3DI3B

Crystal structure of the complex of human interleukin-7 with glycosylated human interleukin-7 receptor alpha ectodomain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
193
structure length
193
Chain Sequence
DYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine/cytokine receptor
molecule keywords Interleukin-7
publication title Structural and Biophysical Studies of the Human IL-7/IL-7Ralpha Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2008-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
B PF18447 FN3_7 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3di3B02
2.60.40.1870 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3di3B01
1GH7A 2QQNH 1JFQL 1J18A 1U3ZA 4DKDC 4R7DA 5B3JE 1KJMA 1MFEH 1A6TA 2VLKE 4RGMB 4C4KO 5INCA 4JR9L 4PRAB 3GSWA 5ID0A 4WI3A 4H20H 4OKVB 1CFVH 1GC1L 4HT1L 5E9DE 2YPLB 5A2LH 4QO1A 4NQVA 5FKAA 4JDTL 3G6JB 1Q72H 4HZAA 3DHMA 2FJGB 4NCDA 4FQQA 2DS4A 3MUHL 4QRTB 3RPKA 5GS3A 1BF8A 1MNUL 1H5BA 3UTPD 3EYQC 3RL1B 4ZNEE 1JJUA 5E8DL 4UQ3A 3SDCD 1JWSA 1J1PH 4JHWL 3VXUD 3MV9E 3VH8B 5IM7A 1T2QH 1A4KB 4ZO9A 1E4XL 3SEPA 3ARQA 4Z7QF 4HV8B 4P2RB 1NBZA 3S6CA 1NC2A 5DS8A 5IW6A 3IKKA 1BIHA 3V0WH 3H9SE 3NZ8B 1CR9H 3WDJA 1JZ6A 1INEL 3QQ3A 1BBJB 1FFPA 3KXFE 5IHZB 5B38B 4JFED 1CGSH 1H3PL 3QWQB 1B4JH 2CK2A 1DVFB 3IAQA 5FO9B 1KIRB 3QIUB 4R90H 4OCXL 1HDMB 2NX5A 1MH5A 3ZT5A 1CFQA 3VWKC 5ADOL 1JMZA 2F19L 2VJXA 3PQYB 1RZIA 1VFMA 5EO9A 1VB9A 5E2UH 3SBWA 3GNML 5GGRB 2BOBB 4PJEF 3IFNH 1YPZA 2WUCH 3NCYS 3LQAC 3MLYL 1DDHB 4U05A 2EE2A 5GZOD 1CD1B 3L3IA 3L3DB 3SGDH 2EXYC 4ZFFB 1CFBA 4XVJL 1QNZL 3MGOA 3I50H 3NIDE 1KCUL 5GIRB 3RVUD 3QG7H 1FORH 1HZHL 3F58H 3WDIA 4U6HA 4JN1H 1FL5A 1GOGA 2W59A 4LL9A 2AJZA 3CU7A 5CKAA 3S5LB 3L9RB 1S9WA 1UEYA 2CGRH 1U8MB 4XNMB 4ZOCA 4Y4FB 2X1WL 1FIGL 1KGCE 3WV0A 1S78C 1HHGA 3ZTNL 4QRPD 4RFOH 4QHNB 3X11B 4PJDA 1A1NB 2WIMA 2I9TB 4L4TD 1AQDA 3V7MA 3RI5K 1BAFL 4LKXB 3NBNA 1QFUL 3B4NA 1OAZH 4JFFE 4HDIA 4Q6IB 3AREC 1ZWIA 3OJDA 2D0FA 4JFHD 3CAFA 4ELKA 4X99A 1G1YA 3PIQA 1KIQB 1MAKA 1S7SB 1XF4B 5CEZE 4DVBB 5KVGL 1HSBA 1G9NH 2ATPA 3L3GB 4DWHA 4KROB 5DC0A 4WV1C 1Q38A 2R0WH 1J0ZA 3GHBH 1R3KB 4Y7MA 1IBGH 4X6BB 3BN9D 1U3HD 4ZNCD 3NABH 2E7LA 4K9EH 1GZQA 3KVQA 4NFBA 3OGCB 4WCYL 4RGNE 3ULSA 3MRDA 5JW3L 1CBVH 2ENYA 4N8CH 1QFOA 4P4KB 5MP6L 2HT3C 1KIPB 4QXUL 4XPFH 2GJ6B 3EYSH 4G6MH 1J0KA 3BT2H 4MAUL 5I8EA 5I1AA 4PJXF 1G6RA 2CRYA 4C56E 3T0ED 3GM0A 1J0JA 2MCPH 3HMXA 4PJ5A 4PRID 4N1EA 5I73C 2YD2A 3NN8B 1KCRL 4LHUB 5EBMB 2CUHA 3VU2A 5KG9B 2JCCB 4M9OA 4M5ZH 4OCRH 1K4CA 5CJQH 1T7YA 2P48B 2WBWB 4YXLH 5DJXB 5J06A 5DUBB 3RWIA 1I3RA 4QGTA 1KENH 2ED7A 4PS4H 2I5YH 4EZMA 1W72H 2J4WH 3QUXD 2XYCA 3HE7B 1OB1B 3HNSH 3CFIC 2N7AA 4FXKA 5B39A 5DVKA 2PTUA 2A6JA 2F8XC 4F7CB 1A5FL 4L8DB 4YHMH 2BNQA 3IRPX 2HRPL 4OUUB 2XXMB 3BX7C 4I0PB 3ZZ1A 1Z9MA 3FFDA 1MVFA 2EYTB 2JJTC 2OZ4A 3CLFH 5ICXA 4Y1AB 1PSKL 5I18H 4O2FA 4XP5L 3QFDB 2DICA 1BFOA 1KBGL 3M17A 3TBSB 1W8NA 4JRWA 3DHJA 4JFYB 5J1AB 5I8OL 4U49A 1V05A 2FECL 2DD8H 3RWJB 1RU9H 2UZXB 2W65B 3RVVC 3DXAD 3KYMB 1T1XA 4HK3N 5EOCJ 3GDBA 1YEHH 2Q3AA 5TF1L 3UEZA 1GZPA 1XF2B 1CFNB 3BD5A 3D3VD 3IDJA 4GOSA 1A7RH 5F96L 3RY4A 2B2XH 1DBBH 1Z3GL 3BEVB 4UT6L 1HCVA 3QZWB 3QWRD 4XP6L 5EO1A 4Y2DB 3GSNA 5JW5B 3DX6A 2AJUL 3UC0H 1ZANL 5KSAA 1FGNL 2ADJB 5E8NA 2XG4A 3O9WA 3EDEA 2NY7H 2R9HD 3T1FB 5ESVA 1PFCA 1FV1B 4OZIB 1WTGT 1QSEA 5D2LB 4FQJL 4QRUA 4HGKC 4PGBA 2VZ3A 4L1DA 3RTQD 1MCPH 1WBYA 4QCIB 1LDPH 1UWXH 4KHTL 3CIQA 5BVPL 4MJIB 1H3UA 2AEIT 3JWDL 3OKKA 3VXTB 1UH3A 3TH2T 2R1YB 1NC4D 3INUL 1S7VB 4X5WB 3MV7D 3NGBB 2XZAL 4XPBL 1WAAF 4Y5VA 1RSFA 3MLRL 5JLZB 4XP9H 2BY0A 3LZFH 4P2YA 4XP1L 4J8RA 4OGAC 1SY6A 1LE9B 3WNMA 1BVZA 5JHDA 3R0NA 2EDOA 1QLEH 2HT2C 4LK4A 3V4VH 5BVJA 4M93C 1D6EB 3GK8H 4G8EB 4PYHA 4JZOA 3NCYP 4NQDD 3T3ME 4NZRH 2ORBH 4M7KL 4JM2D 1BQHG 1WEJL 5E03A 4KV5F 1MI5B 3QWOB 1EEZA 3RWHA 3UTTB 3O2DL 1ROWA 1DBJL 4YAQA 1T7WA 5DJ8A 4JFXA 3MA7B 2JK5B 1K85A 1QVOB 5EWIL 4XVTH 1UJ3C 1F2QA 1TZHA 3P4LA 3PNWA 1MFAH 2GY7B 1NQBA 4NKDA 5IQ7L 1IKFL 5FYJE 1U95A 2WNGA 3O3EB 1RIVL 2HFFA 2Z93B 5D6CA 4KWUA 4M7LT 1JGDB 3B8YA 2W9DL 4BFIA 1RZFL 1F90L 4JVPA 5JHLH 4HWZA 2JIXB 1U36A 5ESQA 4CVXB 1OHQA 5HXMA 3DTXB 4YIQB 3SCMC 4WU5A 3MLZH 5D6DA 3O3UN 4A6YB 5E2WH 3CSBA 4L8SC 2D7MA 4DGIH 5CEYA 4D9QD 2R23A 3WNKA 3DRTA 3PP3K 2DM3A 2AQ3A 4LPVA 5IBTL 1R5WB 1YNKL 3MREA 4F57L 43C9B 3H9ZA 3MV7A 1Y18A 1UVQA 5LXGL 1MLBA 4MAYA 4OD2A 4D9LL 4IRJC 5JA8B 4M03A 1CLYH 4G9FD 3TN0A 1U8OA 5E6IC 3S35H 3UTSD 4PLKD 3VWKB 4JFQB 2PYEB 4BH8A 1P2CA 5LCVL 3GSOB 1KLUB 3CFDB 1BMGA 5LQBL 5IQ9B 3MA9L 3NMEA 3HFMH 3PG2A 2OSLB 4U1NB 4DGVL 3RWGB 1X4XA 5DQDH 3KPSE 5C86A 4AM0A 3MLVL 4D0BA 1C08B 4R2GC 1OQXA 4EKXA 2PCPB 1G6VK 4PP2A 1BVLB 4LPXA 3FMGH 3T2NH 1KXQE 3AXLA 1KCKA 3ABZA 1EGJL 5TQ0L 3HPJA 1U8IA 2R0LL 1ZKAA 4UIMA 2EIZA 3BXNA 3V5DA 3RDTD 3ARFD 1T5WB 5F7FA 2EICA 3VH8G 1KFAH 4YDJA 4X7SL 4M62H 1OVZA 5GGTL 4ZO8A 3ZMRA 3RVWD 2FX7L 5EUKB 1PGRB 4IMKA 2KQMA 1ZGLB 3QXDB 3GRWL 4UNTA 3HN3A 5I16A 4MB3A 1E0OB 3EHBD 1PQZB 5B38G 2AABL 2Y6SC 3GO1L 3NCBB 1ZT1A 4YHKH 5DK0A 3VXRD 1JI1A 4CW1A 