4MD0B

Immune receptor
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
189
structure length
189
Chain Sequence
DTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title A molecular basis for the association of the HLA-DRB1 locus, citrullination, and rheumatoid arthritis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4md0B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4md0B01
2M2DA 1RUKH 3C2AH 4U1IA 3BEVA 3OKKB 1J1OL 2NY0C 4DQOH 2VAAA 5EZOH 3FONA 3RPKA 2DD8H 4HDIA 4UT7H 3WD5H 1EAPA 4XPTH 1ZGLA 4U05A 2Z91A 5KVEL 1WWAX 2GK2A 1DBBL 3MLYH 4X5XA 5ELIA 2NY3C 1J0HA 2E5EA 4OUUB 4D9QD 1NMAH 3NPSC 4LPWA 4ZNCD 3CPLA 4TUOA 1U8NA 1R3IH 5ESQA 1P7HL 3TLRA 4EUPA 4Z7UA 4LSQH 3QNZB 5I1LA 1WBZA 3HA0A 1JZ4A 2HFFA 2X41A 2CDFB 5IV2B 1JTTA 2P46B 2DQFB 1QKZL 3MNWA 3NPZB 3VXRA 2KPNA 3V5HA 1E4KA 1T20B 2HH0H 2OXHA 2EC9T 5F21B 2VXTL 1DZBA 1WIPA 1YEFH 3L5WB 4NO5A 3MOAL 3SKNB 3G5VB 4HQQL 3L3KA 3BHBB 3VRIA 4KJWC 2PO6B 3GSVA 4LGPB 5HY9A 2BERA 2BVQB 3W0WA 2Y6SD 5D1ZB 2DQGH 4RMUA 2EIEA 4NZTL 4OV6F 4RWYH 5ADOH 1UT9A 2F15A 3MOQA 2ZUTA 1PLGH 2X4QB 3LKOA 1S9KC 1Z9SA 4H0IA 5ACZB 4WNQA 5JHDE 4NKIL 5C3TA 3SKUD 5CZKA 3WO4C 3P4MB 4I0KA 5FO9A 4JFDA 1DBKH 2EDHA 4M6MH 5LQBH 4XNUH 5E99L 5IMKB 3D3VA 5JHDA 4DTGL 2Z31B 3ZE1E 4I3SL 5CJQH 3PHOA 4XPGH 4K94H 4LRIA 1JPGA 4JFPA 1EEYA 2UV3A 3EFFA 5F8RC 4YHLL 4JM4L 4XBEH 3EFDH 1MWAL 1F4AA 3F6IA 4JG1L 3C60B 4ELKB 4MJID 3MRHA 4OKDA 4DW2H 1I75A 2VDOL 4MJ6B 5DQ9B 4YBQC 1X44A 2YWZA 5GJTL 1YEGH 1ODAA 1EMTL 2IMMA 3MUJA 4R4NC 5DUML 1V3LA 4NOFA 4LPXA 4KV5F 4NN6C 1FP5A 1BQSA 2HKFL 5E00B 3OPZH 4JFHD 1GHFL 2J4WL 2WUCL 1JNHB 1JMZA 1QP1A 1N3NA 3TVMD 2WV3A 1H3TA 4LNRA 2YRLA 5BVJA 1T89A 2V5MA 1A3RH 4ODWB 3IDXH 1AP2A 4JPIA 1A6UH 4TVPD 5FK9B 2VABB 1KIUA 6FABL 2E7CA 5F89A 4XC3L 3DX8B 4KHXH 2ZCLH 1AXSA 3QDGD 3UTSE 4ZFGH 3E6FB 4FQ1H 4J3VA 2EIDA 4KDVA 4V2CB 3QUZB 3N50A 3FQTA 4HLZG 2ADFH 2NY1C 3GMOA 5B4MC 3LDBC 1T4KB 2AEQH 3IJHB 3L5HA 3AAZA 1I1AC 4FXGA 5FFLA 5DVOA 2G75B 1FORH 5D2NE 2JCCF 5ESAA 4JO3H 2XKNB 3F7YB 2P8MB 3MV7A 1ONQB 4HUWA 4K7FB 3GKZA 1OF2A 3FAXA 3QUYA 3QCVH 4Z9KB 3TN0B 4I9WE 1CLZL 1IL1A 5C0JB 3NIDE 1DBJH 4D9LL 3RWDA 2NY4C 1MFDH 3DX9A 1NFIB 3QDJA 3ZE2F 1S3KL 1HXYA 2DIBA 2WQ8A 3IXTA 4BYHA 3P0YL 2H32A 4WEUD 2B4CC 5FA4B 3WFDH 5I2IA 2CJUL 3O4LE 5ICXA 4KUZH 4OLXL 2DQEL 2FD6L 3VFOB 4UZGA 3RKPA 4LMQI 1A7PH 1N6VA 1A1MB 4HT1L 5FM8A 3OKDA 3T8XA 3FJTA 3DTXA 3OAUH 4NQXA 3AS0A 2HT4C 3PG2A 2CO7B 4XAKD 2CQVA 1MCSA 1JWMA 4QRPB 5C1MB 4AT6B 2I25N 2IBZY 2DKUA 3FQUA 4WGWB 3DUUB 5HGBB 2XV6B 2HTKC 5MP6H 4LVOC 1YMMB 4R2GB 4WFHD 1MHHB 3RL1B 4YE4L 4AIOA 2WBJA 3O2DA 5D1QD 4PD4J 1MAJA 1WZLA 4PGCA 1EGJH 2IQ9H 4KJWD 5HI5C 3DRQA 1X3DA 2A0LD 2ZUXA 5IUSA 1EEUA 1YQ2A 3I3BA 3IRZA 1GC1C 3SDAA 1DE4A 3C09C 5EA0L 4G6JL 4XGZB 3KPRE 4LIQH 3V0VB 3BQUC 2VDNH 4NDMA 4FXKB 3MUGB 4OSUL 4YIQA 3QCTH 3B43A 3MXVH 2M8XA 2XPGB 1NBZA 5IIEA 3U6RA 3LCYA 1GJIA 4NWTL 5L2KE 4G8GD 2X4RB 4Z7QF 1RIUH 3FO0H 4ZQKB 2VLJD 3LSOA 5JPMA 1WIOA 4PRHE 5C6WH 5IVXB 4K9EH 2Q8AL 1IGJA 3CH1A 3U30C 5L2KA 5BW7C 3QPQC 5IK3B 1NAMA 3SOBL 1YDPA 3QAZC 3V95A 1T04A 1T5XA 4OCMC 4KQ3H 2EDBA 1MJUH 4GJTB 1RV6X 3MYZA 1N4XL 4NKOB 1Y6NR 4R4ND 3ULSA 2O5ZH 3MRDA 5CLTA 1U6AL 2BDNL 2GSIB 4GUPB 2X42A 4R6UA 1LP9F 3HAEB 5FKAB 4Q6IC 2QLVB 1NC4A 2VKXA 1FH5H 2MKLC 3IDIB 4LPYA 3FFCB 5I1CL 5EC2A 2Q87A 1ZXQA 5CILL 1IKNA 2GJJA 4XI5D 4PRPD 2FATL 3GKWL 3ZDXE 1I9RH 2FJGA 5SWZA 4FTVA 2GIYA 1J8HD 1IAMA 1JVKA 4JO4L 4YAQB 1U2HA 3L1OH 2O5XL 4J2XA 3HAEH 3V4UH 5JOEA 4NNYA 4K7PH 1AH1A 4HEPG 1PSKH 4E5XB 5I1DB 1AFVL 2VH5H 3CK0L 2UZIL 2FR4A 3VJ6A 4P2YA 3TESA 1WZ1L 2R2BB 3GSWB 5EUOA 1C5CH 1NGYB 4HC1L 2OJEA 2AK1H 4S0SD 1LEIB 4NZJA 3M17A 2PTTB 5B4MD 3MGOA 3MV8A 1IC5H 2ITDA 1BJ1J 2YN3A 1L6ZA 2B5IC 1O7SA 3SO5A 3I6GB 3IFOA 1KBGH 4PJIE 5CMAB 4WW2A 1KG0A 4P2RB 4S1DC 5DD6A 1IAIL 2EDXA 3MRBA 3H9SA 4A6YA 1DVFB 4M3JA 5JOPE 3RVVC 2EDQA 3EDDA 3T0ED 4KJPC 3GI9L 5I16B 2ZOKB 4CVWA 1YYLH 2A38A 1UJ3B 5GISL 4G3YL 1FC2D 4BUHA 5L0QB 3FB5A 3BD3A 4OZIB 2AV7B 3UPAA 1CR9H 5EZIH 4LQFL 5FAAA 3D85D 1YN6B 2W9DH 1S7SA 5F9WC 4OTXH 3BGMA 1AIFB 3LZFL 5I76B 5EBLB 1A02N 2DIJA 3VDBA 2AI0L 2VISB 4MNGA 4PJ9A 5F3HB 4YXHL 4JFYB 3EZJB 1HZHL 2IBZX 1OAUL 3QO0B 1WFNA 3CH8A 4JFFE 5F88B 5GPRA 4IS6A 2E7LA 1KJVA 5ABDE 3PJSB 1QPXA 4YHYC 4JQVA 3RGHA 1P53A 5IBUB 2HG5B 4WY7H 4Y19E 4F58L 4WU5A 3HE6A 1H3PL 1V3JA 2DBLL 3IXAA 3WMSA 4XT1C 3R0MA 1I1YB 4ODVL 4R96B 3DROA 4LCWE 5HI5D 5B8CC 3C5SA 1AI1H 3RVUC 2P42B 1QBLL 4UMGA 3T4AB 2NXZD 3QCUL 4Y7MA 1ZHBB 1RZ8A 3IGAB 5L7XH 1FZKA 4XNYL 4DAGH 5DZOA 4L29A 2VN7A 5GRWA 5DD3H 1AR2A 4BH7A 2IPUG 2H3NB 3EGSB 4TVPL 4LSSH 4ONFL 3THMH 3KPNB 3OB8A 4ENED 2QHLA 1U8IA 5GS2H 2BMKA 3QFJD 1EA9C 5C0BD 1E6JH 4PJFE 4WFEE 3D39D 1GOHA 3SDXA 4HCRH 4LLMA 3VW3H 1R6VA 5A43C 1V7NL 1FVDA 3QPQD 3DO3A 2VO5A 2BY3A 4Y4HB 1N6QH 3WHE0 5JLZA 4C54A 4PRNB 3BKYH 4P99A 3DURA 3R1GH 3FMGH 5SV4A 4AQOA 3GBNH 4NUJA 3SDDA 2CPCA 3NCJL 4PRIE 3MACL 3OKOA 2DQTL 4JB9H 4PV8B 3SKJH 2C3VA 4NM8H 2V2XB 5CEZD 1IM3B 4XAWL 1B3JA 1YY8B 3LPWA 3FT3B 2P5WB 4PGEB 1JBJA 2PNDA 2I24N 4MNQB 4CUCA 