3OGCB

Kcsa e71a variant in presence of na+
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords antibody Fab fragment heavy chain
publication title Mechanism for selectivity-inactivation coupling in KcsA potassium channels.
pubmed doi rcsb
source organism Mus musculus
total genus 49
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2010-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ogcB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ogcB01
1SBSL 43CAA 4OUUA 4Z0BL 3DGCR 4YIQA 1MJ8H 4HS8H 4PRIA 5DA4A 2VLLB 3QIWD 2X7LA 2G5BB 2NY6B 2AK1H 4LLUB 1AJ7H 4KVNL 1OAUH 1DBJH 5D2NC 1D9KA 4Z7VA 2D3VA 1DQDH 3CX2A 3DXAA 1Z9SA 4OSUH 1A02N 2NY4C 1OB1B 1VEMA 3GM8A 1YEJL 3E6FB 4AMKH 3NMEA 5ID1A 3WKNA 3RZCD 1DUYA 4NWUH 1KCLA 5E2TL 2APBA 2R2EB 3CUPA 4Y7MA 2Q7YB 2X1OA 4NBZB 1MI5E 4RBPH 3L3HA 4K7PL 1G9EA 1G7HA 4XXCA 4QRTA 5ISZB 4KKAC 2HLAB 1KELH 1AY1L 2VLRD 5F9WC 3MJ7B 3GSXA 1GPOH 4DN3L 2F5AH 4RGMC 1J87A 1JYXA 4U1SB 3H7LA 1ZANH 4P4RB 4KQ3L 3LKOA 5IVXE 4MB3A 5F6IC 1GGCH 3MFFB 4KTEH 5CJ5A 1IGIH 3DX9A 2NY4D 3AROA 4K7PY 1JHLL 5IBTL 1U8IA 4OT1H 4DK6A 4GUPA 3DBXB 5H94B 4Z9KB 1G7MB 1D5IL 1P4IL 4LVOB 2LU4A 2GI7A 4KKAD 2DLIA 4PB0L 1ZHNB 4P5MB 3X14B 4KZEL 4YBQC 1CTNA 3WYRA 3CJJA 3VWKB 4JPKH 4RAUA 1QFOA 1SJEB 5DC9B 4X0KB 1IAIH 2YZ8A 2QQLH 3KLAB 2Y1VA 3NZHL 1N8ZA 2NX5D 1TMCB 1X44A 1TJHL 3QG6B 2HKFL 1U0QA 3ZE2F 2MKWA 2Y9RT 5DS8B 1E4WH 3ROOA 4YHOH 4Q74A 5ITFA 2G75B 3Q6FB 5HI5C 2HN7A 5ID0B 2CKBA 5F1NA 3P73A 5I1LA 3FT4B 5J1AB 1GVIA 3UTTB 1NANH 1IAKB 3FRPA 1NGYB 3B9DA 3H7BA 4PGDA 2APTA 4Q9RH 4OCLC 2QSVA 4PJHE 3Q3GA 2LVEA 2IFGA 5D96C 1IKNA 4HJGA 3T3PF 3VXNA 2AI0H 4ODBD 4QHKI 4XPHL 3GMRB 4HCRA 4RISL 4NRZA 2FSEA 5F1SA 2VTFA 1UYWH 1XFPA 3PWPA 3RWHB 1KLFA 1IBGH 5EUOA 4EUPH 1NLDH 5EU5A 2F8XC 1YJDC 3Q5OA 4NQCB 1OTUC 2R4RL 3NABH 5I73C 5HI5D 1FL3B 3C8HA 4ZPTA 3GIZL 2ATKA 4L3EB 4QHMA 5C0FA 1RIHH 1QSED 3UTSD 3V4VL 4LVNC 5DJ0A 5CD3B 1S9VA 4HXAH 4YQXH 4HUUA 3F65A 2W9DL 5I19H 5GRVK 3VXOA 4JN1L 5JW4N 1YYLL 1S7SB 3W2DH 2IANE 3W9EB 3V52L 1OSPL 1KN4L 4P3CH 2R2BA 5GGQH 3SDDA 4MWFA 3C60A 3D25A 2MPAH 1WSST 3ZE2E 1CR9H 3VRIB 3G6JF 4CVZA 2J6EA 5JHDE 1R5VB 1T1WA 4PJ7E 1TCMA 3RTQA 2B1HL 3HE7C 1DL7L 1OCWL 3NA9H 3PDDA 4PJAF 4M5YH 1M6OB 1OTUD 4Y8AA 5EBLA 2YKLL 3L3GA 1FNAA 1E4KC 5DD3H 3S3SA 3EDDA 4C56B 1E27B 4TVPD 3UROR 4GRLA 4WI4A 1OY3B 3SJVB 1RPQA 1Q1JL 3O3EB 1RY7B 3JV0A 5H2BB 3T3PE 4AH2B 3W5MA 3VGGA 5KZCB 3GMLB 4KRPC 4FFYH 3TGXA 5GGUA 5ESVA 1CFQB 3MR9A 1WZMA 4HFUL 2XQYK 3IDJA 4D8PA 3OHXA 1Y6MR 5CEXA 4I18B 1RAMA 3ILQD 4JFEE 3HE7D 1HHKA 5B39B 4NQSA 4M9OA 3CCHB 1N3NB 5I66A 5CILL 3IFPB 4QHLA 2PUQT 2XNAB 2BHUA 1YY9C 4HS8L 2V2WB 1MCNA 1RZFH 1WV7T 3MGAA 1ACZA 5JDSA 4GMSL 3C6LB 3DUUB 1A6TB 4LDOB 2AK1L 2VDML 4X98A 1OAXH 2F54D 2ICCA 3BIKA 4NGHL 5F7DA 1KXQE 1EXUA 1E4XI 4OSUL 1WBZB 4AT6B 3QHTC 3K80A 4ODXA 3TO2B 3HCVB 4QCIA 4KRPD 4NWUL 4JY5H 3G6JE 1LEKB 3B9KD 4U1KA 1K85A 1INDL 4G6FD 1FZMA 2V5YA 4F7TA 3P0VH 5KSVB 4FNLH 3CFIC 5C0AD 3WFCH 4RAVB 1KG0A 1OAQH 3NACH 1PJ9A 1A6AB 2BVPB 4JFFB 1KELL 4PJBB 4KKNA 1JPTH 3VXUA 1GPOL 1YY9D 1A21A 1DP0A 2F5AL 2FLRT 4G42B 4BQBA 1FZOB 4DCQB 1QVOA 4RSVA 3NZ8A 1EFXA 2AW2A 3RWCA 3JWOC 2XY2A 1ND0A 4PJ9A 1GGCL 3HI6H 4KTEL 4U6TA 1FFNA 1IGIL 4OIBA 5H37H 3CK0L 1CICA 5F7WC 5LGHL 4OKDA 5FXCH 2R0ZH 4ZDHB 5EIIB 2NNAA 4LK4A 3O8XA 5D5MB 4E5XA 1E28B 4O51A 3LMJL 4LSQL 3P77A 3VD5A 1FO0H 5CP3A 3CFJA 1A1MB 1LK2A 2CO7B 2B4CL 4YGVA 3G04B 5DDHA 3TEUA 2JJVA 2N56A 4JPKL 2ERJB 1A47A 3BAEH 2Z92A 4L8DA 5GS0H 2OK0H 2ZCKH 1IAIL 2QR0A 5L2JA 1YECL 2AJSH 3DUSA 1RJCA 3ZSSA 3JUZA 3KNBB 2ZSVA 3KPRB 5I8OH 3M8OL 2XN9E 3E0GA 4L5FH 1HH9A 4YHOL 2P8PA 2YBRB 1NEUA 2BVOA 1J05A 2M8XA 3L7FB 3FQNA 1T03H 1JF1A 5BOZG 3HPJA 4AJ0A 5MEPB 3VFMA 3B5GA 3HN3A 5DURD 1VKXB 3FQUA 3RHWF 4QRPB 1HHGB 4HKBB 4UT9H 1E6OL 2UY7A 2ZCHL 3R06A 4FZEH 3VXMA 4Z8FL 5FV1L 3VFGL 1CE6A 4NHUA 3C09B 2AI0L 4TQEL 5MP6H 4HG4K 2QQNL 1Q9LA 3QUXA 1W72A 4R26H 4NKOA 5D7JC 5B8CC 2AJYH 4M7JH 1UXWB 4JFHE 4BKLA 5CFHA 1RZIA 1A3LH 3D39B 2IBZX 4OM1H 3BD5A 1DUZB 2AABL 4J4PC 1FO0B 1NLDL 3O41A 3U4EA 3CD4A 4EVNB 1EEUA 3T2QA 5MEOA 4BH8A 2FL5B 3OR7B 1RIHL 4X4MA 3HZYB 4LCWD 1H0DA 4FFZL 4IIQB 1ETZB 3J7HA 1OPGH 5FYJD 1U3HB 5IKCA 1AQKH 2GJZB 5I19L 2EH8H 3LV3A 1MVUA 3CDGB 1IL1B 4I4WB 1IEAA 2AXFB 1Q9OB 2LU7A 1FFOB 3SY0A 2DICA 5B3JF 5I6XC 3CZFB 2HVKA 2BHYA 1NDMB 1LEIA 3TV3H 5DJCB 1G0DA 3C5JA 3NA9L 4J4PD 2Z93A 3VRJA 1FZKA 1L9NA 2MWCA 3VFVB 4K9EH 4LPYA 5DD3L 2Q8AH 1NFIB 4M61A 4H88H 1JI1A 3T0EB 4AL8H 1T0NA 4XMPH 3MCLH 3WNPA 5I18H 2WUCH 4NQEE 2DQIH 5KSAB 1UCTA 1EGJA 3QWRA 2VMFA 3LN4B 1KJMB 4PLKC 1EHLH 5GS1A 1A6ZA 4G8EB 4EDWL 3TBTA 2V17H 4FFYL 3TVMA 2VISA 3QDJB 1F97A 1ZHLA 1NMCB 1MRCL 1VFAA 5HTSA 3QWOA 3I02B 1T2QH 3VDBA 4KVCH 3RFZC 5C71A 4MJ6A 3FRPG 4NNYA 4MA3B 3QEGL 1L6XA 3GHBH 1KN2H 3RZWA 2KPNA 3LZFL 1P6AB 2NXYB 5BVJB 3QPXH 4KKLC 2JJSC 4PRPA 1I7ZB 1ONQA 3DMMA 1PLGH 5TJWK 3ZE0F 4KJPC 3MROB 3QRFM 1VFUA 3ETBF 3T0WA 3EZ8A 1MCOH 2JB5H 5HJ3B 3LIZL 3VGAC 5DUPH 5C0BB 3C2AH 2YC1A 4PLKD 1JPFB 4JVWA 2FYYA 3KPSB 4JY5L 1MLBA 4KAQH 1Z6JT 4HIHA 1HI6B 4EN3C 4LLWB 