4MD0B

Immune receptor
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
189
structure length
189
Chain Sequence
DTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular basis for the association of the HLA-DRB1 locus, citrullination, and rheumatoid arthritis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 42
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4md0B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4md0B01
1HYRC 1ZA3B 2OTWA 5B22A 1LO0L 4EDXB 1GC1H 2QSVA 3U7YH 2AV7B 3DXAE 3SPVB 2MCPH 1MIMH 5CLTA 3CCHB 4EN3C 2ZCHL 4NFDA 3SN6N 3MRDA 1NBVH 1HE7A 1ED3A 4NN7B 1S7WB 4MD4B 3ARFA 1G7JA 5TDNA 2MCPL 3IFLH 5T3XL 1UJ3C 1TFHA 4MCYB 4BM7A 4Q7DA 2MOVA 4WO4B 3KPMA 3VE0A 1U8NB 5DJZA 1U8JB 4WY7H 1FLTX 4NQEE 1Z9LA 1NFKA 2NY1D 3BGFC 3MRHB 4YHMH 3FQNA 2R56L 2N56A 3HNSL 4X5XB 4BZ1H 4HKBA 4HUUB 5GHWH 4WTZG 4WI3A 1ORQB 3VFPB 5E9DB 3P4MA 5IJKA 4QF1A 2XQYK 3TYFA 1UT9A 3DV6A 1NGZA 3TO4A 4WFEE 5GSRA 4EQ2A 1FVEB 2V5SA 2BSSA 3B9VA 5JNYB 4K9EC 3JWDL 4ZYKA 4UNTA 4CVUA 4EUPB 1HOCB 5BOZG 1ZT1A 3JV4B 4WFED 3C60A 1J05A 5I75B 1GGBL 4XBPB 3IDYB 1IC5L 2OQJB 4CU6A 1INEL 5JHDE 3MO1B 4LVEA 3ARUA 2HMID 2F54A 3MV11 4XNYH 1OPGH 4M48L 4MX7A 3FT4A 1D9KB 5EOTA 32C2A 1JPFB 2Q8BH 4MNQE 4GJTB 4IRSB 1ZANH 3V52L 1FDLH 4H88L 1UZ8A 4G6AD 3OX8A 3LKNB 3CLEL 5T3ZH 5JQHC 4UU9B 3ULUE 3TYGL 5ILTL 4DQOL 5I30L 1YEFL 2APWA 3DYPA 4J4PD 1E4XL 1A3LL 1ORQA 1T89C 1MCSA 1NBYA 2XZZA 3GI8L 2VC2L 3RL1B 3QIUC 3NCCB 4V2BA 3O3AB 1B2WL 1WZKA 1LE5A 4BFEA 4MQXD 4OV6F 3DOSA 2MPAH 1NFDA 2H3NB 4OQ1A 5MEOB 5F7WC 5GRXG 5INDB 3RTQD 2YC1A 3U6RB 5DJAA 3CFDB 1PZ5A 5GGVL 4IOIB 1YN6A 3TBVB 4KROC 3D0LB 1CFNA 4PJCB 3JWDC 4XB7A 1VFUA 4UIMB 3HN3A 3KPRE 1QSFD 3WN5C 2PXYA 3RZWA 5FDWB 1WAAA 3TO2A 1X6NA 1HH9A 4XNZB 3TVMD 4JREC 3TVMA 4FQ1H 2R9HD 1NEZA 5GGVH 1G6VK 3EFFB 2PYED 1DDHA 2WBJA 1T22B 5IW6A 1A9BB 1NGXA 2BZDA 3HPLB 4JHWL 5KVGH 3ZKMC 1G7QB 4POUB 4U6HA 3CSBA 1QSED 3IJYA 1F4XL 1WV7T 3ZKSD 4HDIB 5LQBL 2CQVA 4K3HA 3MBXH 3BSZL 5DFWH 2DLIA 4TQEH 1TJGH 4KJPD 3U82B 3QEHA 5J6GB 2NX5D 5I1CL 5TF0A 4M62H 2C26A 1Q72L 5GGSY 1Q0XL 4F2MA 2YHGA 4JVPA 1MCCA 4KRLB 1UYWL 4G8EB 1P84K 1DE4B 1KTLA 3KGRA 5HGAA 3EJJX 4XNMB 4JRXA 1A1OB 4WFFD 4M7LH 2WP3O 4HS6A 4WTXA 5CJOH 3CFJA 4B0MM 3RVUC 1FL5A 1JP5A 5HHNB 1JN6A 2Z92B 1AHWC 4EIGB 1UH3A 3QJHA 4NNPL 5EZIL 4RFOL 4PGDB 1KEGL 4NJ9L 3D3VA 5CKAA 5IVNA 4YHYC 4M7LL 2X9YA 1WIPA 2IAND 3KWWB 4TSBL 4JFEE 4F37K 5L2KB 4MMZC 1OSZA 3AREC 3T77B 1F4AA 2YPKA 4ZTOH 3QSKB 4FQXC 1FORH 3L3OB 5EBWB 3MGTA 2JELH 3QDMD 3PDGA 4DK6A 4HV8A 3ILQD 3K2UH 3CD4A 1I8MA 3IXAB 1D3CA 5H37H 1RZIB 2Q76A 4Z7OE 4WV1A 1S5IL 2YD7A 2DDQH 1ZEAH 1BM3H 1JNHB 4Z0XB 1A1OA 3ZO0A 2EO9A 4M6MH 3WUZA 4K71C 4KHTL 2D4FA 3SDYH 3VFMB 2Z92A 3NOIA 1AO7E 2ZUYA 5EIQA 2W9DH 2AK4D 4JHAL 3ZE0F 2W9EH 2ESVD 2X4NB 4PGDA 4CN4A 4NDMB 5JIKA 1T2JA 5FEBA 1S7QB 2ITDB 2PUQT 4WO4C 3PL6D 4Y2DD 4PJDA 3TIDA 5D1QB 1NUFA 3BRGC 4QWWD 3UAJC 5EZJA 3JXAA 3U1SH 4EDWL 4KK8D 4QCIA 4PV8B 3V0WH 4HUNB 1BREA 1AKJB 1XCQA 5DJCB 4F7PB 2HLAB 2OR7A 2Y4SA 4RX4D 2Z93A 4RX4A 2VYRE 3DIFA 4XXCA 3QAZB 5ICYB 3RNQB 3W81A 1J5OH 2NW2A 3FQUA 2MHAA 4K2UH 5CHNA 4XMKL 35C8H 3C5SB 1ZT7B 5BMFH 1S9WA 3OKKA 3V6OE 3O4LA 2XWTB 1JGEA 5M95B 4OZ4A 5I76B 3OXSA 2HT3C 2YKLL 3GMPA 4GRWF 3JVGA 4WW2B 3GMMB 3NH7L 3ROLB 1F2QA 2ERJB 3BPOB 4KJYB 3RFZC 4XCCH 4H8WC 1RUPH 4HAFA 1T4KB 2YA0A 4ZUVB 2EH8L 5FYLH 2X1XR 2F74A 5EORH 3ZDZF 2X05A 2WWKT 3VCLA 1A4KB 1Y6KR 2WINB 3V4VH 3E6HB 3RY6C 5AZEL 3ET9F 3CLFH 1Q1JH 3VRJB 2W0PA 4M43L 5JLZA 4FQ2H 1T5XA 4WCYL 5KJRL 4R97C 4J2XA 2FYYB 2IC2A 1TTUA 1FGVL 3ES6B 4P2OA 5D1ZD 3U0TB 2BNRE 2R4SL 1GYAA 4XBPA 4PRAB 1AGBA 5TPWL 3TZVA 3MLTA 2GKIA 4Z9KB 4C55A 4IHOB 2OJZL 1KJ2A 2ZG1A 3FT4B 3V5KB 1YEGH 3SO3C 2BNRD 5I8CA 5D93B 4DVBA 1NLBL 5CCKH 1JPGB 4LAJH 1OAUH 2FCBA 4KDWA 1T3FA 3GM0A 4PRPE 5ELIA 4ZS6D 3G5ZB 3BRDA 1WT5C 2CLVA 2P8MA 4LPUA 1KN4L 3GBML 4EBQL 5KOMC 2UZIL 1F8TL 4JDTH 1EH9A 3E6HA 2A6KB 3OJDB 1MCPL 4QRUA 4N8CH 4J3OC 4Y1AD 4Y1AA 3IDIA 4Y5YB 3WKMH 1P4IH 3R0MA 3UTSA 4K7PY 3ARRA 2J7LA 3MA9L 1J0HA 5IOPA 4PJCE 4TVPD 4ZUSA 2ATPB 1OD9A 1HQ4B 4QY8A 3NIDF 4F9LA 2NW3B 2VZUA 2R0ZH 1E6OH 3PL6C 2A1WH 1C5CH 1NGQL 4KK9C 4JZOA 1I9JL 1NDMB 1U91A 7FABL 3K8LA 3P0YL 3UJIL 3D39B 1QLEH 3QIWB 4F7EB 1SMOA 1N2RB 1FCCA 1HH9B 3CC5B 2JB6B 3AROA 5IVOA 2KL6A 4X99B 5IJVB 7CGTA 1NCWH 2QSTA 5E4EB 3PL6A 2Y7QB 4CADA 1IGTB 5AEAA 4PJ5A 1HHJB 5IROC 2BSRB 3QXAB 4LFHD 3B5TA 4NKOB 2BNUB 4Z77A 1Q0YL 5JIIA 1NCWL 5F89A 1A22B 1MOEA 3VWKC 5DD6A 4D9QE 4Y88A 4OAWB 1DTUA 3N50A 3TT3L 1U8LA 2XA8H 3UTQA 1RZKL 2YR3A 5I75C 4HIHA 3V4PL 4PTTA 2VXSH 3RHWF 2ICES 1MAML 4OZIF 5BV7H 3KDMB 1QSFA 5D7IE 5F7EH 5DMKB 1D9KC 1X9QA 1FO0H 2P46B 2DQIH 4O9HL 2PTTB 5CJXC 4O5LL 4QYOA 1GGCL 4GUPB 2FATH 2VR5A 3S4SG 1N6QL 4GRWH 3GO1H 2F8XC 4JZNB 2EE6A 3G04A 3MQIA 4O58L 4X0KA 3I6LD 1D5MB 5EC2B 1BD2A 4HQQH 1SM3L 4QCIB 4EIZC 2A73B 4Y5XC 2GW5A 3K4DA 4MJ2A 1X5AA 1IGYA 4KY1L 2J8UA 1U95A 3EYOB 3STBA 2ZCLH 1YEDB 1I9EA 1Y6MR 3RVWC 3DX7B 4MD0A 1JBJA 5L2KA 3OKYA 1LD9B 3H3PL 3BP7A 2Z35B 3UDWA 2M8XA 2G5BB 3NCEB 4OGXL 4JFYB 2HKHH 3SQOH 