3GMMA 4M7ZC 4X6DF 5FHBH 1AGFA 1EO8L 1I8MA 4N0UE 5GGUA 1U58A 1V7ML 5LWYH 4CN6A 1A4KA 1NSNH 4L3EB 4ORGA 1QFHA 5FYLD 2NNAA 5A1AA 3HS0A 1JN6A 4OCLC 3TPUB 4RMRA 3V5KB 4NQEA 4P9HH 1OSPL 5E7BA 4P2QD 1V3KA 3SJVD 4OCWH 3FO9A 3MJ8B 4R4FH 5DJAB 5C09E 3UJTL 3PHQB 4I2XE 2WWKT 1UZ8B 2HRLA 3RTQB 3BDYL 5IVXF 1PDKA 2O26U 2J8UB 5FHAH 2Y4SA 3CSBA 4I2XA 1IBGL 4XPBH 5HHOD 3LEVL 1JRHL 5DRNA 4Z7VE 4BUGA 2R1WB 1R5IB 3G5ZB 2H6PA 5IFJB 4HKZA 4DCQA 4JLRA 1K3ZA 1QKZH 4R4BA 3BDBA 1WSST 1IFHH 4NC1C 1HOCA 1J0ZA 3GMQA 2XRAL 3BWAB 2VXTH 5F9OL 4HSQA 3F8UB 4PJCB 2O5YL 1BF2A 1MCDA 1IAOB 4M62L 4Y89A 5CP3A 4FQJL 3IJSA 1AJ7L 5CJXA 3CX2A 4NZTH 3H8NA 1AQKL 2R1XA 2WK2A 3S36X 3QT2A 4TULL 2QQKL 1KPUA 4WV1A 1DQJA 4BSJA 5E1AB 1FNHA 1H15B 5F7UA 1DFBH 5C08E 4RMTA 4LKXB 2ADJB 3QDME 4WCYL 3B5HA 3BPOC 4P5TA 2BOBB 3RWCA 3CC5A 4M7LT 5E9DD 1MWAB 4F15C 4R0LC 1IZKA 5D5MF 3RPIA 4PGZA 3MV01 4UQ2A 5A2JH 3IFPA 4DTGH 4YX2H 1WEJL 2ARJB 5BJTB 1YEKL 1E4XH 5E70A 4X6EA 5HPMA 4N8VB 1DANU 3S88L 2X70A 2PETA 3VFRA 3ZYIA 1MWAH 1JPTL 2H9GB 3LD8C 5EU6A 4URTB 4XCEB 4XZUB 1S9XB 3HI1B 5IM7B 4POZD 5B39A 4LVHC 3ILQC 3P4OB 3ROLA 4UNUA 3UYOD 2D9QB 1DEEB 5A16B 4JRXA 1TDQA 4OF0A 2HKFH 4XB7A 1S9WA 3SDYL 2RBLA 3V8OA 4OV5A 4G42B 3T65B 1MLBB 4DK6A 3ZT5A 3Q5OA 1MCIA 3WFCL 3O3BA 1EBPA 1TVBA 5ERWA 1JGDB 2I60L 2IADA 2Q20A 3LMJL 4ONHB 2ARWA 2F54D 2DLEA 2XFXA 3G08A 3Q5YA 3FQNB 1BEYL 2AABH 1VA9A 5TF0A 3ARBB 4OZFB 4YHIA 1XGRB 1S7QB 1WFTA 4X98B 1P2CA 1N7ML 1VFAA 6FABH 5CJ5A 4XC3H 2DL2A 4AG4L 3LKQA 3F7QA 4BFBD 1HYSC 1A7NH 2YD7A 4ELMB 4P3DB 4PJEB 4XMKL 4LSVL 3CVHA 1M7XA 4OZFH 3PWJA 5DFTA 4O5LL 3D2UB 4Q2ZA 1E6OL 1N59A 2KL6A 3VFMA 3TJEH 2P24B 5JDJA 1HH9B 2RJMA 4OIAA 3UROR 3D9AH 3ULUL 5GGSB 4ZTOH 1CLZH 1G7MA 2D0HA 3NACH 3GSNA 3VMNA 1FFOA 3B2UC 4KFZC 5I17B 1S7WB 2OS7A 3LH2L 3STLB 1FFPA 5T3ZD 4NQVA 4K8RL 4S1RL 3DVNA 1HHJA 2CJUH 2HJKB 3KJ4C 1JWUB 2DQEH 4R97B 1E4KC 3ULVL 3MV9B 4CU6A 3EJYC 5AWNH 1P4IL 1NC2D 3IKCB 5TE6H 4NKDB 3BMVA 3LAFA 4NYLB 4QRQB 5IW6A 1G9MH 1HXMB 5L8KB 3MRLA 4MLSA 4PBXA 2OM5A 4H0HB 3Q2CA 1YC8A 1NCAH 2VERN 4MJ4A 4UILL 2DI7A 5HYJD 1QRKA 5J0BA 3O3AB 3CXDH 5CIPB 5I8EA 3MCG1 1QEWB 5GRUH 4F7EA 1HYRC 1NAKL 2VDLH 4PJHE 4Z95L 4Y4FB 1WK0A 3BJLA 1S7RA 5BQ7B 4OF5A 5EFIA 5F6IC 3I6LD 5L88L 3UAJD 1NEUA 1T1XA 4OF8A 3K8MA 2FYYB 5T1KA 3PWVA 3E6HA 1T83A 3OJMB 4LRIC 4Z5RA 5FXCH 2AJVL 5EA0H 3VXOB 5IFHH 4G6JH 4PY8I 3H9ZA 5K9QG 3OHXB 1KB5A 4G8FA 1DQQB 4KJYA 2X05A 3LKNB 3FQXB 1FPTH 3RA7L 3QEUB 4JN1H 2VSDA 1QR1B 3U1SL 1FL6B 1FGVH 3BP6A 5FYJH 32C2A 4ZFFA 5CEZL 2FLBT 1L6XA 2D0GA 2FIRT 1DN0B 3C8KB 3HNVL 3O6KH 1CFVH 3MFFA 5EBMA 3QQ4B 3MFGB 4ZUUA 3UYRH 1IKFL 2Y7QA 3PQYD 2QSCL 4PJGE 2GJZB 2GI7A 3AS2A 1T89C 2DTSA 3QULB 5DURB 3ILQD 1U6AH 1ZLVK 3U7WL 1JL8A 2G60H 4XXDA 5FYLL 3REVB 5I1CH 1NCCL 5CILH 2H2PC 1MJ8H 4ESKA 1ZA6A 4KI5F 4YDKL 5F1SA 1MNUL 3JV6A 3GKWH 2R4SL 4YHOL 2AJSL 2QHRL 5HYEA 5MENB 4JO4H 1MCWW 15C8H 4LCIL 4X7SL 4D3CH 1F90L 3PHSA 1I8LA 1KT2B 4XCYA 3DMMB 3FRUB 4H1LH 2DDQH 5E8EB 4E0RA 5I75C 4XNQB 2OP4L 2I26N 2XT1B 4HD9A 3DRTB 5ALCH 4Z0XB 4HC1H 4XP5L 1UWGH 3WIHA 5I15L 1HYSD 1HCVA 2UWEA 2XQYK 4LKCA 4M8QA 3DBXB 4N9GB 3QHZH 3NA9H 3LS4H 3HCVB 3GDBA 1INQA 4QOKA 1Q38A 4I1NB 4RFNB 4XNMB 3QBTB 4JKLA 4HS6A 5JIIA 1GGTA 3BZEB 4FG6C 2Y06L 3U46A 1OGAB 4LAQL 1R0AL 1UVQB 3CD4A 3P11L 5F7LB 5SWSA 1HHIA 3DV4B 4RDQF 1C7TA 3OKNA 3GI9H 4ZPTA 1T1ZA 3OB0H 2H26B 5DMYA 4TRPL 4G6AC 3X14A 3IS0X 5CCKH 5T1MA 4OLYL 2ZP0T 1BFOB 1KFAL 2JB6A 3RHWF 2C3GA 2CKBA 3EJYD 2KH2B 1OLZA 1OP5K 3RDTA 4NQDA 4IOSD 1H5BA 2BK8A 2ZSWA 2R2HB 3ZE0E 1CD1A 1T22B 1FHGA 5E94A 4DGYL 1ES0B 2AI0H 3W0WD 3O3EA 5KTEL 1JF5A 4YXHH 3ETBF 1HZHH 3KPLA 1OAUH 2VL5A 1FC1A 1HHGA 4NC0B 4ELMF 3SDAC 3P73A 1MCHA 2PTVA 4Y2DA 3HUJF 5FUCE 1DQTA 4PJAE 2QKIA 4HUVB 5IB4A 4F58H 3E3QE 1H3PH 4JFDD 5E0QA 2DBLH 2BY0A 2YRZA 3TVMB 5EZLA 4J4PA 4QCIA 3HPJA 4RMSA 5INDA 4LQ1A 5JHDD 5C0CE 4MAYC 1RI8A 3BW9B 4GG8A 3L6FB 2X4OA 4Y1AA 1QBLH 5I66B 2E7BA 3QUMB 1I9IH 2QSVA 1FAKT 4XP1L 3IRPX 5GGQL 4PLOB 1AGDA 4UV7H 4UUJA 4NKQB 1A6AB 2PW1A 1A6ZA 3CZFA 3JWDC 2IPTH 2ID5A 5A2KH 4P46A 4MX7B 3S3JA 1L9NA 1OAKL 3WN5B 1MUJA 1IKNC 1Q8MA 3QUMH 3CXHJ 4KRLB 3UPRB 1OP3K 3HZVB 3LRSB 3LS5H 1UG9A 5BZWB 1TZHB 3QP3A 5MEPB 5DTFB 4F33B 2FJFB 4GG6E 4N5UA 4UT9L 3VG0L 2ZWLT 4Y88A 3QA3A 3IDYC 3NCJH 4GS7B 2VQ1B 3EO0A 4JPKL 2NY3B 3Q5TA 5DZLA 5E2TL 1U8OA 3MRKA 4LU5H 4LCYA 5E5MA 5FOBB 3RWEB 4XAWH 4BH8B 1IGML 2H2PD 3NPSB 3ZO0A 5F72S 1XIWA 4FQIL 1GH7A 3V4PL 3KHQA 1U8PB 3Q3GA 4YHPB 4ERSL 5DSCB 1V7MH 3MV7D 4WW2C 3FZUD 3D0VA 5EOTA 3QUYD 4TUJA 4FFVC 4LLUA 3MO1B 4U1LA 1VACB 5KSVA 3QJFB 3OJDA 1NJ9A 1HSAB 4MSWB 4WO4A 1MI5A 2YPLE 5INCB 3NCYP 1MFCH 3L3OA 1JI2A 3QDJD 5EU4B 3V4VL 1OSPH 3VFGL 4U3HA 4F7CB 5BO1L 2X4PA 3KHOA 3MROB 1OTSC 1CDBA 2YPLA 4L3CA 3TZVD 3QG6A 1A7RL 5IHBA 3MJ9H 1H8SA 4JDTH 1G7PA 4YC2C 5I30L 2IH1A 3BDYH 3PGCA 1GZPB 1WWWX 4G8IB 4UT6L 1R3HB 1F3JB 1KJMA 3VFPB 3O4LD 3W39B 1G7JA 3L3DA 4FG6D 1JRHH 1BVLB 2XWBB 3WO4B 5D7LE 3OR7B 3WFHB 2PYFA 3QG7L 2BVPB 4PJ9C 4C83A 2UYLA 3WNNA 2DL9A 4YO0B 4BSWA 1HKFA 3PF2A 3E8UH 2E7LC 3D69A 5D7LA 4JQVC 2KKQA 2WBJD 