5EZLB 3LKSA 4UB0H 1FFQA 2RQ8A 1J8HD 1ONQA 2FHCA 2ZG2A 4PJEA 3HZVB 3FT3B 4LU5H 5T1KD 1I1YA 4WV1B 1S7RB 3BKML 5SWSB 2R8SL 1KPUB 4DCQB 3V8CA 2YK1H 4HPOL 2DM4A 1I3GH 1AFVL 3LKNB 5D1ZA 1BOYA 4S2SA 3CVIL 5E94A 1OGTA 2QKIB 4R4FL 5I30H 5AAMA 4P46B 4P57B 4XP4H 2A2QT 1JHTA 3BWUC 1PVHA 8FABA 4FNLL 1FSKC 3HAEA 5HJ3B 3IFPA 1MRFL 1MJUH 2IC2A 2PW2A 4EDXA 4TVSa 4I8DA 3VXNB 3ZYIA 2P24B 5I73B 3C60D 4LIQL 4L8CB 2V2XB 4K55A 2DQHH 3S5LG 5IHBA 3WNPA 1SM3H 3C5ZD 2DWEB 2P5EA 5JORB 4PY7B 3WIIL 1H8SA 3SN6N 3L3HB 1M1SA 4O51B 5GRWA 3CLEL 4F2MA 4PTTA 4K07A 4LLVA 1AQKH 3O2WH 1BVKA 1FE8L 4ZXBD 2E5EA 2D03H 3P9WB 4CVZA 2DLIA 4Q9RH 4OLWL 4G8GA 3VRJA 5CSZA 1OAKH 4BKLA 4OTXL 5GGSA 1IC4H 4OIIL 2H8PB 4O02L 3MNVB 3RZCD 2YBRA 4X0KB 5IROC 5FGSA 3DV4A 1OD9A 4QXTB 1NKRA 2J6EH 1BEYL 3RUGA 1H3GA 1G9ML 5BRZB 2PXYD 2HH0L 5IV2A 3QIBD 1A3RL 4P49A 2VQUA 4MA7H 4R6UA 1FRGH 3WEXB 4EI6A 1AP2B 3S96A 2ADFL 4Z7UB 5GGUA 3ZSSA 5BMFL 2IQAB 2Y5TA 5IVZB 1JPGB 1PYWB 2VXVL 1NGWB 3VFNA 4OGZA 2R2BB 1NLBL 5D7SH 1JGUH 4X98B 1FC2D 4Y5XC 4N5ED 2CR3A 3FO1B 2A9NH 3W11C 2YRZA 3P30L 4LHUG 1RJLA 5HGAB 1LO3H 3QDMD 4L4VB 5GGVY 2JCCE 5I1LA 3WXVH 4NNXB 1KEGH 2R4RL 5CWSA 3O6MH 5E8OB 1D5XB 1HOCA 2GK2A 4LEXH 1P7HL 3DMMA 5TDOB 2GKIA 1B2WL 5T3ZD 3CUPA 2EECA 2HVJB 2QSCL 3C60A 2XV6B 2AK4B 4HXAL 4KY1L 3C5ZA 1DQDL 1AGCB 5ISZE 2AV7A 4RWHA 3HNTL 4PRHA 5HY9B 5D1XD 2ZSWB 1AO7D 5IVXB 1F13A 3C5JA 3WL9B 4LLYA 2AKRB 4LBEA 3SE3A 5ID1B 4GKOA 4AEHH 2VN4A 3VGAC 4O2CB 5TQ2H 3FRUA 1BZ7B 3L5IA 1AXSA 3RFZC 4HIJA 5INDB 1FVEB 4NN6C 5HDQL 2A9ML 4Y1AE 3F7PC 3HG1D 3HZMB 1ZT4B 1YN7A 5F3BA 4D9RE 1RIUL 1N2RB 3VFRB 4NCC1 3QQNA 4K8RD 3QDJE 1G84A 3HZKA 2BNRA 3QDGB 3X13A 3MV11 5EOCL 4GRWF 2OP4H 3BP4B 4WEMB 3KPRE 4OF6A 4Z95H 1UJTA 1JYWA 2QTEA 4LSPL 3PWPD 2CIIA 2IAND 1X7QB 4MCZA 2VDNL 5DUPH 4KGLA 4ODHH 1RJZB 3WS6C 3LIZL 2ATKB 2YD5A 4ODUB 4M93B 2FHBA 4OCMC 1HXYB 2XQYK 4NOFA 2G9HA 3LS4L 3QZWG 4CL7A 3G6AB 3TVMA 2QQKL 4PJGF 4HBQA 1JWMA 3VXPA 2HLFC 3L95A 3GHEH 1YMMD 4LFHG 1UJ3B 4PJ8A 1C1EL 1N8ZB 3KPPB 5EO0A 3D9AL 3KHQA 5D2LE 3QI9C 3ULUD 2F53B 4NQEA 1Z9LA 3O0RH 5ALCH 4NRZB 2YA2A 4U1LA 3UDWC 1WAAA 4OM1H 3IF1B 4PTUA 2WIIB 1R24A 2XRAL 2O5YH 4JY5L 1HHJB 4MJIE 5F9JA 3HLAB 2AS5M 3BZ4A 3O3AA 4YBLC 4JPVH 3O4OC 1LEKA 3HNVL 1NUDA 4B50A 4XXDB 1FO0A 1FH5L 5H35A 5DEZA 1R3LA 2BHUA 1I7ZA 4JAMB 2ARJA 3SDAD 4QOKD 3SCMB 4P2QA 4OZHF 4ZMAT 4ZYKB 3OX8B 3QO0A 1WZ1H 1L0YA 3GSUA 3STLB 5F1IA 2QSTA 5B8CA 4L8SB 3ET9F 2ZJSL 4JO3H 3EOAB 3FO0H 4RDQG 4WFGD 4WUUB 4J3OC 1JF1A 3MYZA 3HMXL 5HHXH 1U92A 1I1FA 1XCQB 1CU4L 1QRNA 32C2A 3AMKA 2MNUA 4XHJC 5I1GH 4G43A 3BKCL 4X6EA 4IRJB 4XCCL 1QA9B 5MEQB 5DI8B 1PKQE 4TTGA 3KPOA 2GI7A 5E6IB 3SKJL 1CFTA 4TVPH 1MI5E 3UTTE 5JXAL 4IBLT 3VXSD 1MPAH 1DQQB 1NMAL 3KYOB 1ZVYA 5TFSH 5IF0B 4HG4K 1R5IA 4XMPL 1N4XL 5CBEA 1GOHA 2R1WB 3TH3T 1S3KH 4M3KB 1V5JA 3X17A 1QFWI 4G6KL 4R2GB 4Q2ZA 2ZCHL 3OAYH 3WFEL 2VH5H 4K2UH 4EEEA 1CGUA 3KYKH 4RMRA 1VFUA 1AGDB 3RA7H 1CG9A 3BZFA 5FGBA 4U0RC 3P40A 4LLMA 3WLWC 1XGUA 1GXEA 4JM4L 3OKMB 3MRNB 2X10A 2XNAA 4YGAB 3VDBA 4A6YH 4NQXA 5DMGD 1JF6A 2Z31C 4MVBD 4P99A 4Q0XH 4RFEB 4KJQD 5FYKH 4PJFE 2G2RB 1R3JB 2VXQH 3E6HB 2O26U 3AVEA 3HRPA 4UIKL 1A1MA 3O11A 2P5WB 2VDQL 2HTLD 5GRUL 1I7UB 2XWJA 2X89D 1VFBB 2YD1A 2YXMA 5DR5H 3UTQB 1LE5B 3KLAA 3LRSB 1UKTA 3P77A 1ZVSA 1T3FA 3BSZL 4LCWD 4ZS6C 5TE7H 4GAGH 5GJTL 3K8LA 1FDLL 1ZLWH 4LSTL 5C0IB 1P4IH 3LSOB 5GJSL 2PYEE 4W70A 4DK3A 4IOSD 2VL4A 1JZ4A 5HHOD 5FOBA 3V6FB 3X14B 3FHAA 2EH7H 4GKZB 4JPWH 3LQAH 4YHPB 3GSNL 1IGFH 5DK3A 2HVKB 5D7JC 2W60A 3MX0A 3QNZB 3EDDA 4K7PH 4P48A 4WIQA 4YDKH 3SOBL 2A83A 2GYSA 4BUGA 3GSVA 1SEBB 3B2UC 4XNUL 1FSKB 4HUXA 3LVEA 4KKCC 4AIZA 4YHZH 2VWEC 2VE6A 1KLGA 5T3XH 3U6RB 5CZKA 5CZVL 3TA3D 1ZGLM 3CNKA 2FH8A 5KJRL 5IB5B 4U1MB 4PPTA 2YKLH 4F7PA 3QCTL 5D2NE 3N0PB 4WDIB 2FEEI 3H2WA 5DQJB 1JPTH 5L2KD 4NOBA 3SQOL 1S9VA 1LO0L 5DD0H 3ROLA 4OAWB 3V7AG 2YD4A 1D5IL 3B9AA 1BX2B 1AR2A 3TBWB 1VEMA 5IWLC 1MCNA 2D4FA 3BYYA 1M7IB 2JF1A 2Z8WC 5HYQB 2VKWA 3VFSB 1SY6L 5L7XL 4R7DB 5BW7C 1HEZA 5FECB 4NZTH 5GPRA 3SE9L 1JNNH 3M07A 2OS7A 5JOFA 5CP7B 3SKNA 4ZFOL 2AJVH 5SWSE 4WFFE 1U8NA 4YUEL 3GSWB 2XKUA 3WKML 3BP6B 3M45A 1KPRA 5T1LD 5IESL 1A4JB 3HI6L 3L3OA 5AG8A 4JJ5B 1H5BB 4N8VB 5E5MA 5TH2A 1EPFA 1A2YB 8CGTA 4TUOB 3BPLC 3ULVC 2A73A 4UQ3B 4QNPF 4QRQA 1CICD 2NXYD 4RMWA 5CILH 4PGEB 1CGYA 5ECJE 4OFYA 1YEDB 5IBLC 5DJ0B 3DX7B 1N0LA 4PYGA 4JEGB 1NBZB 3LOWA 4Y5XB 4LSSH 1NCTA 4LPCA 2ESVD 3ZE0F 3OG4B 4L9LC 5KVDH 4D8PB 1YECH 4EN3D 4KJYB 4U1SA 4IRZH 1QSFA 3BJLA 1JHLL 3CDGA 4HS3B 1PX3A 1F4WL 1D5BA 1XIWC 5HYJA 4BQCA 3L1OL 4TSBH 3QUZC 2DQGL 2WZPD 3ZTJH 1IT9L 5CUSL 2C3VB 4XGZB 3ZTJG 5L9DL 2NX5B 4JFDB 4OCYH 3VFPB 4S10A 3OKDB 1A8JH 1OW0C 2C9AA 1F4YL 3H3PH 5ILTH 1OAYL 1A6VL 1YY8A 2I27N 2EIEA 1UACL 3W5NA 3I2CH 4U1JA 1A3LH 3G6DH 2VZVA 1BFTA 3MGOB 5BRZE 5HGHB 4OM0H 4NN6B 2H1PL 2NY3C 4NUJA 1K2DA 3CJJA 2ZUYA 2DJ4A 4Z7UE 1CT8A 3Q3GA 1MFCL 4HHAA 2BVEA 1OTSC 3QHZL 4PJAB 4R7NB 4U2YA 2CKBH 4EIZC 4XWOD 4HUMB 4PJDB 5T1LA 3IAPA 1CIDA 1AQDB 4H1LA 4L4VE 1K9TA 4NO5A 3M8OL 4RBPK 4YDVA 3SKOB 4QRRD 5D72H 2BSTA 4A2LA 4JLRA 2GK0A 2FWOA 5K9OB 4QTIH 