3F01A

Crystal structure of synaptotagmin i c2a domain with cu(ii)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
143
structure length
143
Chain Sequence
GSPGIGGGGGGILDSMVEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Synaptotagmin-1
publication title Crystal structure of synaptotagmin I C2A
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 22
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3f01A01
2Q3XA 4ICWA 2NQ3A 2WXJA 5G2NA 4QJ5B 3QARA 3JZYA 4TV3A 4XZ4A 1E8YA 4HVBA 5CCHE 1BYNA 4NPKA 2ENQA 1A25A 1UOVA 1GMIA 4GB9A 1CJYA 3OAWA 2WXLA 2JQZA 4WEEA 3L4CA 4Y1SA 5H4YA 1E8ZA 4L1LA 3PS6A 3CSTA 4WWNA 3ZIMA 4Y1TA 1E90A 3APDA 3F00A 4EZKA 4URKA 4LCVA 4DNLA 3ZW3A 1DJHA 3IM1A 2LHAA 4ANUA 2FK9A 3L08A 2CJTA 4KITB 3FDWA 3HIZA 4ANVA 1E8WA 4QJ3B 2WXRA 3F05A 2EP6A 2WXOA 3NZUA 4G11A 4IHBA 3S2AA 2CHWA 3F04A 2X38A 2CHDA 4FLHA 4FJZA 2K4AA 2YOAA 1RLWA 5JHBA 3GPEA 5CCJA 1DQVA 2RD0A 3PREA 2Z0UA 2CM5A 4L2YA 4L23A 3N5AA 4F93B 3QAQA 1WFMA 4EZJA 1E7VA 4L1BA 3PYCA 3DBSA 4TS6A 4F91B 4V11A 2ENJA 4FHKA 4IQHA 3ZVVA 1K5WA 2YRBA 3TL5A 3F01A 2K3HA 3W56A 3RPBA 3P2BA 4OVVA 3M7FB 1YRKA 5EDSA 3APFA 4TUUA 2WXQA 2ZKMX 4QJ4B 2R83A 3KWUA 3HN8A 3APCA 2CM6A 5G55A 3W57A 3L16A 2QZ5A 4KZ0A 4KZCA 2WXFA 3IBEA 1E8XA 3PRZA 4OVUA 1TJXA 4NP9A 4LDCA 3QJZA 1E7UA 4BFRA 2D8KA 4WAFA 2CHZA 3L54A 2ENPA 1QATA 4PS3A 5JHAA 3MJWA 1RSYA 2CJSA 4J6IA 1BCIA 4FULA 4DK5A 3T8MA 1HE8A 1DJGA 1RH8A 2A4ZA 3TJPA 2KI6A 1WFJA 2V4LA 3ENEA 3QR1A 2QZQA 4AOFA 3L17A 2NSQA 2BWQA 2UZPA 1W16A 4FA6A 5KJ7E 2FJUB 3B7YA 3NZSA 2WXKA 4GNKB 5CCGE 1UOWA 1BDYA 3NSJA 4HLEA 1DSYA 2DMHA 2A5UA 4WWPA 2WXGA 4AJWA 3OHMB 4F92B 2CHXA 2N1TE 3PFQA 3L9BA 4WWOA 1DJWA 2ISDA 3LJ3A 2Q0ZX 3FBKA 2DMGA 2K8MA 4FJYA 4EZLA 5H4ZA 1DJZA 1TJMA 3DPDA 