3F01A

Crystal structure of synaptotagmin i c2a domain with cu(ii)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
143
structure length
143
Chain Sequence
GSPGIGGGGGGILDSMVEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of synaptotagmin I C2A
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Synaptotagmin-1
total genus 22
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3f01A01
4MJJA 3QAQA 4F92B 4WAFA 1DJYA 3KWTA 2ENQA 5H4YA 2ENPA 3TJPA 4BGDA 4TV3A 4BFRA 3QR0A 5KJ7E 5G2NA 4JPSA 1YRKA 1BDYA 3PS6A 3ENEA 3QR1A 2X38A 4F93B 1BYNA 3R7RA 4A55A 4FA6A 5CCGE 2A5UA 3F04A 4WEEA 3HHMA 2WXLA 4WWOA 4NPKA 2CHXA 1E7VA 2K8MA 4GNKB 1UOVA 4XZ4A 4HLEA 1DQVA 4EZKA 4QJ4B 3NSJA 2BWQA 2WXMA 3F01A 3LJ3A 2WXPA 3L13A 2ISDA 2A4ZA 4L23A 3ML8A 3PYCA 2RD0A 4G11A 3IBEA 4Y1TA 2ENJA 4IHBA 3S2AA 4LT7A 4ICXA 3RDJA 3QARA 3T8MA 4IQHA 4NS0A 3N5AA 3L4CA 4NP9A 2V4LA 1TJXA 3JZYA 4KZ0A 3NZSA 4WWPA 4KZCA 4EZJA 1DJWA 2NCEA 3FDWA 3L17A 3FBKA 2WXJA 2WXFA 3DBSA 3PREA 4F1SA 3NZUA 3OHMB 2FJUB 2DMGA 3CSTA 1RH8A 4ICWA 2CJTA 2WXIA 2WXHA 4LCVA 2KI6A 4L2YA 2CHWA 4FADA 3APDA 2ZKMX 2UZPA 2WXQA 5CCHE 3GPEA 3HN8A 1E90A 3L08A 4Y1SA 1WFMA 3APCA 4J6IA 1UGKA 3F05A 2QZQA 4QAMB 2CM6A 2N1TE 2K45A 4NPJA 4PS7A 4L1BA 1W16A 2WXOA 4FHKA 5G55A 1E8YA 1E8WA 5EDSA 4F91B 3ZVVA 1QATA 3IM1A 4L1LA 4XX5A 2K3HA 1K5WA 1RLWA 3TWYA 1DJZA 2B3RA 4FHJA 3ML9A 1E8ZA 1DJHA 1DJIA 3L16A 4QJ3B 2CJSA 4EZLA 3TL5A 3DPDA 3L54A 1DJXA 4ANUA 4HVBA 4KITB 4V11A 2EP6A 2D8KA 2FK9A 1A25A 4LDCA 3KWUA 4URKA 3APFA 3P2BA 2WXGA 5CCJA 3PFQA 4ANVA 1RSYA 1V27A 2DMHA 1DSYA 2NSQA 3CSFA 2Q3XA 1E8XA 2Q0ZX 1WFJA 1UOWA 4TS6A 5H4ZA 5T8IA 4PS8A 3RPBA 5JHAA 2CHDA 4AOFA 2NQ3A 4FLHA 3L9BA 2QZ5A 5JHBA 1QASA 4GB9A 4DNLA 4FJYA 2WXRA 4OVUA 2CM5A 1CJYA 3W56A 4ANXA 3OAWA 4ANWA 3W57A 3F00A 4TUUA 4OVVA 3SD5A 3HIZA 4QJ5B 1GMIA 3B7YA 4FJZA 3M7FB 4XE0A 4DK5A 4WWNA 1DJGA 2WXKA 3R7QA 1E7UA 3QJZA 2YOAA 2LHAA 2R83A 2K4AA 2Y3AA 4PS3A 1W15A 2JQZA 2WXNA 4FULA 3PRZA 2CHZA 4AJWA 2Z0UA 3ZIMA 1HE8A 3QK0A 1BCIA 2YRBA 3MJWA 1TJMA 3ZW3A
chains in the Genus database with same CATH superfamily
4ISVB 5J12B 3ME0A 4WAFA 5TE7L 3FN0H 3VRJB 4XR8C 2C7FA 3SGEI 3WTVA 1QOKA 3OGCB 4M7KH 3ZK0A 1XO8A 4D0CA 3BEVA 2KS0A 4EF3A 4OFYD 4OJFL 4R4BB 1CG9B 1T22B 1WCBA 4PY8I 2DQEL 4RETB 4ZDHA 2WYTA 3VRIB 3VWJD 2ZXCA 1DANT 1KBWA 5JW3H 5KSBF 3GMMA 4GBXD 4Q7DA 3GDCA 4JR9H 4I2XE 5CILL 3FH5A 1EMTH 2BIHA 1CWVA 1NOAA 4IOSA 5E8NA 3IDIA 2FBRA 2XXGA 4N2BA 5CJ8A 5GGTH 2YPKA 3H7BB 4C83B 3EFOA 4HWUA 2VMEA 4XNQA 4EN2A 5AB0A 5ABDE 1TYRA 2MOVA 3I6KB 3VRIA 4H8QA 1CLOH 5KVDE 2R23B 3DIFA 1KYOJ 4Y2DB 1DFXA 2SEBB 3GZQA 1I7UB 1WZKA 2WQ8A 5LGJB 3WIIL 3UAJD 3ZJAA 3IFPA 4NPYB 1KYOK 2AJSH 4D9RD 2CJTA 2WKGA 1TXKA 3RGBA 5IB4A 2AJXH 4NP4L 1S9WA 1SXCA 4K8RL 3ULUC 3B1TA 4Z7UA 2FIRT 1A21A 2DKMA 4MJ4A 4PGEA 1Z9LA 2E5EA 3UZQB 4L3ED 1PG7W 3IS1X 3WGVB 1W16A 1QI3A 1WAAE 4MD4A 3X1BA 2MQ0A 4FRWA 5FA4B 4MMXA 5FF6A 4U6YA 1K5WA 4B95C 1K5NA 5D1XE 4Q9RL 1U21A 5I6PA 3OAYH 4L4VB 3RHWK 4Q2ZA 4LNRA 2ZTBA 5KSUA 3TNMB 4ZFZB 5DUBB 4L9DA 4JDTL 2BMKA 3CVCA 1U8OA 4OLUH 5FYKL 2IFFL 2DM7A 3DGGA 4XVSL 1YEFL 5BRPA 4PCYA 1QHQA 1WFJA 1QTPA 1XF4A 4HYTB 4P04A 3RNQA 3BP7A 1JK9B 1S7UA 2CNYA 1AI1H 2F74B 2GSGA 2H3NB 3OMAB 4E9RA 3D69B 1A8JH 1FGVL 2G75A 3MV01 3MRCB 4FJYA 1ES0A 2DQHH 1CJYA 2V2XA 4Y2NA 1YNLL 1AGEA 3MNZB 3RIAK 3W9DA 4KRPD 4CVXB 2IPKA 3DX9B 1JDDA 2X87A 5AVXB 2G3NA 2CK0H 4HC1H 1BQLL 1ZV2A 32C2B 4P3WA 3P9LA 5JA9A 1CPUA 4PRID 3VXOA 2CRZA 4JVWA 1KNOA 4H25B 5C08B 1C8QA 2RIKA 4AZUA 3NACH 4YSCA 1A02N 2CKBL 3T0DA 4FNSA 5D4JA 3CK0H 4L8DA 1IE5A 4JKWA 4GS7C 1AJ7L 4KHXL 4LB8A 5IESL 3UBGA 1EZVY 4HH9A 5C0AD 4X4MA 2GUYA 3LD8C 4AY0A 4LSQH 2OKMA 3C08H 2L7QA 2Y36H 3O2DA 4RWYL 3V4UH 2VWEC 3OR7B 5IBLD 4HETA 3JWDL 2BERA 5DO2C 4RBPK 1B2YA 4GSDH 5FKAB 2CBOA 2H6UA 5FOBA 1R3IL 3H3PH 2CO7A 3IU4H 1UUSA 2WKOA 3BT2L 1NIAA 3O6MH 5BZWA 1B6DA 2ERJC 2OMNA 2VDKB 3LPGA 4WVRA 4EVNA 3CFBB 3NTCL 4ZO8A 1FL6B 2MMXA 3OV6A 2K6YA 1DBBL 1VENA 4HCRA 4XPHH 5DWUL 4DZBA 4EI6A 4AL8H 2YKLH 3OKOA 5T5FA 5C8JA 1MUJB 2BP3A 2DQUL 3VA2C 4MCZA 3INOA 3GSRA 4X8XA 2VR3A 4QCIB 5ERWA 3MV7E 4KGLA 5BZWB 4OGYH 4KY2A 5DJAB 4U6XB 1X6LA 1UWXK 3S97C 5L2JB 2RH0A 5FHBL 1Z32X 1TZGL 4I0CC 5HHME 2HPTA 1CURA 1TJIH 2V17L 5DHXB 1BBJA 1A7NL 1E8ZA 5T1LB 1J8HA 1W8EA 2Y06H 3OKKA 3QJHB 5GS2H 5CZXC 5KVFE 2BZ7A 3D0LB 1TEGA 1KGJA 3O3EA 2X3CA 4DP1X 3LY6A 4NUGL 4R97B 1BA9A 2AEPL 2P8PA 2GYSA 4KNTA 4CKQA 3LAFA 2RFXB 1G7HA 5C0DA 2FH6A 2GSIA 4FTVD 2X9WA 4DKFL 1YZZA 3IBOA 4KI5E 1OY3B 3PHQA 1M1XA 4ZW3A 3NFPB 3WGUB 5BZDA 3DX4A 3MRRB 3P0YL 4OFQA 4TNVK 3W56A 4YX2H 5I6LA 4TSCH 3AGVA 1J88A 2YRPA 1VEPA 1WF5A 4PREA 1OCZB 1JHLH 1DQDH 5TQ0H 4RH4A 3E3QE 5HGGS 2KYIA 4EI0A 2HX8A 5SV4A 1J9TA 3BIKA 4JUTA 3R7QA 4U6VH 4G8GB 2HLFD 4RZCB 2CDGA 2J5LB 4PB0L 4FULA 4N9OB 1ZGLA 3IDXL 4WK4B 2EDWA 5TGBB 4WFGD 1A3QA 3T4AC 1BD2E 2V2TA 4HBCL 2OQJA 5IV2B 4BCYA 4WWID 5BZDB 3NFPA 4WI0A 1OE1A 3DVGB 3SDXA 3KPRA 5CUSL 4HCIA 4OIIH 5JUEL 3X12A 2NDFA 3V7AE 1F2QA 4D94A 5E51A 5K9QG 4XN7A 4BHUA 3D39E 3NCJH 4K55A 5DCCA 1WE5A 3MBXL 2JJVA 3ISRA 2X0VA 4OU3A 