5K9KB 3O8XC 3IDIA 2AK4E 2FBJL 3QUMB 2VLRD 2XFXB 5F7EL 2YSSB 1OT1A 1GZQB 3VDCA 5IVXE 1PG7L 5GS1A 3C6SB 3MRDB 3TT1L 3VGGA 2XG5A 1OY3B 4UDUA 4Q9QL 4LNRA 2PF6A 5DRNB 2X1QA 3QI9B 2EDKA 2ZOLA 5IJKC 3OHXB 4OGXH 4JRXA 5CLTA 1RULH 4NQSA 2CO7B 3DI2B 4U6VL 1Q94B 1DBML 2BC4B 3FT4A 4ZOBA 5F7WC 5I1AB 3UJJL 4MNQD 1KJ3L 3VFOA 5CJ5A 1S9KC 2I24N 3AAZB 4YBLB 1EUTA 4DOHB 3LS5L 3RNKB 1DZBA 2EO9A 3BFOA 2QSQA 3TO4C 5L6YH 5F7DB 1CE1H 4FZEH 2HMIC 1O7SA 4M7ZC 5F44A 5SWZD 3QDGE 1AGFA 1I3RB 3BH9A 2RFXB 2YD8A 5B3JF 2VAAB 1ZEAL 4NWTL 4HCRA 1D5ZB 4P5TA 2ZP0T 3BAEH 5C8JA 1IAII 3JV0A 1NMBH 1LD9A 2DLTA 4LCIH 1A7QH 5C0DB 4YNYB 2XN9D 1IJ9A 2BXYA 4J2XA 1DANT 1NFDF 5GSRA 1MJ8L 5EU3A 2GITA 3MPCA 5JMOC 1EO8H 5I76B 3WXWL 3FB7B 1JVKA 3NFNB 5C3LD 1NMCB 4IOFD 2OI9C 1KG0B 4QRRA 3C5SB 3VE0B 1UZ6E 2BSRB 3REWA 1B0GA 2O61A 4KI5C 3VXMA 1X6NA 3ES6B 5ICXB 1NSNL 3FOLA 1WFOA 4ZFZB 5K59E 4XI5D 3QXAA 2X9XA 1HILB 4AEEA 2F53E 4PGJA 5IMMA 3IJSA 3M17B 3NFPA 4OZHA 2NW3B 2O5ZH 4K23H 3GSXA 4U0RB 4HKJA 4P23D 4K3EH 2IGFH 5FXCH 3MACH 3ZHLA 3HI5L 4NRXA 5GZND 4YHNA 1CXIA 1JUFB 5HYSA 3LKOA 3TM6A 5I1DA 1SJXA 1S7UA 1KC5L 4LCCC 1WZLA 4NDMA 3IDJB 3QHTC 4M6MH 4UQ2A 5L8JB 2BVOB 5IB1A 1H8NA 3KPMA 4GKNA 4Y19D 1JBJA 3S98A 3RHWF 1ZLVK 4O4YL 5C0AD 3S34L 5IKCA 1DLHB 3C6LA 2D7TH 4KDTC 3T04D 1RURL 1XR8A 4TSCH 4ONFH 1MLCA 4R3SA 2O5XH 4MA8H 3O9WB 5AG9A 3LMJL 4O00A 5GRYA 1VGEH 5FM4A 3VWJD 4XMKH 4U1IA 5JQ6L 1EK3A 3BISA 3TBVB 1INDH 3NH7L 2XN9A 1G7IB 4FFYH 2Z91A 4Z77A 2LAAA 3DVGA 3N9GH 4JHAL 5D7JB 4GQ9H 5C07B 3WO4B 5FYLE 4YBQD 3TEUA 5J9PA 2CKNA 3M1BB 4TUJB 4YHLH 4GH7B 2V7NA 3O3BA 4Y5VB 5JIHA 5C09E 4WWKC 2VISA 3NIGF 4KTEL 4NWUL 1NGYB 4Y4KA 3QB7C 4X6CA 1OTTD 1HH6B 1KF9B 3N1PC 5CD5C 4JKMA 1K4DA 4WJ5A 1NBYB 2F58L 2V9RA 5DJAA 2CDGA 2AI0H 4LSUL 5BVJB 1R3IL 1IM9B 2A1WL 4Z7WB 4Y16A 1UQSB 3VD4A 4JZOB 2P5WE 2IAMD 1Q9OA 3VFUA 5ANMB 4Z0BL 4J3SA 4P23A 1P9MC 4EVNA 2BY1A 2BK8A 4RQQB 1VPOL 3IS1X 3WHE0 1RZJC 4XCNA 4QT5A 3IXTB 1U58B 4FP8L 2X4TA 5DFWH 4JGMA 1ZGLP 4JO1H 4YEEA 5IB4B 3PNWB 3QUYC 5DWUH 2XZCL 5DJCA 3TZVA 4OF5A 3LEYL 1U95B 5I1CL 5KSBF 1S7QB 1RUQH 1CLCA 2VDOL 1U8KA 1KCVH 3PHOB 4BUHA 4PRPD 2F54A 5I66B 1YEGH 1A7PL 1HHKA 3NACH 1QFWM 3BPLB 3DNKA 1ACZA 1UM4L 1U2HA 3IXAB 1UEMA 2C26A 3TV3L 1JZ7A 4GJTB 4QF1A 4UZGA 2ADIA 5DJDA 3SJVE 2AK1L 1KB9J 3DV6A 3FQXA 4Z8FH 2V2WA 1TVBA 2EC9U 1QFWH 3EJJX 4LASL 4K3JL 4BH7A 4P3DB 3LH2H 1LO2H 4TPRH 4XWGL 3ARGD 1ZA3B 4JB9L 4WEUD 5AD0A 5F97E 2DQUH 4UUJB 4L9LB 3V95A 1X4ZA 4NNPL 3MREB 3NFSH 1TETH 3C2AH 1Y18B 4R4NC 4X4XB 1FO0L 5MEND 3NAAL 1XIWB 2IPKB 3CSGA 5ACZA 3O6FD 4JRYA 4BA8A 3W39A 4PREA 4NJAL 1IGML 3HA0A 4XPTL 2Q7NA 1BFVL 4OJFL 2P8LA 3ZYJA 1L7IH 1UC6A 4F9PA 4Z78B 1UGNA 3QIWA 1X6LA 4RNRB 1ZSDB 4OV6F 1HWGB 1JF5A 4LLQA 4K3GA 1OT2A 1IAKA 1OARH 3EIFA 2VR9A 1TVDA 2CK0H 4D0BB 2ZUUA 5JIIA 1OOAA 2NY5L 4PP2B 1IL1A 2VL5A 1ND0A 3AXLB 4N8VG 1JCKA 3KDMB 4R26H 1UWGH 2NY0B 3B8SA 1OP3K 3AS3A 2NY3B 1ZLSH 4CNIA 1I7RA 4JO4L 3UZVB 3P0VH 4K7FB 3O6KL 4ZTOL 1U2CA 4GBXD 1MQKH 4YDJB 4BYHA 3PV6A 4ERSH 5CHNB 2X4SA 5ETUB 3PL6D 1C5DB 3T2QA 3F7VA 5I75C 2CLVA 1CDYA 3DSFH 3P0GB 5SX5H 4KK9D 3MNZB 2BVPB 4WO4C 3P73A 3OTTA 1I8LC 3VFWB 5C0CA 4MD5A 3LN4A 2I60L 4YK4C 4Y89A 2AERT 2X42A 3IJHB 2CUMA 3JWDC 4F3FB 2PO6D 3OR7A 2VLMD 2KDGA 2VAJA 4YPGB 4B7IA 2NX5E 1FNEB 4Q9CA 1FL6A 1MF2L 2P8MA 1WFUA 1E6JH 2DL9A 3MV8A 4HPYH 4KXZI 4RFNC 3SDDC 3L6FA 4KJPD 3WN5A 4YX2H 5D1ZB 3MUGB 4G6FB 2FRGP 5J1TC 3MRMB 2EDFA 3TT3H 4ZDHB 3GGWA 4M4RA 4E41A 1YPZE 4ODSL 3SE8L 5C0GA 4XH2B 1YQVL 1MCOL 4HJ0C 1MCEA 5E8EB 4MDJA 5DMKB 1YJDL 2JLLA 4EQ2A 1QLFA 1X5LA 2PW2B 3WIHH 1ZT7B 3F6IA 1UH4A 4KKNA 1T0MB 1NCUA 1KACB 3HMWH 3MV9D 3JV4B 3MSPA 3TO4B 3CVHB 4OQ1A 4PJAE 1SQ2N 4M1DL 3PGCB 4M7ZB 4PJDE 1FNAA 2CDFB 3CFJB 1RZ7L 1UM5H 3ILQC 2VXUH 3LRGA 3HS0A 5LGHL 5IIEB 5JW4M 5ERWB 3U82B 3H9SD 4ODWA 1JRHI 4X6FA 2DIBA 5DJ2A 1TZGH 3FQWB 1IQWH 3KXFD 4G8GB 4PJCF 1FVCA 1V7NH 3GJEB 1SJHA 5CSZB 4XPHH 4BFBD 4BKLB 4E0RB 5D7LD 4NZDA 3RAJL 5CCKH 2BFVH 1N3NA 2FCBA 4UTAH 15C8L 1D9KD 5KTEL 2DQCH 3QUMH 1MVUB 2LE9A 4UBDD 3QULA 3I3EA 3FAXA 3GBNH 1A6WH 1MHPH 3DX9B 1NJ9A 3SGKA 4PD4J 3RUGB 1GAFL 2OI9B 2A6IA 3SDYH 3L5XH 4OLUL 1IRAY 5AYUL 5GGUB 3S37X 2VDRL 4F33A 4FABH 5IR1A 4HUUA 1E6OL 4L3ED 4HH8A 3KS0H 1NGPL 5IK3A 3ARBC 2OR9H 2G5BA 2UUDH 4PY8I 2YN5A 1T1ZB 4PJ5E 3DYOA 2DQJH 2VLKA 1A7OH 3MBXL 2VIRA 3UZEA 5CWSB 1KGCD 4WW2C 4ZUUA 4G6AC 4HJJL 1YEIL 5E9DA 1N6UA 3DVFA 3GMLB 1GGIH 1GHFH 4LCCB 1NFDA 5HI4C 4TQEH 3CGTA 4FQHA 2FO4B 3NCFB 1EBPA 4P9ML 1N0XL 1YEJH 1OAUL 1OSPL 1SBSL 4JFFD 4J3VA 4ZNEA 1G7MA 1U8JA 2E6JA 5FDWA 1T66D 3P4OA 4L9DA 3T0BA 1LVEA 2PW1B 2EYSA 4KVNH 4NSKA 2BDNL 4GRMA 3U36A 4HWBH 4OZGB 3W81A 1J0YA 1ES0A 4LPTA 4M43L 4YDIH 3G6JF 1UB5A 5CEZD 5I8KH 4IMLA 3LB6D 5AUMB 4KQ4L 4TSAL 2FZ3A 1DQJB 3SDXB 2R56L 1NFIB 3G5YA 5L2JA 2BNQE 2XT1B 3BIAX 2C5DC 3VA6A 5IB2A 5CJXC 1E27A 3ECBA 2GJJA 4O2EB 2EXWD 1FZJB 2CIKB 4RGND 4FQLH 1T04B 4HIJB 4ISVB 1V8HA 4MHHI 3IB4A 1BQLL 1YN7B 4GAYA 2Z92B 4RIRB 1OSZB 3C9NA 5GGQH 1S7TA 3D1MC 2FIKB 5MEPA 3RY6C 4IHOA 4FQ2H 3UPRA 4YHIA 2YPVH 5IFJB 2CLZA 2C7UA 2DQIH 2VITB 3BPNC 3X13B 4LLDB 4C56D 2EC8A 