3BGFB 4AQ1B 3IDNA 4W6XB 3GI9L 1RK1A 4FNLH 4EDXA 1WTLA 4LCUB 2VXVH 3S34L 4QRPB 2E7HA 5IFAL 1PX3A 1XF4B 3GSQA 4WFFE 2WQ8A 4OGXH 4L1DA 5I1AA 1M6OB 5K9JH 2Z0BA 2PTTA 1INQB 1UEMA 4MAYC 3UBXG 4G9FE 1DBBL 3I6GA 3S34H 4X8XA 4NHUA 4TUOA 4DGYL 5DEGA 4LCIL 1IC7H 3BE1L 3TBSB 4MAUH 3HNVH 4M3JA 3BDBA 3EYQD 1NAML 2NZ9C 3N1MC 5T5FH 1F58H 4Q74A 1CDBA 4KI5E 5JW3L 1QRKA 1KIRA 1AI1L 5I1HH 1T1XA 5HY9B 3HTLX 2BVYA 2GJ6A 4YAQA 1JTPA 4PJHB 3JSSA 1NAMH 3TESA 5FAAA 3L3JB 4MA3A 4N9GB 1NMBL 3FFDA 2D0FA 1KIUA 1RHHB 2Z9TA 1K8IB 4HIXH 5L8JB 2WUBL 2X4RB 2NY1C 5GRYA 2DWEA 3MNWB 3QHFL 3WFCL 2VQUA 2XWJA 4JPVH 3PG2A 1FVDB 3CMOL 3FQRA 5DI8A 5LVEA 4FQJL 1G7MB 4GAGL 3AXLA 2HJFA 5FYKD 4HS3B 4WNQB 4XT1C 1FG9C 2VL5B 4FN0A 3RQ3A 1IEHA 5TFSL 2YPLE 5DS8B 3LD8B 1W2KT 5D7LA 1YC8A 2ESVE 5JOFA 1QPXA 1DVFA 5ALBL 4NNXB 4PGCB 1CT8A 1OGAA 3PWVA 1G84A 1K6QH 4Y2DA 3SE8L 3SGEH 3MOAH 4PRNA 5GS1A 1DUYA 4PJEB 1REIA 4JDVA 4N0CD 2HMIC 1HQ4A 5CZVL 4X6CB 3QB7C 4C56B 2CKBA 1TIUA 4X9BA 3JBG7 1GZPA 4LSVL 3MO1A 1AR1C 1NKRA 3BWAB 1G7IA 4U6YB 4BSWA 4MA3B 2YMXH 3ARBB 4CW1B 3JUYA 4JRXB 1BVLA 2IAMA 1JPFA 2NTFA 2HT4C 4R3SB 2DQEH 4LVOC 1UZ8B 4KU1A 2YN5A 2DQFA 2NXZD 4PG2C 3V6FB 5I73B 3HC3L 1PZ5B 2PW1B 2FIKB 4H26A 3A6BL 3BPLB 3X13B 4M8VA 4MXWH 1K2DB 4P2QA 4IEFB 3HNTH 4RMUA 5JHLL 1J8KA 4PG2A 4GXVL 4Y4KA 1MFBH 5FOBB 2GUOB 3FT3A 5D5MA 2AJVH 5KW9H 4R9HA 1B6UA 4G42A 5DA4A 1NAKL 1NL0H 4X6CE 4X6CA 3TNMB 3M17A 3PWNA 4JAMB 1JRHI 2L7UA 3BJ91 4NCC1 5FKAA 4N1EA 2ZUQB 5K9KA 4XBEL 3EYVB 1YJDL 3L3KB 1LDPH 3L3HB 1AQDB 1RU9H 3MZTA 5JR1L 2BRQA 1IAOA 3BW9B 1I1AB 3RBGA 4LVOB 2V7NB 1KJ2L 5D2LF 1C08B 1FV1A 4XX1E 3BP6B 4WTZA 2DIBA 3VU2A 3PJSA 1RU9L 5SWZB 3BD5A 2AS5M 4X98A 5JR1H 1OW0C 1YYMH 5I1EH 3ZKNC 1TCRA 1BLNA 1MJUL 1NJ9B 1W0YT 5HGBA 4U1LA 2NY5L 1YEIL 5ENWB 1KOAA 1DBML 5C07E 5C0BA 5FGCE 4LK4A 1DN0B 2IG2L 3QHTC 5IF0B 3NACH 1SY6H 3RVVD 1ZKAA 4XC1L 3LN4A 1YUHB 1G7PA 2E7BA 4GG6B 3PDOB 1T1ZB 1CG9A 5ICYA 1EEYB 1LK3H 4KXZH 3ZE2F 5ALCH 1M05A 3VFTB 2IH3A 3HCVB 3O41A 4XI5D 5T1LB 4ENED 5IT2L 3O6MH 1MJ8L 2DMKA 4TVPE 2AW2A 4OB5H 3UXFA 1R3LA 3ALWA 1T5WA 4I9WE 1T2XA 3GK8H 2DM2A 4PP2A 2GIYA 1FN4A 4R8WH 2Q7YB 5IT2H 1MJ8H 3F5WA 1W72B 2R1YA 3BKCL 3H9ZA 1ZOXA 3WBDA 1YMME 4ONFH 1TCRB 3UTTD 4PB9H 4JFPA 3BIKB 4R8WL 2HWZH 4LLDA 1TPXB 5IHBA 4PJAA 4DUVA 2AK1L 5T1MB 3G5YA 3GUTA 4MS8C 5DC0A 3V5HA 4N8VB 4QOKD 2CPCA 3UJTL 3W39A 3QXDB 2AGJL 4HEME 4GKSA 2D4DA 4D0BB 1I9IH 1RZKC 5JPNB 4JO2L 5B3JF 1MVUA 3CCHA 1A7NL 4JZJB 4L29B 3O9WD 4LPVA 3HZVB 5LBSL 2VSDA 1R5VB 2AGJH 2FHCA 3ULVF 3OPZL 1CFSB 3U30C 3MLWL 1YPZF 1RZ7L 4UIKH 5F1NA 2F19H 2DD8L 2ID5A 3AAZA 1FRGH 1NUDA 4Y4FA 3WHE0 5IMOB 2FD6L 2DB8A 1TETL 3BEWB 1LDSA 4LSRH 2I5YL 1A7OL 5CJ5A 1HEZA 5DJ2B 2HTLD 2GSIA 4G8GE 5EZOL 4LGRB 4MQ7B 1X5KA 1Z2KA 4I5BB 4PJ7E 5CEZL 3OR7B 3SJVB 4Q9RH 4FTVA 4M5ZH 3MLZL 1E4WL 5FB8A 4MQSB 5JORA 3QA3A 5JPMB 4XAWL 2VDLH 1SJEB 1CD8A 3KPQA 2CRMA 4C59B 1CE6B 1A4KA 4X7DC 4F33B 1WISA 2ADJA 3FZUD 4Z76A 4M5ZL 1BHGA 4LAQL 1A6WH 2NLJA 5EB9A 1WBYA 3SE3C 4NZUL 5I1LA 2V2WB 5IFHL 4GAJL 1UA6L 5GS1C 1S9KC 3PGFL 3W9DA 4JJ5B 3ECBB 2R8SL 4K94C 3DRTB 3VXPA 1JMZA 3MNZA 3MUY1 4XP4L 3ARWA 5GGQH 1CBVL 3UP1A 2ATKB 3MLPA 5HYJB 2VXUL 1UA6H 5JXAH 3H9YA 1QG3A 4L5FH 2RGSA 1BZ9B 4MWFA 1UKSA 3B9DA 3T0BA 1SYSB 3BHBA 1G6RA 4H25A 1WAAF 4F7TA 1MFDH 5JO5A 2VZOA 5GZND 1T0NA 5A2KH 3QFJB 5JLZB 1MREL 4HXAH 1MJ7L 1BFOA 4RAVA 3EZ8A 4AEIL 2JF1A 3BAEH 2X4SA 5ACZA 1MFCH 5FHBL 1DBKL 4P2OB 1IL1A 5DHXB 1UVQB 2XG5A 3HI5H 5SWSB 4IOIA 4P46C 5GRVK 4LPXA 2B4CC 4UDUB 5FYLD 3P73A 5D1QD 3V0VA 2FO4B 3SBWC 3R8QA 1HHKA 1MJ7H 2V2WA 3A6OA 1Q9WB 4DVBB 2VLJE 5C7XL 5KTEH 4ZPTB 4M7LT 1DSFH 1VESA 3AB0B 1QYGL 1PEWA 2YN3A 2BXZA 2ATKA 2CKBL 4ODHH 3INUL 3L1OL 5HD8D 1FNFA 5B39A 3S35X 1I4FA 1F90L 4WENB 5DWUL 5LCVH 2MCG1 5KTEL 1BWMA 2XQBL 2Y07H 4NT6B 2YRZA 3D25B 3D39A 4JRYA 5IQ7L 1JVKA 1UACH 4GW1A 5I16B 5HYQA 2H2PD 2OTPA 3RA7H 2J8HA 2XKNA 4LHUB 3BKJH 4Z7VB 4G9DB 2X4QB 3P3YA 3OKNA 4YHKH 5IESL 4MA1C 1ADQA 2ATPA 3KPTA 2FEEL 2IAMD 3WJLA 4S1RL 2YS4A 1EBPA 4OLUH 5JMRA 4YWGL 1T0PB 3B2VL 2WM0A 1W72L 2IGFL 2QADB 2DQCH 2HTLC 1KCVL 2D7QA 4GXUM 5F7DA 4XNUL 4LCCB 2ZSWA 5D7JD 5EUKB 2CK0H 2YBRA 5TJWK 4D8PA 1FFPA 4P23C 4PUBH 3SCMC 3MRNB 2YUZA 5KVEH 4JVUA 4MZ2A 5HHVL 1GIGL 3MCLL 5MEQA 1S7XB 1RULH 5H2BB 4EUPA 4AYFA 5L0QC 4KVCL 1LK2B 1J1PH 3ZYIA 4P9HH 3O4LB 4L8DA 1VPOL 2RBLA 5J9PB 3HE6C 4G6JH 5FCUH 1DQDH 4I4WA 4LSUH 4NZDA 2A9NH 3PWJB 4MGXA 3LY6A 2P7TA 1R3JB 3O4OC 4HK0A 1BFTA 1J1XL 2E9IA 1M7IA 3QNXA 3IVKA 2F53E 5CILH 1ORSB 3CUPA 2UZYB 1F6LL 4PY8J 5ID0B 5DZNA 3OKOB 2A9NL 1Z5LA 3T2NL 3T0ED 3CU1A 4D3CH 4JG1H 1C5DB 2FJGB 3T65A 3FB5B 3BD4A 4KV5E 4D94A 4MA8L 4Z7UA 3ULUC 1IM9A 3QI9D 1FLRL 4PP2B 5E6ZA 3AU1B 3DNKA 4NO2A 5FO9A 1VGKA 3GIZL 3SGJC 1JK8B 3T08A 1TNNA 1KJVA 3D1MC 2ITDA 5F6IC 4HXBL 1X5IA 2B8OT 3IFLL 1B4JH 4JFPB 4BQCA 3VH8A 2DM4A 3MYJB 4ODSH 2A74B 1P7HL 5DEGB 1I75A 4PJCA 5F44A 1A7BA 3QDGE 4OLXL 5BZWA 3DWTA 3S35L 4FZ8L 4UQ2B 1OB1B 5FM5O 1KELH 3SDDB 4K9EL 1FYHB 1TTGA 4P5TD 3VDBA 2ARJQ 3D39E 3ALPA 1HQRA 2EC9U 2XYCA 1BBJA 4MSWB 3MREB 2XZQH 3REVB 5ID0A 4KAQL 