4WWKD 4R2GC 1OP5H 5I19L 1XH3B 4GKNA 5T3ZH 4UT7H 4NN6C 5CBAA 1I7UB 5DRXB 3Q48A 1MIMH 4GBXB 1AHWA 1BIIA 4P23A 4PREA 3BPCB 2VISB 2VKXA 4KUCF 4OSUH 2F53E 1FAIH 2ICWJ 3SDCD 3IT8D 4L8DB 2YRZA 3L7EB 3VXSB 3B43A 4BQ9A 5AWNH 1J18A 1NFDF 2A9MH 1FN4B 2QQNH 2IALA 3CXDH 4MA8H 1QHPA 1CWVA 1NGQL 4MZ3A 4N0CC 1VSCA 2HWZL 3QH3A 1ACZA 4LCCA 5ESQA 3BH8B 2YSSB 4K55A 3L3OB 3MJGX 4PRHB 2WUBL 1WAAA 2DQJH 3MQIA 5IK3B 1O7SA 1MCNA 3F58L 2UZIL 1JIBA 3NVQA 3MJ8B 2ZUSA 5KN5B 3T1WA 3Q1SL 5KS9E 4GXVL 3QT2A 3VXMA 2EZ0D 1UM5H 2KL6A 4GQPH 5BW7A 5D7LA 2Z93B 3QG6A 5D7KE 4E41D 1RVFH 1CXHA 1IEAB 3N9GH 4YDJA 5F6HJ 1TJHH 4O2EB 1ZLSH 4XMPH 5SWZA 3LN4B 4DQOH 3DXAB 4NZUL 3TT1L 3ULUL 4G6JL 1A6VH 3S4SB 5IVZA 4NWTH 5AG8A 3IXAB 3UCRA 3MX0A 1AHWC 1I4FA 1FDLL 3RTQA 1IAOB 1XGPA 4GAFB 4NQDD 3S34H 3HC0A 2YK1L 4GH7B 4H20L 5C0AB 3RIAF 4Y19E 3H9HA 3CFDB 1BQLL 1T6VN 3TN0B 1JZ3A 2VITB 4F7CB 4JPIB 4HUXA 3NZ8B 4CW1A 1N5YH 4D9QE 2P45B 4FXKB 5HVHB 1NFIB 2R9HD 4YHNB 4WGWB 4I18B 1RIHL 1Q1JH 1AGCB 3VA6A 4OLXH 4R26L 3BH8A 3D18B 1E4JA 4MAYD 4ZOAA 4ZO8A 4LSSL 4PJBF 3OWEA 3DHMA 1BVZA 3GMPA 4E41B 4HWBA 3B2VL 1R3LB 3DRQA 1IKNA 4PRIB 4CVXA 3VD5A 4LPCA 4E42A 5HY9B 1P7QB 4QYOB 3HE6A 4JZNB 1WWAX 4BZ2L 2GK0B 5T3ZE 1UB5B 1I8LC 1BEYH 5IB2A 3MV11 2H32B 2AI0L 4H25A 2YBRB 2B0SL 4YDLC 2XG4A 5KVGH 1LK3L 4D9LL 2AJYL 4EI5C 3WKML 3REVA 1F2XK 1DE4B 2Y06H 5F7NC 2H1PH 5C6TH 3VG0H 2GUOB 3KPOA 4O5LL 3IXAA 1J1OL 1DSFL 3U4BH 3S3PA 5CD3A 5HPMB 3V8OA 4FQXB 1MQKL 2VXQL 4L8SA 4ZXBB 3SBWA 3TF7C 2BY0A 3MUGB 3AU1B 1DTUA 1HINL 1ONQA 4FZ8H 3AU1A 1INDH 2W1NA 4O2FA 3WJLA 3DX8A 3FRUA 4CN1A 3Q3GB 5DQ9A 4HAGA 4GBXD 4N90E 4LL9A 4AM0A 3D39A 1TETH 5TDOA 1AC6A 5IQ9A 1DLHB 5BMFL 1SY6A 4XVJH 2W9DH 4UIKH 3F5WA 4NNYA 4JY5H 4PJDA 4IIQC 5SWSB 3AM8C 3CFKA 3CPLB 4WDIB 4OGAD 2PXYD 4JRXB 5L88L 4Y4HC 4R7DB 1RAMA 4JM2D 3MRHA 3O3DA 1CICD 4XCYA 4G8EB 4LQFL 1FL6B 1Z9MA 5JDSA 4D9RD 5IHZA 4CAGA 2VXVH 1QYGL 3U83A 4O51A 2QQKL 2R0LH 5HY9A 3BPOB 4E42B 4OKDA 4XP6H 2WNGA 3RIAK 4NKDB 3C5SA 1CYGA 4XPFH 5J11B 4N0FB 3B8SA 4UILH 4FP8H 4JR9L 4GT7A 5IB4B 1VFBA 2ARJQ 5M7QA 5FK9B 3TO4D 5E8PA 4ONHB 1UWEH 2C3XA 4HZLB 1OAQL 1BD2B 1RHHA 2CH8A 