3QR0A 3RDJA 4F1SA 3L13A 3HHMA 3QK0A 3TWYA 3SD5A 4ANXA 1UGKA 2Y3AA 2WXHA 1DJIA 4FHJA 4ICXA 4LT7A 1DJXA 4NS0A 3KWTA 4A55A 4FADA 1DJYA 2WXNA 4BGDA 4NPJA 2WXMA 3R7RA 2K45A 3ML8A 4ANWA 1QASA 4MJJA 4JPSA 3ML9A 1V27A 4XX5A 2WXIA 4XE0A 2NCEA 5T8IA 2WXPA 4QAMB 1W15A 4PS7A 4PS8A 3CSFA 2B3RA 3R7QA
chains in the Genus database with same CATH superfamily
1ETB1 1TZAA 2OCJA 2Q7NA 3AABA 5B38B 3TF7C 3QRGH 2LTQC 5E5RB 2NY3D 3PABB 15C8L 3EYFA 5E8EB 2COVD 4I77H 3S37X 4AMXA 4MDIB 3FSVA 4ZMTA 3CFIC 2COQA 4NJ9H 4PTTB 4M48L 3V0AC 4DUWA 3FB8A 5SV3A 3ZN6A 4HUXB 1WISA 3ZYOA 4IJ3C 2J5WA 1MELA 4LPUA 1TQWA 2V2WA 4PS4L 2KZ1B 2B4CH 2CXKA 1YECH 3M1BB 1OE2A 1MREL 1UOLA 1Q72L 4J3OH 3NJLA 2R0LH 3QAZC 3RX8A 3HMXL 4YSOA 3T2NH 4I3RH 2OYPA 4XGZB 1TEGA 5C09B 4EUPG 4EO5A 5E8DH 4N9GA 4P3DA 3NIGB 3RX9A 2V33A 5C0IA 3MACH 1JZJA 2FT6A 4G42B 1A7PH 1SMOA 2OLDA 3I50H 1BQLL 3SQOL 4HIXL 5ISZE 1CS6A 1JGLL 3B9KA 3EH1A 2ZUUA 3UZQB 1JZIA 2OXHA 5IB5B 1EHAA 2DIEA 3AWEA 4G6FB 4RETB 1U3ZA 2IDTA 2J6WA 3MRFA 1GAFL 3S96A 1DUYB 4TULL 3RTLA 3V2AR 4MAYA 2R0KL 5D7HA 3ARBC 3OKOA 4OCWH 5I16B 3ABGA 4Q58C 2P8LA 5HP5A 1IAOB 1VFBB 3WFBH 2CRYA 2AC0A 1NWOA 2PWEA 3QRGL 3QJRB 1IC4H 3S5LG 4PJGB 4JFYA 4OLZH 3F5WB 1DQLH 4FULA 3QZBA 4F8OA 2VZUA 3QZNA 1G43A 4KTDL 4O51A 5DLML 3KCWA 4GXFA 4MD4B 4OJFL 4MDJA 1ZLVK 3T0WA 4QRSB 2B4CL 3A6BH 1YECL 3OAZH 2XJKA 1QOKA 4J7RA 2GUYA 3O3AA 1RVFH 1KJ3H 1J5OH 1JFQL 1WBYA 4L1HA 1LHZA 3ALPA 2R0LL 4L4JA 5AOKA 3B2DC 3BVVA 3WNPA 4AX3A 1HSAA 1G4RA 1XGRA 2Z7ZA 1RUPH 5E8DL 4Y4HA 3L5WB 2VZVA 4P59H 4RRPA 2HH0H 2ENYA 4Y5XA 4FG4A 3SD5A 2GQHA 3RUGB 1U2CA 2FWSA 1XD0A 5IJCC 5J6HB 1MI5A 2HUEA 3TA3C 4E9TA 4Z1PA 3CWGA 1QR1B 2ODHA 5DZLA 1BJ1J 4OUOA 3MV8E 1IC1A 4OLVH 4AJ0A 2YPLE 5FK9A 4TNVF 3EH5B 1HL5A 1JN6B 1L7IH 3MRHA 