5AYUH 1N6UA 2J2ZA 1A3QA 1SJHB 4PJBB 3QDMA 1SHMA 3FONA 4HJGA 4CL7A 4KKLD 3RUGB 1SYSA 1DVFD 1YY9D 1I1YB 3ILQC 1K4DB 3HAEB 2LU3A 1P9MA 4OTXH 3DUSA 2OL3A 2XXCB 3NVQA 4UU9A 1H3VA 4APQC 4M48H 3RJDA 1QSFE 1F45A 2E7MA 4JRWA 4Q0XH 2LABA 5K9KB 1B0GB 2Q8BL 4M7JH 2VOTA 2R0KL 4OTXL 4LSTL 1UWEH 5T3ZL 3TA3D 1OGAB 4K8RL 1KPUA 5EO9A 1YEFH 3FT2A 2CDGA 1FNLA 2CJUL 1A3LH 1S7SB 2R0KH 1FFOB 5INDA 4PJ5B 1QFWL 3L6FB 4K94L 3U0TA 2AXFB 2PCPA 4LLUA 1JFQL 4NHCL 3C2AH 3BMWA 4MVBC 1BVKA 4JM2C 1V8HA 3GB7B 1NMAH 3DPBA 4MA7L 4DUXA 2MPAL 3QPQD 5IQ9B 3S97C 2W60B 1QVOA 5EA0H 3JUZA 1ITCA 1N4XH 1DLFL 3R4DA 1TXKA 3EDKA 3H6JA 3C2AL 2HTKC 2C4FT 4APQB 1Z3GH 4X6FB 3QRGL 4H0GA 1RIUL 4PJXF 1X5LA 5I2IA 2OTUA 4QRPE 1TNMA 2K7QA 2XA3A 5GS3A 4FFVC 3KYAA 3U4EB 4PRID 3UMTA 4YFDB 2O26U 3MRDB 4JHBA 5EWIH 2VH5L 5EOQH 3MV9A 5BV7C 4UV7L 4X9IA 5IR1B 4Z5RA 5L7XL 1JPST 3W11D 3QEGL 2IANE 5HPMA 4HJJL 2DWDA 1VHPA 1MEXL 4ALAL 3SKNB 3IFPB 1KV3A 1PBYA 3PIQA 5IWLA 4K7FB 1IT9L 3OKMA 4HS8L 4DJMA 3DHMA 5IEHA 2X1OA 5E8EA 5ICXA 5EULV 2G9HA 3TIDB 1QBLH 4JFFA 3JTTA 2VAJA 3KNBA 4KHXL 4NUJA 4WU7A 5E08L 5ACMA 4YDLB 1UQSA 2IPKB 5SX4H 1UKQA 3GUTB 1KACB 4H1LA 3ARFC 1FE8H 5C09E 1I3GL 5D70L 2BNRA 2IFFH 1IC4H 1KTKE 3HAEH 4R6UA 5HDLA 2EDKA 1ZTXL 2EDXA 2MHAB 3IKCB 4CKVX 2UUDK 4HFWA 3VGHA 4LSDA 2BSTA 4CVXB 4HKBB 1NC4D 1UG9A 4KV5F 4C4KT 2MSPA 3G9AB 3BN3B 2UZXB 2CLZB 4PG9A 4ZNEE 2YD5A 4JCLA 1PG7W 1PW3A 1T1ZA 5C0EA 1P84J 5J1TC 3SO3B 2DIJA 3UPCA 3C60B 4KJQD 3ARDA 5F1SA 4HT1H 1HH6B 2QQNH 3MNVA 4QNPE 3O6LL 3CZJA 4LSSH 3VFWB 4FQLH 5E5MA 1CU4L 1CFVH 1FN4B 5C1MB 4Y16B 3V7MA 3V6OA 1CLOH 3NMEA 4G43A 1GOGA 1ACYL 1IARB 1HQRB 3HS0B 4QRRE 5J06A 3GSRA 4FQLL 3TA3A 1HYSD 4Z78A 4XPTH 3MRQB 1U58B 4KHTH 1CDIA 1H3PL 1S9XB 3BPNC 5D71H 4XNQA 5IHUH 1SMAA 2F53B 3EW3B 4Y4HD 2GK0B 2RHEA 5ERWA 1GGIL 3MLUH 3NA9H 1CK0H 4WI2A 1IAIM 1RZ8A 2QKIB 3HRZA 5FM5M 2Q7YA 4IM8A 5SWQB 4JCMA 1YNKH 3RX5A 5IG7A 5IHUL 5LAXA 4GRMA 3OG6B 2H3NA 4Q6IC 3X3GL 3HLAB 1E6JH 1KIPA 1IFHH 2XWTA 1RK0B 4J7RA 3P4LA 4L4TB 2HLFD 1AO7A 5CGYD 3IFNL 2G2RA 2COQA 1YNKL 4P23A 3VFWA 4XGZB 1JV5A 1YEHL 2R1XB 5ITFA 3QZWB 4YZFE 2FH6A 5SWSD 4XPFL 4ZAKC 4ZODA 4Y16A 3L3DA 3QFJA 1EBAA 4QXUH 3BGMA 4F15C 5J6GA 5IOPB 4MCZA 1DQLL 2DQFB 2ZJSH 3QH3B 4U1IA 2YKLH 2WUCL 2WBJC 5DMIH 3JTSA 3QDJB 4YHLH 1O0VA 1GGUA 2GCYA 1RI8A 3FN3A 4NCDA 1I1FB 4QXUL 1D5IL 1YQ2A 1TLKA 1KB5B 1B3JA 2BHZA 1IAKB 1MCWM 4P46D 3K1DA 1IVLA 3CC5A 2WIMA 4YHLL 1OWRM 2P45B 3QP3A 1BX2A 3FFCA 2FJHA 2HKFL 4NKIH 3VGAC 3FB8B 1CZ8L 1HHJA 2UWEB 4AT6A 5AZEH 4FMKA 1BAFL 1X5GA 4S1DC 4UT9L 3GSWA 2GFBB 2LFGA 2NLJB 3H42H 1EPFA 3OXRB 5L6YL 3EJYD 4M43H 4UV4H 3RIFF 1NFIA 4XMLL 2I25N 4JRYB 3ZT6A 3GRWL 1SJVA 5CEYB 2IQAA 3UYPA 4R7NB 3VI4E 4PP1C 2BY1A 2DKUA 2GJZB 2Z8RA 4Z5RB 5DMJB 4OZHE 2W38A 3VH8G 1IKFL 1NFDB 5IB2B 3BZFA 4ORGB 4F9PC 3OZ9L 1ZE3C 2YC1B 1GCFA 5C0JA 5DMKA 5DJAB 3QUMH 4XZUB 3K4ZA 1GZPB 1WSST 3BHBB 1ONQA 5KOVC 3QNZB 1IKFH 5I1DA 1EEZA 1KEML 1MCEA 1MCOH 4OLZH 4DTGL 2J8OA 1VFMA 2DL2A 1IGMH 1NSNH 4S1DD 4OFIA 4DEPC 3RWCA 3NPSB 5HDQL 2X4SB 5B4MD 4R96B 1IJ9A 3ARDD 4HEPG 3DVGA 3LEVL 1U42A 2A83A 3PP4H 1INDL 2F5BL 1KEMH 3D3VD 5LG1A 1EGJH 4FQHA 1R3IH 3U9PL 3KYMA 3MRBA 5DD3H 3T2QA 5T1DH 2V9QA 4KPHL 4JO1L 4ONHB 3P4OA 4P3WA 4YEEA 5IB4B 3LEVH 4HG4K 1N2RA 5FUZL 4OFVA 3EHBC 4HWNA 5GJSH 4J4PA 1E6OL 2QR0B 3GSUA 1VENA 4GG8B 3NIFF 2VLME 1NH6A 4I77H 1UWGH 3DI2B 4FOMA 2Z93B 3CDGB 1I9JH 7FABH 2FB4L 3CFKA 5F8RC 4ZDHA 3H3BC 4YX2H 3MRHA 3L95A 3SKMA 3C5SA 1ZMYA 3F7VA 3S88H 4HUVA 3DX8A 1KF9B 3DX9B 1IEAB 4FP8H 5HHOB 4OCRL 1T83A 1G7LA 1JZ6A 4XCEA 1IM3A 3Q2CA 3VXSE 4UT7H 2D31B 1UWGL 4EI6B 2ZG3A 5C0NC 5SX4I 3AB0C 1MFEH 2XTJC 4WUUD 1BFVL 5B3NA 4I3SH 4RMQA 1QP1A 3U4AA 1XGUB 2E7LC 4HJ0C 1MWAB 4EI5D 5A2JH 1ZLSH 3TBTA 3SBWA 5CUSL 1MHCB 1UB6A 3KYMB 2YEZB 4KTYA 3DJ9A 4I3GA 2PYEA 1R5IA 4FQQB 4I3SL 1W0WA 1TQCB 5C09B 3I50H 2H9GA 3ZT5A 5D1XA 1LP9E 1FZOA 1AD9A 4IOSD 5IB5B 4UINH 1IAMA 1G1CA 4UAOB 5HHOD 1UEYA 4O5LH 3NIFE 4PR5B 1P53A 1DLHA 3DECA 5B38A 5F3HA 5ETUB 1JNNL 3WS3B 1CDCA 4BZ2L 2R2CA 4PJGB 5D1XC 4C56E 1SJHA 2DQUL 3HMXL 2A6IB 3C2SA 2C1OA 2DQHH 2W59A 4G6MH 4Z0XA 1YNTB 2MJWA 3GSNB 2FGWH 4AH2B 1CLZH 2ED7A 3CFCL 1IM9D 3QZWA 2VZ1A 1ZV5A 1XF2A 2ED8A 1A2YA 1BGXL 5MENB 4ORZC 5EU4A 4PLKC 4ZD3H 4JQVC 1MIML 4NDMA 4IIQB 4M1DL 2A38A 3VXRA 4Z7NE 3NZHL 3DV4A 2JJUA 2APXA 3GJFA 1EXUA 3QWOB 4X4YA 1I1FA 4KKCC 5E5MB 1HILB 3BX7C 4LPYA 3TBSA 1T04B 4MJ4A 4K3GA 3BOVA 4YXLH 4HCRA 1T1YA 4TN9A 4U1JA 4GG6F 2RB8A 3WE6B 1HSBB 2YPLD 4GW4A 1KB9J 2NY0D 1N8ZB 4QT5B 3ARFD 5M7QA 4CJ0A 1PD6A 2BMKB 3FB6A 4LHJB 1WGOA 3TBYB 1EEUA 4NKMB 4Z7WA 4ZAKA 1YNTA 3LV3B 3TP4A 3C6SB 2E5EA 3NFPA 4X8JA 4HC1L 1FVCA 4QRUB 4YZFF 5D7SH 3KPNA 5A2FA 4OFDA 3Q48A 3WO3B 3PQYE 5MERB 1U8MA 5IJVA 1JWMA 1JZ5A 2ZPKL 4PJ9B 2OYPA 2X4PA 3T0EB 1T6VN 1GHFL 5DT1H 4HC1H 5E7FA 2O61B 3C5ZD 3HFMH 4HUXB 5DD5H 5C0AB 1IC5H 5D2LA 5E1AB 3CX2A 4F2MB 3DX6B 1OPGL 1U8PA 3QHFH 4IRJA 3WFCH 4QO1A 3MOQA 2D9QB 3CMOH 1LE5B 3L5XH 3QQNA 3QUMA 4H88H 1DUYB 4YFLI 1NCBL 1NLDH 4LRNL 3KXFE 1NC4B 2KQNA 3CLEH 3KYOB 1FV1B 5J3HD 2FYYA 1MHPL 1RUQH 4OFKA 1FL3B 3IFPA 