3OGCB

Kcsa e71a variant in presence of na+
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Mechanism for selectivity-inactivation coupling in KcsA potassium channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 49
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2010-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ogcB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ogcB01
4IOSD 5IESL 5MEQA 2Y6SC 2YUZA 5IFAH 2GUOB 2WP3T 3VWKD 4UT7H 1FLRL 5J57B 1O0VA 3VI3F 5IFHL 2W92A 4B0MM 5E7FA 5DK2B 1T7ZA 4UT6H 3QEGH 4EI5D 4D8PB 3F12A 4KJWD 4LCIH 2UVFA 3OJDB 4OSUH 3UYOD 3ZHDA 1UEMA 4CN6A 2EH7H 4OZFG 2DWDA 5FCUH 4BH8A 1ZLVH 3L7FA 3JUYA 3ET9F 4JG1L 3QJHA 5JHDB 2Z35A 3LEVH 4LPTA 3NABH 1JTPA 4MWFB 1GZQB 1IQWL 1KCRL 2JK5B 5IJVB 3V6ZA 2GJ6D 4IS6B 1WIUA 5C08D 3NPSB 1PJ9A 1F45A 1EGJL 4HK0B 3M8OH 2WQ8A 4LOUC 4X99A 5FHBH 5TE4H 1JIBA 3MRRB 5IB1B 1CLZL 1FFNB 4HXAL 2D7PA 1IL1B 1NUDA 1PKQA 4LVNB 5FA3B 2CUIA 1D9KB 4MDIA 3QHFH 3H6JA 1KTDB 1DBJH 4JM4H 3U0PA 4QHLA 5F7EH 4KZEL 1QSEA 3O6KH 4XPAL 5ID0A 3HZYB 1N3NA 4MAYD 4KTEH 5CP7A 1RJYA 1IM3B 2AQ1A 3U46A 3ZHKA 5C70A 5TDNB 4H88H 4IHOA 1LP9B 1R3HA 1J5OH 3MRJA 3KWWA 4XMKH 4EDXA 1DFBH 2DIJA 4OF6A 2BMKA 4ZS6C 1EHLH 1HILB 1BJ1H 1XGQA 3GB7B 3AC0A 5HY9B 3OGCA 1W0VB 3PABA 1GXEA 2DM7A 2CRMA 1N59A 3RP1A 1J1XH 3WFEH 5DEGB 2X1XR 3TZVB 3QUXB 3QO0B 2K7QA 1F58H 4PJIB 2XY1A 3O11A 3PIQB 1IC5L 1MRCL 4XX1E 4F9PA 5H2BB 2QQQA 2HT3D 4JRYE 3VGBA 3HAEG 1R3KA 1UYWL 3NH7H 5C2BH 1XF5A 1YEDA 4YHPA 2B5IC 4Z7NE 1IEBA 3N50A 1WEJL 2BSRB 1ZLUH 1QRNA 1OD9A 5DRXA 3TVMB 4QYOB 3REVA 1U8HB 2BNRB 3I3EA 4XNXH 1KELH 2ZG3A 5BQ7B 3UYPA 1ZV5A 2NY2B 1EFXB 5AYQA 1URLA 4ZFFB 5EOQL 2HJLA 4H0HB 3MRNB 3UJJL 2ZJSL 2J88L 1KCVL 1UB5A 5FO8B 5LWYH 4ZSOB 1OLZA 2PO6C 5FGSA 2ZNXA 1FSKB 1IGIL 1OLLA 4H5SB 5HYJA 1IAMA 4XP4H 3OPZL 1GOHA 5FM4A 1TVBB 4NO2B 3EJZD 4ZPVA 5D5MF 3BKYL 3CCHA 4RDQF 3RDTD 1RZFH 3NCCB 5L9DL 1GCFA 4V1DD 3TYFB 4DZBA 3C09B 4PTTB 4L8BB 1NFDB 3P9WB 2NW2A 3RVWD 2K1MA 2VN4A 4BM7A 4WUUD 1BBJA 3CFDA 1S8DA 1D5BB 5F6IB 4G6KL 4NO3B 2R1WB 2EYRA 4PRIE 1FIEA 1UXWA 1NFIA 1JWSA 2W9EH 5DGQA 3LKQA 2A0LD 1BQHG 5I1HH 4RGOL 5F9DC 4YGAB 3IAGC 1JGUL 3FB5B 5IEKB 4PIRF 4L8CA 1CFNA 4PJGE 4KK5D 2ZCHL 1T04B 5T3XH 2MCG1 2EYTB 3I75B 5C0NC 4MNGB 3VE0B 2PR4H 3F5WB 3VG0L 1T5XA 4YH6A 4RZCA 1IEAA 3GIZH 4Y5YA 1NAMB 2K9UA 1MWAB 5DHYA 3DX9A 4HMDA 2DQHH 2JJSC 3E2HB 1MCJA 3THML 1MHPL 1WZKA 3MO1A 3ECBA 5D7IB 5E8EB 1S5IL 2LAGB 4CMMB 1QFOA 2DI7A 3IDYB 4PG9B 4FXLA 2I27N 1U8MB 3LRSA 1B0GB 4Y4KD 5D9SB 4DGVL 3ARGB 3UMTA 2GSGA 1HSAA 4UNUA 1E27A 5J1AA 5EU7E 3MJ8B 1XZ0A 2IQ9L 4Y7MA 4UOW1 3MMEA 1AHWA 3UTSD 4KKLD 2HKHL 4EI5B 2ZUYA 5CJQH 4PLKD 4IOIA 4B41A 1FZMB 2CO6B 3B2UC 4Y2OA 1K4CA 3AXLB 4NKOA 3MOQA 4QHMA 5IGXL 4OT1L 4X7FC 1T66C 1I9IL 3QDMD 3G5YA 1EAPA 2QLVB 2XFXA 2GJ6B 5C08B 1S7XA 3DXAD 3IFOB 4WW2C 2EIZA 4ZMAT 4RFEB 2ZZUT 3QIBA 5J4MA 4PJXB 3CDGB 1YPZE 5EA0H 5EBLB 3MJ7B 2DS4A 5DJAB 1YA5A 1ZLVK 1G7LB 5KW9L 4PRAB 3SE9L 3SGKC 5C2UB 1S3KL 4M8QB 3HB3C 4F7MB 3D85B 2DLTA 4OCXH 5F7MC 4UNTA 4JGMA 1DEDA 2NW3B 3MRIB 3VFRA 3QZWA 4MA8H 1Q0XH 1ZANH 5E2TL 4BQBA 4Y19B 3R8BB 5DVMA 1ACZA 5K59E 4N0UE 4RSVA 5J12C 2P5WA 3KYKL 4KUCF 5I75B 2ICCA 4WCYH 1JFQH 1I7ZB 1QBLH 3LKPB 3S36X 4IMLA 3VXSB 4NC2B 1Q9LB 2OMBA 4CN4A 5ENWB 4MB3A 1NMAH 4JFEE 1L7IH 2H3NB 3P4NB 1FVDB 2BFVH 1MCOH 2FHCA 4MNHB 2ZUTA 4LVHB 4PJ5D 2A6DB 5J9PA 3MJ9L 1AQDB 2R2BB 1KJVB 2R23B 2R2HA 4X7EC 4E5XA 4QF1A 5DO2C 1XIWA 1KB9K 3LQMA 3ZDXE 3O4OC 4M00A 4FQQB 5BOZG 4OZFB 3HE6D 4K8RD 5A3IC 3RWJB 4Z7NF 5I1GL 3IGAA 4RAUA 3RJQB 3LKSA 2FJFA 2O5XL 2YK1L 1ZA6B 3D2UB 3CLFH 3WO4C 2XA8L 5HVHC 3ZHLA 2X4RA 2VDRH 4WFFE 1RUKH 3DSNA 3P40A 5DJZB 3AAZA 1R24B 2YUWA 3SDAD 3G04B 1G6VK 5AYUL 4RISL 3JWOH 2VKXA 2F54D 3CSPA 1EX0A 3FB6A 4NP4H 1U58A 4AL8L 5F89B 3DMMB 1HEZB 2J5LC 4XAWH 2VZUA 3SQBA 5DJ0B 4TSAL 4ZXBC 5TH2B 3S3PA 4QY8B 4X7TA 5I1CL 1S5HA 3CLEH 3IDNA 1CGYA 4YFLI 5EOCL 1ZLUK 2HKFH 5LCVL 3ZTJH 1FG2B 4LBEB 4P23A 3KDMB 4JM2B 4UQ2B 5E9DA 3ZKND 5FYJL 3QT2A 4V1DB 4OZHB 1NEZA 1L6ZA 5KOVC 4NJAL 4L29A 2Z92B 4ZDHA 4ZUTB 1LO2L 4KVCL 1CD9B 1F4AA 2WZPD 1AO7E 1MFEL 4HPYL 2P42B 4KHXH 5GJSL 1RU9H 1HE7A 2VXSH 5FA4A 3I50H 1RZJC 1NGWB 1S9YA 4XNMB 4G80B 1QTYT 2WWKO 5E5MA 3PWVB 3QEHA 4BH7B 2DLEA 4JY5H 4MA7H 4ZS7L 4OV5A 2CR3A 3MLYL 2H9GB 2YOCA 2R2EB 4Y4FD 5D2LE 1DBKL 4N8VA 4PJHE 1NSNH 3T09A 2DI8A 5GS1B 5DQJB 3T0EC 3KYNA 5D4QA 1WBYB 1JGDB 5I8CA 5DT1H 3WIFA 5DD1H 5JW3H 1HDMA 4XZUB 2VABB 1EZVY 2JIXD 4RAVB 2ORBH 1WITA 4OAWA 5D70L 4Q9QL 4U1JB 5F9OL 5GGVL 1S7WA 1CDYA 3T0AA 1U8PA 5AWNH 1MPAL 1CDJA 2P4AB 1UXSA 1ZTXL 4RX4A 1NMCB 1XGUB 3FO9A 3UYRL 4CDGC 3JWDC 3IDXL 2IH1A 4FQCL 5GRUH 1DBMH 5CJ5A 1BFTA 2HT2C 2JJTA 3DX6A 4NQEE 1ES0B 3UTSB 4PD4K 4LNRA 1G9NL 3TV3L 1Q1JL 3DVNA 4XBEH 4DVRH 4UTAL 1UCBL 1A02N 1IILE 4FMFA 4BZ1H 1Y6KR 1S7SB 2YN3A 3SE8L 1CICD 3VXMB 4FNLH 2CIKA 2GK2A 4U1KB 3FRPG 3S35H 4WTZG 3ARBB 3QDMB 1R0AL 3RNQA 4LNVA 2NX5A 3QG6A 1DUZB 2JE8A 3OXRA 3BXNB 5BO1H 3DXAB 4ZYKB 2NQCA 1IEHA 3LY6A 3W39A 4P57A 1BQHB 1RK1A 3IDMA 4LKCB 3MTRA 1CTOA 3RU8L 2GK0A 5K59F 4DN4H 3WIIH 