4MD0B

Immune receptor
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
189
structure length
189
Chain Sequence
b'DTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title A molecular basis for the association of the HLA-DRB1 locus, citrullination, and rheumatoid arthritis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4md0B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4md0B01
2WQRA 1LD9A 2X6MA 4Y5YC 5F7MC 3S34L 2KZ1B 1OGAE 3QHZH 4NC1E 5C8JA 2EEDA 2RJMA 2OL3A 3HE6A 5C92A 4QHNB 2CIKB 3FB7A 3PWPE 3QPQC 3QXDA 1S7QB 4IHOB 5DRNB 1BX2B 1A0QH 5GGVL 5I1KL 1JPST 3MRQA 2YD5A 1QSZA 1MHCB 2C3XA 4C55A 3UPRA 1B0RB 2HRPL 4QLRA 3AAZA 2G60H 3HE7B 4XNYL 3HNTH 4J6RL 2FL5B 4OF8A 5JIPA 3T0WA 1FNLA 1K8IB 5F1IB 1S9WB 4PBWD 2B1HH 3BP7B 4MNQA 1JNNH 4UILL 1AGFA 4MJ2A 1ZSDB 4V1DD 4XP6H 1P6FA 3FB5A 4OF5A 5LCVL 5D1XB 1P7KB 5I75C 3G08A 1B0WA 1M1SA 4I3SL 3HRPA 1HH9B 4OV5B 4JG1L 2W60A 2X4UA 4LU5H 4UOW0 4M7KL 3C6LB 2NY0D 2XKNB 3SN6N 5MHSD 1GHFL 4RMTA 3MRGA 1DVFC 3KXFD 2HH0H 5IWLC 1CR9H 1R0AH 2R15A 5GGVY 3N9GL 1H9VA 3QNZB 2Y9RT 5I1CL 2HFEB 4S1DD 4H0IA 3LKOB 1QRNA 3SKJL 3P77A 4LPVA 3QZWG 3KLDA 4WUKH 3BT2H 1JE6A 4K71C 3P11L 1EAPB 3QP3A 4LBEA 1AY1L 1T5WB 2DLGA 1LP9E 2F74B 2VZOA 1BVZA 4MA8L 3DI2B 2R39A 4M3KB 3FQNA 4LCWE 5K93A 3DO7B 5D1QD 4JG0H 4Q0XH 1D9KA 5TFSL 1RJZB 3MXVH 5GS0L 4XMKH 4AM0B 2GUOB 1FFOB 2QQKH 3RWCB 3K2UH 4ZXBD 3PABA 4PS4H 4YO0A 4J12A 2C7UB 2AK4E 4DKEL 3D0VB 3VDBA 3TFKC 3DROA 1FN4A 5DEFA 1TCMA 3OSKA 3HZMB 5E5RB 3C60C 4F7TA 2FX7H 2V2WB 4AK1A 1I1AD 3KJ6L 1XR8B 2PO6C 4IOIB 2CUHA 4OTXL 2X4NB 4YXLH 1BD2B 5IFJA 2O61B 1BQHG 2PKDA 1OTSD 3O3BA 3DV6A 4ZNCD 1NJ9A 1SJHA 1NAKL 5EORL 5AD0A 3N85H 3GBML 5HPMB 1U8MA 3VXTA 5DJ6A 4FQ1L 4P2OB 1FFRA 4M1GH 3SE4C 3UZQA 4WY7L 3S5LG 5DJYB 1SBSL 4P2QA 2EO1A 1MCRA 2MOVA 4WIQA 3QWOB 4HX1B 4JRYE 4X5XA 2HLAB 3GRWH 1AGDB 1P5VA 4OUUA 3D3VD 2C4FT 4MAYD 4ZOAA 3ARFB 1KN4L 1VEMA 4KJQD 3VXSA 1JGUH 2DS4A 2YBRB 3DX9A 3K2MC 1HDMA 4UBDD 4Z7QF 4QHKJ 7FABH 5SWZD 4K94H 2L4OA 4X6CA 5HDQH 2E9WA 5CEYA 3K4DA 2RFXB 2HKFH 2G75B 3CDGA 3J7HA 5TDNA 3B83A 1UXWA 1I3VA 4YDVB 5IVXE 2NY3D 1MHEB 2VLKE 2NY6B 2AERT 3Q5TA 2R2CA 3C8HA 2A1WH 2DF3A 4JPKH 1XF1A 1JMZA 2D9QB 1JHLH 1CE6A 3GSRA 5L2KD 5B38A 2R0LH 5F9OH 2ZOLB 3MV11 3B5GA 1KCSH 4OZFG 5E6ZA 5IF0A 3PJSA 3OXSA 4M03A 2H45A 1BQLL 2D31B 5JW3L 3BXNB 5E99L 2I24N 4OZHF 3X3FL 2NY0C 1DUZB 4PB9H 5BRZE 5KS9F 4EXPX 4F33B 1BVKB 3RHWK 1QEWA 4C83A 1PBYA 1FDLL 3IDJA 4YPGA 4ZS7L 5HHQA 5GGRB 1G1YA 15C8L 4HEME 2EDTA 4XPHL 5LWYL 4IRSA 4U0RC 5EC1B 1FGVL 1WT5C 3HMXH 1N4XH 1E4WH 5I18L 4X8JB 4S1DC 4YBQC 3MUJA 1L9MA 3O2WH 3DUUB 2ENYA 1T0MB 3L3OA 5FAAA 5LBSH 2VZ3A 3CFEB 5MEOB 4A6YH 1MHHB 1CS6A 4GAFB 2YR3A 5HDLA 5CBAA 3ULVL 1W0VB 1RHFA 3B9AA 1XCTA 4HZLA 1B88A 3TBWA 4NOBA 4P4KA 1BZ7B 3MBXL 4OB5H 5HXMA 4HFWA 1GIGH 5GRUH 3ZKND 4ZXBC 3G9AB 3H9SB 1CTOA 3EOAA 5GSRB 2OL3H 3HAEB 4PJAF 3GMPB 2ZUQB 4Z7QE 5K59F 1FYTD 1JFQH 3JV4A 1NCDH 3KNBA 4X99B 1GH7A 1DBML 1I1AC 1XIWA 3QUXD 2NW3A 2VLJE 1KJMB 5KVGL 3K81A 2EIDA 3MR9B 4PRPD 1QBMH 2BRRH 4YHYB 3V7AE 3F7VB 3HR6A 5C0AD 3ARTA 4YHKH 4G6KH 3FTGB 3JV5A 3PF2A 1OP9A 3U0WL 2DLFL 2RAMA 1HIML 2W59A 1CLOH 4K23L 1H3GA 3H9HA 5EC2A 1IAII 4GW1B 1NDGB 2YD2A 2W0KA 3KPTA 4TVSa 5J3HC 1OTUD 1H3VA 2J3SA 3HI6L 1C7TA 5KS9E 2NY5C 4PJ8D 1EAJA 5BS0D 1YYMH 3O9WB 2XFXA 2ZCLL 3TBTA 4MAYC 2ZKHL 1EHNA 5HYJB 3E8UL 1WGOA 1LO5B 1MCPL 2Q3AA 4KJQC 4HDIB 5I8OL 3D69A 4OFPA 2XT1B 4S0SD 4FP8H 2P1YA 1MCCA 1KB5B 5D2NE 5FYJL 4JFDE 5DWUH 1FZOA 1CFTB 4UBDC 3TN0B 3X3GH 4M8QB 3RWJA 1OPGL 4ELKA 1H15B 1Y6MR 3HZKA 4M7JH 3S4SB 1JWMB 4LNRA 3CNKA 3L7EA 4I48A 4JHWL 3MOBH 3U4BL 5A2JH 4Y5XC 2NY3C 4ETYA 4J7RA 5ESQA 4P3CH 3OJ2C 1BJ1J 1FG9C 5T1LA 4RWYH 5E2WH 3MV7D 2FX9H 1QFWH 3EYVB 5KJRH 3QEHB 5GZOC 4FOMA 2PF6A 2BZDA 4Z7WA 2AXHA 4H20H 4NO5A 3RNQB 5GJSH 4PJAE 3O6LL 1OF2B 4HF5H 1S7RA 3FFCD 3OKMB 3LPWA 1JGLL 5K59E 2IANA 3P4LA 4GS7C 2X5PA 4LAQH 3D85B 3LMJL 3OKEB 4N8CL 3H3PH 1F6AB 1C5BH 1JNLH 4ZFGL 1IGJA 2P24A 4LLUA 3BP6B 3RIAF 1ZHNB 2VLRD 4TNWF 5CJOL 4JZOB 1J05A 4R2GD 3HZVA 1DQMH 4HGWB 2AEPH 4JFEB 4QWWC 1XGPA 2WLZA 3P73A 3G04A 2RR3A 1WEJH 2OLDA 3JTSB 3SCMA 3RGVA 1T2QL 4Y1AE 1A2YA 1HN1A 2IG2L 5E56A 3WFCH 3M17B 3O4OB 4NBYB 5C0JB 1C08B 5I1DB 3MREB 4Y89A 3PV6A 1HSAB 1ZT1A 2OZ4L 2VDLH 1IM3A 4GQ9L 3CDCA 4WO4D 3SDCD 3SDXB 5JW5B 1PKQA 4WFFE 5F1KC 2OTWB 4IDLA 3VFUB 4Q6YA 5D4QA 1OP3H 4YH6A 3ZKNC 4ERSH 4PJCF 1KELH 4L3ED 3UTTE 1TMCB 1UA6H 1L7IL 1S9KC 3UCRA 3I6LD 1T83A 3W11C 1W0YT 3HPJA 3FO0H 5K9JL 4WFGD 5SWSE 1MCWW 4UMGA 5F7EH 2CRIA 4N0FB 4KPHH 5DUPL 1IFHH 4K2UL 1G7IB 4QXUL 1ZHLB 4YJZL 3VXQA 2QR0B 5T5NG 3O6FD 3O4LD 4PG2C 3IFLH 3DGGA 2R8SL 4RDQG 2FEDD 3SPVA 1DQTA 2H6PA 3T65A 5ECJE 4XBGA 3RWFA 5C9JA 1YJDH 2XA3A 2GJ6E 2RHEA 3GHBH 3PUCA 1OCWH 3QULB 5DJZB 1FVDB 3RKPA 5D7IF 2F54A 3MLUL 1OTUC 3NCYS 5CHNB 3SDAB 2V2TA 1CLCA 4LDOB 1S9XB 4LSPL 4PJ8C 5E2VH 4APQB 4JEGB 3FO2A 1I3RB 4LARH 1GGCL 5EU7C 4X6DF 1A6UL 5DF0A 5DDHA 3SJVB 1FV1B 4PJEF 3BD5A 4KY1H 4U6HB 5BOPA 1G9EA 4I0KA 4R8WH 2UZYB 3U0TA 1H3TA 3EYQC 4U1KB 4YC2C 2EKSA 4OJFL 2PYEE 1CVRA 