1CE6A 1JGUL 2B1HL 3B8SA 3Q5YA 1H15A 3EO9L 1ADQL 4OCXL 2XACC 3KXFD 1AP2A 2X40A 4WUKL 5CIPA 2JK5A 1U8HA 2G9HB 5E2UL 3K1KC 4UIMA 4POYA 5EC1B 3BZEA 1CGWA 4LLWB 3ESUF 4UQ3B 1MHPH 4HUWB 1UENA 4U1HA 5EBMB 1AHWB 3QIBD 3TVMB 5BOPA 3S4SB 4Z7VA 3AFLA 4XP1H 2H32B 4JFXB 5ITBL 3GSXB 3L6FA 4PJ5D 3HC0A 3G5ZA 3QEQA 1OF2A 4DVRL 4P2YA 4M7KL 1QA9A 4ZFFA 4Y19E 4KROD 4P2QB 5E6IB 5BJTA 2BSTB 3ARTA 4XCEB 4XMPL 4QHUA 5HHMB 4Y5YA 2ZSWB 1UH4A 3Q6GL 3O2DL 2XIDA 3RKDC 4B7LA 2ADIB 4PJEE 4OT1L 4X4ZA 5BRZE 4EUPH 5GS0H 4GQ9H 1JTOA 1MY7A 2P5EB 1SBBA 2OSLA 1QFOA 2IEPA 5EUOB 1XZ0B 3WO4B 2Q86A 5DJ8A 3ROOB 3V0VB 3QUYB 3TCXA 1RVFH 4S2SB 2HJKB 4ESKA 4O4YL 3ULSA 4LLWA 1FSKB 4CMHC 4G6KH 5ECJE 1LP9F 3FO2B 2BVTA 4IRSD 5CGTA 2J4WL 3W82A 1WC7A 3IDNB 5IHLB 5IW1B 2A83B 5CP3H 3HC0B 3O2WH 2DI7A 4QGTA 4ETQA 3VRIA 5E4IA 4PRHA 5HJ3B 5C0CA 5EFIA 5SV4A 4O02L 4M9PA 3D25A 2DLFL 4PJHA 5I18L 4RRPG 3F62A 2H1PH 3KYNA 4MLSA 4PTUA 2ILLA 2WLZA 5A40E 4P3CL 5HI3D 4ZOBA 4CMMB 2NXYC 5BRZB 2C9AA 3HI6H 3IXAA 3DSNA 4M5YH 1CXHA 1RZJH 4AM0B 1KLUA 4HGWA 4P3CH 1RJYA 3S98A 1T1XB 1N7MH 4L1HA 4U7KA 5JDSB 4P48A 1PKQA 1AO7B 4Z95L 5K59F 4QOKE 4UTBH 5EZLA 4QHNA 1HKLH 1RZJL 2BJML 3DI3B 1WWWX 2J6EH 2YOCA 4DAGH 1IGFH 4PD4J 3MACH 4OIAA 5DRNB 5BO1H 1OP5K 4HHAA 3O8XA 1HSBA 3OAUL 4GW4B 4IRJD 1J12A 4C83A 1YEDA 4FQCH 2UYLB 5F6HI 5HGHB 3UPRB 1S5IH 1HKLL 5IVXA 2IALA 1HH6A 4NZRH 4WEBL 2HJFB 1KULA 3L5WB 2I9TA 4QHMB 2XZAL 4PJAB 4Y4HA 4NC2B 1S7WA 4MD4A 4WHTB 3C6SA 2WBKA 5FGCB 1JWSA 4D2NA 4J6RL 2F9BT 2W9DL 3VE0B 1C16A 1CWVA 4JRYD 4R0LB 4GG6E 1HHGB 2HWZL 5FO8A 3BKYL 5EOCL 5GGVY 3QIBA 1QBMH 3TNNB 2HRPL 2Y6SD 3OF6A 1OAKH 4RMSA 4NHUB 4TUOB 5B21A 1JF1B 3ZDXF 3V0WL 3DURA 4ZFZA 3P9MB 2ZKHH 5DJ6B 2IAMC 5EU5A 3D48R 4DN4H 4JR9L 1NMCC 3VGAB 1XF3A 4PGZA 2IBGA 3VXRB 2EYSA 3WFDH 1VACA 4D0CB 3ARDC 1BJ8A 4NO3B 4PJ8A 1EO7A 1T6WA 1FHGA 3STLA 4FQIL 1G7HA 5JIPA 1PG7L 1CXFA 4TVPH 4DGIH 4F15B 4WTWA 3OAYK 5DQJB 1AKJD 5DVKA 2AJUL 4X4MA 5B38G 2P24B 4HIJB 2X89D 4QRSA 4IS6B 4X4XA 2EZ0D 3C6LA 2UY6A 1S5HA 2QKIA 1SEBA 3BO8B 3QEUA 1HHHA 2RFXB 4HKZB 3PL6B 2YA1A 2E27L 5ID1A 4GRMB 2GTZB 2HG5A 2NY7L 1R3HA 3BQUB 2R2HA 3EJZC 1P2CB 1TJGL 1A02N 4BQ6A 2HFGL 4NWUH 1FYTE 3LHPH 1AE6H 3AMKA 1Q72H 1AQDA 3EOBA 1HI6B 3P9MA 5TGBA 5JMOC 3G6AA 3MLRH 5SV3A 4XPGL 1V7MH 4NM8L 2D7OA 4KTDL 3S6CA 3SHSA 3NCJL 1AGEA 5KSAD 2EXWC 3S3PA 1K3ZA 2P8MB 3DSFH 1EEYA 4KDTA 2CMRH 3EBAA 3PIQB 1N0LA 4UDTA 3F7VB 3VXTB 5DHYA 3UTOA 5DDHB 2D31A 2J1KA 4Z7UE 3PP3K 4GRWB 1I85A 4NZTL 4WRLA 2A6JA 1I3UA 4KK6D 1BFOB 4JFZH 1XIWB 3EO0B 3QUXC 2MFNA 5JW4R 4X7TA 4EZMA 1IL1B 4ZTOL 5KAQF 5I1JH 1MWAA 4ETQB 3HUJF 1MFDL 1FP5A 2X4OA 3K74B 4OD1H 3FAXA 1G9ML 3GZKA 4KK5D 1DANU 4JFZL 5FFLA 4YHOH 2D7TH 4O2FA 4TRPL 3VG9C 2CUHA 1L0XA 25C8L 3RWCB 5C3LD 4ELMB 5AAMA 1A9EB 1OWWA 5DR5H 4M6ML 1U8JA 5L88H 1I4FB 1A4JB 1S8DA 2LVEA 4KXZI 1UXWB 5CZXD 4BELD 4NC1C 3I02A 4P3DB 5FUOL 1BJMA 1V3LA 2W9EL 3LEYH 2H2PC 3GKWH 3LKOA 5HHPB 4Y4HC 4EXKA 4OI9A 1GOHA 3UTQB 4GBXA 1EEQA 4Y89A 5L88L 1MNUH 1LVEA 3L9RB 3EDEA 5JQ6L 2AABL 1PKOA 5DRWA 1FVEA 3UROR 4JPIA 4U49A 2XFXB 5TE6H 5INCB 1KCSH 4G7YL 4OZHF 1I8IA 1MRDH 4NO5A 4R4FH 5DK3A 3VXSA 4AIZB 5FECA 1XZ0A 3B43A 5FF6B 4ENEC 3CXDH 1UM4L 1P6FA 1R5WA 4NBYB 4FQPA 1F4YL 1NCUA 4NQEA 1NGPH 1D6VL 4MJIB 2FHFA 4MQ7A 4G7YH 1C5BH 2VLJB 2X9XA 4XAKD 4B5EA 4KQ4H 3UTSE 1ETZA 4EXPX 1UC6A 1QPPA 4LCYB 4PJ8D 4WO4D 3MGTB 4F7MB 5ICZB 4L9LC 4Q9BA 4P5TB 3IYLW 1K8DA 4G80A 3FQRB 5DI8B 1LE9A 1S7UB 4RDQG 3I02B 4P3DA 2V2TA 4RA3A 5KVEL 5L8KB 2HVJA 1GIGH 2C1PB 4QNPF 4OCYL 2AJSL 1OGAE 4NUGH 3KPOA 4Z7VE 1O5DT 3VJ6B 1NCCL 3JWOC 2G75A 1JWMB 3R0NA 4OLEA 4KY1H 4XWOD 2VUYA 4HIEB 3HA0A 1RIHL 4U1SA 3HE6A 4J3TA 1S7QA 3C08L 1OGTA 4FQ2L 5FGSA 1EVUA 3VFPA 4UILH 3KPLB 4OD3L 1A6ZA 1P9MC 3SDAC 3ARED 2P5WB 1EJOL 5CILL 1TVDA 1V05A 1QO3A 5DTFA 2G5RA 3CVHH 1OCWH 4HWEH 3F7PC 5AG8A 3GMRA 1QHPA 3UC0L 2VDNL 1JK8A 4MYWB 1XEDA 3X3FH 3GJEB 3B3IA 3CFEB 2Q6WB 5E8PA 4P2OD 4OV5A 1L7IL 2XKSA 1QHOA 3CVHL 3CX5J 1J8HE 3D0VB 2B7DT 4P9MH 4KRNA 5L0QB 2OXGA 5ERWB 1IQWL 3X3FL 4FFVD 2X09A 1CFSA 2OM5A 3QG7L 2I9LA 4OCNC 1MCPH 2Y6SC 3CK0L 1Z6JT 4LL9A 3UX9B 4PJDF 1WJ3A 4KJWC 2HTKD 1JHTA 2DYPA 3ARSA 4ODSL 3RWIA 3WKML 1OTUD 3GSNH 4JQXA 1BQLL 2XPGA 5C6TL 3WIFB 3QWOA 3O8XD 4L8SA 4FXLA 4JQIH 1EO8H 2WAHA 5DJ6A 4XWGL 4WI7A 3P0YH 3UJIH 3E1F1 4TUKH 5DQ9B 1J0ZA 2EYSB 4GAGH 3VFSA 3QDJA 3VWJB 3WN5A 4A6YL 2ICWA 4UBDD 2D2OA 1FVCB 3SKJL 3JTTB 1OSZB 3VXMA 2PXYB 4K8RC 4D0DB 4X0KB 3MRMA 1QKZL 4YIQA 4NIKB 5I16A 2H8PA 4D8PB 4QLRA 2QSQA 3L3OA 1EHNA 4GAYB 3U0PB 4TUJA 5D7LD 4QRPD 1MFAL 1RJZB 4OGAC 3JV6A 4G3YH 4A6YH 4CUCA 5HYJD 5HYJA 5J8OA 3VRIB 3WO4C 5SWZD 4LSVH 4PBVC 3FRUA 5MP6L 2R29L 1T80A 4HLZH 1LEIA 4P0DA 1WVZA 5ADOH 4OUUB 3FQWB 5KANG 1S9VB 3CVIL 3PXHA 2DQIL 5DO2D 5F9JB 4C56D 1CXLA 4O2CB 3T3MF 1IZJA 3LRSA 1FNSH 3CDCA 3H0TA 1XGPA 3VFOB 4G8EA 1RJYB 1EV2E 1L7TH 3BUYA 15C8H 3CH1B 4JFHD 3P77A 2FBOJ 1AHWA 1KXQE 5F88A 1MFBL 1RIUH 5KW9L 3FTGA 5HPMB 1QSEA 2QADC 5E2WL 5F70A 1UXSB 3ZKND 1FYTD 4LDEB 5E2VH 4WGWB 1S7VB 2NY0B 3ZDYE 1JZ4A 4LLMB 3O3DB 4LMQE 1RJCA 3ZKXC 3ARBD 4XVUC 2VB5A 