5I8EB 3REWA 2V9RA 4YUEH 3UX9B 2APXA 3C2AL 3ZTNL 4UDUA 3MA7A 4HKZB 1QP1A 4ZAKD 1WFOA 2UV3A 1YEEL 3O9WB 4AEIH 1DQQA 4KC3B 2GCYB 43C9A 5GRVL 2B8OT 3SDXE 1A3LL 3NCFB 4Z7QE 2AQ3A 2VITA 1OSPL 5GS2D 1FH5H 5ESVB 2CLVA 4QWWD 4WHYG 1G1CA 1LDSA 2QKIA 5J7CC 5KS9E 2PUQT 5JDSA 4DVBA 3ZDXF 5ALBL 1FLTX 5A2KH 1R5IB 4QRPB 3SE3A 3FO1A 2P7TB 1MFBH 2V9QA 4MA1C 3HC4H 4YHLH 3IJYB 3BVNB 3ULVL 2FJGA 1CK0L 4JFFA 3BUYB 2KQNA 2F19L 4LK4A 3DIFB 5EU5B 5DK0B 4CN1A 4LLUB 2EIBA 4GRWE 3D3VE 4OD1H 1OD7A 2PYEA 2KBGA 5C9JA 1V8HA 5E8PA 5CGMA 3PGCB 1T7YA 5IW1A 4OLWH 2VDLH 5IV2B 1DQDL 2ED8A 4UTBL 3OKMA 4WFGE 2ZSWB 4OCLC 3U9UB 5L2JB 5BJTA 1PG7X 2P44B 3TBTB 4C4KO 3AS2A 1JGEB 4R6UA 4ZTPH 1QSED 3WNKA 4OGZA 3GO1H 3BEWB 2X9YA 3TO4C 5FECB 4LARH 3LN4A 5EH1A 4O2CA 2FD6L 1H3PL 3B8YA 4HAFA 3DUSA 1RUPL 1DBBL 2AEWA 5F3HA 2CJUH 5HJ3A 1G7JA 5DMGD 3AREA 4M7ZB 3TBSB 2WIIB 3UAJC 1I8LC 3UBXG 3V5HB 1LE5B 5I71C 2E9JA 2DQTH 3E8UH 5IB3B 2NY4B 1C12B 3O45B 1J05A 2JTDA 4E41A 4LCCB 1QYGL 4DW2L 4WI7A 2R0WH 2LVCA 3D9AL 4G3YL 4Z8FL 2ATKA 3DV4B 4ELMA 4RA3A 5BCAA 3AMKA 3ULUC 4H1LG 4ZUWB 4PGEA 3PWPE 5FF6B 5C6PB 3Q3GB 3GK8H 1YEKH 1WBZB 5D2LF 2JELH 1BQUA 2Y07H 3VFGH 3VGEA 1X44A 5JLZB 1S78C 3QJFA 5CJXA 3GSVA 3NA9L 1INQA 5EC1A 4F57L 5FM5M 1QRND 1SJHB 4LLYB 5I18H 3CVIL 3P4OA 3U7YL 4GQ9H 5HHOB 3MLRL 4F37K 5C7XH 2DQCL 3MREB 3D25A 4ZUUB 2BSED 5DTFB 4HMEA 4GRLB 1JF6A 1NC2B 2R4RL 3OKNA 5FGRA 1B4JL 1A47A 4DCQB 2UZXB 1J11A 4GH7B 4OLUL 3VRIB 1IGJA 1WC7B 3MODL 3WFBH 1FPTL 2OK0L 5ACLA 2BVPA 5HYJD 5IMOB 1GOFA 2AK1H 5E1AB 3FT4A 4HS3A 3GHBL 3BIAX 5IEHA 1QVOA 2AQ2A 5DRNA 1WK0A 1QQDA 4NKDB 1INDH 3BWAA 2DAVA 1QHOA 2FCBA 3MLZL 5DJCB 4G9FE 4PJ8A 1YEIL 2I60L 4KVNL 2HVJA 3BN3B 1Z0MA 4J3TA 3GM0A 5GS0C 1YY9C 5C8JB 1T1ZA 3JBG7 4IEFB 4RWHA 3BFOA 4D9QD 1MLCB 4EI6B 5CSZB 3ZDZE 3VG9C 4JAMB 1S7VA 5E6IC 4JKPL 1O5DT 4FP8L 3VGDA 3QNZB 4LCWA 2HJFA 1BVZA 5F7WC 2LQRA 3T0XA 4HIJB 4P3CL 1L7TH 2FGWL 3WUZA 1X6NA 4HWEH 1I8KA 3WE6B 3LB6C 3U7WL 3QCTH 1E4XI 4M1CD 4ODWB 5AEAA 1MWAL 4HPOL 5JPNB 5J89A 2X09A 3SDXF 4OKVB 5I8KL 4KK8D 2R0ZH 4KHTL 4OGAD 4K94H 5KS9F 4J6RL 4ZAKB 3ARUA 3D5OF 3IFLH 2DB8A 3WJJA 1BGXL 1CF8H 3OSKA 3HLAB 3CFCL 1YQVH 4PRBA 4XNQA 5HGDA 2AABL 5C0CB 3AS3A 4NHCL 4MJ6A 2FBOJ 4RGMC 3BGAA 3BD5A 4WV1C 5SWZE 3F12B 1L9NA 4F33A 3V0AC 4YHYC 1UM5H 2DWDB 4OFIA 4BH8B 5AAMA 4NN7B 2RGSA 1KF9B 5FYLH 4FTVA 1NUFA 3QJHB 3C5ZA 2PTTA 2Z35B 5D71H 3MZGB 5T1DH 2VLJE 1TMCB 1XGPA 5FYJE 3O2WL 3QUZD 5JIHA 1G0YR 2OTUA 3WIHA 3MRCB 2WAHA 4JFOA 2A1WL 4EDWH 4X99B 1GGIH 3QIBD 3ROOA 1NGQH 4M7LT 4OTXL 4FA8A 5HHMD 5I1IL 4POZD 2DMKA 2XA3A 3TJEL 2CXGA 2KH2B 4A2LA 1TVHA 1PKQB 4HK3N 3MPCA 4GAYB 4JRXA 5CFHA 3CVHB 4QHLB 3LQAC 3U0PB 4XC1H 4C56E 5ID0B 4PLOB 3GBMH 1N3NB 4HEPG 4QOKE 2QQKL 4M5ZH 1BZ7A 2P5WD 1YYLL 3CFJB 5CP7B 1RJYB 2DM2A 1FGVH 3IFPA 3SEPA 4P9MH 3U46B 4WI6A 5B3NA 1M05A 4ORGA 1RSFA 1R3HB 1NANH 1EO8L 3MRJB 4NFCA 4POYA 1UWXH 2VQ1A 2BMKB 1XGQB 2BNQD 3VDCA 3R1GL 1EBPA 3PABB 3ESUF 2UWEF 4Y8AA 3MFGB 3MRGA 1XCQB 3LH2L 1NKOA 4YPGA 1XIWD 2BVEA 3BPLC 1ADQL 3IAPA 2VDPL 4XXDA 4LCUB 4H0IA 3L9RB 4MNQB 2X9WA 2C7UB 3GSNB 4M43H 4MQTB 1CDUA 2E9IA 5E8NB 4FQPA 3VD3A 4MD5B 4XPTL 4PJ7B 3K46A 2X4UA 3VWJB 1N0XH 1KB9J 1LHZA 2VLRA 3LPFA 3CFEA 2A38A 1RV6X 3B83A 3H9SA 1U3HC 5MI0B 2XZAL 1E4XL 3SKOA 2FB4L 1QRNB 4YDIL 5DRXB 2X10A 3REVB 1BJ1J 5IQ7L 3L3JB 4TTDD 1E4WH 1JRHH 2HJLB 2Q3AA 3NACH 1JE6A 2F53A 5IT2H 2P1YA 1BFOA 1GGCL 2E7LA 2HVKA 1JHTA 1CT8A 4YBLB 4L3EE 3Q1SL 3U9PH 4HV8B 4MD0A 1FNSH 3KJ6L 3B9KB 2A9NL 4P23D 4ZPVB 5FUOL 1FNFA 4FQXB 5D2NC 5LAXA 4NRYA 2VLKB 5E9DD 4Q9RH 3ZDZF 3EO1A 4NN5C 1YJDL 4JN1L 3TBYA 5C3LD 2B7DT 4DZBB 3WUWG 4IRSB 5C0JB 3UBXB 1CD8A 1BBJB 3CFDB 4NQXA 2DOCA 4MCZB 3HZKA 1KFAH 3F58H 4O58L 1KNOA 2XOTA 1BIIB 1ZHKA 3HG1E 2AJUH 3S35X 5KVGL 4JG0L 3LKQB 1HINH 2WUCH 2CMRL 4HJJL 4IRZL 1A0QH 5JHDE 4OJFL 4PJEA 4DKAA 3ULVE 3G6JE 2RR3A 4M6ML 5HI4D 4H1LB 2G9HB 4CVZA 2ENSA 4WU7A 3MCLH 1JNNL 5CZXD 3WFHA 5CSBA 4HCRL 3RX7A 3KPLA 3DBXA 4HJ0C 4JFZL 3HNTH 5T3XD 5T1LB 4AY0A 4RZCB 1IEAB 1H8SA 3DX9B 4X83A 4KQ3H 3P4MA 4RMRA 2XN9E 2EKSA 1IGMH 4L4VA 3LS5L 2I9TA 4ZO9A 3GKWL 3IDIA 5FUZH 5FGCB 4KI5D 1TTGA 4RQQB 5FEBA 2GSGB 1HSAB 1MJ7L 4HUMB 3MROA 1DVFA 3HPJA 1F6LL 1XZ0B 3JZ7A 3KPRA 1LDPL 3BPOB 3MMEB 1AHWB 3PWUA 5IW3A 3SDCA 1LP9E 1PVHA 1ZVHA 4ONGH 4R8WL 2RFXA 4K3EH 1PZUB 3BGMA 5J3HC 4J8RB 1EXUA 1AR1C 4YHZL 4TNVF 4R90L 1AC6A 2AEQH 2PXYC 4MB4A 1K4CB 2UVEA 4NKOB 4JDZA 5AG8A 4DUXA 2FYYA 2NY5H 1HNFA 4LLWB 1EAPB 32C2A 1K5NA 2XFXB 2NX5D 3GMMA 4PD4J 1T03L 1FVEB 1S7XB 5GSRB 2AK4A 3FHAA 1PBYA 3MC0A 2HAZA 4BUHA 2CGRH 2OR9L 4YGVB 2EIZB 4WFHE 3GI8L 3QIBB 3L7EA 4PJIE 1YEFL 3LKRA 4P46B 3VD7A 1IGFH 1LO3H 2NLJA 3ARXA 1X5AA 3FN0L 1OCWL 4OF5A 1FNHA 3H8NA 1UH3A 3MOAL 4KKAC 3PQYA 3OL2A 4UZGA 4MS8D 1CE6A 5JOFA 3VFRB 1NBQA 1HH6A 1T7VA 4GG8B 1NCBL 1UKQA 1VB9A 4NBXB 4HS8H 1F11A 1SM3H 5IBTH 3KYOA 2BNRE 4JO1L 5C0RL 1KENH 4LU5H 5LQBL 2AJ3A 3KS0H 3MUGA 2NTFA 1WIOA 4ZSOE 5IUSA 1QEWA 1ND0B 1FFRA 3BZ4B 1S7TA 3LQZA 4XNYL 4RFOL 2LFGA 1VEMA 1CGTA 5C0GB 5KANI 4G8FA 4KU1A 1BHGA 1A6WL 2DQFB 1JI1A 4Y5XC 2YWYA 4JFFD 4E5XB 