2AJUL 3B6SB 5DEFA 2Z4QB 4KGJA 2WHVA 2XZQH 3WHXA 5C09E 4XPTH 1JZ8A 3WJMA 1A66A 3QORA 1IAKB 1HHIA 4JMNA 5ANHA 4U3XA 5CMAA 4U1SA 2WNKA 2G2PA 1XAKA 1JPSL 1NLBH 5ITBH 4DP8X 1JTTA 2VZUA 2HVBA 3OAUL 4QRRE 3FRUA 4L8DB 5I1GL 3NPSC 3FH7A 2M1KA 1HIML 1YO4A 3BPLB 2Y25A 4JFHE 4Z7UF 3F7LA 1MNUL 5DZAA 4LXFA 3PCYA 4FG2A 4I9WE 1J9CT 1JTOA 1P53A 3J2PA 5J11C 2EXTA 3ARUA 4E9XA 5ICUA 5CN2A 2GIMA 2BDNL 3SO3B 5JIQA 3BUPA 5DYOA 1XFPA 1Y6NR 5BVJB 3CX2A 1FVCB 1W72A 4FFWD 2DEXX 3HE7D 1JUFA 2EO9A 2Z35B 3ABZA 3BVNA 4XNUH 5I6KA 4JRXD 2EDRA 1EWHA 2ZWYA 2B3RA 5LBSA 1MJ7H 4KOBA 4CGUB 4Z7UE 4BQBA 4EOWH 4YDKH 2VL5A 5DQDH 4PV1C 4ZPTB 3OR6B 4X5LA 4LVNC 3RVXD 3A0OA 3ULAB 5KYWB 1JZ6A 1FIEA 1YN6A 3OXSB 3U9WA 3PHSA 4LCYB 3V0WH 4QNPE 3PFQA 5I9QB 4E9SA 3G5YB 1U3JA 5LBGA 4UM9D 1G0XA 5HDQH 1ACYL 1KTCA 2P42B 3HHRB 5FF6B 5HPOA 1DL7H 4NGHL 4BFNA 1LEGA 3O6KH 3MNMA 3WXWH 4GP5B 1TVHB 4P2OA 4X9YA 1DUYA 1YEDB 3M7FB 4NCC1 1J0HA 5BXFB 4X8JB 2OM5A 1H8OA 4E9TA 1XB3A 4OFYA 1WK0A 3TZVC 3TH3T 1UVQA 2KLSA 3KPTA 2AJZB 3QAQA 2G75B 3GMNA 4W9GC 1GPOH 2E9JA 3D0VA 4PQXA 5A1AA 3MUUA 5IFHL 5H94A 5IK3A 1KLFB 3PS6A 4EDWH 1UM5L 1JE6A 4OKDA 1JI1A 2NY0B 4FS0A 1JHKH 3EJCA 4PWFA 1QFHA 2R1XB 5I5JA 2CHXA 4MSWB 5E4IA 1ITCA 5PAZA 4Z3GA 5FFGA 4BM7A 4O02B 2ATKB 1UWYA 4XMPH 3T3PE 1XX9C 1ZS8A 3MRMA 5D7KE 2Y1VA 2WY3B 4JREB 5IFJA 3X3GH 1ROCA 4N2HA 4JFDB 3TBYB 5GJTL 5FLUA 3HUJE 1FE8H 2G2NA 4FLQA 5E94A 4WTZG 2H32H 4PJHE 3OX8A 3VFUA 5LDUA 3I9GL 3RTQA 1A7QH 3TBBA 4AYDC 1WC7B 3MUJA 4RGOL 4JRYA 3MCKB 1TZHB 1N70A 4OLVH 4S1RL 4XGZB 3WEOA 4ONOA 4OW6A 4J6RL 3I50L 4IRSA 1OCRB 2OYMA 3T2LA 4M43L 1OSPL 1UQSA 3KLDA 1KFAL 2Y69B 3I6KA 1ZHKA 1IKNA 4JG9A 5SX4I 1E9OA 4ZMZA 1FFPB 4L0ZA 1WFIA 3GEFA 5HHNA 4X2UA 4XN1A 1E5BA 4KXDA 5I1AB 3I3BA 5JPNC 4XPBL 3WNJA 1JZ7A 5JOPD 1UXMA 4P48A 2V5TA 3QNYB 4DVBA 1CBJA 2HYMA 5CP3A 3BGAA 3CMGA 1IJNA 4PGCB 5ES4B 5DMKB 2UZYA 4URKA 2V3EA 5GXBB 2OFQA 4UOQA 3BEVB 5A6IA 3FO1B 3KH4A 2JB6A 2ATPA 1S7QA 3QUXA 2Q1EA 5CWSB 5HDBF 3ESMA 3SQRA 3K71B 4KJYA 1UA3A 1ACCA 4NI3A 4P2OC 5FK9B 2N0MA 1LNUB 2EXSA 1L6XA 2NY3B 5LXGL 4KRNA 4DCQA 4DN3H 5IR1B 1NPNA 4M7ZC 1E4KA 1LDPH 4XBPB 3TOPA 3HE6B 5T5NF 5FB8B 4UDTB 2WLZA 1AR1B 4MQTB 1BAFH 2Y6SC 3W0WA 1AE6L 3I6GB 4LHUB 2AGJL 4DK5A 2E8ZA 1I9RL 4OF7A 4XMKL 4AJ0A 1KCSH 2CE6A 2KPNA 4Y2OA 1NC2B 2OZ4A 1CGVA 4L9LB 1LJMA 5CCKH 4IRSC 2J43A 1BCIA 3PWVA 1U58A 3KWTA 5IBUG 2ENPA 4X0NA 2BRRL 2BNUA 2XQBH 1MN4A 2F6AA 3MRKA 1RMFH 4RFOL 4LMQE 3QUML 4TNEA 4N22A 1ET8A 4M1CD 3MRIA 2R15A 1OIOA 3EOBA 1Z9OA 3EH2A 2OR9H 5HVHB 3Q44A 1J05A 3MJ9L 4NO5A 4A68A 4NP4H 3VGAC 5IJBC 2Q10A 1CYXA 4D8PA 4FQCL 3Q2NA 4L37A 3RWDB 1J1OL 1B4JH 3FTYA 4YBLC 1MRCH 4BSWA 3F7YB 4N0UA 2FATH 4U3SA 2VKWA 1OCWL 4FG4A 5C0GA 1B3IA 1Y18B 2R2EB 4G1MA 4HEPG 4ZMXA 1IAII 4Q9RH 4X4YB 1PD0A 1S4IA 3F2LA 3IFNH 2XKNB 5K69A 2X2IA 4Y16C 5DMIL 3LXCA 4XNXH 1JWUB 2WVVB 2XG5A 5E0FA 1KG0B 5LCVA 2JCWA 4KVNH 3QSKB 4U1NB 4BZ2A 2IPTH 4JO2L 2PO6C 3AB0C 4D0DB 5CGMA 4PD4K 1OV8A 1E4HA 5I1LA 2PP7A 1S7RA 4H8HA 1PY9A 2YGVA 4TOYH 4PEEA 4QKXB 3AZUA 3RWFB 1JPTL 1ZANH 1A9BA 2B20A 3K6FA 2FJHA 4JQIL 4N0CC 4MCNA 2VB5A 4B9PA 1UD8A 3ML9A 4F8LA 5C09D 4HSAC 3QO1B 1P1VA 5E95B 3QORD 3JTSB 4HFWB 4XCEB 5E6RB 4PTTA 1WTLA 4X4XB 2B1OA 3EJTA 3SSGA 1J8SA 2CK0L 1IFHH 3D85B 3V5KA 3VXSA 1O6VA 4D9QD 3RG1C 5FCUH 3SCMB 1RZQA 1VF5C 1XR9B 2PPFA 4G6FD 1ETZB 2E74C 3MGOA 3WNNA 3ULUF 5K1NA 4FNLL 2BOCB 4GBXC 4TULH 3H4FA 4KHTL 3NQIA 3CLWA 4JUSA 3V4PH 4Z0XA 3EFFA 4JFEE 1QBLH 2ZG1A 3HN3A 3UTSE 4LCWE 3O4LB 1KSRA 3TBVA 3LKNB 4LAQH 2J73A 2WJ7A 1OP3H 3LH2H 4QGYA 2PMZA 3GSOA 1MIMH 4IS6A 4HKBB 1SFHA 2BLFA 2Y3AA 5G4MA 3QS3A 4JRFA 5HDBE 1G94A 3EW3B 4MA1B 2IH1A 2X9ZA 3BXNA 1FG2B 3TIDB 4QD2E 3U30B 2QDWA 4HJ0D 4UZGA 2MPVA 2DL9A 1C5DB 3ZT6A 2Z8RA 5DD5L 5H4YA 3HAEB 4KNQA 2ADFH 2VLJE 3O41B 2G2RA 3CXHJ 4YDMA 3QA3A 3V5HB 3QR1A 3X11A 4OCYH 4JGMA 3IJEB 5DZVA 1Z9SA 3T6VA 1LEIA 3HNVL 1NCAL 2AEQL 5GS0D 5EFIA 3DX2A 4KX9A 2J2ZA 4KX8A 5HI4D 5TH2A 3IGFA 1HOCB 3UG5A 3MGTB 5HHPA 3GTNA 3NVQA 2PTTA 1PZ5B 5IIEA 1HQ4B 1GYUA 1MFAL 4UMSA 1IM9B 1C5DA 2LOEA 3QDJB 4J4PC 4M9PA 1GC1C 2DM3A 3L5IA 2IALA 1XGQB 1PX3A 3I6LD 1CDUA 2DLIA 3CDZA 4R0LC 1TZGH 3IDUA 3GSNB 1SJVA 5KEZA 4NP9A 3VNYA 3W39A 2IC2A 3O3DA 3SDDC 5DD6A 1QO3A 2OZ4H 2XUWA 1I7TB 1XH2A 4MXQD 4UT9A 5HJDA 2ZOTA 5EG6C 3FQ2A 5KOVC 5FGSA 4EEEA 4RAHA 3WAKA 3T4AA 1B90A 3F65A 3FO2B 4ACPA 4ZJ9A 1TDQA 1U3YA 4XNYH 1YAIA 2QZQA 1OAXH 4MJ2A 4KK8C 1BOGB 2CA4A 1AP2B 4AIOA 1SN2A 4XXDA 2O61A 4LKCB 5TFSL 1IAMA 3MKKA 5D5MF 4EIGB 3WN5C 1ZHBA 1NBZA 3K2KA 2HTKD 4PMEA 1QHOA 3GUTA 1XEDA 1MAML 4JRYE 4LPCA 1CGSL 3HLAB 4NQDA 1BZDA 5TPWL 5HD8D 3TONA 1X9QA 1F6AA 4I89A 2WZAA 2G4GA 4L5FE 3FHAA 3SD2A 4X0KA 3FUFA 3OKNA 5DMJB 3GXUB 1NH6A 1ORSA 4Q6IA 2OJEA 1FYTD 5H2BB 1IL1B 1NCCL 1CGUA 4W9JC 3WKMH 4DNLA 2G30A 3BD5A 1Z9PA 3BZ5A 3CNKA 4ELMF 1LP9A 5AG9A 5HVWA 4J2XA 3LIZL 4PLKC 2XICA 3FQUB 3FFCE 4N1CA 4XXDB 5E5MA 2VSKB 3KPNB 2WLIB 4HIHA 5KJRL 1ZPLA 1U92A 1YJDL 1RUMH 4LHQB 1D6VH 1TJHH 3KXFA 1RLBA 3BT0A 5D6CA 1JZFA 2YQGA 1BF8A 3L3HB 1CL7I 2DQDH 2QGCA 2KPWA 4APQC 2QPUA 1IGYB 4WI2A 2YRLA 3INUL 4KVPA 1T7XA 