3U4AA 3TCLB 4U1KB 4FMKA 1KB5B 5KVMC 2DAVA 3VRIA 4XPAH 2BNUA 1AC6A 3GSRB 1QFPA 3WBDA 5KSVA 4ELMB 4FQXA 3SO3C 3IU4L 5AYQA 4KTDL 2FECI 1IAIM 2UVFA 1MHEB 2MMXA 3DIFA 3AUVA 1CDIA 2NTFB 1IAIH 4CMMB 4N0FB 3ZDYE 4PRBA 5FB8B 3HRZB 5GHWL 4GUPA 5CINL 4Q74A 1LEIA 1U8QB 4Z6AT 2X5PA 3UYPA 3QUYB 2CLRB 4F7MB 1QSEE 3MRJB 3QFJA 4GRLD 4NUGH 4CMHC 2NY6C 4PTUB 2GUOB 1SVZA 4MLIA 4ZUTA 1CXHA 1EEQA 5TPWL 1U8PB 5HD8C 3ZE1E 1P53A 1Q0YL 4F7TB 3O3AB 4RMTA 5FUCE 3U2SB 4HIXL 2IWGA 4G8IA 3EOTL 4ZO6A 2A6KA 3U9UB 3PGFL 3TYGL 2ARJB 4P2QB 4IRSC 4ETYA 1YNTA 1VFAA 2VWEE 1TDQA 4JN2B 2X40A 1DBAL 2FGWL 3Q48A 5E5RB 1T5XA 5F1IB 5B8CB 4HUVA 3DVNA 4GAJL 4PIRF 2IADB 1G9MC 1AHWC 1JF1B 1MREL 5JHDE 3U9PH 3DOSA 4D0DA 5HVHC 3D85B 2IH3A 4FZ8L 3T0DA 5C2BL 3MJ7A 4NNYB 1T7XA 5DDHA 2YD9A 3I6LD 1QLRA 4EIGB 3D2UA 4X6EB 3VD7A 2VQTA 4WHTB 4NKMA 4FA8A 3MMEA 3KPOB 4XC1H 5HGDB 5KSBA 4HCRL 3UXFA 2FX8H 2DTMH 3O41B 2X1XR 4LRIA 4WRLA 3WJLA 1J1OL 3Q1SH 4ODXA 1UXWB 3RGVA 5BS0D 3O3DA 1OP5H 5CBEB 4AQOA 1AKJB 5C7XH 1YA5A 1U42A 1TVHA 3UROR 2JCCF 2LTQC 3GKWL 1G7HA 5DRZB 4G80A 1PG7W 1QUNA 4OI7A 5D5MB 1W72A 4MNGB 3FT2B 4NP4L 3ULVH 4GW4A 1IGJA 3MRRB 1NAKH 4XTRD 4AK1A 5KVEL 2XNAB 3SE4A 2NY1C 3HB3D 4Y4HD 5F3HA 5E2VH 3BIBX 4HXBL 2FJHB 5I75B 1EHNA 4WO4B 4N0RA 4ESKA 2FEDD 5ICYB 2XWJB 4W4OA 1DL7H 3BE1L 4Y5YC 1G1CA 3QEUB 1DUYB 3MCKA 2KBGA 1ZVSB 1BZQK 3MJ8B 5ESAB 3RJQB 4L3AA 1CGWA 2B39A 1SHMA 1T03H 4H26B 4FQ1L 1T83C 1RUKH 3UO1H 5LAXB 1CF8L 2DQEH 4OIBA 2KQNA 4G7VH 4RFNB 2I07B 3SDDB 1D3CA 4CN4A 3RNQA 5FOBB 2DYPD 2EO1A 2QQQA 3R06B 1DJSA 1QYGH 5D93C 2DQTL 4M6OL 1JHKH 2AEPH 2Q20A 2PTVA 5C6TH 4EOWL 5CJOL 5FYJD 1F6FB 3A6OA 5E2TL 4LLWA 1HK6A 2A77L 1TITA 3QDAA 4NN5C 5CKGA 4Z7QE 4JFOA 1IEAA 1T1YA 4AIZB 3V8OA 2VE6B 3LEXA 2YZ1A 2BMKB 1CGXA 3DECA 1T2JA 1YDPB 4HUNB 3SDCC 2MPAH 1BGXL 1KEML 4ALAL 2ADGA 1L0QA 4MDIB 3FN0L 1MHHA 2ZOKA 3JZ7A 4JG1H 1EVUA 3I3BA 4GLRI 1T4KB 1NBQA 2N7BA 4I3RL 4JANB 4XNXL 4N0UA 1L7TH 3VFGH 1EFXA 3UJIH 4OZIF 5D2LF 3N85H 2IPTH 4L8BB 3AB0C 4URTB 1VSCA 3B9DA 3B9KD 4QRSA 4KZEH 2LVCA 1JGVL 4XBEH 4PJEE 1DFBL 2Y23A 1RHHA 4OV5A 3SKNB 2AGJL 2AVGA 4UTBH 4H0GA 4RZCB 3ZL4H 5J3HD 3RGHA 4KMTL 4IDJH 4MJ6A 4C58B 4KDVA 1WT5A 5E5MB 4JPIA 5D70L 5J11C 3O4LB 1WV7T 4N9OB 5FHAL 2Z4QB 4QRQB 4QHMB 1F3JA 1WITA 3KPSD 4KKLD 2DLEA 4OD1L 1BQHA 1X5ZA 4HIHB 4RDQF 2Y25A 3V6ZA 1I8IB 3DROA 1DSFH 5GZOC 2D7NA 3QJFB 1I8MA 3ARBB 3EW3B 3P2TA 3X3GL 2B1AL 5BZDA 5EC1A 4JO2L 2ITCA 3RVUC 1FAIL 3CVHH 4JPKH 4PJCA 4WW2B 3WHE1 1JZ5A 3RKPA 3T0AA 5D71H 3OAUL 1QSFB 4TRPH 5HYJB 1T0NB 5TDNB 3MC0A 2E8YA 3AY4C 4W4NA 1A7BA 1U3JA 4PRDB 2OL3A 4FQIH 4HS6B 4HIEB 1FFNA 2R29L 3CFEA 2R1XB 5F8RC 4G8GE 2E6QA 3I02A 1I9EA 3ZYOA 2EEDA 1KPVA 4EUPB 3NCMA 4JHWH 5DD3L 3V79C 5BZWB 3NA9H 3QPXL 4HMDA 4XAKE 5TDPA 2DIAA 3QIUD 5I2IA 4ONHA 4MSWA 2HKFL 3RUGE 2YXFA 1LK3H 3LHPL 4HKBA 3BN9C 1U3HC 4KI5E 1XGRA 3MFFA 5IVOA 4ETQA 5J0BA 4KXZH 1A0QL 1V7ML 3PGDB 4Z5RA 4CJ1A 4XBPA 1LO4L 5EU5A 3R8BB 5I0ZA 1LEGB 5DHXB 1WWCA 3SPVB 2W0KA 3KR3L 1C7TA 1TZIB 4MQSB 4J4PD 1TJIL 5ADOH 3RWFA 4Y2OA 2WWKT 5DRWB 4GXUN 3OPZH 3KJ6H 4PRAA 4Y4FD 3GI8L 3T0EC 1JN6B 2VDML 2YPLA 5IFAL 3RQ3A 4ZTPL 3SO3B 3G6JA 3THML 2FJGA 2V5TA 2Q6WB 1RHFA 4QRTA 1OWRM 1FPTL 1S7WB 4XVJH 1QNZH 2LU4A 4G6JH 3RL1A 1YY9D 3K80A 4OD3H 4LSRL 5KS9F 1HZHH 1DBKH 4FFZL 3X12B 2UVEA 1K3ZA 1OPGL 5DO2D 1JRHH 3VH8A 1A4KA 3QUXC 1I3UA 4HV8A 5GS1B 3VGFA 1FIGH 4P2RA 3HE6D 3ZTNH 4UDUB 2F5BL 3RWEB 3A0OA 1YEFL 3MJ6A 3IS0X 1BBJA 5DXWA 4NQSB 5IHZA 1BAFH 1RFDH 4CMHB 1QFUH 2NY6B 4FTVB 2GAZB 1P7QB 3VFOB 1ULVA 4ZUWB 3CXHK 1RJCA 4HZLA 4P59H 3EGSB 1T80A 1RY7B 3ALPA 6FABL 1DVFA 5FO9A 1TJHH 1KIRA 4EI5A 4PFEA 3OKNB 1HDMA 2J2ZA 1ETZB 1KYOJ 2P49B 3S4SB 4BSWA 3ME0A 3G9AB 5CP3H 5ADPL 4IRSB 4MXVE 1KB5H 3PQYA 5E1AB 1TQBC 2P8PB 4LHUD 5GGRA 2BOBA 4WCYH 2VZ1A 1DDHA 4WEBL 1LD9B 1VKXA 1CD1A 2BRRH 4ZFFA 1AHWB 2C4FU 4MJ4A 5MP6H 5GIRA 3K7UA 2DRUA 3GI9L 5GSRB 5EU3B 2GITB 4J4PA 5AZ2L 4OFKA 2NYYD 1HNFA 2VSDA 3MCLH 5HHPA 3S5LA 2CJUH 3HE7D 1U8MA 4XNMA 1RZJH 3S36H 5ISZD 5D9SB 4BK4A 5IP4A 3BD3A 1KCRH 3RKDD 3X11A 3CSPA 4QHNA 2EDYA 3DUUB 1A1NA 2I9TA 3FOLB 3BO8B 3FQTA 4LKXA 5EIVA 1NCNA 3QXAB 1IILE 1OM3H 5JXED 5IMMB 3LKPB 4Q6IA 1L0XA 2R9HC 4ZAKD 3P0YL 4BZYA 2I9LB 3RIAF 3WFDH 3CK0H 2AEQH 1KIQA 1XF4A 1S7SA 2AAVA 3BGMB 4DVBA 3HKFA 3RTQC 5GQBA 4NO0D 4JKPL 4XCYB 3KLHD 4C59B 4D9RD 2XZZA 1J1XH 1R3KA 2WLYA 2VZOA 4P2QE 3QDJD 2NY1B 5I1DB 4MHHG 2C1OB 4XMLL 3OGCA 2YMXH 4UQ2B 2J6EA 2ICCA 3KPRD 3LRHA 1H8OA 3KPMB 4P4KA 5EIIA 4GKNB 2QQNL 1KIPA 2HT4D 2GJ6A 4MA3B 1QRNE 1G7JA 1PSKH 4Y5YB 3C6LB 1MFEL 3BP5B 4QHKI 1KBGH 3UBXI 5B3NA 1MLCB 3WLBB 4OFPA 4XNQB 2V5SA 4AMKL 4H20L 3NN8A 1CFVL 5EBMA 5KG9A 2JCCA 5IHUH 2BERA 4Z7UF 1Z2KA 1Q72L 2DWDB 4JM2C 3I3DA 2FB4H 5DJXA 1NCCL 3PJSB 4UINL 5TF1H 5D93B 1AC0A 4RWYL 4V1DD 5IFHL 5FUZH 1BQUA 5KZCD 2QSVA 3DVGB 4RRPA 2H6PB 1J1PL 2COQA 1QFHA 5F96H 5CD3B 1T2QL 3DUHA 3UX9B 1Z3GH 1OB1A 4JREC 4NN5B 4OZFB 4UT6H 4P2OD 3CC5B 4MJID 3K4DA 5AWNL 3V0WL 3BN3B 2APFA 1CR9L 2AJXL 1G7LA 2W0PA 4F7CA 1FGNH 4X6CB 5I1EH 1ZLVH 4PG9B 4XXCA 2P7TB 4L8DA 1KT2B 4OUUA 4WJ5B 4ENED 1IGTB 4POZD 3SDCB 4I0PA 3OF6D 3VXUB 