4M00A 4MQXD 2BJML 1RUPL 2E6QA 3MLWL 4PGEA 1OHQA 5IB3A 2V7HA 3D9AH 1LEIB 4ZMAT 2XRAL 5IIEA 4JFFE 1A1NB 5C3LD 4Y5VA 4NM4L 4RRPA 5HGGS 1SEQH 4Z76B 1JZ3A 3ZSSA 2UYLB 1NBVL 2X4OA 3F12A 3KYKH 1T80A 2J8OA 4LEOA 4KVCL 1U92B 3QBTB 4QOKE 3T0EB 3WD5H 5D9SB 1DUYB 5IB1A 5F44A 4ONHA 1JYVA 1KCRL 1A3RL 5FYJD 4L1DA 4KRMB 4HIEA 4PJCE 4BKLA 4NO2B 2ICEA 5EUOA 3ZKMD 3P4OA 1OAUL 5HYFA 1KC5L 5IG7A 1QYGH 3ARDB 3QYCA 2Z31A 4HWEL 3BMWA 3FOLA 5DQDL 3PIQA 4RBPK 1H3PL 2EIZA 5T1MA 4UT6L 4YHLL 5KVEL 3T8XB 5E2UL 4YQXL 2ZG3A 4OIIH 1QVOA 4R2GC 5EPMB 2F5AL 2LV4A 3U36B 1R5VA 5DURB 2X9WA 1WBZA 5ITBH 5IUSA 3G5XA 1CVSC 4WV1C 4X7EC 2AXGA 1LO4L 2BDNH 2XN9D 5JQ6H 1YNKL 4JO2H 4M43H 5E00B 5IV2A 2VJXA 3PL6A 2OP4H 3RKDD 3H9YA 3VRJA 1JI2A 5D7IE 1J12A 2JB6A 1MCQA 5BO1L 4KV5F 1I8LA 3BH9A 4P3DB 4QRSA 4KRNA 4X6DE 4KUCD 4DW2H 1QFHA 1N2RA 2BNRE 2JELL 2LU3A 3DVIA 3MFFB 4WO4C 3SDCC 3C09B 1UB6B 4PJEE 4MDJA 5C07D 3U7WH 1RZKL 3KR3H 5CZKA 2ESVA 3GJEB 4UTBH 1Z2KA 3QCUL 1BIHA 1OSZA 2DAVA 4KZDH 3UTZA 3DMMB 3BN9D 1ZS8A 2BSSB 4OUOA 4NCC2 1N5YH 4X4XA 3VG0H 2BHZA 1K4DA 4MD4A 3RUGA 1EMTL 1RMFL 5F9WC 5AZEH 3IU3B 2XQBH 2V6HA 4ZPTA 3KAAA 4K3GA 5EBMA 2Z8RA 5CSZA 1QNZH 3O6FC 5DTFB 4JPVL 1S5IL 3BAEH 2BSRB 4HZAA 5C0IA 3QQNA 2FEDC 1GGYA 2VQTA 4DQOH 2M26A 3D39B 4GMTL 4J1UA 5ACLA 2Q20A 4Q2ZB 4OLZL 3O3UN 2OR8A 2QTEA 1ZHBB 5IVNA 1VEPA 1IGTB 1FH5L 5CJXA 1MRCL 1B0GA 3SQOH 4FQQA 4L4VE 3U46A 3GZKA 1IARB 3D0LA 3QA3B 5J6HB 3PQYD 1LE9A 5C08E 3RY5A 2GEEA 5HHVL 1P7QB 3R1GL 4GAYA 3REVA 5LAXB 3DSFH 4HAGA 3F6IA 3X11A 1NFDF 3ZT6A 4CVXB 1KT2A 1SMAA 3LQZA 4W6XB 4YFLI 3KWWB 2YC1A 4PGDB 4MB4A 2DN7A 4GAGH 1YPZA 3MJ6A 3FT2B 1RPQA 5C7XH 1MFDL 3P0GB 1RZFH 3AREB 2VRAA 3NMEA 4XCFH 5DT1H 5GGQL 4YGVB 5KG9A 3D87B 4KV5E 4XPGL 3FHAA 5EA0H 4NHUB 1JL8A 1WBXA 5KVFH 5C0BB 5FUOL 3W5NA 1N26A 4H0GA 2Q7YA 1BF2A 3MJ8B 3VGAB 5I2IB 4PJ5A 4PLKD 4E41A 2WMPA 3ZKMC 2EDBA 5BVPH 3NVQA 3GHEL 2UWEA 3H2WA 1ZK9A 1EEZA 3QDME 5I1GL 1KOAA 2FATL 1J9CT 3T4YA 3LEYH 1EJOH 5HI5C 1ITCA 4MWFB 3VXRD 2VDOH 2DI8A 3GGWA 1W8NA 2VABB 4A2LA 4PLNC 5HYSA 3QO1B 4EEEA 1RUKL 2VN4A 1LDSA 2J8HA 3ZE1E 1T7XA 4IMKC 2GJZB 2QSCH 1YMMB 3TF7C 2WUBH 4BZ2H 4HIIA 4ODWB 3T0BA 4NQCE 5CINL 5D5MA 5DI8B 4HULB 4JZJC 4FQXC 3AY4C 3RKDC 4PJHB 3KGRA 5CCKL 3OKDB 3ZYIA 1CWVA 2DQFA 3OTTA 3ULSA 3WMSA 1QO3A 3RWHA 2I60H 5D8JL 1GJIA 1UJ3A 2Y07L 4S1RH 5I8CA 3HE7D 1P4IH 3G5YA 1DEEA 5IP4A 4K8RL 1NFDE 4E42A 2JIXA 1QD0A 2PW1A 1YEHH 4PJBF 1RZJC 3BN9C 4PBXA 1HZHH 2X41A 1GGIL 3VXPB 3OMZA 3VD5A 1SYSB 1KLUA 1MLCB 5F9JB 4YEFA 3LKPA 3TA3A 2OSLA 3ETBF 4O2FB 2ZUXA 4F7MB 1EO7A 5D1XD 5F7DB 1C12B 2JTDA 1P4LB 3L3HB 1D5ZA 3S96B 1FLTX 5E1HB 4ZOBA 4MDIB 1LO3H 1C1EH 3C6LD 2OJZL 3DRQB 2Q8AL 2WP3T 5DK3A 5TDOB 3BO8A 3NGBC 4U31A 4U3HA 2J2ZA 3U82B 5ENWA 3DRTB 1MEXH 1MCLA 4DAGL 1JZ8A 1SJEB 2WUCL 1GC1H 1G7QB 3JTTB 1ZVHA 2R4RL 4L9LA 3IFNH 2Y7QB 2YMXH 3KDMA 4GLRI 2V7NB 3CZFB 5C6TH 3T2OA 4NN7B 5DHVA 4EBQH 5L2JB 2Y72A 4JPWL 1L7TH 2MHAA 2BC4B 1V05A 5JA9A 4MLIA 5C0EA 4MJIA 4JRXB 5HHMB 5ICXB 2C3GA 2HT4D 3MRKB 4NQTA 1QSFE 4WU7A 4GO6B 4WWID 4A6YB 3B4NA 5GGRY 2D9CA 1FNHA 3P9LA 4P48A 4JO1L 5IMOB 1P84K 1IGFL 1TNMA 4D9QD 5KSVB 1E6OH 2KZWA 1F97A 3TCLB 3EDJA 1A6WH 3V52H 2R2EB 1AQKL 3FT4A 2ICWJ 1ZV5A 1LD9B 4X80H 5IJKC 2HJLA 4OIAA 1OQXA 5HD8D 5HHOA 5C8JB 5CZXD 2OL3B 3HE6B 3BKJH 4U7SA 3UJTH 3FB7B 4GKZB 1OAZL 2W9DH 2E7BA 3BRGC 3MRQB 2MJWA 4F9PA 4QRRA 3UPRB 4DZBA 1D6VH 3V4UH 1EA9C 2YPVH 3AAZB 1BD2D 2X4PA 1OB1A 4FABL 4F7EA 1KB5L 1RURL 4XB8A 5FXCH 4PGJA 1KENH 1MUJA 4MNQB 2AV1A 1AGFB 2O5YL 4KQ4L 2APXA 4OLXL 4DCQA 5C0DA 1YN6A 3IJHA 3FB5B 4S1QH 2DDQL 4KVNH 4QRTA 3G08B 1QBBA 2DKSA 4OKDA 1BBJA 3L3DA 2GK0A 5IROA 4FQCL 4M7LT 3L3KA 4XVTH 5I8KH 2W60B 3ARFD 2X4UB 3QR2A 5MI0B 5T1KD 2AABH 3CSBA 3LEVL 1V7NL 2B5IB 2XTJE 3LVEA 5D7KE 1Q0YH 4O00A 3IDGA 1DANT 3MRGB 5CKGA 4KDTC 1YQ2A 1QFOA 3CMGA 4DEPB 5FCUH 4JHZA 25C8L 3S36X 1UH3A 4HUUB 2GCYA 2HT3C 2XWBA 2UVFA 4RCAA 1AE6H 3ZHLA 1QRNB 3P77B 2NY6D 1BAFH 3MGOA 4LBEB 4HWZA 5D1XC 1K8DA 3RA7H 3IT8D 2CRMA 4P2RA 5EZIL 1N6QH 4P46A 2X05A 4WI4A 1A7NH 3FQNB 2FO1A 4HG4K 1JYNA 5FGBC 4ZFOA 4GAJL 1D9KB 2L7UA 4CBPA 1YY9D 1X5AA 3DVGA 1J1PL 2GYSA 1RZ7H 5F89A 5CGYC 3QRGH 1FIGH 3PABB 4RZCA 4NJAL 5HVWA 2DIJA 2K3TA 4QXGL 4YO0B 2LAAA 4AIXA 4JFOA 1L4IA 3BWUC 3NIGE 3DROB 1FN4B 5DEFB 3VFGL 1IEHA 2CDGA 1D5IL 2A83A 3GSNL 4F7TB 1WWBX 1UM5H 4O9HL 4PIRF 2ID5A 3C08H 3Q5OA 5JXEA 1XF2A 5HYIA 2E6JA 3O3BB 5IFJB 5CLTA 3DV6B 3WLWD 5HJ3A 2DQCL 1NJ9B 1SJHB 4NIKB 2MNUA 1U42A 2HT4C 3FO1A 4AEIL 1U8MB 3OKNA 2P43B 4PTUB 3VXTB 5DJ6B 5IFHL 5DHYA 4G6MH 5F9DC 2DWEB 1F45A 4ODHL 4ORZC 4P2QB 2AK4A 1UWXK 3RY6A 5DVMA 4X5XB 5D71H 4U6VL 4IDJH 1GPOL 3H9SD 4OUUB 1AXTL 5HD8C 2DQTH 3V6FA 5L7XL 4CMHB 1RIVL 5CZXC 4Z7NF 3MTRA 5B21A 4NQDE 1VSCA 5EU5A 2VDPH 4F80A 3VXSB 2MCPH 4KGLA 4X7DC 2ICCA 4MGXA 4JY5L 3DX9B 4G6AD 1D5MA 1HDMB 4XNZB 1DP0A 5IFAH 4NZTL 1F13A 1QLEH 2YXFA 2YUWA 4HJJL 1HXMA 3LKQA 4G3YH 3MLYH 5GRJH 4X6CB 5CEYB 3D25A 4I3RL 4YIQA 3FRUA 3UJJH 5TDNB 1I85A 2KDGA 1MCSA 4KUZH 2ZUSA 1UXWB 4X0KA 4PRAA 2DM7A 3S3JA 2XNAA 1P7HL 3ZKXB 4OFDA 2CLZA 3H8NA 1IM9A 