5TFSL 4QF1B 1XIWB 1NFDE 2ADJA 4KDTC 4K8RL 3WDJA 4LLAA 4TUJB 2FHBA 2PYED 1UWXK 3LV3A 3P11H 4GXVL 2R1XA 1GGBL 2D31A 4XVSL 2XWJA 3BE1H 3ZO0A 2Y72A 1HZHL 5LGJB 3T3MF 1MCIA 4Q97A 2IGFH 3DTXA 3AY4A 4OM1H 5CUSL 1E28A 2FLBT 4WO4A 1KIRA 2CSPA 1CQKA 2VB5A 4TPRH 1AGBA 1NCCH 1A1MA 4L5FH 5D1QA 5B38G 4X9HA 2ESVB 1U58B 4YHNA 5BRZB 3RA7L 1HNGA 4MYWB 3IAQA 4XPBL 1MCKA 1CU4L 3NCMA 5HYSG 4X7TB 3EJYD 1FVCA 3ARED 4UDTA 5D7IE 5E2VL 1S5HB 3C60C 4P9HL 2P8MA 3IDNB 3TPKA 5DHVB 1ETZB 2B1AL 4YFLF 4OM0H 2HTKD 4G9DA 3QQ9C 3M17B 4PGZA 1F4YL 3V6OE 3PV6B 4ZNEE 1D5MA 4XBPB 4E41D 2VR9A 1NQBA 1T6VN 5HGAA 3ULVF 1IC4H 5EUOA 1W72H 1U92A 2YA1A 4PYGA 3CXDL 4QHNA 3L95B 4XP1L 4G8EA 5FA4B 3W0WB 1B2WH 2XACC 3FQTA 1S9YB 3CU7A 1CR9H 1AXSA 4J4PC 4HWZA 4CAGA 1CFBA 3EBAA 3WN5C 2GSIA 1MSPA 2GJ6E 2FEEI 2O5YL 4QKXB 3QEHB 5C08E 4NQTA 3QCVH 3OKOA 2E9WA 3BRDA 5FDYA 1JUFA 4GKOA 3HCVA 3P0VH 1KCKA 4JQVA 4ERSL 3I3DA 1EH9A 3BW9B 3A6CH 4PV9A 1VGEH 3OKLA 2IBZX 5KZCB 4I3RL 1LP9F 3VD5A 1S7WB 1HYSC 1ZT4B 4OGXH 5CJ8A 3BPNB 1UXSB 4P5TC 1EV2E 1R3IL 4W4OC 5ICZA 5F7LB 4JFQB 3FO9B 2BVOA 3Q6GL 2EDQA 5KVFL 2IH1B 1A1OB 3CFKA 4BELD 1QR1A 3MRBB 4PJ8D 4YIQB 3SKMB 4RBPH 1Q94A 4GS7B 4U05A 4GJTB 4JKMA 1UQSB 3DSFL 2FDBP 2Q7NA 1OWWA 4Z5RA 3KR3L 1XT5A 4OF3A 3QB7C 1F8TL 2CIKB 4OUUB 1CFVL 1YC8A 4PJIF 1RJLA 5GHWH 1OPGL 3WUWB 6FABH 1XF4B 3B4NA 4NOBA 4LCWD 4NWTL 3QG6B 3V7AG 4TNWK 3OXRB 3W39B 3RWEA 1KN4L 1RK1B 4K9EL 3N1QC 3IDMB 2FX9H 5CHNB 4U1GB 1CLYH 3O6ML 2AJXL 3REWB 3DO7A 3GMNB 3S6CA 5DC0A 4HD9A 4G8GB 2XWTB 4RGNB 4UDUB 3MA7B 4XGZA 3RVXD 2HLFC 4TUOA 1FAKT 3X12B 1A7QH 4OFYA 5DJ8A 4Z18A 1MJUL 5GISL 1J18A 3L3GA 3RIFK 1DQQB 3ARDA 1MRFH 1Y0LA 4DAGH 3VFUA 4XC3H 3QWOB 5EU6B 3L1OH 1LEIA 1ZHLA 2VITB 4PJCE 1VFAA 4E42A 1LNUA 2QKIB 5JDSB 4DVBB 4GAJL 5EC2B 1R6VA 1FFQA 1NFDF 1YC7A 3OAUL 3UBXI 2XTJC 2AXFA 2IH3A 3HNSL 4WFED 3FO1B 2FSEA 1RUQH 4QTHA 5T3ZL 4AENA 1XH3A 4FTVD 3C5ZD 2ZKHH 4JFFB 5SWSB 1JPTL 4K3DH 1IKFL 1KUMA 4WGWB 1SYVB 2C4XA 4MD4A 4V1DE 2OR8A 5KJRL 4NQDD 5MEND 2JLLA 5JHLH 1DDHA 3GGWB 2PYEB 3VRLE 4ZD3H 4GMTH 4M03A 2YRLA 3UP1A 5E8PB 4XMLH 3QO1B 3WS6C 5JIPA 5IW1B 4OD3H 3MJGX 1JNLL 2VXUH 1OAXL 5IB2A 2FEEL 4O02H 4PJBA 1FG9C 3RFZC 3CVHL 4L4TA 5CD3A 3WLBA 4FABH 4NQVA 5EU7C 5D7IF 2OL3H 5F88B 3CUPA 4N0YL 3LN4B 5BV7C 3VFTA 1GH7A 2VL4A 5IFHH 4N68A 1UH4A 1BFSA 4RRPA 1V7ML 2QEJA 2QV2A 1OY3B 5F3HB 2NNAA 3I6LD 3DYOA 3T4YB 4WHTB 5HJ3B 4LHUG 3AREB 5DJXB 2IPUG 4P4RB 4HW6A 3S36L 1P7QA 4TUKL 2OCFD 5J11C 3WFDH 1WJ3A 5IQ9B 5D7JB 3RVVC 1L9MA 4JG1H 1IAIH 3TGXA 1IQWH 1KCRH 2XQYK 5KN5B 3FO0L 5ACMA 4H8WL 3KPNB 3T1FA 2EECA 2ATKB 4ELMB 2V2XA 3L5XH 4EUPG 3UTSE 4XBGA 3RGVA 1GAFL 3GSNL 3QIWA 3D1MC 1IGCL 2HTLD 4OZGB 1AD0B 4V2BA 2EO9A 1CLZH 3JXAA 5KSUB 4PJXF 4NM8H 3ZE2E 3RZCC 3D69A 4E0RB 2VLRD 2OS7A 3TIDA 5T1MB 3MLSL 1W72A 3QDME 2KQMA 5LBSL 3H9SD 4S11A 1SMAA 4XPAH 4BZYA 3P9LB 5EC1B 3KNBA 2JF1A 4ZO8A 3T77A 2VIRA 3OAZH 3DXAE 2NXZC 1KN2H 1D7FA 5CBAA 3BP6A 2E6JA 1HHGB 3D25B 4MLSA 3GSQB 2F53D 3OKNB 1C8PA 5CIPH 1YN7A 4PGCB 2JJSA 1IGJB 3FKUS 4IIQA 4R9HA 1V05A 5KSAA 5ADPL 2X05A 1PYWB 1WGOA 3MRKA 3T65B 5B38B 1ZGLA 4HS3B 4BJLA 5DD5L 2WLZA 2YC1A 4OB5H 3UTZB 5IEHB 1QVOB 3IJHB 3N85L 1JCKA 1QQDB 2NYYC 5E2WL 2DLHA 4KROD 5HYSB 1EEYA 3N1GC 1J8KA 4Z7WB 4PJ8B 2DQDH 4LVOB 3EFDH 1MCSA 3EJJX 1IC5H 1MH5A 4O9HH 2B2XL 1MRCH 3WCYA 5ADOL 5D1XC 4NBYB 1KB5H 2OSLA 1S7VB 3P77B 4GRMB 5EN2B 3PXHA 4LCWB 3L3HA 3ZKMC 1WEJH 2HJFB 2ZOLA 4RBPK 4IMKC 2GW5A 4NNXA 1RMFL 3BDBA 4FRWA 4PJAA 2MPAL 4YO0B 3MOBH 5EOQH 3MNWA 5HGHA 2J88H 1KCVH 4XNZC 2PCPB 3WL9A 2DIBA 2DJ4A 4XPHL 3SGKA 3SJVA 2OJZL 1TQCC 5FOJA 2DQGL 4N1HB 3AROA 4F7TA 1IGIH 3HHRB 4DUWA 5B3JE 4M1DL 1CBVL 1KV3A 1MAML 4L4VD 5A2IH 3HE7B 4N9GB 3OPZH 2K3TA 4QCIB 3G6AA 1PD6A 3BKYH 5FM5O 1ZGLP 2F54E 4PRBB 1DVFD 4XNQB 2BRQA 5D96C 5HGDB 2DLIA 5L9DH 2OZ4L 4JANA 5IFAL 3KPRD 4JM2F 5DD3H 3SDCD 3K8KA 2AKRB 1SHMA 4HHAB 4OZHF 4F33B 3C9NB 4OD2A 2FX8L 3RWCA 5DC9B 3UROR 3VRLF 2VZ3A 1OVZA 3CX5K 3WFZA 3F7QA 2MNUA 4YXLL 4WNQA 4JEGB 4FTVB 2PTTB 4MX7B 5FCUL 1JGUH 2J8UA 4HWBH 2R2CA 2XZQL 1MFDH 2H32H 2ZCHH 2X4SA 5B8CC 3L3DB 5IVXB 5FYLD 2AK4D 2X7LA 2YXMA 3LEVL 2I26N 3BQUB 4ZPTB 3CSGA 4HMCA 4YBQD 5BS0A 4JDTH 5FK9A 3MV8B 1J8HA 3THMH 1TVHB 1J1PH 1X6LA 3PQYD 1S5IH 5F8RC 5GZOD 4HLZG 4Z78A 1BBDH 1NMBL 5ITFB 4PTUA 1SBSL 4Z7OF 4JRXB 3LDBC 4JZOA 4DGVH 3RY6A 2J6EL 3FRUB 4Y16B 5EBWA 5HHOE 1BZ7B 2J8OA 4JM4L 2GQHA 3E3QE 4PY7B 1MCBA 4K3HA 3WXVL 4FQLL 1QSVA 3W11D 2MTPA 2OL3A 3S3JA 3QPXL 5J1SC 1CVSC 1M05B 2H8PA 4ORGB 3MBEA 1DLHA 2JCCB 3SGJA 3ZKXC 3MACL 1FL6A 4XP9L 3H0TA 5C0DA 5J0BA 4TVPL 1DFBL 4PYHA 1EHLL 2YKLH 5IGXH 4OT1H 3E1F1 1I9IH 1PY4A 4HBQA 3U83A 1I1AC 1UACL 1TPXB 2CK0L 3NOIA 8CGTA 4I13B 3RI5F 4JPIA 4XXDB 3ZLQC 4KKBC 5GRXG 2GAZA 4NQCB 4JKKA 2H26A 4AQOA 2PKDA 5KAQF 1MJJA 5KW9H 5I76A 3SE9H 2Z31A 4QNPE 1S3KH 2CLZA 2QJDA 2VLRB 3CFEB 5MEOA 4WO4D 5DUBA 3DJ9A 4IJ3C 2C5DC 2Z93A 2Y25A 5E2TH 3VXTB 3WDIA 4R4NC 2ZUWA 1TJGL 3NFNA 4NCC2 3UCRA 5D1QD 3JUZA 3NH7L 5C2BL 4HULB 3KYKH 2X1WL 4JFYB 3TPUA 1PG7L 2BSSB 3T0EA 4QTIL 2F53B 4XNXL 4Z7UB 5FOBA 4LPVA 2HVKB 1U6AL 3WEXB 2X40A 