3VMOA 4FYRA 5IOPB 2WC7A 3BEWA 4AQOA 3NA9L 4Z7AA 4IDJL 3QR0A 5F7HA 2W92A 2BJML 4IEFA 5AW1B 5I1GH 2R0LH 4NENA 2NTFA 3NZHL 2WYHA 3U0PA 2GVYA 2B9AA 1NJ9A 4JE0A 1UZ8A 4HGMA 1EVUA 1HHKA 4Y5VB 5EZLB 4JRXE 4A38A 2ITDB 4XZUA 1OK0A 3D3VD 3TASA 2XACC 1J0IA 2NXYC 5FLVA 1UZ6E 4YIQA 3ALWA 1T03L 4ELKB 3DX6B 1FYTA 2E0PA 1VFAA 2R2BB 1W8OA 2FEEL 2HUHA 1T0PB 4JANA 4O58H 4YDVA 2I5YL 3NN8A 1YY8A 2WLHA 3WG7B 3HFMH 3L7EB 1W6LA 1T1XB 4S11A 2P4AB 3T3PF 4X8CA 4UAOB 1GGIH 4MNQA 3Q2LA 2J4WH 3HZ3A 5ENWA 4G8AC 3NCCB 1U4FA 3MRLB 5DZJA 3ROLB 4UZSA 4I3RL 4A6YB 2I07B 1O7DC 2VDRB 2NMSA 4HS3B 5B8CB 3LDBC 4YLCA 5GRUH 4YHNB 4Y4FA 3ZDZB 2IAMC 1N26A 2O1AA 3D1MC 3QE5A 3F6IA 1HSAB 3FQ1A 3UEZA 4WWKA 2BCKB 4FQQA 1DVZA 1S3RA 2J1WA 1HQRA 3TO4C 4XX1G 4QRPD 1NGPL 4HAKA 1FHNA 1I1RA 1KTJA 4ES8A 1UCBL 1AQDB 1M7DA 4KKQA 1TUPA 4M6ML 2HT4D 1N8ZA 2P47B 3K6DA 1DSYA 2DBLL 1FNHA 3S96B 1BFSA 5HHQB 3PWJA 3UTTD 5TDOA 3SQBA 5F7UA 5D1ZB 1MFCL 1MLCB 3PV7A 1WSST 5IVXA 1XZ0A 2FGZA 3TBTB 2V5RA 1PGRB 2VISA 1MRFH 3D50A 4NZFA 2SODB 3OLEA 2FB4L 3RGVB 5BRZE 4A7GF 3DVFA 4JLRA 5T3XL 3QUYD 4GRMB 1C9SA 4WFHD 2W88A 4YE4H 4HS8L 3VFTA 3F58L 2W0FA 1BFVL 3RY5A 4N5UA 1W0YT 3PWPA 4IU3B 4WW1A 4KJQD 2WPGA 3GSWA 3KBPA 3S34H 2WXNA 4KZEH 4CJ0A 1AGCA 2WSKA 1XF3B 3LKPA 2F8OA 1ZT4B 5JMRA 5D2LA 3O6FC 4DKEH 4GNKB 4G80B 2EIMB 2GJPA 2X70A 5GS3A 3QRFM 2WINB 2F53D 3CC1A 3I9IA 3G6JB 1ZTMA 4P4KC 3RQ3A 2ATKA 4MA1C 4MA8H 5GJTH 3FS9A 5K39A 4R90L 5D1QE 1I1YB 4Z76A 2MCPH 5INCB 2OXGB 1T20A 1ZJAA 3E1ZA 5K9OA 3FU0A 5EZPA 2WZ0A 5E24E 2C1OA 4GI9A 5DRZB 3I9GH 4F58H 5LB1A 1HHHA 5DO2D 1JYNA 3SPJA 1NC4B 3BYTA 4OLVL 2WJ5A 4UQDA 4K7PL 5FA3A 2WXMA 4X7CC 1MXGA 2NW2B 2AERT 5BW7A 2ZCKL 4K5PA 2AJZA 1YG9A 2VLJA 2VH5H 3ARDD 3F85A 2J6EA 3QIBB 1FAIL 4G7VL 3E8UL 5KAQF 3BAIA 3N41B 4ICXA 4Y16A 4FXKB 3U9PL 2GI0A 4Z7QF 1Q1PA 1HEHC 2P8LB 1WITA 4UUJB 4PB9L 4Z7VF 4Q0XL 1MG2C 2FTAA 1HHJA 5C0CD 1L7TL 1HL8A 2WXIA 2EDEA 4L2YA 5EULV 4LU5H 4LDEB 4RQQA 1ZHBB 5IOKA 3VDBA 2G3ZA 3MROA 2VABB 4AKQA 2R4RH 1Z3RA 4K7FA 2LU3A 2WLNA 3SCMC 4FHKA 2WXOA 3GSNH 4JFDE 1E28A 1Q0EA 4TQHA 2GB2A 5AKVA 1MFUA 3VXMD 5I0DA 3DNKA 4JHBA 4JPIB 4E68A 2ZSVB 1IZJA 2NNXA 3AS0A 4QY8A 2VRAA 2HSIA 2Y7NA 2Z31A 3LN4A 4PJIF 1NOFA 1IGYA 5FM5M 1DQKA 4QXTA 5DMGC 2L7EA 3G04A 3R06A 1GZPA 1CK0L 1XH3A 3DO4A 4LLVB 4OBSA 5KSAB 1ZKAA 1AOZA 1BEYH 5CCKL 3HTLX 5EUOF 2QT6A 5AVSB 1IFGA 2CALA 1HYSC 2ZUQC 3NFSL 1RPUA 3EBIA 2DYRB 4BK5A 5JA8B 4P2RD 2VE6A 2DL2A 2P49B 1JV5A 2JCCF 4F80A 4QHLA 4K3HA 3IAQA 1D2OA 1BW8A 1FJ1B 3NIDB 4ZAKC 1KN2H 2XWBB 4X5PA 5FWRA 4QT5B 3VGGA 3QZOA 1O9ZA 2QVKA 2HLFC 1T7ZA 5C08D 2M2DA 2IWEA 3HLKA 2O5NA 3ZHLA 1SFDA 3QC5X 4OF3A 3JWNE 4UF7C 1J12A 5I0WA 5A43C 3G08A 3I2CL 1F6AB 3L45A 4P23B 1SJXA 4HXAL 1ZLUH 4X4ME 1U8NB 3PNWA 1K2DB 1HS6A 2WOBA 3C09B 4JE4B 4A2EA 3NJJA 2XWDA 3QO1A 4W1TA 4R26H 4HALA 1ZT1A 5E2TL 3B9KD 4G8EA 4J4PD 3G6JE 3MR9A 3WJMB 4G42A 3OMZA 1CU4H 5DTFA 2QSVA 1CC3A 3FQRA 1I9EA 4F7MA 1UYWH 4WWKC 2VQUA 3GTVA 4DEWA 4TSBH 3RHWF 5CCGE 4EIBA 4GT7A 4HIXH 4HDIB 4JAMB 5AVVB 2N3JA 1IKNC 4PCKA 1OGAA 1KG0A 2WVVA 2ZXDA 2PPCA 4QR7A 3VXPA 1R0AH 3QFGA 2QQLL 3EGSB 3LRKA 1VADB 1MH5A 2W80C 4OLYL 1A4CA 3GO1H 3QJFA 4AYSA 1KPUB 4HV8B 2J3SA 3FQTB 4K3DH 5FECA 5I66A 3KLHD 2CDGB 4EQ3A 4OV5B 2CRYA 1I1AA 3LEXA 4CC1A 2VW7A 2J5LC 5T1DL 1DJWA 4KQ4H 1B0RA 3A6BH 3FDWA 2P3YA 4L48A 4ONGL 4PTTB 4KTDH 4NO5B 3FQNA 2E7CA 1HOCA 1IFHL 4MDRA 3U83A 3V0VB 5LNGA 3GPEA 4B9IA 1NIBA 3V6OE 2J8UB 3VFRA 3KLLA 2CDEB 2ITEA 4M1DL 1UGKA 5F7YC 2EABA 2VJXA 4WJG3 2W81C 3CLFL 1ZA3B 1XTMA 4GUPB 4K15A 3HUJA 4E41E 2LE9A 1CGXA 1KXQA 1BZ7B 1NPJA 5E2VH 1JRHI 4W9ZA 4QRRB 5AFAA 3ZDZE 1QBLL 2G9KA 4XX5A 5F44A 2LAGB 2EUXA 3NJLA 1G43A 1L3WA 4DF9A 1UURA 2X53A 3CHXA 4JO4L 1JWUA 2ED7A 3PJSA 4BE6A 1ILSA 2JJWA 4JQXC 3UJIL 4WGWB 1G4RA 1QSFA 3IF1B 3UMNA 3WMQA 5C0AB 4NRXB 2MNUA 5TDNA 1BM3H 1ZSDB 3AS2A 1I9JH 3KGSA 5CGYD 1EUUA 3LKSB 3OQRA 1SOSA 3LPWA 5GSRB 1XGPB 2OXHB 1BD2B 3DYMA 4I4WA 2J5WA 2EACA 1OE3A 1V54B 4KUZL 2FSEB 1KGIA 4N6QA 3SCMA 1AQKL 4IRZL 3RWGB 5HGBA 4QYAA 1K6QL 1GS6X 1H9VA 4ODVH 1QMUA 4GFXA 5FGCB 4OCSH 1FVEA 3R1GL 1PMYA 2YGOA 1QI5A 3TJPA 5C0RH 3ISWA 4HLZH 5TF1L 3RGVD 3AACA 1F8TH 3U2JA 5I5RA 1XAUA 3B2DC 2GBAA 1RZFL 1UD3A 3SPIA 4UYPA 4M48H 4F5CA 3J07A 2YWZA 1R4XA 1DSFL 3AXLA 3QWNA 1WC7A 3CMOL 1LO3H 1EJ8A 3B2MA 3WSQL 2XTJD 3C75A 3O9WD 4W6XB 4MAZA 4WUUD 3VFUB 3W82A 2GIXA 2F0CA 1J1XH 5EU3B 1A6AB 1OAXL 1I8KA 4U1MB 2OI9B 3UJJL 1A3ZA 5DSCB 1G7IB 2MWCA 5F72S 3RUGB 1FRGH 4Y5XA 3EDDA 3QQDB 4JFYB 5KVMC 1G7LB 3FYEB 5GZOA 4F9PA 3K5RA 1MCLA 1UD4A 4LHUD 4NQUA 3KL0A 1UB6B 1U8CA 3ARDA 3PREA 1QLEH 3NZUA 4HF5H 4NAMA 3P40A 3HRZC 1GIGL 3QNYA 4UT9L 4FADA 2EINB 3T77B 3RVXC 2ZKMX 2D0GA 1XSIA 2DKUA 3GSXB 1BD2A 5C08E 2UY6B 1AC0A 2BVUA 1DVSA 2BW5A 1VGKA 2CIIB 3LXBA 2HJFA 3DWTA 5TDNB 2KZ1B 1C08B 1CR9H 1CI3M 2EQDA 3O45A 1CDJA 4EE2A 4HIPA 3MCKA 1RVFH 3L7EA 3DDGA 5DS8A 4XAKE 3TH2T 1GY2A 4V33A 1IGIL 3IPBA 3TL5A 3GJEA 3LVTA 5D71L 2E9IA 3CFEA 2BS71 2BVPA 2FLMA 2JK5A 1RUML 2L4OA 4JZOA 4QOKE 5D8JL 5DD1H 1OAYH 4BH7B 3MLTB 5I0YA 4AEEA 4TLTA 1VERA 3I9AA 4G6FB 4Y7MA 3O8XD 1MFVA 1NAKH 