1OP3K 3QQ3A 5T5NF 4GKOA 5I1EL 1CE6B 1XR9B 3GSRB 1YN7A 5B38B 1IAMA 2IQAA 4M6NL 5F3BA 4KK8C 3A6CL 3O9WD 3OKYA 4RDQF 4ZFZA 5IF0B 3PJSB 3ARFC 4HKZB 3OXSB 5HYJD 1XCQA 4EOWH 3KLAA 2PR4L 3R06A 1KYOK 1HSBA 4C58B 1XF4A 2R2HA 3EZJB 2CK0H 2FJHB 1QEWB 3AB0C 3LZFH 1UEMA 3CVHL 4C83B 5ABDE 3TN0D 4YPGB 3IDJB 3S98A 3IYLW 2XV6B 5HHQB 1UCTA 4L8DA 4IRSB 2NY7H 3MO1A 3WV0A 3BPCA 4XNUL 4D3CL 3C2AL 4I8DA 2DBLL 2HFFA 1KN2L 2O5ZH 2X1XR 4HS8L 5F70A 2NY6C 4U7KA 4U1JA 3DYMA 3L3OB 1K5NA 4NKIH 4RGOL 3ZT5A 5FHBH 1KCUH 1LK2A 4PP1D 4MXWL 3GK8L 4KXZI 5CBAB 1SY6L 5EUKA 3VDCA 3MRBA 1N7MH 3RY4A 1FSKC 1XCTB 1LO2L 4HZLB 3TBWB 4P4KB 4HIXH 2R4SL 4TUKL 4Z7NE 1S7SB 3OKKB 4HFWB 3W0WE 5EOTA 5TE6L 2D7QA 3D85D 4RSVA 1ONQB 3EOAB 5T3XH 4UQ2A 1T1YA 1C5CH 4WGWB 3VD4A 4CUCA 3EO1A 3EIFA 1X5YA 2WINA 1JBJA 4H0HB 3EOBA 3JV4B 1P9MC 1ZE3C 3LKSB 4ETQA 4P9MH 1XIWB 2F53A 2NW3B 1MF2H 2G60L 4JFED 5A2KH 3F62A 4HS6A 2FYYA 3WLWC 3UAJD 5IQ9A 2A0LD 5E08L 3QDGE 4XWOD 2APWA 3RRQA 1CE1L 2ITCA 1NMBH 5EBLA 3UTPE 3UO1H 5FUCC 1WCQA 3PGFH 3H9HB 5EC2B 5TGBA 5LXGL 3MNVA 3DXAA 3MLVH 3RIAK 2UVEA 4HUVA 3F8UB 2E8ZA 2A6IA 2DOCA 2CK2A 2HG5A 5C2BH 4HCRL 2XFXB 4PGCA 5D1ZA 4YUEL 3TBTB 4JFHD 2EDLA 4NZJA 3MGTA 3BKML 3D69B 3LN4A 5DJ8A 4NQSA 2P46B 1Z6JT 5DVOA 1FZOB 4JKPH 3QT2A 4G6AC 5KSBA 4OT1L 2NPLX 3MV9A 3RWJB 2X70A 1CR9L 1R0AL 4ELKB 3HZKB 2CJUH 2VXTL 4LNRB 4MD0A 3TT1L 5F1SA 4OZHA 5JIIA 3L7EB 2C1PA 4UNUA 4BZ1H 3IAGC 2EZ0C 1ITBB 2WWKT 4ZUSA 4G5ZH 5ESQB 5JW4M 4PBVC 3S36L 5CJBA 5T1LB 3S35X 1UYWH 2VNCA 4XC1H 3SDAD 1IAKA 4APQD 2BNUA 2R56L 4Z7WB 2KH2B 2D0HA 2NY1B 3O9WC 4Y2DC 4NO5B 4CJ0A 2P5EE 1YEJH 4JG0L 3TBYA 3A0OA 5ICYA 3MXVL 4D94A 4ZO6A 3GSUA 3SJVD 1S7RB 3VFOA 1HHIA 1ADQH 2IANB 4RIRA 3C87A 5DVKA 2FEEI 4HS3A 3E1F1 3K2UL 3A6OA 4WFEE 2ILLA 4PS4L 4O5LH 1T89C 3VMPA 5TQ0L 4MJ6A 2JCCF 1IGJB 4YDKH 5ICZA 2P24B 4LLUB 2PTUA 1MWAH 4LRIC 2NX5A 5I9QC 1Z0MA 3PWVA 1YYLL 3WL9A 4ONGL 4R4ND 5TF1L 1J05B 4KTEL 4MQTB 2Q8BL 3HZVB 2O26U 1OAQH 2AKRA 1XGPB 4LLQA 2FECL 5F6IB 3LV3A 3OG4B 3P73B 4Y2OA 2CLVA 3G04B 4PJAA 3SCMB 3RGVB 2R0ZL 4F7CA 1A2YB 4WU5A 2Z4QA 3LIZH 4M1DH 2X89D 2JJSC 1NPUA 4M1GL 1ZVSA 3PV6B 1RUMH 4JREC 1IM3B 2LQRA 2BOBA 4HFUH 2EE6A 1PKQB 2DYPA 3GRWL 3WYRA 3ARDD 2GT9A 4QTIH 1AHWA 4WTWA 5DD0H 1CICB 1BM3L 2RQ8A 1MI5E 3MXWL 4F3FA 3V0WH 1E4XL 4PRIE 1RZ8A 3BD4A 4F58H 1DBBH 3HPJB 3B2VL 3NCEB 1JGUL 1MCIA 4NUGH 4W68A 4NM8H 5C09A 4YE4L 5ITFA 5DURD 3RX5A 7FABL 5DD3H 3DSNA 4K94L 5IVOA 5E9DA 3VXQB 3WUWA 4KHTL 2HKFL 3UAJC 4LVOC 4FA8A 4GXVH 2X4RA 4TSBL 2IALA 5A2FA 3DGGB 3GMLA 3QFDA 1SJXA 3SPVB 4XCNA 1JHKH 2H6PB 3T65B 4XBGB 2P8LA 3RWFB 5C9JB 3KG5A 4HWBH 2A1WL 4JPKL 1TVBA 1JHLL 4J4PC 1Q72H 2F54B 2V2TB 3GI8L 5CP3H 4LMQI 2R0LL 4LEXH 3FO2B 1N8ZA 4PV8A 1N64H 3RX7A 1PX4A 2JCCE 4NQEE 4ZO7A 1CGUA 3CFCH 5DDHB 3DMMD 4YHOH 2XQYG 1DSFH 3U0TB 1FCCA 4DFIA 5T33H 3P0VH 2FNBA 3MX0A 1YQVH 2EKSB 4ZOEA 2PXYA 4PGEB 2XZQL 5IB3B 2V7HB 4TQEL 1N4XL 5IIEB 3U6RA 4XP9H 4Q9CA 1BJMA 3IJYA 3WLBA 4Y5VB 4AT6A 4M7ZB 3V0VA 2X4OB 3F12B 2VXSH 3D39D 3AM8A 3QFJE 2DM3A 4LEOB 2FDBP 5CEXB 3CFDA 1J1XL 5IB1B 3SDAC 5HY9A 4ONHB 4I9WD 4NFCA 4APQC 3OBAA 4Y16C 4NN5B 1VKXB 1AO7A 4HIEB 4U2ZA 3O8XA 4BKLB 3T77A 5CIPA 2ICEB 2GIYA 4I18A 1KFAL 3P4OB 4OB5L 2NXZB 4WI8A 4AL8L 2FLBT 5F7HA 5B3JF 1HI6A 5IG7B 1GIGL 3WXVH 1P7QD 3BFOA 2YZ8A 1A7BA 5A40E 4S1SH 1FLRH 2OL3L 2OR7A 1E28A 4U1HA 3U30B 3UJIL 3FOLB 1OT1A 3PIQB 2EIZB 5T1MB 1UH2A 2P5WA 1JFQL 1NCDL 1QFUL 3T4AA 1UM4H 4R4NC 1QVOB 1BWMA 1R5VB 1TZIA 1WBZB 4YFEA 3G5XB 2AXGB 3TZVC 3WJLC 2BRRL 3VXOB 4NZUH 2DM4A 4C57C 1Z9OA 3FZUD 4YHKL 1DL7L 5IV2B 4KGJA 2CR3A 3EFFA 3VCLA 3VRJB 4FG6D 3EYOA 2VXVH 2W65A 4ZNEE 4X7CC 1CLOL 5E8OA 3BH9B 2W9EL 4QRSB 6FABH 4KKLC 2A77H 1Z3GL 1N2RB 1CN4A 5LGHH 4HIHA 4MDJB 5DGRA 2FCBA 4GRWH 5DZOA 1FC1A 3ARDC 3V6OA 3V95A 4QHKI 1SQ2N 4M1CC 3VGDA 4M6AA 1BBDH 4N8VG 2ESVB 2UUDK 1OSZB 3UTZB 1E6JH 4JANA 2ATPA 1ZS8B 1KXTB 4V1DE 4IMLA 4X4XB 1K4DB 4M02A 4MD4B 3RUGB 3X3GL 1YMMD 1KCLA 2RIKA 1M7XA 2BNQA 4HKXA 5K9QG 5EBMB 4ZPTB 5CSZB 1T0PB 4GRLC 1Q1JL 2ZUWA 1KACB 1NDMA 4Z7UB 5C0IB 1S7TA 4WHDA 2J88L 3G5ZA 1IMHC 2E9BA 2W92A 4J1UB 1X5ZA 1ZTXH 5E2WL 2B4CH 2FX9L 3RJQB 1QFWL 3KXFE 5F3HA 2EDRA 5KJRL 1M71A 5B3JE 1B0GB 4FQQB 1L0XA 2YXMA 3U46B 5B39A 4H20L 3D0LB 4WHCA 3WIFA 3S35L 1K4CA 4N8PA 1ZLVH 3LHPH 2I9TA 3I02B 2E6PA 2OXHA 3RL2A 1LE9B 5IT2L 5EN2A 2NY2B 4GAYB 5DR5H 3REVB 3H3PL 4GUPB 4UT9H 1JNLL 1A22B 3X11B 5I1JH 4CMMA 1KT2B 3AGVA 3HR5A 3LQZB 2GY5A 2YPLE 2YC1B 3SE8H 2MPAH 1YPZB 2AJ3A 4KKCC 4DN4L 1N3NA 1MIEL 2LTQB 4M93B 5KG9B 3OZ9H 3WFDH 1WEJL 2FR4A 2IAMA 1I7TB 3BJ91 1A3LH 1WBXB 1GZPA 4OM1H 1GOGA 2JK5A 2VDNH 3ALPA 3WFCL 1ACYH 2Q7YB 1I7ZA 2EDQA 3LS5L 4H1LH 4PJ5B 4E41B 5J1SC 1KEMH 5F7FA 3MOAH 4PLJD 4ZSOA 5IB4A 5CD5D 2UWEB 2QADB 1KJVA 4AH2A 1EEZB 1A6ZA 1TETH 2GJJA 2APBA 2LAGB 1AP2A 1ODAA 5AAWA 1PD6A 4ERSL 2WK2A 4GQPH 1ETZA 3GMMA 3T4YB 3VE0A 2Z8WC 5E70A 5DGQA 5H37H 3GGWB 1TTFA 4JRXD 5HYSB 3VGEA 2N7BA 3FO0L 2W0LA 2VLKD 2ZCKH 1AI1H 2W1NA 1INDL 2NTFA 3EO9H 2HLFD 4KPHL 2FJFB 1FE8H 2IADA 4HMDA 5KW9L 4WJ5A 5EO1A 1BEYH 4M9PA 4HIIB 4XBEL 3E2HB 1HEZA 5D5MB 