5D6DC 3BGFC 5CIPA 2AXGA 4EXPX 3OAZK 3MJ9H 5LAXB 5JXEA 4NRYB 4NZRH 1VEOA 4WHDA 3MRLB 3IDGA 4JZJA 4JPWH 5GS0H 1H8NA 3TBYB 1UEYA 3O6FC 4FS0A 3DGGA 4FFYL 1U0QA 1TCRA 3FL7A 4M93C 1RZFL 5I1GH 2RCSH 3S97C 2IC2A 2HFGL 2ICEA 1I85A 3HZKB 4LLVA 2YK1H 4Z7VB 8FABB 3GRWL 1KJ2H 3INUH 2XXCB 2XA8H 4OIIL 5FAAA 1YY8B 3E6HB 4M48H 1MHHA 5E94A 3D87B 5DZLA 4U3CA 5AYUH 4L8SC 1KB5A 3JTTA 4RISH 2BNUB 4WU7B 4ZTOL 2BDNH 4U1LA 3WFHB 2YBRA 3DV6A 4O00A 1C16A 1T20B 5T3XL 5EU4A 4AL8H 1KOAA 5F6HI 5I1DA 2SEBB 3ARFA 1EA9C 4PY8I 2FJHA 4TSAH 4QEGA 2H41A 4ODUA 1PKQE 3EKCA 5I1CH 3GMRA 1A9EB 2EKSB 5HD8D 4BFIB 3SCMA 2DQHL 4L4VB 2I9TB 5EOCH 1KLUA 3IDIB 5IVNA 5IFJA 1QSEE 5LCVH 4Y5VB 1T0NA 2WBJC 5JOEA 4Y4HC 1DVFB 1YNTA 5D7LA 4PGDA 3SKUD 1F2XK 3SDCB 4NJAH 5DA0B 2YD2A 3VDBA 1LO2H 2RFXB 4KVCH 1ZLSH 3Q5TA 2ZUQB 3BGMB 1H15A 1F3RB 1MFEH 4HPYH 4XVJL 1FYTA 2IAMB 4RNRB 3BJ91 1DUYA 3MRMB 3PL6C 4GKNB 1NDMB 4JDZB 5HPOA 4ONHA 5J6GA 2Q76A 3GMMB 2KDGA 5BZDA 4IDLA 2AK4B 4ZS7H 4UI2A 4HWBA 5ELIA 3TBWA 2H32A 3LZFL 3L7EB 3TN0C 2EDYA 2PW1B 3MLTA 1A6AA 5IMKA 1M7XA 3LKRB 2L0DA 4KGJA 5EUKA 2W65A 1CXLA 3FFCB 3O3UN 3BN9C 4RWYL 4C54A 3PQYB 5TDOB 1YUHA 4M5YL 5CLWA 1FJ1A 1CE6B 1G9MC 3O3AA 2QBWA 5D70H 3RJDA 4Q9QH 1RAMA 4OFYD 5F9OH 5IJKA 2G75A 1QRNE 1F11B 3BJLA 4OCXL 1ZTXH 3KYOB 4N5ED 3ARDD 1A7RL 3SDDA 1LWRA 4KUCD 1ROWA 3UYRH 1Q0XL 3CDYA 3IDXH 4P4KA 1PLGH 1IZJA 4FQCH 5GGQL 3B5TA 3SO5A 1KG0A 2NTFB 5FXCH 3UTTA 1G9NH 2N4IA 4XCFL 1Q1JH 1I1CA 5FM8A 3UDWA 4UTAH 1UCBH 1S7TB 1B90A 1Q38A 3LQZB 5HYJE 3SE8H 3H9ZA 1NMAL 3F65A 4POUB 5T1KA 2UWEA 3FO2B 1QSFA 3IXTA 5JTWA 3ZDYF 3WHXA 5IBUB 2ADJB 4PBXA 1DQLL 4OCSH 1K85A 3S4SA 1T21A 3LV3B 3EOAA 5JA9A 5F70A 3QQNA 3RU8H 2A2QT 1UB6B 2XWJB 4D9QE 3L5WA 3QI9C 3S8WA 3RL2A 4P2OB 2APFA 3SE4C 3C2AH 3ZTNH 3KS0J 3DTXB 4R0LC 4M61B 5DDHB 1DN0A 1P69B 1E28B 4L4TD 4WO4B 1IAOA 3B43A 2B4CL 1MCHA 1YEEH 1RUKL 4K71B 1C7SA 3VXUA 1YQ2A 5DFVC 3C87A 4Q2ZA 1A3LH 2IALB 3G08A 5D1ZA 2AERT 3TWCH 2RJMA 2KL6A 1OSPH 4WI4A 3JWOL 1UZ8B 2WWMD 3HA0A 2FO4B 4LEOA 4DZ8B 1FVCB 4UDTB 5ALBH 1JGVL 5AD0A 1GC1H 1H3WM 2P8MB 5I73B 5F7DA 2WP3O 1P7QD 1F3JB 1ZOXA 4G9DB 1RHHB 5JNYB 5FGCE 1P5UA 4CKVX 3TF7C 1LMKA 3CLEL 4I77L 1FC2D 3TH3T 1QRKA 1VADA 1CK0H 1D5MB 4Q6IC 3B3IA 2BJMH 4MMXC 3IVKB 4YC2C 4IRJA 3MJ9A 2ZG2A 3RQ3A 1M7DB 1HWHB 4LASL 4HZAA 3MUJA 2APWA 2C26A 4M3JA 3RGVD 3GJFH 1CIDA 5EUOB 3TNMB 3QIWD 4LRNL 5KG9A 3VRJA 4X80L 3D18A 2P24A 1MI5B 1DQDH 4G8EB 4JREB 4TQEL 4UTBH 2MSPA 1NCWH 3O41A 4EN3C 1U93A 5E8OA 3Q5YA 2NY1C 1KJ2A 1RZKH 2GSIB 3F7YA 3QIUB 3VGAC 1DCLA 1FIGH 1SMOA 2MQ3A 4NHUB 1NJ9A 2OLDA 1WCBA 1BMGA 3OKOB 3VXPA 2YRPA 1SEBA 5L6YH 1NBZB 2XNAA 1JP5A 4Z76B 5HHME 2FD6H 3C5JA 2R15A 1H3PH 4MA7L 1KXQE 3IETA 4MAUL 1GRWA 1DBBH 4LSQL 5DFWH 3WDHA 3PJSA 2FIKB 1CCZA 2X4NA 1G7MA 5KSAD 1KCSL 4I48B 3SKJH 3WS3A 3OKLB 1OTSC 4LDLB 4CU6A 5JW3L 1OT1A 4XI5C 5JQHC 3ROLA 5GGUA 1ORQA 1SEQL 3RIAF 3I6KA 5ICZB 3IDJB 1L0QA 2P5WE 4JPKL 5D72L 1QYGH 3QUMB 4DW2H 1IARB 3B5HA 3D9AH 4Z8FH 1QR1B 5GZND 3CH1B 1EUUA 1Q94B 1UA6H 4M7JL 4LCYA 1AKJA 5C09B 4Z5RB 5CGYC 4XBEL 4DVRL 1RJLB 1RI8A 4BZ1L 1N26A 2CUHA 4DEPC 2CRYA 4PJ7F 4TNVK 1BJ8A 2EE3A 4MDJA 1P2CA 1S7UA 3S35L 3CVIH 4NBZB 3VFPA 2FEDD 3IDUA 3MLRH 4YXHL 2DQCH 3RWEB 3OKEA 4HDIA 2R4RH 1WBXB 5H94A 3GI9H 3SJVD 3DO7B 4PJDA 2E8ZA 3MODH 5HGGS 4MQXC 3HMWL 1A3RL 3WHE1 4HC1L 2HMID 4TUOB 3QRFM 1M7IA 1BQLL 3TFKD 1NGXB 3T1WA 1FL5B 5DJ8B 4QXTA 1MQKH 3OXSB 2Q86A 3GHBH 3ARDB 2ESVE 4UIMA 1ZKAA 1W8NA 2Z8WC 1ZHLB 2NZ9C 3DX7A 5I1AB 1VFAB 1YEIH 4E42B 1LNUB 2I60H 4KVNH 4L3CB 4YNYB 2I5YL 3S34L 1AGFA 4ZODA 1BF8A 1FH5L 5F9JA 5HYIA 4JFDB 4ZUSB 3ULVC 4QTHB 43CAA 4UV7H 4M8VA 4AENB 1E6OL 2ZNWA 1XH3B 5IR1B 1QOKA 4FP8H 3R06B 5E9DE 3RNKA 4KZDH 3MGTA 3EDFA 2Q20A 4OCWH 3S5LA 3WIHL 2FGWH 1DDHB 5DVOA 3FCTB 3FFDA 4X7CC 2NR6D 3P30L 4LVNC 3CX5J 4Z0BL 1MWAH 1D9KC 4Z77A 1K8DA 3V5DA 4OD1L 1X5HA 5BS0D 4HPOH 5A2JH 5FYKH 1J8HD 5I8KH 1OHQA 5IB2B 5TJWK 4PJBB 4YHOH 4QRRB 4KHTH 4OQTA 4J6RH 3IU4H 4L4TB 4O51A 1JYNA 2JJUA 5CD3B 3WLBB 3EOTL 1BGXH 3W9EB 2DRUA 3CUPB 4AIZB 3BX7C 2W0FB 4NNYA 5D7SL 3CFCH 2V5RA 5ANMB 3VFTB 2GIYA 5T3XE 3GO1L 3RUGA 2QADD 2PW2A 4APQC 1D5IL 3AB0C 4NHCH 2IADA 3ARWA 1S9XB 1Y18A 4LIQL 3MBED 2NNAB 4KDWA 3IKCA 4Z9KB 3NAAH 4U7KA 3UPRA 1JHLL 2A77H 3OZ9L 2XZCL 5SX4H 4XCYA 2G5RA 1QLRA 4D8PA 3GMLB 3DETD 3OJDA 2AEIT 1VFOA 4KI5E 4XHJC 4JLRB 1U8LB 5GRVK 1E4KC 3UXFA 1LO4L 1SQ2N 4KI1A 3O2WH 3E8UL 3MLXL 2NXYD 2V2XB 3M1BB 1VACA 4MWFA 4NKMB 3LKNA 3TA3A 3BESR 5IJVA 1MVUA 3RGVB 2R0WL 2I9LA 1I9JL 2Z31D 1JJUA 4XTRC 3GJFA 5FGBA 4P59L 2A6JA 4IDJH 2NX5E 4X6CB 5FA3A 4UIKL 3T77B 3VFGL 2VIRB 1QACA 4NZUL 2QQKH 5H37G 1CD1B 1NAKL 5CBAB 3GJFK 1JWMA 3HZYA 4DFIA 3AVEA 4K3GA 2NY6D 5C71A 2CKNA 5HDQL 1HKLL 1EO8H 4FG6C 2Z9TA 4LP5A 5KSAB 1OTUC 2Q87A 2Z0BA 4LPWA 1ZGLB 1MUJB 2QL1A 3CDCA 2YC1B 1KCLA 1HILA 1U3ZA 3GB7A 4OCMC 4XCNA 5JXED 3LH2H 2MWCA 2AK1L 5HBBA 5TGBB 1EEYB 2D3VA 4MXVE 1CFTB 1ADQH 4IOFD 2HT2D 4OZFH 1XMWA 5C1MB 3MLPA 5IHUL 2H1PL 4U6TA 3O3DA 1TNMA 3RX5A 1MH5B 5BW7A 3DI2B 1A2YA 3V9FA 3TZVA 3QO0A 4HGWB 4NQSA 3V0VB 1C5DB 5GGVY 4XPTH 3ARTA 2E5EA 4JFFE 