4MD0B

Immune receptor
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
189
structure length
189
Chain Sequence
DTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title A molecular basis for the association of the HLA-DRB1 locus, citrullination, and rheumatoid arthritis.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4md0B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4md0B01
4P2RB 5DJ6B 3F7RA 2GJ6B 2EDEA 2AV7A 4JZNB 3UYOD 2WANA 5KSVB 3BKYH 3LKQB 3WUWB 1MEXL 2LV4A 4LHUD 5C6TH 3HCVB 4C56E 4GKZA 5DO2C 3SDCD 1MJUH 1T0MA 3CFEB 4GMTL 5F7DA 5BQ7B 1HZHH 2Y07H 5EU4A 3ABZA 5I75B 1NFIA 4RGOH 1EFXD 2DQEH 4V2CB 1MCDA 1N59B 5E8NA 3MRMA 1AQDA 4U1MA 1MRCH 4ZTOL 2QTEA 2VABB 5TDPA 2VO5A 4YC2C 3AS0A 3EO1B 5C6TL 3L3DB 3D39A 3QPXL 3ZDZE 1AGBB 3BQUC 2WP3O 2VE6B 4FQ2H 3CFIC 3PDOB 3EO9H 3IFLH 1HZHL 4WUUD 1NUFA 4ONHB 4MQXC 1T89C 3MOBH 3RZCC 4RGOL 4EBQH 12E8L 3FRUA 3T0DA 4Y4FB 5D4QA 3NIFE 3V6BR 4RZCB 5DJYA 1IM9B 4YHOH 4PFEA 1TJIH 5IW1A 4NT6B 1HNFA 3EO9L 3IFLL 1C1EL 3D1MC 3MOQA 5SWZA 3MOBL 5DJZB 5EBWB 4HJ0C 4EBQL 5GS0H 1TFHA 4OTXH 1U3HD 5IMOA 5DRXB 3DOSA 3BKML 5C0CD 3LRGA 1PLGH 4ZFOB 4UOW0 3EYOA 4YDLB 5K9KA 1VEOA 1TJIL 1PFCA 4LL9A 2OZ4A 4ELMA 2NY0B 3JV4B 2IFGA 5E8DL 4IRJD 2D7OA 2P5WA 1HCVA 4PRBA 4XP1L 4PGEA 3QIBB 1KLUA 5EUOB 2XRAL 4HGWA 4K94L 4JM4H 3FAWA 2CPCA 4AG4L 3O4LE 4HUXB 3S35H 4QHUA 2X42A 3NA9H 1YN6A 4OD2A 2J4WL 3ILPA 2D0HA 2Y5TB 4MD5A 1AE6L 2B0SH 5F9AC 3CLEH 4APQC 1CTOA 1ZT7A 4JM4L 4YQXH 3C08L 3QXAA 3T0XA 1A6AB 1XGQB 2UVEA 3S37X 1OD7A 3PGDA 3QO0A 1I8LA 1QLFB 4JFHE 5D1QC 4X7TA 1H0DB 3CLEL 4F57H 4YQXL 3MJ9L 5I9QC 1AHWB 5CLWA 5D9SB 4DZ8A 3UTZB 4ODTH 4HW6A 3O3EA 1HINL 5IR1A 1N8ZA 2DIAA 1UT9A 3FOLB 4X4ME 2EKJA 4L4VD 3MNWB 4YZFF 1BQHA 3F6LA 1RIVL 4XPAL 1GGCH 4DN3H 4F57L 4LRNH 5D7KE 1NUGA 2ORBH 4BFIB 5DVOA 4X6CE 5MEND 3QG6A 4IMLB 2JJTC 4HKZB 4XCFH 3ARGC 1DEDA 3M1BB 2VXUH 3VJ6B 2VXVH 1I3GH 1U8HA 4PRNA 2A83B 1OTSC 5D6CA 4X6DB 2MJWA 1GIGL 1JGEA 3K0WA 4S1SH 2FATH 1IEAB 2ORBL 3QDGA 4MB3A 4YH6A 1A9EA 4P2OA 1MFDH 4POZC 4XCFL 4I5BA 2BY3A 2VXUL 1EMTL 1PEZA 2VXVL 3W81A 1XH3B 5IB5B 5ICZB 3U82B 1QHPA 4PJ9A 2NLJA 3SDAD 5DJ2A 3BDBA 3CFKA 2Q6WA 4S1SL 5E08L 1JGDB 4UDUA 3LV3B 5GJTH 3F7VA 3WHE0 3HR5A 1DE4B 2AABH 2QKIB 4NZJA 3U0PB 3U9PL 3EIFA 1UCBH 1CXEA 1BBDL 3FOMA 1U2CA 4WDIB 4HIIA 2P8MB 1G9NC 1K8DA 4HWBA 3P0VH 5IM7B 4GG8A 3AMKA 1S9VA 1NGWB 4AIXA 2J8HA 5H37H 5IMKA 2AABL 3EYVA 4P3DB 4PRPE 3ES6B 4N8VB 4IOSD 5FECB 5T1LD 4JFEE 4UUJB 1S5HB 3RA7H 4R96A 4OZFA 1H3WM 5EOTA 3P0VL 5HHNB 4K3JH 5LAXA 2P8LB 5HVHB 1WC7B 3BP4B 2UZYB 4L29B 2OQJA 2NW3A 2X70B 2FIKA 4M9OA 3H9SE 3RA7L 2IG2H 5I2IB 2A38A 3P9MB 4HLJA 3THMH 5JA9A 3ROOA 5JPNA 1S7VB 4EI5A 3TPKA 3E6HB 4K3JL 3SJVD 1KACB 4JRYE 5SX4H 1AR1C 2AXJA 3BSZH 1QFUL 1G0XA 3RIAK 1Y6KR 4UQ2A 1DN0B 4Z7VF 2YD3A 4G3YL 1W8OA 1P4LB 4HS6A 5L8KB 3F12B 4JO3L 4ZPTA 1XIWA 4Z18A 5GGSB 5CKGA 3OR7A 1K4DB 3VD4A 3I2CL 3B9KD 1RI8A 3BSZL 3N1FC 4LSRH 4XCEB 3U7WL 4GAJH 3SE8L 4QNPF 2ATKB 4F7MB 3SO3C 5D2NC 5C2UB 4MYWB 3O4LA 3QAZB 3DTXA 5B8CB 2HRLA 2DJUA 3HS0A 4ODXB 1XCQA 1TITA 5TQ2H 4U6HA 5TDOB 2V5TA 4AYFA 2J8UE 4JKLA 4GAJL 5EO9B 3CVHA 4LF3B 3AREB 4KVNH 1NEZG 4X9HA 3FT4A 2W65A 4C58B 2FDBP 4ZXBC 4RIRB 4L8DA 3KPNB 3DI3B 3CFJA 4KJYA 3TO4D 5CD5D 5ITBL 4G6JH 3LKSB 3TBYA 5TQ2L 2YD6A 4MB5A 3X14A 2BSSB 2IAMC 2BOCA 4PB0H 2IC2A 4DTGH 2ERJC 5JHDE 3H9HB 4OKVA 1X5HA 4NRYA 4NN7B 3B9AA 1BJ1J 3H0TB 1KB5B 5E9DD 1BWMA 1HOCB 5C0GA 4KDVA 4P4RB 2B1AH 3QDHA 2QHRL 2BSRB 4X4MA 5J12B 3ULVD 3NIDF 4RA3A 5FYJE 5DFWH 4YNYB 3VA2C 2AKRA 3DIFB 4LFHG 3UPCA 3TEUA 4X6CA 4UU9B 3HMWH 3QI9A 2GT9B 3DUUA 4GLRH 5T3XE 3IDMA 3CGTA 4QTIH 3VI3F 3L5IA 4TUKL 3LIZL 1ZGLA 3PGFH 1T5WA 4EJ1C 3GSQB 5INCB 2MOVA 4XP9H 3E2HC 2A73B 5IT2H 3C9NA 3OGCA 3HMWL 4IIQB 4XWGL 4JB9H 4P46A 3I50H 2HWZH 4D9LH 5F21B 3DX8A 1EXUB 4LLWA 3FFDA 4OF8A 4NQDD 3GSNH 3I75B 1ED3B 1ROWA 1I8KA 4UI2A 3DV6A 3DSFH 3DJ9A 1J1PL 2OL3A 3QUMA 1V8HA 5D1XC 4BELD 1M6OB 2HWZL 4D9LL 1P4IL 1CXLA 1X44A 4H8WH 2VXQH 4R4BA 2HJKB 3DXAE 4U1SB 4HKBB 4DAGH 2PO6D 3O6ML 4AMKL 3BP5B 2V7NB 3BP6A 1P9MA 1YUHA 5D7JA 4H1LG 2PW2A 4HBCH 1CBVH 3GGWA 4DOHB 1T0PB 1UJ3C 4GQ9H 4NN6B 3E8UH 4QWWD 3HE6B 4CN4A 4N5UA 2AJ3A 3MBEB 2XY2A 4CDGC 4TUOB 3SKUD 4YDVA 4H8WL 4PRPA 2V2XB 2VXQL 5C86A 4P5KB 5E8OA 2X41A 4M1DL 1BOGB 1F3RB 5C3TA 5J11B 1W0VB 2OBGA 4R0LA 4JFEA 3S35X 4HBCL 4GQ9L 4NUGL 5FM8A 3V4VL 3NBNA 3WNPA 5I66B 4G8GA 3H7BA 1P7KA 5AAWA 4CMMA 5FF6A 4MAYC 2D3VA 3D3VE 3QB7C 5T3ZD 1MAMH 1NCAH 5IBUB 3MRIB 1DANU 1MVFA 2OI9B 3H9SA 5EZJA 3KDMA 1E28A 4J3VA 3RDTC 3UTSB 2VERN 1INEH 3WFDH 3HZMB 4U33A 4JRYA 5HHOB 5JHLH 1EBAA 1A6VH 4E41E 1NCAL 2JJWA 4QHLA 3C6LA 3P11H 5JW4Q 3MRDA 3CXHK 3SDXB 5T33H 4LPVA 3WO3B 4PJDB 4F3FA 4LVOC 3WN5C 1NMAL 3PJSB 4F33B 2EYTB 3KPQB 1INEL 2Y9RT 3WFDL 4WI5A 3GSXA 4TVPD 2WSKA 3KWWA 3ARVA 3P11L 2VZUA 3QCUL 1J0ZA 3CDGB 5T33L 4OFYA 2F5AL 1D5BB 2BHUA 4I4WA 1XGUA 3WIHH 2Q3ZA 3UTTE 4PJ5D 1G1YA 5AAMA 2J8UA 4XVUC 2ADJA 3C5SB 4U1JA 3VWJC 1U95A 4XNYH 3QUXB 4FQHB 4QRPD 3MACH 3MRBA 4YO0A 3V7AG 43CAB 2V2TA 1S9XA 5BXFB 3WIHL 1BD2D 3VXRD 2EZ0D 