2VXVL 3IFOB 3M8OH 5DD6B 3BH9A 4PLJC 3Q3GB 1RMFH 2GEEA 2VIRB 2MKLC 2Z8VC 1FGNL 1K4CA 2WP3T 3GJFK 4LHUD 3T0EC 4K8RD 3QAZC 2X1PA 3C8KA 1MH5A 3QQ9D 4O2CA 1KTRL 5J1AB 4HCRH 1CF8H 4RGNB 4IBLT 3E3QC 5DJDA 1PKQE 3FAWA 3WSQH 2ZSVA 3C5ZB 1XT5A 4KHXH 2O5ZL 2ZUVA 2Q86B 3ARPA 4Q58C 2FO1A 3BXNA 4Z7QE 2QADD 3D85B 5D6CB 3T3PF 5L2KE 5T5FL 1HEZB 1CFTB 1CF8L 3ZKQD 5TDNB 4ZPVA 1Q94B 1NCNA 3HG1D 4X6BB 2IANA 4ISVB 2JKXA 3NA4A 2DLTA 4UUJA 3V9FA 5HBBA 2V5YA 1T1YB 4U1JB 4J8RA 1B4RA 4E41D 4V1DA 1YYLL 4QXGH 3Q5TA 4RZCB 2YSSA 3KXFB 2JCCF 3EKCA 4JPVL 4G8FA 4E41E 1BZQK 4U33A 1HSAA 2V17L 3EOTH 4XCNA 5DEFB 5F3BB 4G7VH 5E94B 5FGBA 4YFEA 3O4OB 4R26H 3MJ9A 1JZ7A 2DM3A 2BY2A 4GQPH 1PLGL 2CDGB 4OZHB 2QLVB 2X4PB 4QXTA 3O6LH 4PRPB 3EOTL 1JHTB 2DYPB 1AQKL 4X5XA 3TJEH 4Z0BL 3TVMC 1KB5H 3T0WA 1LHZA 1A6VH 1SBSL 5ESAB 4N1HB 2AI0L 5F96H 4QHKI 3BPNB 4XCFL 4HBQA 1DQQA 3HZKB 4NBXB 1I3RB 2J8UF 5I1KH 4NQCE 2B1AL 4BH7B 3Q0HA 3C87A 2BSSB 3TJEL 2DF3A 4Y19B 3HZMB 2GT9A 3T0XA 1SBSH 4Y4FB 2AI0H 4NRYA 5TH2B 4I0PD 3LS5H 1NCAH 4I0PA 1H3TA 5DUBB 4RGMC 3NTCL 4P5MB 3QIUD 2G2RB 3QIUA 4OIBA 2VLKD 5BRZD 3HC3H 2ICWB 1DBJL 5E94A 1JGDB 5GRVL 1IEBA 2OZ4A 1ZVSB 4MXWL 4JQXC 2MQ0A 3IFNH 3QJHB 3EDDA 4ZS7L 1WCQA 1IMHC 2OR9L 4OV5B 1E0OB 4KI1A 3V6ZA 3QG6B 4TSCH 4AQOA 4YHNB 4I18C 4TSAH 4WV1C 5EU3B 4W81A 1NC2A 3HRPA 5EZOH 3T1FA 2C3XA 3WS6C 4RNRB 4KZDL 1MCBA 5GGRY 1U8LB 1OP3H 1I1YA 5C0BB 1KYOJ 1J0KA 3BEVA 4PJ9A 3VXUA 4X6DA 3BGAA 3NABL 5IW6B 1CDGA 2K7PA 3AREA 3CXHK 3LN4B 3G6JB 5HPOA 3QQ4A 4RRPA 1HCVA 3IRPX 4N0UB 4DOHE 3X14A 1RZIA 4PJ8B 1G7QA 4JG0H 3NBNA 2QQKH 2IH3B 3D18A 4PJHE 1TZIA 3D0LA 3FHAA 3O6FC 5JOEA 5TQ0H 1YMHB 1OSPH 2HKFH 1J0IA 2FGZA 4QTIH 1JGVH 2NY2C 4N0YH 4XP5L 4X7SL 2CR6A 3H42L 4JANB 1YEIH 1QLFB 1N64H 4GKZB 5IW1A 4OLWL 1H3GA 1TVBA 2UUDH 3NACL 4P57A 1MHCA 1UB6B 1JGVL 4MB5A 2V2XA 5DRXB 2EKSB 1CD0A 2CIIB 4XC1H 2VLMD 2A6DA 1AGFA 3CFJB 4V1DD 1N64L 5ALCL 5F1IB 2EEAA 4Z7UF 2JCCA 5C08A 4JPKH 5H35A 3BAEL 1NDGA 4YBLC 4PYHA 1XGRA 1Q9LA 2CDFA 3GSXA 1U6AL 3O2VH 4LVHC 5B39B 3RL2B 3I75A 3QFDB 5GGSB 3S3JA 5L2JA 4GRLD 3BPCA 5C0GA 4TTDC 3U36B 1KJ3L 4K7PL 3HC4L 5A3IC 3FO0H 3BKCH 4JO4H 4WI4A 2OP4H 3S8WA 1J1OL 2QR0A 3D87B 1QNZL 3O9WC 4LRIA 1F6AA 3MRCB 4HGMA 3BRFA 1KJMA 4WVRA 3FO0L 4MXQD 2EEBA 4M4PA 2C4FU 1MF2L 3QUYA 5CJQL 4S2SA 1EMTL 2FECI 2HH0L 4NQED 2B5IB 3JZ7A 2IQ9H 2VTFA 1I8KA 4LRIC 3EO1B 4YPJA 1PAMA 5DEFA 1U8IA 3FTGB 2FB4H 3OR6A 2IPTL 3SJVA 5EOCJ 8FABA 3PWPD 4A2LA 5F7YC 4M9OA 4AEHL 5CJQH 2VDKH 2FECL 1ZT4B 4FP8L 3O3DA 4S1RH 5A43C 5C70A 1AIFA 1EERB 3WIHL 3OPZH 4LKXA 3OGOE 1T03L 4F7CA 5FK9A 4QRQA 2BMKA 1G7MA 4KKAD 2VWEC 5T3ZD 1GRWA 2IPTH 1RURH 1RV6X 1KCVH 1BFVH 5GRJH 5J13C 1FRGL 3QPXH 1HINL 1NEUA 1CGYA 4PJ7F 3ZTJG 5ICZA 2HLAA 3BPLC 1CN4A 3T0AA 2AERT 5INCA 4YK4C 5CHNB 4WIQA 5E00A 1JWUB 1VEOA 4BK4A 2VABA 4HGKC 1TENA 5TDPA 4KRPD 3UZEA 4OZ4B 3ARYA 4RISL 2VDLL 3MLVH 1NAMB 1FL6B 3ULVE 3ARVA 3ARBA 5DURD 5IK3B 1XF2B 3MJ8A 3ARGB 4MHHI 1LO0H 4MNGB 4NQDA 4F7PA 3BO8A 3B9EA 3ULVD 1QUNA 4F3FB 2I07B 5BS0E 2R2HB 5GPRA 4RDQF 4LHQB 4ONGH 3VH8B 3UTTB 2HVKB 2DLEA 2GITA 1BGXH 3WDIA 2CUMA 3L3JA 3G5VA 2EXYD 4N9GA 4ODUA 1HXYA 4FHBD 5KVFH 2J8UE 5DTFB 5BZWB 32C2B 2YK1L 5K93A 1YPZA 4KKBC 1MCWW 2LAAA 2OJEA 1JPTH 4ONGL 4UT6H 3OX8B 1QBAA 5IG7B 4PY8I 4PJXE 2BSRA 3MR9A 4PFEA 4P49A 1B4JL 3MX0A 1NGYA 3LRGA 1YZZA 5FYKH 2Y06H 4ELKB 4PV9A 4Z7WB 5FHAL 3TZVD 4MQTB 3EYVA 4JRXD 5F21B 4XGZA 3ARGC 5GS2H 1UJ3B 1MVFA 5HGAB 1LWRA 4ZFZB 4LMQI 1XCTA 1XIWC 3QUXB 3RGVA 2A6JB 3TT1L 1EX0A 5HHNA 3MUHL 4PTTB 5HVHC 4JANA 2XKUA 2VDMH 4LSQH 4Y5VB 3F65A 1ZWIB 2R2EB 1I85C 4FQXA 4RSVA 2XPGB 1A47A 1INEH 5DVOA 3HNSH 4PGBB 1ZHKB 5I8OL 2NX5E 1DFBL 4MJID 1IM3B 4YDJA 3VW3H 2BSED 2BERA 4GKOA 4DWHA 2IADA 4HUMB 4PJ5E 2AJXL 1FAIL 1KNOA 1RY7B 4NUJB 4QWWC 4WU7B 5GGUA 3PQYA 4Y8AA 2FWOB 4MJIE 4PBWD 5GSVB 5ID1B 3JWDH 1DFBH 3HPLA 5BV7B 1G7PB 4YK4B 3ISWA 1WWCA 1WQVT 4JFOA 2BCKB 4MD0B 2PETA 1J7VR 1GGTA 3FQXB 2P8LB 3Q3GA 3PGDA 1JNHA 3LQAC 3GM8A 2B0SH 1RUQL 3RPIA 1NGWA 4GBXB 4Y4KB 3VMOA 3UYOD 3MXVH 2EDOA 4JFED 3WCYA 5BRZA 4WUKH 5D96C 4JFQB 4XNUH 4DFIA 4HPOL 4DGVL 3HG1B 1XGUA 2CK0L 3TEUA 3G9VA 5I15H 3LN5B 4Y16D 1LO2L 1JYNA 3P73B 4CGTA 5EPMB 1U91B 4ZXBB 4DCQB 2FJGA 5DUPH 3T65B 3RKDD 5ITBH 5LJYH 1C08A 1RHFA 1J1PL 4L8BB 2VR4A 1OW0A 4LIQL 4DN3H 5D5MF 2RAMA 3GDBA 4JHWH 3FB7B 5DEZA 5E6YA 4XMPH 2DICA 3IETB 1F13A 3HZYB 4X6CF 2W1NA 5IMMB 1J1XH 3A6CL 4N8VG 3W11C 2APFA 2VZVA 4NQDD 2EDRA 1KC5H 1FCGA 3M1BB 4R7DA 5BZDA 4NQDE 5HYSB 3ZMRA 4BFIA 4U1MB 4OZHA 3WNPA 3TH2T 4P4KC 4BZYA 3LQAH 4ZDHB 4PRIB 3N1GC 3WIIH 3WXVH 1IBGH 1BBDL 5TDPB 1RZFL 5EG6C 3QDMB 5DC4B 3TBWA 3NFPB 3CVHA 4X8JB 5D7LB 4CDGC 4OJFH 1OARL 2AEQH 3TPUA 2EC8A 4YR6A 3RL1A 3S9DB 5DRWB 1P6AB 2ARWA 5T5NG 4Y2DB 2FX7H 3QWQB 4E5XA 4CNIA 1I3GH 5KS9B 5C9JA 2Z91A 2DLFH 1HWHB 1A3RH 1H3XA 1JUFB 4YC2C 2X42A 2H1PL 3BYYA 5H8DA 5FYKU 4K9EH 2I26N 4OCSL 1R5WB 2YWZA 5A2IH 2BC4A 3VGGA 2D03L 1CFTA 2L4OA 3PGCB 5C09A 5C0IA 3CDFA 1BP3B 1CDUA 3DV6B 4IHOA 3MJ6A 2NY3C 1AD0B 1FORL 4Z7VF 3WNMA 2JELL 1IEBB 3GHEL 4ZYKB 3T4AB 3TN0B 5T1LD 1TJIL 5GS0D 5E1HB 1NC4A 