4HH9B 4F8TA 1WWBX 1FNEA 1VESA 2HT4C 2XZAH 2ZOLB 2FB4H 4YDIH 4ZOBA 4NNXB 4WW2B 5IQ7H 4PJAB 2PYEE 2JB5L 2BSRA 5F7KC 5IROA 3TVMA 3MNWB 4QYOA 1U8HA 5ECJE 3ARFD 3WL9B 1ZXQA 4KJQC 5BQ7A 3SJVB 3IDYC 5DMIH 2J8HA 1EFXA 3U6RA 4PUBL 3MRNA 3ZSTA 4XP6L 4O5LL 4UILL 3V6OC 4F7TB 2YD5A 4GKZB 1I75A 5FO8A 2GJJA 3B8SA 1MCRA 3Q1SH 3SCMD 1T3FA 3VWKC 2EE9A 4PRPB 2GY5A 1R5WB 4PS4L 3G6AB 3KJ6H 4H5SA 2A9NH 5FUOH 4K94L 5J12B 2X6MA 4JCMA 2HWZL 4WI9A 1T89A 1YJDH 4JN1H 5D7LD 4KJWC 2N7BA 2DMCA 1YQVL 1INEL 4U6VL 5LGHH 4Y0GA 3TYFA 4OZIA 4X4MA 4L8BA 1NFDA 5C92A 1UJ3C 1BECA 1WFUA 2V6HA 5E6ZA 3KXFB 1FYTD 1Z9OA 3D3VD 4O58H 3OQ3B 4ODSH 4YDLC 1OW0C 5KVGH 2R1WA 4WNQB 2CMRH 4FQ1H 1AC0A 2J8UB 4OJFH 3A6BL 4FFVD 2EEDA 3T4AB 1MNUH 1P4IL 3EFFA 2D7TL 2X4SB 4XVTL 4WTXA 3O4OB 3DARA 2X7LB 4ELME 4EKXA 1P4BH 1OTTD 3GSOA 1T04A 3DYPA 4JFZH 1DBAL 3HAEH 3I75A 2PN5A 3PE9A 5A43C 4MNGA 3VE0A 1GGIL 3WO4B 5HVHB 2JB6B 4S1SH 5DR5L 1F6AB 4NUJA 5J06A 3EO0B 1MWAA 4MAYC 1F42A 5BV7H 4NO5A 5GGTA 2FIRT 1V5JA 3GKWH 5I75C 2W9LA 5IMMB 4G7YL 5DVKA 4JZOB 4CMMA 4I2XA 3S3SA 1MJ7H 2NY0D 4PG9A 3SDDD 1U8MA 3MV9B 3BD4A 4P4KD 2BY0A 2QADB 2J5LB 2OL3B 1LDPH 3BUTA 3E6FA 2H8PB 3UTTD 2D0HA 1DLHB 1FGVL 4R8WH 3VXNA 4JJ5A 4PB0L 5I0ZA 3N1PC 5AUMA 4YHZH 1FL6B 3RTQA 4W4NA 5C0DB 1MCPH 1U9KA 4R90H 2IMNA 4JVUA 2EZ0D 5T33L 3NMEA 5T1KD 4LSPL 1J0IA 1QSFD 2YD3A 1OWRM 4P2CG 1T03H 3K3QA 3V4PL 4DQOL 4HIIB 2WNGA 3BI9X 4GG6A 4JPIB 1JZ5A 3GI8H 3V0WL 2XQBL 2IPKA 2HT3C 1YEFH 4XB8A 2H26B 1EVTC 3FN0H 4PJXA 3RRQA 1OCWH 1K4DA 3CDGA 1LO5B 5I1EL 4BQ9A 3C6SB 3MJ7A 4M43L 4ISVB 1PX4A 1T80A 1I3GH 2WW8A 5DUBB 4LCWE 3NIFE 1NCBH 4UOJA 4PRHA 3MNZB 1XAUA 1CFSB 2Z93B 4M8QA 4X6DA 3D85A 4F7MA 3VXUD 3NFNB 4JO1H 5C0RH 2YSSA 1A9BA 5D1ZD 3TPUB 1I1FA 4Y19A 2APVA 5L7XL 3T0EB 4F7EA 3B9EA 5IWLA 1I7ZA 1M6OB 1WV7T 1FAIL 3VXSA 5F7UA 3NACL 4MXVF 4N90E 3EJZC 4XNYH 3HN3A 5MP6L 3AU1A 2VR5A 3RDTC 1PG7W 3TC9A 4JGJA 2H3NA 4AT6B 1FVDA 3RVWC 1A6WH 3HMXL 5TFSH 4JZJB 2OJEA 1A1NB 2A6DA 1AQDA 3ES6B 1TQBC 4IRJD 2R2BA 4R2GD 2R23A 3NCEB 2BOBA 5T5NF 3LSOA 4YHIA 5GS0D 2NZIA 2ICEB 1UM6H 3MRQB 2J1KA 1GGBH 1X7QA 4LLVB 4XVSH 4OZFA 5FFLA 4WFEE 1HZHH 1AJ7L 2DF3A 1KFAL 3UTPD 4FTVE 1ZA6A 3D2UA 1MHHB 5CUSH 4XCCL 2FRGP 2AJSH 3WNPA 1HINL 1KB5B 3JTTB 2WUCL 1B0RA 4U1LB 4NWUL 3T0BA 1V3JA 4YHMH 5DJZA 4PV8A 1G0XA 2YBRB 3DV6B 1R24A 1MFNA 5EU4B 3G04A 4FQIH 3RA7H 5I1DB 2Y4SA 3ARFB 3RWDA 5EZOL 4I3SL 1CU4H 3C8DA 2ZUVA 1DTUA 3DMMA 1HEZA 4Y4KC 5E2VH 3GMRB 3RBGA 3WHE0 2B1AH 4JRXE 1UWGL 1CGXA 5TH2A 4KQ3L 1KLUB 4QY8A 2Y5TB 3G6DL 1T0NB 1F4YH 3W9DB 1BX2B 3QUML 4KKLC 5E8DH 2EE2A 1EFQA 3ARZA 3KDMA 4JM2A 4MJ5B 4PLKC 5A40E 4ZO7A 4LMQE 3I6LE 2VLJD 1U3YA 4CGTA 4GBXD 1IC1A 4OZHA 1AKJD 1KTRL 4ELMF 3VFSA 1FYTB 4I18C 1G0DA 4D9RD 1WLHA 4ZUTA 3CXDH 3SN6N 4G6AD 4MA1B 4JY4A 4K3EL 4AYFA 2DWEB 4OZGF 4ONHB 2AEQL 2F58L 3I9GL 2O5YH 1NGWA 2NY5L 5ISZB 3HC3L 4XNMA 5EOCJ 4CMHC 5JW4Q 2H32B 2WUBL 1X5GA 3MLTB 3QHTC 2XY2A 4BH7A 1A6AB 5IMKB 1YNKL 2AV7A 4I1NB 4ERSH 4JY6B 2ADIB 3FQRB 2APBA 2H9GA 2R2EA 4F58L 1T2XA 5TF0A 1OM3L 5GS1A 3ZT6A 3HAEA 4R96B 2YUVA 1T4KB 1U8OB 2VLRE 1U41A 2I25N 4U1SA 1JGDA 4HQQL 3O3AB 4I3RH 5DURD 3T8XA 3H9SE 1H3VA 4XZUA 2VABA 4MXWL 4NZDA 2E6PA 1TVDA 3QWRA 1R3IH 3TO4B 1PEZA 3V6FB 4S2SB 3SDDB 4U1JA 3Q6GH 4LFHD 5CJBA 2WLYA 5KVFH 4JCLA 4P4KB 5IP4A 1UFUA 1X5ZA 2F53E 5IW6A 1QNZL 1WT5A 3UTTB 2ED9A 1Q72L 2WANA 4PGJA 3DSFH 2P47B 4Z7WF 2VRAA 1EDQA 4FFWC 3KR3H 5B22A 4J1UA 1FZKA 1MOEA 3ARSA 3BH8A 4NRZA 1F8TH 3HS0B 1CFVH 5I71B 1JK8B 1FYHB 5T1KB 4OLVL 5IK3A 1OPGH 2EEAA 3IXTB 1T2QL 4JZNA 3VXMA 3KGRA 4CU7A 3HE6C 1RIHL 2VOTA 4K8RC 3TNNA 3ESVF 4NWTH 4LVEA 4FFZL 4U1KA 4HIEA 1R3LA 1L0YA 1HH9B 3NIFF 5TDPB 1KN4H 1UADC 1DUZA 4K9EH 1JZ7A 5JW4M 4ZYKA 2VC2H 2O61B 3O6MH 2AJXH 4FOMA 5D6CB 3SDAC 1BQHA 3TP4A 3D39B 1A14L 1R3JB 1X5IA 4GXUN 4YXKH 1J9CT 3FMGH 4PJEE 5I8EA 1IAOB 3NN8B 5GISH 4WWKA 5DS8B 3DPBA 4GUPB 3AS0A 3O9WA 3PP3H 4M7ZC 3KJ4C 4L5FL 2AJVH 2ILLA 3KHQA 4ODTL 4GAJH 3TBVB 3UJIL 5DUML 2GFBA 3W82A 2VTFA 1W0YT 5ESVA 5AD0B 1NCDL 2B0SL 5TQ2L 1MFCL 3HNSH 4XVUD 3ZL4L 4L4VE 5DQ9B 3ZE0F 4JHZA 3ZKNC 5T3ZH 1QPXA 1R5IA 4QRPA 4YWGL 2ATPB 1VADB 2P7TA 3OR6B 4OM0L 4BFGA 3IJYA 1OAYL 5KJRH 3KPRE 3KLDA 4IRJB 2CXKA 3BUYA 1RQ5A 3TA3D 1RURL 1YEGL 1T1WA 5EU5A 5IVXF 3QFJA 5KG9B 3VRJB 2BHUA 5D1XA 3JWNC 3D18B 3OMZA 3DI3B 1V3KA 2V2TA 2P24B 2DQUL 1JNLH 4H20L 3VG9B 1OAXH 4KRPC 5E6IB 3O41B 2O5ZH 4DGYL 3CVHH 4Y4FC 1KJ2B 5IV2A 4P5KA 3F7YB 1B2WL 3U9UA 1N5YL 1NJ9B 2AK4E 4IM8A 1JGEA 1WCBB 3VXPB 3OKKB 4P5MA 2XNAB 1H0DB 4J3XA 1GL4B 4ZG1A 2P8PA 1KLGA 3J7HA 3C5JB 3IETB 3RVTD 3O8XA 4F7PA 4MLIA 3PJSB 1G7MB 3JSSA 2UYLA 3PQYE 3P0VL 4XRCB 2OXGA 3S36H 3HZVB 4TUKH 2JCCF 3QBTB 1BFVH 4PRNA 3A6CL 1ORQB 2WIIA 1H5BC 4WHYH 3BHBB 1LE5A 4NDMA 1CGUA 5EO1A 4KMTH 1AQKL 1C12A 1CICC 1UWEL 4LCCA 1XFPA 4WV1B 1QLEL 3OX8A 3ZKSD 1GAFH 2E7MA 5JW5A 3GSNH 4YHYB 1T6WA 3HFML 2XZZA 1IGCH 3TZVD 3QUXD 1IAII 4ZUWA 5HVGB 5FF6A 3MLSH 1HHKA 4MDJB 5E03A 5I66B 3PWLA 3F8UB 4FQHA 4G6MH 5MHSD 4JO4L 4ZFZA 4KK9D 3TVMD 1SJHA 4LLYA 2HFEA 5HHOA 4ZAKC 5GGRA 5H94B 1JL8A 3MREA 2IQAB 2NY2D 4I9WE 1EFXD 