5E5MA 5DUMH 3THML 1N26A 2OL3H 3P0VL 4FNLL 3P4NB 5IMKB 3RVVC 5D6CB 4GAYA 1OAQL 1JHTA 3NACL 3MZGB 3WL9B 4G8GA 5C0JA 15C8L 3RNKA 4KKLD 4J8RB 1JPSH 1XCQB 3LQZA 4HW6A 4R96A 4KJPD 1PX4A 3VWJC 5BO1H 1AGEA 3QO1B 1DEDA 3KJ4C 3GJFA 3BDYH 1I9RL 4D2NA 1ORSA 1IMHC 5HVGB 1S7XB 3MRQB 1FFPB 4LF3B 2C3XA 5I17A 4L8SC 4R0LC 1D5MA 5JO5A 1AO7E 5FUOH 5I1JH 2R0ZL 2E7HA 4P3WA 1A7RL 3X13A 4EN3D 2VZSA 3UTTD 5ADPL 5CBEB 2HA1A 1GL4B 2D03H 2MKLC 1JUFA 3RVVD 2EDRA 2XWTA 5INDB 1FO0L 4HK0B 5HY9A 2B8OT 1I7UB 1DR9A 5FUCE 3W39A 4U0QB 2XIDA 3QFDB 3KPQA 5TDPB 3EUUA 1BFOB 3ZTJG 3ULUH 1FLRH 2OK0L 2A6DA 2AJSL 2MNUA 1I1FB 2HFFB 3L6FB 1XAUA 1R3JA 1LNUB 1WCQA 2ESVD 2O26U 3AB0B 3WEXB 4IRJA 4GRWE 1H8NA 4OGYH 3V7AE 4LARL 4JM2C 4NQCD 1PYWB 2W9LA 3ARPA 4FMKA 4X9FA 2HKHL 4FQHA 4F2MB 4YBLC 4L3ED 3JV4A 2ID5A 2J4WL 2ZPKL 4DAGH 3HPLA 3QDMB 5BOPA 4AM0A 4K55A 4GO6B 3K3QA 5DEGA 1M71A 1B0GB 3V0AC 2HT4C 2VKWA 5AYQA 5EOQL 4WI9A 3O4LA 5MP6L 2UVEA 2X09A 2PW2A 4M7JL 4Y5VC 5IW3A 4PJCB 4OM1L 2HJLA 1F4WH 1FDLH 3KAAA 4U3HA 1MHCB 2EE9A 3O3DB 4JM2D 3RWDA 2EDBA 1JGLH 4XWOD 2ICWJ 3UCRA 1ZHBB 1P4LA 3SKNA 5C86A 3BN9D 4D0BA 3KPOA 3SJVD 1OPGL 3UC0H 4PG2A 2DQTH 4M1CC 2UZIH 2KQMA 2K1MA 2DQUL 4J23A 2EH8L 5DJ2B 2HT4D 3RGHA 3IU4H 2BZDA 2WLYA 5F96L 4BK5A 5L0QB 2I24N 3RP1A 3BUYB 1SYSA 2VZ1A 1MRDL 4HIJB 5IJKC 4TRPL 5JOPD 2UY6A 4M7LL 1VADA 5DYOA 1UZ8A 3HA0A 4HFWB 2NY0C 1SVZA 3F7YA 3B9VA 3OJDA 3C6LD 1GGIH 2Q8AL 4GT7A 3SE9L 1QSFE 5ILTL 4XMPL 3TN0C 3MCLL 2X4NB 4L9LA 1NC2A 2WUCL 2DWDA 4M1CD 1W0YT 4NM8H 3P9LB 3I3BA 4JM4H 3MXWH 1HKFA 1EHLL 4O02H 3QHFH 4JFXB 1YMHA 3QNZA 4QOKA 4P9HC 3E8UL 4UV7H 1JP5A 1WZKA 3V6ZB 3DLQR 1I7RB 1T2QL 3SDAB 3CAFA 4Y2DB 1QRNE 4JFFD 3GHBL 1MJJA 4K23L 5AG9A 1AQDA 1DQTA 5EULV 1I8LC 2R8SH 2NY0D 4R97C 3FRUA 3TCXA 4Z7WB 1IGYB 2DS4A 4X4YA 4P5KA 5D7LA 1ADQA 3QFJD 4KV5E 1KNOB 5CSZB 3TN0D 1JGEA 2VITA 4ZTPH 1T6VN 1MF2H 1MCOL 2JB5L 3WFHB 5I8EB 3T1WA 4RNRB 3UDWC 2HAZA 3CDYA 4NRYB 4A6YL 5IVZA 2VZTA 4LSSH 2VKXA 5DUPL 4E41E 4MNHB 5IHZB 4LNRB 1C5BH 4JDVA 2DJSA 4P3DB 4P57A 4TULH 3LRSB 3ZYIA 4KAQL 3ZTNH 4M8QA 3QA3B 5GRYA 4P23C 5DUML 4H8WC 4JQIL 2OL3L 3BP7A 1MPAH 3QEUB 4F7PB 3TBVB 2N1KA 3HI5H 1L0YA 3MC0A 2IJ0C 4JEGB 3SKOB 1Q9KA 1WITA 1BREA 2YK1H 3BPNC 3N85H 2ZNWA 4ODTH 4YAQB 4YFLI 3TESA 3LY6A 1PY4A 3GSVB 1LDPL 3EFFB 3UTZA 1WFUA 5DK0A 5DMKB 3BXNA 4LHUB 4ODVH 4Y2OA 3Q48A 5HVHC 4Y4FB 3WIFB 1PQZA 5L2KB 4ZS7H 3BDYL 1KLUB 1WEJH 3ZDYE 3RA7L 5K9QI 4KRLB 3QNXA 4PJDA 3KPNA 2E3VA 1OAKL 1MUJA 5FUOL 3MRMB 4NQDB 1FYTB 1SY6A 1VSCA 4P23D 4C55A 3VG9B 1IQDB 4TSBL 4JFQA 3T0AA 2D03L 2DRUA 1A6VL 1BLNB 3WN5C 1KCKA 2ICEA 4I0PB 3TA3A 5DHVA 4YBHA 1CIUA 3T4YB 3TBWA 5HHXH 5J13B 1FLRL 2EKSB 4OFYD 3G5VB 5F3HB 4BFIA 2GQHA 3U83A 5T3XL 3C5ZB 1KCVL 3U0PA 3TT3H 5C0DB 5ISZE 4BSVB 3UPCA 4OGYL 2WW8A 3V0VA 4NZJA 3T1FA 4UUJB 4U6YA 3QISA 1MNUL 3KLHC 4RA3A 4XBGA 2P5WB 3HE6C 3NGBC 2J8UB 5BXFA 4DAGL 4HWNA 3K1DA 1CD1A 5IVXA 4M02A 5CEZH 2VNCA 1U41A 2IAMB 3ME0A 4X83A 2OTPA 1IAMA 4F7CA 2XG5A 3OAZK 2VSDA 1XR8B 5EC1A 4UT7L 3O6FC 4B41A 2P7TB 2YD7A 5IW6B 4U1LB 1MCLA 3D2UB 5IK3B 2O61B 1JRHI 5SX5K 1X9QA 2X4SB 4CW1A 1SEBB 3EBAA 1U95A 2K3TA 1BMGA 1J1OH 2GK2A 1EAJA 1JGLL 1J1XL 3HNSL 4JQVC 3KLHD 1S7UB 3GI8H 1I8MB 3QUMA 1ZGLB 3MRRA 1KFAH 3HAEA 1OGAE 3IDIA 4YK4C 3BEWB 4XCEB 5D1ZA 4CUCA 1MREH 5IB1A 4HWEH 5IQ7H 2GUOA 2P8LA 4RFOH 1AD0A 2VXQL 1X5XA 4OKVB 1PSKH 5KSAD 1OW0A 2UZIL 3BN3B 5ABDE 5FDWA 3HNTH 1K3IA 2H1PH 1Y0LB 2GSIB 3X3FL 4MHHG 2BOCB 3O6FD 5EZIH 5HGAB 3ILPA 3TWCH 2YD3A 1LGVA 3JV6B 1MFBH 3NIGF 2EICA 1IGTB 4PJHA 4LU5H 1JWSB 4U1HA 4MDJB 2X9XA 1OP5K 1EMTH 3EOTH 1GGIL 4P5TB 2CIKA 4PPTA 4XNQA 1FORH 3QQNA 4BQ9A 3O0RL 3WFDH 4PRBB 5TH2A 2A83A 4JM4L 3STZA 3MXWL 2YD1A 1S78C 4O02L 5IM7B 1L7TL 3KPSD 1BJMA 4HGWB 4UV7L 3S5LA 4JY6B 3BVNA 5BQ7A 4YNYB 1S7RA 4N8CH 3BDXA 4MD5B 2ZJSL 3PP4H 2XXCB 3DO7B 1I9JH 4MAYB 4N8VB 5L6YL 3RQ3A 4F8TA 1IGCH 1HQRA 4G7VH 1IEHA 3WS3A 3BZEB 3CH1A 1G1YA 5DEFA 3BJLA 4YDLB 5MENB 4CMMA 1NGZA 3OL2A 4ZTPL 1CZ8H 2ARWA 4HMCA 3FKUS 4LLMB 2C1OB 1MH5A 4U0RC 4EIZC 5JHDA 1OWRM 4PJ7A 4XMLH 1BEYH 5CEYB 4LSSL 1S78D 1C5BL 1M05B 4TULL 1QFPA 3ZTNL 5I16A 1WTGT 4W6WB 4HIIA 4C56E 4DGYH 5C07D 3INUH 1T21A 1MPAL 3JTSA 2VXVL 1VFMA 1RZJC 2X89A 1C12A 1PG7L 3FO2B 3MXVL 2DQCH 12E8H 5DJ6A 1EEZA 3LEXA 3QUZA 3N85L 4ODTL 1RSFA 1N0XL 3G5ZA 2R1YB 5E95B 5FV2A 4ONHB 4QXTA 3TCLB 2VE6A 1QPPA 2UUDK 2HJFB 3EZJB 1NGWA 5E8PB 1U8QA 4JFEA 1CLZL 5TQ0H 3G6DH 4JO1H 5EOTB 5ETUA 3ARGC 4QF1B 4F33A 32C2B 2X4OA 4YUEH 4EQ3A 2IC2A 3QI9B 4WCYH 1PGRB 5CINL 5T1KB 4YXKL 1G7QA 4WV1C 4IRZH 4M7ZB 4F9LC 3BKCH 3OWEA 3ZKXB 1XF3A 3O3BA 4BFEA 4JLRA 5A3IC 2QSCH 1UVQA 1V05A 4PJGB 3FN0H 2CJUH 5I1KH 5KVEL 2YUZA 1NDGB 1NBYB 3G6JA 4PGEB 1BFTA 3TT1H 4PP1C 1Q72H 2VWEC 4YHNB 1OM3L 2DL2A 5F7FA 3TPUA 3P4MA 1Q0YH 4JKPL 4ONOA 3T4AA 4ZTOL 2ORBH 1HQ4A 5EU3B 4PJBE 4YEFA 1UKTA 2DI7A 2BNRE 2J2ZA 2H2PD 3TZVA 5I75B 4RDQG 5F89A 2VUYA 1I7TB 3L9RA 2CRZA 4GW5A 4OZGB 3A67H 3IXAB 4DOHB 5ICYB 1N5YH 5CEZL 2VO5A 4F37K 3VA2C 1HH6B 3EHBC 2VDQH 4WFGD 4XRCB 1YJDL 4GS7C 5D5ME 3SN6N 2CMRH 3TIDA 4DGVL 1A6WH 2NZ9C 3DV6A 4PP1D 1IM9A 1NCBH 2OP4L 