2P48B 3HE7B 1AO7D 3DLQR 3UTOA 1VDGA 2V2WB 4XNYL 4Y1AB 5JHDA 3KS0H 3TBVA 3BD5A 2EICA 4FMFA 4OV6F 4RGNE 4XMKH 2OTUB 2OXHA 1KELH 2NY1C 4FXGB 3T0VA 3BEWA 2CH8A 5KZCB 3IVKB 2X4UB 3OX8A 4ZUVA 2K9UA 4GRLB 3I3EA 2Z31D 2RHEA 4I0PB 2JCCB 1HK6A 2Q7YB 1G9ML 2EH8L 4KVCH 2E7LC 3OKDB 4G9FB 1ZLWH 2Z8SA 4N9OB 2Z0BA 5CBAA 2E9WA 5DR5L 3DVNB 1A7PL 2OR7A 1CXKA 3IU3A 1GZQA 3MXWH 3KYMA 3RUGE 1P84J 5EUOF 1DQDL 4RQQB 2MHAA 4GRWE 4LCYB 1A64A 2VLRE 4JRXE 1HI6B 2D4DA 3O0RH 1FAKT 5C0NC 5JW3L 2WIIA 3SDDC 4RGMC 1IEBA 5F3HB 3MV01 4P9HH 1F8TH 2BNRE 3O41B 4PJIB 4HWEH 1WT5C 4Z76B 3D85A 5FA3A 1MREL 3LN4A 3PWJA 4Y4HD 3T0ED 2BK8A 1YYLH 2AK4B 3O0RL 1BM3H 1DUYA 2I25N 1ZANH 2I60L 4K07A 1T89A 4P9HL 1F8TL 4WFED 1C12A 2WUBL 2IQAA 1ZA6B 2B7DT 4OIIH 5HGAB 5HHMB 2EC9U 1YYLL 1BM3L 5DEFB 1ZANL 3UZQA 3LSOA 2ITDA 4HLZG 2Z8RA 2EIBA 3OKKB 3VXOA 5I1AB 3QSKB 1JZ3A 1JNHA 2R4SL 4OIIL 3RVXD 3O3UN 1U91A 3QFJE 4FN0A 2EIEA 1ZKAA 2CLVA 2GTZA 1JYXA 5C71A 5E24E 3D3VA 3G5VA 2BCKB 3QRFM 3DRTB 5A2KH 4X6DF 5LBSH 4LEOB 1BAFL 3U2SA 5BV7C 3VXSB 1OSZB 1UZ6E 4JFXA 5MEPA 1U3HC 3TIDA 3WSQL 4DKDC 3VFPA 4E41A 1T1XA 5DRNB 1F4WL 3L3HB 4PG2C 3OF6A 1O5DT 2EDLA 1QG3A 3MMEB 1A6TB 4XWOD 4OCSH 5LBSL 3WLWD 5E5RB 4WTXA 1IC4H 2VLKD 3IXAA 4YHNA 4HFUH 1WCQA 1B3JA 1R3IH 1IT9H 3FO0L 4PRID 4RCAA 1A7NL 3MNZB 2GK0B 4JFDE 2XWTB 1QSVA 2R69H 3WCYA 2ITCB 5DJXB 4UTAH 5D1QA 5A2LH 4OCSL 1U58A 4WW1B 3QUZD 5DJCB 2P7TB 4I48B 4MCYA 4Y2DD 4XVJH 3UTTA 4UIMA 4HFUL 1TZIB 4PREA 1R3IL 3CFCH 1IT9L 3AAZA 1FO0H 1CGYA 2PYEE 2W60B 4HZAA 5KVEH 3ARBB 3B8SA 2R69L 3X3FL 3QJHA 4PV9B 3P0YH 3VFNA 5I8EA 4DUWA 5C0IA 4QF1A 2JTDA 2O26U 5FO8A 4Q0XH 4K23H 3D69B 4CU7A 3QFDA 3ARGA 2ADIA 4HZLA 1JE6A 4CVZB 5C0AE 1CYGA 2C3VA 4BQ6A 2CO6B 3CXHJ 1S7TB 1SVZA 1S7WB 5K9OA 2VLLB 1BZ7A 1NL0H 1FJ1A 1L7TH 3MV8E 4Q0XL 2VH5H 4JY6A 4NFBA 2CR6A 4K23L 4Q97A 1DDHB 5HPOA 5DJAA 5HGBA 3VE0A 1CFQA 1E4WH 5CJOH 1ZLVH 4GAGH 5D5MB 1OGAD 1NGZA 4WI2A 1RD6A 2QQLL 1HHIB 1NL0L 1ACYL 1M71A 5IFAH 1W2KT 5C7XH 4E42A 5EBMB 1KTLA 1E4WL 1U41A 3ARQA 1KCVH 3MRQA 3RUGA 2YEZA 4GAGL 2PCPA 4NBXB 5FCSH 5KW9L 1A3QA 4KRLB 4XP4H 1WFUA 2VLRA 4JRXA 3WDJA 2VQTA 2HFFA 4Z7WB 5HYQA 5FXCH 3RZWA 4ZG1A 4JE4B 5IFAL 3SDAC 4YHPA 32C2A 3JTSA 1N7MH 2OMBA 1OT1A 3I6LD 2BNRA 3SE4C 3NCBB 4QHNB 3D2UA 1U93B 3GNMH 1FNEB 4U1KB 4MSWA 3S36L 5KSAA 5KS9B 2XKNA 4GKSA 3TN0A 2NZ9D 4NQVA 3RWDB 5EIQA 4R8WH 3NAAL 2EDKA 4XP4L 3OAZH 3RTQD 1Q9LA 3GDBA 1T5XA 2VKWA 4UINL 5I76A 1OAYH 1ORSA 3VFOA 1DEEA 2P47B 4LCWB 1N7ML 4NNXB 3C8KA 3GNML 3U7YH 4QOKD 2EE2A 2EE9A 5DJDB 1JGUH 1QFPA 1B6DA 5DEGA 3VMOA 4DEPB 5I16B 4OGAC 5DEZA 4S10A 2ED9A 3FQUA 4LKXB 3U7YL 4DQOL 4DJMA 1R24A 4OQ1A 3TA3B 1XZ0A 1XF2B 3QFJA 1QRND 4XBPB 1SYSB 2R2HB 3VXNA 4P2YA 4Z7NF 4JFFD 2QQKH 4LVNB 3BPCA 1JF1A 5I8OH 5J6GB 3WFHB 1TQBC 2EIZB 1RMFH 2OZ4H 1FV1A 1ZWIB 1KJ2L 3DYPA 3QQ9D 4NKOA 1AGEA 2BC4A 2DD8H 1HXMB 3QULA 5FDYA 1E4XL 4PJAB 4LFHD 1XGRB 3ZDXF 4Y5YA 3EUUA 4LLQB 1QSFD 1Y18A 2LABA 5LXGL 4HUWB 2IMNA 1H5BC 4ODUA 5D96B 3V4UH 2DQFB 3SKNA 5I8OL 5KN5B 1K8IA 4CVXB 3RNQA 2D7TH 3OXRB 5DJ0A 4NSKB 2DD8L 4YFLI 3L9RB 3LHPL 3BWUC 4EEEA 3G5ZA 4ZXBA 2R2BA 3QZWG 3ZTJH 1BP3B 3KPOB 3BQUB 4XNQA 4JFDA 1P69B 4X99B 3GUTB 3RPIB 5F7FA 3MLXH 4HKXB 3V8CA 2D7TL 4EDWL 1YMHA 5GXBB 4D2NA 2XTLA 2R15A 4F7PA 1UH4A 5CJQL 2EKSB 1T22B 3KYNA 3CZFB 2FIRT 2MQ0A 1KXVC 3O2WL 5F88A 5TJWK 4FQ1H 5HDBE 4WHTA 2PYEA 1OVZA 2MCG1 1MCOH 2P49B 3MLXL 3W0WD 2ICWA 2LU4A 3TO4C 5CD5C 1BLNB 3UDWA 3RU8H 1OB1A 4JY4A 1CT8A 3TBWB 1TCMA 2IF7A 2RGSA 2XQBH 5MEOB 1A1MB 5EFIB 5C0AA 4DVBB 3ZE1F 4M4PA 4OB5H 3IDNB 1ZVYA 4X0KB 3MV8A 3MRHB 2NY5C 1F58H 5JQHC 5CGMA 3ULVC 1UWGH 2XQBL 5JW5A 2GYSA 2NYYD 2ZZUT 4M02A 2FLRT 4QT5A 4HUVB 5C3LD 3KJ6H 4G7VH 1GPOH 1A8JH 3WV0A 1X5AA 3SDXF 1RZ8B 4QRUA 1FNSH 1NBZB 3DWTA 1A6ZA 4PJDF 4PD4K 3IT8D 3PHQB 3LZFH 4APQB 2AQ1A 5SWSB 4YEEA 1BQUA 1IGJA 4ZUSA 1JNNL 3VCLA 3KJ6L 2AP2A 5IJKC 1GPOL 4G7YH 4HJJH 1HYSD 3GMQB 4IDJL 2C1OA 1ADQA 5D93C 1PY4A 4ZFZA 2HMID 3LZFL 3VJ6A 4JFZL 4PGBA 3VWKB 2FO4A 2R1YB 4L8BA 4PRHB 5E2UL 4HWBH 1S78D 4RWHA 2B4CH 4LNRB 2EDNA 1TNMA 1HSAB 5IROC 1EERB 1INDH 2W0PA 5JOPD 2XWJA 2D0GA 1FL6B 3KJ4C 5I1LB 5IHZA 4WUUE 2YK1L 4R97C 2PO6C 5J9PA 1DVFD 4AK1A 5ICZA 1HILA 3O8XD 5L2JA 5I1IH 1S9WB 4OZFH 2A6IB 4TSBL 4MAYA 2Q86A 2HT2D 4QWWC 2B4CL 3L5JA 4L3CB 3QEQE 4P4KA 4F2MB 5FCUH 3NFNB 1INDL 4R3SB 3RBSA 4M7KH 1C08A 1QLRB 2C3WA 1A7RH 3QEHB 3ZO0A 4WFHD 1VFBA 5DD5H 5I1IL 4P3CH 3PWVA 1WAAF 4WV1C 1NGWA 4YAQB 3MLSH 1K2DA 3SQOL 2AJXH 1QA9A 1NQBA 1A7RL 1EK3A 2AEQH 1U8PB 3H8NA 3WN5A 1RUPH 1X4YA 3NOIA 5BRZD 3SQBA 4LPCA 5DD5L 4UDTB 4AM0B 5EO0A 1S7XA 1ZSDA 1SYVA 4P3CL 5INDA 4HV8B 3O3AB 1ZLWK 1U8LB 4QXGL 3B5HA 4JPIA 1RIHH 5C07D 1UXWB 3MLSL 5CWSB 1H3UA 1LQSR 2AJXL 4DWHA 2H9GB 1LK2A 3ALXA 2X40A 1N6VA 1RUPL 3OV6A 5GSRB 1VACA 1IKFH 1XGTB 2AEWA 3QIUD 4XC1H 5A16A 1QYGH 1R3KA 3C6SB 5KJRH 4CL7A 1KIUA 1GGUA 4PGCB 1M05B 3VWJA 1AD0A 5IB1A 1IQDB 1N64L 1MCWM 1RIHL 4PJIF 4XNXL 3QEGL 3QYCA 2FYYA 1HQRB 3CVHH 2VAAB 3G5XB 4KDTC 2DLEA 5DD0L 1IKFL 2NY2D 5E94B 3X13B 4EQ3A 3U6RB 3VFUA 1QYGL 3BRGC 1P4LA 5J3HD 5ID1A 2A6KA 3T09A 3BGMA 