3TH4T

Mg2+ is required for optimal folding of the gamma-carboxyglutamic acid (gla) domains of vitamin k-dependent clotting factors at physiological ca2+
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
205
structure length
191
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Coagulation factor VII light chain
publication title Mg2+ Is Required for Optimal Folding of the Gamma-Carboxyglutamic Acid (Gla) Domains of Vitamin K-Dependent Clotting Factors At Physiological Ca2+
rcsb
total genus 44
structure length 191
sequence length 205
ec nomenclature
pdb deposition date 2011-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3th4T01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3th4T02
5FA4A 1IBGH 1S5HA 4CMMA 3GHEL 2DQIH 5D8JH 3IKCA 2NY1B 3N85H 1BD2B 5FYKL 1U8KA 5E2WH 1EEZB 4MHHG 4MCZB 1KNOB 1WWBX 2R39A 3L1OH 5D6DA 3WJLA 1OTTC 1F3JA 2WP3T 3NFSL 3OQ3B 5GXBB 3OZ9H 3DXAE 4FFWD 4K71C 4XNQA 4XWOC 5I19H 4NFDA 1ZE3C 1AGDA 4XCNA 3P11L 3K4ZA 5C6TH 4LDOB 4XCCL 2ENSA 4I18B 3EO9L 5CD5D 3DYOA 3G04A 4WFFD 3U9PH 5ICZB 4P2OD 5FOBB 1TZIB 5B8CA 1QEWB 1T20B 3M1BA 1RIUH 4P5MB 5GGVL 3VRLE 4OIIL 4FQQA 5KVGL 4LRIA 2IG2H 4PRHB 5FYKE 4P4RB 1RZJH 5HY9A 4YAQA 1J1OL 4FQJH 1F6AB 1Z9LA 3D0LA 5INDA 4JB9H 3PP3H 3GSQA 3IJSB 4PRAA 1J05A 2DBJA 5F8QC 3CDGB 4ZS6D 1OW0A 1AY1H 1N5AA 3BH8B 3ES6A 5J11B 3DVIA 1JNJA 1LP9B 4HULB 4BZ1H 4LRNH 2I9LB 5EZLA 4ELMB 4YBQC 4XH2B 3ULUF 2EXWC 3MLZH 4YBLB 3PNWA 3PWPB 5GGTL 3ARDC 1T4KA 3MLUH 3KS0H 3MLXL 3QO0A 3ARZA 3WS6A 4Q2ZB 4P5TA 3SE4C 4W68A 3D69B 2NPLX 4NN7B 4S2SA 1SM3L 1WFNA 1SMOA 3CNKA 3KPNB 2P5WB 4K8RL 2K7PA 2C1OA 1I9JL 4EJ1C 2XICA 4G3YH 4WW2C 1R24B 1YUHA 3VG9B 1X6NA 4DGYH 2OXHA 4M43L 3PP3K 3LB6D 4MZ3A 1ITBB 2DM3A 5IT2H 1ZA6B 5EPMB 3RY6C 4LEXH 4YC2C 1G7PA 1MWAL 4U3HA 2DDQH 2NR6C 3BKCL 3KPOB 1TCRB 1IEAA 1N64H 3D25A 4X7DC 2BRRH 3T2OA 2D7PA 5JXEA 2BVQB 4KC3B 2APBA 3DMMC 2HMID 1TTUA 1YN7A 5EN2B 3GMLB 2G75A 5BW7C 2R0KH 4E0RB 1Q1JL 4C57C 2AK4A 4KDVA 4FFVC 4UOJA 4OFYA 7CGTA 3EJJX 5KBNC 1JCKA 2PW1B 4P5KB 3GSNB 5KS9E 1FO0B 2YS4A 1DUZA 4Y2DD 2A77H 1OAQH 4R96B 3P9WB 1DVFD 2NY5C 5SX5K 1S9YB 3RY5A 1DJSA 1WQVT 3QUML 4ZOBA 2P46B 1A8JH 1DBML 4XCFL 3LSOB 2A1WH 3QJFA 2IH1A 4UUJB 1N6QL 4PLJC 1DE4A 3C5JB 5FO8A 5L2JB 1YQVL 3QHZH 1N6VA 1KULA 4U4BA 4JGJA 4Y19B 1MI5A 1YDPA 3HZYB 1BHGA 3OKEA 3BP4B 2QBWA 1OQXA 3G5YA 3QDME 3MUZ1 2V2XA 1G7LB 5E00A 3D3VB 4MB5A 2E7LA 1IGIH 5E1AA 3U7WL 5HTSA 1QHPA 2O5ZH 4M03A 2IANE 1U58A 4I0CC 4QHLA 1T1ZA 1T1YA 5ISZA 4LBEB 3UPCA 4RISL 4JQXA 2C7UB 3JV0A 3ECBB 1PSKH 5M95B 1MIMH 3M07A 3MR9A 4WHDA 1LK3H 4M6MH 4GMTH 3ARGD 4CNIA 3O6LH 4GQPH 1P84K 2Y06L 1HCFX 4MB4A 3BP7A 2FX8H 4JKWA 2Q7YA 1T83A 3MRLA 2HJFB 3PUCA 1F3DJ 2QL1A 5AWNL 4DKFL 3MZTA 4ZUUA 4G42A 4KRPB 3BIBX 1DQMH 4HH9A 1ND0A 4QRQB 3U7AA 5A3ID 1QSFE 5BJTB 2PXYC 3GJFB 3U46B 5J1SC 5EZIH 1NAMB 4KKBD 1RUPH 5HGGS 3VXNA 3H7LA 1D5XB 1QRNE 1A3RH 1KENH 5I8EA 4O4YH 1YY9C 2ICWB 4HEME 2IH3A 3BZFB 1H5BA 1ORSA 4OKDA 3FFCB 3WFBH 5BS0D 1BZ7B 2VZ1A 4ERSH 3H3PH 3S7GA 2VSCA 4HKXA 1EO5A 3CK0H 2QLVB 4JHZA 4U1HA 3ZYOA 3P9LA 4LVNB 4NQVA 4U1SB 1OD9A 1JPTH 3QEUA 2B20A 3ILPB 1S3KL 4UTAL 1V7NH 4LLDA 3RNKB 2Z92B 3JZ7A 4JJHA 5IB3B 1WZMA 1CQYA 1JZ8A 3FB6A 3HPJB 3O4LB 3O9WC 5EC1B 5F3HB 3WL9B 2X2YA 2B7DT 4NOFA 1QG3A 4PBXA 5AAMA 4JG1H 1YQ2A 5E0QA 4HX1A 5CD3A 1U8MB 1KEML 2VXQL 4TVPH 3RUGB 1VFAB 5C09A 3TJEH 2KQMA 5FM5O 1EEQA 4LHJB 1DVFA 4K3EH 2E7CA 3MRQA 2P5EB 4MD5A 5B3NA 1EDQA 5IMLA 2FSEB 4N9GA 2FX7L 2EIDA 3MRPB 2A0LC 2QR0B 1AQKH 4Z76A 1BX2B 2EDXA 1CICB 5K9JL 3F7PC 1T5WA 4AT6B 1BVLA 2ZKHL 5JTWA 4MD4A 4DN4L 5F1IA 4KTEL 5CP7B 1UVQA 3FO0H 4OQ1A 3CLFH 4PJIE 4WWKD 3CMOH 3O8XD 4HMEA 1J5OH 5D5MF 3EJYC 1IL1A 3DO7A 1GOGA 3CFDA 4J3OC 1B0WA 3ZZ1A 2XG5A 4JFQB 1INEH 2IAMB 3DIFA 1S9VA 1TENA 4I13B 4I0KA 2VNCA 3S4SA 5IGXH 1V8HA 3T0EC 3D18A 3E6HB 3EYQC 2NY0D 3KGRA 5T3XD 3ZHLA 4IOFD 3B9EA 2YPVL 2NX5B 4X6CB 2DQTL 2XRAL 3O6FD 5F6HJ 2EXYC 4DKEL 5E4EC 5GSRA 5HVWA 3UTQB 1NFKA 5FUCC 3T0WA 1UM4L 3B9KC 1N7ML 1MH5B 1LEGA 5DVOA 1FG9C 2A6IB 1Z9OA 5JO5B 1MEXH 4KUZL 4U1NB 1WVZA 2O61B 1B4RA 5J6GA 3ARGA 2BC4B 1FC1A 3RU8H 4F37F 4WUUB 4Z7UA 3IRZA 3AREA 4X7SL 4NQCD 4I3GA 4EOWH 4X5LA 1SYVA 1JUFB 4ODSH 4ZOEA 3KPQA 1YPZA 3VFOA 1DBJH 2ATKA 2HVKB 4LFHD 5FECB 1QR4A 4JFXB 3AXLA 4WCYL 2AAVA 3Q1SH 1RK1B 1ZT4B 3REVA 4L8BA 3LEYL 3SGJA 1RHHA 5A16A 4U7SA 2GAZA 1YN6A 4FNLL 3MRJB 1EZVY 15C8L 1EIBA 5E6ID 1U92B 3L3GA 3OMZA 2VDKH 4M9OA 4Y1AA 3NTCH 3MGAA 1IAMA 1HXYA 3EO0A 1KCUL 4K9EL 4KRMB 1KT2A 5KSAC 5IF0A 2RGSA 5T33H 3DOSA 2Z31B 1TZGL 1MF2L 5F7WC 4OUOA 3TV3H 4ONOA 3EO1B 3KYKH 3FO9B 2ADIB 4PTTA 2B0SL 4AM0B 1NMCB 4J3SA 1FIGL 2ADFL 5DRWB 8FABB 1R3HA 3RFZC 1S7XA 2YC1A 3KVQA 4JO1L 5LXGL 4Y5YA 4LSTL 2Z8WC 4O58H 4YDVA 4KK8C 4LSUL 1JHTA 1HOCA 3E3QE 1I1YA 4U0QB 4RMQA 1QPPA 5I1EL 1P2CB 4P23A 4KQ4H 4G8GA 5HVGB 4WJ5A 2N7BA 1JZ5A 5HI3D 4JAMA 4PJIF 1N0XL 2XKSA 2UWEF 2NW3A 3MMEA 5EOTB 1GPOL 4PIRF 4Y7MA 3MV7B 3DBXB 3KLHC 2Y7QA 3VXMA 1JP5A 3NCMA 4I0PD 1MFCH 2IGFH 1HHIB 4NJAH 4HF5H 25C8H 5HHOD 2ERJC 1E28B 3ARYA 2YK1H 3V5HB 4XX1G 5CSZA 3EJZD 1UYWH 2YPLE 1C1EH 4D3CL 1KIRA 3ZHKA 3X3GH 