4PJDB 4ZUUA 3K7UA 3GSXB 4GRLA 4Q0XH 3CPLB 1NC2A 3TEUA 3T0VA 3WD5L 4Z7UF 2HRPH 3VRIA 5F7NC 3PDGA 1I1RA 2C3VA 3GMPB 4QXTB 1IJ9A 1JNHA 5DD5H 2Q86B 3X11B 1GSMA 3BPCA 3N85H 1B6UA 2LU7A 2OMNA 4QWWC 5E2WH 4UIMB 5I9QC 3BZFB 4EJ1C 1KXTB 3DX7B 1XF1A 4JFHD 1T0PB 1QBAA 1H3TA 4NN7C 1AGFB 5DJCA 2B2XH 5F9JB 1T7WA 1GGTA 3LD8C 4DWHA 5ADOH 1UGNA 4GW4B 43CAB 5CEZL 1QBBA 1MLCA 4EI6A 4Z7VF 4H1LH 1OGTA 2Y23A 4KGLA 4RMUA 5CSZA 3MGTB 3BPLB 3RKDD 3G5VA 1RMFH 1FHGA 4BK4A 3QNZA 1OARL 4FMKA 3FFDB 2Y7QB 4QXGL 5EUOE 5DJ2A 4HKBB 3Q48A 4LAQH 1K8DB 3V5DB 4Z77B 2FHFA 3HPLA 2DYPB 3QQ4B 4XPHH 5EG6C 2CUMA 2OJZH 3BKMH 4ODWA 5E0QA 1DLFH 3O0RH 5DZOA 4PGBA 4M1DH 5JPNA 1CBVH 4OD3L 2VN7A 1MAMH 4OKVA 2VXUL 4OBRA 5FYKD 1UJTA 3SKNA 4O02L 4R26L 3DWTA 4NNYB 5KOMC 5SWQA 1QBML 1JPST 1JN6A 4FABL 2CK2A 2OZ4H 1C08A 2OL3L 3RUGB 5DMGC 3HLAA 2PW2B 4N0CD 4DTGL 3ARGD 2YD8A 4NJ9H 2IADB 5BZWA 1Y18B 3VFMA 1A7OH 3LCYA 4GW5B 3IKCB 5EZJB 5C0CA 3UPRB 3RTQD 2FX8H 4XCYB 5KVEL 1QLRB 4YXLH 4DN3L 1B4RA 5D2NB 1P7HL 4H8WC 2D7NA 4PRDA 2XZQH 3PWJA 5E95B 3PP3K 3WFDL 1UH2A 4BSVA 4CU8A 4NN5B 3NCYS 3V95A 3DUHA 1OB1A 2DIAA 2F8XC 4M7KL 1IAIL 3QQ3B 1VACB 5DQDH 3LKNB 3TA3B 2DD8L 2FH6A 4F9PC 1MVUB 1FRGL 3MRCA 3L5XL 5ESQA 2I9LB 3V8OA 3OR7B 1MAJA 1RZJL 2DQJH 5MI0C 5IIEA 3GJFB 3KPMB 1T5WA 3W5NA 1RFDL 3FRPA 5DRWA 4WTZA 1NMBH 1PY9A 1SBSH 2A6JB 4JQIL 4NM8L 2LE9A 2NY7L 4MHHG 4GAYA 4BK5A 3D85D 2CO7B 2J6EH 3GSUA 5C0AA 3T2NH 5BVJB 3CVHA 1JWMB 2Y06L 3WXVH 4FQLH 4Y19D 2VDML 2IANB 3QPXH 1TJHL 3KYAA 4QXWA 1KN2L 1J0ZA 3CFJA 3O6LL 3OJMB 4QRUB 3VXSD 2KZWA 3MACH 4XP9H 3NIGE 4TVPH 4EOWL 1IAIM 2C1OA 1T1YB 4XCNB 5EO0B 1S9KC 3ARQA 5DLML 3J8F7 4JGUA 4OB5L 1UACH 3JVGA 2CK0H 5A16A 1MVFA 3GKZA 1XCQA 2Q7YB 3D48R 2EDRA 3RIAK 4KAQL 3O3DB 5KTEH 1A2YB 4QXUL 3WLWD 2DQDL 2CR6A 2APTA 1I1YA 4LCUA 4NQSB 1DQTA 5ILTL 3EFDL 2PXYB 1SYSA 3L9RA 4O9HL 4MNQA 2C7UA 5M94B 3GSNA 1NCTA 5IBLD 3D2UD 4UINH 3CMOH 3P0YL 4M6OL 5E8NA 4MD5A 1KB5L 4PJ7A 5F9AC 1FNEB 3VWJA 4KPHL 3RVUD 4M1CC 1ORSA 1TJGH 4Y5YC 5L8LB 1H3XA 3WO3B 4KK8C 1PG7H 5B39G 2FZ3A 2ZSVA 4QTIH 4HT1L 3L3KA 4WU5B 4EBQL 1T2JA 4OGAC 4PP1D 1QUNA 1ERNA 3L3JA 3MOBL 1U6AH 3KVQA 3M45A 3U6RB 3DMMD 4XAKD 2X4PA 4PJBE 3EGSB 3IYLW 5DHVH 4WJ5B 1T3FB 4L4TE 2BERA 4TYUA 4Q7DA 4JO3L 3BPOC 5GSVA 2LU4A 3BD3A 2EE6A 4HV8A 1RZGB 1PX3A 3B9KA 5FV2A 4FQXA 4JM2D 4YPJA 4FFYH 2VLKA 4NC1E 4P2YA 3TT1H 2HN7A 4OZIB 2HFGH 1ED3A 4IRSA 5DD3L 2XTJD 5C0JA 2ICWI 3UBXA 4BZ2L 3GRWH 4OIIH 4MCZA 2B1HH 3QUZC 5EUOF 2DDQL 1FFPB 1BIIA 4Y5XB 3EFFB 4LF3B 3QIBC 1BOGA 1ODAA 4POZC 2GTZB 4ZTOH 4HWBL 1MFDL 2MQ0A 3GSOB 4H1LA 2G9HA 3EIFA 2CLRB 3QPQD 5F72S 4OCNC 3U0TA 4K23L 1RJZB 1A3QA 5T1LA 4NUJB 1TZHA 5HYFA 3RY4A 3VFNA 1KCUH 4JDTL 4NO5B 2YZ1A 2YXFA 2VXVL 1N4XH 1J1PL 2LABA 2P5EA 2YD1A 4D0BA 5FKPB 3QWRD 5I6XC 1BBDL 4F80A 3FN9A 4I2XB 1U8NB 4U7SA 4X6BA 5FYJU 3QEQA 4UAOB 3R0MA 4RQQA 3P9MB 3E6FB 1XF3B 4HJGA 1PDKA 2W07A 3VXNB 4JJ5B 3BP7B 4HBCL 2OZ4A 2D7OA 5AUMB 3RTQB 3F7PC 4XVJH 5LJYH 4X6FB 1DJSA 3QXDA 5HDBE 1XIWC 4S1DD 3MUHL 4J8RA 1A8JH 1FP5A 2V5YA 3VXMD 4TNWF 4Q6IA 2PTVA 1RUAL 4EXKA 2YKLL 4GG6B 4OCRL 5E2JA 3ARBD 4LLWA 3ULUL 4TSCL 3LZFH 1FVEA 1JI2A 2IPKB 5GSRA 4YGVA 4XWOD 3B6SB 3ZT7A 1I9RH 1K4DB 4UT9L 4RWYH 2V2WB 4P46A 1LO0L 2R0KL 4M5YH 1T1XA 2Q1EA 3RIFF 3WN5B 4TTDC 4UQ3B 4PRHB 4X6DB 3VW3L 2CDFA 2VQUA 3JV4A 4WWKD 1A7RH 3NIGF 2Z8RA 4GG8A 2YSSB 1RVFL 1A9BB 4PJAE 1I1FB 3O9WD 4TULH 5GGQH 3VI4E 4F7EB 1KGCD 2J6EA 4ZOAA 4NCC1 4XCFH 3SJVE 4LQFL 4YHKL 4L9LA 5E1HB 4P23C 5ACZA 3AU1B 1FBIL 4BKLA 1RZIB 2XKSA 3B9VA 3KPQB 1ND0A 1LILA 3BZ4A 3NCJH 3GMOA 1O7SA 4P5TB 4G6FB 4QRPD 5C0GA 5CILH 2OJEB 2ZWLT 1TZIB 4RA0C 2DQFA 3MCG1 1DQLH 2ZCKH 1AXTH 3QDHA 1S7QB 3QULB 4NZRL 2AW2A 2BOBB 3QUYC 5HHXL 2OI9C 4JPWL 4JKLA 5GS0L 3LSOB 4YHIB 4NKIL 3QFJD 1X7QB 5D1XD 4TUJA 2RCSL 5HI4C 3DLQR 5DFTA 3D0LA 4H0GA 3CH8A 1CLOH 3STLB 4HIXL 5CZXC 2J8UE 1KJ2L 5LGJA 3FAWA 3INUL 2B4CH 3SBWA 4ZFOA 4LL9A 1AGEA 4M48L 4PJBF 2NTSP 4OCYH 1B0RB 1C1EL 4PV8B 3PWNA 4QHKI 1J0KA 2BDNL 5F1OB 3RWDB 4Y8DC 2ESVA 4I0PA 5BRZA 5BS0E 3O8XD 4B7IA 1J8HE 3GM8A 1Y6NR 5MEPB 1BAFL 2AJZA 3VXQA 4KI5C 1JGVH 4WVRA 1I3VA 1DL7L 3UZQA 3WJLA 1SJEB 4LEXH 1XR8A 1RHFA 4I77H 5DHVA 4LGRB 3UO1H 1ETZA 2BK8A 4QT5A 1U8KB 1OQOA 1H3GA 3AUVA 3MLWH 1G84A 3M17A 4YAQA 1CXIA 4PRIB 3PV6A 4DGIL 2NY4D 1PGRB 4XBPA 4LASH 1FV1A 2DLFL 4LRNH 4PR5A 2XTJB 3VFSB 4X80H 4PJGB 1FZOA 4JY4B 1ZLSL 4TQEH 2UZYB 1GIGL 1LK3H 4U1HA 2D0GA 4U4BA 2CRIA 3L95A 3GRWA 1K3IA 3PUCA 3W0WA 5J56B 5HPMB 4Z95L 4X0KA 12E8L 3FZUD 1NFKA 4X6CF 3KPOB 1EJ6A 4C83A 1N2RB 4MAUH 2AV7B 4MS8C 5HHOD 4LSQH 3H7BB 4N8CH 4E9LA 1X5LA 3PHQA 3HAEB 4GRLD 1KCSH 1NC2D 3ZT5A 2DTSA 1OGAA 1MCFA 3LQAL 4U1SB 3BW9A 5FHAL 3VJ6A 3T8XB 2EH8L 4AQ1B 1WUNT 3GDBA 1SEQH 4EZMA 1E0OB 2IBBA 5L8KB 5MERB 3EYUL 1WAAF 2GEEA 4LSTL 5BV7B 4JPKH 5D72H 5HDBF 5H35A 1SBBA 4QRSB 1ZT4A 3T0EE 4XXCA 5IW6B 2EDOA 4JFQA 5HHNA 1Y6MR 3SE3C 3UPAA 4M7JH 1PLGL 1A1OA 3ILQD 3PF2A 4HGKC 1IT9H 3MRBA 4YIQA 3SKMA 3L5JA 4J1UB 1FZKB 3BH8B 1UQSA 3C6LA 4NRZB 5J11B 4X7DC 2HYMA 5IK3B 4JZNB 3PXJA 3S7GA 2R0LL 3TNNB 4OUUA 1YPZB 2EXYC 3X3FL 4P48A 3GSRA 