4OCMC 3V5DA 2IH3B 3ARBC 3D69B 5E8OB 3QJFA 4N1EA 2A6KB 3RWGA 1YEKL 2YHGA 3O2DL 4HPYL 4Z76B 4FQXB 1TJGL 3MBXL 1LD9A 3SKJL 3TH2T 2VUOA 5IFAH 1C5CH 3LKQA 1MREL 3JVGC 1C1EH 3KPRE 4HWEL 4KY1H 7FABH 3QYCA 4RFOL 1HYSC 1PSKL 1ZVSB 3A6CH 1G7JA 2F19L 2H1PL 2DDQL 2XN9A 3W0WB 3EHBD 3DARA 5HDQL 1RZGB 4IHOB 4JAMA 3EYUH 2JE8A 2YMXH 5EZIL 2YD8A 3TWCL 2NZ9D 5I74B 2ED7A 4I3GA 1KBGL 3FOMA 5KVGH 4LBEB 2R39A 4QRPE 3BP6A 3OXSB 1BFVL 3LVEA 3MLPA 3GMMA 3MLZL 4QYOB 2NY3C 5FYKH 1E0OB 1I8KA 3QXAB 4MX7B 4WU7B 2DM2A 3ZZ1A 3IJYB 1G9NH 4LU5L 3BGMB 1ZA3A 4ETQA 1QEWA 2J8HA 2X4UA 4JHWH 4PY7A 1PFCA 1TVHB 2YSSA 5FFLA 2BCKA 4HLZG 1R5IB 3D39E 5D2LF 3IU3B 1HYSD 3WFDL 2JB6A 5JIHA 3VI3E 1V3LA 2DQFB 3MA7B 3PWUB 1X5ZA 5FUZH 4NDMB 5AWNL 4NZUH 2RFXA 1KB9J 4YE4L 4FQJL 3ARSA 1Y18B 3DX6A 4N0YL 1I9EA 4Z78A 4N8CL 4Q6IA 3U79A 1A0QH 4IOFC 3K46A 4KJWD 4WNQB 5DLML 3PP4L 1E6JH 3BPLB 2Q1EA 4HKJA 1I9JL 1T7ZA 4KZDH 1KIUA 2D7NA 4UI2A 5CJOH 4M5ZL 1IGCL 3GSNA 4G7VL 5DGQA 4IDLA 4OLZH 5I8KH 4P46A 3RIFK 3R1GH 4LHUD 9CGTA 2F74A 1A1OB 5EZLA 3HRZA 4NZRL 3S35H 5ALCL 4JZNB 5FO7A 1BEYL 3I6LE 3Q2CA 3VG0H 4YO0B 1TZIB 1UQSB 3AAZB 4NQDD 1FYTD 3OR6A 1OVZA 2AVGA 1FC1A 4XP1H 2VDOL 5CCKL 1P69B 3T0EE 2ADJA 4FZ8L 1N5AA 4GQ9L 1K4DB 5B22A 4IOFD 1S7QA 1FVCB 3GSQA 3JWOL 4P9MH 4QRRE 4WWKA 2BSSA 4NQEA 3MRPA 5CWSA 4FMFA 4XMKL 4CADB 4R3SA 3MRBB 2OI9C 1UZ6E 2V5MA 4F9PA 1F02I 3QDJE 2NLJA 5D9SB 4U1MB 2GEEA 1KPVA 3C5ZD 2YXFA 3VFTB 4KKCD 4C58B 3O9WA 1G6RA 3FB5A 2ZUUA 4J3VA 3PXHA 4XCNB 2JF1A 1A6UL 1MIMH 8FABB 6FABL 5DJAA 4JO1L 5I15L 4N0FB 1MAJA 3EYSL 1NL0H 2ZCLL 3FO9A 4MJ5B 3CFDA 3TNNA 4KROB 1C16A 4GG6F 1EEYB 4YUEL 4UNVA 1D5XB 4WO4B 4L1DA 3LS5H 3GKZA 3RWEB 3V8CA 2PXYB 3U2SA 5T1LD 5D71H 4XPGL 4JHAH 4JR9L 2IAMD 2VLJD 3MJ9H 3V79C 5C0BE 4K3DH 1CFTB 2H3NA 3QRGH 4J7RA 4Y4HA 1KCRL 2CJUL 5I1KL 3LKRA 2BNQB 2X6MA 4EOWH 3D2UD 5E2WL 1Q72L 5F6HJ 1LE5A 4JB9H 2C1PA 3C6SB 1F6LL 1Q0YL 5D7SH 3S5LG 3X12B 2ORBL 1B6DA 1S7TB 3AMKA 3EO1B 1K8IA 1MCQA 1DDHA 4APQC 3TJEH 4LGPB 1QYGL 1RJZA 3G5XB 4HSQA 5IWLC 4ZFOL 1QLFA 4WTZA 3OKKB 2X70B 5C2BL 4TSAH 2JCCF 4XP4H 5HYFA 3A67L 4WJ5B 4OTXH 5ERWA 1V8HA 4TOYH 5DWUL 3D85D 1L9MA 2GYSA 2LTQC 3F62A 5IBUG 2OJEB 2VDQL 1T5WB 3HNVL 1AO7A 4UZGA 2V7NB 1A6WL 2VAJA 5DRZA 4OJFL 5IFJB 4OV5B 4UAOC 1OT1A 2IQAA 1I85C 4KK9C 3B5HA 1I1AA 4RX4D 1U8MB 2XQBH 4GAGL 4APQD 2AXGB 2YXMA 4U1NB 4JPWH 4OZIB 5LBSH 4GG6E 1JWUB 1FZJA 5HGDB 1QFWL 4MVBC 5AD0B 3QCVH 5KN5A 2AEPH 4P5TD 1BOGB 3I85A 1C1EL 3B9EA 3MV7A 1ZS8B 1U36A 2Y07H 1BZ7B 4P2QB 3A6CL 3ZHKA 4NQXB 5CMAA 3NVQA 1UB6B 4MNQE 4QHUA 5D7KE 4YGAB 4M6MH 2YMXL 4JQXA 5KS9F 4N5EC 3IXTA 3PABB 4LLAA 3O3AA 4PYHA 3QDME 3CX5K 4U1IA 3K0WA 4KMLB 1NJ9A 4P2OB 43CAB 2NY2C 3MCG1 1LO3H 1WGOA 3KXFE 4QTHA 5INCB 4KK9D 5TDNA 4MAYD 1G9NL 2ED8A 2X7LB 5GS3A 1ZHKB 5E9DD 1K5NA 5GRVL 3E3QE 2JCCE 4MVBD 4TNVK 3ARUA 5HI4D 1D9KB 1HEZA 1MY5A 1KTKE 3TYFA 4X6EA 4PJCE 1OSZA 4G9DA 4JN2A 5I76A 2W9EL 5ID1B 5ACMA 3CUPB 2YD5A 5FUZL 3L3HB 1FG2A 1VENA 3ULUE 2JKXA 4N5ED 3C9NA 4OCYH 1DANT 5F9AC 4CU6A 1DQMH 3VFPA 1VGEH 1V5JA 2NY2D 3GSXB 3PE9A 5K9KA 3H3BC 1TCRA 4U1JB 3VD9A 3LAFA 5CJOL 3S34H 4JPVH 3HKFA 4GBXA 3WIHA 3PDGA 4OLZL 5J7CC 5I9QC 5I8KL 3IDYB 3R1GL 5JW4Q 4PJ8C 4YHYB 3DX9B 3RI5F 5HHMB 1NGPH 1U8IB 4Y5YC 5JR1L 2NW3B 3UMTA 3VG0L 4BFGA 2F9BT 1C5DA 1Z2KA 1JNLH 3U0TB 5EO0A 3QI9D 5D93B 1QSFA 4M62H 5JIPA 3VFWA 4RAUB 1YNKH 4EI5A 5FM5O 3AUVA 3LQMA 3VE0B 3JV5A 3BKYH 2Q86A 1N8ZB 2NR6D 3KG5A 3AGVA 2ED9A 25C8L 3REVB 4PD4K 1F3JA 1T04A 5IVNA 3C8KA 3ROOB 3ZT7A 5BMFL 5GHWH 4H5SA 2NY7H 4TSCH 1EDQA 3HR5A 2V5SA 1MIML 2ZG2A 2CKBB 5F1NB 1RK1B 1QRNA 3P73B 1JGVH 2J6EH 5KVDL 2DMBA 3AVEA 5C0GB 2A77H 4AQOA 1AXTH 5DUBA 3OKOB 1QLRB 5F8RC 5C08B 4IOIB 5HYQB 1MHEB 3KPPB 3Q3GB 3LS5L 1REIA 1FAIH 4M3KB 5GSVB 3NFPB 4JHAL 3VXNB 1XGRB 4OF3A 5FGBC 1CDYA 1LVEA 4UILH 4GAFB 2AJUH 4E41A 3PWPB 5FA3B 5FB8A 4LCCA 3UPRA 1FCCA 3IVKA 4V1DB 4OAWA 3CVHL 2DIBA 2E8ZA 5EUOB 5EU5B 5I74C 1XGTB 1D7FA 4JB9L 1FNGA 5D7SL 2FO4A 3BP4B 1X6NA 3SEPA 2CDGA 4OBRA 4ZPTB 5F72S 4QHMB 4I13B 3TJEL 2CLZA 1BPVA 1QG3A 4RMQA 5E5UB 1JMXA 2I25N 1DEEB 4ODWA 1S9VB 3L3IB 4XP4L 4HUUB 2YUWA 4GJTB 5L2KE 1IC7L 3UTOA 1WBYB 3IKCA 2R56L 3RDTA 4KHTL 3MV9B 3IDNA 4I9WD 1BBJA 4JY4B 4CVZB 1AGCB 1QBBA 3WO4C 3RTQB 1IC1A 4NBYB 4FQ2L 4AEHL 2VLLA 3T0XA 3NFSH 4L3AA 2G5BA 1RJYB 1DVFC 2NMSA 4LLUA 5CJQL 2BMKB 1YY8B 4HEPG 4XNUH 1WT5C 3DIFB 4O9HH 4JZOA 4JPWL 4BK4A 4K8RC 3DVIA 1X5KA 2F53D 4JRYD 4GRLB 4IJ3C 3EKCA 3LCYA 1W0VA 2YN3A 3QCVL 4S1SH 4NUJA 5FHBH 1CE1H 2R2EA 3BE1H 4NC1E 5ISZA 2ZSWB 2J8OA 4XVSH 5HDBF 5ESVB 3MR9B 5BRZD 3IDJB 3OHXB 1WZ1L 3MJ7A 3QJHB 2P5WE 4L4TD 4MJ4A 4UOJA 4LRIA 5GGRB 3HB3D 3NCJH 4NQSB 4U1SA 5DMIH 2R69L 4ODSH 4XAKE 5I66B 1DVFD 4QHLB 3F12A 3KYKL 1LO3L 4N90D 3PQYA 3I50L 4XB8A 5J56B 2HH0L 4MAUH 5JDSB 4K8RD 4X98B 5TE7L 4I2XB 1BIIA 2EDFA 1EXUB 3PL6A 2Q3AA 1N59B 3DBXA 5D1XC 5H94A 3HG1E 4WEBH 4ODXB 4QCIB 4NYLA 3S3PA 4OZHB 1ZHNA 2X4TB 3X14A 4AEEA 5EBWA 5KVFL 4MQXD 5E6IB 3NCFB 3VWKA 1BVKA 1MEXH 3W11C 4YDJA 1FJ1A 5C3LD 1SJEA 1C8PA 4MJID 2WWMC 4P0DA 1KG0B 4MXQC 4X0KA 4RCAA 1OGAA 2YA0A 5TE4H 3KLAA 2OQJA 4WW1B 