2VH5L 3FHAA 4JFZH 2IALB 3MYZA 3PGCB 1MAML 5IFHH 2W65B 2XZQL 3G5VA 1UA6L 1FZJB 1DN0B 2CLRB 3TVMC 4QTIH 3FT2B 1ES0A 3LQZB 5I8CB 1FVEA 3MLSL 4ETYA 2JLLA 4IRSB 4JM2F 3THMH 1JMXA 4NC1E 3BEWA 1QQDB 4GKNB 3LV3A 2D0GA 2CDFB 3T0XA 4N8VA 2VXSH 1I1AB 1FNAA 4Y2DB 2YD9A 2M1KA 4PUBH 3VXUA 5T1DH 1YJDC 4CVZA 4P4KB 3PJSA 5T3XH 5DYOB 3SE9L 4ZFFB 4WI4A 1XFPA 5GS0C 1KLUA 1CK0L 2R9HC 1IAOA 4PRID 1P1ZA 3SDCD 3OR6B 1CT8A 1W8OA 5D7IE 4OJFH 1V05A 3WMSA 2WANA 4ODTH 1FNGA 4NQCA 2X4NB 4XNUH 3LVEA 1X3DA 3KXFD 3WFZA 2MOVA 3O2VL 4R9HA 1JNHB 5EORH 5C0AD 3LKNB 4NBZB 5C0EB 1WBXA 3D0VA 4W6WB 5F71A 5FO9A 3LKOB 3RBSA 1XGQA 4JY4B 3D39D 5IFAH 3JVGA 5E6IA 3WFCL 4JDTL 4LEOB 5KOVC 4DQOL 2LE9A 4HK0A 4QCIA 3U30C 4XMLL 2IEPA 3VXSA 3C5ZC 3QXUA 5HXMA 4KAQH 1CE6A 4OZFG 5ITFA 2BVPB 5DUBB 1T03H 1FORL 3GDBA 5JUEH 5TH2A 3SDYL 5IKCB 1KXTB 4GXUM 1A2YB 3ARDA 3BQUC 1OGTB 1WWAX 4HGWA 5F7EL 5IMOA 3D48R 5I1JH 3DROA 3BSZL 2E9JA 1IC5H 1UKSA 2XTJE 5TPWH 2Z4QB 1Z5LA 5F1SA 1MLBA 1NGZA 4EDXB 3MA7A 4HFUH 3PQYA 4QRRA 2VDQL 4HUWA 3AY4C 3CCHA 4PJDA 4WW2A 4MJ6A 3ZL4L 3U0WH 2V7NB 3GEWB 3HUJA 4L4VE 1ZAGA 1DDHB 4GXUN 4AK1A 1YYLL 3GSRB 4DGIL 3NAAL 5MHSE 5KTEH 4M8QA 1BQHA 3RZCD 4H20H 3C09B 5K59F 2E8YA 2B4CC 3TBVB 2R1YB 2EDKA 3RAJH 2RFXB 2FL5A 2PR4L 3F5WA 3AAZB 3ULVD 5CCKH 4TUOA 2GCYA 4RAVA 3KPPB 3CZFB 1T22B 5BCAA 4ZPVA 4I0PA 1DQQA 3W0WE 1Q9KA 3KJ6L 1E4WL 1T0NA 2MNUA 3GMMA 3KPTA 2HLAA 4MQXD 2R2BA 4L3CA 3T65B 3L3JB 1A5FL 1QFWH 4OZ4B 1NFIB 3F6LA 1KTLB 4R8WH 3HI1A 5BW7A 1ADQL 2HT4C 4HLZG 3MSPA 2F53E 4BZYA 5HHMB 2I07B 4U3CA 1FZMA 1Q9LA 4KMQA 1KYOJ 1X5GA 3JTSB 4YK4B 1IFHH 1DBBL 4UIKL 4YLQT 1CI5A 2CD0A 3ARWA 1C8PA 1EAJA 1L6XA 2A6JA 4NO2A 4Z5RB 2NQCA 2X44D 5D72L 5TF0A 3MBXH 1JRHL 5CBEA 2ZSWA 1M71A 3O2WL 2H2PC 4F58L 1CXIA 4N8CL 1VCAA 3QXAB 1LDSA 5BRZD 4MQ7A 1C08B 4PRIA 4GW4B 3QWOA 3WIIL 2R2HA 5AD0A 3SDCA 2C3VB 2Z9TA 1QVOA 4ZO9A 5C6PB 5C2UB 1QBLH 1JZ3A 4X5WB 2QSVA 4M5ZH 1G7JA 4XBPA 1AI1L 2Q20A 1TETH 5JOFB 1UEYA 4EZMA 2A9MH 3WDHA 1RUAH 4WWKB 4NM4H 1PLGH 3QH3B 1I3VA 3OBAA 3WD5H 4ORZC 5C0AA 3HC3L 3ZT6A 2NY7L 3MX0A 1YYML 1EHAA 4KDTC 1B90A 5DZOA 4PB9H 3PWNB 1CXEA 2PW2A 3RPIA 4OGZA 1I1FB 2UZIH 4OSUH 4NM8H 5DZLA 3BO8B 2HYMA 2Q8BL 4C55A 3RVXD 5FCUH 3MFGB 4C56D 1U36A 5IROC 1JGLL 1P4LB 3DVNB 5MEQB 5GIRB 3K1KC 1FZOA 1LGVA 4URTB 3IXAA 4Y4FC 1KN4L 2B8OT 1KC5L 4L9DA 2PYED 1YJDL 3G5XB 2X4OA 3V6FB 1CFNA 4WTZA 5GS0L 2IBZY 3OHXA 1VEOA 3EOBA 2ITCB 2ZG1A 4GBXD 1EA9C 4M3KB 1MRDH 3NCCB 1A6AB 1FNFA 4KDWA 4BFIA 4GAJL 4D8PB 2NZIA 3QUYD 1H9VA 1S7RB 2PXYA 5JOPE 4DW2L 1ZWIB 1IEBB 4JPIA 1OB1A 3MOQA 5K9KB 2GYSA 4XRCB 1ZVSB 5EO9A 1NMBH 2NXZC 4PGCB 4PV8A 1P6FA 3ROLB 3VFGH 4XHJD 1NCAH 2VE6A 3QFJB 3TO2B 4ODVL 3QIWD 1Z3GL 1AP2A 5HHQA 4H5SA 3VXQB 5BV7L 4G9DA 3DGGB 2LVCA 4M1CC 3INUH 1DP0A 4NCC2 3IXTB 1FE8L 3PABB 5SWZD 4P2RB 5E2VL 32C2A 3S96A 3ULVH 1U8JA 4LASL 3O9WA 3S3PA 5IB5A 4X9BA 2G5BB 1K6QL 4XT1C 1KJVB 4NBYB 4Q9CA 3DX6A 1MIEL 2ESVA 5E8DH 3U0TA 3S97C 4JQIL 1JFQH 4CAGA 2BOCB 2AABL 4PLKD 1VKXA 5GJTH 4OFDA 4UI2A 3JXAA 1X7QA 2AEWA 3FQUA 5IW6A 1BAFL 5SWSA 1FCGA 4GRLB 5TE7L 4JFFB 4TNWK 3T8XA 4IHOA 4WO4B 3T3ME 3GMOA 4RFNC 3MRHA 5BRZA 1HH6A 3BN3B 1BQUA 4OZFB 2BY2A 1Q0XL 3IFOB 1KG0B 5E5MA 4NRYA 4BH8B 2R1WB 2J12B 3BP5A 2C4XA 3P73B 4QHMB 4V2CB 4YGAB 5IHZB 1IM3A 5FHAL 4I2XA 3V0VA 4G7YH 4E5XA 1QO3B 3SCMD 5J0BA 1T7WA 5DS8B 2ATPA 1NL0L 4NKMA 3T0EA 3FO1A 3AUVA 4HW6A 2VAJA 4AG4L 4CVXA 4L8SC 2ZG2A 1TJIL 4PJ8D 3ULSB 1ZT1B 5CJ5A 3MOAL 5DO2D 2WNGA 1I9IL 3C8DA 3LMJH 4L3EE 5T3ZL 3W2DL 1CLZH 3J8F7 3QB7C 3BN9C 3KYAA 1NC4B 4GW1B 4UNTA 5I1CH 1TPXB 2CR6A 1HKLH 3HNVL 3B9KA 3WFHA 5I74B 5F3BB 3HS0A 1O7SA 2XPGA 3ZKMC 2DM7A 1Y0LA 1MSPA 2RJMA 3PGDA 3RVTC 1Y18B 3UCRA 2DQCH 1MCEA 5B38A 2V2WB 1NFDB 2HFTA 4KH2A 3EFFB 1NGWA 4PRPA 3L5XL 4LF3B 1K8IA 1N0LA 3BMWA 1D9KD 5TQ0L 1G6RB 4QWWC 5DDHA 5IQ9A 3QDGD 4X4ZA 4EN3D 4P2QD 2EDLA 4R26H 5LGJB 4UINL 1ED3B 1Z6JT 3QUYA 5DK2B 4RMSA 4Q9QH 3RL2A 2Z8SA 5EBGA 3O3EB 5DA4A 1S9XA 3V7AG 1NLBH 2VZTA 4OAWA 4JO2L 2HG5A 4MSWB 4XPFH 4LCCC 4HFWA 2HTLC 4O2FB 1N2RA 1NEUA 1OAZH 3UBXI 2NLJA 2YN3A 4IMLB 1A7OH 1NCBH 4JREC 4D9RE 1Q8MA 3QEHB 5KSAA 1WBZA 4J3UA 2VLRA 2FDBP 2GJ6D 3D39B 2VLKE 4KKNA 3WDJA 4FFZH 4YQXL 5I1IH 2FATL 5I15L 4OZGA 4XP1H 2C26A 4DGVH 2VDRL 5SWZA 4PTUA 5JW4Q 4BELD 3CUPA 4OCYL 5GISL 4M61B 5KVEL 2V5TA 1LE5A 4RGOH 1YMHB 2MTPA 3MJ8A 3HFMH 3MV01 5FK9B 4JLRB 2XY2A 2WLYA 5ESQB 3PV6B 3OXRB 4I3SH 2NY2B 5FM5M 3UJIL 5HPMA 2DQHL 4MA1B 4JFYA 3RI5F 5DA0B 4UU9B 4BQBA 4N1CA 1CD8A 5L2KE 3T3MF 3OKMB 3QQ4A 3HI5L 1VGKB 3LEVL 4NO0B 4C54A 2W9EL 3CFBB 3D85D 5A2LH 4YDIH 4OQTL 4D0DA 3PIQB 5F7DB 1EZVX 1NJ9B 4G9FB 5EBLB 1BEYH 1AQDB 1WLHA 4OFPA 3MLVL 3F7YB 1Q38A 4X9GA 4RBPH 1XT5A 4U1KA 1IKFL 3RZCB 4YPGB 2AI0H 4LDEB 3FQWA 2Y23A 1SVCP 1H3PH 5HHPB 4Y4HC 3AMKA 1CXFA 3ILQC 1HHKB 3SDDB 1M7IA 1KB5L 3M17A 1DLHA 4HK3J 3C08L 4OZIB 4RMWA 5CZXC 2JELL 2AJYH 1CFBA 1XIWB 2ARJB 4LAQH 5D1QD 3G08B 2VLLA 3Q6FB 2Y4SA 1RZIB 4HIEB 4W4OC 2O5XH 3TVMA 1QR1B 4RGND 3SE8H 3N9GL 5CJOL 4MD0B 4OLXH 1YMME 2EDYA 3JWNC 1A1MA 2ENYA 5E9DE 2YUVA 1D5BA 5BOZG 3R1GL 4FG6C 5AZEL 5J12C 1U8LB 4GG6F 3QPQC 4UB0H 1G7QB 4G6KH 3V2AR 5F96L 5HGAA 