3I02A 3I6GA 2NOYA 2VXVH 4JFHD 4KO7A 4LHUA 4O4YH 2AHIA 1MCEA 1O9VA 3NJVA 4JKPH 4GS7B 2EIJB 3FN0L 3O6FD 5K59F 3C5JA 3RU8H 1EIBA 3KYNA 4CJ1A 4M1GH 4FQLH 1KB5B 2GIYA 4IDJH 1GYAA 1UACH 1RXLA 2XPGB 3E8VA 5CF3A 3U0PB 2FH8A 3GXMA 4NZTH 5EWIL 3U4EA 3A4FA 5KYYB 5JW3L 4LCYA 3EHBC 2YIHA 4O9HL 3SYPA 4U1GB 3VACA 1BQHA 5I1KH 5EEZA 1FIGH 4LLDA 1CE1H 2AXFB 4TLUA 4RX4A 2YRBA 1TJMA 3DV4A 4JW3A 5I6OA 1ESOA 3FT1A 3FRPB 1QR1A 2B14A 3LQMA 1TZIB 1YUHA 3HHSA 5DURB 4UOW1 2ZKXA 3EH1A 5HHXH 3BOVA 3B83A 3MUGA 2NY0D 4PJHB 1LLAA 4K23H 5IB3B 2BY0A 1CBVL 1IEHA 3V52L 3NJNA 3TF4A 1N59B 3GMLA 2EVJA 3WN6A 1FCGA 3TTYA 3FSAA 4XCCH 4Z7WF 3ME0B 4LCWB 1CS6A 1ZTXE 2F8VA 4LASH 5EU7C 1L9NA 1F45A 3IN0A 4HKXB 4PRHB 1ET7A 1A4KB 4PWJA 4OUOA 4LLQB 1U3HA 2DD8L 3EGXA 3O81A 1BJ1J 3VFOA 2F5BH 2QGDA 1I8MA 2R0KH 4ZD3L 4E42B 5HYSA 2W0LA 2C9SA 3KYKL 4EN3B 4MS8D 4POYA 3DK0A 3WJJA 2FBOJ 4LK4A 4Q89A 1NAMA 4A6YH 2WWMC 3ZO9A 1UWEL 4FQHA 4RMBA 4PRPE 2BVOB 5BZZA 3TBWB 3QQNA 4XC1L 2VE6B 1N3NA 1KIPA 2NY1B 1WA0X 2HTKC 4U05A 1AHKA 3ZQ9A 3T2OA 2E6QA 4XX1E 5JW4N 4LCUB 3WNKA 1J11A 3KH3A 2D9CA 4YE4L 5DD6B 4LSSL 5DZOA 1O5PA 4IM8A 1NEZA 2H41A 2IOIA 4P2AA 1SYVB 4LCWD 4CUCA 4N68A 3LNGA 1DQLH 5AL8A 3KYMA 4N85A 4YNYA 2HH0H 1KIQA 4RZCA 5GJSH 1GJWA 4UB0H 1N5YL 4K94C 1P4IL 4LOUD 4PR5A 4Z7WE 4OGXH 1ODAA 2VERA 4L05A 4OJCA 3UERA 2UXTA 5BXFA 5EU6B 2PP8A 2AKRA 1BVKA 2DIAA 3JXAA 4NN6B 1HYRC 3WDJA 3KDMA 3DX8A 1NFDB 1DBML 1OTUC 5IJKC 2VCOA 2PW2A 3ZHDA 3QORB 1S7TB 3T2NL 2EH7L 5HPMA 5T33L 2BHFA 3RKPA 1UB5A 5EEWA 4KHXH 4LQ1A 4X6BA 1E4JA 1M1SA 2H32A 2X44D 3QA3B 5FOJA 3V5HA 3WNLA 3IYLW 1I85C 3RIFK 1VACA 3VXRA 1CXIA 1GH7A 4HUNB 2Y36L 4MX7B 3HN5A 2QPFA 4KPHH 2JTDA 4TPRL 1EUTA 4UUJA 3T9WA 5ICYA 4GSDL 3BUYA 3QG6B 3O2WL 4LCCB 4LPUA 3RL2A 5FYLD 4PRNB 3MFFA 4IRSD 1DLFH 4A2HA 4D7PA 4F92B 1AR1D 3PL6D 4CMMA 5BPPA 2XLLA 2XOTA 4BGDA 4FQ1L 4IS6B 4AENA 3ZTDC 2X38A 1HDMB 1J18A 3QUKA 1X9UA 3TU6A 2FD6L 4MNGE 1NBCA 3R19A 2F58L 1J0YA 1XGTA 4ABQA 4LU5L 1OTSD 4P5TC 3GZPA 2ARJB 3ZTCC 3AUVA 1MUJA 2WQUA 3IETA 3FU7B 5E0QA 3F6LA 2QQNH 1I4FB 4Q52A 3CPLA 1N9PA 1M2VA 3MRFA 1FC2D 5B1CA 3RY6C 5DT1H 1L9MA 4NKIL 3KPPA 3CIQA 1TCRA 3DSNB 5C09B 3V5KB 25C8L 3CDGA 3T0EE 1YEIL 3AG4B 2VDLL 2PYEE 5IQMA 1A6VH 3QARA 4MRCA 2HG5A 1S3KH 4W70A 5I6XB 5ID1B 2PPEA 3JV0A 5BJTA 1Q1JH 3CVHA 3N0AA 1MQKL 4U1SB 4GFTB 1MW1A 3ZKMD 1UWGL 3ETBJ 1KPRA 4Z7VA 2HX7A 5T1LA 3PAZA 1CXFA 5B21A 5C9JA 1YEGL 2IBZY 5AVYB 4UIMA 5TE6H 2IFGA 2ZONA 1S9YB 3QDME 3W5MA 1EHXA 4LP5A 4NCDA 2P52A 3BPLC 5HVFB 3LYRA 3M8OH 4FERA 5ACZA 2HJKA 2P5WD 4KQ3L 2K6WA 4GKZA 4YX2L 3SBPA 1FFTB 3MV7A 4MCZB 1ACXA 1G7MB 3BZEA 5KW9L 3MRFB 4MDIB 4XN8A 5J57B 3OKOB 4XOEA 2IAAC 5T3XD 4DZBB 4EI6B 5C8JB 5DI8B 1ZLUK 3H8NA 4LCIL 1XCQB 3EYQC 4H2AA 2NNAB 5F7DB 2OMTA 4YK4B 4ZO6A 3APFA 4UBDC 1S9KC 2XBTA 1NCIA 2IPKB 5IZ7A 2CGZA 5T3ZD 4UM9A 2MNWA 3QWRD 1ULVA 4LQFH 4UIKH 4KRLB 1B9ZA 4WEUD 4Y16D 4IMKA 5F9OL 1U2CA 3T8VA 1PL3A 3H3BC 5ISZE 4OIIL 2F53E 4ANKA 1U91B 2A1WH 3QCVH 4CADA 5FEBA 2F7IA 3P3RA 1N0XH 2IV8A 3T0XA 1DJSA 1NSNL 3MNDA 1NANI 5I1CL 3A4DA 3CVDA 4TSBL 3VWKC 3IGLA 2OYPA 4M93C 3T6QC 1Z1WA 4HIXL 2VDOL 4F24A 5T5FH 1E5UI 4GUQA 3RVWC 1FO0A 2P8PB 1R5IB 4F5CE 2XZQL 1FH5H 4PM1A 2FHBA 2VRKA 4XOBA 4QXGL 5GIRA 5EN2B 2E3VA 3NZ8A 3RJQB 3CFNA 2H45A 5KVGH 2Q7NA 5J6HA 4NM4L 1ASOA 4H44C 4OLYH 4IKJA 4YEEA 4ODXB 1A1MA 4NC0B 1T5KA 4JPKH 5FAAA 1NC4D 2BXYA 2OMBA 2WTPA 5SX5K 3RI5K 3OVUB 1Y0LA 1JF5A 5DVKA 4K71B 2VO5A 4KZDH 1EK3A 3OPUA 4NHCH 4WWOA 1D5XB 3SBWA 4B7LA 1V3KA 1II4E 5D7JC 2BCMA 1I1FB 1SOKA 1YEHH 3NIFF 3R0NA 4M1DH 1G6RL 4AK2A 2BOLA 1MFBH 1WAPA 1KJMB 4ATTA 2Y5TA 5FFLA 3KXFD 2NYKA 3U4BH 3ZE0E 3D51A 4W6YB 4AGQA 3HMWL 4OF0A 1RUPH 3RBSA 1G0DA 3L4YA 5DQDL 1QWUA 1VFBB 2BSRB 2AQPA 4JM2F 2Y72A 3QPQD 1ETB1 1RZ7L 4PJ8D 1KMGA 5G4NA 5D7LD 1IARB 4UINL 4ZODA 4GRLB 4J3WA 4ZUVB 4OJAA 4XWOD 5CIPH 3NIFE 5HVHC 5GQBA 5I82A 5HHOA 4Z7NF 2BSSB 4X7DC 3P77A 5EEUA 4ZO9A 2HB0A 2WBWB 4FQJL 1WAAA 5H2BA 5CLZA 1AFVH 1DL7L 3EJJX 4BELD 3S5LG 2CCLA 3JWNG 1PIGA 3BI9X 4ISVA 3BMWA 3ARVA 4YSRA 5DHVB 3C60B 5F21B 3ZE2E 4X7TB 4G6JH 4CW1B 4KJWD 4B96A 3UTSD 4TKWA 5EEXA 1ITBB 1NUDA 4FQXB 2V7HB 4J2QA 2WAHA 1JZJA 2FBJH 3LKOA 3TT3L 4O02H 5H4ZA 5IQ9B 3L8QA 4OI7A 4UNTA 3W0WD 5DJXA 3MBED 3FQWB 2O61B 3CZFB 5JHAA 4YLBA 1R34A 3GHPA 3SDAD 1T1YB 4JHAL 1EEQA 4ZAKD 5AD0B 2H9GA 1PG7L 1BZEA 4YSAA 2EZ0D 2Q8BH 4N0YH 1QWNA 2VM9A 3HG1E 4YHIB 1EZUA 1X5AA 2P9RA 1QKZH 3GIZH 2GJZB 3A6CH 2HKFL 3KPQB 3RB5A 1KLFA 1XF4B 3SKMA 3QFDA 1DJGA 4HS6B 1SN0A 1WCBB 4YHZH 1BIIA 2HA1A 1OSZB 2OTWA 1GAFL 1NDMA 4D0CB 3Q1SH 2B0SH 3IWVA 5EMYA 3KYOA 1I1FA 3KJ6H 5C0FB 5C0BD 4LNRB 5DRNB 2FR4A 3OTTA 3MMEB 1Y6MR 1E4KC 1FPTL 1KB5A 2IALB 4RFEA 5IMMB 2E27L 4AI7A 2AV7A 4N2NA 4RLDA 3LS5H 2IANE 4AYGA 1P4LB 3ABLB 3D18A 4HJJH 2J55A 3FZUD 6FABL 5KANG 1KCVL 1DUYB 4Y2LA 3QDGA 4JQVA 1S9XB 2MHAA 4I3GA 4XMLH 2KT6A 4KUCF 4G8GE 1IIIA 4AM0B 1G9NC 4QTIH 2HT2C 1JGIA 4NOFA 1USQA 3NZ8B 4X9GA 1MY5A 3MCLH 3BLBA 4GLRH 3AVEA 2BINA 3UC0H 2GT9B 1YPZE 2APWA 4QRUA 1IGFL 5I30L 3T0AA 5MERA 2J56A 4OLWL 1MHPL 3BIBX 1JJUA 3FT2B 1TYEB 3ROOB 3CFJA 3LQZA 