1BJ1H 2X9YA 3FZUC 3D3VE 4PFEA 1U9KA 4QKXB 4ZOCA 4BUHA 4DUXA 2DQFB 3T2QA 5JR1H 4BM7A 3VGAC 2FHFA 3ULSB 2WP3O 3GHBL 5C70A 3HE6D 3UYOD 5SX4H 3MMEA 1QO3B 4JN1L 3RWHB 4IOFD 3C5ZD 4DK6A 4PYGA 4ZAKA 2PNDA 4RA3A 3Q3GA 4U7MA 3R8QA 1UJ3B 5I8CB 3G5YB 4HXAH 1DEEB 2VDQH 1A7PH 1QZ1A 5DJ0A 4E42B 5IQ7L 1NBQA 2JIXB 2PW1B 3EFDL 4PJIA 1H3UA 1PG7H 3KPSA 1DLFH 4XX1E 3MLZL 3JWOH 4DGYH 1GOHA 2EXYD 1KLUB 5JLZA 4AQ1B 1S8DA 3LKPB 4FQHA 2OSLB 3TA3B 2HTKD 1K9TA 5L2KE 1V7MH 3D9AL 3WNLA 2K7QA 3STLA 1D5ZB 3EBAA 3O2VH 1CYGA 1SEQL 3TEUA 4G8GA 3KYKL 3S3PA 4Z7VE 1H8NA 2G5RA 1X5HA 1DZBA 3QIBC 4LSTH 3SGDH 5IHLB 3Q0HA 1VADB 3BO8B 3D2UA 3MRPA 1KB9J 2D3VA 5CIPH 3X12A 1DQQA 1LK3H 4LPYA 5C0ND 3CAFA 3UTQA 5JXAH 1S5HA 1JWUA 4FFZL 4L9LB 4K94C 1JF1A 2DQEH 3KDMB 2N56A 3BW9A 3O3DA 1QYGL 2VLMD 4H8WL 3VWJA 5DHVB 4JRWA 1X7QA 2MHAB 4H88L 4AEHL 1MJ7L 5J4MA 4PGZA 4JO4L 2ZUTA 4L8SC 3G6JF 5C0EB 4MJIB 2L7JA 1CQKA 4Z0BL 3RWDA 5GGVH 4WU7B 4OCYL 2HRPH 1G7PB 2NXYC 1X9QA 3Q1SH 5B8CA 1ZGLP 1HNFA 1IBGL 3WKNA 1IC5L 1TJHH 3FT4B 2OP4L 3WCYA 3KPRA 1E4JA 1ZLWK 2HJLB 4RA0C 4UILH 5D7JA 1FYTE 1JNJA 3I85A 5HHOB 5DC0A 1RUQH 1C16A 4MQ7A 4XXCC 4PLJC 4HUNB 2XOTA 5CD5C 4BZYA 3CXHK 5LCVH 4W4OC 2XZAH 3VXUA 2VL5A 4KMTL 4PRPE 4QRRB 3RZCC 5JTWA 1JGVH 3CFKA 3C2SA 2CXKA 3GSWA 4DZBB 4JG1H 1WICA 4UTBL 2IF7A 2X4PB 1OB1B 4F7EB 4O2CA 4M7KH 4LSVL 3CLEH 1L0QA 1KF9B 1OM3L 1GHFH 1MUJB 2AV1B 4XH2A 3FKUS 2HLFC 1I7RA 2IWGA 2XZZA 1YN6B 4DCQB 5C0DB 3IJHB 2V2XA 3HAEG 3AS0A 2WBJA 5BS0E 2YPKA 1J0KA 4QRTB 1TPXB 1BBJB 2ARWA 1JZ4A 4PJBA 5GS3A 2GK0B 4C56A 1DR9A 2DMCA 3L3KB 3U2SA 3O2DA 3SKJH 4L1HA 3DHMA 5I1LA 4R97B 1YC8A 1A6TA 1WAAA 3C5ZC 1D3CA 3VXSD 1AY1H 1FFQA 4K3HA 4KDVA 4IJ3C 4I0CC 2EC9T 3IDGB 4POZD 1V3KA 2NZ9D 1FL6B 2G5BA 2OQJB 1NFKA 1U95A 5TFSH 5GS0H 2MQ3A 3IDIA 3G6JE 2GCYB 2XWBB 2CGRH 1MRFL 4ZTOL 2EXYC 3DX7A 3EO0A 3MV7E 4NCC1 1VERA 1X5XA 2HTKC 1AH1A 2Y1VA 1QBAA 3MGOB 1P84J 4DKEH 2IMMA 3QCTH 4HWZB 5DEGA 3UBXA 1K8DB 4GAGL 5H2BA 5C7XL 4P2RB 4BH8A 4P46B 1RZFL 4JQIH 4XCFL 3FFCE 3KJ6H 4ZFOB 1RIHH 2QJDA 3TVMD 4OTXH 2WZPD 3F58H 1BQSA 5EA0L 3KLSA 5MI0C 5GJTL 2V17L 5I74B 3S4SG 4MNGE 1NAKH 5KVFL 3ARGA 5EORH 5F89B 4WW2A 4RGNB 2Q86A 1D5XB 4RZCB 4G7YH 2VLRE 3GKWL 4JFOB 4DEPC 4WY7H 3GIVA 3RWEA 4IRSD 1MWAB 3QDHA 5I66A 3F5WA 4DKAA 1OARL 4F9LA 2A83B 3RIFF 3WBDA 2ED9A 4ORGA 5ISZA 4LLVA 3N06B 3LEYL 3H6JA 4OCLC 1XF2B 4XZUA 5HJ3B 4M61A 1F3DJ 3CUPA 3OKNB 1I1RA 5DHYB 1NKOA 2QSCL 5HGDA 4GMSL 4DUVA 1X5IA 2WUBL 4OCMC 2JJVA 3E6FA 5E4EB 4P4KD 4UT7H 4RMVA 3TO4A 1U8KA 5TE7L 4L5FH 5I73C 3I6LE 4KK9D 3ZKQD 5HVHB 1UWGH 4HBCL 4I5BA 1PG7W 5ANMA 5D2NC 1OT2A 4WFGE 2A6KA 5EU5B 3NCYP 5T5FH 4PJDF 1D5MB 1XIWD 3O4LE 4OV6F 1P4IL 1HXMB 3LKQB 4OQTA 2BY0A 3JZ7A 2P47B 1BQLH 3D25B 4WUUA 5JW3H 1T04A 1JZ6A 4JAMA 4YIQB 2ITDA 2BFVL 1HZHL 3FRUB 4YK4B 4CW1A 4X0KB 4PRAB 4OZGA 2XNAB 4Y4KA 2C3HA 2CLZB 4ZS7H 1IM9B 3TJHD 4XPHH 5LWYH 3QQ3B 3I50L 1SJVA 2D7TL 1YN7B 3QH3A 2IQAB 5F3BB 4ZFZB 1IILE 3U4AA 1CZ8H 4CMHC 1XCQB 4KRPC 1FRGH 1NGXA 3OG6B 3H42H 3KLAB 3R06B 3MA7A 4YDJA 4R6UA 1KIPA 1HSBB 4NC0B 4XNXH 1XF4B 2R2HB 2ENSA 4POZC 5CP7A 4XNZC 2NZ9C 1RZIA 3ULVH 4L8DB 2DD8L 5I1IL 2YMXL 3PWNA 3MO1B 4N0UA 1RJLA 4P2CG 3UZVB 3BPCB 3SGEH 5C6TL 4EBQL 2HFFB 3OAYK 1L7TL 1ZLUK 5D96B 4KK5C 4U1JB 1YJDC 5ALCL 1TQCB 1K5NB 5T1LD 5FYJE 4BQ8A 3MRIA 1LK2B 1AR1D 3KJ4B 1N59A 3QDJA 2NY1D 1NCCL 5DMIL 1U41A 1ZGLM 4R7DA 5EUKB 3MRBB 3TVMC 1NFIA 5KVGH 1M6OA 2ARJA 1A6WL 5AUMA 4HJ0D 1NKRA 4XNQA 4OCXL 2IAND 4RMRA 3PDGA 5EOTB 5JO5A 4Y4HA 1UKSA 1XFPA 2DLFH 4OF3A 4PJDE 4UQ2B 1T1YB 1HIMH 4AEFA 3TIDA 3WN5A 4NRXA 3EO1B 4N1HB 3WS6A 3GI9L 5A43C 4L3AA 4NZDA 3EOBB 1KLGB 1DQLL 3HI6H 2XN9E 3BEVA 5DJ2A 4ETQB 1WZ1L 1D6VL 4OSUL 2F53B 3V4UL 5CUSL 1OQOA 3QXWA 2ZCLH 2ZKHH 1MOEA 3V0AC 4HS6B 4LLAA 2FYYB 3E8UH 2H8PA 1CD0A 1MCPH 3SCMD 5IQ9B 3N1GC 4OZIF 1KENL 4Y88A 4LASL 5EBLB 1CG9A 1I9IL 1MFNA 1W0WA 2UZXB 3O41A 5C07E 5AEAA 5TGBB 5LGKA 5EH1A 3MNVB 2EEBA 3DXAB 3OKOA 4KVNL 1NANH 3PXJA 3MLSL 4MJ4A 4JFPA 1KYOJ 3GJFA 2A6IB 3MA9H 2HG5B 3O2DH 3Q48A 4KK9C 3U9PH 4GRWB 5D1ZB 4PGCB 3U4BH 5DQJA 5I8KL 4D0BA 5J11C 1CICD 5C08D 4EDWH 2CKBA 3MGTB 2AABL 1KCKA 3LN4B 5DJ8B 3OJVC 4NQSB 3UXFA 2YRLA 2H2SD 4JQXC 1YMHA 5CGMA 3RWIA 5KSBB 1XIWC 3KPOA 4U0QB 4XB7A 1X3DA 3MV9B 2QL1A 2ZP0T 3A67L 2VSCA 2X70B 3RDTA 4HUKB 5A3ID 1L9NA 5FCUL 4MD0B 3QJFA 1JGLH 4OZHB 2C1PB 1DQDH 2GW5A 5BOZG 4ZQKA 2Y5TA 1S78D 4YHPA 5KOMC 4X4MA 4ZUSB 1BAFL 4G9FA 5L8LB 4LDEB 3ZHDA 3TJHC 5BV7H 1YEGH 4PJ9A 3RA7L 2F54D 4PG9A 1IAKB 2RBLA 1I4FA 2BNUB 3MUZ1 4WNQA 3PQYE 3IVKA 5ICYB 3JWDL 3TBYB 4PB0L 1KJ2A 1J0ZA 4MNHA 3GSUB 1UZ8A 3OJDA 3VFOB 1RZ7L 1HHIB 4RIRB 1T2QH 3QRGL 2HWZH 4HS3B 1FIGL 2IG2H 3MACH 4YHML 4MJ6B 5ICZB 2NX5B 1X5KA 2FZ3B 3PWVB 2GSGA 4U4BA 3WL9B 4OZIE 3DX6B 2IBBA 2X7LA 1UM5L 1AKJA 2WWMC 3C08L 4ZG1A 2AKRB 4LLQB 1N6VA 2V9RA 3LV3B 2CLVB 3VI4F 3ISWA 2WIIA 1CBVH 3DUHA 4F7CB 4UAOC 4WU5B 1AR1C 3W5MA 4JLRA 2Z4QB 4J2XA 5M95B 3A6BH 1ZLVK 2APTA 4K2UH 1ZVSB 1KUMA 1HHKB 4NBXB 1JTOA 5J7CC 2NXZD 1P6AB 2XWTA 2BOBB 2VN7A 5F7NC 4URTB 5DYOA 2DYPB 4MXVF 3ZHKA 1RK0A 1HWGB 2R8SH 4IDJL 3QUZA 2GT9B 