1TNMA 3C60A 4IJ3C 1R5VB 2WINA 2VAAB 1IQDA 4RWHA 3D6GA 4QXUH 3C9NA 3LZFL 4J3WA 3TT3H 1T3FA 1PKQB 2IPTL 1HHHA 4R0LB 5L0QB 1JHLH 4MAYD 3PV7A 2BOBA 2ITDB 5HHNB 4KROC 1AR1C 4QT5A 4AMKL 1KELH 5F89A 3FAWA 4X7TB 2QADB 4FXKB 2RIKA 4MHHI 4D9LL 1KEGH 4GQ9L 2P4AB 1DBKL 2IPUK 3DTXA 4HT1H 4P2QA 1F02I 1Q9OB 4KJPC 1D5IL 5H35A 1DEDA 1BFOB 3MYJB 1SJHA 5C0NC 3MUGA 3JSSA 1UJTA 4PGEB 4K7PY 3L3DA 3WFDH 1OAUL 4LSVH 1UB6B 3WSQL 4NP4H 5FFLA 1XF2A 3LD8C 1DQDH 2HRLA 1A7QH 3C5ZA 1IGFL 1I85C 3F58H 3LKPB 3NFPB 3AFLA 1A6UH 3MRRB 1PG7X 2PF6A 5DJYB 1XF4B 3IU4L 2KUTA 2H6PA 2VQ1B 3BQUA 1K9TA 1HYSC 3NMEA 5CGMA 4B7LA 4DVRH 4PV9B 1KFAL 4MA8H 1A9EB 5EZOL 3PHOB 3ZT5A 4O2CA 1WISA 2DL9A 3BKJH 2V7HA 2PYEB 2NZ9D 3BWAB 3ZE1E 4E41D 4UDUB 1CVRA 3S98A 3L6FA 3O3AB 3VXRD 4GBXB 4R7DA 5E7FA 4PGJA 5I1LB 3N1GC 3L7FB 1T0MA 2X05A 5DQJB 1GOFA 2YA0A 2OJZH 2YXMA 3K1DA 4LU5L 3CD4A 5E03A 5BMFL 3FQNA 3HPLA 2ZSVA 3WS3A 4JFEA 5BVPH 4Z7VE 3JTTB 1XR9B 5DD6B 1MVUB 1JGVH 2GJJA 4XXDB 3REWA 4TSBH 4JGUA 4JHBA 5I73C 2UYLA 2B4CH 3QIWB 4MJIB 1GHFH 3ULUD 3I2CH 2FEDC 4TUKH 1D6EA 2H1PH 4L4TA 1L0QA 1NGYB 1LO5A 3MJ6A 5J9PB 1UJ3B 4FN0A 5D1QA 5E5UB 1F6LL 1PGRB 3FZUC 4J4PC 4ZQKA 3M45A 4HWEL 1XH3A 1P69B 5MEND 3KDMA 5GRJH 3QG6A 2WBKA 4YUEH 2FYYA 4B0MM 4ODWB 5B4MC 4PJAE 4I9WD 5DRZA 4PJXE 2CMRL 3UTTD 3FB7B 4O00A 4POUB 3WHXB 4LPVA 3D2UA 4MXWL 5I1KL 5E70A 3NCJL 3TPUB 3C5SA 4HUNB 3U6RB 4X5XB 4RNRA 2CLZA 1BLNB 3DRQB 4KPHH 5MI0C 1WBYB 2Q6WB 1ONQB 1JN6B 4Z0BH 4NKDA 1ZLWH 1RJCA 2ZNXA 5I1HL 4HWUA 4PJ7E 3TESA 5EC2A 5GSVA 5F88A 1U8OA 1AC6A 4YJZL 2OL3B 3HE6D 2W0PA 4MA3B 3QBTB 1H15B 5FAAA 1CFQA 1U93A 4MNHB 4MA7L 3V6OE 1S7SA 4XCYB 2DF3A 2P1YA 3SCMB 3QWQB 3FN3A 5IR1B 1UQSA 5CBAB 2R2EA 3WIFA 1KV3A 1YC8A 5C0BA 4WEUD 2MFNA 3BZEB 4JM2C 2EE9A 4AIZA 1ZT7B 1I8MB 4PJ8B 4JFDD 4FQLL 2W60B 3LHPH 4GO6B 5GJSH 4ZXBC 4A6YB 2FBJL 4ODUA 5E2UH 5CEZD 4Y4FA 3K8LA 3L95A 1FVCB 3LN4B 4M1DL 1MCJA 5TGBA 4Y8AA 1BD2E 3JWDH 5EUKA 5CEXA 2UV3A 1PKOA 4U6VH 5F9JB 1ZLWK 5EOCL 4F9LC 2DTSA 5ACZB 2YPKB 1ACYL 4NC2B 4R3SA 4HBQA 1YNKL 5BXFB 4G8EA 2G9HB 4ALAL 5JLZA 5FYKD 2CRIA 4C83A 3WLBA 4ZDHA 1G7IB 3I02B 3DI2B 5FGBA 5HJ3B 1XF5B 4LQ1A 4OLYL 2D0HA 4ZTPH 4MDIB 2EYTA 3DWTA 4PRNB 1D9KB 1MRFH 2FIRT 4Z7VF 3VXRA 3U0PA 3QEGH 1QPXA 2KH2B 3UDWA 1KIQA 4NSKB 3MNVA 4QRTB 4MZ2A 2X7LB 4PRHE 3BPLB 4H1LG 3H9SB 1TITA 2ZNWA 3X3FH 3L9RB 3VFVA 3TT1H 3X14A 3PWJB 4OUUA 5C08B 1VACB 2P49B 1LP9E 1HWGB 1HQ4B 4MLIA 2GSGB 4ELME 1WZ1L 2DBLH 3ZDYE 5DEFA 1INQA 4KJYA 4HXBH 5AYUL 3PWPE 3HZMB 3E3QC 2J5LB 4N0CC 4FQ1L 4PJAF 4PJFB 2X4QB 5EA0L 4RMTA 1R3JA 3HCVA 3BRGC 1J1PH 1JV5B 1R3IH 4PJXF 3MC0A 3OJDB 3RWHB 3ULUH 3BP6A 4XI5C 1IZJA 5MENA 4P46A 3DNKA 2I5YL 3HR6A 2WQRA 5SWQA 2P5WE 9CGTA 1MCLA 4PJ9B 1DSFH 4FQXC 3N1QC 3UTTA 4UDTB 4PJ7F 5E5RB 2EDRA 4U6XA 4K8RD 5FCSH 1JHKH 1SBBA 3D85B 4QHNB 4R4ND 2FBOJ 5I18L 2XQYG 4WVRA 5DC0A 3GSNL 3HC4L 2ZUYA 4NN5B 4XCNB 5JQ6H 1QP1A 1KJ2L 3FTGA 1MRCL 4LLWB 4NQDB 4I48A 5DMGD 3QJHA 5D71H 5B8CB 3WHE0 3RVUC 2PNDA 4BSWA 4JRXA 4UV7H 4X4XA 4K2UL 5HDLA 1ZKAA 3TA3C 3X11B 5IESL 3OB8A 5DLML 3SOBL 1MJJB 1GVIA 4QHKI 3A6BH 4YAQB 4LPXA 4WV1A 5HY9B 5GRWA 4IOIA 3KNBA 3GSQB 3LRGA 1AHWA 1J05B 3WEXA 4RFEB 2OP4L 1N5AB 3P77A 5HYSA 1I1CA 3LN5A 3DXAA 2JCCB 4OFKA 2FHCA 4BQCA 4KK5C 5GPRA 5IVXB 5JZ7D 5J3HD 4GH7B 5AG8A 5TE4H 4H25A 3VGGA 5FHBL 5LQBH 3PNWB 5E2JA 1T4KB 1QFUL 3QO0B 3GK8H 5I66B 3AVEA 2N1KA 4P57B 4HUUA 1KN2H 4ZD3L 2GK0B 4MAYB 3BKYL 5D1ZD 2LFGA 3QDMD 4GAGH 5JXAH 5JW3H 1AXSB 2C4FT 3PWVB 3L3OA 5LAXB 2HLFC 1Q9WB 4Y19E 4FZ8L 1N59A 3KLAA 3S4SG 2IAND 4WI2A 2C1OB 1BJMA 3CC5A 3BUTA 5MEOA 3QRGL 4JZOA 1YUHB 5DXWA 5I2IA 1HILA 2WMPA 4RA0C 2DKSA 2H2SD 1U42A 4JKLA 5TDPB 5F1NB 3WV0A 1XGTB 5DJXB 1FNSL 3D3VE 3GO1H 5ENWA 2JIXA 2IF7A 4HC1A 4ELMF 3KYNA 4HBCL 4ZUWA 3SGDI 1TNNA 1F45A 3TYGH 4AL8H 3RWCA 3U48A 3VRIB 1QD0A 1RUKL 43CAA 2AJSL 4XXCC 2OI9B 1MCQA 3QUZD 4JQVC 4F2MA 3VFRA 4XCCH 1YNLL 4ESKA 5HBBA 1F3DH 4HC1H 3H8NA 1G7MB 7FABL 2FRGP 4HMCA 3QCVL 5BO1L 1YN7B 2UZYB 3VXOA 1QSFD 2G75B 3E2HC 2FX9L 5JPMA 4OB5H 1J8HA 2WIIA 3CX5J 3T0VA 4Y5XA 1WF5A 1XGYH 1J1OH 5GS1C 3HN3A 3TEUA 3GMQB 3GB7B 5HGDA 2WBJC 2UY6A 1QRND 1WICA 1DUZB 3LAFA 1LO4H 4QOKB 4O51B 2QSCH 4E41B 5IJVA 1K5NB 4OLVL 1H3WM 1GZQB 4M5YH 4AIOA 5GGTH 2VDPL 4FP8L 4JVWA 3GZKA 3H0TA 1AXIB 1U6AH 2W1NA 3BT2L 4ZUSA 4OLUL 1OP9A 3FFCE 4S1SL 3F12A 2IH1B 2BSRA 1NC2D 3MV8B 3UPAA 4ZYKB 1DE4B 2D31B 4Y4HA 1EHLH 12E8H 1S7TA 3DJ9A 2FJHB 4N5ED 3C8KB 5HVFB 3OF6D 1MFBL 3AB0B 4K8RH 1HSBA 4NO5B 3MREA 1I9JH 1MI5B 1UZ8A 4K3HA 3ELAT 4XAKD 1OF2A 1YDPB 2FWOA 5KS9A 3ARBC 4XNMA 1OCWH 4OI7A 3WUWB 4DKDC 4N90D 1QUNA 3NA4A 4OV5A 2Y36L 3LH2L 3O4LE 2X4UB 3IFNL 3QXDA 4RIRB 3G5YB 4AENA 2X4RB 3WLWD 2IWGA 1CCZA 2BJMH 2X9YA 4LSPL 4EKXA 1MWAH 4QTHA 1L0YA 3RUGE 3OKKB 5ELIA 1T1YB 2LTQB 3TLRA 2IADB 5ISZB 4UT9L 1FSKC 4ELKA 2PTUA 2MQ0A 4H1LB 4F9PC 5F7UA 1G9NC 5EDXA 1DQTA 5KJRH 1LEKA 2P5EE 1KBGL 4J8RA 1T7YA 1WUNT 3MR9B 5BZWB 3VWKC 4LHUA 5EU4B 2AERT 3ZMRA 1BJ1J 5KOMC 4PJHB 4FFYL 5E2TL 1WWCA 1J1XH 1GGCL 3I6LE 1RUMH 5D1ZA 4ZNCD 2Q7YB 2YD8A 5ABDE 3PF2A 4W4NA 1M6OA 35C8H 3NIDE 4U6YB 1RULL 2AJXL 5IB2A 2X1WL 3SN6N 2IANA 2MQ3A 4HH9B 