1I3UA 5IW6B 2IBBA 3QEUB 7CGTA 4M8QB 4TTGA 3O11B 1HKLH 3CVHL 1B0WA 1Y6MR 1RULH 4YGVB 4M1CD 3BW9B 1EZVX 3LOWA 1G7HA 3L3KA 4L4VE 3FHQA 4V1DD 3PG2A 4MD0B 4HULB 2ZCLH 4GS7C 2WLYA 4P23B 1FYHB 3LPWA 1KG0A 4Y5VB 1IGYA 2EZ0C 5MENE 3F5WB 1HKLL 1NMCC 3TH3T 5F70A 5AD0A 2E7LA 3C5ZD 5T1KD 4DCQA 3GIVB 3CU1A 3ME0A 2PXYA 2Z4QA 3OR6A 4J4PD 2ZCLL 3JV5A 1Z5LA 1MJJB 4X98A 5I71B 1FZMA 4KRMB 4MDJA 4XCYA 5GRYA 4UILH 4EN3A 3MC0A 4TRPL 3QUYD 3EOTH 5ESAB 1A3RL 1S7RA 2Y7QB 5C9JB 5D2NB 3VFTA 4TOYL 1TZHA 2GFBB 4RNRB 4HKJA 4LLUB 3H9HA 3MODH 2PETA 2Z31C 2IALB 3FO2A 4NUJA 4S0SD 3ZMRA 3DV4A 5HPMA 4U1HB 3HPJB 1W0WB 4UILL 3WE6B 5CBEA 2NXZD 4NQED 1X5ZA 2ZUXA 3PP4H 1XGYH 1RY7B 2ENSA 3EJZD 5TF0A 4LHUA 4JVUA 3N50A 1S7QA 1UQSA 5CSGA 3RVWD 3SDCA 3QUMH 5C0BD 2OL3H 4F7EB 3C8DA 3DIFA 5FUCC 4NQCB 1SHMA 1CFSA 2JCCE 1VADA 3QNXA 3FO1B 1ZT1B 2IAMB 3MCG1 4KV5E 1RK0A 1A14L 3V95A 1F13A 3SKJL 1EFXA 3INUH 4HK3N 3SCMB 1AI1L 3PP4L 4NKQB 3IFNH 3ZKSD 3OKLA 3BGFC 4Z0XA 5I17B 2ZOLA 3QUML 2OL3L 4PYGA 4Y4HC 3T0EC 3MROA 5DWUL 1A1NB 1EO8H 3ZE2E 1QQDB 4HK3J 1LEGA 4DK3A 4KH2A 3QHFH 4WUUA 3BP7A 1I3VA 2W0KA 5ISZD 4Y19D 1G7PA 3INUL 2DJSA 2CUMA 2ATPB 1J9CT 5A2IH 4JVPA 5FGBC 3IFNL 2GI7A 2YSSA 3PL6B 4G6AD 3GJFH 5I8CA 2NTSP 5EU3A 3U46A 3QEQA 4N0YH 5EU6D 5ESQB 3GHBL 3SGJC 1EO8L 1FDLH 2FX9H 3MJ8B 5ETUA 3MFFA 3NMEA 5GRUH 4PD4J 5HI3D 4M7ZB 3TVMB 2HJKA 1F6LL 1OTTD 3DGGA 1XAUA 5F3BA 5DJ8A 4YIQB 3QP3A 4Y8AA 4JJHA 2WQRA 5TGBA 1NCCH 3RVXC 4PG2A 1OM3H 5D5MF 1E4XI 5HHME 3BZEB 4X80L 2FX9L 2X4SA 1CGSH 1NLBH 1FHGA 3IJHB 5GRUL 4XPGH 2EIDA 5E5MA 1ZLVK 1U36A 1AP2B 4OAWA 4IRJA 1MJ8H 4R7DB 5JPMB 2YR3A 3CVIH 5M94B 2X9YA 3QWOA 5D1XB 1NCCL 4JGJA 3MLTB 1WBXB 4OF5A 3HLAB 1OM3L 4OZGB 1JVKA 4M93B 1EAPA 1URLA 2CSPA 1CGSL 3IAGC 1NLBL 2XIDA 4O5LL 5ID0B 3KXFD 4F37F 4Z7WF 1S8DB 1UJ3B 1LEKB 3CVIL 4KXZH 4XWOC 5FUOH 2HLFC 4FOMA 3PABB 2Z92A 5AEAA 3U4AA 5F9OH 1JPGB 3REVA 4P2CG 2ZOKB 3BYTA 4AT6B 4BH8B 3B83A 5LKNA 1TMCB 1AGCA 1H15A 3JUZA 3KS0J 3H9YA 3PWNB 3ZLQC 2GIYA 5FUOL 3OAZK 4D0CA 2V5RA 3QUZC 4P59H 3PWPD 1GZPB 1ZMYA 2UZIH 3TV3H 3PJSA 1NC2B 3TZVD 3TWCH 4LGSB 5ERWA 5C9KA 3HPLB 3KYKH 2F53D 3QWRD 4RX4D 2J5LB 3ZL4H 4L4VA 3RDTB 2X9XA 1VKXB 4Z8FH 4NPYB 4P59L 4H26B 4XZUA 2UZIL 3HAEG 4MZ2A 4E0RB 1DBAH 3PP3H 1FIGL 4MS8C 3RWCB 5MENA 5TF1H 1JUFB 1BQLH 1WUNT 3N85L 5EA0H 1UM6H 3KYKL 3FQRB 1ULVA 1YEIH 1FRGH 4LVOB 2EYSA 4FQHA 3ZL4L 1MCRA 1EEZA 1YNTA 3V0WH 4Z8FL 4O2FB 5T3XH 3JZ7A 5FK9A 5I6XC 2FBJL 4OUUA 2E7HA 4MXQD 4NNYB 1BQLL 1CU4H 3O6LH 3CX2A 2W38A 4K8RL 5EA0L 3EOAB 4PJAF 1T1YB 4NQDE 1CQKA 3FFCB 3SDAA 3SPVA 3CPLB 4PRDB 3CSGA 5C8JA 3EJJX 2CK0H 1VEPA 4X6FB 3QXUA 4DUXA 4EI6B 1SM3H 3DO3A 5BOPA 4MQTB 3SKMA 4X5XB 1HWGB 1LE5A 2IPUG 1OQOA 2P45B 1I1RA 2JCCA 5I8KL 3QXWA 2CK0L 4WFGD 5JW4R 4PY8J 1G7MA 3UC0H 3UO1H 4KJPD 4LSUH 3R06B 1FPTH 5IQ7H 1LILA 4N8CH 1YJDL 3FB6B 2EH7H 3CC5A 5EH1A 1HEZA 5T1LA 2NZ9C 1EIBA 3HN3A 5B39A 3O3BA 1ZHBB 3T4YB 1KN2L 3RTQC 4JDTL 2NY1B 3PXHA 2PF6A 1R0AH 1HI6A 3DMMD 3UC0L 5J13B 1B88A 4NO3A 4LSUL 4U6YA 3PWLB 1FPTL 5IQ7L 4N8CL 2R29L 4I2XE 4NC0B 4K9EC 25C8H 3ARZA 1F11A 4M5YL 2YD5A 4ZD3H 1OD9A 5IB2B 3UAJD 1M7XA 2MNUA 5DMIH 5JDJA 3X3GL 1E4KC 1R0AL 1P53A 4LU5H 3U4BL 4LVHC 3GJEB 1NAMB 3KYAA 3HB3D 4KJQD 4ZD3L 1I1FA 3QNYA 4YFEA 4DGYH 5JO5B 1MWAA 2HG5A 1H5BA 3MRFB 2DQHL 3O9WA 4RGMB 4RFNB 3SDDB 1BX2A 1MIMH 1B4RA 2FSEB 2YBRB 1A4KA 3B9KA 4TVPE 1JWSB 4LSSH 3RNKB 1MLBB 1PQZA 3QQ9C 4JDVA 1KIRA 4U49A 4DGYL 1ZVSB 3HC4H 2LVCA 1U9KA 3MRGA 2FHFA 3NZHH 3IDIB 2XZAH 3EDFA 4BSVB 2NTFA 1UG9A 4YHMH 4LSSL 4MWFB 3U9UB 5TFSH 2YPLE 2JKXA 5B4MD 2D7NA 1TXKA 4HXAH 3STBA 1MRDH 1RPQA 3HC4L 4OQTA 4J7RA 1Y0LB 4Z95H 1HHGA 3BWAB 5E6ID 4PJBE 3ZHDA 1LO2L 2XZAL 3TO4A 4HC1A 2JIXA 3VXRE 1W8NA 4YHML 3QUKA 1AO7E 3O6FC 4UNTA 1X7QA 1GOHA 3U7AA 2VL5B 4ZFFA 3OKEA 2AGJH 1BVLA 1J87A 2CLZB 2E8ZA 5B22A 4G8IB 3HI6L 5LQBH 3QIWD 1NJ9A 4YHLH 1KBGH 3UYPA 3ARFB 1NCWL 1SJEB 1EO5A 2AJYH 1AXSB 1MCNA 3FT2B 5BV7B 5GGTH 2CLRA 3R0NA 1U3HB 3HZYA 5IB3A 5IEKA 3R8QA 4OCNC 3IDYB 2P7TA 3KR3H 2HKHL 3IAPA 4OD3L 5B38A 4QRRB 3AB0C 3S88L 2OP4L 1WWCA 1DQJA 5LQBL 3DX6B 3CJJA 4YHLL 2AJYL 2UY6A 3H3PL 5GS0C 4H88L 5GGTL 4P57A 3VRJB 3WIFB 4OF3A 2DQGH 1QVOA 1WFOA 1XGPA 4Y16A 4ZUTA 2H1PL 5GZOD 5DS8A 3KR3L 1DBKH 2AJUL 3IFOB 1V7NH 5DRWB 5KSBE 1G6RB 5IJKA 3VI4F 5H2BA 3ARDD 4ZNEE 1YMMB 4GH7B 4L3EE 4NQDA 1UJTA 2ESVB 5F6HJ 3ZT5A 4BQBA 2DQGL 3LEVL 5EC1B 1RK1B 4QTHA 3RVTD 1DBKL 1NLDH 2GJJA 3GIZL 5IVNA 3T0EE 4AIOA 2R4RH 1EHXA 5IROA 4NWTH 1SVCP 4NNPH 2ICEB 1N5YH 4PR5B 2PO6A 4M61B 1JBJA 3KPSB 2ZUYA 1SY6H 4WFEE 3RGVD 1HYSC 4FQJH 1YEHH 2BERA 1WWWX 3RWHA 4M6ML 2HMIC 1M7DB 3VH8G 5DI8A 1NLDL 3VGGA 4FXKB 1S78C 2E7BA 2VC2L 4IRSA 3UJTL 1UVQB 5F93C 4NO5B 3EDDA 5SWQA 1N5YL 5DF0A 2X44D 1SY6L 1VFAB 4FQJL 1YEHL 5HYSB 3DBXB 1EEYA 1XR9A 5ITFB 1HKFA 4K2UH 1DVFC 1FCGA 2A74B 1N2RB 3O8XC 3TIEA 3T3MF 4XCNB 2JK5B 4I2XA 3EDJA 2FR4A 2CKNA 2HT2C 1FYTB 3CAFA 4XPFH 3WMSA 3HI1B 3OJDA 5L6YL 4OLXH 4Q6IA 3RWDA 3ROLB 4ZYKA 1QR1B 2Y1VA 5DC0A 5C6PB 3MGOA 2CDEA 5GS1C 2FJFA 3IDGB 1HHJB 4HIHA 3TCLA 5HVWA 1UM4H 4XPFL 5FOJA 5BS0B 4OLXL 15C8H 