3Q1SL 1VGEL 2W65A 4WTZG 2CH8A 3KYOB 1QVOB 3O4OB 3LPGA 3L3OB 4RRPA 5DS8A 1EFXB 1UADC 3RWCB 3S34L 1AKJD 4JPVL 1FC2D 1NUGA 1KLGA 2G75A 1ND0B 3Q6FA 4PJ9B 1FP5A 2AQ2A 5ID0A 2N7AA 2AEQL 3FT4A 5D1XD 3LOWA 3QDGD 4FOMA 5HDBE 5C0CB 1NCDH 3FHQA 1U58A 2NNAB 4FQLH 1EPFA 3TM6A 4E5XB 3REWA 3VI4F 5CEZE 3BH8B 3P77B 3W11D 1JNLL 5FAAA 3U9UA 4MXQD 1CDGA 4ZUVA 1U42A 2C3WA 2YA2A 3GMRA 3HC4H 2QSQA 1LK2B 2HVJB 2IH1B 1BD2A 4HXBH 5DDHB 3SCMC 4M7LT 5KOMC 1EO8H 1YNKL 1UH4A 2MQCA 4L8DB 2Z92B 3TLRA 4HG4J 3QPQD 1KCSL 1UWGL 3D9AH 3DUSB 1L7IL 3SE4A 5LKNA 2ZSVB 2DLHA 1FL3A 3V7AG 3U7YH 5GJSL 5GHWL 2BHZA 4TSCL 5C0EB 1K6QH 3EYVB 4QHKJ 1KULA 4CNIB 1JGVL 3FONA 4KQ4H 1E4XL 3HPJB 5JW4R 1AXTL 2NXZB 1S7SA 1HZHL 3W9EA 5MENE 1ZT1A 2F58H 5F7LB 3R06B 1INEH 2R0WH 4NHUB 4NT6A 3B6SA 4BM7A 1RQ5A 1Q9LB 2VC2H 2AJUL 4G3YH 2ZG1A 1F6AA 1T1ZA 2BRQA 3AS3A 1RZIB 3VXQB 2EDOA 4MHHI 3ULVC 2WMPA 3O41B 3BGAA 4Q9BA 3LKPB 1DBKL 2L7JA 3QBTB 3VI4E 3O3EA 2XKNA 4LP4A 5JXAH 3P4LA 2XPGB 4RAHA 4BH8B 4JG1H 4OLYL 5H2BA 1A3QA 4AH2A 2DQGL 4NN6B 4EUPA 1IC5H 4OGXL 3MOBL 1KGCE 4ELKA 3GMNA 4CBPA 3LDBC 3LV3B 4KHXL 4LP5A 1A7PH 1RFDH 2JIXD 4NNPH 3OAYH 4XNXL 3SY0B 5B39A 1A7OH 3CCHA 4YC2B 5HHPB 1VB9A 5K93A 2XNAA 4M7KL 2V2XB 4HZLB 3VFUB 2V2WA 4XXCC 3AS1A 3RWFB 3G6AA 4WW2C 3NFSL 3ULVD 4LSVH 1A6TA 1FZKB 5T3ZH 1F3DH 4PRID 4MZ3A 5J11C 4AT6A 2C26A 1NEZB 1AD9B 3TO2A 5SV4A 3WNKA 3OAZH 1D9KD 1P5UA 1BQSA 4S1SL 5FHBL 1G7LB 3DXAD 2XFXA 1NC4A 2VDNH 2KDGA 5GS1B 1AHWA 2IGFL 4O58L 2BVPA 1ZHLB 3MBEA 4PJBA 1VFAB 2PW1B 2BNRA 4G42A 5C0RH 1FZOA 2HMIC 4DCQA 4NNYB 4RQQB 2J7LA 4OZGE 1A4KB 1TJIH 5I71B 1F8TH 2WV3A 3MLWH 5ICXA 4R4NC 2VH5H 1ZWIA 3BHBA 2KUTA 2Q8BL 3FN3A 2OXGA 2EE2A 2YC1B 4WEBL 4AYFA 3RVXC 4JREC 4OD2B 4PRHE 1MLBB 4NN7B 1M7XA 1A1MA 4J3WA 5E5MB 4OLXH 4Y5XC 1ZOXA 4WFED 2PN5A 5IBLC 2HMID 5HGBA 1JHTB 4MMZC 1OP5H 5F93C 2D4FA 5TE4L 1ZLWK 2QHLA 1ES0B 3MV8E 4J6RH 3KPRA 4LPCA 1X4XA 4MXVF 1N6QL 2X4RA 4R4ND 4U4BA 3W0WE 3DJ9A 3DVNB 3UO1H 1A64A 3CPLB 3FQWA 3WLWC 1AGEB 3L7FA 1V3KA 3GJFB 2YZ1A 4PUBL 1ORSB 4XPBH 1V7NL 2Q7NA 4M4RA 3RVXD 4DK3A 5MEPA 1FGNH 5FYLD 4QRPA 2RB8A 3X13B 4HKBA 5HBBA 4HC1H 5AZEH 1G84A 5IBLD 3IFNH 2XWTB 3QXUA 2BERA 1RVFL 2CLVA 2ZUWA 1T66D 5HY9B 4HXBL 1B88A 1DQLH 1EO8L 1UXWA 3W39B 1RD6A 2BFVL 3D39A 3DSNA 2V9RA 3SDDC 1FO0A 2BDNL 3VDAA 3C60C 2WUBL 3PWPD 1ZLSL 5DTFA 3WLWD 3HC3H 2D9CA 5IMLA 1RZ8B 1N7MH 2FL5A 3F7RA 3U7YL 3HZYA 1SM3H 1NSNH 4IIQA 3MOQA 5JTWA 4FQHB 1U3HA 4GRMA 4FXGA 1IQWH 3JV4B 3SDXB 3UYPA 4KQ4L 4NHCH 2GJZA 4XH2A 4XCCH 4LSDA 4FXLA 3HPLB 1IL1A 1FGVH 4I4WA 2ICWI 5ECJE 1MWAH 3SKMB 2AXFA 4AM0B 2BSTA 5MHSD 1Q9OA 2J5LB 5DEGB 1EHXA 1V7ML 1M71B 5GRJH 3UBXI 3CZFA 3HZVB 4ZO9A 4MCZB 4Z7OF 3UP1A 2FCBA 4YHLH 4POYA 4RGNB 3WFEL 5DJCA 1AGDA 2EC9T 2VC2L 4KI5E 3SDDD 5FYKE 1FVDB 3C60D 3BIAX 4LMQE 4B0MM 3RTQD 5JW3L 5E5RB 3VFVA 2JJTC 2HJLB 3MRGB 4F3FA 1UEYA 3DVFA 4D0DA 3T0EA 1PKOA 5JXAL 1A7BA 3DSFH 2J1KA 3SKNB 4QRRA 4GRLD 3WSQL 1NFDF 1KJMA 1IC5L 3B43A 2NY1C 4LFHG 2ZOKA 2AV1B 1SMAA 4R90H 5DVNA 1RHHA 2WIMA 2VYRE 3QDJA 4S1RH 3VW3L 2H8PA 2R9HC 3OTTA 1RFDL 3I02A 3EJZC 4Z7UF 4BQCA 1A7OL 4ORGA 4JGJA 1LE9A 3KR3H 4OQTH 5GRZA 5BVJA 4OI7A 5KSBF 1I7ZA 1VADB 1MWAB 2X1QA 4JM2F 3MROA 4NKDA 3F7YB 2KKQA 4CRPA 2XY1A 3RPIA 3AREB 4ONFL 4ALAH 3WIIL 4G6KH 1JPFA 2NY1D 3OX8B 4K71B 2BNQE 4KUCF 2DWDB 1BQLH 3SDCB 5AAWA 5L8LB 1HI6A 4NKMA 4LLWA 3WDHA 5I8CB 1JHKL 5JXEA 1CICC 1NBZB 3EJZD 5IMKA 5D70H 1OOAA 5A40E 5D6CA 3O8XC 2QQKL 3EDFA 1TVBB 1RMFL 3WUWA 2FEEI 1LP9B 4PRDB 4NQUA 1XF1A 4ZAKB 4FQCH 3VXUD 1P9MA 3KS0H 4LRNH 4RMRA 2CUHA 1JJUA 4WFFE 3T0BA 3A0OA 1P1ZA 1LEGA 1M1SA 4LKXA 1F5WA 5D7LB 1EFXD 1FFPA 2X40A 3ARFB 2ENSA 1JGEB 1I3GH 3H0TB 4OFIA 1L4IA 2ZP0T 4XVTH 4LASH 1IKFH 1GSMA 1KJ2L 1CICD 4Z7UE 4XC1L 4FFWC 5GS2H 3I9GL 3AY4A 4JDVB 5INDA 1A4JA 2X42A 4P57B 2X9YA 4NN5B 3O8XD 4M8QB 2CSPA 4OCXL 4R7NA 1LK3H 4D9QD 4OZIE 4OLXL 1I7UA 2APWA 5F88A 3WJLC 3MUZ1 4LDLB 4A6YA 2PYEB 3QFDA 5J6GA 3BP7B 2CLRA 4WUUD 5TDPA 4GG6A 3BDBA 1CD8A 2E6QA 2Z8WC 4O4YL 4GXVH 1I1FA 5GZOC 5GGVL 4EUPG 4AZ8A 1JK8B 1Q9KB 4J6RL 2PYFA 2OL3A 2MOVA 4R7DB 3UTZB 3QUXC 3BT2L 3BXNB 4P2RB 3SGKA 3RGVB 3UO1L 4MNQA 5E1AB 2DLGA 1UWEL 5J9PA 1PYWA 4NZDA 3N1GC 2VR9A 5B39G 1F4AA 2GK0A 5DQ9A 2DI9A 3QNXB 4FFWD 1XIWB 3E2HC 3QDMA 1MUJB 1MCJA 2MHAA 3RAJH 3KXFA 4NFCA 3RU8L 5GGVY 2X1PA 1B0GA 4HC1L 4JFQB 5JQ6H 2FHBA 3ZKMC 1F3DJ 2JCCA 5J1TC 1AH1A 5GZOD 2R23A 3KVQA 3VXMD 2VABB 3GZKA 3TA3B 1T7WA 3HAEH 4XBEH 1FFRA 2B2XL 2B5IB 1MHCA 2QHRH 3QUXD 2JELL 4BFIB 3O3DA 2J3SA 5HHOB 2EIBA 2VDRL 2PKDA 2VZOA 1ZHBA 4U6HA 2FHFA 2DQJH 1D6EB 1T89A 1CS6A 3LHPH 3OKMA 3T1FB 4PLOB 1MFEH 3OMZA 1JN6A 3BGFB 3VXSB 1Z5LA 1JNJA 1KTRL 1CDHA 4HH8A 4WI3A 3GFUA 5EPMB 4XCCL 3NIFF 4Q7DA 5BXFB 1IILE 4PB9H 1H9VA 1MWAL 2YS4A 4NRXB 1CD1B 3BUYA 5GRJL 4GW1A 4J3TA 4Y16C 4YX2H 1MRFH 1AE6L 2XTJC 5HHME 3MLSH 5EC1B 3TVMC 5DVLA 4UIMA 1CLYH 2ZUYA 1YNLH 3MOAH 1U95B 3ARDC 2CIIB 4Z5RB 2BVUA 4Z77B 2CRIA 4G6MH 4ONGH 1JTPA 4EI6B 1F11A 2HFGH 3B83A 3DSFL 4WRLA 3ZO0A 3QUMB 4NNXB 4OCRL 3BYTA 3MRRB 1FH5L 3HAEB 2C4FT 2IPKB 2P1YA 4CDGC 3DMMC 5D1ZB 2GUOB 1MCFA 1I3RB 2P8LB 4JFXA 