3QI9B 1ND0B 3FQXB 4J6RL 3S3SA 4HLJA 4R4FL 4N8VG 1RURH 1DBMH 2Q76A 4G7VL 5IVZA 1WFOA 5FUOH 1E4XL 3SGKC 4PJGB 3OXSB 2NX5E 3TBTA 4X6CE 1EFXB 1UWGH 3EGSA 3MLTB 3S37X 3GSVB 4YDLC 5JHLL 1HINL 2JB6A 4NQVB 3QEUB 1DN2A 3OKOB 2EEAA 3TCLB 4X99A 3MODL 3BAEH 4JFDB 1CVSC 4MXQC 3HG1D 4U6HA 1FZKA 3B5TA 5DUPL 3MROB 5E8PA 2F9BT 5I8KH 1T66C 3TNNB 1DLFL 1BREA 1LO0H 4Y4KC 2J88H 1HN1A 4PP1C 3PDOA 5GZOD 2ZWLT 4WUUE 4HIHA 3U7WH 4HX1B 2P42B 3CDCA 5IEHA 2A6DA 4Z0XB 3ORJA 3RA7H 2JE8A 1MFEH 5C09B 3WNNA 4NCC1 4H88H 5FKAA 2HTKD 5C2BL 4R97B 5DJZB 1P4IH 3UBXA 3VGHA 4WFFE 1REIA 4JRYB 4U1JB 1CE1L 5IIEB 4BH7A 4N9GB 5LCVL 1CGWA 3ME0A 5CJ8A 4Y5VC 5HGBA 5K9QI 1SJXA 3T4AB 4UZGA 1CFVL 4L8CA 4Z77B 1EJOL 4FZEH 3U7YL 4W70A 3MXVL 3G9AB 1CFTB 4DKFH 3HE7C 8CGTA 1RI8A 5D7SH 2CR3A 3T0DA 5F72S 2R29L 4JJ5B 5DD1L 1E6JL 2EO1A 3OGCA 2D7QA 1VFBA 2ICWJ 1IL1B 3RUGF 1FFPA 2DIAA 2K3TA 4J4PA 2WWKO 3O3DB 2NY4B 3NIGE 5CJQL 3D18B 2V9RA 5FV2A 1GGYA 3U2SA 1AIFB 1B2WL 1AD9B 2G60L 4JG0H 4CVUA 2QQLL 1MCKA 4MJ2A 3X13A 1BQHG 1RZKC 4QXGH 4NQSA 2CK2A 2EEBA 2BNRD 2BSSA 1HHJA 5HDQH 2KDGA 4LCIH 5JNYA 3FONA 4PJIA 3VFPA 2Y72A 4MX7B 4WGVB 5CILH 3IJYA 2YPLD 4GJTB 1CU4H 3BE1L 4DZ8B 4UTBH 3MV7E 2O93L 2LABA 4N0YL 1B4JH 2JB5H 3EYFA 3BPNC 3GSUB 4L9LC 2G2RA 3VH8B 4PGDA 4NO3B 1EO8L 3QYCA 3KPQB 1YPZB 5DD3H 5EBMB 1I3RB 1X5KA 1ZANL 1HSAA 4YE4H 1RU9L 1YY9D 5GRVL 4X6CF 3TBYA 5A16B 5D1XD 1U8QA 4QHUB 3S34H 3QZWA 3STLA 3KPLB 3FN0H 5K9JH 4JM2A 4Y1AB 1R3KB 5C3LD 1KT2B 3DHMA 3FL7A 1SEBB 2A6KA 4JPWL 4MS8D 1N4XH 4ZXBA 1GC1C 1KCVL 4LDLB 5IF0B 1PY4A 1KIPA 2EECA 3TIDB 3GNMH 3O6ML 2NXYD 1N8ZB 1FPTH 3A6CL 4F9LA 1NBZA 5FYJU 1B0RA 5ANMB 3CPLA 4XVUD 1KPVB 1A02N 4CADA 3W81A 3QIUC 1JPST 3U4AA 4YDVB 3O6KH 1NGQL 1DTUA 1RK0A 5H37H 4K3DL 1BWWA 2NY3D 4EI6A 3NGBB 1U95B 3P4OA 5C8JA 3QUMB 1INDH 2YA2A 4DKEH 5HI5C 3MJ7B 4ZSOB 1T21B 4KZEH 3MRKA 1UT9A 4HKZA 4P23B 1N7MH 1VGEL 4F80A 4JAMB 4NNXA 1AH1A 5EULV 1ZLSH 1RZ7L 3ET9F 1IKNC 1VPOL 2EZ0D 1MHHA 4PS4H 3HR5B 2QQKL 2Y7QB 3IDUA 3MLPA 2JTDA 3K2MC 5FO7A 4X7SH 3TJHC 3MFFA 1YEFL 5JW5A 4IDJH 1EMTL 2BVYA 4P3WA 4O5LL 3VD3A 1I7RB 4WTZG 3DI3B 1GIGL 3HLAA 2R69L 1NCCH 1AC0A 2HT3D 5J1TC 2AKRB 3QUZB 4WHTB 2ZCHL 3ALWA 4YXHH 3SGEH 4L4VD 5C6WH 3SY0B 5ESAB 3LS5H 15C8H 4U31A 5T1MA 5FEBA 1UWEH 4IBLT 1T1XB 4JZJB 2X10A 2XA8H 3UYOD 1ZLVH 2EDOA 1J0ZA 2XZCL 3UC0H 3RVWC 1I8IA 5IEKB 4NNYA 1QKZL 3TN0B 3MBED 5IB1A 4OCRH 3S88H 4PP2B 1TZGH 3W0WD 1MF2H 2P7TA 1NAKH 3VXUB 3IS0X 4ZAKD 4WI8A 3QCTL 4KJQC 4BM7A 3P4NB 4PYGA 1P1ZB 2OBGA 4K71B 1SY6L 4OCSL 1JPSL 1JF1B 2F58H 5T1LB 3FRPA 1FNGB 1NC2B 2I60L 4OKVB 2P24A 3S5LA 3IDIA 4L8DB 4OV6F 4JFPA 5L8LB 4LCYA 3OJMB 2F8XC 5DD5L 3TA3A 1QLEL 2EC9U 1WCBB 5E8NB 1WBXB 3TWCL 3VXPB 1N3NA 2CRZA 2IMMA 5LGHH 2C3GA 5HHME 5FO9B 5FGRA 4AH2A 4LPCA 5A43C 3S37L 5HHVH 1U8NA 3QAZC 5L88H 4QCIB 1KXQE 4X6EA 5DF0A 2WIMA 1LDPL 1R3LB 1CE6B 5EBWA 3VXTB 3KHQA 5E94B 5ICXB 4RDQG 1JPGA 4Y88A 3RTQC 5ADPH 1BBJB 1U41A 2E7MA 5C0IB 1A1OA 4D3CH 4R7NB 1EX0A 3QDJD 2P44B 2VH5H 3KWWA 4HGWB 5ACLA 3TO4D 2XZQH 3MRGB 1UA6H 2YSSA 2Z8VC 4RCAA 1PX4A 1VERA 1D5MA 1MLBB 4MGXA 4DTGL 4KY1L 2IQ9L 5F1KC 2HVJA 1YECL 4ORGA 3F6IA 5JQHC 3JWOC 1KYOK 4I4WA 5EU5A 3MCKB 2EKSB 4EUPA 4WW2B 3CCHB 1U0QA 2R56L 3QXWA 1J87A 2MPAH 4OM1H 1ZHLB 5IB4B 4KKAC 4KVNH 2R0WH 3SE9H 1XCQB 4XPGL 3LKSB 2WUCH 3ARUA 4YC2B 4WGWB 4FQIL 4EUPH 1BZQK 3P30L 3F5WB 4MMZC 4XXCA 1A7RH 2DQGL 5B38G 3V4UH 1Q9KB 4V1DB 3Q5TA 5FDWB 5ILTL 3O2VH 3DMMB 3HHRB 4L3CB 3P3YA 5CGYD 1GC1L 3QNYA 4WHYG 1CDBA 4N68A 5DFVC 4ZODA 3TC9A 4P9ML 3T2NL 4XX1E 3HG1B 5C0RH 3FHQA 2BHZA 2YHGA 4Y8DC 1DEEA 2XACC 1C5DB 3IDJB 5MEPA 3B43A 4XPHL 3ZE0F 1E4JA 1MCOL 1FZMB 1Q9LB 2YUXA 1PYWB 3IDXL 3K0WA 4DJMA 5CZVL 5DGRA 1VA9A 3KYMA 4HKJA 2A6JB 5FOJA 3CVHL 4G6JH 1T1WB 4TSCH 3W0WA 5C0CD 3MCLL 4JCMA 5CBEB 1NKRA 3FB8A 2CIIA 3EYVA 4ZAKA 2BHYA 2Z91A 5C07B 5CHNB 3V95A 4AQOA 2VJXA 4MJ4A 3QA3A 3JV6A 2IBBA 4GUPA 2BVOB 4ZFGL 3QFJE 4U1LA 1R0AH 1PQZB 4YR6A 1A14L 3CXDH 3FAXA 3CH8A 1FFNA 3VG0H 4UQ2A 3UYPA 5D6CA 2VIRA 2F53A 2DLFH 2VDQH 1WC7A 3ROOB 3ARBA 2EH7L 4OFIA 5IBLD 4P2RE 5BZDA 1UH3A 1DL7L 3CFIC 4M1GH 4G8IA 4DGIH 5IHUL 1GZPB 3UP1A 3TF7C 3WIHA 1IGTA 2PW2B 1JPFA 4F9PA 3L7EA 4X98A 4JPKL 2X9WA 1DUYB 3VWJC 2B1AH 1IAKA 5J7CC 3CVIL 5ERWA 3WIHH 3VWKA 3TYFB 4JFFE 3IXAB 2IPUG 1RJLA 3ZHDA 2KBGA 2DTML 4HPYL 1T0PB 1C5BH 4HIXL 3UJTL 3BGAA 5TQ2L 4HWZB 4LOUC 4PJEB 5HI4D 4G6MH 1JVKA 1HZHH 1IRAY 1DFBL 1L6ZA 1AGCB 3V6OC 1G9ML 4WUKH 2OSLB 1BZ9B 1J0JA 1ZSDA 5FGSA 3KG5A 5DMIL 4AEEA 5IFJA 3CDYA 1IC4L 4M6NL 4UOW1 2D7MA 3RDTC 4M48H 1L9MA 2PXYB 1OB1B 3O2WH 2GJZB 3ZTNH 3C6SB 4PV8B 2FJFB 4UQ3A 4YFDB 1G6RL 3WIIH 5IMMA 1I3GH 2R0ZL 4N0FB 1ORQA 1JZ4A 5HHQB 2PTTA 4H5SB 4KK9C 1AI1H 1BOGB 1HI6A 2CRMA 1K85A 4XNXL 2FD6L 2CLVB 3L3IA 5T3ZD 5DJ6A 3MCG1 4PRDA 1U8JB 1I8KB 1NH6A 3EOTL 1NFDE 5IOPB 2COQA 4OTXL 3DUUA 2LU4A 1QSZA 2VYRE 1A4KA 1G9EA 4JDVA 2ESVB 3FOLB 1XGRA 3I50L 2LQRA 3V6ZA 3MA9L 3TZVA 4TUJB 5C7XL 3BUYB 3LDBC 3JWOL 4LLVB 4XWGL 1TLKA 2PYFA 4APQC 3P9MA 5SWSB 4ZFOL 1UACL 2VN4A 3DX7A 4UILL 3T8XB 5BQ7A 1EAPA 4Q9RH 1PZ5A 4N0UE 2WBWB 1CTOA 4TSAL 1HH6B 1QACA 4J3VA 1ZEAH 3GIVA 5E5MB 2R1XA 3LPGA 5GZNC 