2R7EA 4XN2A 1PSKL 2CIIA 1BF2A 3I85A 5E1AB 1JIBA 4XP4L 4JCWA 5HI5C 4EUPH 5HI3C 2OSLA 2R29L 4N87A 4DGUA 5D71H 5KBMA 2OP4H 2GW5A 3Q2CA 1FZOB 3V4PA 2C8NA 4UQBA 3O0RH 3F7VA 3CQQA 1Z9MA 2VOTA 1V10A 1L0YA 1AGDA 2VUKA 4Y5YC 2KH2B 3BH9A 4UU9A 2LAAA 4FZ8L 1HH9B 4LOUC 1KEGH 2JB5H 2L0DA 2Y5TB 5ILTH 2OMTB 5D7IB 4JEGB 2IPUG 1M3JA 3ZVVA 1LXMA 3HZMB 3CN3A 3GIVA 4ABUA 1J9RA 1GYWA 5J12C 5KVEL 1AQHA 3DBXB 4JZNB 3VI4F 4D7BA 5T3XE 3FU3A 3C2SA 4JDVB 3TX4A 2D7PA 1CGTA 3LN5B 4GMTL 4ZAKB 3PWLB 3KE0A 2D73A 3HI1B 3MRJA 2W94A 4LL9A 3QUZD 1FL5B 3N43B 1FIGL 1Q9LA 4KTGA 1IC7H 4AG4L 5F6IB 3VB8A 4Z5RB 4QRSA 3UZVA 5J6HB 1UH4A 4R2GC 2COVD 2QGBA 1YNTF 2A77H 3D2UD 2VR7A 3LZQA 1XL4A 2MTPA 5T1LD 3V6ZA 1J9QA 3PWLA 1LO2H 4LOEA 3EIFA 4PJ7A 3C6LB 1KT2B 3CD4A 3LEVL 3VH8A 3B2UD 4H8WC 5G5DA 3L3OB 4I48B 4L8CA 1JL8A 4GSXA 3CVHH 1U91A 3HZMA 1G7JB 4XCCL 2DM2A 1JVKA 2VJ0A 3VWKB 1I4FA 4P9HL 5LVEA 1OKEA 3BVWA 1XGPA 4Z23A 4MAYB 3CFKA 1OB1B 5E99L 4QRPA 4N0UB 4BSWB 3BIKB 2DQIL 5F7KC 1KGCE 3HS8A 3UBXB 5KSAC 1GTNA 2F5BL 5ICZB 4XNXL 4FJ6A 5TK2A 5BMFL 2WXLA 5I1EH 4NPKA 4I48A 4L8CB 3QFJE 2YXMA 2G0KA 3CU7A 4M02A 4N2LA 4QHNA 5DJDB 3OKMA 4KO5A 5EA0H 3QG6A 3FONA 4M5YL 4ADIA 1MCIA 2KQMA 4AUUA 4L23A 4F57L 1SY6L 3PQYB 4TOYL 5F89B 3VX0A 1XF2A 2BNUB 3RFRA 4CSTA 4HJUA 4YGVB 4G5AA 3KJ4B 4N2OA 4DP5X 3RDJA 2Z7YA 3RDTD 5IVOA 5D9SA 1NM4A 5JHLL 3IRZA 3KZ8A 4ZTOH 3N41F 2P5ED 5FW6A 1D5IL 1E50A 5EC1B 4ALAL 1TITA 4FLRA 3QZBA 4WEBL 1RH8A 5I9QC 3ASNB 4R4NC 4FNPA 1FNAA 1KLUA 3CN1A 3V4VA 4CNIA 1F5WA 3MRJB 2D03L 3HI1A 1C1EH 3EYSL 1SVZA 4XODA 2O6DA 4XO4A 3T1FA 4JVPA 3QUXD 1R3JB 1FL3B 4OFIA 5HGAB 5C09A 3DSNA 1PF3A 2UZXA 4TULL 4U33A 1H3UA 3B2VH 3V0EA 5E1HB 4I0PB 4Y2DD 1P7QD 5FYJD 2DTMH 2Q76A 3S3BB 1S7QB 4O00A 5CP3H 3FU7A 4H8UA 5EN3A 1K72A 3KMDA 3ESPA 1D5BA 2ZSWA 1H0DB 5F6HI 5C7XL 3V9FA 3LV3A 5AVUB 4UV4H 1TQCC 4E36A 2WQAA 5I74B 1EGJA 4WHYG 4GQPH 3W11C 2XX0A 3QYCA 3X3FH 3B7TA 3FXIC 4FQHB 5A2BA 2ZXBA 1TVBB 1M9SA 2VLLA 2OMWA 1JXDA 2X4SB 4XMVA 3UP6A 4FCHA 3ARPA 1N19A 2EE9A 3MFFB 1B4TA 1T2XA 1VZIA 1RZKH 4PRNA 4DTGH 4PJ7E 5ID0A 4EN3A 2ADFL 3DHPA 4APXA 3H3KA 4DK6A 3NSDA 1JZ4A 4YHYB 1A7OH 1FGNH 2YD1A 2G3XA 4JFFD 2AZUA 1LVEA 4LF3B 4K5OA 4U6TA 5B39B 3O3BB 1P9MA 1ZXQA 1IAOB 2VDOB 1PDKA 2FEEI 4HFUL 2ZXEB 4AM0A 1F56A 2XWZA 4KDVA 3UYOD 1MJUH 1NMBH 3AXIA 4FFYH 4N9GA 2NT1A 1MF2L 4JQXA 4QT5A 3ZT7A 3KDMB 1N64H 1F90H 7FABL 2ZX6A 2B5IC 5LXVA 2V9UA 4AH2B 1A6VL 4DEPB 4JHWH 3P4OB 1ZS8B 5DS2A 3QDMD 4UAOC 3MV9A 1BYNA 4MXVE 3A5VA 3I74A 3EOTL 3DTDA 4H20H 1MCOL 1MCDA 4MNHA 3FOMA 2V33A 5ANMA 7PCYA 3EFDH 4LCUA 4KAQL 2DM4A 4JM2B 35C8H 4XNMB 3OG4B 3RWEA 5IT2L 3HG1D 1YCSA 2PLTA 4AEIH 1IB5A 3HZKA 2NY7L 3KPQA 4Y0GA 3DJ9A 3ZE1B 2VXQA 4FA7B 3VWJB 2ZAIA 2Y07H 3POCA 1E28B 1CFVH 2IIJA 4K7FB 1HCZA 1RP9A 4ZOEA 1KYFA 3DVIA 4YDLB 3HC0A 5KYUB 1AHWB 3JWOH 1F02I 5CHNB 1TLMA 4LIQH 2PCXA 4RIRA 1BZQK 1Q94A 2FEDD 3FFCD 1DVYA 2WGXA 5IVNA 4XBEL 1G5GA 3O11B 4PRHA 1OB0A 2DWTA 4HLZG 5C92A 4LRIC 5GGVH 4JO3H 1A6ZB 2GJ6E 1IAOA 3VD4A 3V0HA 3QI9B 1PJ9A 4IJTA 5B1KA 3ETTA 2MIZA 5EORH 5GRXG 2GEQA 3GMLB 5DLMH 3UZEA 5E8PB 1LM8V 4Y19E 4D9RE 5INDA 1NGZB 3GGWA 5LBSH 4MD0B 3KR3H 2W9LA 2X1WL 4APXB 4JRYD 2YPVH 4UOW0 2XQYA 1EX0A 4XXCA 2WXGA 4RFNB 3DXAA 4ZQKA 2WW8A 5GSVA 4ANVA 1H3XA 1X6NA 3VYNA 4K07A 5LLIC 3EHBB 3TNNB 5GGUA 1ZA6A 5IHLB 1BIHA 2F54A 4TN9A 3RKDC 2BSRA 2DAVA 3CBRA 4NM4H 3UGUA 1UJ3A 2Z35A 4AW7A 2HRLA 1RSFA 3FCSA 4FG0A 4LLDB 3HB3B 1RKRA 2A9ML 2AXGB 2VWEE 3T6XA 4P3CH 2AJ3B 4X7EC 3OKEA 2ZSWB 3P9WB 4Y9EA 5IJKA 3GJFB 2YXFA 4NKDB 1XCQA 2YEZB 2CO4A 1DE4B 3QDGE 3VD7A 2D4DA 2ESVA 1JRHL 5IBTL 3PGDB 4Z8FH 2BNRB 5EV7A 3WIFB 1IBZA 3LS4L 4NYLA 3ZYOA 5CILH 4IJ3C 2KBGA 4RESB 3MV9E 5I75C 2A9CA 4I3SL 5DRXA 1ERNA 4ONFL 3BZ4B 2Y23A 5DYFA 3MLTA 4DKAA 3X14A 4WI5A 1KGUA 3M86A 4PRIB 1D7DA 5I1JH 1BZ9A 1S5IH 3RNKA 5L8KB 3VI3F 3PJLA 2H26B 1XSOA 4QTHA 2YK1H 4RSVA 4KFMA 4RMWA 5BQ7A 1U8KB 5HGDB 3MO1A 5F8RC 3WJJC 3ATAA 4K8RH 1U95A 2CLVA 4KV5F 3E6FA 3NEXA 1H5BC 2YD3A 3UC2A 3BAWA 1BPVA 4TUJB 2GFBB 4KDTC 1PAMA 3ZYIA 3ARFD 1CD8A 3QWOA 3TFKC 3VI4A 3TIEA 1U6AH 3QIWD 4OZ4A 3ZTJG 3ASWA 2G60H 3KXFE 2VR8A 2Z8VC 5SWZE 1GGCL 1QNZH 5CFAA 4M7JL 1UXWA 2BXZA 2FAUA 2QMKA 3OC5A 4PJEB 3WXVL 3QGVA 5AVWB 4QRPB 4XCYB 1CL7L 4MQXC 2WXQA 3VYOA 5J06A 3T1WA 2ZUXA 5KTEL 4PREB 4JFYA 4FTVA 1AIZA 2DBLH 3QAZB 3SE9L 4POZD 1PKOA 4JFPA 1AYOA 3RUGA 4NSKA 1XR8A 3CAFA 5E2UH 3S35L 3DV6A 5FKPB 4YDVB 3Q06A 4NBXB 3DA0A 4JRXA 5AWNH 2Q8BL 3DJZA 4R2GD 1K8DA 3QIWB 3S2CA 43CAB 1AIFA 4ELME 3X1GA 4X6EA 1YEJH 3NP4A 3NDZE 2HFFB 4JN1H 1S9VA 2PYFB 1YN7B 4PGBB 3V0DA 3S34L 4J1UA 3EJZC 1KGWA 4IRJA 1XCTB 4L3FA 2H2PC 3IE9A 3NPZB 4MDJB 3ETSA 2H1LM 3BSZA 3FQ4A 4BE5A 1Z5LA 5L2JA 5L6YH 5B4MC 2HFGL 1KBVA 1DANU 2R0ZL 4QI3A 3EOAB 5FR3A 1DHKA 1EFXB 2H47C 3CK0L 3OAWA 3W57A 3WFCH 3TC9A 2Q5BA 2YR3A 4MAUH 3GBNL 1A6TA 1MW3A 5IBLC 4AIXA 4PJCF 4NBZB 5HJBA 3PGCA 2YUXA 1HNGA 5AKRA 2TRHA 2CO3A 2FHFA 5IB5B 1Z6JT 4ZOBA 2LHAA 2PXYD 3RB7A 3L4UA 5HDWA 2ARJA 5CR8A 3QCUH 2AITA 3ZGHA 2HN7B 2YBRB 4YVUA 4YSUA 3FJTA 4GKLA 3K46A 1WFUA 1ND0A 1ZSDA 3GTTA 1KB5L 4KKLC 4BK8A 1MREL 3KPSD 