3MXWH 5IVXF 2W0FA 2BP3A 4YC2C 2EYTA 9CGTA 4Y16B 4WTXA 4R90L 1AGEA 4Y1AA 4N0YL 3VFUB 5JMRA 2VDKH 3QFDA 4OCSL 3DPBA 3TBSA 3JWDH 3VXOB 5J1AA 3INUH 4GW1B 2XZAH 3QXTA 4GMTH 3RWJA 2W65A 3KYMA 2ZUSA 5DJCB 5C6PB 3TZVB 3QDHA 1XF2A 4CRPA 1CFNA 1K8DB 3UBXB 1FORL 3F58L 5DD5L 4JN1L 4PLKC 1N7MH 5GS2H 5K93A 3WO3B 2SEBA 3O6LL 3BEVA 2CGRL 5J11B 1NLDH 4PJ9A 1QO3B 4OIAA 3QZWA 4Y2DA 5JW5A 1TVBB 4M7KH 1MFDH 4BH7B 2WBJD 5DLML 5CMAA 1KULA 4MZ2A 2W1NA 4HLZH 3L7EB 3T1FA 2VABA 3O2DH 3MBED 4JQVA 4XCFL 4FG6D 4HLZG 4OZIA 1DUZB 3DSNA 5CEZL 1FFRA 2L7JA 4QCIA 3RDTC 3ARFC 3DGGA 1UZ6F 1IKFH 1G9NL 5ACZB 5IQ7H 3W39B 2R0WL 4QRPB 4LAJH 3VXTA 3RVWC 3QH3B 2R1YA 4APQD 4L4TB 4KJWD 3NABL 1S7VA 2HKHH 2P8LB 4K9EL 4I3SL 4HQQH 4X5WA 5JUEL 4AEIH 1XGYH 4J1UB 1CZ8L 3IKCB 4NZJA 1ZLUH 4BJLA 3EHBC 3D5OF 2HJFB 4LDEB 2X7LA 2R15A 1CBVL 4JGJA 5JLZA 2J7LA 4N8CL 5C70A 1LILA 1XR9B 5E7FA 5EU7C 3EYSL 1UADC 3RBSA 3BT2L 3TO2B 2PYED 4ZPVB 3GKZA 5D1QD 5I1HH 2VL5B 2MCPL 1U3HB 3OB0K 5B4MD 5IBTH 1YNKH 5HHMD 1C12B 2CH8A 1WWBX 4G8EA 1W0VB 3O4LE 1LGVA 5LXGH 4M5ZL 4CNIB 3FQNB 3FQUB 3RWDA 4LCUB 4HAGA 1MI5A 3QWOA 3UTTA 1J8KA 3BDBA 1HHIB 3MA7A 2JK5A 3PE9A 1KENL 2Y06H 5IB3B 3DGCR 4PS4L 1W72L 2J4WL 3C8HA 3MA9H 3OKEA 3T0EB 4OT1H 4PRIB 3QAZC 5C0CB 2YA1A 1QSFE 2BOCB 4DGVH 2O93L 5BOPA 5HYJE 4H0IA 5D8JL 4JZJC 1BOGB 3OR7B 3IT8D 1JGDA 3BI9X 3VD9A 2JIXA 2V5RA 4X5LA 1HQ4A 1JGLH 2RIKA 4CVXA 3VW3L 3DTXA 4JE4B 4YIQA 4GLRH 4EUPH 4LOUC 5TQ0H 3MV8B 2R0LH 1ZVHA 4ZXBC 3L6FB 3WN5B 3Q0HA 3W0WB 4X7CC 1NUGA 4EUPG 3D48R 3QUXB 3S35X 4A6YA 3CLFL 1CK0H 4X7SH 4ZFGH 4E41B 5GGTH 5SWSD 4WFFD 3BMWA 1OAQH 2A0LD 4FN0A 3RZCC 5A2FA 2FL5B 1QPPA 43C9A 3GRWH 2AV1B 5E4IA 1GL4B 3FN9A 3CSYA 5IBUB 2V9TA 2ZUQC 1NL0H 4LSVH 2PXYC 4P46D 1YEHL 3QIBC 1HIMH 1AIFB 5IW1B 4X83A 3VWKA 2PYEA 5DJZB 4MXWH 3GSOA 1KLUA 3CFDA 2R8SH 5I74B 5IQ9A 1VA9A 4ZSOA 3LPFA 4FXLA 1TQBB 2K7QA 5I6XB 4HPOH 3DETD 4ONOA 5KS9A 3EYFB 4U1NA 3RWGA 4N5EC 3CVIH 3BDYL 3DXAB 4YFDB 1SJHB 1PZ5B 2PCPA 5TJWK 1BVLA 4KH2A 5JDSA 3BOVA 4FNLH 3WSQH 2YEZA 3D3VB 4P0DA 3BPOC 4NC2B 4FMFA 1T5WA 1MCPL 1LDPL 4LIQH 3FFCD 4FFWD 2A6IB 5DK2B 5EUKA 2GTWA 3V5KB 3WJJC 5TE6H 5D1XC 1ZGLA 3HCVB 3QXDA 2ZZUT 3PWUB 3ARZA 4JHZA 4JRXE 4E5XB 2XPGB 3AREA 1PQZA 2Y07H 3U4BH 5BRZD 1FE8H 1EEUA 5DHVB 4XP9L 4GRWE 4D2NA 1UYWH 2G5BB 4OLWH 5EZLA 5A3ID 1FNSL 3ZKXC 1I1AD 3L5HA 4UU9A 1CTNA 3RTQB 1IMHC 4OTXH 1JWUB 3FT3A 4WV1A 1S7RA 5SWSA 2VIRB 2VLLA 1QLEL 3S4SG 1KPUA 4DCQA 2ARJQ 3GMOA 1UCBH 1NC4B 1NFDB 3LKNA 1N59B 4C54A 1CWVA 1E4JA 4K8RC 4FQHB 1BEYH 3VGDA 2VSCA 2QKIA 3IGAB 2EH8H 1G9MH 4TYUA 3ZT7A 1U41A 1A3RH 4EJ1C 4NO3B 5E95B 5HJ3A 4XVTL 3WCYA 1QBML 4TNVK 4NQCA 3U36B 3EZJB 5J1SC 1WJ3A 5FYJL 2P24A 4YHYC 4L8CA 2AK4D 3MLWL 1NLBH 1LNUB 1O7VA 5BV7C 1P4BH 2DWEA 4G42B 4NQDB 5JORA 5IB2B 2OL3L 4PY7A 1KELL 4OSUH 5I15L 2Z8SA 4JM2B 2J8HA 3L3HA 5EZOH 4AZ8A 5J56B 5JHLL 4RGOL 4N68A 4GAYB 3C9NB 2Y1VA 2ID5A 1B2WH 3UPRB 4YHIB 4OZHE 3JXAA 3MLZL 5GRJH 2QSCH 1PBYA 2H2PC 4JREB 3ULUC 5E2WL 1SBBA 3MNVA 3MJGX 3S3SA 4X0KA 4WHYH 4WFHE 1DQMH 4IIQC 3RVXD 2VR4A 2KZ1B 4WHYG 4LVNC 1KN2L 4FQXB 3X3FL 1X5JA 3BH8B 3SDAC 4YC2B 2I26N 2JJTA 1B90A 1CLYL 3KYAA 4JCMA 1MIMH 2VC2H 3QEGH 4RSVA 4PJ7B 3WEXA 4Z7UA 2A9MH 3KAAA 1P4LA 2IQAA 5IVZA 1PYWA 1S9XB 1NGWA 2R2BA 2WUBH 3NCJH 4X98A 3Q2CA 3UPCA 2ZCLL 3FO1A 2CKBA 4ZD3H 5DQDL 5DVOA 5HGAA 2W07A 4L4VA 1U8HB 1FYTA 4NNXA 3TCXA 1IQDB 1FQ9C 4NN7C 1T6VN 1D5XA 1ZK9A 2DKSA 3FMGL 3T2NL 4G9FB 5LGJB 4PJAF 3UTSB 2CPCA 5TDOA 4PJDF 4HEPG 4OF3A 2IMMA 2F53D 3T08A 3UJTH 1KFAL 1R0AL 1KJ2L 1QACA 1AGCA 3MRCA 4OZFG 2Q87A 4QTHA 2VXSL 4N90D 3LS4H 5HY9A 2ZSWA 5IVXA 4X80H 5F7UA 3WL9A 4WI8A 1JTOA 2XZQH 1ORSB 2AKRA 1MCHA 1M71B 3DVNB 3H9HB 1T1WB 4X6CE 5ID1A 3UTPE 3ARUA 4YHKL 3D9AH 4O2CA 2AXGA 1AE6L 3RDTB 3VXUE 3ARFB 4LVHC 3S88H 5DMGC 5INDA 3S3JA 1FVEA 2FYYB 3HC4L 4LU5L 1WTLA 3UTOA 2IBBA 4KJQC 3GB7B 1ZT4A 5F9OL 5CBAA 1MAMH 3VCLB 1N2RA 3VFRA 3MZTA 1NFKA 1I3GL 1F02I 3HNVH 2HTLC 4LMQE 1ZHLB 3QDGA 4ODXB 1TENA 5EA0H 3O3DB 3BP4A 5F70A 3VXRB 2UWEB 1VERA 3IDGA 3ARDD 4I2XB 4S1DD 4XP4L 1X7QA 4RAVB 1G7HB 4UNUA 3UBXG 4G80B 1RJZA 2ZJSH 5T1KB 1MJUL 3WIFB 4NZUH 1KB9K 5EOQL 2ATKA 1NDGB 4ODUA 3NTCH 2DQHL 2NW2B 1CU4H 2X4UB 4FOMA 4TNWF 3UTZB 1SM3L 3BRFA 1HXYA 3V6OC 5FYLD 4X4YA 3JWNC 3G6AA 1FZKA 4WI9A 2ZCKH 1MFBH 1NCDH 1NCWH 2FJFB 4D3CL 5C09D 3V2AR 4ODTH 3F7RA 3GSQB 3GUTB 5KVFH 1UJ3A 5JXAH 1N8ZA 3KPPA 5DHYA 3WFCH 3EZ8A 2ITDB 4DQOH 5E5UB 1TXKA 2IPUG 1D5MB 5HYFA 4NRZA 3MLUH 3TA3C 3OXRB 1CCZA 2EDNA 4LCYA 5LGKA 2WIIA 1N5YH 3MOBH 3MCKB 1HHJA 3HLAA 3ILPB 4JZJB 2IG2L 2P5WD 1RUAH 4QRPE 2GSIB 2ZCHH 3WFEH 4Z76A 4XXDA 4L4TE 5F21B 3Q5OA 2J6EL 4BSVB 3E3QE 4JAMA 2G75B 3C08L 3SCMA 3V4PH 5F7YC 2HG5A 4ZXBB 4ZYKA 2AXFB 4MA7L 2APTA 1Q8MA 1FRGL 4NT6B 3BHBB 4TN9A 3QEQB 2MFNA 4WW1B 3EYVB 1UXSA 1MCWM 3STLA 4AH2B 4L8SA 1AD0A 4QNPE 1F45A 1RAMA 4P2CG 3HC0B 4WUUA 1FCGA 3RZCB 2YPKA 1GIGL 4Z18A 4LDOB 1XCQA 5D7SL 3MLPA 1JGUL 3JVGC 2VDQH 3U0PB 4QHUB 1MQ8A 1LO3L 2VERN 2ZUQB 3ZE0E 3WXVL 4IRJA 4PUBH 2PXYB 3E0GA 5F8QC 1KEGL 5DI8A 1J87A 3QIBB 1MCLA 4XB8A 1FG9C 5E6IA 3SJVD 3L3JB 4M5YH 5GJTH 2GHWB 1YEEH 1CICC 2NXYC 3GJFB 5CAYB 