3RBGA 4FRWA 2VISA 4I3RL 4J12A 1FG2B 3G6JB 4G8FB 3P0GB 5JOEA 3O2DH 4XXCC 5ICXB 4AENA 4X4XB 4PRIE 4NKMA 4A6YA 3HNSH 4RMQA 15C8L 1X5IA 3LS4L 1PKQE 1I8IA 1Z9SA 5JUEH 4XBPA 2BX5A 4NGHH 4XAWH 3SGEH 1XCTB 2NW2A 4K7FA 3QIUC 2V6HA 2ZUQC 5IFJB 2ZG2A 4N9GB 3O2DL 1F6AB 1INQB 3PV7A 2YPLA 5JR1L 1DL7H 3MYZA 2AK1L 2QBWA 4TULL 1Q9KA 4AIZB 4L8SC 5E1AA 2R2CA 3AGVA 5JUEL 4F9LA 4MCZA 3B3IA 5EIIB 3WYRA 4PJBA 3CLFL 1B0RA 3PQYD 1LDSA 4MJIB 1V5JA 3VXRA 4ZFOL 5J3HC 2CK2A 2E9IA 1AO7A 1KCRH 5HI5D 3B4NA 2JJVA 1DL7L 5K33A 3WD5H 4X5WA 4MVBD 4NSKA 4EDXB 1P6FA 1IAKA 1NCBL 3QJFA 5KVGH 4F80A 5HVGB 4K3DH 1MFBL 3GJFK 1E6JL 3HRZA 1QBMH 3L7EB 3SJVB 3JWNC 2RJMA 3BD3A 5B3JE 2PW1B 3DROA 5JNYA 4LPTA 3CH1A 4EUPG 3JWOL 2BRRL 1AJ7H 4Q9BA 4OCLC 1OGAE 3ZT7A 4LLVB 5KVDH 2W9LA 3C5ZC 4A2LA 2ZSWA 1XF4B 2BNQD 2H8PA 5EZLB 4WGWB 2AJSH 2ZG1A 3OSKA 1QBML 4HWZB 2P5WD 1ZLUH 2XTJB 3C60D 3QZWB 4Y5XC 3MREA 4MA3B 1MHHA 1J18A 4OUOA 3MJ7A 1HHHB 5CJBA 3QUYC 2R0KH 2VXTL 4HCRH 5KSBA 4LAJH 2ARWA 4OZGF 4PJFE 5MEOA 4OFVA 3IB4A 4ZNEA 1U8KB 2AJSL 3EKCA 3FONB 2VR4A 4L3EA 1NAKH 1U3ZA 2HT3D 3VGHA 2R1WA 3HZKB 4Y4KD 2GUOB 5HYEA 4NWUH 2UWEB 4RAUB 2NXZC 2R0KL 4HCRL 3W39B 3ZYOA 4Y4HA 1EEQA 3T0EA 4MNHA 2UYLA 3MRKA 2YUZA 4JO2L 5LCVL 5L8JB 5GGRB 1X6LA 3RVWC 4GFTB 1LK3L 4H5SA 1FSKC 3HMXA 2X7LA 3MZGB 1FVCA 1OL0A 5EPMA 3BKJH 5FGBA 2VWEC 4RAVA 2GEEA 4LVEA 1A0QH 4Q6YA 3G5YA 5DDHB 1IAMA 5I1DA 4NHUB 4YHIA 1QPPA 1ZT4A 3SGJA 1KPRA 1X5GA 5FKPB 4K3EL 4P5MB 3MTRA 1MIEH 4TUJB 4LCCC 3BKJL 3VG0H 2NPLX 1D5MB 1C7SA 1KIPA 1ZHKA 1A0QL 5FGCB 1CCZA 1FL3B 2HFGL 4IM8A 4H25B 4G6AC 4JFFE 4PS4L 2AV1A 1AY1H 5DHVA 4F8TA 4KTEL 4QCIB 3PP3K 2IADB 1N6QL 4BZ2L 3QH3A 2IH3B 4M9PA 1I3RA 5HI3C 3U0TA 4D9RD 1OTTC 2IPTH 1KPUA 5JIKA 4RISH 5DHYB 4X4YA 5GISH 1GAFH 2F58L 2VLJE 3NZ8A 1QSFE 3KPLA 4KQ4H 1KOAA 3OQ3B 4PJ9D 1WCBA 5HHPB 1IAIH 3Q2CA 4X7SL 5I0DA 2UY7A 3SBWC 4RISL 1FFNB 3S4SG 1GAFL 4KZDH 4KU1A 3MJGX 4PRIA 4JZJB 2NY3B 4XXDA 5C0DA 1JPST 4R97B 4C56D 3VW3H 1PKQA 3T8XB 4O02H 4R4FH 3UBXG 3RWJB 1IAIL 2YUVA 3KNBA 4Y2DA 3O81A 3RL1A 1MHCB 1Q72H 2OTWA 3OAUH 3ZE0F 3Q5OA 1LO0H 4AH2B 1X6NA 4KZDL 2DM7A 2L4OA 2OK0L 1I7RA 5HSFA 2NY7L 3NH7H 2VTFA 4PJGB 4H8WC 3R8BB 3MNVB 5IQ9A 1RJZA 4IRZH 5E56A 1N5AB 4PJXE 3W0WE 3VW3L 4ODBD 1CFVL 1UXSA 4NQUA 4HJGB 4O02L 1CK0H 3BIKA 3N1QC 3RHWF 3RX7A 3VFMA 3TC9A 5GJSH 1U92A 4MJ4A 1Q72L 3OAUL 4XBEH 2HYMA 1LO0L 1XGTA 1MH5A 3V5DB 1SJXA 2DQJL 4WV1B 3RWEB 3WS3B 2FEEI 4UMGA 1TQCC 2HVKB 4ODWA 3UBXI 1KENH 5TH2A 1T66D 4G6KH 3TZVC 5DVKA 2F19L 1CZ8H 5IF0B 1CK0L 3TNMA 4J3XA 5GJSL 5F9JA 2JJSC 2QEJA 4B7IA 5EBGA 4PJ8D 2GCYA 4LEXH 4XBEL 4EI5D 4O51B 2KUTA 2DTMH 3IDJA 3S8WA 1P2CB 3RWFA 4KPHH 1R5VA 6FABH 1KENL 5BJTB 2R0LL 4G6KL 4UZGA 4FABH 1HDMB 1JV5A 3H42H 5BMFH 3OJVC 5BZDA 1CZ8L 1OGAA 1P1ZA 5C08D 3TH2T 5IIEA 5A2JH 1TENA 3V7MA 3FQTB 1DUZA 1XF5B 2APBA 3AROA 3MRLA 1XIWD 2DBJA 1B4JH 2FL5A 2M1KA 3GSOA 4JHAH 1ERNA 1BF2A 1JK8B 3C5JB 2DTML 4WW2B 4ZOAA 4BKLA 4X9BA 2D31A 4AEIL 3FB7B 1AR2A 2CKBA 3L5WB 3P9LA 6FABL 3V6FA 2OSLA 1TVHB 3J8F7 4FABL 3H42L 4MXQC 5EOCL 2XWBB 1PSKH 4CKVX 4MJ5B 3D0LB 3O4LD 3MCKB 3LDBB 4U1LA 4LCIL 4PJFA 4JHAL 4HH9B 2PKDA 4YK4C 4GAYA 1KB5L 4PJ5B 2VDQL 1KTDA 2G2RA 1FLRL 4LSVH 3TPUA 4OF7A 5B21A 5MHSE 4QRPB 4D0DA 5GGRY 4KROD 1ACZA 3RTQA 1B2WH 4C57C 4PBVC 2DIJA 1MCBA 5JORB 3FFCE 4POYA 1YEDA 4L9LC 2GKIA 1F6FB 1NMCB 4JG1H 3X12B 2ADGB 4QOKA 5D1ZA 3IDXH 3KVQA 1NEZA 3BVNB 1B2WL 1D7FA 1E4KA 3V7AE 3VFWB 4WFHE 4PJ7B 3KG5A 4JZOB 3EYFA 4ISVB 1XMWA 4LLDA 5IBTH 1NGXB 4NO0D 2W07A 4F7EA 1Q38A 3RL2B 1DBBH 1I1AD 1XF3A 3DMMC 4JG1L 1ZT1A 5D7KD 3DVGA 1QRNA 3PV6B 5DURB 4ZPVB 3QI9D 2Z31B 5BRZE 4JFFA 5IK3A 4YDJB 5IVZB 3UAJC 5IBTL 5CIPA 3ECBB 1XT5A 4NKDA 1DBBL 2Z35B 1S7SB 1WISA 2XPGA 3FCTA 3HB3C 1V7MH 3LKNA 2P8PA 1R5WA 3KLAB 4KJQC 1HH6A 4PTTB 2VLJA 2WNGA 1U8JB 1QSFA 2ZNWA 5GZND 1GCFA 1MI5B 1JZ4A 1OAQH 4PB9L 3K2UL 3QCVH 4JPWH 4XBGB 4LPXA 1D5XB 1D5ZB 2VIRA 2DYPD 4KKAD 2H45A 4JY5H 3BGFB 3G6AA 3UTQB 2IQ9H 2GAZA 2KDGA 4HAFA 3HKFA 2V9TA 3EYSH 2GTWB 2XQYG 3N1MC 1OAQL 2DQCH 4G43A 3ARWA 4J3OC 3ZKND 4OLZL 4WI6A 5D7JD 5C0FA 4P9HC 3WNKA 3IJSA 1DQTA 4ZUUB 4LGRB 2X4OA 3FT3A 4URTB 2IQ9L 5CGTA 5B4MC 3GSVB 3T2NH 3EYSL 2BVUA 3IGAB 3RFZC 3IAQA 2N56A 5GGVY 2A77L 3RRQA 1WBXA 4PJXA 3W0WA 3IKCA 1FN4B 3IXTB 4JFED 2PNDA 5E6IC 2XN9B 4E5XA 3FQWB 4HIXH 5ESVB 4P99A 5C0EB 1RJYA 3WHXA 4H1LA 4PUBL 1U6AH 1FZOB 4HAGA 5D7SH 4FQXB 4ZS7H 3GI8L 3GSUB 4LRIC 2CRZA 3IJYA 2CUHA 4G6FD 1NC4B 4IOIA 4XI5D 4I77H 1LE9B 1CFTA 5EN2A 5D2LE 1HIMH 3MUJA 4HIXL 4ETQB 2DLFH 3QIWC 3WNOA 1RHHA 1U6AL 4ZS7L 1AC0A 1RV6X 5HYJD 3RY6A 5FB8B 5GHWH 4GJTB 4JRYD 4UB0L 1C16A 2KZ1B 4I77L 1P7QA 4QEGA 4XRCA 1PYWB 1HIML 2DLFL 5CJ5A 1ZA3B 3WNMA 3G6JF 2YPKB 4NQEE 4BQCA 3B9VA 1GVIA 4X9FA 5DD3H 2W91A 1TCRB 5GZOC 4XNZC 4XP5H 2GSIA 3T08A 3TM6A 5C0BE 4AJ0A 4ETYA 3MGTA 3GSWA 3BO8B 5MEQB 4U1NA 3RX8A 3ARDC 4PJHB 3GMPA 3ARYA 4ZQKA 4HWNA 3MJ9A 3QUZB 5CUSH 4Q58C 2HFEA 2UV3A 4M6OL 4NRXB 3ARUA 3AU1A 5TPWH 1T04B 2A6DB 5DD3L 1PG7W 4DVRL 3S5LB 3RVTC 1N3NB 4XP5L 1J12A 3L95B 3FQNA 4XB7A 5F89A 3MBXL 5IFHH 3QDJB 4F58H 3MR9B 5L88L 3PHOB 