1JHKH 2VLJB 2XRAH 1N5AA 2N56A 3HE6C 3SKOA 1EFXA 5B38A 2IPKB 1U3HA 2N7AA 2HN7A 1BVKA 1P5VA 5CD3B 4MCYA 4AZ8A 1AJ7H 2DQDL 1AQKH 5KBNC 2X2YA 2QQKH 4PJBE 1D5MA 1E28B 3KVQA 5HHNA 1UFUA 1OOAA 3G6JB 3O3DA 1XF2A 1M7DB 1KJ2A 4KRMB 1XEDA 3G9VA 5ISZA 2MHAB 4R7NB 3X12B 1QPPA 1CL7I 5DS8B 4PY7B 3BIKA 4JM2D 2JCCA 3B6SB 3KPRD 5HHMD 1G7LB 1A1OA 2C7UA 4IOFD 3BISA 5FKPA 5IMOA 5DUBB 1HILB 3TBTB 1OB1B 4GBXD 1K5NB 2DQIL 3P4NB 4CNIA 2OTUB 5L2KD 2V7NB 4FQPA 1ZHLA 4FMFA 4MDJB 3ESVF 5B21A 3N9GH 4U33A 3BFOA 3O81A 3DETC 5HD8D 1I1AB 3SDDC 1NC4D 4R8WL 1CN4A 3LQZB 4KMLB 3MRFA 4G9DA 5EO0A 5HVHC 4QTIH 4HFWA 2X5PA 3B9KD 2R23B 1IGCL 3ECBA 1JTPA 2NY4B 3WFEL 3T0EB 2ORBL 2AK4E 5CZVH 2GITA 1BEYH 5KVDH 1MLCB 3O8XA 4GQ9H 1CE6A 4I18A 2F5AH 5HHQA 4JKMA 4MHHG 4DN4H 2J6EA 1DCLA 2CDGA 2ZPKH 4O2CA 5HI3D 4LHUG 4AYFA 1ZHKA 4NSKB 3FB8A 5KSBE 3D85B 4XP4L 1U8MB 3GJFB 1B88A 4BK4A 4XMKH 3BUTA 4LSVH 3GZKA 4NKMB 1RUMH 1C08A 3K8LA 3IAGC 4QXUL 4KK6D 4O5LH 4OAWA 4ZPVA 5IWLA 3G04A 4I77L 4MVBC 1E6OH 4IRSD 3RGVA 2YPKB 3C9NB 4ZYKA 4GKNB 5I8CA 5DJDA 1INDL 5DJ2B 3HMWL 3FB6B 2F53A 4NGHH 4X6FA 1JV5B 3GJFH 2A6JB 1GOFA 4CW1A 4JO2H 1BPVA 1PD6A 5HHXL 2ERJC 1SJEB 1B4RA 4HF5L 4CN4A 5EG6C 5KG9A 1VGEL 3LH2H 2DKMA 2OTPA 5JQHC 4U3XA 3NTCL 1X5XA 5JOPD 1F6AA 3MGTB 2FB4L 4N0YL 1G6RL 4QHLA 4G7VH 3FO2B 3UZVB 3KPSA 3QNXB 3QXWA 1XGPA 4BFIA 2GJ6B 5J89A 4YHZH 3BQUB 2COQA 4FQLH 1CFTA 3GMPA 3ARGA 5FO7B 4E41E 4U1SA 1NEZB 2CGRH 1G1CA 5CJXC 2F58L 1LP9A 4LLQA 1WF5A 1W72B 3DIFA 3S36L 1E27A 3PL6D 4AMKL 1JPST 4QXWA 4UILH 1KTKE 1GC1H 4WV1C 3UJJL 2XY1A 4K71B 1ORSA 4O51A 2IC2A 3NCCB 4I8DA 2BVQA 2J88L 3QFJB 1ZEAL 1FZMB 2A83B 2O61A 4JFFD 1IAKA 3HE6D 4P5TC 3VI3F 3U30B 4HWNA 2UVEA 4JHAL 4RFOL 1W72H 4JG0H 5JIHA 5L88H 2E27L 3LV3B 4WI4A 4Y19D 1UXWA 1R3KA 1RFDL 4J3WA 3VFUB 2P5EB 3FO1B 4RGNE 4KVCH 4Q6IB 2AJVH 1DSFH 5EUKA 3S98A 1JTOA 5JHLH 1TXKA 2EDNA 3KNBB 4M4PA 5HTSA 1I8KB 3GK8L 4LP5A 3EDKA 3RA7H 3U4EA 3VI4F 4PLKC 3N0PB 1B0GB 3HRZA 2W0LA 3VFSB 1I9JL 3IETA 3LEXA 3B9VA 3WHXB 1XZ0B 3PWPE 5CEZH 5BCAA 4YDVA 2FBOJ 4LAJH 1T03L 2YUVA 5DLML 4AENA 3FAWA 2J5LC 4FA8A 3SCMC 1A0QL 4WI2A 5SWQB 1TFHA 4P2QB 5E00A 4WFED 3QIUA 4BJLA 3RWJB 5E2VL 3FTGA 2D7TL 4UNVA 2LU3A 3NGBC 1UM4L 1GAFL 5I6XC 5FYLH 1DL7L 5JZ7C 4FXLA 1J5OH 1F4WL 5K9OA 4MJ5B 3D87B 1UYWL 2Z93A 1MNUH 5D7JA 1F3DJ 4XPHL 4PRID 2R4SH 1CLCA 5HHOB 2LU7A 2AJSH 3LB6C 4PJ7F 5FOJA 1PY4A 2WAHA 1YYMH 3EOBB 3H9YA 3FCTA 4G80B 3BP5A 4HXBL 3BIAX 4HKXB 1QYGL 1RULH 1NL0H 4OIIL 1MCNA 1A9EA 2DLFH 3UDWA 2VJXA 1RUAL 2K1MA 3EZ8A 3Q0HA 4XP5H 4ZOCA 1PKQA 3V8CA 5C6TL 2X7LB 1QLFB 3C8DA 3VGAC 3JUZA 4MVBD 1UGNA 3MRPA 4U0QB 1EJ6A 4Z77B 2MKWA 1AR1D 1MFEH 1U92B 2EXYC 2G9HB 4YHYB 2GTZB 3ZDYF 4APQD 2Y06H 4JFOA 2BNRE 1R0AH 5JA9A 3P11H 4HJGB 2R1YB 1D9KA 2MCPL 4CMMB 3O11B 2C3XA 4L4VB 3TCXA 3UXFA 5E9DB 5K9KA 5ID1A 4TTGA 3F7PC 3GSXA 4OLUH 4AIZA 1VADB 5HYIA 5SX5H 2A73B 3TBYB 4RAUA 2HAZA 3WSQL 3QQ9C 1FYTA 5EPMB 4AT6A 1YY9C 1FL5A 1WBYB 3DUUA 1TQCC 1JF1B 4LARL 3BH9B 3TNNB 1HQRB 3MRMA 3P0VH 1IGTA 4DGYH 4QYOB 4MDIB 5EDXA 4QF1B 1ZT4B 1BIIB 2FO4A 1T83C 4NQCE 3W9DB 3C08L 3AXLA 4IDLA 3ULUF 1CFQA 4O2FB 2VOTA 4EQ3A 2WIIB 3NFPA 3V6ZB 5DHXB 4Z7WB 1T66C 4KJQC 3MMEB 4UBDC 1UM5L 4FZEL 5FB8B 2CD0A 2XN9E 4P5TD 1S9VA 4P9MH 4X6DA 5J12C 2HA1A 3SQBA 2AV1B 3BVNB 1EFQA 1P7QD 5DMGC 7FABH 1KLUB 4FXKA 3ULVF 4XVJL 3B2VL 5DVKA 4MNHA 3VH8A 1X5ZA 3DSFL 3B9AA 1QZ1A 5C92A 4UOW0 1G7HB 4G6KL 2DQHH 1CLOL 3SN6N 2PYEE 2B0SH 1BBDL 2PCPB 4PRDA 5F1IA 2Y23A 3HC0B 1QRNA 4Y8DC 2V17L 4CMHC 1FGNL 1NFDB 2YD9A 3RZWA 3LKRA 3NCFB 4JRXD 5DO2C 5DMJB 1NCWL 1RHHB 2VLRA 1F8TH 4F8QA 1KUMA 4PUBH 4KTDH 4LLDB 1JGEA 3D0LB 1JE6A 1IQWL 2LV4A 3BP7B 4LBEB 5MERA 2V2WA 1H0DB 2DMKA 1QFPA 4UT9H 5IB3B 2N4IA 1AKJD 3HC3L 1A5FL 3BZDA 2R4RL 5SV3A 3ARZA 3EO9L 1ZOXA 3V0WH 4JPKH 4XPFL 3F5WA 1BQLH 3HKFA 4KH2A 1IGMH 2C5DC 3MCLL 4OCXL 2VE6A 3F58L 1ZE3C 3BGFC 5T3ZH 4FQIH 2XQYG 1NC2B 2NMSA 2XOTA 3V4PH 1LO2L 2JLLA 4GW1B 3TYGL 5CD5D 4Y5XA 3RAJL 3DOSA 2NTSP 4QTHB 4FQXC 1QSFE 3S5LG 5D9SA 3MLZL 1B4JL 5HDQH 3NCMA 3WUWB 2FJHB 5HYJB 3Q1SL 4PP1C 1FFNB 4YUEH 5TFSH 1KB9K 5IB5B 4KROD 3V4VH 1FO0B 5BO1H 4U2ZA 1TJGH 2QADC 4S2SB 5BRZB 4LPVA 5D5MA 2IQAA 2A2QT 5FECB 3O6ML 4KRPC 1RJLA 5C0AA 3RVWD 3BSZL 5ICZB 1M4KA 2E9WA 3DLQR 1QFOA 3ZTJH 4UT6H 4FFZL 2R56L 3U9UA 3WL9B 2GK0B 3MNVA 1FO0H 4MGXA 4GLRH 2V9QA 1IC1A 1Y6KR 2FIKA 1H5BC 3MLWH 2AVGA 2YXFA 1W0WA 3SDCA 2W59A 3BPOB 3QG7H 4JGMA 2X4UB 4EDXB 1XH3A 1L9MA 3HE7A 5EU3A 3NZ8A 1YN6A 4G9FE 1Y18B 4F15B 4R0LB 4JFZH 3WXVL 1I3RA 5DK0A 4X4YA 4OCYH 3EJZC 3BT2L 4XPAL 3QQ9D 4KKAD 4OD2A 5ECJE 3BUYA 4HUMB 3VFWA 4X6CB 5KJRL 1WQVT 1RMFL 2X09A 5DI8A 1U3JA 4LGSB 4XTRD 4J4PC 3LD8B 3PQYB 4LEOB 4O9HH 1CGWA 3B83A 3BO8A 1YQVL 5T1KD 1P4BH 3QDHA 4LVHB 4F9LA 2XACC 1KN4L 1Q9KB 1GGUA 1HE7A 5D7SL 5E8OB 25C8H 4GRLA 1I7TB 1RVFL 5GSVB 3CLFL 5HDBE 1C12B 1T66D 2EDJA 1RZKL 4KJQD 5D7IF 1HHHB 5KS9B 1DLFL 1MHCB 1RJZB 4JVUA 2OJZL 4R9HA 3U4BH 5J8OA 5D93B 3OF6D 2VB5A 4H26A 2QR0A 5JPNB 3UTPD 5C0FB 1CFSA 4PG9B 1HIMH 3CUPA 4HMDA 5GIRB 1F2XK 2OMBA 4P46C 2VZSA 1LEGB 3A6BL 5E8PB 1KIRB 3L95A 3HR5A 