3D39E 4F33B 2FR4A 5ID1A 4NWUH 1KGCD 1CLOH 3EYSH 3V0VB 2XXMB 4OGYL 4NQTA 3OAUL 3HNTH 1MCWW 2ZG3A 4HUXA 4XTRD 4TYUA 1RHFA 1GSMA 3T0EB 2QJDA 4XMKH 1XCTA 3MACH 4LMQE 4CVXB 5A2FA 2A9NL 4M93B 3DVGB 4WY7L 5CLTA 2P45B 4ONGL 4YHYC 2HAZA 3TFKD 2GITB 4XBGB 3GI8L 1EV2E 2GW5A 4BFGA 4HJGB 4R2GC 3GHBL 3B9KB 3BZ4A 3NH7H 5DEGB 4WFHE 1MHPL 2BCKB 1RZKH 3PHQB 4G9FE 4LPTA 5FYJL 4EQ3A 5B38B 4XVTL 2A83A 4L9LA 4HZLB 4G6AD 2APTA 4P9HC 4MWFB 2EDTA 4KJWC 1AD0B 1A1NA 4JQIH 4OD2A 3QO1A 4LIQL 5E9DD 5DDHB 3O3BA 3O2DL 1BMGA 1H0DB 2V17L 1OP3H 1QFHA 2VDLL 4OZIE 4L3EA 4NKOB 4FXLA 2YR3A 3CU1A 5IG7A 1UGNA 3KPMB 4AEFA 4K7PH 1LK2A 2EC9T 4BFEA 4D0CA 1F58L 4GG6A 3MQIA 5I1AB 1V5JA 1JYVA 2J8UB 4M7ZC 5ALBL 3HB3D 4EVNA 3VFTA 4EDWH 1MFNA 3VFSA 2VLRB 5KAQF 2H8PA 1NFDF 3NCBB 4JN2B 3RI5K 4JE4B 4LIQE 5HD8C 4P2YA 3HNSH 1PKQE 5DWUL 2DI7A 1AKJD 3HA0A 1Z9SA 4PTUB 3U4BL 4LLUA 3QNZB 2DYPA 1FN4A 1T6VN 1A6VL 5GGRY 5IHLB 1LE5B 3QDJB 3QIUA 5KW9L 3IFLH 4NKIL 1IC1A 1K4DB 1OP3K 1OAXL 4BK4A 2Q87A 1JK8B 4K94C 4X80L 3CFJB 3W2DH 1BBDH 2OTUB 1OLZA 4GW5B 3B5GA 4KMTH 3EUUA 5AZ2L 4H8WH 5DJ0A 5J6HA 1CZ8L 2NCMA 2VL5A 4WEBL 5JIIA 3IVKA 3B2VL 1JNNL 2VLKA 3VDCA 2YN5A 1FP5A 3SDXF 1SBSL 5INCB 1IKNA 5KN5B 1CDUA 4U1MA 3V52L 1CBVL 1P7QA 4RAHA 3PL6D 3DSNA 3FQWB 2ERJB 4GRMB 3RWEB 2YZ8A 3F7QA 1CFSB 3TIEB 3IGAB 4GKSA 1T6WA 5J13C 1A6TA 1IGJA 2IFFL 3M17B 2V6HA 1OSPL 5L2KA 5KG9B 3MV9D 1NANH 4POZD 5DRNB 4JO2H 2XKUA 1JWMA 2AEPL 4XPAL 1MJ8H 1NDMA 4FQHA 1A1MB 1RZJC 1FAIH 2C1PA 1FBIL 2PYEE 5I0ZA 4DOHB 3SDAD 4LSSL 4TNWF 3PWLB 1UG9A 1R5WB 5HGAB 3V7MA 2FNBA 4YQXH 5I15H 5I1DA 1JF6A 4KHXL 4U2ZA 2YRPA 3Q6GH 3UTZB 3U1SH 3RWDA 4NZTH 1TVHB 4NJ9H 4LVOC 4GXVH 5C0CB 4YHKL 3IJHB 3UAJC 4UT7L 4OZIF 4QT5B 3ARFD 5F89B 2VDOH 5D2LF 1TJHH 1HKFA 1FFOA 1YMMA 4ETQA 2ORBL 4MJIE 1NBYA 2GTWB 4RSVA 2VMFA 3N1PC 4PFEA 5DJAA 3RWGA 5E8OA 3WBDA 3STBA 3MOBH 4CGTA 1OOAA 1KLGA 2CUHA 5DSCA 5BV7B 3MLVH 3BPCB 4IRJA 2MCG1 3S8WA 3GBMH 3U4EB 2BNUB 3OKDB 4DZBB 5CEYA 3U30B 4OLZH 3V7AE 2OL3L 2BVTA 2UY7A 4Z7OE 3UTPE 2D03L 3G9VA 4DUXA 1K2DB 3RTQA 1EGJA 1QA9A 1NCNA 2A74A 1LNUA 2HFEA 5TE6L 3BH9A 3BQUB 3RIAF 1F90H 3NA9L 1X5YA 4LKCB 3BD4A 4G43A 4ONHA 4I77L 4KGJA 1C7SA 2VWEC 3OX8B 4JVUA 1EGJH 2R2CA 2W0KA 3I85A 4LGRB 1W0WB 3DSFL 2VUOA 3VCLA 1K4CA 1YEIH 1UWXH 1SEQL 4MVBD 4P9HL 5F96H 4YDJA 5I75C 4M3JA 2XQBH 2BFVH 3N0PB 2P8LB 3B3IA 4Q0XL 5DQDL 1T0MB 1EEYB 3LPWA 1EXUB 3VFMA 2AQ2A 4OD3L 3ZTJG 2X42A 5HYSG 2R23A 4CUCA 2NY1D 1AJ7L 5EIQA 4J3XA 3GMRA 4JFEB 2D0FA 1YC7A 4C59B 2MHAA 5CWSA 1OAYL 4AMKH 1WEJL 2J6EL 3V5KA 5ALCH 2DQJL 3WO4C 2UYLB 3DX8B 4NFBA 4Q6IA 2FLBT 2AV1A 3CFEB 1UXWA 1FG2B 5HYJA 3GMPA 1MNUH 3WYRA 1LO5B 5DTFA 5TF1L 2OZ4L 2X6MA 1UWXK 3UYRL 4TRPL 1S78D 3I6KB 4KMLB 4PRHD 4HPOL 5CD5C 5FXCH 3KDMB 2J8HA 2X4PA 4P2OC 2FYYB 4EQ2A 1MFAH 1FV1A 2NTFA 5TDNB 4Z7VA 3LIZH 2H32H 4K94L 2X1XR 3C2AH 5DT1L 3QEQA 5DRZB 1JGUL 2YWYA 3V4PL 2ZPKL 2E7LC 1I7ZB 2YD2A 3W5NA 3K7UA 3C5SB 3H9SE 1IBGL 4X8JA 3FRUA 1KFAH 2DQIL 1CGXA 5D8JL 4JRWA 4WFGE 4KZDH 4HCRA 1WT5A 3N85L 4KFZC 3TNMB 1X5FA 1J9CT 3RX5A 3MRIA 4ZS6C 1ZHBA 5E2WL 5E1HB 3HMXA 2HN7A 5C08E 3L1OL 5EC2B 1F11B 4OI8A 5CIPA 5GSVB 5F88B 5I19L 2FIKA 1UKQA 4L3AA 2PO6D 1LE9A 5C6TL 1ROWA 4ENED 1A9BA 1LD9A 4PJAA 3HMXH 1U93B 2AXHA 5ICYB 1E6OH 4PJFE 4Z7OF 4QYOA 1T83C 4JFOB 3R8QA 1J0HA 1FL3B 4PJXA 1UQSB 4JO4H 3PXHA 5CIPH 5DI8A 4LCWA 4MXVE 5BMFH 1RIUL 3Q0HA 2VB5A 1QBAA 3IF1A 1WWWX 5C0BB 2IG2L 1JWSA 1Q0YH 4YIQA 5F8RC 3WKNA 5C1MB 1U3HD 4XVSH 4FQJL 3RWIA 4JB9L 2GSIB 5T1KB 5F21B 4PJ7A 1R5IA 3LB6C 1HEZB 2E27L 1DQLH 4NN6C 4KKLD 1S7UB 1AY1L 5TGBB 1H5BC 5B39A 5CEXB 1ZS8A 4BZ1L 1F13A 4NYLB 4GG8A 4LRNL 2Z35B 5EU7E 2BVEA 5TJWK 4UIMB 3WFEL 3MLZL 3V6OA 3MLUL 1P7HL 2L7UA 3H42H 1W72A 4UAOC 4ZDHB 1SJEA 2HMIC 4NQDE 3GMNA 3IETB 4HHAA 1WTLA 3RDTA 1MHEB 1X44A 4YO0A 2CMRH 1X4XA 2CK0H 1NGPH 4KV5F 1W72H 5I1KH 2NXZB 3NCJH 4JHWH 2C3WA 4G3YL 4CVWA 4LKXB 1BD2A 4DGYL 2VR9A 5HVHC 3GFUA 4MNQB 4RGNE 1EEZA 4OUUB 4MCZA 4LHUG 4U0RC 5IT2L 3OPZH 3RQ3A 1KB5B 1DVFC 4QRPD 3QWRA 3BWUC 2DIBA 4LEXL 3W11D 3OGOE 1UB5B 1EH9A 2JCCE 3JBG7 2W91A 3FZUD 3EYOB 1N64L 5IVXE 1PDKA 2BRRL 4Y19D 1G0DA 4KJYB 4I18A 2Q8AH 4IS6A 5ICZA 5BOPA 3U79A 1TZIA 1QEWA 5IW1B 1T20A 4X0KA 1AKJB 1R3JB 3HCVB 3T1WA 5KVDL 4P5MA 3G6AA 2HA1A 5F6IB 2R0KL 4P4RA 1JTTA 1WGOA 4WI5A 1FVDA 3TH3T 4Q9BA 4FQCH 2X4SB 3IJSA 1XR8A 1U8HB 1B88A 5DFWH 1A64A 5CINH 2A77L 3CDGA 1IGCL 3BH8A 3LEXB 1OAQL 1LP9A 2EE3A 4OGXH 1UXSB 6FABL 5HYEA 4RFNB 3GRWA 2AK1L 2I9LA 2RAMA 4ELMA 2EDHA 2HFGH 2H9GB 2YMXH 3MPCA 3PWPA 4Q2ZA 3MZGB 3G6JB 3RGVD 1B6DA 3D69A 4OLYH 3SKOA 3GRWH 5H2BB 4MXVF 4XGZB 5KSBB 3PL6B 3ARGC 4KRPD 1KCKA 4NGHH 1N26A 3QHZL 5F9OL 2P5WA 2Q1EA 3EAKA 2HWZH 3N50A 1R24A 1PAMA 4L8SB 3Q3GB 1PBYA 3MV9B 5I17B 5HDBE 3UBXG 1M7XA 2HKFH 2VC2H 4X9FA 4ONFH 1B3JA 2V2TB 5EPMA 1IGIL 3AC0A 4QOKE 5A3IC 4LSQH 3SGJC 3WEXB 3GGWB 2O5ZL 4E41E 1PG7W 3DXAB 1TCRA 4KKBC 1S7QB 5MP6H 3ZE2F 5AYUH 4M7KH 2BVQA 3R0NA 2Y5EA 3QIBD 1RJYB 1PSKL 4N1EA 2VLJA 1MIML 2X40A 3CX5K 1LK3L 3MGTB 2ID5A 4M6ML 4GMTL 1WK0A 5EN2A 3GMLA 1TQBC 3MV8E 5I8OH 3O6LL 4ZFZB 2VN7A 5IMKB 5DJ8B 5IJKC 2Q86B 3L3OB 1MCRA 4IRZL 4XB8A 3SPVB 