4MD0B

Immune receptor
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
189
structure length
189
Chain Sequence
DTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title A molecular basis for the association of the HLA-DRB1 locus, citrullination, and rheumatoid arthritis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4md0B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4md0B01
1KJ2L 1UJ3A 2FRGP 2HWZH 2OYPA 4Z7QE 2NZIA 2XRAH 1GOGA 3IGAA 5F1IB 3HRZA 4JQIL 1DBML 3H9YA 5F7DA 2OJZH 1LO2L 2NY7H 2A0LC 4MQ7B 1FIEA 5SWSE 4MAYD 3Q3GB 4YO0B 3TCLA 3LAFA 3H8NA 3HNVL 4GQ9H 1ZT4A 3QQNA 3ZT5A 4JFYA 4MCZA 1ORQB 4NHUB 4YBQC 1OP3K 3RPKA 4XP4L 5E08H 3FB8B 4M9OA 4RRPA 3SPVB 4KU1A 3N85L 5HI3D 5FM5O 4QHNB 4JFDA 1BWMA 4P2CG 2PYEB 4J3VA 5FECB 1M05A 2AK1L 2EECA 1EO7A 3LV3A 3BPLB 1ZANH 4U1GC 1YJDH 3SDCA 2H8PA 5HVFB 4RMWA 4Y5YB 4KVNH 3IKKA 3H0TA 4EN3B 2R1XB 4PJXB 4ONFL 3QHZL 1M7DA 3GK8L 1MLCB 2BSED 5JXAL 2FZ3B 1RURH 3VFOB 4Q9QH 3FN0H 5H37G 1NFIB 2VLJB 3A6BL 3DMMD 4HIJB 1NL0L 4Y4FB 2X4SB 3C6SA 4GW4B 3UTZA 2VDML 3QIUA 5DS8A 1JPGA 1ZHKA 4P59L 5D7JD 4M02A 4JPIA 5E8DH 5IKCB 4X4ZA 5L6YH 2NXYD 2ADGA 3OQ3B 3OXRB 5KSVA 4I18C 2AK4D 1WIOA 3BYTA 2P44B 1NCWL 4KMTL 3LMJL 3WKNA 1J11A 2HRLA 5HHQA 1S8DB 5ISZA 1XZ0B 2DQEL 1BX2A 3WFZA 3UCRA 5IJVB 1MCPL 4JZOA 4CU7A 1MCOL 3VWJD 4PTUA 5FYJU 5FOBB 4XBGB 1IE5A 4PRHE 1H8OA 3B8SA 5IVXF 4Y16A 2CJUH 3CU1A 4HG4K 4IOIB 4U1HA 1CZ8L 3W9EB 1IGFL 4YDVA 1HKFA 4CAGA 4PJ5A 4ODTH 2HRPH 3HAEA 1MUJB 2XTJC 4AEIH 5L9DL 3H3PH 3QO1A 1B88A 2CKBH 4DK6A 4ODWB 1RVFH 12E8H 3GSWA 5JTWA 4HG4J 4M4PA 3SGKC 4HPOL 5HHME 1K4CB 1T20A 4LGPB 4ZNEE 3H42H 1LILA 3C08L 1IFHH 3AS3A 1QUNA 3KR3L 2DTSA 1CXLA 1DEEB 1JNLL 3KPNB 4RFEB 4HKZA 3G5YB 1WBYA 3E6FA 4GG6B 5CSZB 5JOFA 3X3GL 4X98A 4PJFF 4Z7UF 1ZEAH 5H37H 2XWBB 3NCMA 4Q6YA 3RA7L 1NBYA 4R26L 1TVBB 1DN0B 1W72H 4WTZG 3RKDC 1KLUA 2Y6SD 1S3KH 1RAMA 3VWKD 1F58L 4G9DB 4BQ6A 2E5EA 3FRPG 4KK8D 4YXKH 4N5ED 3R8QA 3H7BB 2YUXA 1UA6L 1V7NH 4DKDC 2R4SL 5EZLB 2G2RB 4JFQB 1GZQB 4M1DL 1TZIA 5GS1A 4EI6B 4AEEA 1QQDA 4CGTA 5GGVL 3NFPA 3PV6A 2W1NA 1A9BA 3MCKB 4JFHE 4TNWF 3D85D 3BD4A 3F58L 2CUHA 1BECA 2QADB 4BFIB 4WW2F 4LFHD 3ULUH 1T7ZA 4D9QD 3SO3B 4HZLB 4WFGD 5GJTH 5IIEB 2QQQA 1AGBA 1A7NH 2AEPH 5IBLC 5GRUL 4C56B 3BIAX 1KENH 2YZ1A 3NOIA 2YXMA 5FA4A 1W8OA 2A6DA 2XG5A 3EYOA 1KPUB 4XPHH 1SYVA 4G8IB 1LQSR 3ES6A 1BZ9B 4NZTH 4MJ5B 3O3BA 3PP4H 3S35L 2XFXB 5BCAA 4EIGB 2EDWA 2Y25A 3SKOB 3TESA 5H35A 3LKOB 4KJQD 5EZOH 3BEWB 3IDMB 2FBOJ 2DLHA 4RISH 5KVEL 1QSVA 3OAUL 5LBSL 5KVFL 5EBGA 1AGCA 3F7YA 4XNXL 3DTXB 5E6IB 1S9XA 1T2JA 2W92A 3SJVB 3KWWA 1N64H 5FO8A 3HR5A 1NCBL 1MFDH 1QBBA 2FO1A 5I9QB 3VFNA 3TO4A 2KPNA 5DJ2B 2IH3A 1JHKL 4HIEA 4NO3B 3GHEL 4KI5D 3IAGC 4FMKA 4ELME 1JP5A 4HFWB 4M3JA 1CF8H 1CGYA 1I3RB 3MRNB 1OTUC 2OTWA 4R4FL 2OZ4H 3LB6C 2ZUQB 3TPUA 3VMNA 4IBLT 4L8DA 4POYA 3MXWH 4MAYA 2DM3A 1JNNL 3STBA 4DGYL 1ETZA 5DI8A 5EIIA 4NO2A 4F8TA 5DEGB 4JAMB 3IVKB 1CFBA 2DMKA 3AREC 4NSKB 3IJYB 3B2VL 5DFVC 4HHAB 2DQIH 2O5ZH 1X7QA 3I75B 4CDHA 4XP9H 1XH3A 5JDSA 1URLA 4OLZL 3ZKSD 2HJFB 3FKUS 1NMBH 1KEGH 4NJAL 5M95B 3UDWC 2AV7B 4MMXC 1K85A 1QNZL 1MCWM 1J0KA 1SMOA 4TQEH 3V4PH 4PJBA 3GJFB 4LKCB 3DMMA 2JCCF 1XGTA 2XZZA 5E99H 4WI6A 4UDTB 3UPRB 5CD5C 1NBVH 1I9JH 4BKLA 1ULVA 3EYVB 3QNXA 4P4KB 4WI9A 5D7JA 2MQ0A 4YWGL 3CVHA 3CZJA 2VDNH 4WNQB 4RNRB 3MLWH 2HTLC 4ZUVA 3MPCA 1BQLL 4YK4C 1J1PL 3RBGA 2AK4A 3D69A 2F74B 1H0DB 1NGZB 3SDDD 5LAXA 3V8OA 4NDMA 4YXLL 2VL5B 3QG7L 3HG1B 3MUJA 3TBWA 3L5HA 1CE1H 5HGHB 5DJXB 3Q5YA 3QCVH 3VWJA 1CGSH 1DANT 1WWAX 1CFQA 2YD7A 4ETQA 5CZVH 4ESKA 2J8UE 1MCJA 1XF1A 5EU3A 4P9HC 4XTRC 5IT2H 3AUVA 5FA3A 3SGEH 5EO0B 4Y1AD 1EEYA 3TA3A 1M6OB 2MWCA 4HC1H 1YN7B 4OF3A 4XPBL 2R1WB 3MACH 5DMYA 4UBDC 1F8TH 2V9TA 2X4UA 4NKOA 3P11H 1G6RH 4LIQH 1ZVHA 2VKWA 5FUCC 4POZD 4U1SA 1KCRH 4M3KB 1IC7L 4MA8H 3W0WD 1YEJL 3MV01 1IQDA 3QDGD 1BVLA 5ALCL 5FYKU 4HC1A 3NCYS 1CU4H 1PSKH 4ZPVB 4UT6L 1S5HA 3OKLA 2XZQH 1J88A 2QQKH 5FM5M 1A3LH 3MR9A 3UBXI 3KPQA 5EPMB 3EO9H 1NC4B 3MRBA 2CRIA 1CICD 4GAFB 4TTGA 2PW2B 1F6FB 3VWKA 4OGAC 2NY5H 1UM4L 4PRNA 5I8EB 5DQ9A 5E2TH 3TEUA 2XXCB 4Y4KD 5I16A 1OTSC 3GIZH 4WFFD 5CBEA 1H3GA 3DGGB 1ZLUK 4QOKB 4NZJA 1C5BH 4MZ2A 3GM8A 5ANME 3VXRB 3MRQB 4HJGA 2WIIA 4ODSL 3WUWB 3OKYA 4I18B 4PP2A 4LVOC 1DZBA 5TE4H 4PB9L 5FCUH 4PJ8C 2IJ0C 4FQHB 4XHJC 3D85A 4RMTA 4TUOB 4J12A 4EUPG 5DJDB 2D7TL 4OAWB 4DKFH 4IRZH 1MY7A 1BOGB 4UZGA 2WAHA 1AO7B 5KSBA 1IILE 5CKAA 5D96B 2F5AL 3ZYIA 1CS6A 2VZ3A 1AY1L 1A6TB 1ED3A 3GSXA 1JTPA 5KVGH 1ZLSH 1M7DB 3BZ4B 4YHZL 2P5EB 3LKSA 1FSKC 1I1AB 2AQ2A 5DR5L 3KYNA 2AJVL 5ACZB 3ILQD 5CJQH 1QVOB 4UQ3B 1MFEL 1BZQK 1JGLL 5JDJA 3C6SB 3O2DH 3QIUB 2XTJB 5T33L 1JPGB 2D7MA 4I48A 4JPIB 1QSZA 5C0ND 4U1KA 1KEMH 3TNNB 2EZ0C 3CAFA 1CLZH 1FVEA 1SEQH 3ZDXF 2WBJD 4X0KB 4XC3H 3I6LD 3F7QA 4M8VA 4U1NB 2DI7A 4P2RB 2A83B 1II4E 4LLYA 3H2WA 3T2NL 1ZXQA 4I77L 3GMLB 3SKJL 3REVB 2EIZB 1EZVX 4TOYL 2K9UA 1LO0H 2V5YA 3C6LB 1NAMH 4MZ3A 4TVPL 4RZCA 4M61A 4F7CB 5F1OB 1K9TA 5KSAD 3Q48A 5IMLB 1MCKA 4WENB 5SX4H 5L88H 4Z7QF 3WN5B 1FZOA 