1AHWB 4NYLA 1J7VR 3SKUD 2VDKH 4GG6A 1ZA6B 1MY7A 4TULH 4Y5YA 2VDPL 2X1OA 4F3FB 2EDKA 2BERA 3MRHB 1RZ8B 5JUEL 3BUTA 3MLUH 5C09B 4OQTH 1QLEL 3BGFB 5ITFB 3QHFL 3QXVA 5F6IC 5J13C 5E9DB 4CVWA 4L3CA 3WUWB 4GBXD 1A6UH 2G2RB 1TDQA 3SCMC 1ERNA 2X4RB 4EVNA 2IALB 3L5HA 5KVDL 3V5HA 3GMLB 1JPTH 4UUJA 3QFDB 4LKCA 2ZJSL 5KSUA 4XCNB 4G6JL 4LRNL 3BRFA 3B9EA 2P8LB 1MSPA 3WDHA 1RUPH 5A16A 1TVBB 5H8DA 1CK0L 2XRAH 3QNYA 3FB8A 4NM4H 5HYQA 1N8ZB 4PV8B 1R3KA 1CICC 1HE7A 5D6DC 4EOWL 5C3TA 1IEAA 1U8HA 4G6FB 1JNHA 1HQ4A 1RI8A 1TLKA 4JR9H 2H2SC 3LZFL 1CFQA 1KCRH 1FAIL 1IZJA 2PXYB 4ZUWA 1YEKH 1EJ6A 5E94A 1F3JA 2NY7L 1J8HA 5A3IC 3VI4E 1OAUH 3CSPA 3LDBB 3U6RB 1WFTA 3IJYB 4OI8A 5DD6A 4AT6B 3V0VB 2YUXA 4HWEH 5IR1A 1HWHB 3IETA 4OLEA 5DQDH 1LWRA 3GSQA 4WRLA 5JORA 3CFDB 4JKMA 4UT6H 2KL6A 3C5JA 3DOSA 5KVEH 1IGYA 5HY9B 3HKFA 3T3MF 5E2UH 4IEFB 2A9NH 4MXVE 2JJTC 1AJ7H 2F5AH 4MZ2A 2HN7A 3JUZA 1AO7B 5D6CA 1N7ML 3O8XB 3T77B 5CIPB 1TTUA 4I18B 3VRIA 1Q9OA 1ACZA 1LO4H 3AU1A 1HI6B 1YNKH 2AJZA 3RHWF 4GOSA 4KI1A 2XXCB 2NY2D 4JFXA 3SKNA 1E28B 4U1HB 1C5CL 5BO1H 5F72S 2P5WB 5K9QI 2JELH 4D9QE 3T4AB 2W07A 4U1SA 1RUAH 2VZUA 4P9ML 1RZKH 4LSSH 1MF2L 1TZIB 43C9A 2WBKA 2C1OA 3T3PF 3QCUH 2PO6A 3EFFB 3VCLB 4P9HL 3NCMA 2W65B 1DN0A 4WI6A 4NN5C 1EMTH 1G7MA 1NMBL 1RMFH 5E8OB 1T6VN 2X40A 4PJ5D 2G9HA 4E41D 1CI5A 5DMYA 4K9EL 1IE5A 1GC1C 3I3BA 5DRZA 3ULUL 1PQZA 1VENA 4JHBA 2QADD 4HIHB 3EUUA 2AGJH 1BD2E 3SE4A 4FXGB 3G6DL 5ADOL 3O11A 1T2JA 3T2NL 4GMTH 4JANB 4LFHD 2ATPB 2WBWB 3PP4L 4HPYL 4Z6AT 4IMLB 2KPNA 5CJ8A 2ICES 1FH5H 2HTLD 1MRCH 4Z77A 4ZNEA 5E8DH 2BNQB 4HKXB 3BIAX 1A21A 4GBXC 2CJUL 3PGCA 4NO0A 4E9LA 1NDMB 3KPPA 4BZ1L 1S7TB 2ORBL 3T3ME 1YZZA 3G5ZB 5F8RC 4PJFA 4OIBA 4G5ZL 5IESL 5EG6C 4ZYKA 1NCBH 3IS0X 4XC1L 1M71B 4V1DA 4G80A 1J5OH 2I27N 4K7PX 1NCWH 4ZFOL 1MFDH 1EZVX 5GHWH 4ONOA 3OX8A 1YEJL 3WIFB 4OD1H 4AMKH 1K4CB 3BE1L 3LH2L 4R4BA 2JIXD 4JHAH 4XPGH 2I9TB 1NBZA 1JI1A 3RL2B 2AQ1A 2HAZA 5EN2B 1ORQA 1S7UA 5FUOH 4JY4A 4O5LL 4YDKL 2UZIH 3TA3D 4CMMB 2R23A 2ADJA 3DARA 1XF5A 5HBBA 3HR5B 4JJ5A 4N68A 4XBPA 3T3PE 1EHLL 3GHEH 3MGAA 2AJ3B 1N3NB 4MX7A 1DQJB 1OAQL 1VFBA 4HUWA 5A2IH 3WIHA 1FHGA 1WT5A 4WTZA 1GGBL 3QDAA 5DJXA 4PV9A 1U8JA 3RWGA 3THMH 2FR4B 2IAMB 2DLIA 4KI5D 1GZPB 2JK5B 5I15H 4M1DL 5D7LB 1I7ZB 3V7AG 3SQBA 3BKCL 5F96H 3NAAH 1CXFA 2PCPB 4NN6B 1RUML 2C26A 4ZSOB 5IB4B 4HFUL 3HG1A 1KJVB 4AH2B 4LVNC 1A6ZB 1MCDA 1AP2B 4X7TA 2NY2C 5FGSA 1ETZB 3GMMB 3OB0H 5DD0L 3VE0B 4PLOB 1IVLA 2W38A 3V0WL 3MBEC 4ELMA 4LPTA 4MJID 1DBBL 4XVSH 4R4FL 1AQDA 5FUCE 3NH7L 2NTFB 1IJ9A 3LN5A 2IADB 2Y07H 4PJGA 4QRPA 5DD3L 4WJ5B 3ZLQC 5KZCB 4PRNA 4K8RH 1HEZB 3MLTA 3H9SE 1I1AA 1VACA 3NFPA 3MSPA 2BVUA 4CNIA 5KBNC 2CO6B 3B2UD 4WI5A 5HHOD 1RULH 5T3XD 3P9WB 2JLLA 2NNAA 1T20A 3MMEB 5D72L 3L1OL 2ED8A 2QADC 1Q72L 3W81A 4ZAKB 3Q3GB 4LEXL 4QRRD 1IKFL 1NLDL 1N64L 1HYRC 3O3EA 5DJ0B 3DX8A 5INDA 4PJIB 2AJXH 3KPSB 2Q8AH 1G6RA 3X14A 2JB5L 5F7YC 4YX2H 5JLZB 1N6UA 1S8DB 4FQHB 3SE9L 4RISH 1VESA 2WUCH 1F4YL 2FIRT 2R4RH 5FYJU 1XEDA 3STLB 5HYJE 2C3VA 5SWZA 1KTDA 3BH8A 3SDXF 1PDKA 5C86A 3IDYB 2K7PA 4EN3D 4G8GB 1IAIL 5EU3A 4JPWH 1CFBA 1JTTA 4GKSA 3K8MA 4LLDA 4MLSA 5E8NA 2YA2A 2GQHA 3ESVF 3LB6D 3D2UB 3UROR 3MRPB 3NBNA 3X12B 1DQQB 3UTQB 1IGFH 3QIUC 1S5HB 1JWUB 4P59H 1JF1B 1TJGH 1Y18A 3BW9B 5IW6B 3O3DB 3WO4B 3G9VA 2EECA 3VWJB 1ZVYA 4S1SL 5ILTL 5B38G 1JZ7A 4G43A 1X7QB 4MA1C 2GSIA 3TA3C 2R1YA 4XP4L 1FFNA 3BZ4A 3B9DA 2Z92A 2YN5A 3RWDB 4P2RD 2W0FA 4HXBL 1T1WA 5IMKA 2DTML 5B8CB 1BFVL 4FABH 4NZUL 2BHYA 1CU4L 3VU2A 1KB5H 1RURH 4KI5C 4RGND 3IFOA 3KPRB 4OLXH 1C16B 3C8DA 6FABL 4MQ7B 2ZUUA 4L9LC 4JFEE 2DDQH 4IM8A 3VXUB 2VL5B 5TDPA 5C9KA 5JMRA 1G0XA 4LF3A 3CFKB 3GSWB 4FQCH 4POUB 3P3YA 3BGMA 5JXED 4O2CB 1OD7A 3CFJA 3BEWA 3LEVH 3UDWC 5LGJA 2ZPKH 3L3JA 1V7NH 2NTSP 1CL7I 4OGZA 4XH2B 5EZOH 1XGUA 1I7RB 3SDXE 4BQ9A 4NZRL 3T0AA 2V2XB 4UI2A 3VFTA 2WBJB 4YZFF 2YPKB 5FO9A 1VDGA 4JFHE 4PJBB 4P5KA 4C56B 3T2PA 3B2UC 3U2SB 5JW4N 3U48A 5C0AA 3GNML 1R24A 5I1LB 2GFBA 1A6TB 1ZTXL 1XF3A 4OM0L 1KBGL 2XACC 5IB2A 1BVLA 5EZIH 3UPAA 4OKVB 5JOEA 2G5BB 4DGIH 3HFML 4GAJH 3LHPL 3QWRA 5E2JA 1EEYA 1U95B 3KLHD 4LQFL 3IDIB 4K7PL 3P2TA 1J1PH 4X9GA 3BIKA 3RVUC 4JPIA 1MCBA 2X09A 3UX9B 5DR5L 3DX7B 3EO0B 3FB6A 4UT9L 4NJAH 3HCVA 3IS1X 1QPPA 4HUXA 5GQBA 2Z93A 1U36A 3OL2A 1LNUA 1IM9D 5DEGB 3B9VA 3UBXB 2MPAL 3I6GA 5H2BB 3VFGH 4M6OH 1B6DA 1TPXC 3SO3B 5BV7B 1A6PA 3QEGH 4BH8B 3GSNH 3ILPA 5IROC 2ICWB 3BQUD 5EBWA 3SJVE 4ACPA 4O9HH 3OZ9L 4EN3C 4NDMA 2DQCH 3MLPA 3ARGB 5F6HI 4R0LB 4WW2B 1ACYL 2Q86B 2BX5A 3GB7A 2OYPA 3IF1A 2JKXA 4TTGA 4YFDB 1JGDA 3U1SH 1BMGA 2Z91A 4BFBD 3GIVB 2Y6SD 4LIQL 3RWEB 5I66B 2FO4A 3F5WB 1TETL 4CN6A 1AC0A 1VCAA 4ORGB 5ISZB 2C5DC 1NC2A 2KUTA 4LLVB 1S9VA 1AXTH 3T0EE 1CGWA 4MAUL 5L7XH 1YEFH 4XZUB 4MVBD 1RIVH 4K7PY 4M61B 4YZFE 3V5DA 1EZVY 1K3IA 4MNGA 5EULV 4WHTA 3CUPB 4PR5B 3PXHA 1FZMA 2VWEC 2DLHA 5HGDB 1LGVA 3C8KA 4HJJH 4NZTH 4ZTPL 2FRGP 1BEYL 3E6FB 4Z5RA 3LKRA 4I3RH 5I74C 1A6AA 3TO4B 1U8KB 4UTAL 4IOSD 3QQ9C 5E6IA 4RGNC 4WV1A 5CLWA 5F7LB 1S7VA 2EDEA 3DBXA 4OCNC 4I5BB 1AGBB 