4N68A 1EGJL 5FUZH 4PJCE 1DVFA 5GGUB 1DBJH 4XPTL 1W72B 3O8XA 4ORGA 3EFFA 5TPWL 2B2XH 5IJVB 2RQ8A 2HVJB 3V5HA 1PZ5A 2XQYK 3NFPA 1KTRL 5EU6E 4KMQA 5IFHL 3BAEL 2VJXA 4F58L 1ZHNA 4L8CB 4X7EC 2VQ1B 1A6WH 3FN0H 3FO9A 4EVNB 1JRHH 4IHOA 4HBQA 4KY1H 5GS1A 1BOYA 4JDZA 3BH9B 2WWMD 4M62L 4BSWA 3HFMH 5IMMB 1BFOA 2DI8A 5GGQH 1GGIH 1MVUB 2WZPD 5BRZA 3FN0L 3P4MA 1MWAH 2P24A 4OZ4B 1T21B 3GMLA 3V8OA 2HKFH 1FZJA 4XXCA 1CG9B 3TBTB 1LNUA 1U8NB 3T4YA 5HVFB 1NDGA 4JKKA 3OXSB 5GGQL 3MYJA 1J05B 1ZLUK 5F1NB 5L2KB 1J8HD 2IFFH 3AS1A 2OJZH 2NXYD 5FDWA 1CE6B 3MPCA 2FGZA 4OBRA 4UIKH 4POUB 4M6NH 2ARJA 2BZDA 2WINB 1BVKA 4ENEC 3QDMB 3VRIA 5J1SC 4TPRH 4PLNC 4OZIE 4JPVH 1E27B 3MRJA 5HHQA 2BSED 2V5MA 2X4TB 3LRSB 5CSZB 1AXIB 2OJZL 5DRZA 4OQTH 1K4CB 4QHKJ 1RURH 1YDPA 3DXAD 1OOAA 1WBZA 5BS0E 4F7TB 2AS5M 4JN2A 4JFYA 4W4NA 4W68A 4H0HB 3PWPE 1QBLH 1YPZE 3DNKA 3ULUF 4HC1H 5HD8D 5A2FA 3LKOB 2K1MA 5J7CC 1C5BH 1OGTA 4U3CA 1FIEA 2EDBA 2VB5A 1FNFA 2A6JB 2D03H 4QO1A 4JO4L 1K6QH 2F53E 2H2PD 3JVGC 2F74A 4BFEA 5J1AB 4LVHB 1A7BA 1QBLL 4HC1L 1F42A 4NYLA 4DKEH 5K59E 1TDQA 3IDIA 3ULVF 3E3QC 2BMKA 1ZEAL 1RZ7L 1CDBA 1C5BL 4Z7QE 4X5LA 5HI5C 1QR4A 1CQYA 1IKNC 3QXDB 5C2BH 2D03L 3F7YB 3L6FB 1K6QL 3TYFA 2VDLH 3LD8C 3D3VD 4J4PA 4MVBC 1ETZB 3WLBA 2X4RA 3U0WH 5D2LA 4TVSa 4JFQA 4Y5XA 4DKEL 1QFHA 5DMGD 4NM4H 1SEQL 5L9DH 5E4EC 3LMJH 1MY7A 5C2BL 4I18B 2HN7B 1N26A 4MX7A 4X9GA 8FABA 4GUPA 2FH8A 4MJ2A 4NP4H 3OF6D 1BVZA 1LP9E 3U0WL 2CLZA 5DK3A 4WI9A 1HHKA 3MRPA 4WU5B 5CFHA 4OSUL 3A6CL 5EC2A 3PF2A 4FFWD 4OT1H 5L9DL 1OSPH 3GM8A 2FLBT 3LMJL 3LQAH 4NQEA 5MERA 3LAFA 3C60C 3IDUA 4X8JB 3WFBL 1MRFL 2F8VA 4AEFA 4NP4L 2J12B 5C0BA 3E6FA 2EDJA 1LO5A 2YXFA 1CL7I 5E99H 4WFGE 3O6FB 5BOZG 4HUUA 4OM0H 1S3KH 4JJ5A 4HDIB 5H35A 2HT3C 4H0GA 4LKCA 1FL5A 4Y4KC 4DGVL 4IS6B 4PJGF 2I9TA 4AY0A 3BPOC 4WY7H 5FHAH 2AQ3A 4HXBH 4OM0L 3FTGB 4PJCA 4O2CA 1Q9WB 4RFEA 4G80B 5F1SA 1CGTA 1I8LC 1CLYL 1T7VA 5CEXA 3AB0B 5L7XL 2UWEE 1FVEA 4WY7L 2IANE 5EU6A 1XR8A 1CXIA 3VXUB 4MA8H 4HXBL 5HDQH 4MA1B 4BFBD 4CMHC 4RGND 1SBSL 3ESUF 1FZKA 1AFVH 3BKCH 5GRVK 3QO1B 4NM8H 3OKOB 4PGDA 5DMJB 4L4TE 3DX9B 4XNMA 4ZODA 1LHZA 2ICES 4U7MA 5C09E 4HIEA 1T20B 3B2VH 5E00A 4MA8L 5HDQL 2G75A 4HEPG 1FVDB 2KQMA 1L9NA 4HIJA 4K55A 2B39A 3MLUH 4MB4A 4NZTH 4XVTL 3SBWA 1AFVL 3BKCL 4LSPL 4JQXC 4NM8L 5KTEH 4WW2F 4JVWA 5EO1B 5DT1H 1VFAA 1I9JL 5HY9A 3OKNB 3T1WA 4TVPH 3M17B 4KMTH 1KPVA 3BD4A 2BFVH 43C9B 4A6YH 3MLUL 4PJ9C 4WHYG 5KTEL 1A1OB 3DO7A 5FO7A 4JM2A 5DT1L 2BNRD 3L3IB 4ODSL 4OZIA 5KSAD 4NDMA 5KG9B 5D7LB 3G6DL 3KPRB 3PNWB 5DD1L 2O93L 4KMTL 4BH7B 3MLZH 1DQQB 2BFVL 1A6UH 1BGXH 1JPTH 2G9HB 4G9DB 3CD4A 1RUKL 4TNVK 3T77B 4X9IA 3PWPA 1YPZA 5CEYA 2B4CC 2I5YH 1F3DJ 3OL2A 3TZVA 1T7YA 4J3WA 1TVBA 4N90D 4P2RD 3FQXA 1KCSL 2GJ6D 3MLZL 2JJSA 3VRLE 4Q2ZB 3QWRA 2F53A 4M48H 1TJGL 4PJ7F 4RX4A 4JO1H 3DRQA 1KEML 4NFCA 2UZXB 2I5YL 4MXVF 4A2MA 3GBML 3W9DA 1BIIB 3QFJD 1PY9A 4WNQB 1T66C 1KJMA 5CP7A 3FL7A 3W2DH 5IW3A 4NO2B 4R7NA 3MQIA 4JO1L 4MDIA 3LQZB 4GSDL 4PJ8C 3T4AB 4JANA 1IGTA 4EI5C 1T3FA 2WWKO 1MOEA 3CDCA 3SGDI 5C07B 3O6KH 2WLZA 2LAAA 4HMCA 2E6QA 3EGSA 3VXPB 4Y4FD 4KZEL 5F7HA 4CJ0A 1IM9D 1KLFA 3QIUB 2ZUQB 5TE7H 4BSJA 1VEMA 1LP9A 4L5FH 2XNAB 1XIWC 1JWUA 1YY8A 2HTLD 1D6VL 1I7ZA 1YC8A 1UZ8A 3O6KL 4BZYA 5E70A 1TPXB 1QPXA 4XX1E 4L8SB 1KJVA 4QRSA 4LHQB 3WIHA 3LPFA 3QXVA 1A2YB 4NKIH 4MD4A 5TE7L 1J5OH 2X4QB 5CS7A 2GITA 1IGFH 4L5FL 4L9LA 3EO0A 3OBAA 5CZXD 3JV0A 2Y36L 3BRDA 2NY0D 4U1GB 1HXYA 4GRMA 5JLZA 5ALBH 3HMXH 2ZSVB 3GI9L 1KNOA 4YXKH 3I3DA 2GHWB 4D0BA 5CMAB 2NX5E 4NKIL 4ONFH 2Q76A 4FG6D 4KROC 1IGFL 2YMXH 1RUQH 4QXUH 2RCSH 4V1DB 4MNQB 1G7QB 5T1MB 4PJEE 4EUPB 5ALBL 1I1CA 2O5ZH 3HMXL 1KULA 1KSRA 2LU3A 5KSUB 1REIA 2QADB 4YXKL 4ERSH 3BUTA 3MUHL 3DX7A 1U42A 5C0AD 3C5ZB 1MQKL 4TN9A 1NSNH 4QXUL 2YMXL 5HYIA 1S7UA 2IANA 2RCSL 1OCWH 3W5MA 3O3DA 3N9GH 1EH9A 4R90H 5FO9A 4FP8H 2O5ZL 1J88A 4X6EB 5C0JA 5DUBB 3QUYB 4IEFB 2YXMA 5ACZB 2V9RA 3T0BA 3NFSH 4L4TA 1A7QH 2X4NA 1U3JA 1IAIM 1NSNL 5C09A 5I0ZA 3QI9C 2O61B 3T65B 1NFDE 1OCWL 1LVEA 4ZSOE 3N9GL 1WEJH 4R90L 3N1GC 4GG6E 3I6GB 4LLYA 2VNCA 1B0GB 4O2EB 3HA0A 2NXZB 2Y06H 3RIFF 5JQ6H 3KGRA 4GW4A 5TDNB 3NFSL 4KMLB 3TP4A 1YA5A 5CHNB 4KKLD 1A7QL 4FQLL 4JLRB 1JWMA 2J8OA 4JREB 4YHYC 2DN7A 5DFVD 1UB5B 4N1CA 2QL1A 4X6BA 2OS7A 5BO1H 5GZNC 2NQCA 1WEJL 4FZEH 4P5TB 2XFXA 4PJHF 5E2JA 3F7PC 5CINL 1Q9OA 4QCIA 4GKNA 2Y06L 1S5IL 4N0FA 2DWEA 5JQ6L 1J1XH 4FTVE 4R2GB 3VFSA 4KKAC 1C5DB 4YR6A 4YBHA 3K2MC 2J88H 5BW7C 5L0QC 3B6SA 5IGXH 5BO1L 3PQYE 4LCCB 2COQA 5DTFB 2FJHB 3V4PH 4FZEL 3ZKNC 4NQXA 5D7JC 3UEZA 4Y19B 5ISZB 1J1XL 1U8OB 4LDEB 1TTUA 5IVXE 5EU7E 3X17A 1CD1B 3FB5A 4P4KD 2J88L 3D25B 4YWGH 4UQ3B 3P40A 5ANMB 3IETB 5IOPA 5EOCJ 2BOBA 3W9EB 5E7FA 1GRWA 1Q94A 1UEMA 3L3GB 4GW5B 2H26A 4U2YA 5AZ2H 3MRNA 4W6WB 2E9JA 3T2QA 1KT2A 1OF2A 1RZFH 4YWGL 5DA0B 4QY8B 2W0FB 4J2XA 2BNQE 5DMYA 4P9MH 4XI5C 2DM2A 5IG7A 2C1PA 5IEHB 2R2EB 3BX7C 3S4SB 4ODHL 3NIGE 2AXFA 5AZ2L 2OXGA 5IUSA 3GMRA 4HX1A 2RBLA 3WL9B 5F7UA 1F3JB 2CKBH 1NBVL 3UBXB 3ARDA 3V0AC 4P9ML 3GSNB 3P77B 3KXFB 3OPZH 1KFAL 