2QJDA 2HTLC 4XNZC 4R90L 1RUMH 2EXYC 5FDWB 4Y16D 3QWRD 3V6ZA 1I7RA 2RBLA 5A2LH 1M7IA 1BBDL 3TVMD 1T7XA 3SDAA 4Y2DA 1PVHA 3LPFA 5J12C 4LLVB 1YNTA 2P8MB 4KUZH 5C08E 2APXA 4CVUA 4JFOA 1KNOA 5H37G 4OFDA 2I60H 5I8EA 4PRPD 3MLUL 3BO8A 5CIPH 2VXTL 2WK2A 3DMMD 3L5XH 2CIKB 1BHGA 2W59A 4G6KL 5IHZA 4LNRA 2JTDA 4P3DA 2HTLD 2XKUA 3KWWB 4V1DE 3GHEH 3OAUH 5FKPA 3LRSA 4KTDH 1NAKH 1KIRA 3QA3A 5TH2B 4XGZB 5BV7B 2NYYC 3KYAA 3L3JB 2V2TB 1A3RH 3U9PH 5E4EC 1MSPA 3S97C 3QEUA 5EA0L 4F7PA 3TBVA 2DLTA 1YEGH 2DM4A 2IBGA 1OTTC 3SKOA 5BQ7B 3NCEB 4YAQA 2L4OA 4JFDE 5FO8A 3EFFA 5DMKA 3IDXL 4G8GD 4Y4FA 3CFKB 3WIFA 1JRHL 4S11A 4HS6B 1KLUA 3MV9E 4ZPVB 1GYAA 1AXSB 5ALBH 3SE8L 2DL9A 4TNWK 3NIDF 2WM0A 5SWQA 4YHMH 4IRJC 1K3ZA 3QG7H 1QQDB 2NYYD 1IQDA 4EBQH 3W9DB 2EDNA 1RUKH 4Y1AE 2AXJA 4GSDH 1BLNA 1NCCH 1SEQH 3O45B 4I0PA 3NPSB 3KHQA 1OARH 1T21B 1WQVT 4HUWB 2EKSA 4PRAB 1C12B 3CFCH 3RVUC 5I1GH 4Z7NF 3G5VA 1UCBH 5DK3A 4KPHH 4YZFF 1ZGLP 1EEZB 1UWXK 4MS8C 5I1DA 1DBBH 3QUZB 3IETB 3OJMB 5C0DA 3PWJA 5EZOH 1R3LB 2FJGB 4BSVA 3MNWA 4UDTA 5DFVC 1EJOH 4YLQT 2NX5A 2VE6B 4G8FA 3QIBB 5FCSH 1DBML 1NGWB 2P5WA 4IRJD 1U8QB 1TPXB 3FB6A 3ZDXF 2CKNA 1JF5A 2WLZA 4XPFH 4KDWA 4IDJH 2Z31B 3RAJL 4B50A 3MPCA 2GFBA 4I2XE 4PG2C 3RVUD 2CQVA 3L1OL 4MS8D 4X5XA 2AXHA 4U1LA 4JLRB 2O61A 4LDEB 2YWZA 2X4SA 2A73A 1SEBA 3HG1A 2FX8H 3O4LD 4OZHE 2GW5A 1MCHA 1NGQL 5IGXL 4Z95L 1XZ0A 3G6JB 4MNGB 5E2VH 3ZDZF 3DNKA 2LU3A 4JZJC 4WIQA 1UM6L 3FT3B 5AEAA 4RIRA 5K33A 1I8MA 4OFKA 2DQJL 4PJAB 4OCNC 1HQ4B 4Y89A 3BEWA 4J3SA 3GMOA 1MIEL 3WUWG 2BVEA 1MELA 3TZVB 2KBGA 2FX9L 1X5YA 2AP2A 1Q94B 2ZUQC 4NWTL 4OKVA 5EU7E 5E08H 1NPUA 4GW5B 1Y0LA 4L9LC 1TZGH 1FIEA 2J88H 2IBZY 5HGAA 3O11A 2W92A 4YX2L 2VIRB 4LQ1A 5C0CE 3JV6A 1WTLA 1I9IH 4D0CB 4JFZH 1CLYL 3TIDB 2VLKB 1IGTA 3DV6B 1JWSA 4MDJA 3MOAL 3V5DB 2PR4H 2XRAL 5E56A 1KACB 4HUVB 3QJFB 3LKNA 3RWGB 4G6ML 5D6DC 5HVWA 2NZIA 5E8DL 2HFGL 4I77H 3SE3A 1U3JA 2Y23A 5DQJB 4R4FH 1DSFL 4MA7H 1NC2D 5KANI 4PTTB 4AEFA 5C09B 1FVEA 3W5NA 3O2DA 4M1GH 3RKDC 1HHIA 4HGWA 4BA8A 5E70A 4JY6A 3C5SA 1S3KH 1P7QD 4YNYA 4W4OC 4JAMB 4MD5A 3ZDZE 4QOKD 4GKSB 4N8VA 1PG7W 4QGYA 4ZOAA 1QBLL 4C4KT 1ZEAH 5AAMA 3GKWH 4K8RL 3BP6B 4GKNA 3BZEA 1JNNH 4MMXC 2CGRH 5MENA 1ZVYA 4ENEC 2I60L 4LLMA 4MA1B 4ETQB 2C1OA 1QEWB 1J0JA 4NKIH 4OGAC 2WBJB 2X4UB 4TVSa 3L5XL 3EFDH 4MA8H 2YSSB 2BCKB 1M05A 3GHEL 3MYJB 4D3CH 1FBIH 3RKDD 4KTDL 4JO4L 4UNTA 2JB6B 3PWVA 3BQUB 2O5XL 1KENH 3MLVL 1A3RL 3U9PL 2IEPA 4YHIA 2XZQL 4X8JB 3FO2A 5DJZB 1YEGL 4U6VL 4Z78B 3KPLA 1A5FH 2R1YA 5K9JH 2IALA 4KJQC 4ONHA 1VCAA 3TCLA 4ENED 1CGYA 3TA3C 1QR4A 4I3RH 2HJFA 3ZMRA 5E8PA 4OGAD 4P46B 1S5IH 3UEZA 2ARJA 4LIQL 5EU6E 5EZLB 3HRZB 2VDLH 4YXLH 3DI3B 3QG7L 2OZ4H 4O2CB 4IMLA 3D0LB 1RUKL 4HIXH 1AP2B 3GSUB 4GSDL 1FCGA 3V6FB 3WD5L 1A9EA 5FM4A 4XX1E 1DFBL 1N5AB 1U8LB 5E03A 1VPOH 4ELMF 1S7QB 1NCUA 4UTBL 5I1GL 1RULH 4WWKB 1T20A 4M48H 1UCBL 5JZ7D 4KPHL 1NDGA 1NBYA 4R2GC 5CWSB 4R3SB 3TA3D 4PGEA 1HNFA 5EZOL 4YHNA 5JOEA 1GAFL 3CFBA 5HYIA 1KPVB 1EJOL 3GMPB 1IT9L 3PHOB 3O9WB 2Y5TB 4U1GC 2R1XB 1MI5D 4OLWH 1I7TA 2R1WB 3QP3A 2FIKB 5DJAB 5GPRA 4OZGA 5F6HI 3HMXH 5E6ZA 4XPFL 3CFDB 5ICYA 1T2JA 1C16B 2A9MH 4XRCA 2EDWA 4F15B 5CZXD 4R2GD 1OW0C 1JNHB 2CK0H 3LQAH 5J89A 3BPCA 4RFNC 2FX8L 4Y4HB 5JPNB 3F7VA 2QADC 4PRHA 4DN4H 3LKRB 3F8UB 3D69A 1U8PB 5T3ZE 3UZEA 1NUFA 2GSGB 5AUMB 5E2VL 3LSOA 5IVOA 5IESH 4FQXA 2C1PB 2D31A 3MRCA 4X4XA 4HUXA 4X99B 3WXVH 3ULSB 4HAFA 5FEBA 4S2SB 4P59H 5I30H 1RJZB 1HIMH 4G5ZL 4ZD3H 1R0AH 1J9CT 5HGGS 2APVA 3MV8A 5E08L 1ZVSA 4CKVX 4ELME 1OAYL 5D1ZD 1BOYA 2PO6A 4OM0H 5CZVH 3VXTB 2Y06H 3W0WA 4DWHA 1RZGA 1TZGL 4K07A 3SO3C 1LO2L 3TIEB 2J88L 5K59F 2IPUG 1B2WH 2Z8RA 3OB0H 3F6LA 4DZBA 3BSZH 1J0KA 4PJEF 5CZKA 3U0WH 1I9IL 4LBEA 4PGCA 3OXSA 2QADD 4Z0BH 3WFBH 5D7JA 3RVWC 1UJ3C 5DRZB 5SWZE 4HULB 5GXBB 4MX7A 4WU7A 3CX5J 1QOKA 3BGMA 2PR4L 4WY7L 4KVNH 1TVHA 3VGBA 3CU1A 1R5IA 1FZJB 3V5KB 1YEJH 3IU3A 3OPZL 2G5RA 4G80B 1OTSC 3I6GB 1KYOK 5KN5B 5E2TH 3CVIH 3EDKA 2DQFA 4ZUUA 1KEGH 3MA7A 3MV7B 3PWUA 1CGSL 4FFVC 4C54A 5I2IB 4K3EL 1P4BH 5HGHA 5CMAB 1Y18A 1LWRA 3VGFA 1Z9MA 2OTUA 2WINA 4WNQA 4S0TD 3SDXE 1ZGLM 1CXLA 3RVWD 4NC2B 3IXTB 3DO3A 2DB8A 1EVUA 4L1HA 4U1IB 4KQ3H 1NJ9B 4P2YA 5TDNB 3B2UC 1JNNL 5MI0C 1A1OA 4Q58C 1BWMA 3I75A 4G9FB 5B21A 4RGNE 2YD2A 5I1CH 1OTSD 5CP7A 4WUKH 2YPVL 1JHLH 4NKIL 5IBTH 1PW3A 4K3JH 2IAND 1RUQL 1HEZB 5K59E 1ZV5A 4MA8L 3TYFB 4HBCL 5GIRB 3AAZA 1OSZB 1FBIL 4FFVD 2E6PA 4JN2B 1P4IH 2FBJL 5JHDD 4PJEE 4PB0H 3EO0A 1G7PB 5CBAB 1LP9F 4DEPB 2FATL 1K4CA 1FVCA 1XGYL 2GAZB 5A2KH 5J6HA 3C9NB 4CADA 4XVUC 1CL7L 1I4FA 1S5HB 3H2WA 2X89D 3VFPB 4U31A 5K9KB 5K9JL 5FK9A 2D7PA 3QUZD 3UZVB 4GKZA 1QFWI 4I3RL 4XCNA 4PD4J 4X7FC 2H41A 8FABA 1FV1A 2KQNA 4MJ5A 4UQ2B 1OF2B 4NPYB 4JFED 4BZ1L 1EEYA 4F37F 4WO4A 4X7DC 2FEDC 1NLBH 1T1YB 4ODHL 2GTWA 4I0CC 4XVUD 5ITBH 2HG5B 3MCKB 2R0LH 1EK3A 4CN1A 1VPOL 1GH7A 4ZSOA 2IMNA 4WDIA 1TQBC 4M48L 4PREB 1YUHB 2BNQA 3GI9L 3P9WB 2I9LB 3C6SA 3K2UL 4LGRB 4XTRC 2R4RH 3GSWB 3EO1A 3GIZH 3C8KB 2X4QA 4NO5B 3VWJA 3UXFA 4H5SB 3PP3K 2ESVA 3V4VH 3G5XA 2YWYA 2WAHA 1LP9E 4N8VG 