4P46D 1DN2A 1KJVB 3G6DL 4XXDB 4H0HB 1K3ZA 3VD4A 3PNWB 4P48A 5HDQH 3RWCB 5JMRA 5T1KA 1GGCL 1I85A 1KTLB 4NQDA 4QHMA 5GZOD 1CL7L 1DLHB 4EUPH 3BP5B 2DJUA 4GRWB 3DX8A 1I3UA 1U92A 2FLBT 2OM5A 3NZHH 1KOAA 4LVNC 2EDEA 3HB3C 2A9NL 4M7KL 4B7LA 2Y9RT 4KTEH 3D18B 3MUY1 1WBYB 4PBXA 1K8DA 2ENSA 4FN0A 4LPYA 3S36H 5BRZD 4X98B 4GAYA 4KZEL 2CKBB 2Y07H 4OJFH 1FNGB 5CHNB 3N1QC 3GMMA 3O2WH 1QZ1A 2XQBL 5H2BB 3P9WB 3PDOA 2FO4A 2X4QA 1OM3L 1ITCA 4JM4L 2VLKD 4XPGL 3FB5B 2NY3D 4X7SL 2FBJH 3U4EB 2BC4A 5E03A 4HMCA 2YC1A 2BNUA 3SE9H 1FNAA 1RZFH 1EBAA 3PWNB 4G6AC 4J8RB 2VDPL 1CLYL 1R3HB 3SDDA 3CFCH 1W72B 5M94B 2VIRB 3S35X 3GSVB 5F7WC 5T1LB 3CPLB 5IFHL 5GHWL 2AXFA 3LN9A 4LF3A 1CGWA 1MAKA 5CJOH 3O4LE 1B6DA 5DJCA 3ALWA 1YMHA 3FT2A 4HUVA 1NEZA 4P5MA 4EZMA 5D7SL 4JQXC 5ETUA 2R23A 5HVWA 2LAGB 1T6WA 3CFEA 5A1AA 1IMHC 1N5YH 1CDJA 3FFCE 1XF4A 4Y1AA 4HS6A 1HIMH 5EO1B 1YYLL 2D7NA 3AS0A 3QCTL 4KGLA 4M43L 4V1DE 4R2GC 3SDAC 3T4YB 4KPHL 4E41D 1AJ7L 2COQA 1H8SA 5DRNA 1FHGA 1A6WL 5JXEA 1SYVB 1E4XH 4PGEB 4WU7A 1INQA 1A21A 2FWOA 4JY5L 2OR9L 3P40A 3D48R 3MLPA 3AREB 3NIDF 2E7LA 3GUTA 2I24N 5DRWA 3W0WA 4PJ7A 2Y1VA 5FM8A 3QDGA 4U1JB 3THML 5C0CE 3I02B 2ED8A 1HHHB 2ATKA 2IBZX 4X6CE 1J8HD 2RCSL 3IDNA 1GH7A 1CICA 3DARA 3DV6B 4WCYL 1D5IH 3RBSA 1D5BB 4DJMA 2VDQH 4YE4H 5KS9A 2GK2A 3QULB 4Y4KA 2PO6D 3GRWH 3MV11 3VXTB 4JDVB 4QWWC 5J4MA 3AY4C 1SHMA 4RWHA 3OKDA 2G5BA 3TBSB 3C5JA 2RJMA 3EDFA 2LTQB 3PGDA 3CSYA 5EIIB 1BGXL 2AXGB 3T8XA 3EOTL 1A2YB 3L1OL 3PWPE 1KN2L 5C09D 4EXPX 4LLMB 1AGEA 5F93C 4ZOBA 4M5YL 1LGVA 1BFSA 4OI8A 2C9AA 4OZGA 4NJ9L 3HC4H 3O6KL 1AI1L 5D9SB 4M48L 4JG1H 5D5MA 4R4NC 3VD5A 2EXWD 3UTSB 4QO1A 4QF1B 5I1CL 1FFNA 3WJJC 2ID5A 4LU5H 3B9VA 5EA0L 1QEWA 3BDXA 1A5FH 4AH2B 1BBDH 1SYSA 5EZJB 4NYLA 5F3BA 4QHKJ 1KYOK 2CLZB 3JWDC 4Z7VA 1JWMB 1VA9A 2W9DH 2XRAL 5IHZA 5EUOE 1QP1A 2OJZL 1JF6A 5B39B 3S37H 2WBJA 7CGTA 3MRJB 4H0IA 2X4TB 2APTA 3DRQA 4GQ9L 1KYOJ 5LAXB 1NCDH 2YRPA 1PZUB 4FXLA 4LPUA 1UFUA 3SBWC 2CLRA 1VEPA 4OCSL 5I74C 1FC1A 2WUBH 4GMSL 4PJ9C 4M7ZC 4K7PY 4NKMA 2X42A 2HVKA 4IMKC 4JZJC 1ZANL 2BRQA 3V52H 4ELMF 3GMPA 1YJDL 2ITCB 5KSAA 4U1IB 4KVNL 3MO1A 3MRIB 1YY8B 3TA3B 1ZTXH 3ARDC 3E0GA 4P46A 4MNQA 3MRHA 4N0FB 1OGAD 1RURL 2VYRE 3QEHA 5K9QG 4Q9QL 1YY9C 1I3VA 2N1KA 2QBWA 2VLRE 3PHSA 4PRBB 5JW3H 4PJ8B 5J9PB 5D1QC 2IAND 1Q94A 3UTPD 3WO4C 2FCBA 3TYFA 3CDCA 5D8JH 3VDCA 4FQXC 1P4LA 3HC0A 3U36B 4GLRI 3C60B 4FFVD 5EOCH 4U6YA 4K3DL 5BRZA 2OTUA 3M1BA 1X5FA 3QJFB 3O9WD 5IMMA 1NDMA 4DN3H 1G1YA 3HKFA 1G6RB 4XRCA 3KNBB 4ODXB 3TPKA 4DVBB 2VLKA 1HZHH 5IQ9B 1J9CT 4ZAKC 5DMKB 2OJEB 1CXEA 2BX5A 4EOWH 1S7RA 4XCNA 3RI5F 4AK1A 5C71A 2CJUL 2HTKD 3E8UH 5ACLA 1D6VL 1TTFA 2LVEA 4LCCB 4PJAE 4D8PB 5IEHA 5GGSA 4MHHI 1F6AA 3C5ZC 4ODTL 5D2NA 3D0VA 1NGWA 1B0WA 4J3SA 4IOFD 1LEKA 1DVFD 1QA9B 2CIKA 2BNRB 4AEIL 1CT8B 4JHWH 1JZ5A 4JO3H 2CKBL 5FGRA 2XN9B 3DWTA 4UV4H 12E8L 3ZKMD 4JDZB 1MHEB 3GJFK 2AABH 1NBZB 2E8YA 1TMCB 1MI5B 1ND0A 1MNUH 3H42L 1A7PH 4S2SA 4WEMB 5TF1L 1IFHL 1QSFB 4ZO9A 4BSWA 1KGCE 5C0BB 4LARH 1GZPB 4KVCL 4LGSB 3WIIH 2GJ6D 1SM3H 2J8UF 1N4XH 4YNYA 35C8L 3BZFA 2BXYA 4L4TB 5JHLH 4I8DA 2PETA 1W72L 4WW1B 3O6LH 4P3DA 5F96H 1S3KL 2NY2B 4KK6D 4XB8A 4FXKA 4BSVA 4UOW1 4G6FB 4X6EB 5CP3H 4U1KB 4HIXH 4YEFA 3TJHD 4EI5C 3QA3B 3IFPB 4GAJH 1CFSA 3AB0B 1EPFA 3L5XH 2DTML 3FO0H 2E27H 4QYOB 2CDGB 3MRKB 1ES0A 1MCIA 3P9MA 3DX6A 3O8XC 2GAZA 1J8HA 4MNGB 4ELKB 5CEXB 1WFNA 1T5XB 2DIAA 4XWGL 1LK3H 3QRFM 1VGKA 5CP3A 3AXLB 3RWHA 4OD2B 3ULUL 3FZUC 3UTTD 2PO6A 2P49B 1G1CA 2VLJE 3EUUA 1Q38A 2DQFB 4K7FB 4ONOA 1Q72L 1CFNB 1R3JB 1FFPA 3VDAA 3P4MA 4BH8A 1A9EA 1KENL 1KIPB 4UTBH 4L8SA 1FZJB 4GRLB 2AQ3A 4XC1H 3BJLA 4NQDB 3L6FB 2FH8A 4Z77A 1LO4H 1U36A 3PGFH 4NZTL 5C09A 1NAMB 1MRCH 4U1LA 1J05A 4E5XB 2NY6C 3PP3H 3RJDA 5JQ6H 4BQCA 5EZOL 1CGVA 1RUKL 2LVCA 5HI4D 4RISL 2D03H 1V5JA 4C83B 2CDFA 2JIXD 4HIHB 5HHNA 3GFUA 1EVTC 5A43C 1N64L 1D3CA 4WU5B 4YHNB 3ZYOA 2I5YH 3DX7A 4NBZB 3KPRB 5B4MC 3DVFA 3SDAB 3FTGA 3SDYL 4R2GB 4DOHB 3D25B 4EUPB 3MLSH 2CO7B 2KH2B 5HGBB 2X4QB 4U7KA 4PJCA 4C4KT 4WUUD 1ZSDB 4XP6H 4CU6A 3G5XB 2L0DA 1PKQA 3BJ91 4PREA 2W0FB 4MLSA 2IG2H 2OZ4L 3SCMC 5K59E 4APQB 1UXSA 5C7XH 3KLHC 1JV5B 1Q9WA 4MCYB 1MAMH 4JHAH 3S9DB 3NFSL 4FHBD 1BBJB 2OL3H 3VXMB 2A6JB 4PG9B 3BX7C 1DL7H 3PQYD 4JREC 1HEZB 2FB4H 5JLZB 1PD6A 3TYGL 4H0GA 1CIDA 3N06B 4GG6E 4HUVB 5EBLB 3D2UB 4R4BB 4EVNB 5DYOB 4IS6B 4XP9L 3O6FA 4PRAA 1JPFB 1LEIA 3N9GL 3QFDB 4AY0A 2OL3A 2V7HB 4L3ED 2WLYA 2JJTC 2Z92B 1I1FA 1OGAA 4P2QB 4PYHA 4HWNA 4TQEL 4JN2B 3AS2A 1I8MA 1RUAH 4M6MH 5ITFB 1INQB 1NBVL 1I9JL 3RL2A 1BLNB 3NGBB 2YEZB 3VXSD 1Z0MA 2IANA 1FNHA 3S34H 4O2CB 3QUKA 4DZBA 3B9DA 1NLBH 5E4EC 1HSAB 5KVDL 1KFAH 4FFWC 3BVNB 2OTPA 1BAFL 1FG2B 2BY1A 5C70A 1N3NA 5DK0A 3ZTJG 1DBJH 2OK0H 3O9WA 3G6JE 3O3AA 5FB8B 4C56E 1CE1L 4G8GD 2DI8A 3QCVL 1CGSL 4ZD3L 4NM4L 4PGCA 3G5ZB 3EO0A 4Q2ZA 5CZVL 3RGVC 3BOVA 4LPVA 1XR9A 4NBXB 3QPQC 4U49A 4TVPE 2ZSWA 3ZSTA 2WQRA 2VMFA 2NXZC 3VCLA 3MACL 4CN6A 2D3VA 1L7TH 1IEAB 1DVFA 1WFTA 3SJVE 2EDKA 4ZG1A 1YUHB 3H3KA 1G6RL 1WV7T 1A14H 5HYFA 4TTDD 3WS6A 5HHXH 2WANA 