1R3LA 4WHCA 1DQML 3TJEL 2RFXB 4CW1B 5KVMC 3SY0B 5T1DH 4P48A 3GMOA 3QQ4B 2NNAA 3CUPB 1AD9A 1D6EA 2FJGB 3LVEA 4J8RB 3DVFA 3VFVA 3K1KC 3RGVA 4XC3L 4WCYH 1O0VA 1IC1A 3MA7B 1TQCB 2M26A 4U6XA 2GJZB 4X4ZA 2A1WL 4NN5B 4S1DC 4YE4H 4HPOL 5FYLE 3DPBA 1FAIL 2D7QA 2NX5A 4S2SA 3CCHB 3WS6A 1U8IA 4S0TD 5M7QA 4WO4B 4PJEA 2NY4D 4HH9A 4CVUA 1JHKH 3UZVB 2JB6A 5BZWB 1OTUD 2HP4A 2FWOA 3MCLL 4MQ7A 1IAOB 5I1HH 2PXYD 5D7IE 5E2VL 1MCPH 4D9RE 2I24N 3K74B 3H3KA 1FH5L 5F9WB 4EN3D 2WWMC 2CJUH 5CIPH 1JHKL 5CCKH 5HJ3A 4OZHE 4WI3A 1B9ZA 4UT7H 5I1HL 1MEXH 2F5BH 2QHLA 1NBYB 5JXAL 4PTUB 4UT9L 3G04B 2BNUB 3CXDL 1MCPL 1NFDA 5GPRA 1KV3A 4ZSOA 1MCIA 1U8QB 5DUMH 1HH9A 4YPJA 1D9KB 2CJUL 4GG6A 2EDTA 5CCKL 4U0QB 4ZTOH 3TO2B 3BHBB 4UT7L 5FGSA 2F5BL 4PV8B 4Z7OF 3KAAA 3SHSA 4WTZG 3LEXA 3QPXH 3BN9D 2NXYC 1CLCA 1RUML 4Z6AT 5DUML 4KHTH 1CXHA 1RJLA 1G7IB 5ABDE 12E8H 1ZHLA 3ECBA 4QYOB 5HGDB 4FTVA 3Q3GA 3MRCA 1SEBA 3JVGA 5DC9B 3NPZB 5EUKB 1C7TA 1I7UA 2X4PA 4G42A 2W0LA 3PQYA 1EVUA 4DW2H 4KHTL 3ULSB 1C1EH 3BZ4A 2CMRH 3DMMB 1IKNA 2FNBA 3A6BH 5HD8C 4H1LH 4Z7UE 2XI9A 5IVXA 3BKMH 1V3LA 1ZAGA 1PX3A 1UYWH 1G7JA 3QEQD 5ICYA 1T2JA 3VXMB 3CFBB 2YC1B 2B1HH 4HG4K 3O4OC 2H2PC 4DW2L 1A4JB 5DQJA 4F37K 1KJ2A 1FFOA 2CMRL 4MJ6B 5E8DH 4NRZB 3BDYL 2ZCKL 3A6BL 4XP1H 4B53A 2N7BA 1WBYB 3HTLX 3LB6C 3SDYL 2XRAH 1KUMA 5SV4A 4D8PB 4K94H 1UYWL 4KK8D 2AXHA 3CSYA 5E8EA 5C08E 3HE6D 4AG4H 2IH1B 5AG9A 2B1HL 5BVJA 3MXVL 4WU7A 1WV7T 4L1HA 5IKCB 4TNWK 2BNQA 2WBJB 2EDYA 4ZDHA 2Y72A 2J4WH 5F7WC 1T1ZB 3C60A 3T3PE 1BREA 3LY6A 4YXLH 4HT1L 4ZO7A 1AE6H 5DMGC 1OARL 1R5IB 5C0EA 3P73A 3C08H 1PGRB 3TNNB 2Y4SA 4U6TA 4MMZC 3NCYS 2DWDA 3W5NA 4XH2B 5BVPL 3AY4A 4LQFH 1WZMA 2C5DC 1EBPA 4YXLL 4Y4KA 3HRPA 3CFDB 4ETQA 4FFWC 3GSRA 1JHTB 3MJ9H 1KYOK 2F54B 5HHOD 3ORJA 5E6IB 2Z91B 1HINH 3UROR 4LQFL 1EJOH 3VMPA 2AJZA 1AGDA 3LKPA 1I7TB 3L3JA 5JDSA 1RIVH 4XPAH 3OHXB 2KL6A 3VFRB 2V7HB 4UV4L 6CGTA 3OZ9L 1CDJA 1I4FA 3QG7H 5F1IA 1ZS8A 3WXWL 1LEIA 1EJOL 1EFQA 3HUJB 3QIWB 3EDKA 4ZAKA 4HHAB 3V5KB 2WP3T 1QSZA 3WKMH 1GIGH 4CVWA 4Y7MA 3DYOA 3GMMB 4OI9A 1FNGB 4HS3A 5I73C 1VFMA 1MFNA 3QG7L 3WEXA 1EMTH 4HF5L 4N8PA 1ZOXA 1QHOA 4JQXA 5D7IA 5I1CL 1CFNB 5H94A 1RZIB 2JELL 3WKML 1HWHB 1UH3A 2FCBA 5E08H 4RGNC 5FA4A 4YDKL 3GB7B 5JOFB 5F9DC 5EG6C 5LGJB 1CICB 3HAEA 3BH8B 3GFUA 3BYYA 1AGFB 1FCCA 3U9PH 1S9YB 1NKRA 5DYOA 4OZHA 2Y5EA 3VGAC 2OCFD 1NGPL 1BBDH 1TNNA 3Q5TA 4HUNB 4RMVA 4FZ8H 1I1YB 5GSVB 2BJML 3VXUE 4MNGB 5E8PB 1P4BL 5DK2A 5FV1L 3PWUA 5DK0A 4WTWA 5IBLD 4WJ5A 5EWIH 5ACMA 2XA8H 4PG9A 4LPUA 5KZCD 1T7WA 3WO4C 4Y89A 2P5EB 4V2BA 1IM3B 4C56A 4FZ8L 3BOVA 5LVEA 2OR9L 4GRLD 4I0PD 2FEDD 1GXEA 4GW1A 2Z93B 1NGYB 1UB6A 5I74C 1QSEB 4N0UB 1FO0B 4G9FD 4CU6A 4UV7L 2Q8AH 5EWIL 1VESA 4RAHA 2XA8L 3TBTA 3VMNA 5KSAC 1EVTC 3PGCA 1BZ9A 3TN0C 5F7KC 4N0CC 4AL8L 5JIHA 3HG1E 1AIFB 4F9PA 3IS1X 4I0CC 3S96A 3VXQB 4CUCA 1R3JA 3CMOL 2CIKB 4M43H 2NR6D 4Z77A 2Q8AL 2VITA 4JFOA 4YPGB 1TZGH 1QFUH 3UTPD 5LGHH 4Z7UA 2C4FU 4G3YH 4PRAB 3VXTA 1MPAL 3TBSA 4JO3H 4C83A 4PJ8A 4CADA 2R0WL 1MHEB 3DVIA 5HYJE 4M43L 3BIAX 2J2ZA 3I2CH 4PY7A 1TZGL 4HLZH 1T1WA 1BZQK 3U7WH 3SE8H 1BBJA 5LGHL 1KGCD 1I8MA 1TTGA 3OKMB 5E6ZA 4PP2A 2MPAH 4P2QE 5C08A 2HJLA 3BESR 3AXLA 4J1UB 4OFDA 5HHMD 3O9WD 4B50A 2H3NB 3PUCA 1CGXA 4YZFE 1WWBX 2BVPA 1ND0B 2AV7B 5EBLA 2MPAL 1F2QA 3JV6A 2R9HD 3C2AL 1YEGL 4GKZB 1N0LA 4NC1E 1T0MB 2I07A 4Y4FC 4Y5YC 4M00A 5ITBH 2G5BA 3UZEA 5F7DB 1DP0A 2BVOA 5EU4B 2JE8A 5J57B 1NFIB 5FYKU 5E8NB 3MRMB 1FC2D 1AQDB 2HTLC 4U1MB 1P84K 5TDPB 2C9AA 5BV7L 3VXSD 1QTYT 3D39B 4HG4J 2BRQA 3BZDA 1G0DA 2JIXD 2QHRH 2QQNL 2DMKA 2HLAA 5DZOA 5CZXC 4LCUA 4ALAH 1EPFA 3FRUB 1Z9MA 1VGKA 2NY0C 4JQVA 5LWYH 1NCNA 4YDIL 4QGTA 3K46A 3LD8B 3ZDYF 3REWA 5IW1B 4PGJA 1YYMH 4OCXH 5IV2A 4TUKH 2AXGA 4FG6C 5SWZB 3LIZH 4HS8L 4NO0A 4ORZC 1G6RL 4ALAL 5E4EB 1I1AA 2O5XL 3UDWC 4LPYA 5IMOB 1DSFH 5LWYL 3CDYA 2C7UA 4XHJD 3P4NA 2CD0A 3PDGA 4XWGH 3EYOB 5K9KB 2AEPH 1YYML 3FB8A 4OCXL 2QR0A 4ELMB 1FBIL 4IS6A 4PLOB 3STZA 3ARBD 4M8VA 2JB5L 3WIIH 3FMGH 4NC2B 2P5WB 2FZ3A 4PRBB 2A0LC 4PGEB 1DSFL 4Y16D 4PBWD 1KLUB 1KYOJ 3GMNA 4YXHL 2L7UA 4HGWB 1J8HE 8CGTA 1J1PH 2V5YA 1VA9A 2VDOL 3I6KA 1OP3H 1P4IH 4O4YL 2AEPL 4QHUB 1KIQA 2ICWI 4AMKH 1A9BA 3O6MH 2DLIA 2FD6H 1YN6B 3MV7E 3WIIL 3FMGL 1MCFA 3RWIA 3HZVA 5KAQG 1UACL 4OD2B 4BK4A 3ILPB 4YBLB 2DYPA 3VXUA 2ZUUA 3C2SA 4MD5B 5AUMA 1ES0A 1DQLH 1ZT7B 3LN5A 5BW7A 1AKJA 5HHVL 3OKOA 1IILE 1QO3A 5L8LB 3QXAB 4OBSA 1VGEL 4KKLC 4Z7VE 4M1DH 2FD6L 5ENWA 5DFVC 1RZGA 2QV2A 3CSPA 2GY7B 1MCEA 3PGDB 3ET9F 3QO0B 4NUGH 1JPFB 1DQLL 3V4VH 3VG9B 5DVMA 1OAXH 3KLDA 2I26N 4IRSD 4QNPE 4UOW1 4DZ8B 2IPKA 4CMHB 1CN4A 3O3EB 2P42B 3DURA 5IB4A 3STLA 3HG1A 4XAKD 3KLSA 5IR1B 1N8ZB 2HT4C 1U8MA 1BQHB 3GJFA 3T2OA 1OAXL 3TGXA 2APWA 3VH8A 1NCUA 1KEGH 1A1OA 2OYPA 2LTQB 3QG6B 2EDOA 5D72H 1YEKH 1R3HA 4P4KC 3UPRA 1RZKH 2H6PA 1U8HB 1YQVH 3HR6A 3MUGA 4JFPA 1QBBA 4PRNB 2EECA 1E6OH 5D6CB 1NMAH 3BUYA 3A67H 4YGAB 1JGEB 3QHTC 2DKSA 3EYUH 5HYJA 3QDGB 2C3XA 1KEGL 1A9EB 4P2OB 5I30H 1MLCA 3EDEA 1X5KA 1G6VK 5D72L 2I9LA 1YEKL 4HK0A 2EEDA 3H6JA 4I5BB 5AYUH 1CLZH 