3KYOA 3ZDYF 1NAML 2ADGB 1YN6B 5F72S 1MHHB 3RIFF 5K9QI 2HTKD 2DJSA 4PJIB 4ZUVB 3U0TB 4PRIE 3K2UL 5C0CE 3AS1A 3RX7A 2LAGB 1FCCA 4MCYA 4MMXC 5MERB 4XCEB 3MRKB 4EN3C 3B9VA 3OB8A 1AGDA 4XNUH 4I0KA 4AEHL 1B6DA 4S0SD 3BPOB 1M6OA 3OKMA 5TQ2L 3C87A 5LJYH 3MV8E 4CVUA 4X7DC 4DUVA 3W0WE 1QR1B 1C8PA 4RFEA 2OTWA 4DKEL 2G2RA 5KJRH 1R3JA 3ZKSD 3E6HA 3QCTH 4E41E 5D1XB 1AO7B 4P3WA 1P5UA 1IAOB 3KYNA 2JB5L 2HA1A 1I7UA 1MFNA 5FIEA 4RMQA 1A1OB 1LO0H 1VFBA 3DROB 3UTQA 3TP4A 5IBUG 4UI2A 3LRSA 2OP4L 5IG7B 5FO8B 4Z95L 3ZKXB 4ACPA 3IDMA 1YNLH 5BZDB 4OI9A 4Z7WF 2Q8AL 1FJ1B 1QPXA 5IT2H 5DUPL 4CDGC 4ODHL 3SE9H 5C0IA 3HG1B 2VRAA 3LSOA 2P1YA 5DVLA 1C5BH 4WUKH 2X6MA 4JQXC 3X14A 1JPST 4GKZA 3W11D 1NC2D 3MJ9H 4YHPA 4XWOC 2HVKA 1FFNB 2CDEB 2EKSA 5HI5D 3DXAE 5T1MB 4N9GB 4KZDH 5GRVL 1SEBA 3PWPB 3GHEL 2DLHA 1CLZL 2W91A 4PD4K 4OCWH 4NRYB 4U3XA 2XY1A 4YHYB 4G9DB 2NX5D 3O0RL 3ULVF 1MCSA 4BFGA 4OM1L 4U3HA 5BV7B 5IB5A 4U1MA 5E00B 2O5YL 4EXKA 4WDIA 5DQJA 1UWEL 1OAXH 3QJHB 5T1DL 1XZ0B 1WCQA 1KN4H 5FO7B 1JHLH 3DI3B 4OAWA 3J8F7 1BX2A 3TBWA 1YMMB 1GSMA 5DHVH 2FX9H 1ZV5A 5EU5B 1M7IA 3VI4E 5HYQA 3VFSA 1PLGH 2X4NB 4QLRA 4AEFA 5FECA 2R0ZH 3RWFB 4JO3L 1XAUA 2QQLL 5CP7A 5IROA 3D39A 1A6VH 4IIQB 3BP6A 3IRZA 12E8H 4LVNB 1NFDE 1A4JA 5I1GL 3SDAB 4QOKB 4JJ5A 4J6RH 4N8VA 2P46B 1A2YA 4TUOA 5JZ7C 4HX1B 2APXA 2D9QB 4PGEA 1MPAL 2H1PH 4OBRA 2B1HL 3T77B 1YEDA 1IGCH 5DJ0A 3DX7A 4Y5XA 1S3KL 3QG6B 2E9JA 1LP9B 3QHZH 3FQRB 2IF7A 4HUKB 3OBAA 2PTTB 1A22B 3FAWA 4D8PA 4KJYA 4NN7B 1K3IA 2VH5L 4K2UL 3KYKL 2NZIA 1MRDL 4HS3A 4AENB 3RA7L 4RISL 1MJJB 3ARTA 3RU8L 1N5AB 1O5DT 4HZLB 4LARH 3VXSB 3TBYB 1MY5A 4EI5B 1WLHA 2C3VA 4A6YL 3K81A 3ALXA 4XGZA 1WICA 4JFDA 2F5AL 2OMNA 1UM6H 4Q0XL 3VFPA 4BSWB 4XI5C 5FYKL 3OKDA 2Y7QB 5CFHA 2VXQL 2FBJH 3WFHB 4M02A 4PJ5D 2B20A 1A14H 4KRMB 3D0VB 5LG1A 4KVCL 1JE6A 1VKXB 3ZE2F 3CX5J 4H25B 4LLUA 4P23C 4DUXA 2BZDA 4Q9QH 1EAJA 4NM4H 3KPNA 1PY4A 1F4HA 4GAGL 5HBBA 5GZNC 4LVHB 5HGHA 2V9QA 4G5ZH 3LY6A 4XX1G 4PJBF 5HHPB 1P4IL 2EEBA 4H8WC 1J88A 3EAKA 5BXFB 1TLKA 4PJAA 4R7NA 5JOEA 2EH7L 4JPWL 3LS5H 4M1CD 3LQAL 5E2JA 1IGFL 2ZUTA 1YEKH 3PDOB 3E8UL 4K7PL 1QSZA 4L5FH 3FQTB 3TJHD 2BSED 4NKOB 3VG0H 2BNQD 4LCWB 4LRNH 3QFJE 3SKOA 3BWAB 3WS6A 3VWJC 5K9OA 3PP4H 3NIGE 3MQIA 4CVWA 5K9KA 3NIFF 3OAZH 1AJ7H 5HHOB 2YKLL 3QUMA 1MJ8H 2XFXA 3A67H 4UT7H 2Y36L 1BWMA 1ZTXL 2YSSA 1EA9C 1FLTX 1JPTL 3P9LB 3WXWH 4YBQC 3EJZD 4UMGA 5DD0L 3C6SA 5JA9A 4ZQKA 5GSVA 1QKZL 4YEFA 5EIIB 1MELA 1UCTA 4HJGA 5DRNA 3QI9A 5I1JH 1DEDA 3OHXA 1WZKA 3TA3B 3UDWA 1G7JB 2FLRT 3RUGF 1Q94A 4NZTL 2BC4A 3UZQA 1UB6B 4IS6B 5JTWA 1CGTA 4KI5F 3AAZA 4YO0A 3LV3B 5EBLA 5EZJB 5BOZG 5L2KB 5SV4A 3RNKA 1BIIB 3BYTA 1J5OH 3BGFC 3OZ9L 5KSBE 2IAMC 1JK8B 4XVSH 5F7DA 5KSAD 5EFIB 4TTDD 4OF8A 4P9HC 1AH1A 3O9WD 3HI5H 2RFXA 4GG6B 5DURB 2VAAA 2UWEE 3QUKB 1D5ZA 1QSED 3QRFM 3F5WB 2XICA 1F00I 3VG9C 5LWYL 1G7QA 1J0HA 4W81A 4KK8D 5C0DA 1LK2B 2PKDA 4YNYA 2XTLA 1XH3A 4LSSL 4LHJB 5HHNA 1HSAB 4HWBA 5GXBB 1G7LB 5I76A 3PXJA 5KVDL 4ORGB 2Z9TA 3FB7A 4IRZL 3NFNA 3LMJH 3B2UD 3MODH 3JWOL 4U1HB 3S9DB 1Z0MA 4I77H 1KG0A 3CZFB 1UFUA 3C5SA 3VE0A 4TSBL 2BSRA 2M8XA 1ED3B 2W0FB 4OZGF 3EOYG 2KKQA 2FD6L 5CZXD 3U7WH 1Q9LB 2FDBP 3ES6A 4DEPC 1AGEB 2EDRA 4ZFZA 4KQ3H 3NH7H 4OCYL 3ZO0A 1HILA 3SDXF 5JHDD 1PEZA 3ARGC 4HS8L 5EU6A 3RHWK 2HJKA 2ESVB 2VDPL 4JHAH 1W2KT 5ILTL 2NW3A 1YC8A 3PABB 4EN3B 1W0YT 2GTZB 3QNYB 1YYML 3I2CL 3O6FC 5H2BB 5FYKU 1A3LL 1F97A 2J8UB 3G6DL 5C0JB 3D6GA 4BQ6A 5F9WC 1JUFA 5IW3A 2OBGA 2Z31A 2WQRA 4OM0L 4MXVF 3QEQE 2BVOA 5CSGA 5H37H 1GGUA 2SEBB 1IARB 1OLZA 4PJ9B 1FP5A 3Q6FB 5H37G 1R3IH 1CVRA 1PD6A 1A9EB 4Z0BH 3JUYA 1DLHA 4ELMF 5ITBH 3CFBB 5CMAB 4ODBD 3LDBC 2VABB 5CJ8A 1GGYA 3GJFH 1S8DB 4PRNB 1JPSL 4MX7B 2XZCH 4QTIL 1NDMB 2YC1B 3TBVA 3DGGB 4GBXC 5DZOA 2BJML 1G7IA 3FB8B 5FGCB 1TQCB 4S1QL 4N0UE 5D7JA 3PL6C 1HXMB 4PB0H 4PJIE 5C08A 5C07A 3WD5H 3CMOH 4KK9C 3M1BA 1EV2E 4Z7VB 4TUJA 4MAYD 1RK0A 5DVMA 4ZOEA 1WBXA 1G9EA 4R96B 2X7LB 4KK5D 3TV3H 3SKUD 3PWVB 2AK1H 2OTPA 1KLFA 5T3ZH 3TN0D 1B3JA 1NGYA 3E2HC 4MWFB 2PO6C 4LASH 4Z0XB 4K3JH 1RULL 5T3ZE 1HH6A 4XWGH 3REVB 1NBYA 4F8QA 5DD6B 4ONGH 2VLRB 5DT1H 3KS0J 3N1QC 3H0TA 1IM9A 4Z7WA 4KJPC 5D4QA 1UQSA 5DSCB 3B3IB 1AR1D 4XT1C 3NAAH 1CDJA 5ANMA 3RWDB 5IWLA 4HMEA 3EJYD 4FZEL 2X9WA 3QQ4B 4RQQA 1Q9KB 4NJAH 5DJ6B 3IXTA 1U58A 1CL7L 2NY0D 4Z7NE 1BFVH 4OJFH 5BW7A 3BAEL 1D7FA 3MYJB 5IB4A 3VA2C 1NMBL 2JELH 4MA1C 4LCIL 1A7NL 1A7QL 4PJCE 3OKEB 1AI1H 3T09A 4FS0A 3CCHB 1IVLA 4K8RH 3VFTB 1S7QA 4HGWB 3LQMA 3PHOA 3B5TA 2BX5A 5I66A 2OX5A 1MCBA 5SWZB 3ZDZE 1N6QH 3KPQA 1HQ4B 3IXAA 1FZOB 3PWPE 1HHHB 2R69L 2FBOJ 1GRWA 4MJ5B 4OBSA 5D5MF 1SYSA 1G0XA 3CXDL 1PZUB 2OJZH 4NM8H 4P3DA 5DGQA 4F15C 1ZA3A 5BV7H 4UUJA 1D9KC 2VDLL 4L9LA 1RIHL 2JJUA 4UBDC 5HHVH 2O5ZL 4BQBA 5D1ZD 4G6FD 4X4XA 1I9IL 3CPLB 3CSYB 1XIWA 2IPKA 1GJIA 4NKQB 5M94B 2I60H 3QUZA 2IGFL 5E7BA 1YMME 4CU6A 3ULUH 3N1MC 1BM3L 4M6ML 4Z78A 3ULUE 4H88L 1OW0A 4RNRA 4ZSOB 1ZSDA 2B0SH 1H0DB 3DURB 5KS9B 4O58H 3OJVC 2P5ED 4J23A 1HINL 2YPLE 3SKMB 3UP1A 3ZLQC 5TE4L 2D7TL 4P5MA 4WY7H 3G6JE 4ODSH 4ONFL 2O5XL 4MA8L 5JDSB 4NBZB 4FFVD 4QOKE 