3GSOA 1BEYH 2X70A 4UOW0 4CUCA 1G7MB 3QHFL 1IAII 1MCBA 1T4KA 3T0EC 1CU4L 1PSKL 5T1MB 5HDOA 4MDJA 2XZQL 2GJ6A 2QQKL 1HH6A 1AP2B 1A3LL 3LKQB 1TLKA 5FK9A 5TDPB 3IAPA 3DX9A 2H26A 2OI9B 3B9EA 4HD9A 4YHMH 3B5TA 1HHIB 1E28B 2BOCB 5D7LB 5EZIH 2NY5L 3RWJB 1I7UB 4CL7A 5E2TL 4Z7UA 3R06A 3GIZL 3KPOB 5I0DA 3MMEA 1EAPB 1YEIH 2FEDC 5DMGC 3ZKND 3LS4H 1FVCA 1FDLH 5EO9A 3VFUB 3O4OC 1JTTA 3ZTJH 3L7FB 2EH8H 2C1PB 3T0XA 1SY6H 1UJ3C 5TE4L 5HHVL 3LOWA 5FCUL 2AI0H 1H5BA 1QSEB 3WEXB 3E2HC 2BK8A 3NCCB 2VISB 4CU8A 2P1YA 2IADB 3E6HA 4X6CF 4DKFL 4NKMB 43C9B 1CLOH 2X9YA 2ZOKA 4ZS7H 2PW1A 3FT4A 3EYUL 3IB4A 2A9ML 4HUWA 5IW6A 1F3RB 1JNHA 2XTLA 4J1UB 2VDOL 3QR2A 4I0PD 3F5WB 3L3HB 3EDDA 2Z8VC 4UTAL 4ZQKA 5SV3A 1G9MH 4X8XA 1SY6A 3RPIB 1Z2KA 4MNQB 1ZLSL 5DMIL 5F9JB 5KVGL 1UCBL 4OUUA 1G7HB 1KXTB 1SQ2N 1NSNH 5DGQA 3SDCC 5E5UB 2NPLX 3O2DL 4HWBH 1FLRL 4LNVA 3IFOB 1OAZL 1INDH 3TYFB 4PRPD 1KB9K 3HG1E 3MNWB 2JIXA 3LEXA 3N1MC 3V7AG 1CLZL 5CWSB 1SEQL 1RHFA 1L6ZA 5I66B 5DUPH 1QLEL 1CD1A 1RFDH 4XCCH 3ZE2E 4XC3L 4OUOA 4JPVL 4RSVA 1QR1B 2Z0BA 3OJDA 4AIXA 2P5WB 5LGJB 5FGBC 4XRCB 1KB9J 5DJYA 4KH2A 4X8JA 1LO0L 4GW5A 4JB9L 4WUUA 4GW1A 1NAML 2DM2A 1IZJA 4MB4A 4GKNA 1CFTA 3UEZA 5AZ2H 4PJDB 4J4PC 4XVUD 4YX2H 1B0GA 1LNUB 2VC2H 4EI5B 2AAVA 1T1WA 1KCKA 1N0XH 5JHDB 5J3HD 5IFJB 1OAUH 2DQGH 5GGSB 1RJZA 2DWEB 2EDDA 5EUOF 5GRJH 3UAJC 4UDUB 1MCHA 4GBXB 1JZ6A 3DSFH 1MELA 5T3ZD 5HDQL 3CCHA 4RX4D 3PQYA 1A1OA 2Q6WB 1UADC 3O8XB 4Y16C 3X13A 4OV5B 3JXAA 1UYWH 3DETC 5IUSA 4EDWH 1BMGA 4WGWB 4AIZB 1IEHA 4UIMA 2EYRA 3NZHL 5SWSD 1ZHBB 1DQDH 4FG6D 3VXPA 1J10A 4P2YA 3RNQA 3NTCL 4TSCH 1NGPH 4HJJH 3MLZH 3MCLL 4L3EA 3S36L 5ESVB 1U0QA 5DURD 1KG0A 3GBNH 2B1AH 2B39A 1VFBB 3BKYH 4F9LA 3EOAB 1CDCA 1R3IH 4QOKE 2DJSA 1IRAY 3M8OL 2Y07L 4MLIA 4OJFL 3CFDA 1JVKA 4HKXA 4NN5C 1U93B 3O2WL 3VXRE 3W39B 1JGVH 1K5NB 1NANH 4HS8H 3MREB 4FXKB 3VXSA 4BSVB 1JHTB 5J1AA 2B1HH 5JIKA 2NY6B 2JCCA 1UQSA 4I3SL 3LDBC 4MQTB 5FDWA 1FBIL 3EYFA 2W9LA 3BXNB 5I76A 1H15B 2MHAA 1AO7E 4IRJD 3DBXB 1CXFA 3CFCL 5TDOA 3QT2A 5C0GB 3FCTB 4K8RC 5D6CB 3ROLA 2QTEA 3VFPB 1M71A 5IF0A 2HG5B 1NKRA 2IPUG 4TUKL 2GY5A 2P5EE 2BSTA 4OTXH 2QR0B 4KROC 1FQ9C 1BQUA 2HFGL 3RDTD 5JR1H 1X5IA 1HHKB 2AEIT 1J7VR 2MTPA 4W70A 4EKXA 1N5YL 3RVVD 3T2OA 3X12A 1NGYA 3MYJA 2F9BT 4ZUTA 4H5SB 3UJTH 1JRHH 1T89C 1TZHA 3BP6B 4Y0GA 1GGUA 1QLFB 5ILTH 3I85A 1G7PA 3VFTA 2APVA 4QRQA 4PJAF 3MOQA 1PJ9A 2H3NB 2MKLC 3B6SB 3GMQB 4JREB 4PRHD 1AHWB 2G5RA 4P2RE 3PABB 1TIUA 5ISZE 5DD5H 1NGQH 2CDFB 3CZFA 3JWOC 4Y2DB 1OAQH 3V4VH 3SN6N 2AV1A 2B4CC 1NUGA 3P30L 5D1ZB 1A1NB 4N1HB 5FYKH 4HW6A 1J5OH 2Z8RA 3TO2A 1BJMA 4HAFA 2DQDL 2VDQL 4QLRA 4R7NA 1T0MA 3GRWL 4PREB 5DC4B 4XBEH 2RIKA 4O4YH 5C0FB 2IFGA 3TO4C 3BHBB 1CXHA 2MFNA 2X5PA 4P5KB 2J88H 4YQXH 1OAKH 4GRWE 1K8IB 3BDYH 2G60H 3HNTL 3KLSA 5DQDH 4Z7NE 1RUMH 2HFFB 2XKSA 1LP9B 5B3NA 4HGMA 4KK9D 4M7LL 2X1XR 4RAHA 1WUNT 5I1AB 4MAYC 5E2VH 3HC4L 4MDIB 4D0DB 1Q9OA 1QLRA 4QTIL 4JG1L 4PGDA 4PJXF 1J8KA 4CVXA 1K2DB 2P7TB 3O6FB 2HMID 3WFCH 2JB6A 4DGVH 3RGVB 1WWWX 3NZ8A 3DHMA 4JFHD 1DFBH 5HI3C 4LU5L 2FJHB 3CMOH 4I4WA 5JNYA 5KZCB 1A5FL 2D7QA 4WI5A 1BBDL 3REWA 3T77A 3QO0B 4U3CA 1B4JH 2Q7YB 2O61A 1YEKH 2W9DL 2Y7QA 1KJMB 4PRPA 5EOTB 2NY4D 3DMMC 2E7MA 2DB8A 3S37L 3RVUD 5EBMA 3T0EB 4UT9H 2IWGA 4P2OB 5HYIA 2OQJB 4XP5H 1NCDL 1QFUH 5J0BA 2NXYC 1TITA 1ZGLA 3BZEA 4NN7C 2E7CA 5DVLA 2NY1B 3BFOA 1PVHA 1B2WH 1G7QB 3STLA 3EFFB 1CTOA 2H9GA 3ULUE 3UJIH 4LSVH 3MXVL 1EAJA 4OF7A 1ZTXL 3VWJC 5K59F 4LCWD 1U8HB 1UXWA 4RX4A 2FEEL 5MENB 1EEZA 1KB5A 3ARTA 3QSKB 3FQRB 2X70B 3WHE0 5D8JL 2IQAB 4GG6F 1IJ9A 1DSFH 3A6OA 4RGOL 2Y36L 3F7VB 4DCQB 3B2UD 2DIJA 4LVHC 4YPGB 1Z9OA 3RWEA 3L3DA 5HHOB 1IKNA 5JORA 4DN3L 5IG7A 5EG6C 1UM5H 1AXIB 3JV0A 4XNYH 4NKDB 1P2CA 1HZHL 4JO1H 3T2QA 3U6RA 1WVZA 2NW2A 3MV7D 1U3JA 4EOWL 2HP4A 4WO4D 4B50A 4JFEB 2XYCA 1JGEA 1R3LA 1MVUB 2JTDA 3E8UL 4F7MA 1HOCB 3FQWA 2Y6SC 5CUSH 4OD3H 3INUH 3M17B 1UB5A 4G8EB 3VWKC 5F9WC 4IRJA 3PL6D 3QIBC 2R2EA 2VQ1A 1XGRB 2F8XC 5DD6A 3UTSE 3DURB 3QQ9D 5DRXB 5I6XB 5FGCE 3OKNA 5D7IB 1RI8A 5CGTA 3RDTA 2AJSH 3WHXA 3W5NA 2AABL 5MP6H 4UAOB 4PJIB 4L8CB 1U3YA 1XGYL 2BY0A 1MNUL 1A7PL 3C8DA 5EN2A 3JVGC 4MWFA 1SM3L 5DHVH 5KANG 3G04A 4HBQA 4BH7A 2V5SA 1UH4A 4KFZC 3EGSA 5J6HA 5B21A 5JHLL 1FL5A 4W4OA 1S7TA 3M07A 1L7IL 2NR6D 1IGJA 2AK4E 1I7ZA 3JTSA 4XMPH 3QDJB 1V3MA 1LE9B 4PRHA 4TNVF 3PHQA 4ZO6A 1KPVA 5JIIA 3P0GB 4NQVA 5E6YA 4YIQB 4GAJL 3C9NB 4Z0BH 3VXQB 1PG7H 5DHVA 5EULV 3L5XL 2CH8A 3FO0L 1I7RA 2ATPA 5GGUB 4X7TB 4KJQC 4YBLC 5CZXD 4ZFZA 2AW2A 4JKPH 5KAQF 5I1HH 1FFQA 1BJ1H 1FYHB 4AYFA 2YD4A 1KLGA 2IMMA 3KLAB 3V5DB 4BFGA 3CU7A 4AZ8A 3TGXA 3L7EB 1FNEA 1F90L 5I17B 2QJDA 2V2TB 4WFEE 4MA3B 2QHRH 3MRPB 3BYYA 3S5LB 3S36X 2MJWA 3P4NB 3GJEA 1M7IA 5D93B 4KI5C 3GSRB 4YGAB 3HUJB 4W6WB 3GM0A 1XEDA 5ALBL 4NQCB 1DQQB 3C8KA 3CCHB 4NRZB 2R1YA 3BKMH 4KKAD 1LO4L 3PGFL 3SGJC 1EUTA 4UOJA 1MRCL 1LO5A 1A7BA 4Q6IA 3B5HA 5HGAA 2Q1EA 4ZOAA 4I1NB 4KROB 3EYQD 4KJPD 2VH5H 1I85C 2HT3D 4LIQE 1WZLA 3PWJB 5EU4A 4BQ8A 4G6MH 3QZWG 3MV9B 4FZ8H 3NABL 2I5YL 4JCLA 1U8JA 3NA9L 4PIRF 