1JZ8A 1HHHB 2RFXA 3VXPB 3ULUF 4PLJD 4RFOH 4Z7NF 1B9ZA 2VMFA 1KXTB 3V5DB 2NY6D 1ZEAL 3ARBC 2GJ6D 4TSBH 3ULVC 4LARH 1K8IA 3P2TA 1XR9B 1N3NB 3THMH 2P8PA 2CD0A 3DGGB 1S78C 2PTUA 4KVNL 2Q20A 5DQ9A 4ODWA 3X14B 3WFEH 4BKLB 2R2EA 4FQXB 4NSKA 3VWJA 3NZ8B 3VWJD 5HVGB 3CX5K 1U3HC 2DBLL 4LVHB 1RHHA 2LVCA 2FZ3B 4CVWA 1JIBA 3VXMB 3SDDA 2VDPL 3UYRL 5C8JA 3WE6A 1IKNC 3SE9L 1JN6B 1CICD 3NCBB 4I0PB 4LCCC 3E6FA 5EA0L 5D1XD 1KFAL 2R4RH 3MRLA 4JFHE 3HPJB 1N5YL 3FB6B 5TQ2H 3MJ7B 4NQCA 4G5ZL 2HFFB 4UTAL 5D6DA 5DZOA 3ARZA 3BDYL 3GSOA 3IGAB 2P24A 5JDJA 4M6OL 1KPRA 4JR9H 3H8NA 4N0UE 3S7GA 4DOHB 4ODXB 3U1SL 1EFXB 1O7VA 1RUPL 3HE7A 5DZLA 4YDVB 4FRWA 3WD5H 3O11A 1HHIB 2FLRT 1U8QA 3D2UA 4XPAL 1TQCC 3VFVA 2VRAA 5DMIL 4M6OH 1NGYB 1JGLH 1BQHB 4K2UL 4O51A 4PV9B 1MUJB 4R2GC 3QQ3B 3V4VL 5BMFL 1J9CT 4MDIB 4LEXL 1ACZA 4WW2C 5ABDE 1HZHH 3U0WL 3GSVB 1CS6A 3HE6D 3VXRD 3VXNB 4IOFD 1A6AB 1ZS8B 3H9HB 3RWEB 4HULB 1QBLL 2NX5B 2W0KA 4OLYL 2IBZY 5D1ZC 3VXUE 2HFGH 2IPUK 4QKXB 3MRNA 3LH2H 3LHPL 4LEOB 3AY4C 2X4NA 3H3KA 4RIRA 3TFKD 5FM4A 4CU7A 4UV4L 1WK0A 1NEZG 3ARDB 4JFFE 3MA7B 4HD9A 4XNMA 1D6EA 2IFFL 1IC4L 2B5IC 3E8UH 4MLIA 4KTDH 5IVZB 3LH2L 3IDXH 4YXHH 1OAUL 2IPUG 4M4RA 1O7SA 4LCYA 5BW7C 4YPGB 3ULUL 1BOGA 1HHIA 2ZOLA 4TULH 3OZ9H 1MCHA 4A6YA 4M00A 3QXAA 3ZZ1A 4LSPH 3AVEA 4X98B 3QUML 3GBNH 1BEYH 1SYVA 3ULVL 4O51B 4R2GB 3WLWD 2UZIH 1CXEA 5I1AB 4OZFA 5HGBB 4ZSOB 3RX8A 3BXNB 4R4ND 1F3DH 5B4MC 1HXMB 1MCRA 2C1OB 5F1IA 4R97B 3G6DL 5L8LB 4MX7B 1WICA 1OAXL 3BW9A 1J11A 1KEGH 3MA9H 4CVZB 1OAZH 2H2SD 3PHSA 5EU4B 5GZOC 1KCRL 3SKMB 5AWNH 3TC9A 5E8EB 1TZGL 5ICXB 1J8HA 3GBMH 4EBQH 1CGUA 2Z8WC 3U7WL 4DKEH 2ADFL 2YD8A 4Y4FC 4U6TA 1F97A 2YZ8A 1NAMA 2EYRB 4DK3A 1BD2B 3O3AA 3VRJA 4BFGA 1KPVA 3AUVA 4TTDD 4G9FD 1Q9LB 2CDFB 1DZBA 1DQJA 2ARJB 3RZCC 4ZTPH 1FVDA 4MB3A 2FEDC 3R1GH 3FKUS 3VD4A 4OCRH 1MNUL 4KTEH 3VFUB 3VD9A 3BH9B 4WNQA 3F12A 4X6EB 3UTTA 1OL0A 1LILA 1CFNB 4YEFA 1KJ2B 4O2EA 4YHPA 2VXQL 4KK9D 2MQCA 1FNGA 4I13B 2NXYB 4JJ5A 4BUHA 1XR9A 1F6AB 4JKMA 5IMKA 2BRRH 5HYSA 3UTZB 4HF5L 5DJZB 5SX5H 3FJTA 3CSPA 4M02A 2OL3B 1QFPA 3V4UH 1A9BA 1KLUB 5CUSH 2UWEA 1MFNA 2R15A 4WUUA 1FO0L 1ZT7A 4CN6A 4J23A 1C5BL 5F9OL 1JRHH 1F11B 4AG4L 1GGCH 2FATL 1T21B 2CXGA 1CL7L 3OF6D 2RIKA 3GO1L 1G6RB 4XNXH 3MJ9H 2H2SC 2KZWA 3R8BB 1C1EH 4JY5L 5CEYA 1IM9B 1J5OL 4XMKH 1VEMA 4N8VA 3KLHC 4M1CC 4TPRL 5C9JB 2AJYH 1DQJB 4ELMF 1E27B 2XTJB 3KYOA 4U1GB 4G43B 3HUJA 5CGYC 1MAMH 4MHHG 4YGAB 4W68A 2AP2A 3VFSB 1FFOA 4EEEA 1GXEA 1C1EL 4JY5H 5C0JB 5IBTH 4UOJA 1TMCB 4MXQC 2R0LH 5I71B 1KTDB 3WN5B 2PN5A 4TPRH 2F54B 4DKFH 5I1GH 4YDJB 1Q38A 2VITA 3ZDXE 1QQDB 1IC1A 4UT9H 4ZOEA 4OBSA 4G8IA 4D0DA 2W60A 4FXKA 1HNFA 4YLQT 1CR9L 4LVNC 5KG9A 2VAAB 3C08H 4NQTA 1SM3H 5GGUB 3UO1L 4GT7A 2R0LL 1RFDH 4R0LA 2YWYA 2XV6B 3AREB 3MREA 3DUHA 3NZHH 3AXLB 4Z76B 3RI5K 1U3HA 3NN8B 2BCKA 3TFKC 1OCWL 4OCLC 4NRXB 4UDTB 4DGYH 1DE4A 1KTLB 3FMGH 3HI1A 2VDNH 4JO3L 2N7BA 5KJRH 1RUKH 3SGEI 3W0WB 5JTWA 5D72H 3BGMB 5E8OA 1X6LA 3EGSB 3EO0A 5JW3H 4P9ML 2VN4A 3KDMA 4TNWK 1VCAA 4GKZA 3HG1A 4L3CB 2VLRD 5K9JL 1SJXA 2Z8SA 3MA7A 1B0RA 1C12B 1DBBH 3C60D 2A6DB 5HYJE 3OHXB 2EDQA 2A77L 1XGYH 2GK2A 4X80H 3HNVL 4FZEH 1DDHB 1F8TH 1NDGB 2DL9A 4JDTL 2RQ8A 1DL7L 4M93B 5C6TH 5FUZH 1H15B 1QD0A 2EH7H 1I8MB 1Q9OA 4HFUH 3K8KA 4XVUD 2A77H 4JDZB 5D1QA 4FZEL 1R5IB 3HI1B 2VDRL 4FFWD 3PWUA 1DL7H 3ABZA 1KNOB 3HB3D 3ZSSA 2EH7L 3WIHA 1FZOB 2HN7B 3MOAL 3BT2L 2D9CA 1MWAH 1I8LC 5GSVA 5JHDD 1U8QB 3D2UB 4HPYH 3WHE1 4BSJA 1FIGH 2BNUA 3VWJC 3HUJE 1MUJA 4J3SA 5TDOA 3MUZ1 4LCWE 4OFYA 2FJFB 5H94A 1TZIB 4QTHB 2E9BA 1AFVL 4OZGA 2VZ3A 3CVHB 4G3YL 1I7RA 4MDJB 2C1PA 2DQEL 5D4QA 2DKSA 1VB9A 5TE4H 3ZYOA 2DQGL 2P5EA 3I3BA 4F7MA 3LQZA 2JJTA 2UWEE 3H0TB 1Y6NR 5L9DL 1FIEA 3SY0A 4X4ME 4I9WD 3PWLA 4C83B 4EI5A 3NFSL 5DJ8B 2XA8L 3ROOA 4I0PC 4DEPB 3D2UD 4HWBH 2DQGH 4XVSL 1T0MB 3HE7C 2F53A 5DRZA 3RBSA 1UQSB 1I7UB 2IPKA 4GXVH 1QFHA 2YRPA 3UTTE 1NFDF 2X4QA 4ZSOE 1DANT 1H8OA 1L7TL 3EYOA 1CLZL 3CFCH 3MV9D 3LIZL 3EYFA 2OZ4H 2C5DC 5FDYA 1S9YA 1S7TB 2BVPB 4ZSOA 4O4YH 3OAYH 1WITA 2PYEE 1QFWM 4IRJC 3RUGA 1OTSD 2W65B 1W8OA 3QIBC 2V7HA 1I3RA 4PGCA 1U92A 3C8KB 1N3NA 4L8BA 4TNWF 4JFFD 2XFXA 2ZCKH 5AZ2H 3O2WL 1N26A 2AKRB 4JRXE 4HGWB 5D2NC 2AJZA 4PRDA 1JPSH 5DVNA 3NCFB 3WDJA 1YY8A 4U0RC 4RMVA 1T0MA 1G7IB 4FABH 3IDJA 4ZPVB 4PRHD 5C0CD 2WWMC 4L9LB 5C0BE 4XP6L 4NRZA 1AR1D 1AXTH 2Z91B 2HFEB 3FT2B 4BFIB 1ZHLA 2R56H 2G60H 4QRQB 1CQYA 1MVUB 4KMQA 3VFUA 4HBCL 2ED9A 2M2DA 1T2QL 2OQJA 3J8F7 3PABA 1VFAA 1C7TA 3H7BB 1BZ9A 5ESVB 2NY2B 4ODTL 4P5TC 4YHPB 1K2DA 3HFML 2X4RA 4H25B 3GK8L 1DBMH 5CGMA 4I48A 3MRMB 1CTOA 1AI1H 5I1HL 4POZC 1IGIH 4HBCH 1T2QH 5I73C 4RGNE 3RAJH 1RJZA 3F58L 1CGSH 4OF3A 5DJXB 3RWFA 3X11A 2XZAH 4NN5C 1IGIL 3I6KB 3FO9A 2FL5A 1U2CA 2L0DA 1JGUH 4NQXA 2VQ1B 5DK0A 3RNKA 3L7EA 4QHUB 2PNDA 1CTNA 5I9QC 1QOKA 3QDHA 1ZGLP 2CDEA 3BKYH 4D0CA 3KPQB 1WIUA 3C60C 4S11A 1AGBB 3BUTA 1MIEH 1OAKL 1PGRB 5DQJA 2CIIA 3KPPB 1QRNB 2AK4E 2VC2H 4XHJD 3S5LG 3X12B 5CBAA 3ECBA 4ZFGH 2AK1H 3NGBC 5CZVH 5D7KE 4FFYL 4YHZH 3RDTC 2JJTC 2R2BB 1EGJA 3FO1A 2AV7A 2O61A 