1N59B 4EXPX 1MI5E 2FX8L 2PW1A 4P5KA 2XWTB 1FO0A 3CC5B 1TQCB 1I9RH 4Y5YC 1DQML 4YDKH 1HILB 4Q6YA 2MKWA 1KJ3H 4NQEB 3FCTA 5D7JD 4R4BA 3KPSA 4LCCB 1S9YA 3M8OH 4EBQH 2JCCF 1AGFB 1BF2A 3GSNH 3QUKB 1FO0H 5IVXF 5EZIL 4JREB 3KYNB 1RUPL 1BJ1H 1BQLL 3LSOA 5ISZE 1A3RL 1KENL 2QV2A 4O4YL 3I6LD 3WFBL 4GAYB 2HRPH 4UUJA 4X6FA 3H3PL 4ERSL 3MRNB 4PY8I 2D4DA 3B9DA 1EPFA 4AY0A 3CK0L 4F57H 4YHNB 1OT1A 1Y6NR 4PGBB 2DMBA 5IVOA 4XI5D 1V7NL 4B50A 3B5HA 1ZGLA 1O0VA 4NOBA 1M7DB 4PJHE 4WWKC 5JPMB 1J8HB 2IAMD 2WIIB 2GT9B 2IBGA 3O8XC 1NGXB 1RVFH 5D7LB 1G7LA 3D3VA 2P43B 4JG1L 3NABH 3QZWG 5ESVA 5FB8A 2NX5D 3V4VL 1RPQA 1NBQA 4TVPL 5IJVB 3MLWL 4LBEA 3TJEL 2AXGA 1L9NA 2NY0C 2C7UA 4DAGH 4FTVD 4IOFC 3PHSA 1QFUH 4J1UB 1MREL 2C5DC 1AFVL 3F12B 3O6FC 3QPXH 5FV1L 4PJGE 3U36B 1C5CH 3BHBB 4PJCF 5E4IA 4QNPF 1DR9A 4N1HB 4WUUD 3GKWH 3RZWA 3QXVA 1GGUA 1WJ3A 2ZOKA 4TTDD 1HSBB 3BD5A 3MREB 3GSXB 4HS3A 2HJFA 3O11B 3FO0L 3CLFL 4JFDE 5HDBF 2FWOB 4XNMB 4HJJH 3FMGH 3WNOA 3LRSB 1E4KA 1JNLH 3VGBA 1J5OL 5CEZE 4LMQI 4OV5B 4XP4H 4PR5B 2BSTA 3QQ3A 4QRQA 5BJTA 3T1FB 4D9QD 3VD5A 4BUGA 5J12B 4FMFA 3U46A 4M7LT 1INEL 2FGWH 1NAMA 1Q72L 4ZUVB 5IGXL 1T2JA 1D5XA 5LG1A 1JGDA 2AJSH 2ICWA 1CR9H 3BZFA 3FFCA 1BZ7A 4DEPC 1YNLH 4S0TD 3GJFH 2AEIT 1D6VH 1LEKB 4JRYE 3K80A 4KK6D 2Z31D 1NAMH 3JVGC 3SJVD 5E6IC 3KPRB 3OKLA 4U1SA 7FABH 3ILPA 1TMCB 4HQQH 4OGAD 3RNKA 2Z92A 4K7FB 4KROB 1FDLH 4L1DA 1MEXL 3AROA 3HPJA 3O4LA 5EC1A 3RPKA 4KRLB 3ZDZE 1U8PB 4AEIH 5D5MB 1U8MA 5IB2B 2HKHL 4X6DB 5JDSB 3RUGA 1VFAA 4EOWL 5GGQH 1DQJB 3NBNA 5F7FA 4WWID 1J18A 4Z78B 2EEDA 3KR3L 1OAKH 2PO6B 3DV6A 2XNAB 3TBSB 2P5EA 3RWFB 4OLUH 3EDEA 3IDMA 2C9AA 2EIZA 5GHWH 2BHUA 2YKLH 3LD8B 4HH8A 3MRPA 2HH0L 2CIKB 3MV7D 2DQFB 2QR0A 3GJFK 3TBTB 1CICA 2VDKL 4AT6A 3DRTB 5HI3C 5SX5H 1MFBH 4JM4H 1FNEB 1UH2A 1U3HB 4X99B 3STZA 1UCBL 2M26A 5B22A 5T33L 5J8OA 2WBJD 3HMWL 3VGEA 2Y36H 3S5LG 4A2MA 4I0PC 3TV3L 2W9DH 2OR8A 3KYKL 4RX4D 1WFUA 5I76A 4G8FA 4JFQA 3AU1B 4M7LL 1S7WB 1ULVA 2BDNH 3EJZC 1JL8A 5L7XH 3E6HA 1YPZE 4IRSD 1C12A 4MNGA 2OTWB 4O58L 5BVJB 4GRWB 3GBNH 3OAYH 2J2ZA 1ZHKA 4F7CA 3KJ4C 4X6CA 5FKAB 4PJGF 3ETBF 1LEIB 3CXHJ 3UBXB 1KBGH 1I1AD 2BY1A 1RIVH 3ZSSA 1ETZB 2YBRB 1F8TH 1MH5A 4P4KD 5JR1H 1MFDL 1GOHA 2KKQA 4Y1AE 1KJ2B 2JJVA 5E2TH 5JO5A 2AJZB 1H3VA 2Y07H 2EDEA 1GGCH 2O61A 4PRBA 4KVCH 2BC4A 5I73B 2VUYA 3MXWH 5GS3A 1G0YR 2R15A 2FZ3B 4CN4A 5JMRA 4WUUA 1RULH 3VD7A 5EFIB 1EK3A 5FYLL 1MFCL 2IGFL 3IDGA 2J1KA 3MNWB 4HF5L 4NJAL 4QRPB 25C8L 1JUFA 1VFBB 1A7NH 3DUHA 5CJBA 2YK1L 3SDCC 3PDGA 4F7TB 1S9KC 2N7AA 5FECA 3VRLF 1KOAA 2YWZA 4HD9A 1UYWL 3FT4B 1X5ZA 5ANME 1HNFA 4EUPG 1G7HA 4XPBL 3X3GL 1HDMB 4JFZL 3EFDL 4TOYL 4P3DB 4P2OA 2XIDA 5IFHL 4O02H 3OAYK 3KAAA 3MRJA 2NYYD 1NEZB 4QTIL 4RA3A 3BXNB 1CL7L 1MPAH 5A2KH 4S1DD 4ZSOE 1HHJB 1SQ2N 4MMXC 5FYLE 3V9FA 5I30L 4NNPH 4F7EB 3FONB 4PJIB 2XA3A 2P8MB 2UWEB 2Z31A 2VXSL 3ZDZF 2EH8H 3IJYB 4A2LA 2CGRH 4DCQB 2BRQA 3EO1A 4IEFB 3FO9A 5MI0B 5T1DL 1KCRH 1P7KB 2ADIA 2GUOA 1RIHH 3EYFB 1PVHA 2VITB 4LLMB 5DRWA 8FABA 4HDIB 4NZRL 3JV4A 2G2RB 1HXMA 4L29A 4HV8B 4LVEA 3ZKND 4OJFL 1YNTA 1FJ1B 2FO4A 1XF3A 1S9WB 3HRZB 4ODTL 5D7KD 3RGVB 4XNUL 3WNMA 4EI5D 1U8QB 1P2CA 2CDGB 5LCVH 3STLB 3ZKSD 3EIFA 2I27N 3I6GB 4O9HH 4JM2B 1FYTB 4OT1H 3U7YH 4XAWH 1J10A 3MXVH 5EOTA 3SEPA 4JZNB 2B1HH 3BOVA 3VE0A 2A6KB 4ZUTB 5IFAL 5DK0A 1WCQA 2X89D 5HHXH 1HHIA 2R29H 3RZCC 2BVUA 3VXUE 1KTDB 1U9KA 2F74B 1E28A 3VFNB 3V5HA 1AO7D 1CWVA 1OPGH 3ULVC 5CKAA 3CAFA 1T03L 4HS6A 4RWYL 5JUEL 5FDYA 4DFHA 1MQKH 3BRFA 4AYFA 2GEEA 1IM9B 1ZXQA 3GKZA 1QBBA 4Z7NE 3BD3A 1MY5A 2IALA 3PGCA 2R4RH 5I1JL 2W65A 3QIBB 4OF8A 4MQXC 1IC5L 5HHMD 3V0WH 5KS9F 2CLRA 3UXFA 1ACZA 5TPWL 4GKZB 5KVFL 3FT2A 3LQZA 4PJBB 4IDLA 5K33A 4JN1H 5C8JB 3KYOB 4IRSA 2Y6SD 4XNYH 5IK3A 4HFUL 4MQTB 4GKNA 5HGHA 1OM3H 4I5BB 2CDFA 5E99H 3L5WB 4WTXA 4XAKE 3U0WL 1FC2D 3D5OF 4Y2DA 5D2NE 4P3CH 4N90E 5K9OB 5DYOA 1IGYB 2R4SL 3WKMH 5KTEL 5D7JB 1EBPA 4XP6H 5FO7B 3BEVB 3RAJL 5JW5B 4WI6A 5CCKL 2OMBA 3HLAB 5T5FL 2X4NA 1YEEH 2DWEB 4ODXB 3SE3C 1JNHA 2BX5A 4MYWB 1QFWL 2QHLA 4R8WL 3WO3B 2FECI 5C0EA 3NZHH 3SKMB 1QFWM 4XC1H 3PP4H 3LKOA 4JY4A 1V7ML 3DPBA 1H3TA 3IAPA 2Z93A 4LEOA 2K9UA 3L3KB 4M7JH 4FQXB 5EIIB 2ED9A 3BKMH 1F4WH 1IFHL 2BVPA 2VO5A 3DGCR 4HG4J 1FGVH 1QBMH 2EYRA 5IKCA 4NZJA 1A2YA 3IT8D 4FTVB 3RVXC 4PD4J 2IFGA 2NY5L 2Z4QA 3BJLA 5JIHA 3FFDB 1I7UB 3LS4H 4V1DE 2P24B 1QBLL 4JFPB 2FB4H 4C4KO 4M5ZL 2OK0H 3OG6B 1TETL 2FGZA 2D7OA 1KSRA 2HT2D 3ARVA 1RUAL 4J12A 2MMXA 4CJ1A 1NDGB 2V7NA 2ZOLA 4NM4L 3HG1E 3MLRH 1PLGL 4GBXC 1DDHA 4RMUA 3WD5L 5DUML 1KCLA 3LN9A 4AH2B 4NUJA 4V2BA 4OCXH 1U8NB 3QUYC 3TBVA 3QFJD 2R1YA 3P40A 2RFXA 4PB9L 5EBWB 1SHMA 1T22A 2P47B 2XWJB 4Z7NF 2VDMH 2ZUWA 2X89A 4DVBB 2UZIL 4OSUL 4NM8L 4M6OL 5BS0A 1A1OB 1C16B 1UENA 5C07E 2NNAB 3DX9A 3KWWB 1CD0A 2MCPH 3QIWC 4P2RD 3T65A 3L3JA 4OZ4A 3MRMA 1NFIA 3SJVB 1KTLA 2VXUH 1ZTXH 2GK2A 5IJKA 1UJ3C 3HAEA 2B5IC 4Y16D 4GFTB 3SO3C 1ZOXA 4HWBA 3OR7B 4TN9A 3MUHL 4XZUB 4U1IA 3JTSA 3MRDB 1JZ7A 3T2PA 5ITBH 3MRBB 1RUQH 3HAEH 4KI5C 4Z5RA 1BJ8A 5IVNA 3QCTH 2VQUA 3RGHA 3PGFH 4GRLD 4HWBH 4PLKC 4JFFD 4G80A 5D70L 3VU2A 4WO4D 1NMBL 3B6SB 