4AIXA 2WINA 2CJUH 1HEZB 4J3UA 4JLRA 2WBWB 2BX5A 2IFFH 4L3AA 3MLYL 4ZFGH 4XB8A 1OARH 4UNTA 3KPQB 4NQED 5FGCB 4Q0XL 3GRWA 4BJLA 1XGTA 3BKJH 3FB7B 1LDSA 2N7BA 1FLTX 2VNCA 5I18L 5GRYA 3WNKA 4LNRA 5IGXL 2IFGA 5I1LA 2ICES 4G8GD 3QDJA 3L1OH 5BS0D 3LPGA 1RUPH 2XN9E 1AO7B 3GJEB 3E6HA 4XPBH 4F7EB 1XGRA 4AJ0A 5CFHA 4JRYA 1FO0B 2MCPH 4P59H 1FNEA 4ODWB 1AO7D 1YQVL 2E7BA 1JP5A 3K80A 5HDBE 1A7OL 4EIZC 3MROB 4XNQB 1LDPL 1VERA 4LDOB 1R3JB 5DJYA 1NGXB 5GGRY 4ODTH 1E6OL 3SOBH 5IFJB 3FT2A 3UTSE 1JTTA 1RZJL 4XNXL 3JTSB 1FL6A 1YNLL 2NY6D 4DKEH 4YLQT 2C3VA 3DO7A 1FGVH 3RWDA 1JNLL 2G60H 5FO9B 3PWJA 2BCKA 3L1OL 2E7HA 5JMRA 5CCKH 1YNTB 5IGXH 5BVPH 3F12A 1SM3H 4Y16A 1AD9A 4PD4K 5MI0C 1H3PH 5ICXA 5IB4A 1FORL 4NFCA 1KLUB 1UB6B 3LEVL 4PD4J 3WO4B 2DICA 1WZ1L 2EXWC 3MOBL 1BAFL 5JHDE 5SWSD 1OAQH 2KQNA 4LEXL 1YYML 4XPAL 4D94A 1F90H 1C08A 3VXPB 2X89D 2DWDB 5C0BB 4HLJA 4UINL 3NH7H 3HAEB 3LQZA 5CGYD 3BRFA 4GXUN 3QQ9C 1YEIL 4KZEH 1S7TB 2Q8BL 2CO6B 3BEVA 5IB5A 4F7EA 2DQTL 3C6SB 2PO6A 1S5HB 5A40E 1QPPA 2JCCF 5TE7H 5A16B 4YEEA 1JPTH 1KB9K 1MREL 3UTOA 5LGJA 2VXVL 1DDHA 4JQVA 2E8ZA 1JF6A 5JUEH 2JJVA 4ODBD 1W8NA 3QAZC 1KPRA 4M7KH 1XGUB 4P49A 4PJXA 3PXHA 4KPHH 4UBDC 1T66C 4I0KA 4PGJA 3D0VB 2ZUYA 5TE4L 4ISVA 2EYSB 3AS3A 4K9EC 4XVJL 5BMFH 5EUKA 1LK2A 3PG2A 2YR3A 1L7IL 5KJRH 3WBDA 3V52H 1CQKA 3VRJA 2I9LA 1TVDA 4AG4L 1OOAA 1HINH 4PV8A 3S4SG 3BUYA 1QZ1A 2VXQH 2UWEB 5EO1B 1DBAL 5I0DA 4JFZL 1DQDL 2NTSP 1A6TB 2W9EH 1CFNA 4QRSB 3X11B 3MUJA 4OF3A 4XNYL 4O5LH 5DFVC 2OJEA 3UZQA 2C7UA 2BP3A 2X4SA 5I17A 2AJYH 4HS8L 3FQWA 3BIKB 4N0UB 1U8IA 4AY0A 3MGOA 3RL1A 3MODH 3P0VL 4HF5H 3HG1D 4L1HA 1EXUB 1T7WA 3VFGH 3M1BA 4OI9A 4NCC1 4PGZA 4RMUA 1MJ8H 3P9LA 4M7LT 4OIIL 4K3DH 1K8DB 3NCBB 4GO6B 1CGXA 2FJGB 3DROA 5K59F 3KR3H 2XIDA 5GRJH 5FEBA 5CSZB 1MLBB 1S9XA 4FS0A 3UJTL 1CFVH 4D3CL 1NEUA 4HEPG 3VMNA 2O5XH 4FABH 5T1KB 1QRNE 1TVHB 1EEYA 1VESA 4C56A 4EXPX 5JHLH 2VZOA 4J6RH 1K8IA 3UJIH 3QDJD 5IV2A 4I3RH 3CVHA 1Q1JL 2VXSH 2KBGA 5I0ZA 1U8QA 4Q9BA 1JTPA 4WI7A 5SV4A 1C12A 3HPLA 3LH2H 3MRDB 4YHZL 2B2XL 2P8LB 2UWEE 2CK0L 1ND0A 1RUML 3BPOC 3HNSH 3RJDA 1I9EA 5T33H 3C2SA 1FCCA 1CGSH 