4XPHL 2PYFA 5GGSA 4LLUB 4R90H 4ZFGL 1MRCH 1EDQA 3MV7D 4Q9QH 2Z35A 4L8SB 3EOAB 5J3HC 2W0FA 1YNLH 5D7JA 3WEXA 5LGHL 3HE7B 4MDJA 5EU7C 3ME0A 4PJFE 4R90L 3FL7A 3BD3A 3IXTB 4MVBD 3WS6A 2X5PA 4A2MA 3RVTC 1W72A 4F58L 1I8IB 3V8OA 4BK5A 3IU4H 3QQ3A 3PWLB 1CE1L 1I7ZA 1WBZA 4NGHH 4L8CA 1X5ZA 2EIEA 5K9QG 1AY1H 1AR2A 3VXNA 3O45B 1PVHA 3HR5A 4MD5A 2CRIA 5TE7L 4ISVA 3NAAL 1LNUA 4AL8L 2E9WA 4O02H 5IB5A 5FV1L 2QQKL 4TUJB 5JOPE 4M1CD 5DRNA 3V5HB 3DSFL 3RIFK 3VG0L 1K85A 1B0WA 1GZQB 3UPRA 5DGQA 2WV3A 5EO0B 5JOPD 4KMTH 2CO7B 2YPLB 3WHXA 5E5UB 2O93L 2Y36H 4NQVA 2RR3A 2MTPA 2M26A 5GIRA 1MREH 4NO0A 1DVFC 5CSZB 5KN5A 1YYML 1H8SA 3HRZB 5I1EL 3N9GL 1TCMA 1MJUH 2BY0A 1X4YA 3BP5B 2NY5H 4NOBA 2DOCA 4HG4J 3IKCA 2VXUH 3QIWD 4L5FL 4N0FB 3G04B 5DYOB 1CVRA 25C8H 1OAYL 4XCNB 4Y0GA 1X44A 4BQ8A 4NFBA 1QYGH 3QWRD 1A1MB 4F57H 3CZFB 3T04D 2FR4A 4JDVB 4RWYL 5C2UB 3MXWL 3ILPA 4M61B 4PJIB 3TBTB 1OAYH 4QRTA 4XTRC 4HH9A 5F7UA 3I9GH 2XQBH 4AMKH 5FUOH 3GNML 5FO7B 1KTDA 2E6QA 5ESAA 4HK3N 4BSWB 1UACL 2DJSA 1HXYB 4PIRF 1U8IB 5CSGA 3K3QA 5JQ6H 2AABH 5HHXL 1KPVB 3RY6A 1R3JA 5DK2B 1ZGLA 3Q6FB 1EMTH 3OJVC 4GBXD 1N5AA 2HG5B 3VFNA 4YWGH 2FLBT 3LRHA 2W92A 3WJJA 1JGEB 4C56A 5I66A 1R5VA 1SVZA 1VKXA 2VDKL 2A2QT 1JHKL 4JE4B 5EU6A 2GTWA 4PUBL 3BKML 3VDAA 2DTSA 4J3WA 2F15A 2FR4B 1EUTA 1QLRB 5E00B 2NY4D 4LQFH 5DSCA 35C8L 2Q8AH 3GMQA 2AJZB 3M17B 3PWNB 1SEQL 1JHKH 1UB5B 2F58H 4PRDB 4RZCA 5FKAB 3V7AE 1RJLB 2FBJL 4X6DF 3D18B 2JJWA 3O0RH 2PF6A 5KSBE 3IDJB 2VLKA 4I18A 3OR7A 4OCYH 4P23D 2AJSH 1MLCA 1FNGB 1TJHH 5D2LE 3LKQA 1RUML 5MENE 3ZTNL 1WCBB 3VFRA 3WLBA 2FBJH 1AE6L 3S4SA 2P4AB 1ZHLB 3OBAA 1RIHH 1N5AB 2B2XH 4U1GC 5LGKA 4AK1A 4IOFC 1EAPA 5IEKA 3VD5A 3K2MC 3VA6A 3LVEA 5I17B 4LLAA 1MCLA 5I8CB 3L3KA 4HMCA 3JVGC 2CMRL 4XAWH 2F5AL 5D7JB 3WEXB 5HHME 5EIIB 3UC0H 4L4JA 3FZUC 4PJEA 1G9NC 4WCYH 5EBLA 5CBEB 3DRQB 2HT2D 3O6FD 5I19H 1KGCD 3TWCH 1OT2A 5C0AA 5T3XD 5HHMD 4GMTL 4HJ0D 4N90E 3BPCB 3FOLA 3ZL4H 1FJ1B 3G5XA 4PJAF 1U8PB 4IRJB 4RGOH 4K55A 4OLXH 5CWSB 5I19L 1H5BC 5GGQL 4MAYA 4AENB 3ETBF 4GMTH 3OB8A 4YDKH 3TIEA 4CDHA 2C3VA 3ZYJA 3ZL4L 4YPGA 1CQKA 1QRNE 2AK4B 3EUUA 5JZ7C 4ERSL 4NPYB 3GIZH 1IGYB 1BD2E 1XF1A 2H32H 1X4XA 2R1YB 5H2BA 3C9NB 3RY5A 1AP2B 3LPFA 5C07A 4YHML 1A21A 5GXBB 3DO7A 1QRND 3SDCA 4WI5A 4RGND 1QRNA 5FV2A 4ZFOB 2FX8L 3QBTB 3QDME 4HXAL 1YPZE 4KUZL 2ESVB 5GHWL 2ZZUT 1I1AD 3WFHB 3QIWC 4OIIH 3M1BA 5C6WH 2FWOA 1BZ7B 4LCWB 3AS0A 3GKWL 2HRLA 3P40A 5ISZB 2JCCE 5B38B 4XHJC 3SGKC 3FOLB 1FZKA 5GRUH 4DZBA 5F7NC 1FG2B 5JDSA 3TGXA 3LPGA 5T5NF 2GYSA 4BJLA 5DHVH 3P4MB 3F8UB 1ZVHA 5EO1A 3VXQA 1L0QA 2EZ0C 3VMNA 4GG8A 4PJ9C 3MBEA 3MMEB 1IZKA 1F90H 1F4YH 3AU1A 5LCVL 2W9LA 4W70A 1A1MA 4JY4A 4RFNC 4HHAB 3QJFB 3KG5A 4KI5C 1XH3A 3HS0A 2HJLB 1Q0YH 1JCKA 5H94B 3KJ6H 1JFQH 1I7ZB 1WBZB 1VEPA 4PJBF 3U2SB 4X4YB 1FPTL 3GI8H 4XNZC 3QNYB 5EBWA 3ARGA 2BY3A 3MV7E 4OZGF 4XI5C 3LZFH 4XBGB 5E56A 4S10A 2HFEA 5IBLC 3Q6FA 4KROB 4P2QD 2IGFH 1IKNA 3CFKB 1IRAY 3CFEA 2Q6WA 3OB0K 5D1ZB 3VFTA 4UI2A 1FC2D 1SQ2N 1MI5D 3RIAK 1NUNB 3LOWA 4FQQA 3WHXB 1OAQL 4K23H 5ESVA 1FH5H 3FQTB 4NQSB 4NC0B 1FNAA 5CKGA 1EO5A 2Y23A 1KCKA 1VDGA 4NCC2 1S7RB 1OLZA 2GTWB 5J1AA 5CINL 1R0AL 3B83A 5FM8A 2GAZB 4P5KA 4PR5A 3RDTD 3QEQE 1MQ8A 1EJOH 1ODAA 4TNVK 4PS4H 4WU5B 3KR3L 3KVQA 4HS8H 4ODVL 4XPBH 1LO5B 1FZJA 1RMFL 2CKBB 3FCTA 3MV8E 3MNVB 3W2DH 4EOWH 3H9SA 4GMSL 3SQOL 4MS8D 4EUPG 1BJ1J 1OP3K 2KPNA 1I7UA 3KPSE 1WZ1L 2PO6B 4PS4L 3TA3C 3QQ9C 4UV7H 3PV7A 3BWUC 4PJGE 1IAKA 1FE8L 4LQ1A 3QEGH 3RUGF 1WCBA 3VFRB 3T2NH 3SGDI 1MEXH 4GMSH 4LBEA 4JG1L 1OTSC 1ZTXH 1H5BB 3CH8A 2HAZA 4M62L 4YO0B 4ZO9A 1CYGA 2BOBB 1FLRH 4QHMA 1DEEB 2F8VA 4BSVB 1U8HB 3PNWB 5I76A 1WBXB 2NR6C 4QOKB 3DO3A 5FUCC 3WUWB 4UAOC 4AH2A 3PDDA 4Q6IA 3MUJA 5DGRA 4H5SA 3QIWA 1U8KA 1YECH 4FG6D 5CJOL 4I0KA 3CAFA 5JO5B 4O00A 3V0AC 4X6DB 2D03H 1EO8L 3RGVC 3CXHJ 2LU7A 4P2CG 3DXAB 5M94B 1V5JA 4L4VA 4ZXBC 1RK0A 1YMMB 1PQZA 2YUVA 3FRUB 5C2BL 1Z0NA 4H20L 4E41A 1TJIH 1ONQB 5BJTB 3EDFA 1G9MC 1CT8B 1QEWA 4U1KB 4R26L 5EU6B 3MJ8B 4FTVB 4XXDA 1PLGH 1CICB 2H26B 3GRWA 1QLRA 4M6NH 1QZ1A 1IQDB 5JPMA 4Y1AE 4IJ3C 4JREB 4KWUA 3IXTA 4FFZL 1GGYA 1Y18A 2J5LC 3IDUA 2HP4A 2OSLB 4YDIH 1M1SA 1WZLA 4MNQD 2BOBA 5TFSH 1YEKH 1H3PH 1PY9A 2ICWI 3IB4A 1XMWA 1YN6B 5F96L 3QIUB 3MBED 4NQUA 4J1UA 5DMGD 1MFAH 2FL5B 3QXVA 4ZAKB 2FX9L 1JI2A 3D39D 3T0DA 1YEJL 5ALBH 1P1ZB 3ULUD 3N1PC 1AC6A 1KPUB 5GGTA 1T20B 1WWAX 1JPGA 3KAAA 1X3DA 3QUKA 5C08B 1XF5B 3OB0H 1MAKA 2FJHB 3OJ2C 3WDHA 1BOGB 5DD1H 3T0VA 4I1NB 3V6FA 2GTZA 4WW1B 4HV8B 5T1KB 4JHAH 1M71A 4UBDC 1ACYH 3QG6A 3GSWB 5TF1L 3BP4B 2NY0C 1UWEL 1IFHL 2WANA 2Z4QA 1A14L 2JK5B 2JLLA 5IM7B 3TM6A 1JMXA 2VSCA 1UM6L 2R69L 3BISA 1A8JH 2LAGB 3MOBH 4ODXA 4F7TB 1AJ7H 1GGIH 1R3LB 4KQ3L 2ZP0T 1QFWH 4K94H 4RBPH 4YNYA 43C9A 4EDWH 1A14H 5CEZD 1OM3H 5KN5B 3EGSA 1UM6H 2R69H 3VGBA 1MAJA 3DTXB 1F4WL 3REWA 3BDYH 4NN6B 3MOBL 3MRFB 5FKPA 3EIFA 3X3GH 4FTVD 2NZ9D 5MEND 3OKOA 1ZHKA 1V3MA 3B4NA 5DDHA 3UTPD 4WI6A 4PGJA 2ZUSA 4KGLA 2IADB 4NM4L 4HUWA 2XXMB 1M7DA 3TYFB 3RWEA 3Q1SL 4ZUTA 3NH7H 4DUWA 3G5YB 3PWJA 2BVOA 5HI4C 