1K8IA 1D5ZA 2I5YL 2DQIH 3WBDA 3P4LA 4HCRA 4F7TA 3ZKMC 3U4AA 3OG6B 3C5ZA 3KLSA 2BNQE 2GT9A 4GT7A 4HKJA 4U1IB 3VFTA 3BEVB 2N1KA 1MIEL 4X0KA 3MOBL 1ADQL 2VAAB 5CSGA 2ZUWA 3K4AA 3FONB 4HDIB 1EAPB 1FNEA 1ZGLB 2Z91B 3DI2B 1QFWI 3PV6A 5DO2D 4Q9QH 4X5XB 4NNPL 3EYFA 4LSRH 3RY4A 2X4TA 3MLTA 1I1CA 1IGCH 2BX5A 1FSKC 1XIWC 4DGVH 1UKSA 4TUOB 1U8NB 5ESQB 3O2WL 4N5EC 4EUPB 1OARL 4Z7UB 5I1LB 2ORBH 5EBWA 1WBZB 1CLYL 2NW2A 3AS3A 5C07E 2HFFB 5BS0E 3BD5A 5AAMA 2ESVE 1Z3GH 5GGVL 3KJ4B 2NXYC 1WV7T 3VXMA 3VXRB 2PUQT 3FOMA 4WO4C 3V5HB 5E8DH 5A3ID 1VENA 2CLRA 3DGCR 1J11A 1URLA 3QNYA 4EUPH 4L8CA 1RURL 2OR7A 1Z6JT 4NO5B 1RUPL 4KKNA 2ZCHL 4H20H 5JUEL 4QNPF 3L3KB 3VRIB 1BAFH 4QXUH 1MCQA 4KTEH 3D48R 3GSVB 5C2BL 5HY9B 3CVIL 3TO2A 3W0WB 4QOKD 1H3WM 3O9WD 3MGAA 1JMXA 4KK8C 3L5XH 4G8EA 5T3XE 5E08L 3LKOB 1KV3A 4WNQB 4KUCD 3IDMA 4P2OA 5HHXH 2A1WL 5SWSD 4U1NA 4ODXA 3CFBA 2QADD 4JFDB 5FO9B 5D72L 1BECA 2EC8A 1JWSA 2J7LA 3IDJA 3S37X 2VDQL 4DKFH 3DJ9A 2JJTA 3D3VB 5F6IB 5JHDB 3NA4A 1YEHH 1UH4A 3O0RL 1B9ZA 3PHOB 2ILLA 5EC1A 4NT6A 1JPGB 2VLKE 4EKXA 4JFPB 4M5ZH 4L4TE 1EEYB 5IT2H 3EFFB 1OCWL 3RDTD 1P84J 2CK2A 4N1HB 1U3HC 3MRHB 3KYNA 1J10A 1X5JA 1SBSL 5ENWA 1K9TA 2L4OA 4IHOA 5AYUL 1F3DH 5ALBL 1EHXA 1UACL 3UJJH 4M00A 3EJZD 3TA3A 4Y2DD 2W9EL 4F9PA 1A6PA 4WHDA 1ZEAH 5ACLA 2VXUL 3ZYZA 5EU7E 4KTYA 4JHAH 1N3NB 4X7DC 4J4PD 4M1GL 2EC9U 4LNRB 3RNKB 1J0JA 4J6RL 1EEQA 5E1AA 1UA6L 2A6DA 3WE6A 1DDHA 4JPIB 1AP2B 2ADJA 2OQJA 3VXSA 1MRCL 5I0DA 1NANH 1RUQL 4DK3A 5F89B 4RISH 4U1GC 4TYUA 1AXSB 1MWAA 5C0CD 2C3WA 3SGDH 2BVOA 5I73C 4EBQH 3FQTB 1LO0H 3GMOB 2GFBB 1Z9MA 3GK8H 1UWXH 1MCWM 1MY5A 3AAZB 5T5NF 4ZFOL 4PV9A 4JFEA 4FXGB 3SPVA 4M7LL 2E9IA 5K93A 4DN3L 5ESAB 3CDYA 3MV7B 4HUWB 1OF2B 2BY2A 2FL5A 3QUYB 5D8JH 4XCEA 1S9XA 1GL4B 3ZKMD 5DLMH 1IL1B 4NQSA 3ZL4H 5I75B 1VESA 5E95B 3RWDB 4XMLH 1A0QH 3QDJB 3DX9B 3TV3H 1AC0A 4E42A 1HXYB 4NJAH 2PXYD 3O8XC 3IXTB 2WBKA 5AZ2H 4I18C 1CU4H 4JN2A 5BV7B 4HHAA 2H32B 1SEQL 2APTA 2DOCA 5I2IB 5E2VH 2D7TH 5ICXB 4X4XA 1QOKA 1UM4H 2EECA 4NRXA 1GAFH 4X6CF 2D4DA 3SKMA 5H37G 3VWJA 4DOHB 4RAHA 1UYWH 3OKDB 1GGCL 3T8XB 5I1IL 4XPHH 2QV2A 1YPZF 3DTXB 4N5ED 5BV7H 4NQXB 1PBYA 3TIDA 3VD9A 2Y5TA 2E9JA 5D2LE 5IWLC 5DC0A 1JWMB 3RGVC 3MA9L 4M8VA 4Y0GA 3CSYA 4ELMA 4KZEL 1PJ9A 5M7QA 1SYSB 4OGZA 5ITFA 2XZAH 4GXUM 1LDPL 4HXBH 4R3SA 4X7FC 1BGXH 3HUJA 2HLFD 1RUAH 5E2WL 3KPPA 2WBJB 2R0KL 4TTDC 5C9KA 4M43L 2XG5A 4RMQA 1ZV5A 5FGCB 2XA8H 4QRTA 4CBPA 3S5LA 4PGCB 2OL3L 2D31A 5HYQA 2EKSA 3RUGE 1OAYL 2YPLD 3K46A 5BXFB 3ZMRA 3FN0L 1JZ8A 4JPVH 3DRQB 3MBED 1S7VA 3HNTH 3GO1H 4KK8D 1F13A 2HT3C 3O2DH 1A8JH 3ZKNC 3SDAB 3IFNL 3O41A 4GRWB 1DE4B 3RUGA 3UX9B 1S7UA 3U0PA 4Q6YA 2APWA 2XZZA 3JWOL 4C56E 4NDMB 4B50A 4JAMA 4N9OB 4QWWD 3ARGC 3CMGA 2GYSA 1D5BA 4YIQB 1KLFA 1ZLWH 3MV9A 1NBZB 3O2VH 4WUKL 5IIEB 1S7TA 3KPRB 3O4OC 5HHMB 4HBQA 1T3FA 1XAUA 5D7LD 5DR5H 3OZ9L 1HXMA 3LSOB 1UZ6F 1DQLH 5JPMB 4UTBH 3T1FA 4QRSA 5DK2A 4GKSA 1IGJB 3CH1B 4NHUA 3STZA 5L2KB 2YPVL 1U3HD 2XQBL 3F6LA 1NAMB 1YDPB 1T04B 1T5XB 3O3AA 2JJVA 2BRQA 2R0LH 3I85A 3ZDZE 3SGKA 3ULSB 2VZVA 3MRDB 2Q7NA 4OI7A 1NC4B 3WS3A 1U8QA 2Q7YA 5EC2B 4QKXB 3PIQA 1NAMH 4V1DE 3TC9A 1PG7X 4W4OA 1UM5H 3VFVA 5ISZD 3H3PL 5MEOA 4ZO9A 2FJGB 5SWZB 5T1LA 2NR6C 2V5YA 1KYOJ 4FTVB 4ZDHB 4GMTH 4XVTH 3JWDH 3A67L 5AAWA 4NNYB 1S78C 4G6FB 1UKQA 2A9ML 2Z4QB 3OHXA 5L8JB 4GW5A 3IDYB 4OI8A 2JIXA 3W9EA 1LO4L 4XVJH 3E0GA 4HW6A 2FR4B 3VJ6B 1GGBH 5EUOB 1ACZA 2OJEB 4YEEA 1CLOH 5DJCA 5ESVA 3M17B 1BBDH 4ZOEA 3MGOB 5I8OL 3H6JA 3MV8B 4JZJA 2ITDB 4JFXA 3QIUC 2V17H 3FT2A 1SM3L 4IRSB 4H8WL 3IFOB 1BQHA 3GNML 3EHBD 4WW2B 1KG0B 5IHUL 4PLJD 4GW4B 3S3SA 5DD6B 3MRBB 2QSTA 3ZE1F 4A6YB 5D7JC 4C57C 2I27N 4GAGL 4HX1A 1IQWH 4AEIH 1BBJA 1JHLH 3O8XD 4KKCC 4H1LA 3FB5B 3ZTNL 4HC1A 4YC2B 4XPFH 1EDQA 3UDWC 3TJHC 3IF1A 3NMEA 1JZ3A 2HFTA 1BJMA 2KZWA 3MCLH 4OCXH 3BGMB 3F58H 3HG1E 5E1HB 4U4BA 1I85A 1UB5A 1ZSDB 4RIRA 3S34H 2GQHA 4YPGA 3RGVD 4ZSOE 3L7FA 4MNGB 4PJ9B 4KHTH 1EH9A 2F53D 5CJBA 5I8KH 2UVFA 3IFLL 4Y5VA 1B4JH 4IS6B 2F19L 1KJVB 2ZG2A 5K59E 2YD6A 3QJHA 1IILE 4CADA 3Q1SH 5EWIH 2IGFL 3EDFA 5GZOC 2ZJSH 1WJ3A 3BAEH 1D9KC 4TTDD 4X7EC 4WU5B 3HE6B 2ED8A 4PJXE 3IXAB 5CUSL 1SJVA 3O6MH 4MXWH 3DROB 4M7KH 2Z92A 4Y4KA 1TVHA 3IDGA 3OGOE 3PXJA 3C5SB 4JJ5A 3BSZH 4X4MA 5ANME 3KPSD 3ZKND 1AO7E 3UTTE 5HGAA 2BVTA 3GUTA 1VERA 1JZ5A 4YNYA 2XI9A 2EDKA 2KBGA 4G7YL 3MBXL 1RZ8B 1Z9OA 4JQIH 2X89A 1NGXA 3ARGD 1FZKB 3NIDF 4XNXL 4HS3A 4L29B 3ZT7A 5IVZA 3T77A 4BH7B 1AE6L 2ED7A 3WXWL 1OLLA 1ZGLP 1MCPL 4FS0A 4S1QH 4MJIA 3BT2H 1U8IB 4Q0XH 2Q8BL 1EVTC 4X6BA 4XPAH 1BD2E 3MRCA 1SMAA 2P8LB 5KJRH 3SDXB 4LLMB 1RMFH 3ORJA 1K6QH 1QSEE 1H3XA 1QBML 3UBXG 5JLZB 2DN7A 3PV7A 4ZS7L 4LF3A 3DURB 4OQ1A 4NUJB 2X1PA 3OKOB 4JKPH 2AJUH 2E9BA 5IVOA 4JDZA 2C3VB 1RVFH 3CLFH 5HVHB 3EIFA 4U7MA 3RFZC 1KCVL 1U93A 1T6VN 4BZ2L 4RGND 4YXLH 3TBVA 3GMMB 3MPCA 2CR6A 2NR6D 4MB3A 3QDGA 1AGFB 3IVKA 2I9LA 1I8MB 5GGUB 1U58B 4MZ3A 1A4KB 1QSZA 3A6BH 4ORGB 2I5YH 5KAQG 2NNAB 3HS0B 1JN6B 3HMXL 4Y16A 3U9PH 4NQEB 2VDRH 4IMKA 4TSAL 4JM2F 2APFA 3MOBH 3PWPD 3OB0K 3FO9B 3CMOH 