5L9DH 3QXAA 3UTSB 3VMPA 1QSEB 3VFGL 4NRXB 1C08A 2AGJH 2C3VA 2DQUH 1X5XA 3IU3A 1Q94B 2I60H 2AEQH 2VXVH 4X5WA 4JPVH 4P2CG 3DECA 3S3JA 3QNYB 2BNRE 5JOFA 5DD5H 4OM0H 3INUL 4CDGC 4M6AA 4WWKA 5FA3B 3QH3A 3O8XA 4PJEE 3ULVL 5GS1B 2WBJB 3H9ZA 2VZUA 2ICES 1F4XH 5D93C 2CXKA 5E8DL 1LDPH 5E6ZA 1JFQL 4Z7WB 3HC0A 5EO1B 1I1FA 1NC4D 4YHPB 5GJTL 4XP9H 3GM8A 3BO8A 4PJ8C 2YRLA 1P4LA 3DVNA 5DO2C 5MEQA 2MQCA 1EO7A 3L3HA 1A0QH 1T2QH 3O6FA 4OCNC 3C60C 3F7VB 4YR6B 5T5NF 1FFNB 4DTGH 1L7TH 1MOEA 1YECH 2ZP0T 3ISWA 4UQ2B 3V6FA 3FO2B 4Z95H 2CKBA 2VIRB 2FJGA 4EIZC 4HXAH 2ITCA 3ARBB 4FXGB 3K4DA 1A6AA 2XV6B 4G7YL 5E7BA 4XP5H 2O5YH 4G8IB 1KUMA 1S7RA 2CKBH 3WUZA 1ZWIA 2OX5A 1U3YA 4Z9KB 1IEBA 1CD1B 2AS5M 4FQIH 3RY4A 2ESVE 2AJ3B 3QFDB 5K9KA 4OF6A 4XRCA 1ZVSA 2GTZA 4EN3C 1YEKH 4PGCA 2X70B 5I9QB 1IGTB 2DKUA 3RKDD 3ROLA 1FSKB 4ZNEE 4NIKB 2IC2A 4OLEA 3QFJA 3TO2A 3Q48A 5F97E 1CLZL 1IAKB 1QLFB 3VXQA 2MWCA 1E27B 3DGGA 4H0IA 5I1CL 2D2OA 1HKLL 3B2UD 3QHFH 2FHFA 3RX7A 3IXTA 3PABA 4WHCA 4P2RA 2WP3O 3RBGA 2DQCL 4QY8A 5DHXB 4PGZA 4XPHH 1KJVA 2VRAA 1OTSD 2NY2D 4P48A 4JDZB 5IQ7H 4S10A 2DD8H 5DHYB 3MJGX 4NO0D 3RVVD 2E9BA 4NZUH 4BYHA 4R26L 3T0EE 1X5HA 3A67L 3MJ9A 4WFHD 5K9QG 1DANU 4EI5B 4UQ3B 4ZFGH 4GRLA 1O5DT 1NLBL 4G9FD 4X4ME 5IMMB 4WO4A 4XPFL 3BZDA 3MO1B 4CRPA 5GGRA 3GI9H 1XZ0B 3ZKXC 4WRLA 5FUCE 1OAZL 2EDJA 3IFOA 3MJ9H 1KG0A 4PJEF 1HI6B 1CG9B 1NCBL 4LQFH 5GRUH 4BH8A 1KTRL 1MCDA 3P73A 3SDDD 5IHZA 1QO3A 2OJEB 2HFFB 4Y4KB 1RZGA 4LLYA 4XP1L 5IHUH 4OZFH 4DGVL 1F97A 1XIWD 5HHOA 5DS8A 5A2IH 3E6FB 1AO7B 2WWMD 4JDVB 4KKCD 4YXLH 4RGOL 4OLWH 3HFML 3WN5C 3ULSA 1A22B 1ZT1A 3IB4A 5D1QC 2XTLA 4RGNC 1NC4A 5JW4M 2XN9D 3LKRA 3P9MB 3MRFB 1BGXH 3SHSA 5I16B 5F3BA 4Y5VB 4MB3A 4YDIL 5BQ7B 5F9AC 3Q2CA 1PZ5B 2DN7A 1IJ9A 5FYKU 5TQ2H 4K3JH 1Y18A 4LSRH 2J8UE 4U33A 3S36H 3K4AA 3I75A 1NCDH 5D7IF 1BEYL 1NFDA 3HE7B 3CU7A 2VLRE 1G9MH 5I6XC 5ID1B 3EFFA 3U9UB 5A2JH 2W0FB 5IV2B 1PZUB 4MAYC 2AI0L 2QADD 4M6NH 1NUGA 1H3PL 4XVJH 5JW4N 3G6DH 5LGJA 1ED3A 4JFHD 2ADJB 2F5BH 5FF6A 5CGTA 1JZ2A 3QDJE 2AJYL 3TGXA 3KXFA 3O3EA 4LAQL 1YEHL 2O5XL 4MSWA 3SE8L 4QRSA 4OLXL 4N0UA 4M62L 4G5ZH 4QRUB 1NCUA 1TZHB 4IMLA 4XNXH 1LHZA 4UB0L 3T2QA 4PJ5D 3SDXA 4G6KL 3D39A 3MV11 5KSUB 3T08A 1BFVH 3JWDC 2DM4A 4YX2H 3SQOH 4JANA 2DLTA 4QXUL 2P48B 3TT3L 3QG7H 2A83B 3O4OB 1QOKA 4MAUH 3WNKA 2OXGA 2EC8A 1IZKA 4MLSA 5FK9A 2XWBB 4JLRA 3O3BB 1KELL 4YGVB 3PV6A 3OXRA 4YBHA 3GIZH 4Q7DA 4XWGH 4F7MB 3CJJA 2LU7A 3BDYH 3OKMA 4GSDH 3MNZA 1KEGL 1VGKA 2ICCA 3P0YH 1LK2B 4HT1L 3CFBA 4HUKB 2FECL 2NZ9C 5FGBC 3PIQA 4KK9D 3UEZA 4D0CB 5F7DA 1NJ9A 2AXJA 4GG6B 4DOHE 1AQDA 5JIKA 3EDJA 5I1GH 3OKNB 3F7YA 2ICEA 3WFDL 3N06B 3UDWC 4LSVL 3RZCA 4NP4L 4YPGA 4HUVB 1DQDL 3CFKA 5IP4A 1A7QL 5HHPA 4PBVC 4MJID 2QHRH 3F58L 3QULA 3SDDA 1BPVA 4FQ2H 2YD1A 6CGTA 4JVPA 3H9HB 5C0CE 1LMKA 1FN4B 4OZIA 4XNZC 2X4TB 2E6PA 1XIWA 2ARJA 1RZIA 2BNQB 1IAIH 5D2LA 4MA8L 1QR1A 3ULUC 1BP3B 3CVHB 3KLDA 4MD0A 5EOQL 4ONGH 2QQQA 5F7LB 3JV5A 1U8LA 3GI8H 3CX2A 2DS4A 3BDXA 2GQHA 4U49A 2NY6D 2J8UF 4Y16B 2GFBA 3VW3H 1G7QA 3UTPD 1F6FB 1MHPH 1VADA 1D5ZB 1R5VA 1KCSH 2VAAA 3WE6A 4P46C 2FHBA 2CQVA 1MUJB 2A73B 3GJEA 4AEHH 3H9YA 1OGAD 2AJUH 1PKQA 3W9DB 4R0LA 5H8DA 2OJZL 1YZZA 1P7QB 2E9WA 1HIMH 2I25N 2ITDA 5B39G 5HHNA 3CH1A 4TQEL 5BVPL 3CFCL 3QR2A 2M2DA 4LIQH 4AQ1B 4PY7A 3SKJH 2X41A 2D9QB 4GS7C 3FQTA 1JGVL 4GKSB 4BFBD 4TSBL 4X7TA 3O41A 1IGJB 4FXKA 1UM5L 1SJVA 1BWMA 3SE3A 1GAFL 2B4CL 4F8QA 4OCWH 1GHFL 4WU5A 3I2CL 2EYSB 4TUKL 2BXZA 4NWTL 4GT7A 1BFOA 1F58H 1K8DB 4FQHB 1DBAH 5F6HI 2C1PB 1KF9B 1MCWM 3HE6C 2H3NB 2XZAH 3WXVH 4I3RH 3RNQA 5C9JB 3VI4E 1UB6A 5ADOL 5GRJL 4YUEL 2RCSH 3HZKA 4ISVB 3F8UB 3LKPA 4WV1C 2J4WH 3LCYA 1B0GB 3MLYH 3NFPA 5F9DC 3MRRA 5DJYA 4HJ0D 1XF4A 5EUOB 1PX3A 4H26A 1AHWC 4JFEE 1OL0A 4PV9A 5ETUA 3QUXD 3ZDXE 4C56A 4HS8H 3C6LD 1A9EA 4X80H 3BGFC 3PHOA 2V5YA 3OG4B 4Z0BL 2DRUA 3H7BB 1P4BH 2PYEA 5AZ2H 3BWAA 2H45A 2H26B 3IFPA 4UDUA 4FABH 3B2VH 43C9B 3DETD 3RIAK 1ZHNA 3QQ9D 5T3ZE 4GBXA 1RSFA 3DV4A 5I1LA 5E8OB 4RQQA 3L7FA 4XMPH 1N5YH 5DSCB 4R97C 1CBVH 1FNLA 3EBAA 3QAZB 3H9SD 3UPRA 2E6JA 4WFGD 5CEYB 1RZ8A 5DVKA 5DD6A 1MVUA 2F19H 5C08D 1IC7H 3RTQB 4XXDA 3BVNB 4FS0A 1CS6A 2A74B 5J06A 1LNUB 3E8UH 4IIQB 3VMOA 3BH9B 1YEJH 3NIFE 4OF5A 3QIWA 3LHPL 4OD1H 4RFOL 5GGUB 5E2UL 2CJUH 5SX4H 1MVFA 3VJ6B 4ODHH 2DIJA 1NGYA 3QQNA 4U6VL 5DMKB 4XPAH 5B21A 1I8LC 1UJ3A 1JJUA 1BM3H 3X12A 1A4JB 3VCLB 2I9TB 1K4CB 2AW2A 3LY6A 4XC3H 4U1GC 2YEZA 4ZFOB 1A6WH 4EEEA 2XFXB 2WUBH 4ODWA 1KGCE 4Y5XC 2DQEL 3EYUH 1ZV5A 4PJ9D 5IUSA 1NCWL 1MRFL 2PUQT 3VFMB 4OBSA 1RJZA 3W39B 5CMAB 1IT9H 4TULH 1T7XA 2AJVL 4UT7H 1OSZB 2LVEA 2MHAB 5C0BE 3U6RA 4X5XA 2ZUVA 5CWSB 3X3FL 4BSVA 1BLNA 3RRQA 3TT1L 1WBYA 2PCPB 4FRWA 1JN6A 4UMGA 3BI9X 1F3RB 4FHBD 1VDGA 1Y6KR 1FAKT 2AV1B 4K8RC 5IBTH 3WXWL 2KZWA 1UXWB 4R4NC 1KPRA 4NQDD 3BGMB 5DJCB 5HYJB 4OZHB 3GMPB 4MA3A 1W0YT 3VI4F 2DBLL 4NUGH 1I4FB 4XBEH 4HXBL 5IM7B 2ZJSH 4MCYA 2D7TH 3SCMA 3V8OA 5IR1A 3LOWA 5DMGC 3RWJB 1J1PL 1R3IL 3IAQA 5I71C 1FV1B 2NTFB 4BQ6A 4NT6B 3ULUL 1QRKA 2D03H 3BZEA 3QEQB 3ZDXF 1I8MA 2DOCA 1MY7A 4PJ8A 4X83A 3UO1H 4ACPA 4ZTOH 2W60A 1MCFA 