1TQCC 4OLWL 1WIPA 3BRDA 1QRNB 3K8MA 1JIBA 5A1AA 1EA9C 3HMXL 1ZLWH 3EYOA 3ZT6A 2HRLA 5CKAA 5KTEL 3V52H 1PBYA 1OSPH 1KN4H 4GXUM 5HYSA 1QR1B 2OJEA 7CGTA 1T5WA 3QEQB 4MQTB 2V7NA 2B1HH 2BJML 1IEBB 2CK0L 1DL7H 1O0VA 4E0RB 5IFJA 4UQ3A 4OV5A 4Z7UA 3SGEI 4XTRD 1UM5L 4LCCB 3UPRB 4DN4L 1X5HA 5DD5L 3GSOA 3MRKB 4U1NA 4U3XA 5DC0A 2PYEE 1IM9D 1FSKC 3QIWC 4OZIA 5IESL 1JWUA 3MJ9A 1FNGB 4LLDA 2FO4B 5AD0A 5T33H 5T5NF 3OGOE 3STBA 4LSRH 2DOCA 3HUJF 4B7LA 1ZS8A 3CVHA 1HIML 4ZD3L 43C9A 1R0AL 3RUGF 3VXRB 5IEKB 4NQXA 4WI2A 4P2RE 4HQQH 4PJFB 3MJ6A 3MSPA 2BOBB 1GGYA 4L4VB 3UTPE 4QTIL 3RDTB 2JK5A 3PABA 4LPXA 2GITA 3IDNB 1HXMB 2XN9D 3BUTA 1BBJB 2EIEA 1EERB 2IBBA 1XF4B 4CU8A 5CILH 4P2OA 4ZFZA 2BNUB 3WFBL 3RIFF 2Y4SA 1GXEA 4QY8A 5INCA 4GKOA 1QD0A 2HLFC 5HYEA 4GMSH 3FB8B 4Y5VA 1BECA 1ZHKA 4Q6IC 3S9DB 2VDMH 4NGHH 3Q6GH 4JZOB 2VZ3A 1H3XA 3ECBB 1A7NL 3V6OE 2GIYA 1W0VB 1XGQB 4CVXB 4NUJB 5HHOE 4QHNA 3CVIL 1IC4L 4YHZH 3SOBH 1KEGL 1INDH 3JBG7 4JFHD 1FAKT 1NANI 1P4BL 2Y36H 2WIIB 3U30C 3U48A 3VXSE 4AG4H 4CMHB 4NZTL 3GIVB 4U1JA 1MCIA 2HLFD 2O93L 3N1MC 5IB3A 4I48B 3F12B 1UB5B 3QDHA 4WWKC 3PQYB 2MTPA 5L7XH 5FM5M 4DGIH 3CK0H 5LGHH 3IB4A 4F9PC 5I1CL 1GZPA 1MCPL 4WUKL 4P46D 1XT5A 1BIIB 4K3JL 1T1XA 1AFVH 3QFJA 3TN0A 3T04D 2EXWC 3PL6B 2NW3A 1LMKA 1F6FB 3LMJH 4LSQH 3LPWA 4PV9A 4QRQB 3U0TA 3M17A 4NYLB 2DKUA 4X6BB 1X5IA 1QKZL 2B4CH 5EBWB 2FWOB 4FQIH 5TF0A 3RWIB 1BVKB 5F1IA 4YDJB 2PETA 1FJ1B 2ITCB 4M8VA 5C7XH 3VE0A 1UT9A 1YECH 1OGAB 1HN1A 2OQJB 3ARZA 2W65B 4WWKD 2VZUA 4NQED 3REVA 2FJHB 3M8OH 4FTVE 3JWNC 1VEPA 3CFEB 1KLGB 3GDBA 1B4RA 4JG0H 2EXWD 5MERB 2H6PB 1RK1A 2H32H 2LE9A 3T0DA 5JUEH 5C0GA 4NQTA 2E9WA 2OSLB 3OKOA 1QLRA 5C08A 5HYQA 4IOIA 1MHEA 4I9WE 2HFEB 4QXWA 1U58B 2VERN 3KPPA 3BX7C 3REWB 1E6OH 2ZCHH 3G08A 1NLBL 3WS6A 4Z8FH 5GSVA 3VFGH 3NFPA 1GHFL 3U9UB 1XGRA 3LD8C 4P23A 4TQEH 5ITBL 4ZUVB 2QQNH 4J3OC 2R0LL 1BD2B 4V2CB 5FA3A 1JYWA 5E2UL 4V1DA 1P84J 1PKQA 2AABH 1U91A 1XGTA 5IMMB 2R0KL 3NBNA 4Y4HD 3BP4A 1KEMH 5CUSH 3F5WA 2ADGB 4PLJC 4FFZH 1MCDA 1WZLA 4HJ0C 2NPLX 1OQXA 1DEEA 4JFDA 2WSKA 1I1AC 3L3IA 3JWDC 2FECI 1OP9A 3FONB 2E27L 3K4ZA 1WBYA 4J3UA 5FUCC 3T09A 1ZT1B 3MV9A 1X3DA 4JY4A 4HZAA 2BXZA 2H32B 3PWLB 1AGCA 3NH7L 3L5HA 1U8OB 3S4SA 4Z18A 4NT6B 3B6SB 4L8BB 3ILQC 3EJJX 2CXGA 1ZT7B 1CDIA 1F6AB 1RJYA 1T1ZB 4TNVF 1AO7D 3GEWB 1OGTA 2BMKA 1YY8A 3CDFA 4Y1AA 4JQXC 3DIFA 3S36X 4IRSC 1KJ3L 5HDLA 3D3VE 4IM8A 4PLJD 1QO3B 5F3BB 4HJ0D 2XKNB 5T33L 2ARJQ 2OJZL 1I1AD 1KPUA 4LSRL 4RBPK 2CPCA 1OWWA 3QQ3B 4EUPB 3HE6A 1RZKH 1Z9OA 4EDWH 4J3XA 4ELKB 2ZSWA 2P44B 4HQQL 3GMNB 3CSYB 3B9KC 3HFMH 1MRCH 1URLA 3QJHA 5GGRA 5GJTL 4YXHH 5LWYH 3QEGH 4NOFA 4ZXBC 5A2FA 1INQB 3LZFH 3S98A 3BZ4B 3HLAB 1G9MC 4IRSD 3G6AB 4CJ1A 3GJEA 4LIQE 2FGZA 2XQYG 3FN9A 5LG1A 3CU7A 4DQOH 4I2XA 1HCVA 3LIZH 3Q6GL 5F7UA 1N59A 4H1LH 1YYMH 4GBXC 5GGTL 3S37X 4UDUA 1VERA 4OZHA 4MNGE 4DFHA 4YHZL 2X4TA 1JF6A 4ZO7A 2XFXB 3SOBL 1ZA6B 1NC4B 5E6IA 2YR3A 4WTWA 4LPWA 3THMH 2AJ3B 2AJXL 4S0SD 5DC4B 4PJAE 2Y36L 5E1HB 1AHWB 3MQIA 2E7BA 2Z0BA 4ZXBD 2ZUSA 2BP3A 4WW1A 3MBEB 4IS6A 4PRNA 15C8H 4AIOA 4AG4L 2BNRB 2Z91B 5IHUL 5IQ9A 2W0FB 2N7BA 3KYOA 3NCCB 3L3OA 4OZFH 1LILA 3QUYB 2VAAA 4MB5A 3QULA 4AIXA 1WISA 1EUUA 3ULVF 3EYFB 4P4KC 3N9GL 1I9RH 4EI5C 5HYSG 5ICXB 5L7XL 1UENA 1G0XA 4DGIL 3CLFH 1ZWIB 3LRGA 2E5EA 4GBXD 3BHBB 1BX2B 5C0CA 2VLKE 1AFVL 4Z7VF 3QNYA 1A7RH 3ZSTA 1R3IH 3CXHK 4F7EA 3BH8A 5ADPH 3FHAA 3QIUC 4N9GB 3VA6A 4KGJA 2FRGP 2IH1A 2HVJA 3PIQB 2LAAA 2BXYA 4FQIL 2X5PA 3HS0A 1QZ1A 4UB0H 5HGBB 4QXUH 5C7XL 2OBGA 3MREB 4WW2F 5C09E 3FFCE 1QSFD 1QFUL 2M2DA 4P4KD 2I07A 3MRLB 4EI5D 1TZHA 2X4RB 4PJ5E 3MLTB 5DD0L 2X4PB 3TH4T 4OIAA 3QAZC 2GTZA 2ICWB 2BVQB 4LARH 1BZQK 2WBWB 3FQWB 5C0EA 5ICZA 2HKHH 3EYVA 4JG0L 3UBXB 4PJIB 5DJ8B 4CNIA 3EO9L 5JUEL 3EGSA 2J4WH 2ZPKH 3MO1A 4OZFB 3A6OA 3QIUD 4UIKH 1NBQA 2CK2A 1QRND 4NO0B 1PDKA 1H5BB 2MCG1 1B6UA 5EOQH 2CLVB 3RNQB 3D1MC 3ZYZA 2CDEB 4Y19E 1XGPB 3GSRB 1JGUL 4U05A 5IW1A 3MGTB 3CMOL 3GUTB 3D6GA 4WGWB 3VXQA 2YPLB 3MFGB 4ZUWB 4E41D 1X5AA 4V2BA 3LKPA 1HSBB 5DTFB 3GMQA 5IMLB 2XPGA 1KEML 5ACZA 5CUSL 3TO4B 2OLDA 1IGFH 4XZUA 3RIAK 3EDJA 4FQQB 3ZE1F 1CGVA 1J8HE 4XPAL 2NY6C 2PCPB 4JGUA 3DRTA 5EN2A 4GRMB 4FXGB 2NY5C 2OTWA 3OGCA 5BS0B 4XH2B 3ARGA 2DQUH 2EYRB 2W0LA 3L5WA 5F96H 2BSTB 4LLQB 4BZ2L 5IG7B 4K94C 5MEQA 5HHPA 1MRDH 4OIIH 5EU6A 3FQRB 4WV1A 2P49B 2V2XA 4HZLA 3VFUA 4F9LA 4TRPH 3RWFA 3RDTD 1AGDB 4M7LH 5DI8A 5BCAA 2X1WL 1NGXB 3H9YA 4LL9A 3LH2L 5TFSH 4OF6A 5I1AA 4HWZB 3EJYC 1JE6A 4F3FB 5SWSB 4D0DB 1JFQH 3SE9H 4LNVA 5ILTH 2FGWH 1NEZA 1AD9A 2NY6D 1QA9B 1O7SA 3DWTA 3K1KC 2ENYA 1G7LA 3F7QA 4QRRB 1MOEA 4LVHB 4JE4B 2G60L 4MD4B 1P5VA 3VJ6B 5T1MA 1RZKL 2ZOKB 1II4E 4MSWB 4PYGA 1RHHB 1MHPL 1JZ6A 5KSUA 1NMAL 2H8PB 3E8UH 3HFML 5D2LB 1B9ZA 3MODH 4I8DA 2PW1A 4LVOC 5ISZD 4YXHL 2G2RB 5LWYL 3PJSB 4RQQA 4RMVA 4K23H 1A4KA 4ORGB 4I5BB 1JV5B 2EC9U 1LE9B 3VWKC 4WEUD 5FOJA 1BVZA 3ZE1E 3EJYD 2HRPH 4JRXB 3NCYP 5DRNB 5HYJE 1ADQL 4KC3B 4NKDB 3ARBA 2FH8A 4DQOL 1R3HA 3RPIB 3ZHDA 4A6YH 3UYRH 3DV4A 5FECA 1D6VL 1YYML 3ELAT 3K74B 5B3JE 5DD6B 4OD2A 5E94B 3GBNH 