4TNVK 3QIUD 3OKEA 2ZNXA 4OD1L 3RJDA 3MLVH 5MEPA 3O6LL 5DTFA 1VPOL 1CICA 1RIVL 2B8OT 4HIJA 2EYRA 3L7EA 5J1AB 4I2XB 4APQB 2XKSA 2ERJB 5DRNB 5C71A 3EYOA 1RZJC 3UTZA 1OARH 3BN9D 4Y5XC 3BKCH 2LTQB 2H6PB 4KKCD 3RWEA 1CLYH 1TJHL 4JZOA 4HKZB 4LP4A 1HNGA 4KKLC 4DCQB 4ISVA 4JLRB 1Q1JL 4N1EA 1TTUA 3BPCA 4P4KD 4R4BB 4NHCL 4X99A 4YHMH 5J1SC 1HOCB 3TJHD 2JJSA 1R3LA 4OZHE 1JF6A 3GMQB 3DXAA 1RURH 1IAIM 1X5IA 4XRCA 5F44A 1NGZA 2E8YA 4CVZA 4DKEH 4ORZC 4D0BA 1RK0A 3KYKL 5TH2A 3ZDXF 3WCYA 3CVIH 3IJSB 3E1F1 3H2WA 1DTUA 1G84A 2CLZA 4XC1H 2HYMA 1S5IL 2R1XB 5ID0A 5D1QA 3TYFA 1KPUB 2HP4A 5H2BA 4WV1B 5K33A 4QY8A 1DQJB 1NCDL 5D71L 2A1WH 1D9KD 3IU3A 2APVA 3SDCC 4P5TB 2EXWC 4MS8C 3HE7C 3RWCB 3CC5B 4FOMA 4GMSH 5CWSA 3RPIB 2BNRD 4UQ2B 4TSCL 3DUSA 1KCUL 1XMWA 3QEHA 4ZG1A 2DWDA 2XZCL 3DWTA 3QFDB 4NJ9H 4X6EB 5HPMB 4UIMA 1FG2A 2X70B 3PDOA 1OCWH 5GSRA 3VFRB 2EE6A 2P47B 2AJZA 2NYYC 2CXKA 3ARUA 4G8GA 4BQ6A 1JZ2A 5EU6B 1LD9A 5AYQA 1SBSH 2AGJL 2NY5C 4E9LA 5B39B 3V52L 3ROLB 4F9LC 3H3BC 4JRXB 2WM0A 4GRLC 2DM7A 1S9WB 5C0DA 5EBGA 3VGDA 2BSED 4OV5B 1MCKA 1WICA 4PP2B 2E7MA 2VXUH 3O3BB 1TVBB 5ERWB 5GGTL 2IADB 3JUYA 4PJ7A 2J5LB 1YJDL 2VDML 2JJWA 2BC4B 2XFXB 3CDGA 3UP1A 2WSKA 3G08B 2IANE 5IQ9A 4WUUA 3OKYA 4JGUA 4KGLA 4YFDB 4YHIB 2XN9D 5CJOL 4HJ0D 4PRPA 1P2CB 4LSPL 1VFAB 1RUQH 1XFPA 3NGBB 4P4RA 2UZYB 5I6XB 2IANA 1J8HA 3C5ZC 1E4WH 3LKQB 2WINA 1DLHA 8CGTA 5IEHA 3PDGA 3D5OF 4IRZL 3RVXC 2KQNA 3CVHB 1KJ3H 3PWJB 4O58H 1QRND 3MLRH 3S4SA 4WGVB 4Q2ZB 1N59B 3VFMB 2GKIA 1SVZA 1KPRB 5F1NA 3L5IA 1G7MB 2LQRA 3GSNB 1FFOB 3W2DH 1MJJA 2H1PH 4FNLH 3EW3B 3KGRA 4N1CA 4KROB 4KZDL 4N0CD 1FFPB 2ZCKH 1FIEA 3VGAB 3DVNB 3MR9A 3VGHA 1HHJB 5I1HL 3Q6FA 4FQQA 4YDLB 4POUB 1GGCH 3EYQD 2YK1L 4G6MH 4GKZB 1I7UA 1FFQA 4XBPA 5FV1L 4PJFF 5DGRA 4WI9A 4RAVA 5IW6B 3MRLB 2CXGA 3MX0A 3MA9H 3B9EA 1INEL 4KKLD 3MRQA 1UC6A 4TOYL 4KC3B 4LSTL 1L0YA 3IAPA 2C1PA 5GHWH 5AZEL 4P2OC 1H3VA 4AEHL 5JW4N 5I8EB 3AB0C 1TCRA 1TJIL 3WEXA 3O6FD 4F7EB 1F02I 1PYWA 1TQCB 1EERB 4O4YL 1S7RB 2JJTC 3JTTA 5EFIB 2DTML 2JTDA 1T1XB 5T1KB 1MRDL 3PWVB 3E6HB 2D0FA 5C9JA 4UINH 5JXEA 4Z5RB 3IFNH 1VFMA 2AXFA 2D03L 3JWOH 3K4DA 4R7DA 2R69H 4PBVC 4G8FB 3WJLA 4OFPA 4KJYB 3GGWB 4MS8D 3HE7D 5J12B 2FNBA 3TNMA 1J1XH 4CKVX 5CINL 1BLNA 1JGVH 3BP6B 3NN8A 3OAYH 32C2B 3OZ9H 4KI5C 5F7FA 3TA3C 4ZFFB 4F9PC 4G9FD 4LPCA 3MFFB 2H41A 3DX6A 5EBMB 5JORA 5LXGH 5IJKA 3HLAA 4ZUUB 2E3VA 1RAMA 2Y7QB 3MODH 4H88L 3KJ6H 5CLWA 4Z7VF 3EDEA 1LK3H 3P30L 5C0BA 4P59H 2ATKA 5E2UL 3D39A 1JPSL 2Y72A 4XXDB 4HG4K 3W5NA 4GRLD 1SQ2N 2MTPA 5F6HJ 4NFBA 3ALPA 3HPLA 3UEZA 5AUMA 1B2WL 5EO9A 1ZA6B 3DPBA 5HHVH 3JV6B 5F7NC 3OJ2C 3T0AA 5ILTH 1R3JB 3FRPA 3MRRA 3X3GL 3BP4A 3A67H 4GH7B 1N64L 2BVUA 4XCYB 3F62A 3GJFK 2BSSA 5HJ3A 1WCQA 1MCLA 1RPQA 5A2FA 3ES6A 1MJ7H 3I75A 3GBLA 1WC7A 1J0KA 4E0RB 4AEEA 5DJ6B 2ZG3A 3D6GA 1JK8B 1P4LA 3BGFB 4S1SH 5SX4H 2M26A 4JY5H 3EYVA 4LKCB 4M8QB 4M6NL 2EE2A 2BNQD 1SM3H 2DBJA 1G9NL 1LO5A 4H8WH 1INQB 3GNMH 3MLSH 4QOKB 5IHUH 3CFIC 3WIHH 3SJVA 3VWJC 2BRRL 5HVGB 4AM0A 2LAGB 4HS6B 4QRPE 1IT9H 2QQLL 4MA7H 2VQUA 2AQ3A 4LCCA 3U46B 5SWSB 1HHIB 5JDSA 1YMME 2YBRA 1CD8A 3OKNB 2QADB 4ZPTB 1T1ZB 2LAAA 1A14L 5GJSL 1HKLL 1QFWL 4WVRA 2H45A 4LLAA 1DQML 5I18L 3PNWA 4KRPB 3VXMD 3X11A 5DEGA 3X14B 1EHNA 5T1MB 1TCMA 3CFKA 4LIQE 1YECH 3MLUL 4IMLA 5C07D 2JB6B 5BS0D 2ESVD 2CKBB 3HI6L 4BK5A 4HIHA 4PGDA 5DD0L 3RDTB 1W0VA 2B1AL 4NQDB 1H5BB 3OXRA 4GOSA 1Z0MA 3P2TA 1CD1B 1BZ7A 5EORL 5E94B 1ZANL 2MPAL 1SY6L 3O3EB 4ZUVB 1CTOA 4WFFE 3KPLB 4LSUL 2VL5B 3REWA 3UYPA 2VITA 2CKBH 1TZIA 1UH2A 2IJ0C 2YA2A 3P73B 5D7IA 3G5YA 4P2OD 1VDGA 4Y2DB 5FYKU 2J2ZA 2QKIB 4R97C 5IB4B 3KXFA 3QUKA 4YXKH 5CUSH 5T3XD 4JPWH 4PJDE 1F42A 1K8DA 5EZLB 4QCIB 3HPJB 5INDB 3DECA 4QRUA 2GTZA 2KZ1B 3NABL 3MXWH 4GG8B 4U1JA 4CMMA 2X4OB 4PJDA 2G5RA 4Y1AB 3QWRD 4KVNH 1ERNA 1T1WA 4WI6A 3MBXH 2FHBA 1TNNA 3C87A 4CVXB 1D5IH 1VADA 2AEPL 1A6VH 3P40A 3WNOA 1FAIL 3M8OL 3RWFA 3FFCE 4M1CC 2VLKD 5L8LB 2A9NL 1AGDB 1AE6H 4UUJB 3SGKC 2DQUH 3WXWH 1IRAY 4X80H 2PW1B 1A6ZB 1UH3A 3CZFB 4F2MA 1CZ8L 1GGIL 1KXQE 2DS4A 1MCPH 4P46B 1OAQH 4KI5D 3TA3D 4FABL 1MUJB 3IU4L 4OZFG 1PG7L 4W4OC 4KDTA 4Q7DA 3W9DA 4LCUA 1FBIL 1F58H 3QSKB 1O7VA 2W91A 2ZUVA 4ZS7H 1UM6L 1PVHA 3QA3B 5T33L 1CXHA 3EO0B 2F54A 1U8OB 3MRKB 5E5MB 4LCYB 3WKMH 1EZVY 3LHPL 1KCVH 2MJWA 2VC2L 1FSKB 1XIWB 5FUOL 3T08A 4P2RE 5CHNB 3MUY1 4JZJC 2Q6WA 2HFEA 5TQ0L 1A3LL 4K3JH 3Q3GB 1ITBB 4PJHF 4N0FA 1QD0A 3N1FC 5EIIA 1CDGA 3MA7A 3A6OA 3BKJL 1Q9LA 5EOTB 3R06A 4TUJB 3SBWA 4Z7NE 1K2DA 4LLUB 2NXYB 2VLMD 2PCPA 4U1LB 5KSVB 3OJDB 1NJ9B 1RZIA 4WO4B 5KSAA 1MI5B 4XCNA 1J0IA 1QA9B 1RD6A 3TBSA 3L3OB 4OZIE 2N7BA 2X4PB 2YPLB 4L3CB 3DO7A 3QG6B 1DEDA 4OD1H 1G7PB 3HZMA 2IH1B 3NIFE 3PGCB 5GS1A 3O6LH 1TIUA 3Q6GL 4FQ2H 3IDNA 4KKBC 4OBSA 4RZCA 3VWJD 1IC7L 1KJMB 1XF4A 4JGJA 1G7JB 3L3DB 2K7QA 5IMMB 1LDSA 1NUDA 1I85C 3K4ZA 3TIEA 1KENL 2PYFB 1TJHH 4C83B 2UYLB 4OQTL 4LPUA 4PJGF 2W65B 4BSWB 3NAAL 3RY5A 3CNKA 2F74A 1KTLA 4Y5VC 3JTSA 1NC2A 4XCCH 3D69B 2MQ3A 1OD9A 3G5XA 5D7LB 2W0KA 3MCKA 1RZ7H 4PYGA 1N5AB 4P3WA 1ZS8A 3SKOB 4RFNC 