1X7SA 2CMRH 4LKXA 4MA3A 3QJXA 1HEZB 5FKAA 1Q0XL 4X99B 1JF1B 3NCBB 1D2PA 3VCLB 2VJ8A 2P48B 2Z64C 4AK1A 5J56B 3OKNB 1XT5A 5F6IC 1MJ8H 4PGZA 3VXRD 1BQSA 3BUYB 1DQIA 3T6ZA 1WBYB 3GKWH 5DJZB 2OP4L 3EUUA 1CQYA 4F1ZA 3ULVC 4L8SC 3FK3A 3NIGF 3D2TA 1BVLB 1URZA 3ZQXA 4ENED 4WU7A 1MCHA 4Y1AA 4U1JA 4NKQB 1KEGL 5K9KA 4X6BB 2DTSA 3VQMA 4UTAA 2CZNA 2HKHH 1DYZA 2B77A 2ENJA 2PXYA 1F1AA 4ELDA 3G9AB 5KBDA 4NO2A 3Q3GB 3BMVA 3MLYH 4KZ0A 4MJ6B 4UDUB 2UVFA 5C0EB 2CO6A 4ERSL 3C9NA 1F6LL 2GITA 3FMGL 5D4QA 1KCRH 5B22A 5IB3A 3L1OH 3UO8B 1I3GL 2KLRA 3GBEA 2IDQA 1J5HA 3SDXE 4PTUB 2VZOA 2CIKA 4PJBE 1P1ZB 1QABA 1KIQB 3N6YA 3U36A 1YUHB 4NQTA 2C34A 2XX1A 3OM3B 1CFNA 1MI5D 2A7BA 3I6LE 1VADA 4NQXA 1OAQH 1OP5K 4P2RA 5I6XC 4OH2A 2DQCH 5J89A 3L5XH 2MOQA 1LK3H 2W9EL 2ORBL 3LPFA 1SJMA 4P5KA 3DRQA 2DWSA 4OGAD 4RSYA 1S8DB 3U4EB 4U6VL 3MXWL 3WD5L 5DTFB 3QJSB 3QIUB 2LGNA 3CHOA 3FB5A 1R3KA 3LZRA 3VSVA 2R4SL 1Z9SB 3T2QA 1M71B 1JDAA 1WWCA 3HA0A 4GG6B 3Q6FB 3N85L 4KNSA 1BWMA 1HHJB 1G1OA 1VB9A 1K2DA 2CBTA 4QXWA 4R7NA 1U8QB 1X7QA 1H8LA 4I87A 1LEKA 4FJZA 5CJXA 2BVPB 2NY3C 1AD0A 2XXCB 4UT6A 3NSYA 1Q9KB 1U41A 2IQAA 4I2XB 4ODHL 4Z6AT 5FDWA 2K4AA 4Q4IA 3BJLA 4WY7L 5D72H 2ZP9A 1JZHA 1SLXA 5FA3B 4HZLB 1RK1A 5A3IC 2WZ5A 4YDIH 4PJBA 4AV5A 4FYQA 3EFFB 3ARGC 4UOJA 3SO5A 2OX5B 3FC8A 4IBTA 1ETA1 2P80A 5GGQL 1BLNB 3SE8H 1O7DE 2VLME 3EF7A 4X6CE 3MFGB 4PRPD 1TQTA 4BH8B 4XXWA 3QUMB 4N8CL 2X6UA 2DIBA 1UB6A 1U8CB 4G9DA 1MCPL 1QTYT 2APTA 3MNWB 4HC1A 1BWWA 3N1QC 5ADOL 5BOJA 2AQ2A 3QISA 4NUJA 1EFXA 2VXUH 3O3UN 1A65A 1U42A 1G4MA 4HFWA 4AMKH 1JZ5A 4D3CH 1KCUL 1AXSA 3OAZK 3V0IA 1F58H 3K4DA 2C4FT 4PPTA 5B1AB 3U2SB 1KPVB 2YGPA 2VC2B 3WFEH 3ZT5A 4J1UB 1KN4L 1A9BB 5GRVL 3SOTA 5IREA 2E8YA 2X4UA 1OPGL 4ZMPA 3RVUD 3L3IA 4K8RD 1DBJL 3PWPD 3ET9F 4CGTA 1Q72H 3I84A 1KJ2H 3QCTL 1FVDA 4HA1A 1CICB 3C60C 4B0MB 1HKLH 1MCWW 2J21A 1UADC 4Y16B 1QQDA 1D9KB 1K4CB 3FFDB 4BFIA 3S9DB 2WP3O 1NCTA 4B50A 1T7WA 4K71C 1R5IA 5C71A 3LZFL 3M1CA 43C9A 3CZGA 4OZGA 4KFZC 4G1EA 2AJYH 2YAMA 3V6FB 1T1WA 4L3EA 1OTTC 4ZUTB 4PWIA 5E6SB 1UXWB 2XWCA 2ZWKA 1EBAA 1HILA 3TESA 4NZUH 2DQJL 2DY2A 3AUWB 1Z9NA 3BUDA 1Q4NX 5GSRA 2M8XA 5KN5B 3QUGA 1DDHB 4OD1L 5CJ5A 4L3EB 1EEZB 4GO8A 5DQ9B 3K0YA 2XT1B 3VM5A 43C9B 4ZNEE 1QASA 2BC4A 2RTTA 1U8KA 5HGDA 1ZT4A 4JHWL 3BVXA 3QNXB 5B7MA 2RAMA 3O9WB 4WUUB 5CGTA 1DQMH 2JQMA 4MDIA 4BXSV 1UXSB 1BFOB 4KBPA 1K4CA 3FFDA 4NQCE 1E6OL 3FL7A 4GAGH 2NQDA 3MJ7A 4XNAA 2ICEB 4HKZB 3QH3B 2YAOA 5MEND 4W9IC 4HOWA 3Q0HA 2FSDA 3GSVB 3C6SB 2P5WE 3RGVA 5DK3A 2K6ZA 3MREA 4R4FH 5A6MA 3HE6A 2DH2A 4DCQB 5I16A 2ZJSH 3IRCA 2DBJA 5I19H 2OMZA 3U2SA 1E27B 2NRDA 5KBPA 4XOCA 3DHUA 5MP6H 2ZWSA 3QRBA 4UT6H 4K94H 4F93B 1G9ML 1OAKL 2XU9A 1H3TA 2DYPD 2ATPB 1HI6A 2IGLA 4WKZB 4JPQA 5F1IB 4DH2A 1L6ZA 3ULUH 5EOCJ 2BZDA 2K8MA 3D5OF 3QUZB 5A16B 3U82B 2MPAH 1JGVL 1SHMA 1CZ8H 3W1ZA 5DZNA 3Q9QA 3BQUD 3WDHA 1E40A 3LZPA 1KFAH 1ZHLA 5E6IA 5FO7B 5E8OB 2X89D 1BM7A 2QVFB 5B8CA 4YHPA 1HXYA 5D6DC 1E9OB 2JCCE 5EORL 3QDAA 3TN0A 4M5ZH 2VN3A 5BUPA 1HYSD 2Y1AA 3CVIL 3SODB 1RVFL 2F54D 4Z3EA 4PHZA 1X9LA 1A7BA 4WUUE 2XJLA 4C4KO 1FDLL 3L2LA 3WKNA 2ZAHA 1ZLSL 4MVBD 3SPCA 4KVCL 2Q8AL 2LW3A 4HJGB 3TPKA 3VSUA 3VRLE 1WIUA 5E94B 2AS5M 1UT9A 4Q56A 4HWBH 3T4YB 3DUHA 1GZHA 2VC2L 1OARH 3AU1A 4FABL 5CBEB 1L0QA 1NFIB 2BZCA 3HAEG 4JFDA 3TBYA 4F91B 1FP5A 4WUKH 8FABB 1RLWA 4XVJL 4AYBA 4JY4A 5DEGA 3N06B 2XG4B 3BQUA 2EH8H 4IMLB 3LEYH 1UB5B 1RZIB 4QRQB 3L54A 4XPHL 5DWUH 2A9DA 1BHGA 1AP2A 1DP0A 2HT3C 4BZ1L 4Z77B 1IAIL 3STBA 2NTFB 3IMWA 5IVZB 2BFGA 1WICA 1XWVA 4G59C 4QO1A 4JDZB 4HD9A 4DVRH 4Q6YA 5JIIA 4UYQA 3IJYA 4M4RA 3RA7L 4QOKA 4L2LA 3ZKSD 3QIUC 2BSEA 2NXZC 3QPQC 4OFKA 1QI4A 3FT3B 3I3DA 1JWMA 5D93B 3RAJL 1PBYA 1A7NH 1UVQB 2GQHA 4PRAB 2KQNA 3HG1A 3WS3B 2AFNA 4XC3H 3MBEA 4XP9L 2FWLB 4NX0A 1VA9A 3BDYL 5JR1L 4ZMYA 3D48R 3D25B 5JXEC 3Q7JA 4M4RB 4NUGH 4DP9X 1DBAH 4GLRI 1VAHA 4UQ9A 5JLZA 3CFCH 3MGTA 2HVJB 1I31A 1DFBH 3MV9D 1B4JL 5DLLA 1M57B 2J2ZB 4P9MH 4IHOB 4AC2A 4AYFA 1QRNA 2FEDC 1RUAL 5DQJB 3DSFL 3NQKA 4NI6A 3U2IA 5L0QC 5CFHA 2ICWI 4WEMB 4AYEC 1CVRA 2DD8H 5D96C 4G72B 1QX1A 2Y6SD 4Z0BH 4J8RA 4WNQA 1PKQA 3E2HC 2EYRA 1NANH 3SPGA 1V7NL 3WTYA 1PTZA 3SYCA 1U8NA 1VDGA 4HH8A 4JY5H 5I8OH 4KVNL 4QXUH 4E9YA 4QHKJ 3TIDA 3TO4B 1HE7A 1RD6A 1TF4A 4ABVA 4WW2B 4HJGA 3FTGB 4WZ9A 4EMZA 1DVXA 5AYUH 4E5XG 5IP4A 3B9VA 3BKJL 4MA3B 2ZOKA 4XE5B 5FYJL 3QJRB 1ZHNA 2OW6A 3A3YB 3OMIB 4X5WA 3RFZA 1AKJB 4Y5XC 4GUOA 3PWUB 1AZNA 4LSSH 4YXLL 2AQSA 3MJ8B 4JBSA 2PCFB 2IMNA 2DEYX 2AK4A 2BPBA 3N40F 3AAZA 5HI5D 5E8OA 5ESQB 5SX4H 3UABA 4JNXA 4AQZA 4XPTL 1MFEH 5K39B 3GSNA 3OPZL 3UYRH 5HP5A 1UC6A 1H6EA 2WO4A 3SY6A 4U4IA 2HFGH 2BIQA 5I73B 4YUEL 3NRQA 4ZW5A 4HCGA 3LRLA 5F1NB 4F9LA 3VD1A 4AIZA 2XN9D 3V4VB 4J3OF 5DHVH 5GS1A 1HSBB 4PJ7F 5JPMB 1IGJB 2NY5L 1QPKA 1YPZF 4P4KB 1E3XA 1LE5B 1ZSHA 5I16B 2W0FB 1A5FH 3RWFA 3CV5A 2E7LC 3VFPB 3N44F 4K5MA 4CBZA 3ZKXB 3LKRB 5SWSE 5I1LB 1XZWA 2A9NH 3C6SA 2WLMA 4XBMA 3GSVA 2P5EA 4Q9QH 1AIFB 3KS0H 1GS7A 2WK2A 4XP5L 4H1LH 3OKLB 3ZSSA 2JJTA 3RZCA 3ZPDA 3FOLA 4QLRA 3CFEB 2IH1B 2CMRL 3BXNB 3DVGA 3L95A 