4HFWA 4Y2OA 3QCUH 1RZKL 4P2QA 5GGSY 1YQVL 3W82A 2DL9A 1HSBA 4PJ9B 3RWGB 1E6OL 2NLJB 2F5AH 5DJ2B 3SN6N 3A67L 3CFKB 2Q6WB 3MV9E 2DM4A 1AC6A 3EYUL 4UDUB 5DD6A 5I30L 3WUZA 3F7VB 3DECA 3HR5B 4LASH 5AZEH 3CZJA 2BVQA 2BDNL 3EFDH 1OHQA 1CWVA 2CDFA 5AYUL 1CLZL 3FZUC 3FOMB 2YA1A 3TA3D 4HIIB 1JJUA 2DI7A 2C26A 3WFCL 2EXYD 1K8DB 1IFHL 3VI3E 2LQRA 1F02I 4GG8B 1S9VB 3JSSA 3W11C 3RKDD 4LASL 3MLVH 5AZEL 2YPLD 5IMKB 3EFDL 3EYVB 4OLWL 3BXNA 2PTTA 2NMSA 1NDMA 4FHBD 5JZ7D 2ICCA 5EZOH 3NABH 4OZFB 4R96B 3AC0A 5EOTB 1JGLH 2OJEA 1J11A 5DMKA 3MLVL 5DFTA 5LAXB 3PIQA 2YOCA 3IFPA 3ZHKA 4LP4A 3NN8B 2OQJB 4WGVB 2NW3B 2FIKB 1G9MH 2DLHA 2EH8H 4HUMB 4FQQB 5EZOL 3NABL 5IMLA 1JGLL 5CJXA 3BQUD 1QD0A 3ROOB 5JPNB 2EDWA 3V6ZA 5DR5H 4G8EA 5I15L 4EI5B 1BEYL 1A7PH 5FKAA 5JXEA 3WHE1 3WJJC 1AXTL 1GGBL 2PYFA 1MAJA 2NY4C 4UQ2B 1DQDH 4LHJB 1VFUA 4FQPA 1JTPA 4J23A 4HS6B 3ULUH 1OTUC 4GKOA 3VDAA 1MELA 4ZPTB 1XIWB 2PXYC 3TT1H 5JW3H 3OR7B 3WJLC 2H32A 1UFUA 4C55A 4GMSH 4EN3C 2YUWA 1MREH 3QR2A 1J8HA 4DZBA 2R23A 3ULUL 2G60L 5IWLC 3O4LB 3DTXB 2I60H 3TT1L 3DSNA 4X7DC 4L3ED 3H2WA 3HS0B 1KN4L 3MV7A 4QRQA 1XCQB 1K3IA 2ADFL 4UNUA 3T1FA 4U6HB 2WUBH 4GMSL 1E0OB 3CVHB 4JAMA 5GS2H 3FT4B 2A9NL 2R1XA 2W65B 3BI9X 2NY5L 5HDLA 1MUJA 3E0GA 5J6HA 3EOBA 4L8DB 3DXAA 1FFPA 4Z7VA 3CFJB 4L4JA 4KJYB 4LHUG 3SDCC 3BMWA 4WEBL 3BN9C 1CLOL 3SKOA 3TBYB 3UCRA 3X14B 2O61A 4WWKA 1K5NA 1J0HA 1IGIH 2BOCB 3EYQD 2R4SH 2RR3A 1T4KA 5ACLA 3KPPA 1KCUH 4N90E 4P2RE 4OKVB 4LBEA 2GJ6E 1T0NA 4LLMB 1B0GA 4NRYB 5SWSD 3MUY1 1G7LA 1DLHA 3RPKA 5C0GB 1IEHA 2EYRA 3HUJF 4IIQC 5CD3A 3RJDA 1IGIL 1BAFH 1KCUL 3D0VA 4OFKA 2AKRB 3VWKD 4M3JA 1V05A 5HYFA 4X6CB 3WSQH 3QI9B 1X5YA 2QQQA 1F00I 3L3OA 3DUUB 1F4WH 3IDMB 1C5DA 4NFDA 4GT7A 3QPQD 5F7NC 2DQTH 4CBPA 3OB0H 1ZGLB 3EHBD 1T5WB 2MTPA 3P4OA 4Q7DA 1KB9K 2KH2B 2ZNXA 1QKZH 3G9AB 3JTTA 3NACH 5GGVH 2D7PA 3FO0H 3OGCB 3Q6FB 1A7NH 4P46B 4OCMC 3DX8B 4KK8C 4NN6C 4LLWB 5CLTA 3HE6C 3ILQD 3RHWK 3FFDB 4GBXA 4JQIL 2DQTL 4IMKA 1BQSA 4IRJC 3MV9A 1I8KB 4NQSA 3DV6B 1QKZL 2X1PA 3QQ3A 3KPMA 3NACL 3MO1A 5GGVL 3QUMB 2OL3B 5L0QB 2XZCH 5ILTL 4OV5A 5JW4N 3L3GA 5T5FH 3X3FH 3U36A 3BP6B 1YUHB 4I0KA 2AAVA 4BYHA 1GOGA 3D18A 2PW2B 4JRWA 4NZRL 1CR9H 2IEPA 3GGWB 4NCC1 4EOWL 5DSCA 3L5XL 2AJ3B 3LCYA 5CEZH 1CD9B 2XZCL 5ECJE 5JW4M 1OW0A 1ORQA 2YD2A 5T5FL 5EUOE 1IC5L 1CIUA 3O45A 4YDVB 5IESH 4PRPB 3QA3A 5F7EL 1OP9A 4IJ3C 3L7FA 4R26H 5E8OB 3V0VA 3DUSA 3ZYIA 1MQ8A 2SEBA 1UA6H 4R0LB 4JFEB 4MAUH 1CR9L 3X11A 4MA7L 2DOCA 4ELKA 4C4KO 2W1NA 1NANI 5TE6H 5DQ9A 5CEZL 4G8GB 3H7BB 2DMBA 1P7KB 5IESL 2DJ4A 5FF6B 4CMMB 3B2UD 4DGIL 4R26L 1WTGT 5GGTA 2VDNH 1OAZH 1UA6L 3I02A 2QQLH 3H9SB 4MAUL 5EZJB 1QEWA 3KDMB 1ACYH 4J8RA 4XGZA 1YEJL 1P7HL 1KLGB 1E28B 1V3KA 2XA3A 5TE6L 5HYSG 2FH6A 4JRYB 4ZUWA 2VKXA 35C8L 2ZG3A 4QHLB 2VDNL 4KI5F 5KW9H 3C6LB 1OAZL 2MCPL 3MRDB 3QNZA 1JI2A 2E6JA 4F3FB 3LKRA 1LD9A 2A9MH 5E6YA 3ZKXB 2Y25A 3V9FA 3GSXB 4FS0A 4YX2H 3S36H 4QHMA 3KWWB 4P23D 5EU5A 5F7MC 5KOMC 2OMNA 4OLYL 3M45A 3NAAH 1QFWL 2YN3A 4F7CA 3BEVA 4I4WB 1XGUB 4UINH 2A9ML 3IU4H 1XFPA 3LEYH 2ZUWA 4X6DE 4YX2L 3RI5F 1ZK9A 3HI5H 2AI0L 2ADJB 3IRPX 5FOBA 4U1JB 1JYVA 2W9DL 4BUGA 1U95B 3DUHA 1JF5A 1JP5A 1YN7A 4KWUA 1SY6A 2QSTA 3UXFA 3MRBB 4YO0B 4Z78A 5HGHA 2V2TB 1S9XB 3IU4L 1JN6A 3F58H 3LEYL 5EOQL 5GS3A 2FEDC 3MRRA 3HI5L 4KUCD 4DQOH 5K9QG 1FNLA 3IF1A 5D1ZD 3BZFA 4P2RA 5JHDB 5DJ6A 3NPSC 4MMXC 4ONGH 2GJ6A 4JZNA 4FFYH 3TBVB 1IGML 5KSVA 1M7IB 3LKQA 3WUWA 3F58L 3HCVA 2CGRH 4NOBA 3P2TA 1UKTA 3BEWB 1GC1H 2FECI 3CFEA 1KJ2H 4NQCD 1RHFA 4YJZL 2NR6C 5BQ7A 1VPOL 3OX8B 3SEPA 4ONGL 3VA6A 4ZUVB 1E4XH 1FORL 3BJLA 4FFYL 1N59A 3NGBB 3SCMD 4J3SA 3MLRH 2VABA 5LXGH 5K9QI 1QACA 2XOTA 3EO1A 4ELMF 5CBAB 2CGRL 3L3DA 3I3BA 1AGBA 5F1KC 1CDGA 2ED8A 1GC1L 3IU3B 4KGLA 2E3VA 2VE6A 3PDOA 1GZQB 3KYMB 3LHPH 4ONHA 2MHAB 4Y4FA 2VLJD 1F4AA 2Z8WC 3MLRL 3M8OH 4RZCA 3PL6D 1IM9A 3O2DA 1OP3K 2WIIB 3O9WC 1IEBB 4EDWH 4ACPA 4NT6A 5CJQH 1UH2A 4YC2B 3RVVD 3B9KC 3TVMD 3D85B 5DJZA 5EBWA 4ODVH 1OAKH 3TYGH 5FA3B 3LN4B 3O2WH 3PWJB 3M8OL 5DRXA 4TTDD 1DUYB 2R9HC 4ZFOA 3LQMA 1T7ZA 3RZCB 2W92A 4QGYA 4BA8A 5IKCA 1C12B 2EEBA 3JV4A 1CGVA 2IQAB 4ODVL 1OAKL 4XMLH 3TYGL 3QIBA 5EUOA 3O4OB 3LSOB 4JPKH 4X83A 2ITDB 2ZKHH 1IMHC 3C8HA 1EAJA 4CN1A 4HUXA 3VXOB 1EJ6A 5FYLH 1KB9J 3KHQA 5F97E 1JNHB 1WJ3A 4XMLL 3EZ8A 3PXJA 4PLKD 1U91B 1P6AB 2Y5TA 2CLVB 4U05A 4JPKL 3D3VB 3G5VB 2ZKHL 1J86A 4HEME 5FYLL 3BMVA 2CIIB 1A6AA 4CU8A 2WMPA 1XGQA 3U2SB 4OD1H 1QNZH 1QLFA 4JFXB 5MEPB 4YBQD 1H0DA 3TIDB 4XHJC 1JNNH 3VFPB 3HAEH 4E41B 1AHWA 1KF9B 1T1XB 4OKDA 1NC2D 1P7QD 5D9SA 4I9WD 3UTZA 4IDJH 1CS6A 4N1HB 1HNGA 4JFZH 1SJVA 3IXAB 4HCRA 4OD1L 1QNZL 3FOLA 4YHNB 5E2UH 3MNWA 4Y16C 4BFIA 1MFCH 3NVQA 1W72L 5ALCH 3KYOB 4IMLA 4HKZA 4Z7NE 5D1QB 1JHLH 2YK1H 1U58B 3M1BA 1EO7A 2BHZA 3LQAC 4MCYB 5I9QB 2A83A 3UTTB 2YPVH 4UIMB 4TSBH 4X6DA 4H0IA 4PREB 3NTCH 1IEAA 3C09C 1MFCL 5MHSD 1JZ2A 3L1OL 2WIMA 5ALCL 3QJHB 3GBLA 3ZDXE 4RMTA 3VFNB 5I8EB 1JHLL 5C0IB 3ZDZF 2DICA 4QF1B 1XH3A 5FO8B 5IB5A 5J06A 3FFCD 2YPVL 4PYHA 3D48R 3QFDB 3NTCL 1MFAL 3ARGB 5I73B 1JGDA 2ADIB 