1A47A 4LLWA 1EFXB 5B38B 3UC0H 5KVGL 1U3HB 4RFEA 3KYKH 4KPHH 2HN7B 1BVKB 1FLRH 2OSLA 4MCYB 1XGTA 4PS4L 3ZKXC 4Y4KC 1IVLA 2XY2A 2AAVA 1KELH 3QB7C 4LOUC 4R26L 1S5IH 3RZCA 4YQXL 1PAMA 1D5MB 5HHNB 2BHZA 3O3DB 1XF2B 1Q0XH 1KJ2B 2VN4A 4LMQE 5F7WC 1NCDH 4P3CH 4YHKL 5D71H 3V6OE 5HGHA 1A4JA 5DT1L 3IJYA 1BM3H 5ISZB 1D6EA 3AY4A 3VXUA 1KEGH 1TVDA 1EO7A 1VEMA 1X4XA 3BIKB 3VRLE 5TDOA 2JCCB 3WIIL 3B8YA 4QRRA 1BHGA 5F3BA 4C56D 1A1OB 2C7UB 2IAMA 1I1FA 1KCUH 3QI9A 1I3GL 3WHE1 2C4XA 4DZ8A 5F96L 5IMOB 2E8ZA 3RX5A 4KUCF 1WITA 2XZQH 1QSVA 4U1KA 4U1GB 3HFML 1JGLL 4I3RL 3VU2A 4CNIB 5GRJL 5FUZL 2QBWA 1ZHLB 4ALAL 5I73B 3RKDC 1S9YA 5F7EH 4YPJA 4RA0C 1A21A 2OR9H 1RZFH 5T1DL 4EIGB 3V52H 5JIKA 2ZKHH 2P5WE 1T7WA 4NWUH 2ICES 2JB5H 3MRFB 4G9DB 5EO0B 3PQYA 4LEOA 1BX2A 1YPZA 2D4FA 4HFWB 4U1HA 4ZAKA 3HC4L 3OBAA 4K3DH 1IGFL 1XF3A 4KY1H 5DJ8A 2VWEE 3RU8L 3LQMA 2GITB 4V1DD 3O8XB 5BOPA 1CBVH 1CE6B 3ZE0F 4I18B 5J9PA 5HHQB 5CJOH 4HWZA 2JIXD 2BP3A 1L7IL 4LSPH 2CDGB 4YZFE 3TT3L 4OM1L 5CBAB 4NZUH 1EUUA 4Y16C 1ZHKB 3FB8B 2VXSH 1U8LB 4IMKC 2A77L 4PJ5A 3I2CL 4D8PA 1C08B 3HN3A 2OCFD 3BXNA 4OAWB 2J6EH 4WEBL 3G04B 4ZPVB 1CGUA 2J8UE 2R0ZL 3RGVB 1N26A 2X40A 4ZYKB 5I8CB 5DJDB 1AGCA 2F53B 1CS6A 4X6FB 1JGUH 1CICC 4MAUL 4HK3N 4PB0L 2R0WH 4CW1B 1A6TA 4HUXA 4WHTA 5DQDL 1MPAL 1WZKA 1CDIA 4GS7C 5KG9B 4I48A 4NBYB 2VYRE 2XNAA 5KW9L 3RP1A 1YA5A 1F6AB 4PJCE 1EAJA 5J6HA 2FEDC 5I1HH 1KACB 2EIZA 2WUBL 4QHLB 1W8OA 2JJSC 3QIBD 2FWOA 4Z7OE 4M1DL 3V7AG 3KPSB 4KKBD 5DVLA 1XGPB 4KQ4L 3C8HA 1X6NA 1L0XA 4BFIB 3GB7A 4FFWD 5T3XL 3QEQE 1CFTB 3GMPB 3ARGB 3DUHA 1QHPA 1BWMA 4EDWH 4U1SB 4LLQB 1LP9B 3DIFB 1E27B 5D7KE 4GG6F 3O4OB 4TOYH 5D1QC 3QEQA 3LN5A 1FVEA 3QO1A 3QEGL 3U0TA 1ORSB 4O51B 2CDEA 1FNLA 1UWEL 2HRPL 4UTAL 2O61B 1IAKB 4KXZH 2A0LC 4JDVA 2EEBA 2AJXH 1RHFA 4EI6A 1K4CA 4O4YH 5T5FH 1HEZA 4QHNA 1G6RA 4N0RA 1W8NA 4Y4KD 3BEWA 4HS8H 1UXWB 4OGXL 4LOUD 4R90L 1R3KB 1KCSL 4NRYA 4IDJH 4PG2A 1HN1A 5EUKB 1IQDA 5CZXC 5TDPA 3N1MC 2X89D 2DF3A 3NZHH 4QHKI 3VCLA 5IR1A 1QFUL 5IQ7L 1ACYL 4TPRH 3U4EB 2F8XC 5CINH 3HRZB 1X4YA 3IETB 3LEXB 4QO1A 3ROOB 3OX8A 4JANA 3B3IA 4M5YL 1OPGL 5F7DA 4MXQC 4YDVB 5DUPL 4ZS6D 4AENB 9CGTA 3S9DB 3U7AA 4GAYA 1WAAE 2V5RA 5DJ0A 2LABA 1NMBL 1RIHL 5TF1H 3RKDD 1GCFA 4H88H 4ZO8A 1RY7B 2YN5A 3VDCA 3M1BA 2GY5A 3QIUB 4XI5C 5DWUH 4XVSH 1ZVHA 3FTGB 1Q0YL 4PJEE 5E2UH 1MAML 4MB5A 5MHSD 3BRFA 2BOCA 5D6DA 3RNKA 4HULB 5K9OB 4HIIA 1E4JA 1X4ZA 4DFHA 5E8NA 2Z93B 5D7JB 5I1GL 2R8SL 2X9WA 1TENA 4O2EA 3QRGL 2WBWB 5D1XD 3FCTB 3BP5B 3QISA 4Z8FL 2GFBA 3HNSH 1CDCA 5DRZA 1A9EB 3SGEH 3UTSA 1N0XH 4Y16D 4PJBF 4ODHL 4MJ2A 1T21A 4RNRA 5CS7A 3AMLA 1LO3H 5D70L 1PKQB 4MZ2A 4M6NH 4YFLI 3B8SA 1KTDA 4F7MB 4OJFL 1G9NH 5D2NA 3MRPB 3EYSL 2YMXL 4RGMC 3WFBL 1OQXA 3NCEB 3CFCL 2DQCL 3T0EC 3BJ91 1CICD 1RZGA 4LSDA 4I0PD 2B2XL 8FABA 3DHJA 4JFOB 3TZVA 3KYMA 3LIZH 1D9KB 2SEBA 4P23A 4EN3D 1FE8L 1YEEL 5IHLB 1A14H 1F4YL 1HKLH 3ULUC 1HINL 2I07A 3VA2C 5K9KB 2FEEI 3O4LA 2Y36L 1C5BL 5ID1B 2FEDD 3GSXB 4UNTA 4AIZB 2HJFA 3IYLW 2J3SA 1KCLA 1U95A 5F1KC 3DXAD 4RAUB 4LFHD 3IAQA 3MLUH 1DQDH 3QUXD 1FYTB 3GHEL 2PTUA 3HI6H 4K8RC 1RJYB 5TE7H 1FL5B 3MJ7A 2B1AH 1SYSA 3FL7A 3C6LD 4K3EH 4HAGA 1OVZA 3CFDA 3RQ3A 3GBML 3MRMB 1IGTB 1F4XL 5FYJE 1BIHA 2MPAH 3BWUC 1SY6H 4UDUA 2QSQA 3ULVC 4JO1H 5HYSA 2FO4B 2CK0L 1IEBA 1J9CT 2A6IA 4HWBL 2B1HL 4L5FL 3AXLB 5JXEC 3WNMA 1CFQB 1ZLUH 2D7QA 4F57H 5LCVL 4YDIH 3NFPB 1RJCA 5BXFA 4M93C 3WDIA 2DMCA 1CE1L 4NZRH 2KQMA 1NUFA 1UWXK 3WJLC 3ARXA 3I50L 1S9VB 4PRBA 4X6DB 5KSBF 5E5RB 4NO2A 4RRPA 5J06A 2NXZC 5LG1A 12E8L 2QQNL 1K85A 4K7PX 1NH6A 1MREL 4XVUD 1D6VL 4WI3A 1EJOH 4MNHB 3VH8B 5CZXD 4JM2A 4LLYA 2ZUUA 5IJKC 3KPRA 5HGDA 1DJSA 1A1NA 3L3IA 4K71C 4YR6A 2HVJB 5FCUH 2AEPH 4ENEC 4U1MA 4PRDB 5F1IB 3FQWA 4GBXA 2A9NH 3LN9A 1QRNB 4D9QE 1X5FA 2J8HA 3VGEA 1FIGL 1OGTA 3LKRB 3QWQB 1SEBA 1YZZA 2VLRB 5C7XL 1VKXA 4FABH 4MXQD 5MENE 1EBAA 3IU4H 1KF9B 4JFQA 1OT1A 1JGEB 3D25A 1F4HA 4NP4L 4PRHA 3KYOA 2YHGA 4XB8A 5AD0B 5MERB 1FBIH 4F3FA 2CMRH 4WUUD 2V2WB 1CQYA 1UM6H 3B9KA 4D0CA 5T33H 3GEWB 5IW1A 4FZ8H 3L3HA 4XWGL 1T2XA 4KAQL 2RR3A 3F5WB 3ARSA 4ZDHA 2IAND 4HJJH 3AFLA 3OXSA 5F7HA 3FHAA 3LHPH 4M9PA 2R29H 2Z4QA 5FUOH 3R8BB 2VE6B 5LGHL 2Q3AA 4NRZA 2V2TA 1ZTXL 4Y5XB 4HBCL 5FGSA 1OGAE 2P45B 2D7NA 5D9SB 2W60A 5F9AC 1IC4L 2VXQL 2A6KB 1MHEA 1E4XI 4LCCC 2BFVL 1RZJH 1PX4A 4IRSA 1ZLWK 3JV5A 3LN4A 5F93C 4GW4A 2DLIA 5D5MB 2IQAB 5JW3H 1JYNA 1GPOH 3FFDA 4WFGE 1RJLB 5C0AB 1AQDA 4PJIA 1JHTA 1UXSA 4NC2B 3Q6GH 2XICA 3U9UB 1IC7H 3MNVB 3V7AE 1EVUA 4NNXA 2NY7L 2P43B 2OZ4L 1VCAA 2FIKB 3GMNA 4MQ7A 4BQ9A 4D0DA 1W0WB 4EXKA 3SDCB 3VD3A 1VFBA 1NGQL 5IGXL 1XH3B 3HE7B 5EU3B 3NZ8B 3ULUD 1ZVSA 3QZWG 4OD3L 1MIML 2OK0L 1AY1H 4M7JL 1I3RB 5DK0B 2D7OA 3IKKA 4EOWH 3BZFA 5C0RL 4X4YB 3K7UA 1ZSDA 2EDEA 1C1EL 1MFBL 4OD2B 3BUYB 2DQJH 3VFWB 1GOGA 4K8RD 3PL6A 5DI8B 5KVGH 1N6UA 5EOCL 3JXAA 4U6VL 4WDIB 3ULVD 1BFVL 3BO8B 4PTTA 3SE8L 2Z31D 4A2LA 4JFFA 4YQXH 2Y07H 1KCRL 2EDTA 3GIZL 5JXED 3EOAA 4PFEA 4GRLB 1AXTH 1J1PH 2RHEA 4M3KB 2QJDA 2IG2H 4JHWL 4Y19A 5L6YH 2NY5H 5E4EC 4H26B 2QR0B 3H0TA 1RU9L 