4X5QA 3P0VL 4MKTA 5GZND 3SDXB 4AYMC 3S3SA 2W91A 1EEYB 1MPAL 2J1YA 2LU5A 2RJMA 1OLZA 2OQJB 4YBHA 3UJTL 5IV2A 4KXCA 5J7CC 4KMQA 3CHRA 4NO3A 1IX2A 4N24A 3FSZA 3CHPA 4X6CA 2AK4D 2NW3B 4FGMA 2HTLC 1J86A 1X9RA 3ZHFA 1L5GA 1R33A 4E41A 2ICWJ 3L4VA 4HIEA 1E6JL 3DI3B 4GAFB 4Z0XB 4G5ZH 3GXPA 3EYUL 5DRZA 1AVAA 1VPOH 2V3FA 5L2KE 2HT3D 1J05B 5E6IB 5FYLE 1ZRUA 3MZGB 3GXNA 1OT1A 2BS9A 4QHKI 3TCLB 3UTQA 3VI4B 2XIBA 1JAEA 3AB0B 3QWOB 4Z7NB 2I07A 4LVHB 4U0QB 2PR9A 3O6KL 3S5LA 2NY6D 1BGXH 3FMGH 2OZNA 5ICXB 2A6IA 1AMXA 4Y88A 3MNVA 5LCVL 1T1XA 4ABWA 2QR0A 3JTTB 1KY7A 1BPLB 4KU1A 1JVOA 3V8OA 1TTCA 3FFCA 1F4XL 1SDAB 4DUVA 4ZG1A 3IFOB 4HWEL 1FVDB 3L3KA 1RK7A 1OVZA 1S7RB 5E5LA 4JQIA 4G2AA 1MFDL 4KQ3H 4NZRL 5IFHH 2X4NB 4Y4KA 1TMCB 2ORBH 1CDYA 2GAZA 4MXWL 5HXMA 4FQXD 4NQCA 4YO0A 4BJLA 4K3EL 5CSBA 4EXPX 2Z65C 4QNPF 4A2DA 5IEHB 4F37F 1E3ZA 3DX0A 3GIVB 4YHPB 3X1FA 4FQIL 3ARGB 3S6CA 2W9DH 4IEFB 5GGVY 2BS8A 3IDYC 4LPXA 1SVBA 5IVXE 4HGKC 5L2KB 2HP4A 3H0TB 2YD0A 4LQFL 2VIRA 4RA0C 5BOZG 3LXUX 4O2EA 4R7DB 1T21A 3L4WA 3FCSB 5AAPA 2O5YL 1N0XL 3Q2VA 3QDMA 5IHZA 1HH6A 1NGQH 1E5CA 2OXHA 2VUOA 2A4CA 4PJ8C 4HJSA 4QRAA 2FGWH 4QHUA 5JOPE 4MASA 1C7SA 3CBKB 3KPNA 4OT1H 2WNXA 1AY1L 2OMZB 2A4EA 5KZCB 4JL2A 1ZHKB 3QC6X 4XT1C 4A6YA 5CJOH 1OHQA 3FQUA 4UILH 4HCRH 4I0PD 4L4TE 1ZV5A 4AUJA 3ERXA 2DQDL 2Q3XA 5AZUA 4TS6A 5EO1A 5I5MA 4OZIA 1WVZA 3D39A 3MZTA 5KVGL 5A2FA 2OR7A 1N4XL 3PIQB 4I9WD 4PS4H 4PWEA 5TDPB 3SE6A 3K91A 2FLBT 4D0BB 1VFOA 1SGKA 3KPSA 2XWXA 4JO5A 4N2FA 3S4SA 2MQ3A 3WUWG 5KS9A 1GTFA 3SE3A 1FNEA 4WJ5B 5I2IA 4X7SH 1XF1A 1XVSA 5GGQH 4OVVA 3WFHB 4PJDE 1LL1A 1EAJA 4KZDL 5HJ3B 2WSDA 2DQEH 3D3VB 5A2IH 1MCPH 3MNVB 3Q43A 1P4LA 4JR9L 1N6QL 5B39G 2YBGA 1P9MC 1VIWA 5CJQL 4TVPL 1YEHL 5KYUA 5CINH 2BP8A 2XYCA 2F61A 5L4MA 3BAEH 2QADC 2APVA 4FFYA 2V2XB 3C8KA 1ES0B 2H3XC 2XWTB 1KDJA 3P11H 4BFRA 2X1OA 4YAQA 1KN4H 2YUWA 3W37A 1HJCA 1QW9A 4LFHG 5F7BA 1BIIB 1FZKB 2DMKA 4XP6H 3GUFA 5ITFB 3SKJL 5JHDA 3SKMB 1OPGH 2B2XH 4A55A 3WS6A 1UOLA 2D3NA 1MWAB 3FQTA 5FECB 2DLFL 1DCLA 3GMNB 3ZMRA 3BLKA 3KL5A 3VQ2C 2EIZB 1EJOH 2ZKHH 4WHTA 4I3RH 3ZU8A 1HKLL 3BIAX 5A2JH 2BWQA 3TVMA 2GBUA 4YPGA 3CXDH 3U36B 2ISDA 4LPWA 3MV9B 3PXHA 4P5MB 4Q14A 1SXNA 2IDTA 3L5JA 4ZMVA 3PP4H 3SDAB 2IBGA 2OMYA 2F7QA 1M05B 1AGFB 1OGAD 1X3DA 5K1JA 3VO0A 1Q0YL 3MSPA 5I17B 1UASA 5AUMA 2DJMA 3UO1L 4F7MB 3NMEA 1QFUL 2OJEB 1PD6A 3ARBB 3JVFC 4QF1A 3RWJB 2XWJB 3L4TA 5TQ2L 5CD3A 2ZXQA 1W0WB 4WO4A 3OLGA 4K73A 4NQDB 4OZHB 4Y1AB 3LHAA 4J3OD 4N3TA 5DU7A 1SEBB 5FUOL 2JJSC 3QHZL 2O30A 4FKHA 4N0CD 4HUUB 4EKXA 1M71A 4NJAH 4JHAH 3DIFB 4P23A 4QEGA 1WUZA 2R51A 5DJZA 3HR6A 2P8MA 3QXWA 4G9DB 2ED8A 5ID0B 1PZCA 1R3KB 1XV8A 3AJ7A 1HCYA 3DROA 1QZNA 5E23A 4BKSC 4WI6A 2VDNL 1PNCA 1QBML 1FZJB 4Y19B 3IDIB 2EICA 1XF5A 3NH7L 4PJ9A 1JUFB 2VITA 4KY1L 2NPLX 4U7SA 4ZSOE 3P2BA 3O8XB 4KKAD 4BDVB 1CG9A 1T22A 3QEUB 3VDCA 2K9FB 3AT8A 3E9UA 5HHVH 5JOFB 4E5XB 3RPIB 5F3FA 5MHSD 2Q76B 2QZ5A 1FPTH 2LV4A 2F15A 3Q6GH 3V4VH 3CHSA 5IW6A 4MA8L 2AQ1A 1N8OE 2JV6A 2BP0A 3RGHA 1P1ZA 1AHMA 4I9XA 4N2MA 5IESH 4TUOA 4B5ZA 3CHQA 5EF0A 4QLWA 3QJOA 4N8VB 3C08L 3GBLA 4RWHA 4GT0A 5TH2B 4MDJA 2ICES 1XEUA 1QZ1A 2ODHA 1I85A 4AKOA 2ZCKH 3IEAA 4AEFA 3CG8A 4MJJA 1JNLL 3U6XS 2D3JA 4FNLH 3HC3L 1RURL 3BISA 4YGVA 1FO0B 4M7LT 1ANUA 2IOOA 4MLSA 3ENEA 2WWKO 1YECH 2P8LA 3L3OC 5IVXF 3VI3B 3D25A 3U4KA 4HBQA 3H6JA 5DUMH 1WBZB 1FLRL 4YFLI 2XZZA 4X4YA 4KVCH 4NQED 5CSZA 3WTXA 4QJ4B 3NPSB 1OLLA 2K8QA 4MQXD 2K1MA 2AF2A 1HL9A 4GW4B 1LK2A 2JB5L 4RDQG 3UBXA 3LKNA 2GHWB 3GSNL 4Y1TA 4YFDB 2VXQL 4ZFOB 4KKCC 1F3DJ 2XN9B 4L4TD 1N68A 2PNDA 5E6YA 3A4AA 5FPIA 3V95A 3W5NA 4Z95H 1RIHH 2FL5A 4KMLB 4F2EA 2EH8L 2FHCA 2Y1ZA 3AS3A 5C0ND 1TCMA 4ZX5A 3HNVH 4G9FB 2JJSA 3EO1A 2EYSB 3BZEB 5FYKU 2DW5A 1EAPB 5B38G 4K9EL 1SLVA 3FO0H 4H0GA 4LZKA 3D85A 3HI6H 3G5ZA 1A7RH 3BESR 1TIUA 3ARZA 1UM6L 4J23A 1RHFA 1IGCH 2N1TE 2P5WB 5BRZA 3VG9B 5ADPL 4U1GC 4XH2A 4H1LA 1KF9B 1CLVA 2IANA 3IMVA 3R0MA 1Y1DA 4TTDD 4X8GA 3VGHA 4OCXL 4WGKA 1RUKL 3CSYB 4HUMB 3FB8B 2VLKA 4X6DA 1IM3D 2H1PH 3IGUA 2ZUUA 2X4QA 3TZVA 4D0DA 2GKIA 2ZYHA 4CU7A 4YSQA 3WEAA 5DJAA 4U1NA 1RIUL 2DRUA 5ERWB 3GRWL 2DMHA 2VLRB 2NY4C 3CFCL 4HUXB 4UWQB 4RISH 4PRIE 4P9HH 5FKPA 1B88A 5CN1A 3WIFA 1F2XK 1FFOB 3FF7A 4LSDA 2GABA 3UDWC 1CB4A 3MBEC 3PDGA 1TNMA 2X6BA 4RRPG 2YD2A 1H3GA 1C5CL 2WWKT 2B39A 3OB0H 1CIUA 1THAA 5DDHA 1O6TA 2VDQL 3W11D 3QUKB 4POZC 3H53A 4B27A 2ARWA 1G7PA 3BP5B 3S0PA 3GNMH 1UJ3B 4IOIB 5LG1A 1OOAA 5FO9A 3REVA 2ZYRA 3R18A 4PP1D 1HINH 4JREC 3W2DH 3GM8A 5GGUB 2WQXA 1UT2A 2F2HA 2DKSA 1SLWA 3ARYA 4ADGA 5LJYH 1M1XB 5F93C 2ZCHL 1HL5A 3BN3B 1X5KA 4XP1H 5AOLA 4U49A 4MD0A 4TV3A 3AG1B 4FXGB 2AQTA 4R9HA 3EO9L 1U95B 5F3HA 3ZGIA 4MMYA 4L1SA 4ELMA 1NKGA 1XGYH 3NP3A 2O6EA 1U30A 1OT2A 2RCSH 5DFWH 1XQ4A 3WL9A 1MHCB 4Z3HA 5CEZD 3PWVB 3QH3A 4K9JA 2YRZA 5HHOD 4CDHA 2RBLA 4PSRA 5HYJA 3VXUA 3FCTA 4QDGA 1VJSA 2IH3A 3DPBB 3AMKA 3ZQWA 4YHKL 4F8TA 2CDFA 5C2BH 2VDRH 3PYCA 2YA1A 4KJWC 3P3YA 1EHNA 1MWOA 1P7QA 3UTZB 2ENSA 1R5WB 5IMMA 3TP4A 2D7NA 1ZIBA 1PEZA 2ITDA 4N90E 2R0LL 2PXYC 1XBRA 4JCLA 4WHDA 1UZ8B 