1F6LL 3KDMA 1VGEL 4OUOA 3U0WH 2YEZB 1I4FB 4G8GD 4YXKH 1UWXK 1X9QA 4K7FA 3BIKB 2NMSA 2J5LC 4I1NB 4Y19B 4X6DF 5CHNA 1T66C 4FFYL 5ETUA 4X7EC 3D0LB 5BJTB 1KOAA 4P2RE 4M4PA 1B0WA 2RR3A 1C5DA 3MRPB 2GTWB 4XAKD 5FYLL 5C0AB 4M1DH 1YYLL 4GQ9L 3MNZA 2BVPA 3GEWB 5HVGB 1A21A 4CU8A 3H3KA 2VLJA 1IC7L 3LB6C 2BVTA 3AREB 1FG2B 2E6PA 3VFWA 4YHLL 4NHCH 4HGMA 1KYOK 3VWJB 4MD0B 3IJHA 4F3FA 1JI2A 4UU9B 5T5FL 3O8XA 3OXSB 2EXWC 3STZA 4MQTB 4RGNC 4YPGA 3WE6B 1NCBH 2VLLB 1FNEA 4O5LH 4A2MA 15C8H 5KTEH 1VEOA 1WWWX 1HI6B 3FB6B 3GMOB 3PQYE 2DDQL 3MUGA 2DQFB 3MRMA 3OSKA 1ZA6B 4ZDHA 1EO5A 4PBVC 1MCRA 4PJBA 1Z9OA 5IJKA 4XH2A 2X4PB 2RCSH 3VD3A 1S5HB 2MWCA 4OLUH 1A02N 5FFLA 5E8EA 5DMKA 3B2VL 3DMMD 4P3CH 2EYRB 5IMKB 5IMOB 4NQCB 5AYUH 4JO1L 2VDRH 5J6HB 3U79A 5DWUL 4POYA 4QXGL 1ZT7A 2QJDA 1NGZB 4PV9A 5CGMA 1H15B 1T0MA 5KN5B 1RUQL 3BGFB 1ZHKB 3JV4A 4PRHD 3CVHA 4KMLB 2IAMB 3TO4A 5JR1H 1KCVL 3PGCA 1CLOL 5DMYA 3TNNB 2CDFA 3CFJA 1YEGL 3TIEB 3NACL 5BCAA 5IIEA 5ERWA 1RQ5A 3V5HB 3FJTA 3QEHB 1WFTA 3FQWA 4P9MH 2NZ9D 3GJEA 4DN4H 4WW2F 2XQBL 1AY1H 3LQZB 4TNVF 4GRLC 4TPRL 4E0RA 1CQKA 4KPHH 4W68A 5HHOE 1MVUA 2FSEB 2OM5A 4XRCB 2FHFA 1GGBL 1BLNA 4M43H 1WF5A 4PRPB 1TETL 3C2AL 3DX9A 3TESA 3QYCA 1I85C 2BNRD 4TSAH 4HEME 1PY9A 4YGVB 1G0DA 4DEPB 4O9HH 4OZ4B 2GJ6E 1L7IL 1VGKB 1ZXQA 1RZ8A 3ARGB 3T0WA 1P4LB 2UZIL 1BQLH 3ZDXE 3HZYA 3V0VA 4UV4H 1T1ZA 3G04B 2CKBB 1FZMA 1OARL 5J7CC 2CK0L 3O6FB 3TVMD 1FYTB 4LLAA 3E6FA 1VADB 5F9WB 1JZ2A 3GMLA 1QTYT 4R26L 4LCCA 1UWGL 2D0HA 4PJ8D 1B6UA 2FO4A 4RRPG 5EUOA 3QSKB 4HW6A 3BUYA 1CS6A 3IU4H 4NQED 1MQKL 4OLZH 4KTDH 3ESUF 4ERSL 3MRCB 4QTHB 2PW1A 3ARWA 1MIEH 4KU1A 4OZGA 2OXHA 4KDTA 5DD1H 4YHOL 5AUMA 3LDBB 4WHCA 2QHLA 5CINH 1DQJA 3SDXA 2LU7A 1NFIA 1F11A 1FNLA 3ARRA 4P2QD 1U0QA 5F7NC 4XTRC 4JKKA 5E1HB 2AXGB 4O2EA 1FZJA 2CIKA 4JZNB 3AM8C 1T04A 4GBXB 4BZ2L 3HB3C 4ISVA 3I9GL 1ADQH 4Y4HC 5EN2B 5F6HI 4RIRA 5CBAB 2Z92A 2GEEA 1OSZA 3PL6B 2FIKA 4HPYL 2J1KA 1Q0YH 1QRND 3FO2A 4YX2L 2EE3A 5IFJA 4KRPD 2ESVE 3NZHH 1CDCA 1X5FA 3CXHJ 2VITA 2FEDC 4LQ1A 3PGFH 3MRHB 4LLDA 4WWKA 4JQIH 2ZUVA 5CP3A 2W38A 1TNMA 3TCLA 4U1KA 3IDGB 1KB5A 2J8UE 3E2HB 4LGRB 2PO6B 2XXCB 1ZE3C 5E99H 3GSRA 2IMNA 4ELMA 5FHBH 2K9UA 4G8FB 1MREH 1AKJD 2C3HA 1MHEA 3ORJA 5CIPB 4FRWA 4NFCA 2AQ1A 3PWLA 4X4YB 1I1RA 1DE4B 2HN7B 1FZKB 1P9MA 2UY6A 2NTFA 4CMMA 2FGZA 2X41A 3ESVF 1UM5L 4N0FA 2NR6D 3PF2A 2VXUL 5FB8A 2KH2B 3HRZA 4FQCL 2ERJC 2IEPA 1U8QA 4NCC2 1IC5H 3ETBF 1F6AB 1TIUA 5DHYB 1DN0B 3QUYA 2CLRA 4F7MA 1TZGL 4OZIE 3IDYC 4IDLA 4OLEA 1N64H 3MRJA 4XPHL 5IEKB 4IJ3C 3U46B 2GUOA 1MCCA 4LCYB 3VGHA 1DTUA 2BFVL 4B53A 1M7DB 4ZUSB 1EIBA 1U8PA 2DQCL 3MV9B 3QUML 4F7TA 4BZ1L 1FNGB 4WO4D 3U2SA 4X7TA 3GBNL 1A6WL 1MHPL 4Z76B 4NP4H 3U9UA 3JTTB 4ZS7H 2APWA 3H9SB 4Z7VE 1R3HB 2HG5B 3SDYL 1BD2A 3L5XL 4HKXB 1MRCL 2CRIA 3KXFB 5FUOL 1F3DH 1WWAX 4JN2A 5KAQG 1UXSB 3B9KC 1AD0B 1ZS8A 5E8PB 1SMOA 2W9LA 5D7LB 3BUTA 4FABL 1G6RL 2IADA 1D9KB 1KCLA 2YPKB 2N4IA 3SDDD 1FNHA 3D85A 4MMZC 2AJ3B 1HYSD 2PUQT 2Q86B 2DQJL 4NNYA 1NGXB 5BO1L 4YPJA 5LVEA 5J3HC 2DJUA 4YQXH 2AJSH 4WHTA 4PGZA 3TNMB 4KRLB 1J0IA 1DQTA 2EC9T 1Q0XL 5HGDA 5LBSH 4KUCF 1XF3A 2RB8A 4TQEL 4PLJD 1ZHBB 3O41A 1O0VA 4TVPE 3FHQA 1CF8H 1UXWA 3QQ9D 4L3EB 2LV4A 1AKJA 1FYHB 5C0FB 5I19L 5TGBB 3KPLB 3EYUH 4NQTA 5DRZA 2EDTA 4KVNL 4AG4H 3IFOB 3TF7C 2P45B 1JTPA 5D5MA 4MCYB 2WAHA 4MNGA 4YDIL 2Q8BH 5JW4N 2V7HA 3FCTA 4EOWH 4GW5B 5CJOH 3FT2A 2DI8A 1WBZB 3MRRA 4U6XB 5SWZE 1EX0A 2YA0A 4ZPTB 2QL1A 1M6OB 1GOFA 5K9JL 2OZ4L 5IJVB 3ZKMD 2XIDA 4JFFB 2IFFH 4FQLL 2J5LB 5F7KC 1A6ZB 4MD4B 2OTWB 4DKAA 3HTLX 2FJHA 2CR6A 4JFZH 5FYKE 3WUZA 4GXVL 2BXZA 1BGXH 4FQ2L 4WO4A 3KYNB 1JTTA 2YPVL 4X6CF 2DQIL 2VNCA 5ICYA 1XCTB 3LEVL 3QIUC 1DLFH 1I8LA 1NBVH 4U6TA 2XKSA 4YXHH 3QEUA 1DUYA 2RAMA 3MJ8A 5ESAA 3IDMB 5ALBL 5KANI 2GJZB 2EEAA 4H26A 1P84J 2L4OA 1P6FA 5LAXA 2YD7A 4OFYD 4PY8J 4WGWB 4TUKH 1CD9B 2I07A 3IU3B 3SDDA 1TCRB 2BY3A 3R06A 4ZSOE 3W2DH 4Q6YA 4OLVH 5DEFB 1HKFA 2VN7A 5KS9E 2MQCA 5GRVK 4KMTH 2WWMD 4C56B 2EKSB 4W6XB 1E4WL 1IAIL 1Y6NR 1QSFD 4J3XA 4F9LC 4X6DA 5FHAH 4Y4FC 5HVWA 5HYJD 4N8PA 4WGVB 4PGCA 4GG8B 5L0QC 2ED8A 2BMKA 4H8WH 1RZKC 2E9IA 2EDXA 3DBXA 3BKYH 5T3XE 4CDHA 3X3GH 3OMZA 1YDPA 1X4YA 1YY9C 5IGXH 1FLRH 4X8JB 3T2PA 1X3DA 4MDIA 1MCKA 1RV6X 5DO2C 1T4KA 4FQPA 5I71C 4FXGA 3V7AE 4JANA 3HE6C 1RJYB 4TOYH 4L8BA 3UYRH 1T21B 4GRLB 3H42H 4NO2B 4OFVA 3MRQB 4JG0H 3AC0A 4R0LC 1EHLH 2VXTH 3D39B 3U9PL 3U4EB 2GCYB 3K4ZA 4RZCA 5CGYD 5I8CB 4I0CC 1I9JH 3O4LA 4XC1L 2Z4QA 4M7JL 4QHMA 4WI2A 1WGOA 4K94C 2FX8L 2DTML 2OTUB 1A0QH 1V7MH 4QWWD 4HIHA 5M95B 1I8IA 5C0RL 1UZ8A 3Q1SL 4NQCE 3QJFA 3ARBA 1FFOA 5C0BB 5A16B 3OAYK 3I6KB 2Q7YB 4UOW0 1TJIH 4WW2A 4P9HH 2NYYC 3GBMH 3FOMA 1QZ1A 3HE7C 4BQ8A 4OLYL 1T0NA 5TDNA 4WTWA 3RWCB 5C92A 1NAKL 4U6YB 1JV5A 1JZ8A 3D25B 3RKDC 4HUWB 4YWGH 4PRDA 1MWAB 2R4SL 3HPLB 4HS6A 4HIEA 2R1XA 4JRXD 5BS0B 4DZBB 1FPTH 4JJHA 5E2VL 5JXEC 4EUPA 4R8WL 4ZAKC 5BZWA 5F89A 1XGPB 3UYOD 5DMIL 2VQ1B 3BKJH 2E8ZA 5I1IL 3MRBB 3JUZA 5GGTA 4LLUB 3KLHC 4DKFH 4L3CB 3VGAB 1ZLWK 5CJXA 2IALA 3KPNB 3ZHKA 3GRWA 1T03L 4P5TD 2BCKB 2FO1A 1FBIL 3PGDA 4Y4HB 1RUKL 