3O3DA 1MHHA 3ILPB 4G7YL 2H2PC 3CFDB 4EBQH 4UNVA 1MFCH 3GMOB 3U4BH 4IJ3B 4GAGH 3VFSB 3QI9A 1ZS8B 3GMRB 5FHBH 3WNMA 3AU1B 3U7YL 3WKML 4WHYG 2IG2L 4IIQB 1ZKAA 1EO8H 3H9SA 5C7XL 4KTDH 4AG4L 4X5XB 1MAML 4ZO7A 4JHAL 4D9QE 4ZDHA 3NPZB 4MD4B 3FO2B 3ULSA 5JZ7D 5FGSA 4LLVA 2ADFL 5C0BE 2BVOA 2FB4L 4LQ1A 3ZE2F 3X17A 1OGTB 4D0CB 4GG8A 1H3WM 4LLQB 3HC3L 4L4TE 1IGTB 3SDDC 4J3OC 1I9IH 5I75C 3SEPA 5GGRY 5TQ0L 4F58L 1FV1B 2FX9H 1E27B 2L7JA 3ZYZA 3AS1A 4FNLL 1A4JA 1RJYA 2EEBA 3CVIH 2V2WA 2G75B 3W2DL 1OTTD 2GT9A 5IHLB 4LCWA 2V7NB 4MNHB 5D2LB 3UROR 4DEPB 2ZSVB 2FNBA 3T65A 3D9AL 1RUAL 4O5LH 4PB0L 4MYWB 1MQKL 1CG9A 1S7XB 4LHUD 3S34L 2DM4A 4XAKE 3WLWC 1RZ7H 1G6VK 3MRMB 1NLBL 3A67H 5E5MB 1KFAL 4WV1B 4Z6AT 4JHZA 1Q0XH 5DJ8B 2HKFH 2PYFB 2BY3A 1WF5A 2WV3A 3FAXA 1DBJL 2OK0L 4POZC 3PE9A 4TPRH 2Z31A 2E7LC 1IGCH 2F15A 4RGNB 2YMXH 5GGQL 2OX5A 1GL4B 2GFBB 4NFCA 3UYPA 3U2SA 3WLBB 3CFJB 4NN6B 4DKEH 4FFZL 4Z8FH 3MRDA 4N5UA 2YD5A 4HH9B 2FJGA 3V5HB 5ESQA 3MV7A 3KPMB 5FKPA 4BK5A 4NQDE 4JGMA 3VFGL 4WO4A 3QZWA 4LHQB 1A7RH 4WHYH 2R0KH 1CICC 5MEOA 1PY4A 2Z35B 3VMPA 1ZVSB 4MJID 1Q9LA 4DAGH 3CFBA 1FPTH 4YHKH 3PL6A 1IAIH 5FYJL 1AH1A 1L7TL 4Y4KC 2EKSA 5TQ2H 4QGTA 3CH8A 5BV7C 2DWDB 3EW3B 4FQJH 5K9OB 2FECI 3ZT7A 1YECH 4NN7B 1A14L 1HINL 3P0VH 3HFML 1WC7B 3QIWC 5DVNA 2R15A 4NO5B 1BEYL 3GSUA 5T5FH 3U83A 4E42A 1U8NA 4QXUH 2X4OA 3S37X 2BRRH 3DUSB 2N7AA 2V2XB 4AM0B 3QWRD 4XNUL 1TTUA 4I4WB 3KYAA 3O4LD 4YHML 4PRDB 4HFUH 3T77B 4OKVA 3VA2C 2YSSA 3PWVB 3HS0A 2J8UA 5EZIL 5GS2H 4K94C 3FFCD 4U1MA 5C6TH 4PJEB 5DLML 1T04B 3VXME 1HCVA 1RU9H 4U4BA 2I26N 4V1DD 3ILQC 3UZVB 3LS4L 5E8PB 3W82A 2MSPA 1FE8H 5F89A 3VRLF 4E0RB 5C0NC 4LVHB 3NPSC 2AXJA 1CL7I 1R5VA 1BWWA 3MLRH 2J6EH 3BZEB 3CSBA 5E00A 1SEBA 3WCYA 4A6YH 3C2AH 2WBJC 3NAAH 4JQVA 1NMCC 2I07B 4P2QE 3ARFB 1KXVC 5C0CD 3SKNA 2YWYA 3L9RB 1GJIA 2XPGB 2GSIB 1IM3A 1DBAL 4PJ7E 2J6EA 4JFPB 5F9WB 3QIBB 4GRWF 1EDQA 4A6YA 5KSAC 2GY7B 4ZYKA 3TN0A 2VABB 2IGFH 1G7IA 4HWBL 4Z7NF 1N0LA 1FFOB 4L8BA 3FO9A 4OV6F 5T5NG 4P46C 3WFHB 5KG9A 1JIBA 1INDL 5ANMA 1YDPB 3H3BC 3ARGA 3PP3K 1G7JA 2XWTA 3BN9D 4M9PA 5DZLA 5GZOC 1LE5B 1HSBA 5DUPL 2EDOA 4XCCL 3PWPD 1FJ1B 3DO3A 4QY8A 2PCPB 3A0OA 4U33A 4NM8H 1FGNH 1KELH 1TZGH 1FLTX 3S96A 4K8RL 3RTQD 5IK3A 4H20H 1VFAA 3VXOA 4XVJH 1MAJA 3KYOA 2NNAB 5FF6B 1PLGH 1OWRM 1OP5H 5AZ2L 2ILLA 1JCKA 1TCRA 1JGEB 3RL1A 1RZGB 4CVZB 3KYMA 1MLBB 2VC2L 1SJVA 1N0XL 2VZVA 1EZVY 4Z76B 1UB5B 1VADB 5DDHB 4XNQB 1FZMA 4MXVE 1F00I 1UGNA 3DSFL 4UILH 2XWJA 1JZ3A 5AYUH 3FOMA 4YBLB 2VAAA 5LWYL 5GGRA 1CR9H 3H9ZA 5DWUL 2LABA 4N9GA 4S1DD 3SY0B 2R39A 2D2OA 2BSSB 3BIKB 5D2NC 5A3ID 2I25N 3PWLB 1DQDL 3NN8A 2W0PA 3CH1A 1YEGH 5GGTH 2E7HA 5F8RC 5EN2B 1S7VB 5CKGA 5FUZL 3MLZL 4WWKB 4Z7VE 5EDXA 1OT1A 3QRGH 2AJZA 3DXAB 1AE6H 3GBNL 3ULUF 4PS4H 1XGPB 3BKYL 4NRXA 1RZJC 1OW0A 1R3IL 1MEXH 3QISA 4LLDB 2YPVH 2F8OA 4UMGA 1JGVL 1PEWA 5ESAB 5GGVY 4KJYB 2B1HL 4J3UA 2QSCH 4JO2L 5GGTA 1QSEE 4MX7A 2GJZA 3OKOB 2PXYD 4KRMB 4HGWB 2VLRD 4NUGH 3HZVA 1P7KA 2Y23A 4PV8B 4ONHA 3AM8A 3QUYA 3WFDH 4U0QB 3IFNH 3U79A 1IEBB 5DZNA 4MNQE 2VN7A 5DSCB 1UG9A 5JR1L 4ODBD 1S7QB 4XT1C 5D1XD 2R0ZH 1PEZA 5HYQB 1NCAH 4CVUA 4Y2OA 2RGSA 3MJ7B 4NPYA 1WWCA 4F2MB 1VGEH 3Q5TA 5E8EB 5IB4A 3VD3A 4JQIH 4N9OB 4MJIA 4QXTB 1JRHL 3UJTL 4U0RC 4N0RA 5AG9A 1S9WA 4BQ9A 1RZ8B 3LN5A 4I5BA 5EFIA 4ZUWB 1JMXA 1T2QH 2X09A 4PFEA 4GKOA 5IW1A 1C08B 4D3CH 1EXUA 3LQAC 3MFFB 1F5WA 3ROOB 1KJ2A 1KIUA 4K71C 4L8SC 4G6KL 2DLEA 2DQTL 3V6FA 5KSUA 2JKXA 5KW9L 4LSTL 1RZKC 1Z5LA 2VLKE 5DUMH 5AD0B 4O58H 3QWRA 1BIIB 4ONFH 4PJDE 3O4LA 4WI8A 5JXAH 3OKKB 3TBTA 5FYKL 4YXHH 1HYRC 5JHDE 1J5OL 2EXWC 1OPGH 2MPAL 3Q1SL 3TVMD 4L4JA 3FFCA 4OZFB 2BVPB 1KGCD 1RJLB 2IBZY 4PUBH 5BOPA 4Y19B 2HVJB 5I1LA 2HT4D 4RA0C 2IEPA 3WYRA 3O11B 3BPCB 2W9EL 4RMUA 2J88L 4YQXL 4BUGA 1X5JA 3GBMH 4JRWA 1KCLA 4ZDHB 2E8ZA 4YHYB 4OZIB 3TNMB 3K1DA 2A1WH 2VWEE 5DQDL 3ULSB 3DGCR 3QQ3A 4MAUH 3EO1B 5FXCH 3VRIA 3QDMB 3LSOA 4XVTL 4UIKH 1NUNB 3IF1B 4FQ2L 1JMZA 1Z3GL 4EQ2A 3OKMA 3VW3H 1MCPH 5E2VL 3V6ZA 3PJSA 3QBTB 5C0CA 2FHBA 3DYMA 4LKXA 4M6NH 4Z7OE 4XB7A 2PYED 3O3EB 3WFCL 4DGVL 4YDKL 4LRIC 3QDAA 2EDXA 4X6CA 4J7RA 4EN3D 3PHOB 4FXGA 1WTGT 3CMOL 1FL3A 1IGFH 1I3GH 2BJMH 4M1GH 1F4YL 3OL2A 3JV4B 1IBGH 4XXCC 3F12B 2WNGA 1B4JL 5BV7B 2VLJD 5L8LB 4Y4FD 3IRPX 3B9KA 1YEKL 3BUYB 2NTFB 1J8HE 3I9GH 2GUOA 3E3QE 3QIWB 1SMAA 5JPNA 2X6MA 2C3GA 3C08H 4V2BA 3VH8A 2X4NA 2PTUA 4S11A 1JNLH 1WIUA 1OLZA 4OQTL 3X3GH 5JPMB 2FL5B 3OG6B 1NC2B 4WVRA 3P9LA 2VSCA 3QNZA 3RWGA 5F7MC 3U0TA 1EA9C 1D9KB 2RHEA 4FFVC 3RTQA 3FQUB 4HUUB 3BRDA 1B2WL 3QXDA 1N6UA 3O9WC 1ZLUH 2HN7B 4ORGB 2X1QA 3C09C 4HS3B 3HPJA 5GRVL 3UJIL 4LSVL 5DQJA 2DJ4A 1U58B 2FDBP 5SWZB 3CX2A 4KDTA 3JBG7 2APFA 1HCFX 1AXSB 4Z18A 5E8NA 4G6JL 3DV4A 4WTXA 2QKIA 1VACB 2FX7H 4QRUA 3IJHA 1JWSB 1N6QL 3NFNB 1DQJA 1GIGH 1HXMA 5EUOA 2YUZA 2J5LB 1WLHA 3F58H 1A3RL 1CDYA 4J3TA 4JY6B 5F1NA 1NMCB 2ZG1A 1U8NB 3C5SB 5D6DA 1D6EA 4NQUA 2CSPA 3HCVA 1IQWL 2X4OB 5F3HA 2VXTH 4IOFC 4X5WA 2ADJB 1CE6B 1DSFL 2YBRB 3RKPA 3U48A 1C12A 1U8PB 4OIAA 1OL0A 5GRUH 3ZKMC 5D70L 2YHGA 4LNRB 