4NN6C 2C9UA 4KJYB 1TSHA 1MJJA 2NCEA 3KYOB 4OJFH 5D6DA 3SDAC 1SJHB 4BSJA 1E30A 1NEZB 4N0FB 3QRGL 1I9IL 5MEQA 4TRPH 4IGBD 1GVIA 1R19A 3B9KB 2ZYIA 3LPOA 4DAGL 2UXFA 2P46B 1WLHA 3ES6B 4WDIB 4AV0A 1MLBA 5CEZH 3NCWA 4L5FH 4Q9QL 4GKNB 2V5SA 2GK0A 2MCG1 2EYTA 3GS7A 1FNSH 4NRYB 1U8OB 4OM0L 5IBUB 3WNOA 2F54B 3WENA 1CMOA 1ADWA 4S1DD 4QTHB 2MOGA 4N86A 4XPFL 3T6WA 5AD0A 4IRJD 4XVTL 4DPRA 1NAMB 4NGHH 4UTCA 5IQOA 4PW3A 2YAQA 5I1DA 1XSKA 2VZVA 1FGNL 3DECA 3ZL4H 5DUPH 3UEQA 4Y1AE 5EIIA 4H13C 4N90D 2ID5A 5I75B 2XZAH 2FECL 1TZHA 2YPLE 4PBDA 3DARA 1BQ5A 3RVVD 5DJ6B 1NMBL 2JWYA 1V27A 2VXTL 3RGVC 4K7PX 2RQEA 3B34A 1ZV9A 3CDCA 1LTXA 4OCSL 3FH8A 3O6LL 2X6CA 4H25A 5C08A 5LGHL 3O2DL 2WGNB 3U0WL 1L9TA 2WXRA 1YEKL 15C8H 1A6WL 4PRDA 5MEPB 3DOSA 3UXFA 1CQKA 1JP5A 1THCA 2RHEA 4N3UA 3B7YA 2FIKB 5EIIG 2EUVA 4PJHA 2FYYA 4NO0B 4IRJC 3PDOA 4NJ9H 1Y07A 5IM7B 4OLZL 1LO4L 2IFFH 3BAXA 1F86A 4DP6X 4MSWA 4A7QA 1IO4C 2OMWB 4OF8A 1TVBA 2VLLB 5DFTA 1HNYA 3RE0A 3WSQH 4PG2C 4AC4A 3K74B 3SB3A 4NN7C 3D69A 2VRQA 4X6CF 2Y2TA 5BUGA 1IBGH 3HZKB 4PJDF 2A9BA 3QNZA 1FGVH 1N5AA 2Z7WA 4JJHA 4WDIA 2Y07L 2FB4H 3RWEB 1U8LA 2YEQA 1XGUB 2E4FA 4OKVA 3QZWA 3AT0A 5IHBA 3UGXA 4YHLH 3R7RA 4OD2B 3KPMB 1MJJB 3TLRA 2VR9A 4WEEA 1WUNT 3PFUA 4E9VA 2NZ9C 4R8WH 3QAZC 1GYVA 3VSQA 4HC1L 1QSED 3CN4A 1C5BL 2ZIDA 2JELH 4KK6D 3WKPA 3EH5B 2EDHA 4NUPA 4YR6A 1EJ6A 4AH2A 1FN4A 4ZZFA 3GDBA 4R7NB 4QHPA 3SO3C 1OT4A 2VNCA 4QWWC 3EGDA 1QSEB 2RD0A 1KLUB 4CNIB 2X10A 2NYZA 2AP2A 3N42F 4V1DD 4NDMB 2ALWA 5EFIB 1YMMA 2DYPB 3J8F7 4JGUA 3IJEA 4KXZH 1PLAA 3ULSB 3GI9L 2EO1A 3MN8A 2E6PA 3W81A 3L4XA 1PYWB 2FO4B 3OXSA 1JZEA 1YN6B 3DRQB 4BCZA 3EYVB 2NQCA 4HPHA 5AQ0A 5F0MB 1JYVA 2VGLM 1TENA 3CCHB 3NEEA 2VSDA 1PU0A 3OHXA 4JM0A 1PCXA 4M8UA 3TFKD 4XNQB 5BUAA 3IU4L 4IBZA 3HVDA 4PS4L 4P4RA 2B59A 1AANA 1E8WA 2ITCB 5LXGH 4M1GL 5FM4A 4CU6A 1COBA 3M88A 3ULVH 1IC5L 1BV8A 1MHHB 2MTAA 2XBZA 5TTRA 4K3GA 1SYSB 2R8SH 4A1RA 1RI8A 4O5LL 1JXGA 1L9PA 2AEWA 1GOGA 2WN2A 4Y19D 3U6XA 3WMSA 5AW5B 5D93C 1EHLL 4HLJA 4M8VA 3U30C 4OZGE 4O9HH 2DMBA 1BMGA 3LS4H 3SGJC 1NCHA 1ZMYA 2EEBA 1AR2A 4P5TA 5K33A 1S78C 2NUTA 1KGYE 4U2YA 3LRSB 2WB1A 4JN2A 4YHMH 1J5IA 2CHDA 1PDKB 3Q8FA 2BRRH 1ZCRA 2XQBL 2Z8WC 3P11L 4GKZB 4ONFH 4PP2A 5FO8A 3QUYA 4DGYL 3BO8B 1G84A 1KWKA 5AVQB 2HTLD 2MKLC 3GD1C 3WHE1 3GLZA 3RZCC 1WG3A 2CR6A 2WXKA 3KLAA 4NNYA 3QEQB 1WBYA 3SYOA 5LNDA 4XPAL 4RAUA 4PS3A 2P80D 1EJOL 5E8EB 2Z4QA 3ZKQD 3B6SA 4OUUA 3FTSA 5EOTB 1HE8A 4HHAB 4UTBH 4R0LB 4JG0H 3TV3L 2VZTA 4KRPB 1RK0A 1UGNA 2X1XR 1ZPUA 4ZAKA 3WUWB 1F4YH 1GL4B 3CDGB 2G60L 3RP1A 1M7UA 4WHYH 5G2NA 3ZUNC 4NIYE 1LO5A 3LX9A 3TS8A 4UM8B 2ATAA 2QEJA 1U3HC 1YC8A 4WO0A 5I8KL 4Y2DC 4DO6A 4ODTL 1SJHA 4MS6A 2HRGA 2D7MA 4XO5A 1FFOA 5FUZH 3D7PA 4RMQA 3NIDF 2YMOA 2JIXA 5CU5A 4LSRL 4NBYB 3QG7L 4HULB 4OJDH 1KELH 1EH9A 1WWBX 1J0KA 1AGDB 1HCVA 1UWEH 5F0JB 4MQ7B 3T1FB 3ML8A 4FI6A 4DQOL 3DI2B 4F7PB 4Y7OC 5E2UL 3OG6B 4Y89A 1JPTH 4WU5B 3WHE0 5JUEH 3FQXB 1KIRB 4IQHA 3ZDYB 3II3A 3FCTB 3SZ6A 2FWSA 2XQYK 3CSYA 1QBMH 2B5IB 2O4EA 3IJ9A 1RULH 1JHTB 3L4ZA 5C3TA 4BZ2L 1EEUA 3MBXH 2DEWX 4CVZA 4WNJA 4LEXH 3VYPA 3MI6A 5MERB 4P9HC 1FC1A 1F97A 2GEEA 4MMYB 2BIIA 3IMSA 4JPWL 2F1EA 4IBYA 3P30L 3ARTA 4JO1L 2HMIC 4AQAA 4C58B 3E2HB 1NLDH 1GOFA 3VGEA 2AVGA 2EYSA 3F6JA 4LSUH 1Q9LB 2XTJC 2Z1KA 4P59H 2FT8A 3VGDA 2NXZD 3UTTE 2VO8A 4E2OA 4LEEA 2WMPA 4QJ3B 4XBPA 3ZDXE 4B9GA 5BW7C 5IR1A 5F0PB 1D5ZA 4XVUD 4O2FA 3MNZA 3HZYA 1XH0A 3PU7A 2B8OT 3TV8A 1OD9A 4PJGE 1TTBA 4HWBA 4YL4A 3SDCA 1NUNB 1HOEA 5JQ6H 2YQ3A 3VWKA 2JKWA 3BRDA 5CLTA 1DLFL 2B59B 4EAEA 1CFQB 4U1KB 1IQDA 4QTFA 5DD5H 3HS0A 2L8AA 1D9KC 1GHFL 5AW6B 2DQMA 1LILA 4PGCA 4W9EC 2VITB 1MJ7L 3F7VB 2VDKH 5F7EL 1YECL 3AW5A 3NCXA 1XF5B 2EEFA 4QYOB 4JFXB 3TWCH 5BCAA 5I15H 4L4TA 1G6VK 3T0EB 3HFFA 2R7EB 4JFDD 1YVLA 3V0WL 4G71B 4MCYA 5AKTA 3VI3E 4U6YB 5C3IA 1UKTA 2QSCH 3APMA 4Z5RA 4E42A 4XB8A 3PABA 3IXTA 3F62A 2IPUK 4ECNA 2CKBB 3EGDB 4HUVB 1I9JL 1PG7X 1PNDA 3EJPA 1YEIH 4OZHA 1MDTA 1R24A 3OGOE 3SKOA 1ZVNA 1NZRA 4LBEA 4MNGB 4Z95L 5IG7A 4A63A 3I75A 4W9FC 1T89C 3QEGH 2BNRA 3ARBA 1I3GH 3PGDA 3TN0D 2KUTA 1ZGLP 2F53A 1T2QL 5LQBH 1R46A 4QHLB 3IJHA 4QRTB 3SY0B 1KZQA 1U8LB 2QVTA 5F2FA 5E6ID 3UP1A 4XNYL 4GRLA 3MMEA 3W9DB 1BECA 4LEOA 3E1F1 4NUQA 4WFFE 3U9UB 3MLSH 5EBLA 3WEXA 3L9YA 2FX9L 3V79C 5FGBA 4P2QB 2VDPL 4QRFA 4AJYV 3DROB 1S7UB 2GSGB 4FP8L 1SDDA 4EUPG 1MAMH 1MCFA 2CKNA 3CZUB 4ZXBA 5DHDA 3U0TA 2P8MB 1WT5C 2WXHA 2XETA 2XA8H 5F7FA 3MV11 3D0VB 2ZWNA 2APBA 3G5VB 4I13B 5E8PA 3RX9A 5KVEE 3BX7C 3T3MB 1IM3A 4YOKA 3BVDB 5MI0C 1AMYA 1FNGA 2EDMA 4Z7WB 1O9WA 3ZE0B 2GJ6A 3AC0A 2IF7A 4JFZL 5FO2A 4YBLB 4YSSA 5AZ2H 2OK0L 5T1MA 2XRAL 2VR6A 4FL4C 1H15B 1EBPA 3OJVC 6TAAA 4L9LC 4RIRB 5F9WB 4TUOB 1P7BA 1LHZA 2CJUH 4HPYL 1TJHL 4WFEE 4S1RH 1HINL 2XPZA 3VFGH 2BSTA 5BS0D 4EI5D 3KPMA 3FRPG 1OD7A 2R9HD 2VM4A 3CUPA 3ZUCA 2OTWB 4BKTC 4BD4A 1DLHB 3QUHA 1BXVA 4B97A 4DFHA 2BJMH 3HG4A 5AOIA 3SE8L 1FG9C 2ZNXA 4TMPA 4ZPTA 3SD5A 1QLEB 3PPSA 4OCLC 2YPKB 2VAAA 4R2GB 4XN5A 2F8IA 3SKUD 3THMH 4DN4H 5JO5A 4URTB 5B3SB 1PFOA 4MNHB 1NM9A 2VQTA 4D8OA 1OAYL