3UO1L 1DQLH 1W0WB 3EFDL 2QR0B 4G7VL 3VRLF 1VENA 3RY6A 3T3PF 4NJ9L 2XWBB 1JPFB 1LEGA 1YZZA 6FABH 5I17A 3SPVA 1N6VA 1QYGL 4HC1H 1OF2B 2HT4C 1JHKL 2AEPL 1TZIA 1G7PB 5DRWA 3K74B 2V5MA 2QV2A 1FYTE 7FABH 1JN6A 3U1SH 5GRXG 1KNOB 3MOAH 4WEBH 3VXMD 2YR3A 5KSUB 3G5ZB 3QHFH 2Q6WA 4PGDB 1CVSC 1S7WA 1F4AA 2D9CA 1NCAH 1KTDA 2DYPB 4U7SA 3QA3B 3X12A 5E08H 3VFVB 4AY0A 1Z6JT 2NXZD 5AZ2H 1BREA 2J88H 1EBAA 1EMTH 3A6CH 4JG1L 2ERJB 2F74B 4ZQKB 5GSVB 1L7TL 4P2OC 3UJIL 4DZ8B 4HJGB 4WFHD 3RWEA 3IDYB 4DN3H 2WLZA 4J3TA 2BVUA 4FTVA 1FNFA 4IJ3B 3CDCA 4KZEL 2GAZA 1P7QA 3VXQA 1NANI 4HFWB 4ENEC 4ZUWA 2C1PB 4POZC 2HWZH 3P0YH 3GMNB 3EGSA 3O4OB 4YO0B 5EBLB 4PBWD 1EZVY 1EERB 3OKNA 2EZ0D 2OLDA 1ETZA 5I1KH 4PR5B 3S4SA 3G5XB 3C6LD 3QBTB 3VI4F 5D7IB 4IRSA 4HWEH 1B4RA 5EBWB 3G08B 4JVWA 3S36X 5E1AA 3FTGB 3B9KB 2P8PA 4DGYH 1GC1C 3L5WB 4BFEA 2VLME 1DSFL 1G7QB 2HFEB 1AHWA 3FO9A 1WUNT 4U2ZA 5H8DA 3RIAK 1XH3B 5CIPH 1K6QL 1WCBA 3MXVH 1K8IA 3CVHL 5HHNB 4JPKL 5GGVL 3MLXL 3OG6B 5D71L 4TRPL 5D9SA 4AMKH 4P5KB 4UV7L 1IEBB 1YC7A 4YE4L 3KPSB 5DJYB 5SV3A 3DUUA 3K0WA 3V6BR 4FQIL 2DLFH 4Y4KD 1RVFL 3AS0A 3B43A 3W5MA 3BO8A 1Z5LB 1NCCH 1UENA 2WBJC 4UINH 1CQYA 3OL2A 3VGEA 3WFBL 3NCCB 4RWYH 5IFHH 3LKPA 5EU6B 3PWJB 3MBEC 2HJKB 4FG6C 2I9LA 1J05B 1QG3A 4HD9A 3NA9L 1HYRC 1EJ6A 3DUSA 4JM2F 4Y16D 3BGMA 2HAZA 1EUUA 1JYXA 1TJGH 1V3LA 2XTJD 1KJ2B 4XCYA 5AWNH 3BESR 3S97C 1LK3L 2R2HB 3O81A 2OCFD 2AJXH 4APQC 2Z31B 2C1OA 4KJWC 4Z7OF 5I0DA 1C5CH 3I85A 2X4OB 2QHRH 3RPIB 3QPQD 5D7LE 3QCVL 3TZVD 3L3KB 4HMCA 4WUUE 4ODVH 4DTGH 3EO0B 2M26A 4MA3A 5MI0C 5ENWB 1T89C 4N0YH 4Y5YA 4LEOB 2F54D 3BP5A 2MKLC 2JJWA 4OCSH 5D1QC 3WLBA 3O2VH 4XNQA 5HDBF 3PHQB 1BWWA 3OPZL 3KJ6L 4XVUD 3U83A 5B4MC 1BBDH 4PJ7F 3MO1B 1IM3B 1T83A 3T8XB 4XBGB 3VD5A 1HWHB 2CSPA 2DWDA 3PJSA 4G6JL 4L3EE 4OD3L 3ALWA 2H6PA 3SY0B 5E6ZA 3OKOA 1DBKL 5DD5H 2VYRE 5C08B 1VACB 5CD3A 5AEAA 1JRHL 3TYFA 5A2IH 3U48A 4H5SB 3O6LH 1RK0B 4EBQH 1WBXB 4OZFA 1K5NB 2DL2A 4JRYD 4NKIL 3CC5A 4R97C 5D2NC 3BRGC 3UAJD 1DEEB 5L0QB 1CIUA 5J13C 4G7YH 4PG9A 5DLMH 1RFDL 5JOPE 3W9DB 2P7TA 2PR4L 3I84A 3QIWD 3WS3A 1KT2A 4M48H 1IGTA 1R5VB 3GMQB 4XCFH 3SDCA 1U6AH 4P59L 3VXUA 3H0TB 3JV6B 4I18C 5CEZH 1TJHL 1P7KB 2EDWA 4WTZG 5I71B 2BSSB 4F7EB 3HE6B 3QCUH 2FR4B 4CU7A 1EXUB 1QBBA 1KB5L 3KLSA 2A0LC 3VXOA 5FV2A 3IJYB 3H8NA 4GW1A 5JUEH 4I3SH 3IVKB 4JFPB 1JNLH 1CZ8H 1IKNC 4JFEA 4KC3B 4QY8B 4R0LB 2BRRL 1WQVT 2NNAB 2R2EB 1BP3B 4LPWA 4I13B 1NEUA 4P46C 3MROB 3A6BH 1K8DA 3UBXA 1A6UH 3IAGC 5C0ND 4EQ3A 1VCAA 2EDEA 3TPUB 1C16B 3MCLL 4OB5H 1E4KC 2MOVA 3KJ4C 2CJUL 3C8KB 2UWEF 3KPQB 1RZJL 3S36L 1QO3A 4Y8AA 2WANA 2ZSVA 5C0CD 3K1DA 1NH6A 5T33H 3DETC 1SYSB 4X5XB 1OM3L 3L7EA 4UILH 5D96C 3JWOC 3BZEB 2ZKHL 1JZ3A 2P43B 3MV8D 5DC4B 1ZAGA 3VJ6B 1DUZA 4JKLA 1CDHA 3W0WD 2R0KH 3CK0L 3WFDL 2XWTB 4OI8A 1NAMB 2AEQL 4S1SL 2DQDH 3LPGA 1M05B 5ISZB 4EDWL 4E41D 3AY4A 4FFWC 4IM8A 3QUZB 4L29A 1J1XL 4QRPA 2XKNB 3QH3A 5D8JH 4L4TA 1AXTH 1WC7B 4HH9B 1NGQH 3VFMA 2YMXL 4J1UA 2H32B 3IKCA 2ZPKH 3VW3H 2HJFA 4ZAKB 1XR9A 5IOPB 3KWWA 3D39E 5A3IC 1I1AC 3TO2A 4ZPVA 4NO0B 2YD6A 5GS0D 4P5MB 5KANG 4LP5A 1U3HA 5HPMB 1EH9A 3QDJB 1KCSL 2D31B 1C12A 2QADD 3EFFB 1W0VA 2JJSC 3PP3H 5IHUL 1BJ1H 3FQNA 35C8H 3FQUA 4WU7B 3KPRB 4PG2C 3Q5TA 4LCUA 4LKCA 5MEOB 2FB4L 4HBCH 3JSSA 5FUZL 4JVUA 1HHIA 4NBYB 2NLJB 1A47A 1P6AB 5DRXA 5IB3A 2IQ9H 2FNBA 5C0BE 3UMTA 2DMBA 3EDJA 5AZEH 3I6LE 2AQ2A 2VLJB 3T0EA 1JNHB 4PRIA 3MGTA 2BOCA 2DI7A 1E4XI 1MWAH 2E7HA 2WW8A 1B0RB 3BDYH 1BOGA 3O8XB 3STZB 1JMXA 5I1EL 5FF6B 5FAAA 2UYLB 2H2SD 4KK6D 5BS0E 4JFDE 4V1DB 5KZCB 4PJIF 3MLTB 4TULH 4XNYH 1LHZA 3F7QA 2DBLL 3T2OA 1WIOA 3W0WA 3MXWL 3CX5K 1IFHH 3D18B 3QUXA 2W0LA 3EO9H 2X05A 1EZVX 3EDKA 2VLKD 3HR5B 4PJBB 4P2OB 3HI1B 2VDKL 4AIXA 5JPNB 4NPYB 1SJEA 3JTSA 5E9DD 2FL5A 2AV1A 4GMTL 3RVXC 1SEQL 4DFIA 3ZYZA 1FL3B 5FA3B 2HJLB 4XHQA 3D69B 1U93B 3KGRA 2QBWA 1AIFA 4PV9B 1T7VA 1FNSH 5IW1A 1F4XL 4QHKJ 5FGRA 4YR6B 5DJZA 1N7ML 4D0CA 4LAQH 5C9JB 1F58L 3EYOB 2PYFB 4ZFOA 4Z7NF 3FB5A 1NLDL 3BW9B 3F6LA 1V3MA 3IDXL 5DTFA 3MJ9A 3EYFA 1L4IA 4W6YB 3CFCH 1WVZA 5C2UB 1DR9A 1MFDL 3DXAA 1PKQB 1PZ5A 1TTUA 2CO6B 3BEWB 3MRGB 2WINB 4C83B 1RMFL 1M7XA 4POUB 5DFTA 3D3VA 1QBMH 1BLNB 4UT9L 2OJEB 3QO1B 3ZDZF 5FYJH 3R4DA 4H0HB 3MLWH 5E6YA 5EZIL 5IUSA 5KBNC 3F8UB 5DK2A 3QWRA 1QQDB 5CGTA 1A9BA 2LQRA 2NY4D 1A6PA 3V5KA 2OL3H 3NPSC 3P4NB 1KELH 3HCVA 4GFTB 5I15H 2C4FT 1WFNA 2HKHL 4AEIL 3PWUA 2WBJB 4HQQL 1XGYL 4E5XA 1MEXH 1RZ8B 2XPGA 5JW4R 3MBEB 4RGOH 4FQXD 3HZYB 5DHVA 4WWID 3V0VB 3QRGL 4BELD 4BK5A 1T7ZA 1FZMB 5H94B 3RTQA 4PJFB 3QXVA 4DOHE 1JWUA 1I3VA 1P1ZB 5HGBB 4J12A 2ICEA 3E6FB 1MCQA 4UDTB 2B4CL 5I1HL 1QR4A 5D7IE 1U8LB 4DAGL 4APQB 1NC4A 5BQ7B 1N59A 3MLSL 3ULUF 1MUJB 3ROOB 2E3VA 5EUOB 2RJMA 5EORL 1KN2H 1BJMA 5J89A 1CFSB 4LQFH 3V52H 3GIZH 3IGAA 3X3FH 1J12A 2AP2A 3BUYB 4B7LA 3QFJD 4M6NH 4XAWH 3MZGB 4M1GH 4XPGH 2V2TB 5C0EB 1UT9A 5SX5K 3WYRA 3GIVB 4K3DH 3ARDC 2AJYH 2H3NA 3P9MB 4S1DC 5MI0B 4NO3A 1YMHA 3DYMA 2CXKA 2Y06L 1P69B 5EH1A 4S1RH 5D1QB 1LO5B 2F9BT 4OT1L 5HHMB 1F11B 4KAQH 1LNUA 2ZCLH 4G42A 4NQDA 1TPXC 4JM2A 1F8TL 1WIUA 2JE8A 5TF0A 5EIQA 1JGLL