2E9WA 4B7IA 2YRZA 2EYSB 4KJWD 2VN4A 3HS0B 1A6ZA 4XNYL 3DI3B 2FH6A 5BVJB 3VJ6A 1YN6B 3HPLA 1DQMH 5LVEA 1QBMH 5L7XL 1RZIA 1RSFA 2GEEA 5IB5B 3S8WA 2IALA 2PXYA 5KVFH 5GRZA 5TJWK 5C92A 2DQHH 5CUSL 5J6GB 3INUL 4IRSD 4KK6C 4P4RB 2VLRA 5E2JA 2X7LA 5IVZB 5KOVC 2H32H 3V6OE 4X80L 2DOCA 5HPOA 4FQIL 2F58H 1P7HL 5E00B 5H94A 3GHEH 3TZVC 3L3OB 2AJSL 3QUXB 4YUEL 9CGTA 5LJYH 2QADD 4K9EC 4JM2B 1T1ZA 4F3FB 1P4IH 4HK0A 3D3VB 1H5BC 3DIFA 1XF5A 2EYTA 2IANE 4L9LC 2H32A 5ID0A 4UINL 4R4FH 3SE4A 4HKBA 3RX8A 4C56D 3AVEA 4ZXBC 4PY7B 4PR5A 4G42A 4DGYH 2DD8H 4OLYL 3RP1A 1P6AB 3TN0B 5C0EB 1GSMA 1CDBA 4XMPL 3B83A 5CD3B 2Z91B 4WW2C 4TVPD 5TGBB 3SO5A 3B2VH 5INDB 4PJAA 5I8KH 3ARGB 1OP9A 25C8H 4Z0BL 3CUPB 1JHLL 4PLKD 4X6DB 4XCEB 1HSBB 4Z7WB 4OLZH 5E6ID 1Z6JT 2W59A 4MA1B 4ZFFA 1GGIH 3VGFA 1NPUA 4ZFGL 1DE4B 3GIVA 4NC1C 4M4RA 4XZUB 3I50L 5HI4C 3SJVD 3BGMA 1OOAA 3KPSB 3PIQB 5D72H 4JKPL 2A74A 4G43B 2ZOLB 4WHDA 4U6XB 3OX8A 5FO7B 3ECBB 2OBGA 4IMLA 1XF2B 4NQXB 1PBYA 1U91B 1NJ9B 2Q3AA 5JUEH 1C16B 2QHRL 3RL1B 5MENE 3ARPA 1CLCA 5F1IA 1BQHG 3HZKB 1H9VA 5DUBB 2FYYA 3MTRA 2V9QA 3Q3GA 1UWEH 4YO0A 2DQUH 4RBPH 4L4VB 3BKML 1KIQB 3BW9B 4PJHB 2P47B 5FYJE 3SQOH 4YXLH 1ORQA 4NHUA 5HHOE 4LSDA 3FB8A 3SPVA 5E94B 2GI7A 3ZKQD 4HLZG 1QFOA 5DJAB 2OCFD 2VH5L 4QHNA 2KKQA 4Q74A 2PYEA 5FECA 5E95B 1HYSD 4FZ8L 2XNAB 4Y5YA 2F54B 4U2YA 1V05A 3LCYA 3L3JB 4EN3A 3HE6B 2R1XA 4PJXA 1H3XA 1O7SA 4HEPG 4JFEE 4NRXB 4XPBH 1MLCA 3SOBL 2FZ3A 2XY2A 3VFOA 4EBQL 2IPKB 5BZWB 1AKJB 4PJ7F 1NFIA 1JWUA 1MFCL 2VLJA 4HIJA 3U4BL 4Y4FA 5I1KL 5ID1B 1R24B 4GAGL 3OR7B 2X4SA 1LHZA 4GW4A 4UQ2B 4R90H 5FHBL 4P4KD 2NMSA 4WWID 1UZ8B 5C1MB 4F9LC 3SGEI 4NCC2 1IC7H 2P8PB 5IKCA 1U42A 3ULVH 1YEJH 3QJHB 5F7HA 1LD9B 3OXRA 5DEZA 5EOQL 2FD6H 3HZVB 4GXUN 2VJXA 4H88H 4PJIE 5DXWA 3QUYB 1KNOB 43CAB 1OHQA 4NKQB 3L3GB 2DQJH 3OJVC 1U3HA 1S8DA 2W0LA 2LU7A 3Q6FB 4OFVA 1XZ0A 1MH5B 3HG1D 5IJVA 3BWAB 1QOKA 1ZA3B 2YPLB 3TC9A 5L0QB 4X9IA 1I9IL 5JIPA 4GSDL 3B3IB 4YLQT 2ICWB 2FX9L 4PTTB 1TJIH 1BZ7A 3QDJE 4XBGA 1JUFA 4XGZB 2B7DT 2E7BA 3MNVB 4IOIA 1DLFL 3OSKA 2CDEB 5GSRA 2DMCA 2FJFB 3MJ6A 2A0LD 4ODSH 3W9EA 4NQSB 5M7QA 1RIUH 4JFZH 2YD6A 4EJ1C 4MXVF 1MUJA 4HF5H 4JFFB 4O00A 4ODWA 2D7TH 2QEJA 1W8NA 1MCSA 2UY7A 2UYLB 4HLZH 3A67L 1I1RA 1ZLWH 1HH9B 3T3PE 2YD2A 1K4CA 1I8KB 2F5AH 1Q0XL 2ZPKH 2XA8H 4WUUE 4OCRL 1DEEA 1WZ1L 3HR6A 4WEBL 2CIIB 3KPNA 4RFEA 1C7TA 5J8OA 1X4YA 3G5YA 4TPRL 4NGHL 4TTDC 1IGCL 3Q6GL 1JFQH 4YHZH 5CSZA 3SGDH 5IP4A 4GG6A 4Z7VF 1Y18B 2BVEA 2AJVH 2XWBA 4K3JH 3HUJE 1NC4D 4C57C 1TVBA 1DN0A 5J1SC 1MFEH 1WIPA 2X05A 4DKEL 4Z8FL 1JGLH 4NQCE 5HDLA 2VLLB 1TETL 2IAMA 5HBBA 1P7QB 2ZCHL 5IJKA 2AVGA 1LK2B 2M8XA 1NLDL 1OARL 4LEXH 1A7RL 2R0KL 5HHPB 4ZMAT 5E0QA 4LAJH 4QOKD 4RQQB 3H7BA 2R2HB 5FIEA 4YHKL 2I27N 4MXQD 1MWAB 2BZDA 3T1FB 3QXAB 3VXRD 1FVDB 5EZLA 4YC2C 1FORL 2EE2A 2G2RA 1DBKL 1GZQA 3MV9E 4JFQA 4Y5VB 4F9PA 2K7PA 3ZKNC 5IM7B 5CLWA 3MCKA 1YECL 3T2NH 4I77H 4GS7B 3P0VL 3SKJH 4KUCF 4HGKC 4KY1L 4TOYH 5J11C 2VQTA 2YKLL 4BFIA 3MBEB 1AO7D 2BRRL 2QQLH 1HNGA 4HZLA 1KLFA 5DTFB 3VG9C 3C09B 2M2DA 4AMKL 5IIEA 3VFWB 1TQCC 3WFBH 4C56A 4LAQL 5EWIL 3PV7A 2JCCE 2E9JA 1OD7A 5BXFB 2P5ED 3AROA 1KPUA 1TQBC 1I1AD 1R3KB 4I0PC 4YDLC 4G8IA 3S6CA 3OB0H 3X11B 1BZ9A 1DDHB 4MJ5A 3HE7B 5C6TL 2XFXA 3OR6B 3QIUD 1RU9L 2JF1A 4AJ0A 3WE6B 3LKOA 5SX4I 3BEWA 3IDMA 3VI4E 4AENA 3LHPL 5IVXB 2A9NH 3DTXA 2X4NB 5E6IA 1PQZB 4G8FB 1JF1B 4KKCD 4RDQG 1MPAH 3UPAA 3FFDB 3V7AE 1A7QH 3SJVA 5F7FA 4KZEH 3MLRL 2DLTA 4H26B 4E9LA 4P2RD 1EEUA 5DJ2A 5ISZD 4PJDF 4U05A 3C2AL 2F19L 2C3HA 5JOPE 4NO3A 4K23H 3QXDB 3OAZK 2NY0B 2NX5B 4JM4H 3KPPB 3C6LD 2OSLB 4ORZC 1MCFA 1I3RA 3MRNA 3S4SB 4XPFL 2D0GA 2MKWA 5I1DB 1NFDB 4R8WH 4TVSa 4UUJB 3UBXB 4X5LA 4XNZC 1CTNA 3NACH 2VDPH 1CLYH 4CMHB 4Y5XC 4D0BB 5JW4N 4QRUB 4XVUC 4LGRB 1UKQA 2XZCH 3WS3B 1OT2A 5DA4A 5DEGA 4JAMA 3IVKA 3AAZB 1RZJL 5J3HC 3GJFH 2BCKB 2BVYA 4NSKA 4K3GA 4YHPA 3IJYA 2E6PA 4RGNE 1JPST 5F1NB 2IH1B 3TZVB 4CNIB 4HHAA 4DZ8B 3I75A 1S7SB 2HJFA 4Z7OF 5CEYB 4L9LB 4JFOB 4DTGL 2DQCH 1R5WB 2AV7A 4ISVB 4DFIA 1NAKL 4S1QL 4ZXBB 1A6WH 4FG6C 1QRNB 3KPTA 1KELL 1TZGL 4NM8L 5K9JL 4G5ZH 3GJFA 4K2UL 3WUWG 4LKCA 32C2B 1XIWC 1H3VA 4OLUH 3WL9B 4UDTA 3UPRA 5FYKE 1U3ZA 4XVJL 1QPPA 3EYVA 4P4KA 1PLGL 1E4JA 5F9OH 2VZUA 5CS7A 4WNQA 4RNRA 4HWUA 2R56L 2UZYB 5EU7E 2O26U 5F7UA 2WINB 4G9FB 4L1HA 1E4XI 1BJ8A 1ERNA 5A2FA 2F74A 1H0DA 2C3VB 1NGZA 4JKMA 5L2KB 1Q0YH 3QQ4B 2RCSH 1F3JB 1WISA 5T1LD 2VL5A 4PY8J 1CR9L 4WCYH 3HG1A 1IAKA 2LU3A 3AC0A 3MRGB 5DJXA 5HGHA 5ITBH 2ERJC 1A22B 5GGTL 1ZGLP 3RUGB 5EO0A 4PRPE 1FN4B 2OLDA 4PS4L 3T04D 1RZKL 2J4WL 1CFVL 2WIMA 5KVMC 2VDRH 4ZODA 3T3ME 1YQ2A 1BGXH 3RVVC 2ZWLT 1VENA 1J1OH 1RIVH 3ULUD 4HUNB 2QSCL 3GNML 3O6KH 4W4OC 5J13B 2B2XL 1N2RB 1TJHL 3GO1L 5DFVD 5MERB 4HPYH 1ZT1B 3HI1B 4NUGL 1WT5C 5F88B 4ZPVA 5I1CH 4LSPL 3DJ9A 4HT1L 4R96A 5DFTA 2A74B 5C0AB 2QHLA 3IFNL 5EPMA 4YR6B 3P73B 1C1EL 1NC4A 2XKNB 3T4AB 4Y89A 2PW2A 5FV2A 4IMLB 4XPTH 5B22A 1KTRL 2W07A 3DO7B 4Q7DA 1NCAL 5C3TA 5I8EA 1UWXK 3FN9A 1JBJA 2GIYA 1VGEL 3DGGA 1WICA 3R4DA 4HQQH 5E5RB 4QOKA 3WXVH 