3PL6D 1U8NA 3MYZA 4NKMB 4JQIH 4LPTA 4FXKB 3ZYJA 3RY5A 3HRPA 2EKJA 3GGWB 1HILA 1UH2A 3RBSA 4M9PA 3V9FA 3EW3B 1ZAGA 1ES0A 1YMMB 3VWKD 2ZWLT 2AQ1A 3WUWB 4Y0GA 1LDPH 1U92B 1OGAD 1D5ZB 4NSKB 1OP3K 3DVNA 4ELMA 3CPLA 1HXYB 1CDJA 3L3KB 1XH3A 2HP4A 1P1ZB 4LFHD 1LEGB 3STLA 3RA7H 4DJMA 4L8CA 4LKXB 3CLFL 3S4SG 1OAKH 4M6AA 3QXWA 4NCDA 1R3KB 1R3IL 4PP2B 2CDFB 4Z7QF 4TSBH 4X5LA 5SWZA 2XWBB 1T0MA 2Y6SC 3UTQB 1A6VH 1A4JB 3FAWA 4KJYB 3TFKC 4QLRA 3S35X 4R7NB 4WU5A 5F88B 1LO4H 5DEZA 4A6YB 5J6GB 4GG6B 2CLRB 4UB0L 3ZE0E 2W07A 3QZWB 4QXUL 5CLWA 1T22B 3MV7E 5T3XH 3MACH 1KCVH 1Z3GL 2PYFB 1RZ8A 4G6AD 1KPRB 2OL3B 2F8VA 4QWWC 1IZJA 1P7KA 4N0RA 4LSTL 5J9PB 4MNQB 1MNUH 1WFTA 4XWOC 4LVEA 2GK0B 5DQ9B 1J5OL 1DLFL 5TPWH 3SDXA 3BN9C 3N1FC 1CXFA 5GGSY 4RMUA 2Y6SD 4RMTA 1TETL 4GMTL 4UIKL 3SKMA 2MHAB 3TFKD 3KXFB 3MV11 4XHQA 3OSKA 4G9FE 1MCWW 4UOW0 2X44D 2ZKHL 3HZVA 1T2XA 5E00B 4OZ4A 4MCZA 4HWUA 3MLYH 3QUKA 4UT7H 2JCCB 3PDOA 4NIKB 2R23B 1FVDA 2XA8H 4I18C 1DTUA 4RGOH 1SQ2N 1VGKA 4HC1A 2OM5A 1W8OA 4QWWD 3MRGA 2FEEL 4PJEA 4X6DF 5DHXB 1GZQA 4NM4L 2EDXA 1N6VA 1ZKAA 1J1XH 2CUMA 3HNSH 4OD1L 3VRLF 5D7IF 4U6HB 3NCBB 4NP4L 3C6LC 3LB6D 1IGFL 3OKMB 4C56D 5DMJB 2N4IA 3BW9A 3IF1A 4ERSL 1JN6B 2AV1A 4RZCB 1Z5LB 2VXQH 4P2CG 3IDGB 1U8JA 3U7WH 1CXIA 3LKSA 4H26B 4KMTL 5KZCD 4G43A 5M94B 3X3FH 4D9LL 3QQ4B 3TPKA 3CNKA 4MGXA 4RWHA 4AY0A 2ZG3A 4UT6L 2YN5A 3ARWA 4YR6A 2DTML 4GW1B 4OIIL 3D85A 4UIMB 2D7MA 1MWAA 3KPMA 4CJ0A 1ACYL 1S9KC 1B4JL 5KS9B 5TFSL 3ES6A 3AREA 1JFQL 2AJVL 3MRFB 1TNMA 1FNFA 2FGWL 4PJFF 4Q9CA 5BZWB 5HXMA 1F11B 3OX8A 3OF6A 3SDCA 3O0RH 1HKLL 3VGDA 1UA6H 1OD9A 5I8CA 3O2VL 1NBZA 3R0MA 5IWLA 4YHPB 1L7TH 4L4JA 3FJTA 3GK8L 1T83A 5FF6A 1RZ7H 1MY7A 3H8NA 3MODL 4YDVA 4WWID 1S7WB 1TVBA 4X6DE 1DBAH 1M7IB 4Q0XL 2ZJSH 5BW7A 1LP9A 1GGBL 5IJVA 4PRDA 5D7IE 4ZAKA 2MSPA 5L6YH 2AAVA 3MBED 1YNTB 4KFZC 5HHNA 3BRFA 2AGJH 2ERJC 2NQCA 3L95B 5F9JA 5FO9A 2HRPL 1YEFH 4JFOB 4HUMB 3BD3A 3ARFA 3L5IA 3QEQE 1CBVH 3H0TA 1KOAA 3OKYA 3TNMB 4PFEA 3BO8B 2V6HA 3O3UN 4OQTA 3UYRL 4A2MA 4WHTB 4JO2H 4EXPX 4DTGL 2C4FU 5FKPB 1CGWA 3GBNL 1UH3A 1OLZA 1KIRB 1P6FA 4LEXL 2PYEA 3RZCB 1KIQA 1W0WB 2VXVH 1PG7H 2VDPH 3MXVH 4JVPA 1VACA 5IT2L 4EKXA 1HE7A 1JK8A 3VXRE 1EV2E 1Z9LA 1FN4A 1N0XH 3MJ8A 3C09C 4PJFE 1X5FA 5FO8B 4E9LA 4R7DA 3OKEB 2VLRB 4OCSH 4P2RA 3RGVA 3C8DA 3CGTA 5E1AA 4L4VE 3H6JA 3KPRD 1N0LA 3QH3A 4HGKC 1CLZH 1XIWA 2Z35A 5D2NB 1JWMA 3BPOB 3CXDL 5SWQB 1HINL 5GS0C 1ZLVH 2DIAA 4IIQC 3H9SE 5CINH 2YA1A 1YPZF 4YXKH 1BGXL 4QRPD 1U3HC 4S1DC 5DD1H 3N0PB 5C8JA 4UBDC 4XX1G 1NEZG 4U6XA 2ZZUT 1NCNA 1LO4L 2V5RA 2VABA 4HT1H 1OT2A 3V6OA 5KVEH 3KYMA 5F9WB 35C8H 5HHOA 3MACL 5I1DB 2Z9TA 3PWJB 4RGMB 1OM3H 3D39D 3MNWB 4UDTB 4JKPH 1HDMB 4ZTOH 5FYJU 1D6EA 5DJDB 3FAXA 2B0SL 2NX5B 4HPOH 4XP5L 3ZKNC 3V4UH 4X5WB 4G8FB 5F6IB 4PJ8A 3VXSA 5JORB 5IEHB 4DZ8B 5TPWL 2XTJE 3HI1A 3FB6B 1DQQA 3BYYA 4XBPB 5FGCB 5GS0D 5EPMA 3T0EC 2PTVA 2EIDA 2DM3A 3PQYE 4NRXA 2QQQA 1U3HD 4S1DD 4Y5YA 4UBDD 4WENB 3QXDB 5KSAC 2RQ8A 3L7EB 5DJYA 2GFBB 2I5YL 1YDPA 3VD3A 2BSRA 3MLYL 1YJDH 3HC0B 1HOCB 5ESAB 4X5XB 4DGVH 2XA8L 3HTLX 4OD3H 1NMCC 4QGTA 2BVTA 4RGOL 2OP4H 2A73B 3HG1B 4X9IA 4Z5RA 2CIIA 4TVPH 4Z77A 3I6LD 1XZ0B 1YEKH 3ZKND 3O2DH 2NXYC 4PGBA 4PBXA 4EI6A 4HPYH 5GISH 1TJGH 3MBXH 4RIRB 4NNXA 3SKJH 5C9JA 4X9GA 4N1CA 4QNPF 2IPKA 3T0ED 3GMOB 4Y8DC 1I1YB 1I3RA 1Q9WB 4QRRD 2VLME 5ACLA 1QSEB 3U7WL 2DAVA 2F19H 1GCFA 2LV4A 2DDQH 4FTVA 5HDQH 2IG2H 4HLJA 4JDTL 3UJTL 1MAML 4K3HA 2B39A 3QDJD 3O11B 5JXEC 5D96B 3S3JA 4K9EC 4LLVA 5KAQF 1S9YA 2P8MA 2UWEF 1KBGH 2QEJA 1BFVH 3MLZH 2FIRT 3AU1A 2UYLB 2NXYD 4NO2A 5EOCH 3H42L 3U36A 3FCTA 4HDIA 1BD2E 1BIHA 2VR5A 3LKNB 5I73B 3KWWA 5CHNB 1UA6L 4XGZA 2GJJA 3DPBA 3L3JA 5C0BD 2V2TA 4LVNB 5EC2B 5DFWH 1FVEB 5AWNH 1HHIB 2CRYA 1RZ7L 5JXED 2YRLA 4FQJH 4YE4H 4N0YH 5C6WH 3C5SB 4NC0B 1DBAL 5EB9A 5DLMH 1H3WM 1X5JA 3RL2A 1TTUA 5LQBL 3CFKA 1YEEL 4ZO6A 3IDUA 2AGJL 2OXHA 4M5ZH 1C7TA 4HS6A 2IADB 2K9UA 3HE7B 4GKNB 4ZPVA 1JZ8A 4RWYL 1YEFL 1CXKA 2YD9A 3MRDB 1YEHL 1AXSA 4NZRH 1CBVL 3BH9B 5ALCH 3AB0C 1WT5A 1QHOA 1F42A 5JA8B 1QQDA 4JO2L 3W9DA 5ADOL 2EYTA 2F54B 3O2WL 1MJ7L 2UWEE 2VDOH 4FG6C 5CCKH 5BJTA 3PWVB 3O45A 4FZ8H 5IB4B 3NIGE 4GQ9H 3P0YL 5CIPA 5EFIB 3D3VA 4HUWA 3IFLL 4KRPB 4YHIB 1N2RA 4PRAA 3JWOH 3VXPA 2VDPL 3NFNB 2P4AB 4XPTH 4G6FB 3BZDA 4XMKH 5F44A 1F4YH 3IETA 3KPLB 1MVFA 5J8OA 1R3LA 2FJGA 4MJIA 3E3QC 4YWGH 5HI3C 4X80L 2IALB 4OCSL 5C3TA 1TVDA 3QIBA 5JMRA 1G6RL 1O5DT 2GJ6E 5GRUH 2ARJB 3SQBA 1A6UH 1AKJA 6FABH 4MNQD 5I15H 1MJUH 2H2PC 2ZCLH 3EYSH 5D7KD 4FG6D 2YPKB 2Z31A 1FE8H 1NCTA 3A6BL 5D1XA 1T89C 3ULUC 3FFDB 5C0IA 4IMLB 3QDMD 5DD1L 4YPGA 1CFSA 4XPGH 2BY0A 3KXFD 4NBXB 1A9EB 3GBML 4JR9H 4NFBA 4G8IA 4DW2L 1IJ9A 2XXMB 4F57L 4F58L 4HT1L 3U4BH 5B3NA 5HI3D 1CFVL 3RRQA 5L0QC 1T20B 1KCRH 2P5EE 1AIFA 2DYPA 4GFTB 5KBNC 1WCBA 35C8L 4MNGA 4PJIF 5F97E 5E2WH 3UJJL 1FPTL 3FT3A 1QBMH 1IARB 1IZKA 1DJSA 1Q38A 2Y7QB 3CFBB 5TDOB 4PJAA 3QEHA 1NUDA 5K9QG 4HPOL 3HZKB 2G9HB 1T4KA 3V4UL 4ZMAT 1QYGH 2IQ9L 1Q94A 1I3UA 3ULUD 5C2BH 3X17A 4PJDF 3T2OA 5TE6H 1H8SA 5DWUH 4UV4L 1NCAH 3ARVA 2VIRA 