2X1QA 4HZLB 3LV3A 5A40E 2C3VB 1DE4A 3NIFF 3SQOH 4IRSC 5DZLA 2QKIA 2L7JA 4NZUH 1I85C 3U0PA 2C3HA 5K9OB 3WFEL 1BZ7B 1Q8MA 4RGNB 4WDIA 1FJ1B 4AEHL 2P8MA 1GGTA 5DVLA 5IM7A 3NCMA 4QXGH 2Z93A 5DJAB 4DOHE 4PLJD 5HGBB 3VE0B 1H8OA 1CFQB 5T5NF 1T80A 4NZUL 4P3DA 1NGZB 3ES6A 4N8VA 4KDWA 5FECA 3MV11 3K8KA 4Q6IC 1UKSA 1A47A 1M71B 3QHZL 4U0RC 3B9DA 4UUJA 1S5HA 3T0AA 1N64H 4E42B 4XNXH 5HHNA 1KTLB 3QEGH 3WO4B 3MRQB 3RUGB 2YEZB 1CGUA 2P8LA 4GRWB 1EX0A 1WC7A 3BP4A 4L29A 1G9EA 3ZE1E 5DD0H 4OGZA 2VLRB 4JRXB 2IGFL 2HFFB 2X70A 5I74B 2FRGP 5HYQB 4YHPB 32C2B 5I2IA 3JTSB 3P9MA 1PKOA 4OLEA 1OY3B 1JGVH 1S7VA 3D2UB 3UTSE 4KTDL 3E6HA 4MSWB 2DLGA 2XKNB 4GKSB 3TN0B 3RQ3A 5HHOE 4KAQH 4M7JL 4UAOC 2VN7A 3WBDA 1BECA 4OLUH 1Q9LB 4M6AA 3TA3C 2LAGB 1DN0A 4NJ9L 1T5XB 5I76B 1ORSB 4LDOB 3VFOB 1DEEB 3SDXE 3F12A 4PJDE 1JGVL 3C8KB 4NCDA 5GGSA 3RKDC 1K4DA 1J1OH 4CN6A 4KAQL 4XCEA 3S36X 2NY6D 4OLUL 1ND0A 5DEGB 2ATKA 4F7MA 1X5LA 4IDLA 4F9LC 5JZ7C 4U2ZA 1TETH 3WJJA 3O2VH 3FQUB 3ZTNH 1G1CA 5B8CA 1NKOA 2APFA 2J6EH 4CGTA 4ODXA 4TRPH 5D96C 1R24B 4DFIA 1BFVL 1J1OL 1A3RH 5TDOA 1XZ0B 3HNTH 3QFJB 2EE6A 5EO9A 5ELIA 4TOYH 4LF3A 2VLME 4X6CF 3AREA 3VXNB 3BKYL 1JZ8A 3WJLA 3BPCB 1TETL 5IHLB 2BVTA 2X1OA 3O2VL 3ZTNL 1JF1B 4RIRA 1MJUL 3KPNA 1FV1B 2J6EL 4NJAH 4NKOB 1AGEB 3LKSA 2BC4B 3HNTL 2RAMA 2Y07L 2BSSA 3ELAT 3OB0K 3QULB 3SO3B 5IWLA 1QFOA 2DQEL 4Y5YB 4Y1AE 1MRCL 2OM5A 1Y18B 4ODUB 3H0TA 1KB5A 3SKNB 3B8YA 5JMOC 1TIUA 1HOCA 1K8IB 1QFWI 3RNQB 2D9QB 4P4RA 1A14H 1CTNA 4NJAL 4RSVA 1JYNA 3SKJH 5DJ0B 2Z8VC 4FQ2L 3S7GA 2BSRA 2IBZX 3ARFD 1AI1H 3G5ZB 4L3AA 4ZXBB 1WAAE 2R2BB 2IJ0C 4YNYA 3M07A 4RMRA 4XNQB 3RY5A 1QLEH 4JFDB 3BFOA 4YHOL 4UU9A 5DWUH 4FQIH 2GT9A 3VD5A 2K3TA 4QRRD 1UADC 4G9FE 1YMHB 3F62A 4F7PB 2ERJB 4C54A 2XG5A 5GS0L 2DBLH 3GSQA 2WM0A 3KYNB 2WBKA 5F88B 5INCA 4OTXL 1U0QA 2B5IC 4WHTB 2PYEB 1QLEL 2A73A 4M7LT 1PLGL 4IIQA 4FQIL 3GHBH 2FX8H 1EXUA 2ICWB 1HCFX 1YMMD 1AH1A 3HC0B 3VDCA 1OB1B 2ESVD 4JY4B 2HRPH 3UTPE 1CT8B 2DBLL 4WFFE 1RSFA 3EYQC 4PJIE 3I75A 3SGKA 1ED3A 5ADPH 5C0AB 1CDIA 1Q1JH 4X80H 1M6OA 2AK4E 3ISWA 2FX8L 1L6XA 3S35L 4U1SA 4HKBA 3MV8B 3NA9L 3E2HB 3KPSD 2HRPL 2V7NA 3BP5A 2WW8A 1KGCE 4TQEH 4B41A 5JW5B 5ADPL 1JPFA 2B0SL 3HE6A 3VWKC 3AFLA 1JFQH 2IWGA 3MBEA 4HD9A 1Q1JL 4OIBA 4QT5B 4TUOA 4O5LH 2V2XA 4O00A 2YRPA 9CGTA 4P5KA 4QRUB 1BOGA 1A6ZB 3QPQC 1W0VA 3EHBC 2VRAA 4TQEL 5EULV 1IGJB 4LMQI 4ZUSB 2DL2A 3VCLB 5I66A 1JFQL 2VR5A 3QCTH 1IE5A 1FYTD 3ILQC 1FC1A 2C1OB 4ODTL 2XT1B 4ZFZB 3MRIA 2CXKA 4PGBB 1IARB 2FO4B 1WIUA 4EQ2A 4JM2D 3RAJH 3WLWC 2AW2A 4L8BB 4HH8A 3IYLW 1SJHB 4XT1C 2J8UF 1GGCL 3UTSA 4DN3L 4LRNL 3VXSE 3HZMA 1N6UA 3K4ZA 3SE9H 5HHOA 1EHNA 3QCTL 1JMZA 4KJWD 3QT2A 2XWJB 5J9PB 5IHZB 5BS0D 1I3GL 1HILB 2VZ3A 3RAJL 3SDXA 5L2JB 3RWGA 4PJDA 4Y2DC 3V6OE 4MAYB 2Q86B 4XVSH 4F33A 2EYTA 1FIGH 3KPQA 1Q0YH 2FATL 4HPYH 4P4KB 3SE9L 2I27N 3N85H 4JN1H 1MFDL 3S5LG 1WZLA 1C08B 4RMSA 2YRLA 4U4BA 1VFBB 3CDGA 1IQWH 1D5BA 1S9KC 4XVSL 3PWVB 2PUQT 2VZTA 2FBJH 1Q0YL 4HPYL 5GJTL 5TE4H 4HUKB 4JN1L 4K8RH 1K2DB 2YUXA 3C5SA 1X5JA 1QA9B 3B2UC 3WN5B 3QUXA 4YEFA 1UCBL 5DC4B 4OGAD 5EO0B 1S7XB 5EZIH 1IQWL 1ZSDB 2FGWH 1SYVB 43CAA 5INDB 5BXFA 2E5EA 4MJID 5TE4L 4JPIB 2H32H 3HE7A 4HSQA 4G8GE 2GK2A 2BVEA 2V2WA 1LK2B 4AQOA 4Y1AA 1VACB 5FM4A 3NN8A 4EUPH 5A16B 5EZIL 1R3KB 2FGWL 5IVOA 5I8KH 2EDDA 4FQQA 3VWJB 1AD0B 5IB1B 3OWEA 3BN3B 2OTUA 3V2AR 4E9LA 1TVDA 4FXGA 3GRWA 1YJDH 2FYYB 3IVKA 4DUVA 1WAAA 1NUNB 3MUZ1 4P23C 3S3JA 1EGJA 2X4UA 4Y5VC 5D5ME 1KN2H 2YD7A 4GRLA 3VFUB 3FRPG 4JDTH 4I0PA 1H3GA 2Q7YA 4XCCH 5ID1B 2IG2L 3MA9H 3OKDA 2A6KB 4G9FA 5DHXB 3THML 3BGMB 2X10A 2R29H 3DVNA 3T2PA 2XTJD 4M5YH 4KK9D 5I71C 1Z2KA 5LGKA 4XAKE 1DFBH 4RQQA 3JWDH 1MJ7H 4LCYA 3X3GH 1G7HB 3L3KB 4XCCL 3MA9L 3Q1SH 3DARA 4Z7WE 3U4BH 5CKAA 1KG0B 4U1IB 1IGYB 2NY4B 3RIFK 4OCYH 5F3HA 3JBG7 1JPSH 3O41A 4PJIA 4LSRL 1YZZA 4XPHH 5AD0B 4W6XB 5D1ZC 5KS9E 4Z76A 1DFBL 4DCQB 3JWDL 5F6IC 1MJ7L 2PXYB 2IAND 2Z4QB 3CDFA 3OR6B 2DQHH 2AK4A 3Q1SL 1Z5LB 3UJIH 4X98B 1FZMB 4MDJB 4XCYB 5E0QA 4OCYL 4LCWE 4EN3B 4EXPX 1JPSL 3ULUD 1S7RB 5A1AA 5F44A 4XPHL 3MZTA 5CZKA 3VFTB 4L4TD 1TZHB 2EDRA 1ZA6A 5C09D 4KVNL 3K7UA 5HGAA 4HKJB 3SCMC 4LLMA 3FO2B 2P1YA 4WEUD 4NUJB 3DGCR 3DV4B 5DEFA 3UJIL 1OAUH 5HPMB 3U79A 4G6JL 5CBEB 4K7PY 3OKKA 5I1AA 4NIKB 4NCC2 3DHMA 1BMGA 3EW3B 3ZZ1A 4PB0L 4DTGL 4LHUB 3HNVH 1S7QB 1UQSB 1EUTA 1CFBA 2DRUA 2HA1A 4NQTA 4U7SA 4W81A 3SDCB 1LO2H 5F7LB 1CFSB 1VADB 3QNXB 3NCYP 3PL6C 1OAUL 2BCKA 1RK0B 5GS2D 2B1AL 3DRTA 1EFXB 4ZO6A 4OGYH 5JMRA 4LEOA 4X7CC 4M7ZC 3RVVC 3OKLB 3TVMC 3HNVL 4Z0XB 2ZOLB 1QOKA 3VXSA 1OSZA 3S6CA 4PJAE 4UNVA 4U6VH 3HI6H 3MROB 3Q6FA 4TTDC 4NOFA 1LEGB 2BVYA 3FHAA 1NCWH 5DRNA 4WUUB 3BP7B 3L3HA 4QTIL 1L0YA 3U30C 1G7PB 4WENB 3MMEA 4OGYL 5J0BA 1A6TA 3PGFL 3V6OA 1K3ZA 5GIRB 2YSSB 5I8CB 2HKHH 4XP9L 4OD3H 5EU3B 3U46B 3QEQB 2IPUK 4W6YB 5IT2L 1QRKA 4U6VL 3S88H 2VZ1A 2OP4H 4JHWH 3MNZA 4JB9L 3I50L 5ETUB 2GK0A 3MFFB 2XWTA 2NY3D 4WHDA 3H3PH 4H88H 4U3HA 2W9EH 2ITCA 2FEEL 5DJXA 3DGGB 4M93C 5F3BB 2OTPA 2YRZA 5DJ8B 1HQ4B 4WW1A 2H1PH 5TGBB 3GSNL 5C0CB 1L7IH 2AJUH