3UZEA 2FYYB 2XY1A 2DS4A 3WIFB 3VXRA 1A3QA 3MRQA 3WUWA 4I18A 1MRFL 1T2QL 5SWQB 1AFVH 4D3CL 4FQHA 4JANB 4ZUUB 5MHSE 4OCSH 1A64A 2V17L 4DQOH 1F6LL 4TUOA 4GMSH 5DJDA 4OAWA 1BOGA 1AO7A 2HKHH 5CSBA 3BMVA 4ENED 5DUML 3VE0B 4LCIL 4KK9C 4O58L 2ZP0T 4Q6IC 2BVQB 3UTSD 3RWIB 2EKJA 5HYSB 1A6TA 3GMNB 4G8GB 3KS0H 3BZ4A 4WFHE 4M00A 2P5EA 1WCBB 4XI5D 1MWAL 4ZS6D 2R69H 4YXHL 1I1AA 2HMIC 1UEYA 1JWUB 5ACZA 1OPGL 4GJTB 1QVOA 1GOHA 4UQ3A 4UBDD 5HYJB 5F44A 2VXSL 4PUBL 5DHXB 1KT2B 5C08B 5F9DC 2ED7A 1JZ7A 3WJLA 5C0JB 5ICXA 3TNNA 3D0LB 3GBML 5T3XH 3QFJB 2ARJB 4K3DH 1XGUB 4R0LC 3WBDA 2A1WL 4X0KA 1D5ZA 3O2VL 5B8CC 4MAUL 3KDMB 2LV4A 4U1NA 5GZND 2UZIH 5IR1B 2NY4C 1U3HB 4P2RA 2A83A 1TCMA 2R9HD 3DXAE 4UIKL 3GMLA 3K4AA 3UTQB 3REVA 2EIZA 3VW3L 4D9RE 2RB8A 3C6LA 1JYWA 4CRPA 3QXWA 4M6NL 2R0LH 3HI6H 4F7CA 1BZ7B 4GRWH 1JUFB 1OTSD 5IMLA 1AGFB 4GFTB 3ET9F 1YC8A 5GSRB 1D6VH 3TA3D 3TWCH 3WN5A 5TDNB 1I3GL 2BJML 1KJVA 4M1GL 4FFYL 4XXDA 1F3DJ 2EC9U 3KVQA 3PNWA 3RWCA 1IBGL 2J3SA 4QXGH 1X9QA 3EOBB 3NIDE 1KTLA 3X3FH 4YC2B 4JJ5B 4NOFA 2YUVA 3EDEA 4PD4K 3MRRB 4WFED 4ZOEA 1NMAH 1DLHA 3J8F7 3BP5A 3I9GL 2MOVA 1R6VA 1BQHB 4HUKB 5SX5H 5FO9B 5J11B 5J57B 5DJ6B 5TF1H 1OSZB 3QWQB 3PDDA 2B5IB 1H3TA 4KVCH 3EJZD 3C60D 3D18A 4QEGA 3PG2A 3NH7H 1AD0B 4PD4J 4NNXB 1TQCB 2YA1A 3TIDB 35C8H 4W68A 3ELAT 3MQIA 4Z78B 2YRLA 5DJZA 2CKBA 3IDGB 2IQ9H 3WIHH 1GPOH 1TQBB 1FNGA 5CHNA 2D7PA 3B2UC 4YDLB 5H2BA 4N8PA 2IAMB 4DGIH 2GSGA 5HSFA 1IGYB 3FB5A 3U4EA 1Y0LB 3GI8L 3FRUB 1OP5K 3KXFB 4K9EL 4QKXB 5K9QI 3S88L 2EDJA 3IS0X 2DTMH 1XMWA 3PWNA 4AEFA 4KWUA 4J8RA 1R3HA 3MRCB 4L3AA 4WO4C 5D7IF 2FX7L 3WIHA 3RGHA 1W72A 3HRPA 3L5WB 2VIRA 3KHOA 1O5DT 3GSVA 2VXQL 4PJIF 5T1LA 3CPLA 1GIGL 4DFHA 2M1KA 3O41B 4XWGH 4Q0XL 2XN9D 1YMMB 2VXUL 2XIDA 4P23B 3UC0L 3M45A 2D0FA 2VXTL 4OGYL 4BA8A 3QQ9C 4PJGA 3QWOB 2AGJH 1MI5D 1PYWB 1Q72H 1WQVT 4I2XB 4QGYA 5C0BD 4Y19E 2CUIA 4IHOB 1JGDB 5EO1A 4XNZB 3WDHA 3T4YA 5IROC 5B39G 2XI9A 3CLEL 5BZDB 3H9SE 1AGDB 4L4TD 4JHBA 4GKZB 4Y5XB 4TUJB 4PGEA 4OZIE 2P45B 1LEGB 2D31B 3DI2B 2NY2D 3AREA 1DQML 1QBML 1RUKH 3RZCB 1YNLH 5E70A 4LHJB 2P42B 2NR6C 4AENB 5ADPH 1QBLL 6FABH 2CRMA 2DAVA 4U1JA 2DQHL 3HB3D 3T3PF 3I02A 1AQKL 3TBYB 1HHHA 3L5IA 3FQNB 1PY9A 5IBUB 2F58L 3BT2L 3IETB 3SDYH 2ZKHL 4XAKD 1T1XB 3ARBB 4U6VH 3DV6A 3QUZC 2BNQB 4P0DA 2HFTA 3U9UB 4AL8L 2CMRH 4LCWE 4KUZH 1XIWB 1D5BA 1KIRB 3HUJF 4WUKH 5CZXC 1P4IL 1XCQB 3QULA 2IC2A 3FB6B 4RFOH 3VXTA 2ICWJ 3JV5A 4JDVA 4POUB 4R3SB 3MA9L 5ADOH 2PN5A 4M8QB 3T09A 5EU6B 3TBSA 3NFSH 3U0PB 4P9HH 2DD8L 4WTZA 1WBXB 4GRLD 5T1KD 2AXGA 4NQDD 4OLVH 5IQ7L 1A2YA 1JF5A 3IAQA 4YHPB 3TYGH 4LLMA 4HV8B 4F7PB 3BPOC 4R7DB 3FRPA 1HQRB 5I8KL 5GRWA 25C8L 1HQ4B 3FB7B 5D9SA 2ERJB 4KKAC 2OZ4A 1DEDA 4KRPB 2EO1A 3N9GH 5EU5B 3MV7E 1GGIL 3UTSA 4HWEH 3DHJA 4QF1A 3SE3C 5JMOC 3IFLH 4BFBD 1N8ZB 5FOJA 2ZUTA 5D72L 3VFRB 3EYQC 1J86A 3KPRD 4KJPC 2HT3C 1NCTA 3SDAD 5SWZE 4Y4HB 4R2GD 3D39B 1G9EA 4BZYA 3BUTA 4AH2A 1OQOA 2P24B 4I9WE 5EZJA 5CMAB 2ZUWA 4L1DA 1IT9H 1T3FB 5JUEL 1T1YB 2CLZA 3MUZ1 1JWMA 4XCFL 4IOSD 5E2WL 4ZTPH 3GSQB 3OJ2C 1XGQB 5KVDH 4B0MM 4H1LG 2IPTH 5B39A 4APQD 1BAFH 3MRJA 3VI4F 1UWEL 5FV1L 2DQUL 1EEQA 2X4TA 5EIVA 5I73C 1OF2B 3FHAA 3VXMD 3SQOL 5ICYB 1GC1C 4XHQA 1ADQH 2APWA 1NDGB 2AJUH 1IAKB 3MUGA 2VUOA 3OHXB 1SVCP 4ZD3H 4NM4H 1NFKA 1H3PL 4PPTA 1GYAA 3MJ9L 1CXIA 2ITCA 3FAWA 4UV7H 2RAMA 3I6KB 4U1IA 3VGBA 3MRIA 1YY8A 5CJBA 5HHMB 1ACYL 5BQ7B 4HKJB 3WSQH 5LGHL 3MLTB 4WDIB 4N0FA 1U8LB 5D71H 1ADQA 4P2QD 5JXED 4WIQA 4QXWA 1YNKL 1CGXA 4PRBA 3UYRL 1KPRB 4PJ8A 3JUYA 5F97E 4R90L 4YEEA 1OTTC 4PP1D 3NCBB 5J9PA 1HI6B 1OW0C 2ZUSA 3ULVL 4EDXB 1T83A 2EDFA 3QHFH 3U36A 1SVZA 4GMTL 2HJLB 2BOBB 2HA1A 4YHIA 2FD6L 3C60A 4U1GB 5BW7A 2FIKB 4H88L 1RK0B 4R96B 5FKAB 4ZTOL 2W38A 3QXVA 3QJFA 2DQJL 1WFUA 2ICEB 2JJSA 1G6RA 1Q8MA 3KNBA 4ODXA 4X4XB 4DVBA 5EB9A 4L3CB 3AM8C 5IQ9A 5DMKA 2OJEA 2G9HA 4S0SD 4RFNC 1TJIL 2HT2D 4H1LH 4HMEA 5KN5B 2W60B 4LCCA 2YA0A 4D8PA 5GQBA 4RAVB 1CBVL 3KJ6H 1B90A 1QR4A 1RIUL 4JFZL 5HHVH 4LLUB 1LO3H 4OF0A 4Z7WE 1BFTA 1UWGL 5CEZL 1EHNA 2CXKA 3IDJB 5B8CB 1NCUA 1QA9A 2BNRA 1CT8A 4HF5L 2XN9A 3MNZB 1OAXH 1YZZA 5CILL 4JDZA 4DUVA 1MHEA 1A7OH 4H1LA 1NBZA 3EYUH 2VZ1A 2A9MH 3P4LA 3F7RA 2F8VA 1MI5A 2VDOH 2ZPKL 2XA8L 5E9DB 1QSFA 4UTAH 5C0BA 3ZTNL 1GZPA 1Z9LA 5DMIH 5AAWA 3DRTB 1JFQL 1UCBH 1D5MB 3NCJL 4KRNA 1I4FB 4L4TA 4K3JL 4ZFOB 4WW1A 2EH7L 3W9DB 5C3LD 3T3MF 1FLRH 5D7LD 4QCIB 4L4VE 2Q20A 3PXHA 4PJHE 4X6EA 4LEXL 1OAZH 3TV3L 2SEBB 5ICXB 4GUPB 3QA3A 3IFPA 5JW5B 3LIZH 4KDWA 4TULH 4F7TB 1QLEH 1D5ZB 4QYOA 2CDGA 3J7HA 3OG4B 3MRKA 4JPVH 3ZKXC 1N59B 5CAYB 2K1MA 2NTSP 2F54E 3O2DA 1QSED 4MNGA 4ELKA 5CEXA 1T5XA 2JE8A 4QHLB 2ZZUT 4M7JL 3V0VB 4CW1B 2XXMB 3UXFA 1E0OB 1P1ZB 3KHQA 4JB9H 1J18A 3AXLA 1KCVH 4LSSH 4OD2A 2GITB 1B3JA 1BHGA 2QQLL 4LSRH 1UEMA 3VFMB 5SV4A 2HJKB 2UWEB 2DQFA 4K7FA 5TFSH 1CFNA 1R3JA 3KG5A 4KUCD 4QNPE 3WFBL 2VL4A 1KIPA 4MNQD 1P84K 3UPCA 3FL7A 1FZJA 3BP4B 1P53A 4KHTL 4MQXD 3OPZH 5HY9B 1T66D 4DW2L 4GRLA 1PDKA 3L6FA 1WGOA 7FABL 1NAMA 1RULH 4E5XA 3LKPB 1CVRA 1S7WB 3RY5A 2VZTA 1PZ5B 2BFVL 1Q1JH 