4B7LA 5ANMB 3BD3A 1QR4A 2A6KB 4S0TD 2J8UA 2YS4A 1MAJA 1OTTC 5CEZL 3LAFA 5FUZH 1WTGT 1VA9A 2F53D 4XVJL 5HHXL 3OXRA 1RQ5A 5JXEC 1A7PL 2VDQL 4X5WA 2BY3A 4WUUB 1PG7L 1T04B 2PR4H 1DLFL 2J1KA 4JAMB 2ITDB 3TH4T 4L3EA 3JWOL 3IFPA 4DGYL 1X6LA 4CW1B 5FA4A 1IT9H 4OZGB 3CVHH 4JFQA 4DZ8B 4Y4KB 1RHHA 1F4XL 2VZ1A 4JFYA 3DXAD 2VZVA 4N9OB 3RY6C 4ODUA 4AZ8A 3O2VL 1F4WH 3CCHA 3QH3B 4D3CH 1ZXQA 3SGJA 1VEOA 3C2AH 2DBLH 4O51A 4F7PB 1WCBA 1NGXB 5GIRA 5JQHC 3MA7B 4YDJB 2HT2D 1KIPB 1OY3B 2A73A 1TQBB 3IKKA 4GG8A 3ZO0A 4L8BA 4MXWH 2P44B 2D4FA 4IRZL 1J88A 5CP7B 5I71B 1FNGA 1LK3L 2D4DA 3HZYA 1RZIB 1SY6H 4HT1L 2XYCA 1F2XK 2EYSA 4WDIA 2R4SH 2DQEL 3PWNB 4TUKH 3V4VL 1JRHH 4N0UB 1RJLB 3D39E 4NQXA 4CL7A 5TE6H 1YNTA 5DJAB 4PJHF 2V5MA 1CGYA 4I9WE 3PDDA 4AY0A 2ADFL 3QEQA 4LCCA 2A38A 1IAOA 3K46A 1DLHA 3LSOA 3T0XA 1ZLSH 3S3SA 4JO3H 2EC9U 1N59B 5IBUB 4H26A 3QDJB 3BQUC 2DQIH 4R7DB 3JXAA 4WEUD 3Q1SL 3RQ3A 1M6OB 2ARJB 1ZAGA 5AUMB 1WBYA 2I9LB 3I2CH 1FBIL 1TJHL 1QSEB 4XNQB 1UM6H 5EU6A 5JO5B 5BVJA 5E08H 1WK0A 4Y4HB 3HB3D 2N1KA 4RRPG 4FZ8L 1CE1H 1RUQL 4V2BA 2KQMA 3TIDB 1A02N 3WN5B 3VXMA 4LPWA 2X44D 4NRXB 1SYVA 5LXGH 2AQ2A 4WWKC 2XZAL 1HHHA 4XPBH 1JGVL 3BEVB 5DJ2B 4Q7DA 4HCRH 3UTSA 1HK6A 1MCHA 4YUEH 5C0BE 3BPOB 4G8FA 4AIOA 1U3HC 4LCIL 4MVBC 2H8PB 1TQCC 4XAWL 4QCIA 3ECBA 4XMPL 3BKMH 3CLEL 3ET9F 4NRZA 1U2HA 1A1MA 4P99A 5MEQA 1QUNA 1W0WB 3O41B 4OT1H 4X83A 3FOMA 3MLRL 4KTYA 5EB9A 3OKOB 2NQCA 3EHBC 2VXTH 1HINH 2DYPD 3TT1H 4JFPB 5C0CA 3ZDXF 3OAZH 2AEIT 2NYYD 5BJTA 3V8OA 1E0OB 5DQJB 3K1DA 4JZJA 1G7HA 4FQXA 2CKBB 3AY4A 1X5JA 3S36H 4KK6C 1YMME 4FXLA 4JCMA 2EDXA 5T3ZL 1EH9A 2VKWA 3EDKA 5ID1A 2AEQH 5IVXF 1YMHB 5LG1A 3RWIB 2R56H 4U1MA 2YPLD 3KPOB 4JN2A 3RDTB 1DFBL 4EJ1C 5E9DD 2X4SA 4PJHE 5C07A 3E3QC 4N0RA 3VRLF 3QJFB 4FTVA 2CGRL 3SDDA 2ATKA 5JPMA 2R69L 4ZQKB 2DKUA 3O0RL 2Y5TB 4Y19A 4YAQA 1B9ZA 5EIIA 4YHPB 3O45A 5TQ0H 3QAZB 1B4JH 2CUMA 4G9FB 1TVHA 3QCTL 5BQ7B 1I9JL 3QUYD 4PJ9B 4PG9B 4PJXA 5LJYH 3W39A 1YYLH 1T7YA 4ONGH 1I4FB 4JQIL 5TF1H 4O02L 4KTEH 4WNQB 2O5XL 5CEZD 3IVKB 2Q8BH 4I13B 4R3SA 1T03L 1RIHL 3F58L 4H5SA 1OAXL 1KJ2B 5D7SL 5CAYB 5BZWA 4MNHB 4S11A 4G6FD 1UZ8B 3OJDB 2HT2C 2R0ZH 4U1GB 4XP1L 4KMLB 4UNTA 4G7YL 3B5HA 2PXYD 3G6AA 2D7NA 2CPCA 1MQ8A 2AAVA 2D7MA 2AJYH 2GSGB 5IGXH 1JYWA 5D93C 4ZUVA 4NNPL 1U3JA 2QQNH 4D0DA 2X7LB 1AKJB 2OK0H 5CS7A 3RTQA 3EYFA 1BM3H 5MP6L 3CDFA 1FNAA 3MXWH 4UV4L 2WIIB 3M45A 1ULVA 1E4XH 3ARBA 3CZJA 3L3GA 2B4CC 2FH6A 3B2VH 5DFVD 4JLRB 2AXJA 3K7UA 2NY4B 1NGZA 3ZDXE 3QUMA 4YE4H 1AO7D 1PAMA 5JHDA 3O8XD 1IGCL 4UT7L 4KHTH 2XWTB 4U49A 5DYOB 4L5FL 2VR4A 4TSBH 2YK1H 1RK0B 1UWGL 3HB3C 4NYLB 4JRXE 5HHME 1ZHKA 1UH4A 1IGML 3HHRB 1T21A 1I8MA 4GG6B 1CGTA 5JW4R 4QXTA 4Y5YB 5IJKA 1P1ZA 2NLJA 2P5WD 5E8PA 4L8CA 3VRLE 5T5FL 4JM2A 3GI8H 1SVCP 3GO1H 4L3CB 4IIQC 5K33A 2XG5A 2RCSL 1NGQL 1HOCB 3U4EB 4EVNB 4NNYA 3V5HB 4UUJB 4LKCB 5KSUB 1TITA 3VXRA 1QR1A 3LKNA 2X42A 5JDSA 2D0FA 2K1MA 4NRYA 4Q6IA 3DIFB 4FQPA 2AJVL 4FMKA 5CSBA 1HKLH 1LEKA 5A16B 3WFHA 2XZQH 3Q6FA 4LFHG 4P2YA 5HYSG 4TQEH 3ZYJA 3OB0K 3ARVA 2BVYA 4EI6A 3QNYB 3FB8B 1EVTC 5MEPA 5HYQB 1AHWC 1GGUA 2D7PA 3WXWL 1CZ8L 1R3KB 5DEZA 1Q9KA 3NABH 3MROA 1FRGL 2GTZA 3UP1A 4MNQE 3H42L 1IEAB 1U8HB 3TT3L 1HQ4B 3PV7A 4XNXL 1J1XH 1X4ZA 3LCYA 5FHAH 2ARJQ 1MRDL 1HHJA 1W8OA 4X8XA 4NHCL 4ZUWB 5D1QC 2LVEA 5E94B 1F3JB 1J8HB 1KFAH 2ED7A 4AL8H 5E5MA 4U6XA 1PKOA 2VH5L 4KDTA 3ABZA 3WE6A 1S3KH 5DD6B 1F3DH 4I4WA 4HKBA 1TFHA 1JV5A 5IR1B 1G1CA 3UJIH 3IETB 3RJDA 3BP7A 3GSQB 1XGRA 5JORB 3MLXH 1R3JA 4TUOA 4PRBA 3QUYC 4NNXA 1IGYB 3TC9A 1QFUH 4F2MA 3CFBA 4K71B 1EO5A 1KEGL 5T3ZD 2HN7B 3TO2B 2DBJA 4UDTA 2VLME 3VRIB 1Q9OB 1OTSC 1QRNE 3STZA 5GS0D 2AJZB 1DL7H 4X6CF 4Q58C 4LCUA 5FYKH 4XPTH 4OGYL 3ALXA 3JWOC 4JFXB 4TPRH 3SKNB 2FB4H 4XVUD 1UCBH 2W9EH 3R4DA 1Z3GH 4U1SB 2YN3A 5HGBA 3MCLH 3CLFH 4W6YB 43C9B 2C1OB 5MENB 3TCXA 4Y8DC 3ZTNL 3IDUA 2IAMD 4LLWA 2PO6B 4PREA 5DO2D 5FGRA 4QXWA 1UQSA 2VXUH 5DFVC 5GS2H 1UFUA 2NR6D 4G42A 5D7LD 1DN0B 3FN9A 5FDYA 1T5WA 2G9HB 2WNGA 5DRZB 1PQZB 3QXAA 3QG6A 4TSAL 1Q1JH 5HVFB 3O2DL 1TVDA 3MA9L 3U9PL 3WHE0 2Y36L 3ARZA 3MV8A 3VFMB 5KN5A 1Q94A 2J88H 4JFZL 5J9PB 3O11B 1G9ML 3BI9X 3HUJA 4EDWL 1IC4L 1S9YA 4EQ3A 2R29L 2BVQA 1U8OA 2LVCA 2P8MA 3OV6A 5EZJA 4Z77B 3TYGL 1T5XA 4BFEA 2RB8A 3LRGA 4CU7A 5KZCD 3S35H 3I6KA 4NO0B 3PGCB 5IM7A 1HILA 2XXMB 3WNOA 1DQDL 3KPPB 3BYTA 5IT2H 1B2WL 3WNNA 1CIDA 3VXSE 4PJFB 2EDFA 1VFUA 4LHUD 4ZYKB 3OAUL 5CGTA 5BV7L 3MJ7A 5JOPD 1YEGL 3QO0B 2V5TA 3RBGA 4V1DB 4G80B 4G9DA 2QSVA 4X6CE 3V6OC 3BPLB 4DN4H 1MIEH 4P5TA 3OX8B 5FO7A 2YHGA 1MCOL 1QFWI 1OD9A 4R4BB 2AV7B 3CC5A 1MFCH 3T0VA 4JDZA 1NBZB 3KPSD 2HWZL 4XPAH 1ORQB 3EOTH 1S7UB 3MACL 4JY4B 1N0XH 3Q5YA 3FN0H 5T1KA 2PYFA 1Q9WA 1VHPA 2R23B 3EGSA 1XF5B 3LS5H 4JJ5B 4OZ4A 4XBPB 3WHXA 4QTHA 5L9DL 2ZSVA 4MX7B 4W70A 2VO5A 1VFBB 1EUUA 3GSNB 4HUWB 3QG7H 3LPFA 4G8GD 2GKIA 4UQ3A 2IEPA 5DJXB 4PV9B 3RWGB 3GSVB 4PRHA 5D2LA 2AW2A 1CBVL 2ZUYA 4MMXC 5CKAA 1NGPL 5I8EA 3D2UD 3QUMH 1INDH 2DLEA 3A6BL 4YHZH 3QUXC 5KW9H 3RL1A 5MERA 3ULVD 2CDEA 2CKNA 2V5YA 4FFYH 4XBEH 1LE5A 3U9UA 4FQ2H 