4A6YA 1S5IH 4X8JB 3CSYB 1EUUA 1FVCA 3LN4A 4Z8FH 3QNXB 5LJYH 4KQ3H 4MNQE 2XN9B 1MLCB 5F9JA 5LBSH 1QYGH 1JHKL 3BISA 4P5TD 5ACZA 1KXVC 2VDNL 5DJDB 2UUDK 2YPKA 5DD0H 3EZ8A 4A6YH 2G9HA 1QNZH 3RIFF 5J3HC 5JZ7C 5GGSB 4KTDL 2R8SH 3BIAX 3I02A 5JQ6L 1LE9B 5HJ3A 4Q0XH 4MDIA 1A3LH 3DUSB 4PRNA 1D9KA 5D1ZC 5F1OB 4UV4L 4QYOB 2AXFA 4OD3H 4ODBD 5D71L 3QDGA 3NCYS 4LCWB 1AE6L 1MHCA 4NHCH 4NSKA 4EN3A 4QRTA 5IWLA 2X7LA 4UV7L 2OR9H 3P0VL 4KTYA 3H9SA 2ADGB 4YIQB 1CGSH 3VWJB 1ZA3A 3ZSTA 2VXTH 4MJ5A 3VFWB 4KUCD 3IDNB 2H2SC 3NCFB 1JZ6A 5C08A 3LQAH 1VACA 1OP5H 4OF0A 3ALXA 4QF1B 5JXED 2IPKB 5B39B 2QKIB 4E42A 5KSVB 2GSGA 2JK5B 4DN3H 1BVKB 5F9WB 4PJ5B 2GJ6A 4CU8A 1TJGH 4UT6L 4S1QH 1CF8H 3HZMA 3QUZC 1XGUB 2X4QA 4HPOH 3G6JE 3GK8L 3D9AH 3SGEI 1KN2L 2ZUQB 2DQDH 4OFYD 5KSBE 3OJDA 5JXAL 2F5AH 3RDTB 5AUMB 5JW3L 4JZJC 4YO0B 1AXTH 4QOKD 3V4PH 3RL1B 1CLYL 5ID0A 4HMDA 4AZ8A 4JY6B 4UDTA 5FM8A 2SEBA 1EFQA 3MV9E 4AIXA 2APWA 2NW2B 5LVEA 5CZKA 3D85A 4QHNA 4YNYB 3GO1L 4JKPH 4K23L 1OP5K 1FH5H 3MV8D 5EH1A 1D7FA 3TYGL 3GUTB 4AL8L 2DLGA 4WW1B 4YHMH 4LLWA 4NQDA 1MI5D 4F3FB 1ITCA 4IS6B 4HC1L 3RKPA 1CYGA 3IRPX 4X0KB 4N5EC 4F15C 3G6AB 1WIUA 4S1RH 4MQSB 3X11A 3WN5A 1MJJA 4GMSH 2EE6A 4OB5L 5EU3B 4YHOH 3LDBB 5D2NC 1XGYL 3VFUB 3MRCB 1FVDB 5JA8B 3SKUD 2RHEA 1GGBH 5ISZD 1XR8B 1J88A 4APQB 2E27H 1LO4L 4NQEE 4RFEA 3P4MB 3WLWC 2XYCA 4WNQB 2Y9RT 1JBJA 2JCCA 2QSCL 1J12A 2NY6B 4KRNA 4P59H 1LO3H 1S7VB 5IVXA 4QGTA 1A6PA 4M5YL 3WFEH 3RP1A 1F5WA 3BYTA 1X6LA 5I66A 1U6AL 5JPNB 1OGAB 4P57A 2GK0A 4MAYA 1P9MA 2LAGB 3SKOB 4MDJA 3HZVB 1AXSA 1EHLL 12E8L 3PWVA 5EU6B 1A7PH 2VKXA 3VRJB 5JORB 5LAXA 1Q9WA 5E8EB 4F7PB 2EDNA 3QI9D 1A6ZB 1NSNH 2DI9A 1CGUA 3T4YB 1YEGH 1J8HE 4YWGL 1OCWL 3EDFA 5D7LE 3R06B 5TDPA 4PREB 4XCEB 5F1NA 1RFDL 1XGTA 3HRPA 5DJXA 2OYPA 1OTUD 4YHYB 5JHDB 4QEGA 1LVEA 2BJML 4JR9H 4DUVA 4R2GB 1EFXD 5DHVB 2HJLA 3VRIA 3BIKB 4LLQB 4YHLH 3G6JF 3FKUS 1BIIA 5DMYA 5D4QA 1HHGB 5M7QA 2QSQA 5KJRL 5KSBF 1G7MA 4TVPD 2VLJB 3DURB 3WDIA 1KB9J 1W0VA 2ED7A 5KVDH 4PJCA 5E95B 1RMFL 3ZE1F 3QUXB 4LHQB 4X9HA 1J1XL 5MERB 4JO3L 1RUML 3GMQA 3GB7A 3C6LB 1GH7A 4NHUB 4WU7B 4X7FC 5C09D 2E9IA 35C8L 4QOKA 5GZOC 1IGCH 2HJKB 4O51A 3FCTB 4E41A 6FABH 4R4BB 3KPSB 2AK1H 1K5NA 4JRYD 3FQRB 5CJXC 1GZQA 1VHPA 2C3HA 1WAAE 4M7ZB 1RURL 1V3KA 2ZCKH 2HTKC 3O0RL 5FUOL 2V5RA 3K2UH 3MV8A 4X6FB 4ZYKA 2D31A 2F54B 1UWGL 4NCDA 2FJHA 1NBVH 3C8KA 3KPRE 4RZCA 3U82B 5F9OH 2CDEB 4NO5A 1AGBA 5C0JA 1ZGLB 3BAEL 1UCTA 3EHBD 1ZVHA 3WUWA 1MCIA 1MJ7H 1RZFH 2D9CA 2NY4D 5I8KL 1LO0L 2X4UA 4RIRA 2J88L 1B6UA 2X4RA 5E08L 4BJLA 4K9EC 5D5ME 3CLEH 1GGIH 3QRFM 2IBZX 4X6DE 5ESVB 5FB8B 3OKKA 1LWRA 3RA7L 2IADA 3AS3A 1MFEL 3EZJB 2XKNA 4H1LA 1PEWA 2AXGB 2WZPD 4H88L 1QTYT 4NDMA 1P4IL 1MCPH 3DARA 2VABA 5BZWA 5EU4A 4TNVK 5FA4B 3S35H 1S5HB 4CMMB 3TM6A 3IKCB 4WFEE 4H1LH 1U8KB 4PJHA 2J8OA 3ARED 4DK3A 5J13B 4IRZH 4FZEL 5CUSL 5DQ9A 2VZVA 1FYHB 2ZOKB 4OF3A 4HS3B 1F3JB 4XNQB 5LWYH 1F4YL 1FL5A 1UM6L 4U6YA 5D7SL 1AGDB 4XPTH 3B9VA 3QI9A 2BSTB 3QQ3B 5IHBA 3FQXA 3G04B 2A2QT 1JRHI 3HE6A 1S8DA 3M1BB 4NC1C 1MJUL 1BQLH 4Y1AD 1RAMA 1JGDB 4NPYA 4FQQB 1U2CA 4GRWE 4JHAH 2K1MA 4JG0L 4S0SD 4PJGA 3OXSA 5D1XC 1EFXA 3MLTA 4NQXA 3GSVA 4QXGL 3D0LB 5INDB 5AAWA 4PRAB 3OKLB 4U05A 3OKOA 5HDQL 1PG7L 3TCLA 4LCIL 4LVOB 3ES6B 4JFDA 1NQBA 1T04A 5CILL 3MROA 4MS8C 3TNNA 3TH4T 4B7IA 1CU4L 2E7HA 5EZLB 4UTBL 2QQNH 2NXYC 1B4JL 1LILA 1L7IH 3TBWA 2JB5L 1NLDH 5F7MC 4P5TB 4QRPE 4QXTA 1EVUA 4Z0XA 3V4VH 1WAAF 3CXHK 3MLWH 4XVUC 5CEZH 5DD3L 4HIIA 4S2SB 4P23D 1XAUA 3JUZA 4G8GD 4YE4L 3DV6B 5FYLD 4YHZH 5DJZA 2PKDA 2D7NA 5KZCD 5F70A 1MREH 4JRYA 4U1JA 3E1F1 2NY3C 1AFVH 2Q3ZA 3GHEH 3IDMB 5IIEA 2EIZB 3S34L 3FN0L 5F93C 3T4AA 5FYKH 3VXMD 4Z77A 4LARL 1LP9F 3ARRA 2JJWA 5LGKA 2Y5TA 1CXKA 1CFTA 3NFSH 5L6YL 3ZDYF 1N4XL 1G7PB 3STZB 2VERN 2EZ0C 2UWEE 1CQKA 1FL6A 1IEAB 3P11H 3GNML 4JJ5A 5C71A 4X6BA 3D25B 4HZAA 1FPTL 4X6DF 2XTJC 1I8LA 1R6VA 3EO9H 5I76B 4G8FB 5EOCJ 2XQYK 4OF7A 1EBAA 4U2YA 3O3DA 1Q72H 5GGVH 4LP5A 5I75B 2HT3C 4OIIH 5KVGH 1C12B 1AIFA 4HSQA 1AD9A 4MNGB 3O6KL 3WNPA 3TN0D 2AK4B 1ZHKB 4M93C 4F7CB 1CGTA 1VFUA 1INDL 5GGTA 4KZEL 1MCSA 3VXUD 2XOTA 1GGTA 2VLME 4MX7A 1FYTE 3MBEC 1OTTD 1ZLSL 3VD9A 4PYHA 4DZ8A 4PRBB 2AV7A 4XWOD 5D96C 3WO4B 3HKFA 4PS4L 2L7JA 1MCNA 3GSUA 3MLXH 3ARTA 4ZAKC 5T1LD 2HKHH 3VH8A 3IDGB 3QJFB 4IDJL 3HAEG 4NO3A 5EBMA 1J0YA 4LCUA 1I3RA 3KR3H 5FO8B 1SM3H 1NCCL 4GRWF 5C0DA 1WSST 1G7HB 4YXHL 2CSPA 1U2HA 4QHUA 1MWAA 4P2OB 1NMAL 3VI3E 2HH0H 4PJBE 3AM8C 2UZXB 3KPLA 3OKEB 3LS5L 4FQPA 1UWEL 4JY5L 4M43H 1F2XK 2I26N 2XA8L 1R3KA 2V2XB 5E00B 3UC0L 5E1AB 1KPUA 1SEBA 2GIYA 3ZYZA 3VXSD 1U58B 4QHLB 1T1ZB 1UCBH 3BKCH 4OCRL 4YBQD 3TIDA 3S88L 3HMWH 2EXWD 5E56A 1N8ZA 4RRPA 1NAKL 4KI1A 3ARDD 3LKQA 2EDDA 2GUOB 3MTRA 4M7LH 2DJ4A 2YD5A 5ANMA 1KPVA 5M94B 3JV4B 1KLFA 1FGNL 1HXMB 4CNIB 4L29B 2ZZUT 4OBRA 1EHXA 1Q1JH 1YNTB 2FO4B 2F58L 3PQYD 1XF3B 4QRRD 3TO4C 5F7NC 5DURD 3BP7B 1U95A 1KACB 3QDMA 3QUMA 3MRLB 3MJ7A 4ZSOA 1T21A 4ZUUB 2QSTA 4G42B 2X5PA 1MFDH 2YD6A 2IQAA 4YFEA 5LGHL 1RQ5A 2EO9A 3NCYP 3OKYA 3QUMH 2NR6D 3VE0B 5ECJE 3HR5A 5DK0B 3O81A 4XCFH 4BUHA 5HHVL 3V5DA 4HEPG 5L88L