3WUWA 3OB0H 4HIEB 4KQ4L 1XF4A 5HI3D 2DQEL 1R3LB 4YXHH 4L1HA 3BKCH 1EJOL 2A6KA 4WW2F 4OCSL 3NVQA 4OLZL 5IMLB 4PJAF 1X4ZA 2R69L 1CXFA 1JYWA 5F96H 3VI4F 4OQTL 2W1NA 3HMWH 5CHNA 1A3RH 4HC1H 4N0UB 1X4XA 1BQLH 3GMNA 3VXOB 3RHWF 4G8GA 2XWTA 1G7HA 1CZ8L 4WWKB 4HFUL 3X12A 1WWAX 3JWOC 2XWBB 4KY1L 2ITCB 3ISWA 4OUOA 3EJYC 1II4E 3AREC 3LHPL 1UVQA 1X5KA 3LN5A 5EU6A 3QWOA 2I5YH 3S34H 2HTKC 4Y88A 3TWCL 5C0CD 5GIRA 4K2UL 2GFBB 1MHCB 1DE4A 2BVYA 4JVWA 3ELAT 2ADGA 1TZGL 35C8L 5EC2A 5I17A 4ELKA 2VDKL 1E6OH 25C8L 5ICXA 1GC1L 5EORL 5I8OL 2BCKB 1MCDA 4JHAL 3U1SL 5T3ZD 4U6HA 4KKCD 5D7LE 5EIVA 3WIHH 3VGHA 1XGYL 2J8UF 5SWSA 3ALWA 2BJML 1QHPA 1SYVA 1T1WB 3P30H 3QFJB 4Z0BH 1FYTE 5D1XB 2V2TB 3GGWA 5CJXC 5CD5D 1NCNA 1RPQA 5DF0A 5I74C 3QO1A 4XWGL 1NBVL 3OAYH 1QFHA 1IE5A 4P5KB 3EOTH 3O2VL 1NCWL 3BMWA 4V2CB 5D7SH 5C0AD 1RZKL 4F9LA 4P5MB 1G9EA 4XPGL 1FIGL 1D5ZA 3EYQD 2P8PB 1KLGB 1YNLL 4NPYA 5F88A 1QLFB 1D5IH 3PGDA 1HI6A 4XNZB 5HGBB 1QFWH 2JJWA 3BT2L 3O8XB 4LIQH 5L6YL 4ODVL 4F7PB 3UC0L 1TQCB 1JPGB 4N5UA 2LV4A 3PV7A 2UYLB 2VYRE 1JHLH 2O26U 3OZ9H 2XZCH 3WXWL 2CD0A 1BM3L 5IVZB 3T4YA 4WHTA 3OJVC 4I3GA 4PRNB 3SKJL 5JR1L 2QSQA 5DJXA 2EO1A 4PJ8C 4UU9A 4P4RA 1LO4H 1BVLA 1Q9OB 5D96B 1XCTA 4F7CA 1CGSL 5IQ9A 5D7JA 5C0BA 4K7PX 2AJYL 4NDMB 2VWEC 5SX4I 5EO1B 3MXWL 1AO7B 3MLXH 3FB7B 2EIEA 3WKNA 3UTTE 4KV5E 4RAHA 3OX8B 5KN5A 3JTSA 3KPNA 5JW5B 1ZWIB 3DVGB 2M1KA 1I9JH 3KPSA 1UA6L 4ALAL 3FQWA 1HOCA 5EPMA 2BP3A 4JO2L 4MNQD 2UWEE 4F15C 4OZGA 1AD0A 5FB8A 1QSFE 4P59H 4CW1A 4ZO6A 1HHKB 5KSUA 1KC5L 4PJHB 5B8CB 4X4YA 4LRIA 3VWJD 2GTWB 4UIKH 4E0RA 1PAMA 3PWLB 4NZUH 4FQHB 5T1MA 1NAKH 3C2SA 3P9LA 4ZQKB 2ED7A 2RAMA 4ZFZB 1TETH 2EXWD 1HHHB 2HFEB 3RVXC 2QSCL 5GGRB 5HDQH 1HKLH 1HHGA 5F8QC 3RGHA 2BVUA 3WJJC 3GSQA 1NL0L 2J12B 4MAYA 1EHXA 2WIMA 5EBGA 1A6TB 1OAZL 3GI9L 4PGCA 2IWGA 4ZFGL 3LDBB 2C3VB 3K8LA 2FH8A 1JNHB 3VXUE 2Q3ZA 1PYWA 3BPCB 4NZTL 1BEYL 4AZ8A 4EEEA 3T65A 5B38A 4NQEB 5I1LB 4YR6B 5J13C 1AFVL 1MQKL 3B9KD 3UTZA 4FHBD 4PJ9A 4C55A 3IJHA 1K6QL 3EYSH 4FQXD 3G5XA 1VEPA 2F74A 1MLBA 1RK0B 2VLKD 3QRGL 1CD0A 5IHUH 2D4DA 2H1PH 3VFWA 5HYSA 3ZKXB 1N5AB 4Z7WA 4IRSD 5L2KB 2CDEA 3C5ZC 4UOW0 4UBDD 1NDGB 4WW1A 5DJ6B 2MHAB 3ZMRA 1UC6A 1H8OA 4NKQB 4EUPH 1TJIL 1OGTB 4UV7L 2BSTB 2G60L 1I1AB 5LXGL 3P77A 1IC7L 3G5VB 4GRMA 1Q8MA 5EN2A 1HHJA 1J10A 4KZDL 2JB5H 4OCWL 2VZTA 5DJ2B 3HPLB 1IGTA 5E24E 4KUZL 4YO0A 1FORL 1KTKE 5T1LD 4JFXB 4PUBH 4XP6H 4O5LH 4UILH 4Y2DA 3U0WL 3UTPE 2PCPA 4NO0B 5T5FL 4PGBB 5GGTL 5FYKL 4MHHI 1WZMA 3L6FA 4PS4H 3SKNB 4QHUA 3OB0K 2P5ED 4YHOL 1P84J 3IU4L 4HC1A 5SWQB 5SV4A 3HE7A 4N9GA 2HWZH 2YPLA 4QCIA 1JN6B 4PLJC 5ERWB 3QEQD 1C08B 3HI1A 1K8IA 1INEH 4U6VH 2D03H 5BZWB 3VFMB 3LPGA 5F9WC 3T2PA 2R39A 1P53A 5IB5A 3CSYB 3RDTA 4GQPH 4K7FB 2AKRA 4HHAA 3C8KB 1X4YA 3NAAL 4ODBD 5F1IA 2A77L 2VZVA 2IF7A 3C9NA 1FNAA 4MXQD 4PRDB 4GRWB 4O4YL 3PWJB 1IKNA 3A6BH 4DK3A 1TIUA 1P4IH 3GBLA 3ILPB 5CZKA 2D7TH 4BSVB 2X4QA 4XVTH 3VH8G 1OB1B 3O6FB 4MX7A 3K8MA 2HTLC 3CMGA 4P49A 1DBAH 3L3DA 5IVXA 4AIXA 5C9KA 3LKOB 5ESQB 3MLUH 4D9RE 3BQUA 4ZPTA 4AEHL 5DR5H 1YEHL 4IBLT 5IIEB 4P46D 1T5WB 5GRYA 5FO9B 5DRWB 4KDVA 5DJDB 3WNLA 2IG2L 3MV8A 3CK0L 4G7YH 5B4MD 3SPVB 5DVLA 5ITFA 3GSUB 5C0AB 4IDJL 5AG9A 3FOMB 2E7LC 3BMVA 4YLQT 4HFWB 1WTLA 4GAGL 3FRUA 4Y16A 2EDEA 4P2QA 3L5HA 4PY7A 3TJHD 4PB0H 4PJDE 4XHQA 2XG5A 4WTWA 3OAYK 5L0QC 1OOAA 3VGFA 4TTGA 2JCCA 5AZ2H 3K0WA 1PFCA 4KV5F 4NYLA 4ESKA 5T33H 4KROC 4LSPH 1LEGA 2C1OB 2WBJB 4Y4HB 4U1MB 1DZBA 3JV6B 4TVPD 3V4PH 4R4FL 3PWPB 5FIEA 4DQOH 5A16B 1JYVA 5EIIB 1KTLB 1U8IB 5HI5D 2YD9A 3V0WH 2XQBH 3U4BL 1UM4L 1I1YB 3KLHD 5CMAA 3ULUF 1SYSB 1AIFB 5I1EH 4NQCA 1EHNA 3BEVA 2N7AA 3DVFA 4X9IA 3VMPA 1ORSB 5EWIH 3S37H 5EU3A 3TN0B 5L7XH 3VXTA 2FZ3B 2ZSVB 4HLZH 3L3KB 4TOYL 5HDLA 2ESVD 4I0PD 5BRZD 3GSWB 4JFYA 3T3ME 1N8ZA 2HLAA 4PG2A 2BSSA 1XF2B 2X4PB 1FAIH 1LGVA 4Z7UA 5MP6H 4K94C 5DMIL 1DVFC 3WEXA 1J88A 2YEZB 3U4EA 1M71B 3DRTB 5D93C 5LVEA 5GSVB 1EUTA 3HMXH 3SDCC 2GHWB 1B6DA 2G5BA 5LKNA 1M4KA 3RUGE 1SY6L 2ZUQC 1OQXA 4M9PA 5JZ7D 5IVOA 4XPFH 1FE8L 5FDWA 3MRLA 2HN7B 2WM0A 2IJ0C 3NA4A 4LHUA 4PJ5A 5JXAH 1ED3B 1CXKA 2B39A 4MJ4A 4OFPA 3I02B 5LGHL 2PF6A 1AJ7H 2VDQL 2YWZA 5CCKL 4X5WA 1BP3B 4ONOA 3KLAA 4Z7VA 8FABA 2FR4A 4ODSL 4XCCH 1XGTB 3PDOB 3K4AA 2IPUK 3KAAA 1BOGB 1OAKL 1YY8A 3E6HA 3W0WD 4FQ1L 5CSGA 2AS5M 5DXWA 1L0XA 4NWUH 4EUPA 3F7VB 4YBQC 3V79C 1MNUL 5JOPD 1U8QA 3K2MC 2BNUA 2EDLA 3U0TB 5GZOC 5EZOH 4I3SH 1P4BL 4MSWA 1T20A 3BZEA 3QI9B 3SDAA 2SEBA 5I19L 1TZHB 1HSBA 1YMMA 5F97E 1CTNA 1OGAD 3MGAA 3VFNB 1UWGH 4YK4C 4S1SL 4NSKA 5GPRA 4OFVA 3G6DH 1FN4A 2P5EB 3W11C 1A9EA 4D0BB 1D3CA 4BFIA 5KZCD 3U36A 5BV7L 2DBLL 4ZUVA 4PP2B 3QUMH 1IZKA 5D7KD 5DEFA 4X6BB 3QEQB 4N8PA 4Y5VA 1YECL 4RX4D 4HJGB 3T3PF 1ZS8A 3VXRA 4PREB 4X98B 5KVMC 1NBYA 2D9QB 1MCWW 3Q0HA 3QXDB 1AD9B 3C6LD 3AMLA 4OLYL 3DVIA 4X9BA 3ZYOA 2IAMA 4RNRA 1FDLL 3MRMA 1MCPL 4Q6IB 1N7ML 2F58H 3I9GH 4GKNA 1NDMA 2R9HD 3HC3H 2E7BA 2A83A 2WUBH 3MSPA 1YNKH 4M62L 1EVUA 4L4JA 3AY4C 4F58H 2FLRT 4WO4C 3BWUC 4C56B 2ZOKB 2PW1A 1OM3H 4J3VA 1V3LA 1DANU 4EN3B 4QOKB 2QR0B 