3HG1B 5GS0C 4OGXL 4X7TB 4TNVF 2WSKA 2B2XL 5ERWA 2VDKL 4RFOL 2YZ1A 4TULL 1NGWA 4ELMB 2V5SA 4JN1H 4V2CB 2BVTA 3VDAA 1AQDB 3SKOA 1EO8H 2HRLA 1UC6A 4OQTL 3LN5B 4PJGB 4QRPB 5F7KC 4PJ7A 3MLTB 4AG4H 4O58L 5EOCL 5IQ7H 2IAMC 4MQSB 5DC9B 1I1AB 1VACB 1A7QH 3EFDH 3NFPB 3DUUA 1JPTL 4HKJA 3KPRD 3MLZH 3BN3B 4M48L 1QRKA 1UWEL 1ZEAL 2NNAB 4NN6C 2P7TA 1OAKH 1T20B 4XCCL 4MCZB 4WVRA 4W6WB 1KTKE 3VXUD 1W0VA 2XI9A 3MNWA 2DL2A 5DXWA 1A9BA 1FPTL 3O3EB 3ORJA 1BREA 5AYUH 3DX8B 4HWUA 5INDB 5E7FA 3EDEA 3GMRA 4JR9L 1G6RB 3X14B 2Y06H 1HHGA 4EUPA 1H5BC 2A9ML 1DEDA 2YA1A 1YEKL 3IDXH 3CVHB 4I0PB 2WBJD 4KC3B 3RVXD 4FFZH 3B43A 1MVUA 3GIZH 1KJMA 2C3VB 5DZNA 5SWZB 1KTDB 3BH8B 4C56D 4H8WH 5ACMA 5L8KB 1I9RL 1E4KC 5EU3B 3LN9A 3VH8A 3WJJC 4EI5A 4H88H 3GMOA 4AEHH 1MJ7H 4ZO8A 4JO4H 4LLDB 5E8NB 4Z0BH 4XHQA 1T7WA 2A9NL 4W81A 4ONFH 1AJ7L 4PGBA 4OCYH 3GMNA 3DVNA 1MCWM 1Y18B 1IBGH 3FFDB 1IC5H 4UV7H 4Y2DA 1Z9SA 3MUY1 3T09A 4L4TA 5I1AA 4G43B 1T7VA 1X5FA 2QLVB 4P57A 2GSIB 1Y0LA 2R1YB 1SBBA 2ADIA 1FFNB 3BZ4B 1GXEA 2Z92B 1H0DB 1T89A 1GGTA 2YA0A 2NW2A 2W0FB 1RUAL 4KMTH 5EBGA 1CCZA 1IC7L 2WQ8A 1T1WB 1H15A 3BZFA 4LSSL 4NO3B 4NPYA 3ZE2F 5IMKB 3RVWD 2IANE 3I9GH 1KPVA 4ZFFA 1TJIH 1P69B 1F8TH 4LSVH 3ARGD 3IFOB 3TWCL 1OM3H 5BXFA 3RI5F 1VFAA 3VFSA 1DTUA 3CGTA 5K9OA 4LLMA 1J18A 1CXKA 1AGEA 3ULVC 1E27A 4IRJA 2FEEL 2H32A 2AGJL 2JJSA 3RNQA 3ZE1F 5TDPB 5ISZD 1HH6A 5GS1C 4LF3B 1U8LA 1P5UA 2CKBL 3RGHA 3N1MC 1SMOA 4KTDH 1TXKA 3REWA 1MPAH 2DQDH 3CFJB 3S37X 2A6JA 2VAJA 3SY0A 1CDUA 5LGJB 3L3JB 2Y23A 5D70H 4LVHB 1XGUB 4N0CD 1WZMA 5BMFL 5E8DL 4M4PA 1PKQE 5B8CC 3VFTB 2AK1L 5FO9B 2Q76A 2Z8VC 1Z5LA 3TO4D 2WV3A 1J0YA 4P5KB 5C0RH 1MRFH 4XGZA 4ZTOH 2QEJA 5C0AB 1WISA 1R24B 4MQXC 2FWOA 2GFBB 3VA2C 4ZODA 1XF3B 1NCBL 5FB8A 1C08A 5I1DA 1J5OL 5IB2B 1BVLB 1NCWL 5GHWL 1KJ2L 5HHPA 1MJJA 4OD1L 1D6EA 4XWGH 4AMKL 4J4PA 2E7LC 1EEYB 1KGCD 4JHAL 4FFWD 5ESVA 2FD6H 4HH8A 5GJTH 2DIAA 2V17H 2ADGA 3BIKB 4JPIB 3JV6B 2IPTH 2J5LB 3FB6B 5FGCB 3HCVB 3ZE2E 2UZIL 2F54E 4Y4KD 4XC3L 1A7RL 3GKWH 1FVCA 2Z93B 4WEBL 2WBJC 3S88H 1LNUB 3NN8A 4NFBA 2EYTA 4KJPD 4X98A 3RVXC 3OAZK 3Q2CA 3I6GB 1OARH 5DLML 1KB9K 3HTLX 3ILPB 4Z8FL 3BYYA 2P49B 4DWHA 3N1FC 4TSCH 3THML 2BP3A 1UG9A 4NDMB 5DUML 4NKMA 2HP4A 5I15L 3GB7B 4KKAD 3IF1B 4RMUA 1JGDB 4HLZH 2Z91B 4XTRD 4GMSH 5F96L 3NAAL 3RUGF 1J0HA 4PRDA 4Y16A 1R3HA 1EEQA 2FO4B 3F6LA 4JVUA 5CD3A 1QFWM 2DKMA 5DK0A 1NC2B 5TE7H 1QACA 3WKML 3EDDA 1S9VB 4Z7UF 3T04D 2AJUH 2VE6A 4HBCH 4UB0H 5TPWH 1QKZL 4Z18A 3V5DB 4XVSL 4LCYA 5BV7C 3SO3C 4LK4A 3CU1A 3IGAA 4WHTB 2OI9B 3QDJD 1F4AA 3EYSL 2Q7NA 1MLBA 2L0DA 3C8KB 3RVWC 1MFBL 5A1AA 3VA6A 1LVEA 1OWRM 1CFSA 4Z5RB 3ALWA 3TBVA 4R2GB 2YEZA 3LKRB 1QSED 1A6AB 4R0LC 2YRPA 5E6IB 2BFVH 1ZA3A 4Y4HD 2EYRA 3TZVA 1T1XA 3WJLA 5GPRA 1S7VB 3DBXB 1RULL 3T1WA 2VC2L 1EXUA 2QKIA 4OF7A 3DI3B 1A14L 3UYRH 4RGMC 2J8UB 4NKDA 5JIHA 2X89A 3I50H 2D7TH 5AYQA 3MODL 1YPZF 3B8SA 3OXRB 5CJQH 5E4IA 4X5WB 3WDJA 2FGZA 2AJXL 4H1LG 4CVUA 3STBA 3WFEH 4L3EB 3IFPB 4EUPH 5AAMA 5FA4B 4YX2L 4XNMA 3I75A 4JFQB 4RISL 5IJVA 1RHHB 2DD8H 2EE3A 1LEGA 3QPXL 4JFYB 3MJ9A 5I1IH 1ZKAA 2ESVE 4ODUB 5F9WB 3TO4C 5H37G 1HNGA 3CCHB 2UWEF 4GRLA 4Z9KB 1OSPL 4O51B 1WCBB 3B3IA 5GIRB 3VMOA 3WUWG 5ALCH 3RUGE 4P0DA 3LRHA 1KIUA 1MCFA 4GG8B 2DJ4A 2PUQT 1NCCH 5DMIH 3HZYB 3RDTD 4Z7UE 5TH2A 1UB6A 2EYSB 4Y4FA 4P59L 4U1NA 1TJGL 4FFWC 1W72A 2F19H 4WI7A 1DBKL 4QEGA 3PP3H 5EIQA 4EIZC 4OCXH 4OFKA 4NQXB 4JKWA 5D5MF 3HNVH 1YNTB 4CN1A 4OGAD 1H8OA 3BSZL 3TGXA 3DYPA 4PLKC 3QEQB 4G9FD 4LCCB 2HMID 1IAOB 3QXDB 4KJPC 3LSOB 3GI9H 1JF6A 5DZLA 1DQLH 4H26B 1EDQA 3MRJA 1WZ1H 5B3NA 4OSUH 5CUSH 2BSRA 3NIGF 1WBYB 4B7IA 2FBJL 5EU6B 5BVJB 4LASH 2IJ0C 4KKAC 5B4MD 3WIIL 4P2OD 4YBLC 4X7SH 1YPZE 1OGAA 3OHXA 4XTRC 3VXMB 1I9IH 1QG3A 1OAYL 1SYVB 4PY8I 3DNKA 2H32H 2YUVA 1PLGH 3PWPA 5DRWA 1HHHB 1B3JA 4M7LL 3MLSH 1TCRA 4NP4L 1AKJD 3LQMA 5DK2A 2VQUA 1CD1A 3UTSB 4G7VL 4R26H 4G8FB 1TIUA 4QCIB 3ECBB 5BZDA 2ZPKL 3M8OH 4NRZB 3KYOA 3H0TA 4PJ5E 5DJCA 4E41E 1JPFA 3JVGA 1A1MB 2BRQA 5EZOL 4IBLT 1CD8A 4KI5F 4LKXA 2NY4D 2UWEE 5MEQB 3HE7C 3VGHA 3A67H 3WDIA 4XX1G 4WTXA 4DKFH 3FOMB 1EERB 1MJUH 1BECA 3BDYH 3AMKA 4LAJH 5KOVC 1HXYA 5C0CB 1T4KA 5BJTB 2J6EL 1N5AA 5FM5M 3RVTD 4JZJB 1G7HB 2EICA 4FQXB 1NLBL 5EOCJ 1RJCA 1X4XA 2SEBA 3VG9B 1ZMYA 5D5ME 4U1MB 4DGIL 4JN2B 4LGPB 1RZKC 3K8KA 3BPOC 4GKNA 2X4SB 4N5UA 3JWDH 2X4QA 4PB0H 3C6LC 4K8RD 5KSAA 4FTVB 3SDDB 2ATKB 4HGMA 1OW0C 1I3GH 5JPMB 3M07A 4Y19B 4YAQB 1YA5A 5EIIB 3TJEL 4YHMH 2Q1EA 3O45B 2VUOA 1QHPA 5HI4D 4WHYH 1TVHB 4M6OL 4PJXB 3W39B 3QEGL 1LP9A 1ZT7A 3BJLA 4YDIH 1WWWX 3WIHL 2FHBA 3LQAH 4NBZB 4R3SB 1KTLA 4H5SB 4LCWA 3OR6A 4LNVA 5BZWB 1EFQA 4UIMA 2IH3A 3L3IA 5AD0B 4JJHA 5F9AC 4AENA 3U1SL 2HKHH 3HS0A 3QIBA 5DSCA 1OVZA 5DVLA 1J8HD 2DWDA 2JJWA 4P3WA 4D0DB 2DI9A 4KI5E 3NPZB 4XT1C 4D9LH 1BLNA 2F5BH 3Q6GH 1YEFL 4YR6A 3SGKA 3RTQB 2X4TA 3H3BC 5IEHA 3VW3H 1UB5A 1S7XA 3KS0H 2VXQL 3ARBB 1V3JA 3L3GB 5JUEH 4F7MA 1NGZB 3QUMB 4L8SA 5JHDB 3QHFH 3ZDYF 5LQBH 1T66D 3L9RA 1BP3B 3UPCA 2C3WA 3FT3A 2AP2A 1IEBA 3CDGB 2OMBA 1KCVL 1PY4A 1NMAH 4JRYA 4O2EA 