1RQ5A 4LCWA 1CFSB 3PP4H 3CUPB 4FFYL 1I3GH 2D3VA 1H9VA 1JNNL 3L95B 3HR5B 4TQEH 1K8IB 1D5ZB 4F7TB 4POZC 3PABA 3GI8L 4I3RH 4KDTC 5IROA 3C5ZB 1BJ8A 2GT9B 4HKJB 5J4MA 3VFTB 4ALAH 4JRYE 2JE8A 4X0KB 1WGOA 4U0RC 1FNEB 4YK4C 3OG4B 2BJML 2PR4L 1QNZH 2P8LA 1NGWA 2BNQB 3PV6B 5GGSY 4ZUWA 1ZLSL 4TN9A 3EYFB 3I02A 3LY6A 2X4TB 4M6OL 3MLTB 1Z5LA 4XAKE 5JW4M 3HC4H 1CI5A 1U8HA 4PJFA 3QUZD 1FCCA 5I1JL 1NUNB 3EUUA 3RU8H 1XGYL 5EBWB 3V9FA 2NW2B 4IOIA 3S35H 1YEDA 4RBPH 3SBWC 2GSGA 3VXMB 2F5BH 3TP4A 4PRIA 3FOMB 5GGRA 5KSAC 5DD1H 2CLRB 1ADQA 3OGCA 3QNYB 4LVNC 4L8CB 1KN2H 4OCSL 3BZ4A 3SQOH 2A77H 1OQOA 2ESVB 1GIGL 4HUNB 5BVPL 1RK1B 1JYXA 5IBTH 4WEBH 3TO2B 4OZ4A 1ZA3A 4N0UA 1J1OH 1J12A 1Z2KA 1XCQA 5GS1C 3DGGA 1P69B 4MD0A 4G8EB 3CDFA 4PB9L 2VIRA 4PB0H 5KVEH 3IDMB 4K3GA 4P2OB 5JIPA 1MPAH 3AB0B 1KPVA 4U1NB 1DBBH 5J11C 3OSKA 4ODXB 4O00A 3CFBB 1JWSB 3IDJB 4QRPD 2VLJE 5C09A 5KW9H 5J1AA 2GCYA 1OWWA 4APQA 3RBSA 3VGFA 1YMHA 1YMMD 2FH6A 2Q76A 5EC1B 4NT6B 1NBVL 3S97C 2VNCA 1IJ9A 5T3XH 2GTWA 2EDOA 3VGGA 4Z7VA 4WHCA 3KYNB 3G6JE 4NBXB 1AHWA 4M48L 5ENWB 4OB5L 4IHOB 3RZCC 2DI8A 3AMKA 3MOAH 2YZ8A 4HQQH 5FDYA 3OAZK 3RL2A 3TA3B 2F9BT 1UWEH 4EVNA 2HRPH 2CRIA 3RWHB 4UTAH 4WFFD 3UAJC 3VGBA 3KXFD 2JKXA 4OLZL 3AY4C 1C7SA 1MHPL 4XCFL 1I7ZA 2XA3A 2BVEA 2YC1A 3PGFL 3MUZ1 3NFSL 4FP8L 4DJMA 3T2NL 2IAMC 4MA8L 4OGXH 1CXKA 2A6DB 1SBBA 3QI9C 4NKIH 3WE6B 1DDHB 2OQJB 1CGXA 4P48A 3VXSB 3NCYS 4ONOA 3BE1L 1J88A 3V5DA 5E99H 2BVOB 1RUKL 1P7QA 4Y5YA 1EEZA 2XTLA 5C08A 3MLPA 3MRGB 4TNWK 1QFUH 4DQOL 3QDMA 4I3SH 1WLHA 3QFDA 2V6HA 5EZOL 1ACYH 1P84K 5I1KL 3BIBX 4PV9B 4JFEB 4XPTL 3SPVB 4YHLH 5FIEA 1FZOB 3PWNA 4JM4H 1U41A 3OTTA 4JG1H 3MLYL 2DLHA 3T0VA 1MFAL 2EYSA 2FL5B 5L9DL 3CFJA 1UQSA 5TDNA 2VDOH 5J7CC 5GJTH 5KZCD 3W81A 4NQSB 1HQ4A 1EMTH 1EHAA 5DUMH 4EI5A 1F11A 1NMBH 1FQ9C 2EYTA 2EIBA 3T1WA 3GMRA 4E42B 4LSQL 4JN2B 4HHAB 1GHFH 2J4WH 2WUCH 4PP2A 1SYVA 2EZ0D 4X4XB 4W68A 5D93C 4NRXB 5H35A 1I3VA 1B6UA 2BC4A 5DDHA 1ZLVH 2AKRA 3SKMB 5AG8A 4ZD3L 1EUTA 2HH0L 3VWJB 3BRDA 4ZFOA 1AKJA 1YEFL 2R8SH 1PG7W 4UAOC 3V6BR 1TQBC 3TIDB 2Y5TB 3RNQA 3CJJA 1R5WB 3ZTJG 3CSYB 1Q94B 4ETQA 5ADOL 4RWYL 5ITFB 4R3SB 3T3PE 1NKOA 1FDLL 2P1YA 3HUJB 5KSAD 3AS1A 2Q1EA 5J6GA 2G5BA 4ODHH 3KPPB 5A40E 4HPOL 4EXPX 3RJQB 4IIQA 2C3HA 5HDBF 4QRTB 1KPRA 1X6LA 3S5LB 2D31B 5HYQB 2EKSB 1IGIL 4XNUL 2GJ6E 2YMXH 4Z18A 3WNPA 3ILPA 4D9LH 1S7VB 3WYRA 4MA3A 1X7QA 5FO8A 1S3KH 5CJQL 4XPGL 2B2XH 3SE9L 1M6OA 3O41B 3G9AB 4NO0A 4K94L 3RUGB 1S7UB 3P0YH 3U0PB 3GRWL 3BYYA 3L3JA 4JAMB 4XBEL 4D9RD 4PGJA 1OSZA 4OLXH 1D5BB 2FD6H 3AU1A 4DW2L 5CSZA 4FRWA 1PW3A 4I4WA 1F4YH 5I74C 4HT1H 3QFJE 1YEGL 1S7TB 2ARJQ 3NIGE 4GKZA 5IB2A 1T3FB 2FCBA 2CRMA 5CP7A 4I3GA 3QXAA 4JZNA 2BXYA 3OPZL 4LHQB 1P5UA 3GHEH 5H8DA 3T1FB 4QRSB 5DK2B 2OL3A 4GKSB 3QZWA 1CDUA 2XWTA 4NHUB 3STZB 1S7XA 2BSTA 2P5EE 1MY7A 5CKGA 1OP5H 4AY0A 4YE4H 1ZWIA 3RZCD 1A3RL 1A6UL 4PG2C 4L5FH 2B1HH 1QHOA 3WS3B 4CU8A 5JNYA 3A6CL 1U8QB 3OKLA 4KHXL 2ZCLL 2Q7YB 1FV1A 2W1NA 4ZFGL 3PIQB 1CE1H 4HKBA 3VFVB 2OXGA 3VXUD 2Z35B 5MEOB 1TTGA 1XF5A 4PJHA 5T1LB 3TM6A 4QRRD 2AEQL 1BJ1H 1U91A 3BGAA 2IAMD 1FORL 4V1DB 3QI9D 1IGYA 2GUOA 4JO3L 4GW5B 2NX5E 2JIXB 3W9EB 1AGBA 4YDJA 1D6VH 4OSUH 3GGWA 4P2QE 1OAZL 3OF6A 1DP0A 5H94A 5DFVC 3RIAK 4NWTH 3ARED 1FFRA 5DJCB 5ESVB 2NX5A 1MFDL 1JRHI 2CUHA 4HFUL 4JZJB 4JFXB 3FT2B 3WFDL 1FIGH 3VXQA 2Q8AH 4EUPG 1BQHB 5GGRY 5M95B 3VE0A 4KUZL 5D6DC 5HHOE 4AL8L 3SOBH 5C7XH 5KN5A 2IMNA 5ETUA 4PPTA 1A7PL 4ZAKD 2K3TA 1N4XH 4NP4H 3QIWA 3L9RA 4LLVA 4HX1B 2BDNH 3KYAA 3AM8A 4N8PA 5C0GA 3OAUL 1NDMA 3TCLA 1BBJB 1TNMA 1LWRA 4PJGA 1OP3H 5DF0A 4H1LB 4PIRF 3KPQA 2ENSA 1KYOK 4WHYH 2FATH 1T7YA 1P1ZA 2ICCA 1B0RA 5MP6L 4NFCA 1R3JA 3QIBB 3JVGA 2O5XH 3IF1B 5GS0D 2IH3A 1I3UA 4ZMAT 4PJ5D 5IB1A 3FZUC 4HIEA 5LGHH 3QUYC 1AFVH 5GGVY 5JW5A 3CK0H 2UZIH 1YUHA 2V9TA 1UB5B 4RIRB 1EGJL 1WZ1H 2IQ9L 4YPGB 5D2NC 3L7FB 4HBCH 5DJ6A 5CBEA 1JK8A 4Y5VB 2NZIA 4L4VE 5BV7C 2VXQH 3QJHB 5KOVC 4CADB 5E9DE 5CEXA 4KI1A 1EXUA 2BFVH 1GSMA 2C4FT 4LIQL 3TZVC 3NFNA 5IG7A 2VDNL 4RMVA 4P23C 5F9DC 3O9WA 1IMHC 1IAIH 1FJ1B 1H8NA 3MXVL 5AEAA 3OAYK 3ZKXB 2Z92B 4Y4KB 1TVHB 3IDGB 5B8CA 4JJ5B 4U7KA 1RIUL 1WBXA 4QT5A 1EHLL 3FO0L 5CGTA 4ZNEE 3H9HA 5HGAB 3GUTB 4Z76A 1II4E 4YNYB 1LE5B 5GISH 4G3YH 5FYKE 4OFVA 4K9EL 1MCOL 1NGXB 4WENB 3TBWA 2KUTA 4HS3B 5IVZB 4LQFH 3T77B 2ZOLA 1F6FB 2WBJC 3VWKD 4KQ3L 1SHMA 1MJUL 4Z7WE 1MIMH 2Z8SA 3QEQD 2O5ZL 1U9KA 3LZFH 5TPWL 1XR8A 2Y25A 4MJIB 1C1EH 1MFBH 4X6BB 5ICYA 2RB8A 3MRCB 5D7KD 4ZUVA 1REIA 1IM9D 1MOEA 1BREA 2AXHA 2V7HA 1T1YA 5HVFB 5L2JA 4GAJL 3MC0A 4UOW1 5KSUA 3FHQA 2X9YA 1UCBL 4LF3B 5D2LF 3QYCA 4K7PL 4PGBA 1PSKL 2D9CA 1KCRH 2VH5L 5DHVH 4JDZB 4JM2C 4ODVH 1C5CL 1NFDE 4JHWH 1U93B 4PJAA 2AK1L 4IOFC 3TBVB 5JTWA 4GBXC 2APBA 5JW4Q 3QDGB 3IVKB 3QCUH 5C0CA 2I9LB 4EJ1C 4FFYH 5LAXA 3RUGF 4CVXA 1KBGL 4XNYH 1X5KA 2YWYA 5T3ZE 5HD8C 5DFVD 4TVPH 4Y16B 4ONFH 2EDLA 4H5SA 5I1AA 1UB6A 3C6SA 2NY6D 1MF2L 2HT2D 3ARBD 2XG4A 3B9KC 3GJEA 1YYLL 3OKEB 2PR4H 4PLNC 1R24A 4MB4A 1ZLSH 1V7NH 4ZFZA 2XXMB 3DYPA 2DRUA 1CICB 4HIJB 2EYRB 2PXYA 2ZUYA 