2PR4L 4LPWA 4C83A 1P84J 1ORSB 2EE9A 4K55A 5HJ3B 4HIHA 3NTCH 4ZUSB 3O0RH 5IBTL 5C0DB 2YPLE 1MPAL 1GAFH 1A7QL 3MCLH 4WU5A 3OV6A 1ZE3C 4YHNA 3KPRA 3O6ML 3OMZA 5DJZB 3SDAA 1N6VA 3IU4H 4MJIE 3BN9C 3D25A 3M8OH 4EUPA 4K23L 5HGBA 1IZKA 2GSGB 1ZSDA 3K46A 1EV2E 1EIBA 3C87A 1OB1B 3G5XA 4V2CB 5DMJB 2W0FA 3QP3A 4I3SH 4R8WL 4BJLA 2AJXL 4OBRA 1FBIH 3RTQC 1WWBX 4APQA 2WWMD 3NACL 3BO8B 1T03L 1JV5A 5CIPB 4MCYA 5JHDD 4Y8DC 1BBJA 2EDTA 3BQUC 1N5AB 4GBXD 3VXMA 1NANI 2A6JA 2XZCL 2ED9A 4PG9A 1HEZA 4RBPK 4JR9L 5E7BA 5JLZA 5GGSY 3O8XD 3BPNC 3QEQA 1J12A 4TUKH 1X5KA 3QUZB 2HFGH 5EBLA 1RQ5A 3D2UA 4R4BA 4PRIB 4EVNA 1VESA 5DYOA 4PJGB 1HK6A 4QTHB 4IS6A 2FSEB 1JPFA 4EEEA 1XCTB 1A8JH 3QFDA 1TNMA 1CVSC 3AY4A 4S1DC 2DQCL 2V7HA 3T0DA 5A3IC 1EGJH 2ICES 2Z92A 2NQCA 2PTTB 4P2QA 1TVHB 4JN2A 4G5ZL 4MJ6B 5A16A 1MOEA 5JO5B 3CDGB 4OLUL 5GS0C 1HNFA 5ITFA 1J1XL 4FS0A 1BLNA 4WHCA 2YEZA 4MD5B 5F9OL 4UNUA 4LLWB 4O2CA 4F57L 2NY6D 1JRHI 2VLME 3QUMB 1HSAA 2UV3A 1A6UH 3BVNA 2MNUA 3JWDH 1FG2A 3WNPA 2EDQA 5IVNA 5D7KE 1SJXA 3P30H 2I9TB 4OF6A 1A1MB 2X41A 1EK3A 4M6OL 1IL1B 1Q0YL 3ZE1E 5FB8A 5DC0A 1YYMH 1MCQA 5ITBL 2DQDH 4OKDA 1RK1B 5CBAB 3G5ZA 2ZCKL 5EIQA 1QYGL 1G9NC 4F37K 1T21B 3IDYC 3DVIA 3UO1L 1U41A 4YK4B 4CDGC 3HNTH 5D1XC 6CGTA 2VDRL 3OGOE 3VGDA 1IEAA 1YA5A 5I73B 1J1OL 4Q9RL 1RIVL 3SE4C 4IDLA 4M7LH 1YUHA 2WMPA 3GRWA 3SBWA 4NNPH 2J12B 1EMTH 4KAQL 3G6AA 4LDLB 4PJ9A 4NCC1 4QTIH 3QNYA 1YNTB 4HPYL 4P3CH 1G7MA 3VXNB 1HE7A 1ZLWK 4Y2DD 1RMFH 4NO0B 3ZDZE 2NX5E 4IMKA 5T1MA 3DPBA 5F6IC 4I0CC 4XCYB 1WITA 1QO3B 4G3YH 1AP2A 3LKQA 5TDPA 3ARDA 1NFDE 1WZKA 5D1ZD 4OM1L 1HHIA 4XPTL 1E28A 1T0PB 2NLJB 3WXWH 2BOCA 5MI0C 1U8IB 4FQQA 5D7LA 1UZ6E 3RWJA 1I7UA 1K6QH 4OZIF 2RFXB 3T0BA 5D1QA 3KPOA 4HQQL 4M62H 1EAPA 3MRFB 2VDLL 4J2XA 3BIBX 1WTLA 4LOUD 2A77L 3TVMC 3WXVL 2IBBA 4FQXA 4MD0B 4ALAL 3VFUA 2HT4C 3L7FA 4YDJB 4Z0XB 3BKJL 1I1YB 3IXAB 2C1PA 1AFVL 1QSEA 3WEXA 1AXTL 2FHCA 4X9HA 3MUGB 4DQOL 4G7VL 2VISA 4Y8AA 3U30C 5I8OL 1W0VB 2IADA 4Z5RB 3K4DA 3JZ7A 2APBA 3K81A 43C9A 1QRNE 5JW4R 2HKHL 4JEGB 3LH2L 5IW3A 2GTZB 4J1UA 1VB9A 3O6FD 4S1SH 2WBKA 3F5WA 3L3HA 3MXVH 3RGVD 3QEGH 4X6BB 3RPIA 4K3EL 1V3KA 5F9JA 1BD2B 4XMKH 2BP3A 1G7HA 2R69L 4TNVK 4XP1H 1P4BH 5KZCD 4LVOB 2ADIB 4FRWA 5EC2B 4Y5YC 1KCSH 3OB0K 4D9LH 4EN3C 5AEAA 4H8WC 3IFOA 5L2KE 1I1CA 1CN4A 5EC1B 3MNWA 3FOLB 2VZOA 4LEOB 4Y4FC 1T0NB 4YHIB 5T3XL 4RGOH 2Y36H 5CWSA 3K4ZA 5I66A 2KQMA 4M1CD 4P2OD 4HCRL 3QPXL 2UZIL 4P5TC 3RUGE 3MRLA 1QR1A 1FSKB 3STZB 4FOMA 3LKRA 1WBZA 2OR7A 2P5WA 3EZJB 1A0QL 5LGJA 3GSNH 2NY1D 5E56A 2IFFH 4KKNA 1FZKB 2WP3O 2R0LL 3HI6L 2G9HB 4PLJC 5CP7B 1ZT7B 4PJDA 5B3JE 1K4DB 1AC6A 2H6PB 1LNUA 5HGDB 4EI5A 5JHDA 5IFJA 2AJYL 5DMGD 3TWCL 2KQNA 2CQVA 2DWEA 4UDUA 1OD9A 2Y4SA 4GBXA 3KYKL 4QXGL 4DUXA 3NBNA 3GSNA 3F8UB 3X3FL 3O45B 4N0CD 1ZOXA 3ZKXB 2Q6WA 3O8XA 5MEND 3RVWD 4MGXA 1NMAL 3BGFC 4OV5A 4LQFH 2D9QB 5C0AE 4G80A 1YQVL 4J3XA 4H1LB 4AIZA 4LBEB 4MXWH 1XGYH 1ZHBA 4N68A 5IHUL 3MA7B 2HLFD 3DVNB 5FYLH 5FYJD 3NH7L 2YD1A 5ESVA 5HHOD 5MEPA 1VFBA 1H8NA 4FQPA 3MOAL 3EOAA 3ORJA 3BRGC 2IQ9L 2KUTA 3WIHL 1GPOL 1L7IH 1ZWIB 1U93A 3UJJH 1T22B 2FR4B 3CD4A 3W39A 1K5NA 4DGIL 3MREA 4YJZL 1F2QA 1JHTA 4YGVB 4JRYB 1T5WB 4P9ML 4JFED 2X4RB 3QG6B 3PUCA 3ARVA 3ARUA 4ODHL 2OMBA 4LVNB 2J7LA 4QRTB 3PGCB 3BXNA 5IB2B 1H15A 5FEBA 2PYEE 2FHFA 2AEQH 3T1WA 5IJKC 5KTEL 3DBXA 4XWOC 3BP7B 5C0GA 3FCTA 1FO0B 5D6CA 4HUXB 4JM2F 4RAUB 1ZGLM 3VFPA 4OQ1A 4PJXE 4IRSC 2HG5A 1CQYA 5C9JB 3FQXA 5FCSH 1XF3A 2QR0A 1EJOL 1IM9A 3PWPB 4ODUB 3F62A 1HHKA 1L9NA 1F90H 1UACL 4F9PC 5HYJE 2AGJL 5T1DH 3MROB 4GT7A 1Y6KR 3FO1B 3QUML 4J4PD 4H5SA 5DJ0B 5C08E 1FL6B 5C07B 4FQCH 3BP6A 2QADC 5DHYA 1QLFA 5ALBH 1Q9KB 1B0RB 4N8VG 1RD6A 3BQUB 1RUPL 1F11B 3QFJE 1G7LB 2H3NA 3MJ8B 5AUMB 1U8KB 3B6SA 3GMQA 1ONQB 5DZOA 3QDJD 3OJMB 3FQTB 5F6HJ 4Z7WF 3TFKD 1IARB 1SJHB 1AHWA 1CDIA 1YNLL 5F21B 3PABA 1RHHB 2BXZA 5ADPL 1XFPA 6FABL 4X4YB 2H41A 2GTWA 5ERWB 2Q86B 3B5GA 4Y2DA 3ULVE 3VFVB 2XZAH 3NABH 2ESVB 3NA9H 5D1ZA 1S9VB 5BJTB 1A1NA 4PLKC 4G7YH 4U6VL 2XT1B 4JZNB 4YAQB 4LASL 2WSKA 1E4WL 3VD7A 2CMRL 2P8MB 4KUZL 4XPAL 3UP1A 1FCCA 1GC1L 4WUKL 4XNMB 3U7YH 3WKMH 5I9QC 4RFOL 1U8OB 5C0FA 5KANI 3K8LA 4KZDH 3BHBA 2YS4A 4X4ME 5IESL 3DOSA 4PJHF 4P5KA 5ADOL 4AG4H 1K8IA 4JRXB 2C5DC 1BVKB 4P9HL 5IV2B 4LCUB 1IKFH 4NQCD 4CJ1A 4TSBH 3OZ9H 3IKCB 5GS3A 1WAAE 2ADFH 3PWUB 4OLVL 4K8RD 3QEQB 5E1AA 2HFFA 1LP9A 1HHJB 2ZUQC 1VERA 4KMQA 5CEZE 3NCYP 5F7EH 5I1AA 3HC3H 4WEUD 4MDIA 4D0DA 4BZ2L 3DYOA 4RMQA 1J0YA 3V6OA 4KROD 5I2IB 5F7KC 5TQ0H 5DGRA 4F58H 1K2DA 2P7TA 3U46B 2Z93B 4FNLH 4HWEL 4KKLD 3IDYB 3RGVA 3MV9D 4KK5D 1A6AB 3IFLL 1X3DA 3S3SA 3LEYH 3W2DH 1HDMB 4LSUL 2FJHA 4LDEB 5I30H 4QNPF 3KXFE 5A16B 5K9KA 1HYSC 1HKLH 3D9AH 3QO0A 4PB0H 2VB5A 2Q7YA 1MSPA 1BOYA 2VITA 1MQKH 4Q9CA 5IWLA 1IT9L 5LGKA 3WO3B 1N7MH 3FONB 4NNYB 1VDGA 4AQOA 1KJMA 4ZTPL 3CGTA 5EOTA 3RIAK 3OKEA 4PGBA 2DN7A 4FQ1L 3AGVA 2VQUA 1YMME 2IPTL 5T5NF 3KS0J 3JUZA 3T0EA 4ONGH 4WJ5B 4P2OA 2OQJA 4I2XE 5GGQH 5F8QC 5GIRB 1FYTA 5IMKB 1QFWH 1ADQL 2WP3T 3WNNA 2AJUL 3MGTB 3JV6B 4XX1G 4FFZH 2NYYD 