4U1GC 5KVDH 4JDTH 1F11A 1YY8A 2P45B 2YD8A 4RX4A 2ZJSH 5B4MC 3ME0A 4G6JH 4MJIE 1ZHKB 4LRNH 4P2OC 1T21B 1I8MB 4ODXA 4TYUA 4RNRA 4DVRL 1CDBA 1P1ZB 2NLJB 2FGWH 5E8PB 3KPLA 4L8CB 1INQA 4JM2B 1R3LA 1CK0H 2IFFH 4XXCA 5FUZL 4OAWA 2NY5L 1EFXA 5MEND 3AS1A 3HMXA 1MHPH 5F21B 1G6RL 3RZCA 1U8PA 2PO6D 3IU4H 4LL9A 3DGCR 5HHOE 5T3XE 4NNYB 3DURA 1IT9L 3VXRB 35C8L 1QR1B 2NY4C 1NUDA 5IEKA 3B9KA 5F71A 1FAIH 5IVXA 4D8PA 5JDSB 4Q6IB 4NRYB 2VLKA 3MJ9H 4O4YH 5JHLL 4UU9A 4QRRE 3HC3L 5TQ2H 1LEKB 4A6YA 3BISA 3WFHB 2VLLA 3Q6FB 2E9JA 1F4WL 5DHVH 4EI6B 3X13A 4DOHB 1C7SA 5MEPB 3F7YA 1DJSA 2IQ9L 2R2EA 4R96A 1Q9KB 3MROB 2GTZB 4HK0A 2X1PA 2BHUA 4LVEA 3CSGA 5ADPH 1FO0A 5BRZA 3O6KL 2DJSA 5IOPA 3RAJL 4GKZA 1HHJB 3TV3H 4U6YA 3C5ZA 4MJ5A 3ULUE 1W72H 4NO0D 1YY9C 1CXHA 4LHUG 1JRHL 4K8RC 8FABA 5E5MB 4U6XB 3HMWH 3WE6B 1T1ZA 4I4WB 4U3CA 1I1FA 4TVPH 4HKBB 1JV5B 3CH8A 2H1PH 5HI4C 3ZDYE 1XGRB 1MQKL 4TUOB 1R3JB 5E03A 4PRBB 1ZLSL 4NNXB 4JO3L 5T1DL 2YKLL 4F2MB 3KNBB 3CFBB 1WZKA 2R2BA 2DQIL 5J89A 3ILQD 3BWAA 4UDTB 2BK8A 1YEIH 1R5WA 2YWYA 3I2CL 2GAZA 3STZB 1UM6L 4LCUB 5I19H 4R9HA 4KAQH 2ZG2A 3V79C 3NA4A 4P9HH 5C6PB 4QYOA 3H3KA 4P2RE 1J11A 3OB8A 3HI5L 4FFVD 3JWNC 1P2CA 3D6GA 2VWEE 4K9EH 1OLZA 4XPBL 3ULUH 1CGSL 4FNLL 1PVHA 1KLFA 5HGBB 2FIKA 5IVZA 2OM5A 4B41A 3G6DH 5ADOH 4HUUA 2QSTA 2VLJA 2ZUQC 4RGNE 2CO7B 4S10A 3T2NH 4YBQD 4LLWB 5DMKA 1U2CA 3PP4H 4HPYH 4PREB 3F7PC 2Z9TA 1IKNC 1UQSB 2E27H 1FFPA 2YD9A 4QY8A 1OL0A 4N90D 4G42B 3MFGB 3QNXA 3QSKB 2IMNA 1NC4A 1R5IA 5EZLA 1T66C 4B5EA 1PZ5A 3CMOH 5IKCA 3QXAB 4YHYC 3QG6B 3HG1D 1HINL 5CJ5A 4LHQB 4JDVA 1TNNA 3K3QA 5KS9A 4I48B 3MV8B 2ORBH 5KN5B 1Q94B 1FNEA 5GSVA 3HUJB 1CT8A 1S9YB 5IESH 3N1QC 1WIUA 4HGKC 5HHNA 3U7AA 5AG9A 1SEBA 2BVQB 3DVFA 5SV4A 3B5TA 1U8OB 5D2NA 2AEQL 2P8MB 1FG2A 4JFDA 5EZJB 4QRPD 1T5XB 3MPCA 5L88L 2FBOJ 3CFIC 3BE1H 3LH2H 3I6KB 5IM7B 3VD7A 1RFDH 1HILB 4KWUA 4PTTA 4OFYA 4HHAA 4TNVK 1JF5A 3ARQA 1B4JL 3TN0C 1FL3A 1FL5A 4PTUA 3MJ7B 4PP2A 1EHLH 5L0QB 1AFVH 2XZCH 2DWEA 1CDIA 4G9DB 1A1OA 4P5TB 5FO7B 3EW3B 1GAFH 3VXNA 1BFOA 5J3HD 3WNPA 1GGBH 3CC5B 4JDZB 3U0PA 2ZCHL 3T0ED 4X4YA 1NEUA 2A2QT 4PP1C 4KU1A 5T1KB 3VD3A 1BPVA 2PYFB 2PW2A 1Q9WB 2UV3A 4I0PD 1BOYA 3BKCH 3EGSB 1ZT1B 4CU6A 2AJYL 3AB0B 4OZ4B 4FQIL 3WHXB 1CF8L 2A6DA 4RFEA 2K9UA 5IGXL 4MB5A 4ODBD 4QTHB 3VWKA 2QQNL 1GCFA 2ZSVB 2FSEA 1RK1A 1UT9A 4YNYA 2OK0L 1U0QA 3ZT7A 5FOBA 4YWGH 2EDDA 4UQ3B 4GRWF 5D2LB 4PRHB 2VL4A 3QQ4A 1LO0L 4K3EH 4KKBD 4R4FH 5I8EB 4Y1AA 1KG0A 3BPLC 3HN3A 3K74B 3NH7H 1F90H 3ILQC 1EGJA 3K0WA 2QQQA 1Z0NA 5AWNL 3RL1B 1XR9A 5MERB 5KSBF 2CDEB 5C1MB 5GZOD 1LE5B 1Q0XL 3U9UB 3UBXG 2A0LC 1RU9H 4U1LA 3QJHA 4DTGH 3RU8L 3TVMA 4HKZA 2YK1L 1FSKB 4XWOC 1NEZA 2MFNA 3O4OC 5GISL 3GUTA 4QHLA 5ERWB 2VDRH 3UTTA 4FFVC 1NGWB 2FJHA 5D72H 3L1OH 3UC0H 4HC1A 4MSWA 3SKOB 2QQLL 3ARUA 2I25N 1NQBA 5SWSA 1IKFH 1NLDH 1FVEA 2OMNA 3GO1L 4PJ7B 3MRLA 1I3UA 12E8H 3P4MA 4M6MH 4HSQA 4QWWD 4HKJB 2JB5H 3NA9H 3QB7C 4Q9QL 3SE9H 2P7TB 2COQA 2GJ6A 1F4YH 1HKLL 2A74A 1CFNA 1C5DA 4HBQA 2F53E 1AR2A 1WWCA 3L5WA 1XMWA 4ZD3H 4KJYA 4JY6A 4P23A 3E3QE 3CDYA 1L6ZA 3MNWB 4N5ED 1A9BB 1S7SA 4XHJD 3OKKA 1OWWA 2DQJL 4P4RA 3NABL 1IAIH 1FO0H 3TBSA 5IHUL 4MB3A 3OPZH 1ONQA 3GMRB 2B39A 5FHAL 1HHGB 3DXAE 4EUPB 4ALAH 3W11D 3RI5K 2PYEA 1AXSA 3QCVL 1M7DA 5EUOB 4GRWE 4JQXA 3QHTC 1MCNA 3LKSA 1MVUB 5KTEL 4PD4J 1S3KL 1XAUA 1EPFA 1EHXA 4JFFA 3CD4A 1IQDA 4FQLL 4X6BA 2Z31B 3BIBX 5E5UB 5ILTH 3VH8B 4EI5B 1NMCB 5FV2A 3GMOB 1FAKT 4XP4H 5KSBE 3MLXL 2F8XC 1RVFH 3MV9E 4QOKA 2MSPA 4IS6A 1UKTA 3ARED 4HXBH 3GBNL 4PGBB 2DTMH 4OZHE 1J8KA 4PJCA 3GMNB 3QWRD 3DVNB 5E24E 1BFVH 4YEEA 5HI3D 1CU4H 3FRPA 4X6EA 4Y2DB 1YEDA 3PL6B 2NMSA 3T0EC 5C0BD 5FYKL 3O3AA 3QWQB 4XPTL 4TPRL 5I1AB 4L4TB 32C2A 2JB6B 2FB4L 1MIMH 4P57B 1Y0LB 1UCBL 2ADIB 4I0PC 3FQWA 4QGTA 4TOYL 1MJ8L 3EYQD 3INUL 1WITA 3QI9A 3SE3A 3S8WA 3EOYG 2NW2B 4HH9A 3MCLL 3SDYH 1P4BH 3BZFB 1HKFA 4NPYB 5I9QB 3CLFL 3IKCA 1KPVB 3T1FA 4ZFFB 3LOWA 2VXUL 4KKBC 3NZHL 2NX5E 5BXFB 2D0GA 5D7IA 1VFAB 3VFSB 3EAKA 5K9OB 4LLMB 4NZRH 3PP3K 1AGEB 1E27B 4IRJB 5J6GA 2YRZA 4X6DA 2H32B 5ACZA 1WUNT 2BNRA 1YC7A 1HH6B 1NC2D 4PJEA 4JREB 1U8LB 4X5LA 5IBUG 1G7LA 3GNMH 3REWB 1FCGA 1UWXH 4OLUL 3F7RA 3SHSA 2A6JB 3SY0B 3NCCB 2QHLA 3C09C 4OM0H 1KBGH 3FAXA 4ZPVA 5J12B 4LIQE 9CGTA 3HFMH 3SKMA 2Q76B 3ZTJH 1I1YA 3DMMC 5GGSA 1Z5LB 4NWTL 2XG4A 4LQFH 4K7PH 5DUBA 5E6ID 4XGZB 1RZJL 2ZZUT 4YHNA 3BVNA 5A2LH 3QIWA 3OWEA 4LVOB 5HVGB 2FWOB 5C09E 1FZKA 4ODVH 1VPOH 5FB8B 3FONA 5E9DE 2FHCA 5LKNA 4N5EC 4L4VA 5HHPB 2AI0H 1MJJB 4XHJC 1D6EB 5FF6A 4S2SA 2XY1A 1MFCL 5ESVB 4F15B 3DECA 2R1WA 2ADGB 4XPAL 3EOTL 3EYUL 3PWUA 1CICA 5C08A 4WFHD 4LVHC 5D6DA 1N0XL 3FN0L 1J1OH 3PDOA 5F1OB 1FVCB 4Z7VF 3NN8B 3HRZA 2EYTB 4X98B 5CEZE 4LIQH 5C2UB 4M62H 3HC0A 3QG7L 1CDHA 3D5OF 4MAUH 5JNYA 2B8OT 5HHMD 4LQ1A 3MC0A 2LE9A 4NKMB 2DQUH 3QUML 4YFLF 1EGJH 5C0GA 3AREC 4WW1A 4YHZL 1VGEH 4ZTPH 4YXKH 4PRDB 2EIEA 1T3FA 4FFYL 4DJMA 5HI3C 4Y16B 1R3HB 5IHBA 4FQ2L 2JJTA 5GGTA 4LSQL 1AGCA 4NCDA 4RFNB 5CD3B 4G8IA 5GZND 5DK0B 3QDMA 4UTAH 4OCRH 4FG6C 2J5LC 2VE6B 2V9TA 1KJ3L 3QEQD