4O5LH 1F3RB 5EG6C 3T8XB 2ZUTA 1MCKA 4JFYB 5KW9L 4D0CA 3HNVH 5E99H 4D9RE 4ZOEA 2VLKA 3SCMA 3D48R 4OD3L 4OJFH 3BPCB 1A1NB 4U3CA 1YA5A 3SQOL 4TTGA 1R6VA 3SDAC 4TVPL 4Y2DC 3F7VB 4PRHB 4HUVA 4GAGH 1FHGA 3LSOB 3JWDL 4M1DL 5GISL 4UU9A 1BJ8A 1HNGA 2DQHL 1QFWH 2D31B 3MRCB 2RHEA 2XZAH 4X4XB 5DQJA 4HUXB 2VXUL 2DQEH 4PTTA 4KKBC 3FFCA 5C09A 3MV8B 3S6CA 1KT2B 1LDSA 3I6KB 4M00A 2PO6B 1H8OA 4PJ5A 5I0DA 2DF3A 2IG2L 5TQ2H 4PJIE 1QRKA 5D1QA 2RCSL 4BZYA 4I0KA 4GKSA 5IVXF 1RUAH 4ISVB 5IOPA 1E4JA 1F4HA 2FR4B 4ZFOB 4DZBB 2JIXA 4PGCB 3SDAD 4KJWC 4Y2DD 1ORQB 5D7JB 5B8CB 2R29H 4DKDC 4K2UL 4TNWF 5EOCL 3OXRB 4F7MB 3KJ6L 1F58L 3TBSA 5IFHL 1YN6A 2WBJA 2EDTA 1RV6X 1CVSC 1VHPA 2YRZA 4Y4FC 4Y19A 4KKBD 2ITDA 1FNSL 3MYJA 4GG8B 2W9EH 4X6CB 4L29A 3MRHB 2YPLE 1EAPB 3BQUA 1J10A 4LPVA 4ZUUB 4HD9A 4PIRF 5F1KC 3BPOC 1ZLUK 4X8JA 1RURH 5DJZA 5HGHB 5JW4M 3VG9C 1G9ML 3M1BA 3TJHC 4ZFGH 2AK4E 3QSKB 2OTUB 4X6FB 2WINB 1J8HA 1U8KB 2E9BA 5BS0E 3B3IB 4I3SH 5I6XB 4I0PC 1H3TA 5T5NG 4FN0A 3X3GL 2R2HA 4Q2ZA 5J13C 3IRZA 3SGEH 4YFEA 3WIHL 4WW2A 3C5ZC 4KKCC 4Y4FD 5ANME 4PJHF 5L2KD 4HKZA 3I75B 4OB5L 5JHLL 5IROA 4Z0XB 5CP7B 3DOSA 4NC1C 4DUXA 5JR1H 4O2CA 3D0LA 3WHE0 3SDYL 4BFBD 1AP2A 3OZ9H 3GSUA 3V6FA 4J1UA 3GO1H 5SWSE 3EO0B 3TJHD 1U8LA 5HHQA 4BQ8A 5IR1A 1K4CB 3HAEG 4UTAL 2QTEA 2H26B 3IFOB 4XPTL 5J6HB 2IAMC 4I0PD 1F4YL 2P46B 1I4FB 4X7EC 3KYNB 4YWGL 25C8H 5FK9B 2FBOJ 5D2LE 1PD6A 3GMPA 2IFFH 3PHOA 5BMFH 3MX0A 2Y5TA 2D7OA 4GKZB 2R1XA 4XCYB 5GRUL 6CGTA 2O5ZH 2R1WA 2FIKA 1FV1B 5KVDH 4MXWH 4OV6F 1MJUL 5GZNC 5GSRB 2P5WD 2F5BL 4JRXE 3VGAB 1FE8L 3N1QC 1AGFA 4HS3A 1UKQA 4PJ7F 2EE6A 3PV7A 3DVGA 1J0YA 4AENA 5EOCJ 1EZVX 1WBXA 1H3PL 4XAKD 1QLEH 3FO0H 5HYJA 2GTWB 4EN3B 5DVMA 5DZNA 4Y5XA 1JNHA 1DZBA 5CGMA 1ZTXH 3MV01 2OZ4A 1NBVL 4HWBH 4ZSOB 3U4BL 4WDIB 5HHVL 5JPNA 1FL5B 4YBQD 1DLHA 3WO3B 5GRWA 1U8PA 3VFRA 3CVHH 2GSGA 4HMEA 4MDIA 2F8OA 5AUMA 4IEFB 5CGTA 5IF0B 1IM3A 3HG1D 1QBML 1YEIL 4X99A 2ZUVA 5FYJL 4KXZI 1YMME 5T1DH 3M07A 2X4QB 3ULSA 3VWJB 2V9TA 2ESVB 4S2SA 3KJ4B 5GZND 1JBJA 4S1QL 2L0DA 1QNZL 4P5TC 3TP4A 5FCUH 4L8SB 4R0LB 3VXTA 5TE6L 3SE3C 1IC7H 3TIEA 3EYOB 3MLXL 2R56H 4KHTH 1NFDB 1CL7I 1NCAL 5IIEB 4O5LL 5HYSB 3W81A 2A0LC 2HFTA 4JHBA 1IGJB 3HMXA 5E99L 1X4ZA 4FQ2H 4AEHH 4UQ3B 4XCFL 4Z7UB 2HT2C 1EFQA 5CJQH 2XOTA 3HZMB 4MAYC 3GSOB 2NY5L 5CEZD 1J1PL 2WANA 4LLDB 3V5KA 5KSBB 4G80A 3QCTH 1CGTA 5I1EH 5HI4C 2XZAL 3I6GA 2C3GA 4JM2B 4YDLC 1A2YB 2XA3A 3CVHB 2DQEL 4K94L 2VQUA 43C9B 4YBLB 2OS7A 5I2IA 4LQFL 5AZ2L 4ETYA 2GCYA 2B20A 4KRNA 5F70A 2A0LD 4LLYA 5TQ2L 1WZ1H 1FL6B 4MD0A 1RUAL 2JK5B 2GITB 2VQTA 2FB4L 3PV6A 2R69H 2HT2D 5E4IA 4ZFZB 3KYKH 3E6HB 4QY8B 4Y4KA 2R29L 3I50H 4URTB 2HH0H 2LFGA 4Y5VB 4P99A 4G9FA 1WICA 2JJTA 2NW2A 5E8NB 5TE7H 3O6KH 4X8XA 1OQOA 1EUTA 1XF5A 3MRIB 5MEND 1MJ8L 5GIRA 4NO3A 1I8IB 4P9HH 4DVBB 3P30H 4CN6A 4QHNB 1G7PA 5CBAA 5KVFH 1AJ7L 1U3ZA 1OAUL 1DBJL 2BX5A 1RURL 1DQDL 2GAZA 2RJMA 5CJXC 2I26N 2DJUA 4ZFGL 5FM8A 3QI9C 4AMKL 5C6PB 2PTTB 4MZ2A 1S5HA 5T3XE 3Q1SH 1FFQA 4UOW1 3T3MF 4M7ZC 3J8F7 4I3SL 3OJ2C 3ZKXC 3IAPA 2VB5A 5IB3B 2NR6C 3DECA 2D4DA 3NPZB 5CSGA 1ZT4B 1KGCD 4KK6C 3V7MA 2AEQH 3HHRB 2NY0B 2W91A 1I3VA 3OKNA 4H8WH 4UQ2A 3V4PH 1GZPB 1WLHA 1OF2A 1TTGA 4NPYA 4XAWH 1T1XB 3QFJB 3RY6C 3TN0B 1ZANL 2XWJA 3U46B 5ESQA 5E0QA 5KS9E 1T1YA 5I75C 4IOSD 3OZ9L 4PV9B 1OL0A 3M17B 3GO1L 1JZ4A 2A74A 1RK0B 1XMWA 1MLCB 1JGDB 2HG5A 4H0IA 3MCKA 4NFDA 5T1KD 5FOBA 5DSCA 5F1IB 4OT1L 3VFNB 4PREA 3ARRA 1YUHA 1VA9A 3KGRA 3VCLA 1KCSH 1UWGH 3ABZA 1L7IH 4WUUA 1T80A 2I9LA 1ZSDB 4WFHE 2YEZA 3GSWA 4KK6D 1XR9A 4K7FA 1AGBB 2IFFL 2D0HA 4NO5A 3DX7B 5GJSH 3K7UA 4R97B 3FO1A 4X6DA 2FH6A 1J0IA 1NAMH 2O5ZL 2QQLL 4UMGA 3G9VA 1E4XH 5D7IA 3B4NA 3MRJB 4MXWL 4YJZL 4FQXC 3AM8A 1HZHH 1E4WL 3G08B 3T3ME 3LEVH 1QR1A 1OP3H 1JZ2A 3SHSA 5LXGH 3WJJA 1QLEL 3FO0L 4PBVC 3QEQA 2Q6WB 4P23B 1IEBA 1U2CA 3WJLA 2PO6C 1BAFH 4E0RA 5F7EH 1ZTXL 1QPXA 5HPMB 1S9WB 4Q9RL 4HWBL 1AI1H 3WDIA 3DUHA 3JXAA 4YFDB 3MRKA 1PKQB 3BPNB 1NKOA 5EORH 1HK6A 1U91B 3P9MA 5ENWB 1DBKH 3BWUC 4PRHD 1KC5H 4OLYH 5HVHB 5T1DL 1UYWL 3F5WB 1NUNB 4XC3H 4FQXD 1IBGL 3VD4A 1I75A 2DQGH 3WCYA 2K7PA 3DURB 1HHJA 3MOBH 4OGXH 3VXRA 5IEKA 1XF2A 4H0GA 4JFDB 2VLRE 4PJFA 5FCUL 1TTFA 4KGLA 3NABL 2BOBA 4KHXH 3MV8D 4XXDA 4C59B 4L4VA 4W6XB 5AYUH 1H15B 1GOHA 1DE4B 2C7UB 2PO6D 4XNXH 1HXMA 3W0WD 1R24B 1SVCP 1NAMB 4LOUC 4LCUB 5D2NE 1XF4A 2BNUA 4M7KH 3WN5B 4HXAL 3S4SB 4YQXL 4LHJB 3HB3C 3FB8A 4BJLA 3W2DL 4PTUB 3H9SA 4P3CL 5GGQL 1OGTB 3BPLC 5D7JD 4Y1AB 4PGJA 4JGMA 2WP3O 2MPAL 4ODUB 1CR9L 3ALXA 5M7QA 2FDBP 3ECBA 2ZOLB 5JNYB 3QCTL 5I1EL 1XGQA 3K4DA 1RIVH 4CVXA 4M5YL 1KPUB 3QO0B 3HE6B 3NGBB 2WIIA 2IGFH 4O58H 2NX5E 3D18A 5CD5C 4KI5C 4YPJA 2Q76B 4LOUD 1XEDA 4MQXC 2FD6H 2VN7A 1G9NC 5FGCE 3DI2B 3GIVA 1D5BB 4Y16A 3OJVC 2EEDA 3O6FB 4I48A 2DIJA 1UB5A 1MFAH 4PJXF 4BYHA 3GJEB 3ARDA 3SPVB 4AIZA 2Q8BH 4MJ2A 3O6KL 4ZUSB 2EO9A 5JOFA 2OYPA 1S8DB 4NCC1 4J12A 1RZFL 4P9HL 4QRQA 3P30L 4KK8C 4UDUB 2NTFA 4YK4B 5SX4I 4X6BA 3RY4A 5CD5D 3BKMH 3CXHJ 4KI5D 2FECL 5FYKD 2FWOA 1OAXL 3RWIA 5C9KA 4GW4B 3LEYH 3DGGB 4KROC 4C4KO 2WWKT 2ITCA 3JZ7A