3RWJB 3EFDH 3U46B 1G9NL 2I9LB 5D1ZD 1ZLUH 2DRUA 5D9SB 4L8BA 3T2PA 1CR9L 1NFDB 2WWMD 2UYLB 2XXCB 3B6SB 2NXZC 2P44B 1KFAH 2FBJL 5KTEL 4BUGA 5CBAB 4XP1H 2AP2A 4PBVC 3WEXB 1V05A 4QY8B 1Z0NA 3IDIA 3SGKC 3M1BB 5EU7E 2Q86B 4G6AC 3WNLA 4C56D 1A4JA 3KPMB 1CD9B 4I77L 4U3XA 4JFYB 2UZIH 3BGMB 4KK6C 2XWTB 1QACA 4WWKB 5DHYB 3MRPB 2JE8A 5L2KD 4POZC 4XP4H 4LLDA 3ZT5A 5DVLA 4LPUA 5FCSH 1GGTA 5C08D 4PJ9A 5IF0B 5TQ0H 4KC3B 3OJDB 3RU8H 1I1AA 5E1HB 2FBOJ 4XAKD 3N50A 5TDNA 4JVPA 3JTTA 4UTAL 4NO0D 2BFVL 1CN4A 2PXYA 1YYLL 4OCWH 3O11B 4NN5B 1WIUA 4MA8L 1A5FL 2CKBA 2J5LB 1BFTA 3U0PB 4F7PB 2A9ML 4DJMA 1ADQA 1LO3L 4C4KT 4WHTB 4NFDA 2K1MA 5D7LB 4QO1A 3CFCL 5BQ7B 2GCYB 5C0AA 4P99A 2X44D 3DJ9A 1EMTH 4UT7L 4X4YA 3DIFB 4LOUD 5E5RB 4N0RA 1JZ5A 2O5ZL 5A2JH 3BQUD 3EAKA 5I19H 1AFVL 4P4KD 3ZKNC 2ADGA 2ADFH 5ANME 1YY8A 3U36A 4PY8J 3QCUL 4BH8B 1JNJA 3PQYE 5HDLA 5D7IF 4OCLC 3NAAH 3L3OA 3DETC 4X6DE 3GUTA 4ODUB 3TJEH 1DQJB 3MO1A 3BN9D 5GIRB 2DQIL 2UUDH 5D1XA 2CLZB 3DSFH 4MCYB 3K8MA 4UIMB 4PJCF 2WLYA 2XN9A 4KJWD 1IC7H 1KB5A 4IJ3C 4GG8B 3S6CA 2I60L 2HT3C 4HW6A 2PR4H 3D25B 3QXAB 3R06A 1B4JL 1DVFD 1NANI 4RFNB 5ESQB 3QFJD 3X3FL 1KENL 2VLRE 3FONB 3FMGH 2MPAH 2DTML 3H2WA 3HG1B 1YA5A 3P4MB 3QEQB 4Z7QE 4PLOB 5DHVA 4XC3H 3LSOB 4RMSA 5EOQH 5SWZB 1W0WA 5FYJH 3ARXA 3FO9B 4P4KA 4H1LA 5B8CA 1B6DA 4KDVA 1DBKH 4M03A 3GJFK 2XZZA 3BH9A 3T1FB 3GSQA 3PP4L 3WN5B 3QUYC 3VFMB 3QHZH 3RGVC 5DUBB 2CDFA 2IPTH 2QSCL 4KH2A 1HKLL 4FZEH 2LE9A 1VGEH 4FQ2L 4U6XB 1NCDH 3MFFA 1KB5L 1JHLL 2K3TA 3TJHD 5FDWB 1ZHNB 5DJAB 5GJTL 2DQUL 2OP4L 5EG6C 3PIQB 4BUHA 3QSKB 1GGBL 3OF6A 3RZCB 3JV6B 2VABB 4N1EA 3RVUC 5DJ6A 4N0UE 5CKAA 4KMTL 1P2CA 4XCNA 1P6FA 3ARWA 1W0VA 1NCCH 4QRRD 1Y0LA 2RCSL 4HDIA 3HMWL 5HJ3B 1ZA6B 4CVXB 4HUUA 3VGFA 1JL8A 3CH8A 4DUWA 2A73B 3QDMD 4O2CB 3VJ6B 4DEPC 4RFEA 4WO4C 3SPVB 4X6FA 3KHQA 2FX8L 5CP7B 4MXVF 3TM6A 4H8WL 1A3LH 1KELL 3L9RA 4BH7B 2J8HA 5D5ME 4IIQA 4P9HL 2V5MA 5DJ2B 2R4SL 3H42L 3MRHB 4Z7OF 3EOAB 4G8GA 3MLZL 3O6KL 4F7MA 4IOIA 1HQRB 4I8DA 3VWJB 4AIZA 5CIPB 2CDEB 4WUUB 3IU3B 1DBJH 3L3KA 4JO2L 1IBGL 1IKNC 4P2OC 5IMKB 2C4FT 3QIWB 1OP3K 4DCQA 4F33A 3L5XL 4KROC 3W9EA