4U0QB 4YDKL 1T1XB 2W60A 2NY1B 5D1QC 4AEEA 2OX5A 4HQQH 3FFCA 2VZOA 4G8GD 4PJDF 1B0WA 2ZUSA 4RGND 4MXWH 5TDOA 2CDFB 3JV4B 2C3HA 1I3GL 5MHSE 2X1OA 4FQJL 3PNWB 3NIDF 2NY3D 1QNZH 2ZUXA 1F4XH 3IFNL 1N6QH 2PNDA 5E4EC 4AMKH 1Q72H 5EU6D 3NTCL 1DEEA 4L9LB 2PYFB 5ACZB 1N64H 4BKLB 1P1ZB 2H2SD 1MF2L 3VMNA 3GMOB 4OLVH 1H5BA 3D0VB 1T2QH 5CS7A 5JO5A 1CL7I 4XNUH 4X4XB 1RIHH 2Y5EA 2ID5A 4NT6A 4FFZH 1HIML 2D7QA 3FO2A 4LSDA 5TE7L 1T83A 5SWSD 5KVDL 2X1QA 2ZG1A 4JFHE 5K9JH 4YQXL 1F2QA 3TYGH 4ENED 2YUXA 3IF1B 4OZIE 4X4ME 1FCGA 2P45B 1SJVA 5AZEL 3DX8B 1A14H 1UM6L 3VH8B 3D0LB 4MA3B 4U31A 1U42A 1UB6A 1CS6A 4DEPB 1U36A 2XRAH 4P2OA 4ZFOB 2HT4D 1AGEB 3EZJB 2ARJB 1CXEA 4M61A 5DDHA 4JQVC 2AJSL 3PWNB 1RJCA 5D8JL 4L3EB 4MNGE 3SO3C 3I84A 3QG7L 4YHML 3CC5B 5HD8C 3WMSA 2YD7A 1YZZA 2P43B 4I0PB 4ODTH 2IALA 4FQIL 1RUML 1F3DH 4MVBD 3UJIH 5DUMH 2AJZB 3RUGF 2HP4A 3VXQB 1QFUL 1YEJH 1UZ8A 1NCDH 2B0SH 4S0TD 1MFCH 5TQ2H 3ZL4H 2FO4A 5FYKE 2D2OA 4DZ8A 4C57C 2FNBA 1XR8B 1FNGA 4YWGH 3FOLA 4I2XE 5DMKA 4QT5B 2FO1A 4ODHL 1F3JA 1AP2B 1RHHA 5JNYA 3X17A 5D7JD 4YAQB 5C0BD 1OAYH 2MKWA 3UZEA 5F93C 3HG1B 3HMXA 1FV1B 4GKSB 5E8DL 1RURH 1YEGH 3MLVL 4G42B 4LSUL 5F6HJ 3IVKA 3HR6A 1I7TA 4FXKA 4PR5B 2XKNB 5CJOL 4PY8J 1M7DA 5ID1A 3KPSD 3G6JB 1GPOH 2DQUH 1FZOB 4H20H 1P7KB 4CNIB 2VE6B 3TNMA 4OZ4B 4AG4L 4P2RA 4DGYH 4RMVA 4U1HB 1EEZA 2NY5C 5DJYB 2HH0L 1MI5A 5JUEL 1LQSR 2IBZY 4S1QL 1BZ9A 2RIKA 1N5YH 4GG6E 1Z3GL 4X0KB 3GEWB 1JMZA 3QNYB 3LRGA 1VHPA 2X70B 3QIUA 2OYPA 4NHUA 2XN9B 4FN0A 4C83B 3BSZL 1NBZA 4PJXE 4Z76A 3PHQB 3T2QA 4N5EC 3ARDC 1OGAB 2ZP0T 3VJ6B 2FIKA 1P9MA 4PRHE 4I48A 4JPVL 4DKEL 3MR9A 4JB9L 4X6DE 4J3WA 5I2IB 5DZNA 2H6PB 5H35B 2HJKB 3MRHA 4OF0A 4EVNA 4Y19E 4APQB 4PJ9D 2R8SL 3AB0B 2OXHA 1AQKH 3IDJA 1F6FB 5DGRA 1UWEH 6CGTA 5HHNB 3QUMA 2Q8AL 1A4KB 1I4FA 1QA9A 1QLEH 2DMBA 1G7PB 1T0MA 1G6RB 3VXSE 3HFMH 3CH1A 1CL7L 1KYOJ 3OGOE 4KMQA 3C6LB 2AGJL 4M6NL 1ZK9A 2G2RA 3W2DH 5C09A 1U91B 5IHZA 5HHVH 3BKJL 3GSRB 5DWUL 1JGLL 4KJPD 1KEML 2R4SL 1FGNL 4DOHB 4JO4H 4C58B 1EMTL 1RZ7H 2UY7A 3X3GH 4JDVA 1BJMA 1IRAY 2A6KB 3BO8A 3GUTA 4M02A 3MGOB 3LIZL 4Y2DD 1WBXA 2VC2L 5E08H 3WD5H 3MRDA 4NFBA 2ADFL 1G7HB 1CN4A 4N90D 4YXKL 3FMGL 4NC1C 1NGXA 3ZSSA 1FL5A 5EFIA 3HE7D 2WWMC 2YPLD 3OXSA 4OGYL 1BREA 2NY3B 5DSCA 1UVQB 5F44A 5IF0B 3LN5B 4FZ8L 4L8DB 4NGHL 5GIRB 4XAKE 5I1AA 2AJVL 3ETBF 3QCUL 4NM4L 1DE4B 4YNYA 4L3CA 1MIEL 1HCFX 4CVXA 2ADGB 2A9ML 5CEZH 4LLQB 5I17B 4ELKB 4OZIF 5ICXB 3V5KA 4JFPA 4J12A 2VLLB 4JFDA 4HX1A 5GGSB 4ZUSA 4OI9A 4A6YB 4BQ6A 2EDWA 4BYHA 2DTML 4XCEA 3B2VL 5DD0L 4U6HB 3RGVC 3UTQA 5IR1A 5KAQG 3QIWC 1VKXA 4GLRI 3R06A 1PZ5A 4GO6B 1OARH 3QDJA 4QXGH 2NPLX 4OZHE 1U8JA 4R97C 1GZPB 1CFQB 2XTJE 1F90L 3FCTA 3BQUD 1AY1L 3MV8D 3GHEH 3CXHJ 4YX2L 3S37X 3FT2B 4B5EA 1EIBA 4QRRA 2O5ZL 4R26H 1I9EA 4OI7A 3V7MA 4JRXD 1QBMH 3QISA 5K9OB 1DANT 4IIQC 1D5ZB 3W9EA 2VSCA 2BC4A 3QFDA 4NPYB 5KSAC 4AIZA 4DTGH 2W0FA 3PGDB 2WV3A 1HI6B 4Y16D 3U30C 4FZEL 4NOFA 4P2QD 5DD6A 5ANMA 5DEZA 1FFOB 3CJJA 4RFNC 4L9DA 4YEEA 4HUXB 1S9XA 2X44D 3VWKB 1EEQA 4N1EA 4Z7OE 2PO6A 5KVEH 1KPVA 1IGYB 2R56L 1D5XA 4DN3H 2VAAB 3WKML 3S9DB 4UU9B 5GZNC 5C3TA 1BVLB 1BFVL 1XCTB 3EDEA 3GMLA 4F7CB 2AEPL 5C0BB 3H42L 4JLRA 1U8LA 3DHJA 3SGDI 4M7KH 3KPTA 4MJIA 3MFFA 5KSVB 2DD8H 1JPFB 7FABL 1FRGH 3JTSB 1WCQA 1UJ3B 1WZLA 4KMTL 4GG6F 3M1BA 4NKMA 3U4AA 3X14B 3KPSB 3QWQB 4YDLB 3FQWB 1HOCB 5EPMB 1RZJH 2BHYA 3QUZA 1BLNB 3CX2A 4NQCD 1KPUA 1RFDH 5FB8B 5IHBA 5K9KB 3VXME 1Q9WA 5DYOA 4LLDA 3WFCL 2GJZA 4U2ZA 4CW1B 2FEDC 5I16A 3LEXB 4JQIH 2ERJB 2NY7H 4X4YB 3VCLA 1S9VB 3O2DL 1S7RA 1ZMYA 1YYML 4X6CA 2Y06H 2VDMH 1TENA 3GMQA 4LLMA 4X6DF 1NKRA 2EDBA 3EOYG 1TJHH 2UUDH 4G6ML 2HMIC 1CD1A 3TFKC 5TF1L 1D6VL 2EDFA 3O6LH 1KULA 3VA6A 3FQXA 4MAYB 1G9ML 2W9DL 1HHIA 1EO7A 4KTYA 4EOWH 3H3PH 2WMPA 4Q0XL 5TQ0H 3I2CL 3UTOA 2HRPL 1WAAA 3IRZA 2EDNA 4URTB 3JWDH 1HQRB 5DLMH 1MUJA 3IU3A 1OP3H 1LK2A 4PJ9B 1KGCE 3G5XB 2F74B 2BNQA 1MLBB 5TGBA 3VFWB 4KAQH 4JHWL 4LHUD 1JZ6A 1CFTA 4BFEA 4QXUH 4FFWD 3N9GL 2CDEB 1B88A 4RMQA 4WW1B 5ILTH 4U6YA 2N56A 2GITA 5IKCA 2VMFA 4HGWA 3V0VA 4QRPE 3P0YH 4M6OH 1C5DA 5IG7A 1WQVT 2EICA 4KPHH 2NR6C 1DR9A 1HHJB 4HH9A 4G43B 5EB9A 4U3XA 5HHQB 4HT1H 3QFJE 4EBQH 4WW2A 1IGTB 1IQDA 1KPRA 1LVEA 3V52L 1FL3A 5BXFB 4Y2DB 2EC8A 3HC0A 4LAQL 5H37H 3RY6C 1AGCB 1YMMD 3RX8A 3HR5A 5CAYB 3L6FB 3BKML 4QHUB 1DLFL 2QADC 3O0RL 4GKZA 4JO3H 4PJCB 1JNJA 4KMLB 1PSKL 3MBEC 4PRPA 2YPLB 1R5WA 3SGJC 3DROA 3HI1B 1K8IB 3RHWK 5JQ6L 2IFFL 1CI5A 5CZVL 1NEUA 3FT3A 2KZ1B 3IJSA 5KANG 3VXRD 3STBA 3DETC 4FXGA 4NJ9L 4HAGA 5IB5B 3BYTA 1A7OL 4HXBH 4BZ2H 3RDTB 4EIZC 3EO9L 5F1IB 3B9AA 2DDQH 2W0PA 1BZQK 1Z9LA 2NXYC 3ALPA 3KXFA 2IAMD 2X41A 4WUUB 3NGBB 4PJGF 3A67L 3CFBA 2X4QB 1TQBB 2FX7L 5I1JH 2EYSA 4OLXL 4NNPL 3RZWA 3T4AA 3QUYA 2Z31C 2VDOH 1W2KT 3SGEI 4K23H 5DQDL 3GZKA 5LGKA 1ZHNA 2VISA 1IBGH 1WVZA 5GRZA 4KRPD 3C08L 3CZFB 5E00A 2OP4L 3OKDB 2JB6A 3AS1A 3RBSA 1J1OL 3FFCD 2DQJL 1F6AA 2VXVH 1QFPA 3EW3B 5DHXB 3EO0A 1MJ8L 2NY6C 1KJ3L 2VO5A 4PB9L 3LPWA 2V7NB 4NN6C 5IMMA 4CVWA 4I4WB 3QYCA 1JV5A 4P2QB 4UB0L 3T2NL 2P8LB 4O2FB 3MV9A