4UUJB 4WWKB 1XCQB 1U8OB 2VLLB 5HDBE 5HDOA 1EHLL 3I6LE 4JPWL 1K8DB 1ORSA 4JKPH 2NY1B 3U0WH 2JJVA 4NM4H 3ZHLA 3GSRB 2NW2B 3FQUB 4P4KA 4XBEH 5L6YH 3KWWA 4HH9B 4MMXC 1G6RH 1LDPL 3K46A 1S9XA 1E4KA 2EE2A 1HK6A 3KPRB 1KGCE 2W0FB 3CLFL 4Q97A 4U4BA 2X41A 3MUGB 1RD6A 2ARJA 1KJ2H 2XKNB 4LHUA 4OCWL 1Q1JL 1RSFA 4E0RA 4JVWA 1FAKT 1GAFH 5HHQB 5ADPL 1UWXH 3BDXA 3DTXA 5E5RB 4NN5B 5FO8B 2EC9T 2AQ2A 5HD8C 1FGVH 3HCVA 4JKWA 3OG4B 4X5WA 1G7LB 3KYNB 3ULUH 1A7RH 5ADPH 2E7LA 1DQQB 1M7DB 5C0ND 4MNHB 5J4MA 3DBXB 2P5WE 3QDJE 3KS0H 3GBNL 1QO3B 3QUZB 3TCLA 4BH7A 4JPIB 5E2TL 1U6AH 3LQZB 3O2VL 2V17H 3SKOB 3TLRA 4GXUN 2JIXD 1A7RL 3SDXB 4XP9H 3S96A 4QT5A 4F9LC 2YEZA 3IT8D 2ZUWA 3NCMA 4X7FC 3TH4T 3MRRB 5F7HA 4K7PH 4H1LG 1UFUA 1OAZL 1FBIL 2H9GB 5C09D 3EYQC 2VKWA 1J1OH 2Q87A 4JM2A 4GRLA 1BVLB 2IAMB 1MLCB 4DTGH 1CXIA 4TNVF 3OMZA 5HDQH 5DJYA 1CD1B 4F7CB 2QQNL 4HT1L 3S5LA 4MXVF 1A0QL 5I8EB 4JFEA 2EIBA 3BQUD 3S88L 3MLXH 1CFVL 1J0YA 3TBWB 4K3JH 3GMPB 3K0WA 4I3RL 1D5XA 5IMKB 4NQXB 5DK0B 1QLEL 4RBPK 1PEZA 2R39A 5KS9A 5K9OA 3GGWA 4LLQA 1QR4A 4JN1L 5CLWA 1AGEB 4BA8A 3NIDE 2J3SA 4WI9A 1T21A 1Y0LB 5GRJL 3TJHD 2Z31A 5EN2A 4HF5H 3O4LE 4EKXA 5D6DC 3F7QA 3FOMB 4NN6C 2C3HA 4RMTA 1BQHG 4DW2L 4ZNCD 5F9WC 1MFEL 3BYTA 1RZKH 4B53A 2XWJB 2D7MA 4KZDH 5DUMH 4LBEB 1CL7H 2P47B 3CSYB 1FNEA 4S1SL 4JFXA 3TV3H 5F7EL 5IEHB 4RISH 1N59A 3EYUL 3TBVA 4OSUL 4X6DE 4NBZB 3RDTA 3WNLA 3RWJA 1PFCA 3MSPA 3WLWC 4HIJA 2AJYL 4W4OC 4LLVB 1AGFB 5FDWA 3IF1B 3PWVB 3EHBD 3WLBB 2AJ3B 1WAAE 4RWHA 4PREA 5JUEH 2VLRE 3GGWB 4AIXA 5KZCD 4LLYB 4OSUH 3JWOL 1MCKA 2WBJD 5TQ0L 3OKLB 4LKCB 4YHIA 1L6ZA 3KPSD 1D5IH 1YDPA 2GFBA 1QFWI 1JNNH 1MY5A 4NFCA 1A6WL 3FN9A 4LF3B 4E41B 4ZOAA 5IFHH 1JYVA 1FG2A 3O2DA 2EIDA 3MFFA 4I2XA 4R4BB 2NY4B 2E7CA 3O45A 3G6JF 5E8DH 2ZCHH 1JPTL 4XP4H 4Y19D 3QEUB 3RZCD 3K7UA 1BFSA 3L3GB 1CBVH 1T22A 1ZWIA 4A6YB 4OZIE 1G0XA 2A0LC 5T3XH 4JO3H 4JPKL 5C07D 1IGJA 1BIIB 3SDCD 1BF2A 4WY7L 3GSOB 2W91A 5D72L 2YPLA 3QYCA 1C8PA 2X7LB 2DYPD 2EYRA 5D2NB 4PP1D 4JM4L 4NJAH 2ZPKH 1IC7L 3Q5OA 3RTQB 4MCYA 3HC4H 2VISA 1GHFH 3M45A 4H8WH 4GKNA 5KSUB 4POZD 4X6FA 3QISA 3CUPB 1P4LA 4Y8DC 5IM7A 3TA3B 2YUWA 5I8OH 3UJJL 5D9SA 4JDZA 2E3VA 4E42A 4L4TE 1DBAH 1ZHNA 1UJTA 3QUXD 2JJSC 4KK6C 3L7FB 2DMBA 4K3EL 1INDH 1U2HA 1U9KA 1NCBH 5I74C 1R3IL 3KLSA 3U9PH 2IQ9L 3MODH 4LVNB 5F1NB 3MGOA 1RPQA 2CKBH 4ODHL 1K5NB 1XAUA 4KPHH 5LXGH 2ORBL 1QFUH 5DLMH 5C07B 1KJVB 2DI9A 1KIPB 5E4EC 3VCLB 5GJSL 4YJZL 2IALB 1L4IA 4ZXBD 2AEWA 2EYTA 5J11C 4LGPB 5ILTH 1JV5B 1XR8B 5LXGL 5D2NA 1HILA 1E4JA 3FFDB 5J12C 1E4XH 5DLML 4LCWA 4YHKL 2OTWB 2YD2A 4RMWA 3MRGB 4D9QD 1GH7A 4MJ5B 2QHRL 3WV0A 1CG9B 4G6FD 2X1WL 1B2WH 3BIBX 4U1IB 3J7HA 5LAXB 4F3FA 2V5TA 2ZUUA 4N8PA 5BCAA 3EO9H 3F6IA 2BXYA 2GCYB 1MRFH 2DQDL 1VGEH 2GITB 2H45A 3IU3B 2QHRH 2VITB 1L0YA 3RIAF 2CLZA 4RFEA 2DMCA 3B8YA 3NFSH 1CVSC 3UTPE 1NFDE 4Q2ZA 5F7MC 5JW4N 3L3DB 3N85L 2A9MH 4LASL 4XVSH 3HUJB 3I50L 4WUUE 4F9PA 1RVFL 3JV5A 4BKLA 5IHZA 3R06A 3DVNB 3I6KA 3OJDA 1R24B 4JZJC 4N68A 1U93B 4PLOB 3PV6B 3MBEC 3MCG1 4JQVA 4ZO6A 1QQDA 3L7EB 1JGDA 4CAGA 4P46B 2ICEB 5KSBA 4U7SA 2VAAA 3HE6B 5GS0L 4GQ9L 2VDQH 2DQHL 4G6ML 4KJQC 3L5JA 4TQEL 5FK9B 5AD0A 3CPLB 4R0LC 1LO5A 5GS2D 3ARXA 1S7UA 3K80A 2PW1A 5JW5B 3BN9D 2LTQB 2HFTA 4G6AC 2MWCA 4NRXA 4WHTA 5E03A 5I1DB 1NQBA 1T20A 2NTSP 4IRSC 4U6XA 2G75B 1CFQB 4PJFB 5LGJB 1A3RL 1KSRA 3U48A 2Q3AA 4FABL 4WUUB 4HWZB 1GC1C 4HXBH 4HS3A 2AAVA 4GLRH 2MMXA 3RVXD 4L3CA 2VDML 4LSQL 1Q9KA 3MTRA 1AXTL 1R3KB 4YHYB 4W6YB 3GHBL 5IIEA 4PLNC 5ANME 3DUSB 1E27A 1JZ2A 3RTQC 1FO0A 1ZAGA 4L4VB 5GJTH 1H5BA 3SKNA 5SX5K 3U6RA 4PRAA 3FRPA 4NZRL 4WEBH 4WHYH 2X4TA 4LARL 3IRZA 1BIIA 4BZ1L 3OKEA 2EKSA 5EPMA 4WJ5B 2VQ1A 4QHLA 3W9EB 4UTBL 5F7DB 1FFNB 2BJMH 5FYLE 3V52H 5DA0B 3BESR 5DD5L 1BM3L 3MNZB 5D96B 2AQ1A 2EE3A 4P9HC 1DR9A 5F71A 3B2UC 1CLYH 2CRZA 4NN7C 1ES0B 1FNEB 3FB8A 3C09C 1D5ZA 5J89A 3OAUH 2BNQA 5I30H 4U6HB 5EU3A 1CDJA 4OZFB 5EC1A 3BZEB 3BP7B 4PB9L 3WYRA 5GGRB 2ZUQC 1ZLUK 2VR9A 1I7RB 1T0NB 5KZCB 1F02I 1ZANL 4M3KB 2YD6A 2WLYA 3KPMB 4FG6C 4OLVL 5IP4A 4L4VE 2AEIT 5CP7B 4JY4B 4FQIH 4UTAH 2NR6D 3AS1A 3FQNB 2KZ1B 4DQOH 5KSVA 4LIQH 4DN3L 3IAGC 4OLVH 1Q9WA 4NYLB 3MJGX 3DXAD 1NGZB 3TO4B 1T7ZA 2OI9C 3O6KH 4Z6AT 1XIWA 1XIWD 1WEJH 4GAYA 1X5FA 1CFBA 2JTDA 3U0PA 3KLHD 1KIQB 4CNIB 1QLFA 1MELA 2NY3D 4Q9QL 4PJXB 4U05A 4RIRB 2VXTL 2IJ0C 5D7IF 3VFOA 1KIRB 4P57B 2V5MA 2FD6H 4PD4K 5ESQA 4LEXH 1A6UH 2QQLL 4LDLB 1CD9B 5IBUG 1WZMA 4LSRL 4YAQB 4PJGA 4IDJH 5FYJH 1WEJL 3CFBA 3EAKA 4OT1H 1MCQA 2A74A 2E8YA 3KPSA 2F53D 3MBXL 4ZUTB 3RP1A 1JWSB 2A73A 5FGRA 1YY9C 2ERJC 3BPOC 2F8OA 1L9NA 3P0VH 4IRSA 4EN3D 3K4AA 4ALAH 3T0EE 4AEEA 3QULA 3IS1X 5I1CH 2AEQL 4X5LA 4U2YA 3OGCA 1CD1A 2E27H 3QXUA 1BBJB 4MSWA 4OD2A 1Q0XH 3MRFA 4G6KL 1JWUA 1AGCA 2GSGB 5D9SB 2NXZC 5TDOB 1CCZA 1UYWH 1LD9A 1OGTB 3SCMD 3OKDA 3P0VL 3DVNA 3L7FA 4LAQH 1AH1A 3WNOA 1RUAH 3KLDA 2R4SH 2P5WA 3IDMB 3KHOA 2YBRB 2VLRA 4LCUA 3N1QC 2OJZH 5HI5C 4NNPH 5EZIH 2EE9A 5CJ8A 5FYJE 1BEYL 2IMMA 4LIQE 5I18H 3RPKA 4MAYD 2Y36L 4MNQB 4WW2F 3RWFB 2XRAH 5DUBA 2E6PA 3X11B 3GHEH 5D6CA 3ZDZ