5MI0B 1G7QA 5ENWB 3EFFA 3VFGH 4Z95L 5MEQB 4UV7L 3CXHK 3B43A 1P6FA 1HHGB 3OXSB 3QEUB 4X7FC 3TVMB 1KTDB 3WSQL 4I3GA 5FYJH 3HAEG 5JOPD 5D71L 4ZNCD 1U8HA 5MENA 3GI9H 4GH7B 4M03A 3V5KB 2UVEA 1I8IB 1HINH 3CXHJ 3K2UH 3HFMH 5I74B 4CVWA 1OVZA 3G6AB 1LMKA 3HLAB 3FQRA 3U30B 4BFEA 4PJ9B 1R0AH 1S7UB 4P3WA 4M7ZB 3QNYB 3K2MC 2BNQE 2IQAA 3TT3H 3BEVB 5I71C 5SX5K 3BD3A 4FTVB 5DVMA 4JZJB 5TF0A 3F7VA 2L4OA 4DCQA 1MIML 4AT6B 3MLUH 3S5LG 4YPGA 4XNUH 5C2UB 5HHOA 3ARDB 4RGND 3ARSA 2F53B 4HLJA 4OCMC 3PXJA 3U0WL 4FQQB 5EU6E 5E2UL 4NKDA 5DLMH 2ZNXA 3DUUB 5BS0B 4CBPA 3HTLX 3NCEB 4H25A 5D1QB 3SDXB 3WO4B 4JFEA 1CDUA 1MVUA 4U3XA 1YEHH 2JJUA 1U6AL 4FQXB 1HOCA 4MSWB 3M17A 4G8EA 2C7UB 1EX0A 2BSRB 3KJ6L 1CD9B 1U95B 5FYKD 3CC5B 1LO3L 1XGRA 2X4PB 3KPLB 1QBAA 1ODAA 5AZEH 2GK0B 4JDTL 3RWFB 2EEAA 3DURA 4P5TB 5DRXA 3P4OB 1OAXL 5LXGL 4HDIB 4MXQC 5FGBA 5D7IA 3ZE1F 3NIGE 1A7OL 3D39E 1V7MH 3ABZA 5IEKB 1L4IA 4PJIA 1X4ZA 1BFOB 2EIBA 4ZAKB 4L8CA 3BD5A 5DRZB 3OGCA 2FX8L 4J4PA 1DBAH 4GRMB 1O7VA 3ZSSA 2DYPB 3EAKA 3HAEH 3P77A 5D96C 3C5ZB 4GKSA 3TH3T 4F80A 1FO0L 1QHPA 3QDJA 1LE9A 3WV0A 1N26A 3BGFB 2LQRA 4I3RH 3CSPA 4P57B 2ARJQ 1I1AC 4YIQA 1G84A 3C9NA 3LIZL 3VXQA 1EJ6A 3BDBA 4TULL 3GGWB 1BFVL 2KDGA 1QKZL 4QHUB 5IMOA 3CK0L 3G5VB 3QIUC 4NZUL 1S9YB 5GGUA 1C8PA 5GSVB 4X7TA 3ZDZF 1YJDC 2EIDA 3MRLB 3CFKB 3WJLC 3LKRB 4HWBA 1WBZB 4KGJA 2R2BB 2AERT 4KKCC 3RY6A 1NFDF 4K8RH 2CKNA 3HZMA 5TH2B 4LSSL 1KCVL 3KLAA 4HWZB 3ARFD 3V5DA 3FN3A 4LSRL 4HX1A 3L7EA 2QSTA 3MYZA 5I17A 4NT6B 2V2TA 5TFSL 4MA3A 3MRPA 1UZ6F 4KQ3H 3S5LA 1PFCA 3P4NA 2FIRT 2LU4A 1FAKT 3GSRA 5F72S 3HUJA 5CFHA 4QRPB 3WNKA 2HH0L 3C6LC 1YEDB 1JK8B 2CK2A 4FQLH 4NQCA 5C6WH 1DQQA 3OPZL 2CR6A 4IM8A 5TE7H 1AIFB 4NRZA 3GSNB 2CPCA 3QIBD 5ICZB 4F33B 5LWYH 5KJRH 1IAOA 1NGXB 1RULL 5DWUH 3V9FA 1RV6X 3WN5C 4IRSB 4WTWA 4G80B 1Q1JL 1UCTA 2DLFH 2X1WL 5GS0L 4EQ3A 1SJEB 3PWJA 3WD5H 2KL6A 3O0RL 4HIIB 5FUZH 3MV9A 1GAFL 1IAIM 1CWVA 2CXGA 4LCYB 3HA0A 5MHSD 3JWOH 2ITDB 1T89A 5MEPB 3BKCH 2A6KB 3IU4L 3ILPA 1MFBH 4UU9B 3IDUA 2B4CH 2A2QT 3GMOA 4MA7L 3G6JB 2Y06H 4KQ4H 1HXYB 3VFSA 3MLYH 5BMFH 1ZS8A 1GGBL 3CNKA 3GMRA 4JO2H 3AU1A 3MV8B 3ARRA 1IC1A 4JFXA 1UKTA 4WFHD 5B38B 4IIQA 3B8YA 3ZZ1A 4X5XA 4FMFA 2C3XA 1G9NL 4F8QA 2V5RA 4X99B 4MD4A 3FO2A 5E9DE 4QRRB 4A2LA 1VKXA 2JB5H 3GKWL 1OGTA 4D0CA 3MBXL 2HLAB 1MJUL 3RNKB 2X9WA 3FQXB 4LLQA 4NKIH 3RUGF 2UZXB 1XF3B 1AQDA 1IM9B 1IGTA 2ICWI 3GB7B 4JKWA 5DA0B 5DD0L 5GS1C 5HI5D 3IU3B 5E7FA 5DD3L 3IDXH 1FV1A 1RUQL 4N0YL 4N1CA 1E27A 3N50A 2XTJE 4YZFE 4NWUL 4WWKD 3SCMB 1C5DB 1MCEA 3QCUL 4JLRB 2G75A 5B3JF 5DHYB 2YPKB 5IGXL 1EGJL 3DXAD 3PF2A 1WCQA 2V7NA 4MNHA 4JGUA 5D2LA 4D9RD 1MREL 2ZSVA 5I0ZA 1DBBH 3G9VA 2H2SD 4Y7MA 5ELIA 2E6QA 5AYQA 4QRSB 1S7XA 4N8CH 1DQTA 3N0PB 3HNSH 4WGVB 3QH3B 4G6KH 3MRMA 5BOZG 2ZCLH 2DQTH 2GTWB 5KW9H 5E5MA 3VRLE 4LSTH 4WV1A 1INEH 1A6UL 5EUKB 3JWDL 4MMZC 5DJ8A 5HPMB 3ULUC 2PYFA 5T3XE 3KGRA 1QFPA 3DVGB 2UWEE 2F5BH 4RGMC 4NQTA 1YYML 2GFBA 3FHQA 2Q8BL 2OXHA 2E9BA 3CVHH 1CQKA 3L95B 2MPAH 3O81A 3Q1SH 3ZT6A 3WLBA 2H2PD 3CFJA 5L2JB 4HH9A 3V5HA 2I9LB 3KPMA 1E6OH 3FT3B 3ZO0A 5I19H 2DKUA 1QRKA 2W9EH 4F7EB 3IT8D 4U6HB 1ZHNB 5E4EB 1HWGB 2Z35A 1ZVSA 1XR8B 5BO1L 5EBWB 3VD9A 1UB6B 1KTKE 2ORBH 3RAJH 2Y5TB 4XH2A 2DWDA 4NQEB 5E1AB 3X14A 2C1OA 4LFHG 5K9OA 4X7CC 4XVTH 1ZLVK 4JG0H 2R0WH 4NNPL 4FQ2H 1EMTL 1Z3GH 1VPOL 1WC7A 4AEHH 2N7BA 2LTQC 4NO5A 1LVEA 3CJJA 4P3CL 3ZL4L 4ERSL 3N1GC 3DUSA 1RMFL 2VDKH 4YDKH 2Q76B 2GCYB 4H8WL 2P48B 4OFYD 5CGMA 2B0SH 2V2XA 4G3YL 4AM0A 2A6IB 2NXZB 3TH4T 3S7GA 4X6FB 4OBSA 2MCPL 4PRDA 2EXYD 3WDJA 5A2IH 1EFXB 1F4YH 5K9KB 4ENEC 1DUYA 1BF2A 3BN3B 3U1SL 3I6GB 2VITB 3PWVA 3WXWL 2CGRH 1TPXC 3TIEB 3LN4A 5HTSA 4K07A 3QI9D 4L29B 4DKAA 4PJEA 1T04A 1K6QL 4GQPH 4Y19D 3EHBD 4XI5C 4ZS6C 5KBNC 3OKEB 4M62L 4KXZH 4PGBB 3IJSB 1I7TB 3MGOB 3WLWD 2J8HA 2VR5A 1OSPL 5E8PA 3EFDH 1AR1D 1S9KC 3H9SD 5I71B 1MRDL 2PKDA 2N56A 3DROB 4N8VB 3S3JA 1BM3L 5D7JC 4PRIE 4E0RA 4PJGE 1CD8A 4OQTH 3ULVF 1FYTB 2MCG1 3BH8B 3HMXL 4CADB 1HILB 1X5HA 3QDMD 1SBBA 3MX0A 3ESVF 2I07A 2VXVH 4WHTB 3ARFA 1I75A 2CRZA 4JPKH 4LSQH 5GZNC 3L9RA 4S1SL 2R9HC 3VXUB 2XPGA 3IDIB 4NHCL 3QEGL 2GSIA 3DSNA 2N4IA 4OQTA 4F37F 4OCNC 2CLVA 4XMKL 15C8H 5C8JB 3O4OB 4G6JH 4XP1L 4JFPA 3RWDB 1DP0A 1P4BL 2KBGA 3QIBA 5CJ8A 1UJ3B 1GGTA 2AJ3A 2VABA 2EDLA 3IGAB 1KCSL 1N6QH 3HRZB 3E2HB 5F7DB 3TA3C 4D9LL 1FFOA 1WAAF 3WFHA 2DL2A 2V9RA 4CMMA 5C2BL 1A3RH 3W11D 3I84A 1YDPA 5DC9B 3TCLB 1CYGA 1IQWH 3QIWD 2XQYG 1ZT4B 2HAZA 2D7OA 1LE5A 4JFYB 4MCZB 4OLXH 3JVGA 3IS1X 5J7CC 1FJ1A 4M5ZH 5D70H 2Z31D 4C54A 1T83C 2PCPA 4JFDB 1NC2D 1M05B 3GSNL 3LV3B 3EJZC 3C60C 1D9KD 2DBJA 5BW7C 3SDCB 2H8PB 5K33A 2IFFL 3MLVH 3H0TB 3I3BA 2NNAA 4H25B 5HD8D 5FF6A 5L7XH 2JJSC 1RZGA 4CVZA 5FUOH 4WI3A 4RWYL 1MLBA 2YR3A 5SWZD 4C55A 3W81A 4Z76A 3BRFA 1VADA 3DLQR 4I9WD 5DDHA 4XNQA 3UTZB 4X80H 2Z8SA 5DS8B 1ZHKB 4KK8C 2FECL 4FQIH 4LL9A 4N5EC 4W6XB 3C2SA 1NEZG 3WFEH 2ADGB 1UM6L 1LDSA 1F4XH 4LCCC 4LQFL 5KSVB 3T08A 3SY0A 4YUEH 3T0AA 2BSSA 3BIKA 4MXWL 3PWLA 4OZFG 4O2FA 3OGCB 1S7VA 5HHQB 2NY5C 4JJHA 3FMGH 5FYLL 4WWKA