3L7EB 4I0PB 2W9DL 5EO1B 5I1JH 4OTXL 3IB4A 3EYOB 3NH7L 3UTZB 3VA6A 1XGYH 3MACH 2DQTH 3T2QA 3H42L 5HI3C 4EN3B 5HYJE 4GG6A 3MNZA 4CJ1A 4JZOB 3LKPA 4ISVB 1HK6A 3BPCB 5CHNA 3HMXA 4X99B 3ZDZF 1G7QA 3UTSD 5BRZE 1R3LB 4KK6C 3DXAB 2FX7L 2XXCB 1EO8H 4IRSC 4KDWA 4XRCB 3QUXB 3U0WL 3I6LE 4WY7L 1GIGH 1NGZB 4CVZB 2WANA 4K23L 4D0BB 1RK0B 1BQUA 5H37H 1FLTX 4X4ZA 1CIUA 5DD5L 5TH2B 4OZHB 1V3MA 5IMLA 1QA9A 2VR4A 5FEBA 2CLZB 3PUCA 5GRVK 1AI1L 5ID0B 5D1QB 4G43A 3TYFB 4I9WD 5H2BB 1QACA 3RI5F 5M94B 2HMID 4QY8B 4YHNA 2VTFA 3UJTH 1MELA 5JR1L 4KGJA 3BN3B 3IU3B 4IRJD 4P23D 2AQ1A 4P5KA 3MBEA 4IM8A 4DAGL 5DD3L 2NTFA 4DFIA 5CWSB 3F7VA 3INUL 1IBGH 3DUSB 5IMMA 3LEVH 3QEHB 2DWDB 2ENYA 4JY4A 4IJ3B 1HCFX 4F37F 1NBVH 3IS1X 4UIMB 1FG2B 3PDOB 2W65A 3PL6C 1E6JL 5GSRB 2AJZB 1AGEA 3OMZA 3VW3L 4G8GB 1LD9B 5HBBA 2K9UA 5GXBB 3BKYL 4M4RA 5F9OH 5KS9E 2O5YH 3FMGL 4M62H 4KK9C 4Z78A 4JHBA 5FYJD 3MYJA 4FQJH 3SKJL 5C0DB 2ATPB 3EAKA 4NM8L 5DRXA 1I4FA 4ODBD 1Q72L 5CFHA 4PJ7B 4TULH 1NBYB 3CDGB 5IF0A 5IQ9B 3NFSH 1TTFA 4WUUB 1S8DA 5FHBL 4MA8H 1B6DA 4OFYD 5LWYL 4PRPB 4WCYH 4PJBA 3BE1H 4P4RB 1NSNL 5JO5A 2DYPA 1FCGA 5IROC 2IANB 1J8HB 1V5JA 2WINB 2VZ1A 1DLHB 2YD8A 5I1EL 5K59F 1HI6A 5IEHB 1WEJH 1N2RA 4P9HL 4MD4A 1JCKA 1YEKH 3H3KA 4OFKA 4OCWL 4R4FL 5I1KH 3S88H 4PJXF 5DURD 3S4SB 4ZOAA 3ARFA 5MEQA 3DYMA 2MMXA 1JPTH 1RZKC 1UZ6E 4ACPA 5L9DH 1MFAH 5GS0L 4Z7UE 2VR9A 5F1NB 5GGTA 2WW8A 2Q86A 4D94A 2VAJA 4FN0A 3R8QA 4PRHD 5FHAL 1MQKL 1MJJB 3BOVA 3MRJB 3C2SA 4GAFB 5JMRA 4XPBL 1DUYA 1LNUA 3VXRE 1XR9A 4WI8A 5MEND 3BYTA 3SDYH 3SY0A 3MR9B 3DMMD 3WFCH 4AH2A 4LNVA 4EIZC 2GY7B 2I60H 4HEME 1Y0LA 3LMJH 3Q6FB 4FQQB 1M1SA 4L8BA 4RGMB 4TVSa 3T3ME 1IFHL 1NCUA 3J8F7 4HGWA 4ZD3H 3W0WE 1N7MH 1I7UB 3QQ3A 4GSDL 4XBPB 3MREA 5CBAA 2JELL 4RAVB 4ODUA 4AG4H 2AK4A 1OD7A 1U8LA 1HSBA 3MRQB 3RY6A 2MCG1 1FDLH 4JFDE 5FF6B 1G7IB 1UCTA 2C1PB 3C5JA 4HPOH 1TCRB 5KSBA 3ZSSA 3D3VE 1OGAD 1ETZB 3WEXB 3WUZA 4ZUSA 1DFBL 1PYWB 3FN9A 1AR1C 2WLYA 3ULUH 4LGRB 3JTTB 1YNKL 1IGIH 3EOTL 4APQC 4JHZA 5IVNA 4YX2L 1OHQA 1PEWA 4WW1A 1WUNT 5C9JB 2CKNA 3EO1A 2LTQC 1E4XL 3SE9H 5HDLA 4K8RH 3GIVA 2AXFB 3DVGA 4S1RH 3GRWH 4WFGD 4M93B 2JF1A 4R7DB 1CT8A 1AHWC 3ULVH 4U6YA 5DEFA 3TNMB 3KAAA 2NXZB 1BLNB 1P4IH 2FGZA 3NN8B 2CRYA 1PZ5A 3P9LA 4HV8A 2Z9TA 3X13A 3DX6B 3LVEA 5JORB 2CIIA 3HLAB 2W0FA 4C55A 2RFXA 4E41A 2BXZA 2AABL 5C0BB 3FOLA 3WLWD 4HXAL 2ATKB 1NAKH 3D39B 2HFGL 4KK9D 4OGYL 4Z95H 3A6CH 3HPLB 5AUMB 2VXVL 3UBXB 4Y5YC 5EO9B 4OZHF 4L9DA 1A7NL 1I8IA 3MV7E 4J8RA 5D6CA 3MRRB 4LCWD 2XTJE 1QVOB 3BP4B 2DJ4A 3VXTA 1FVCA 5HJ3B 2BSSB 3TJEL 1OT2A 2NY2C 3QDJE 2W0PA 3ES6B 3D9AL 4HIXL 1OAZH 3I75B 4ZTOL 1WC7B 3NACL 1ZGLM 4EI5C 1KNOA 3V2AR 3U1SH 3ROOA 2NY0D 4GLRI 1P4LB 4NOBA 4BQBA 1ZKAA 2EDFA 4HFUH 1FNAA 1MH5A 3EYVB 4DOHE 3HNVH 4D2NA 4BSVA 1LO5B 4JRYD 5E2JA 5FA3A 5CEYA 4AL8H 1IKFH 2NY3D 2QSCH 3PWPA 3SJVB 4AM0B 1BFTA 4F80A 4S0TD 1QBBA 2X4SA 1G6VK 2H8PA 4LCCB 5AWNL 3U7WH 1J05A 1CG9A 5TE6L 1CGSL 1WISA 2YD2A 5JDSB 4RQQA 5KVMC 2YBRB 1J7VR 2VSCA 1G9ML 1NCCH 1ZK9A 2G2RA 1KLGA 4YDKH 1C5DA 1NCAL 2MQCA 3GHBL 3PNWB 5DA4A 3X11B 5DEGB 5FGCE 4YHOH 2PW2A 3CFKB 2QHRH 3VXNA 2EH8L 4LCIH 4X7SH 5CD5C 4IMLB 3CXDL 4OGAC 1F90H 3QXDA 5LGJA 4LK4A 5EN2A 4IIQC 4HIHB 4PGDB 1QLEL 5GRUL 1W0VB 2VDLL 1J18A 3OXRB 4P4KA 4AQ1B 4OF3A 1BZ7B 4YJZL 3ARYA 4GRWE 1KIQA 2OP4H 1QR4A 3LKSA 5DJYA 5I15H 5EULV 2X4NB 3OR6A 1HH6A 4KROC 3CIQA 3REWB 5FGBA 1WTGT 2VITB 4W6YB 1TZIB 3IT8D 4PRAA 4PR5A 5D7IB 3ZT6A 3G5YB 5IFHL 3ZHLA 4F7MA 5HHME 3RVWC 4YDLC 3KXFB 1BF8A 3QUKB 5FM5M 2EH7L 2CUIA 1MCCA 3P77A 4DWHA 5C09D 2H2SC 1K8DB 1BZ9A 2IWGA 1FPTL 3KPOA 4QRUB 2MWCA 3U36A 4JN1L 4LAQH 1FGVL 4MAYA 5FYJL 4NQTA 3UTQA 4U1JB 1EHLH 4PJDB 5B39G 4RX4D 1T1WB 3O6KL 4TRPH 1CFVL 2D7MA 1MCOH 1YNTA 2BNRA 4JKKA 4OLEA 1SY6A 3UYRL 1R5VA 3ELAT 4OLYH 3RWFB 3EBAA 5E4EB 4YBQD 5C0EA 4KKAC 1KFAH 1T2QL 1RJYA 4F2MB 5TPWH 3JWOC 5SWZE 2C26A 2G60L 4XTRC 4FTVE 4NCC2 4DZBA 2I9TA 1GVIA 5KTEH 5KZCB 3ZLQC 1MJ8L 3BKML 3MTRA 4LCUB 4GAJH 5EUOE 15C8L 1TETL 4D3CL 2UZXB 1UCBH 3QXVA 4U0RB 4YK4B 4NQCA 2DDQL 3MV8E 2F54B 3WIFB 4PREA 5ALCL 1UWGL 3GM0A 4ZO6A 5C08D 3QDMD 1I7RA 2XN9A 1CXIA 4OT1L 3G6AA 2DJUA 2NY1D 3QHTC 3HZKA 4XXCA 5BOZG 3LQAL 5F1OB 2HFEB 2Q6WB 2BVYA 5IKCB 4J23A 4G5ZL 3H9SE 4ONGL 1EO5A 3QHZL 1I1AD 1SJHB 3LS4L 3NA9L 4N0FB 5EIIB 3MA7B 4XH2A 1Q9LB 3MJGX 3R06B 1K2DB 2HVJA 2NY2D 4XP1H 5GGQH 2DLTA 1RZIB 5KSAB 3QIWC 4XCNB 3D18B 4U49A 4EI5D 3TBSB 3FT4A 3AM8C 4LVNB 5DQJA 1KC5L 2NY4D 2FHCA 2PYEA 1U8KA 1OAKH 1MF2H 4OZGE 1ND0A 4ODSL 3RIFF 3EKCA 3SO3C 3DO7B 5F7YC 1T5WA 2X10A 4YBLC 3R4DA 2BY1A 2EKJA 3HZMB 5CCKL 5AD0A 5GS1B 1PX3A 3JVGC 4GRMA 4OZGA 3IDNB 4RZCB 4C4KO 1I8LC 1XF4B 3VG0H 4MNGE 4OFDA 3CLEL 3NH7H 1ORQB 4H8WC 3TIEB 5J11B 2HT4D 3H42H 5E2TH 1U36A 5A3IC 1YC7A 3LRHA 1ZLUK 3SGJA 3WDHA 2F74B 1KTLB 3JTSB 2HTKD 4UV4L 1FN4A 1Q9WB 3G5XB 3WV0A 3L3GB 1NANI 4UDTA 3KR3L 3MCKB 2FX7H 4J3TA 3BESR 4LHUA 4OGAD 1A22B 4ERSH 3U0WH 1ZS8B 3VMOA 3O9WC 4LLWB 4K23H 3SGDI 2FH8A 4RFEB 5DD5H 2BSRA 2A6KA 1NCTA 2OSLB 1XGTB 4XP9L 5JOFA 3RZCB 1QFWM 3O6FA 1QSFA 3VFGH 4NZDA 1QO3A 1T0NA