4RISH 1Z9SA 2ITDA 3GSXA 3TTSA 2XG5A 4IEFB 1U3HA 2IPKB 3T04D 4OCWL 4XH2B 3WFBL 2QSQA 3BJ91 1W8EA 4G9DB 4JQIA 1IGTB 3WUWB 5EU6A 2GTWA 1FNEA 2OA9A 1IC4L 4BFKA 2HXAA 5AAWC 3ZU8A 1S9XB 4JQXA 4OLZL 5DCCA 1DQLL 2AEWA 2VZTA 2VISB 1XF3A 4JANB 3TM6A 4ZXBA 4ODVH 1MQKH 3A6BL 3BVNB 3SE6A 3CSPA 4XNZB 5A40E 1RVFL 1KJ3L 2DYPB 2HKHL 3GMMA 5IW6B 1J5OL 2GI0A 4PJIF 3JTTB 5AVQB 4WHYG 2CJUH 2JJWA 1L6PA 1MSPA 5DJ2B 5FM5O 5H94B 3VXQB 3X11A 3VD0A 2YEVB 5I6LA 1KPRA 1RUPL 1JL8A 3SJVE 3UADA 3RGVA 2Q7YB 4P59L 3EOBA 1ADWA 5DLLA 3S6CA 5C0FA 4PJIA 1BVNT 3STBA 4NZ8A 3TVMD 3DO7A 1E28A 5K9KA 3QDMA 3DV4A 3TYFA 2CAKA 3WJLC 3LN9A 4X9GA 2CK0H 5CZKA 3ILPB 3APNA 2AXFB 2AS5M 5KS9F 3FK3A 2JTYA 3K46A 1COBA 2A6KA 2PYEA 1BWWA 1RMFH 1G1OA 4Z9KB 1OWWA 1CDGA 1FFOA 2VUKA 4FL4B 4MBRA 1CD1A 1G6VK 4JE0A 1WZ1H 4OCYH 3ARVA 3FCTB 4PRHD 4M6NL 3FYEB 1MCHA 5KS9A 1KGYE 2L0DA 5FA4A 4UWQB 5I5RA 3N1QC 3MRMB 4AZ8A 3S8FB 4PJXE 4MZRA 3NIFB 3FXIC 1A6TB 1UEYA 4RRPG 4KKPA 5L2JB 4ODVL 2GT9A 2GTZB 4XO8A 3FTUA 4PJ7F 4JPIB 1YEDA 2KC0A 2GI7A 4JQVC 3SPGA 5ESQB 5DQ9A 1RZGB 4MS6A 4UOQA 4MD5A 4OLXH 4IBTA 4TNWF 4L8DA 1UUSA 4JDZA 5DRNB 4K7FB 5EUOB 1UEMA 4UQ3A 3GHBH 5ICYA 5I74B 3VD4A 3U36A 4PJ7A 5ENWA 3EO0A 4PREA 2NXZB 3S8WA 5D6CA 5TQ2H 5KYXB 3H56A 5F88B 1II4E 1MWAL 1QABA 3BEVA 3IWVA 4YC2C 4XBPB 2BSTB 2ATPA 4AJVA 3SE8H 2CK0L 2XTJC 4L0PB 3MA7A 4OFPA 1F1AA 3NA9H 4B60A 1MPAH 2XETA 2A9MH 3QZWA 4PS7A 5E8OA 3EJUA 2B3RA 4NBZB 1RMFL 4M02A 1KTDA 4P2QB 3I6KB 4PY7A 4NNPH 4AEHL 1A4BA 5JW3L 4NUGH 1MUJA 4GW4B 4NQDA 4OZ4B 1NFAA 4PR5B 1LEGB 4GAAA 3VXRB 3O3BA 4YGAB 5FO8A 2XKSA 4X8XA 1DR9A 4EZKA 3S4SB 1PSKH 5HHMD 2W88A 4MWFA 1AMXA 1MRCL 4JKLA 3W9EA 2IAMA 5JORB 4F7CB 1MLBB 2Z31B 3ZT6A 1KCWA 2JB5H 2RD0A 1JHLH 4MS8D 3RFZB 1T22B 4FQHB 3QIUD 3V4LA 1T5WB 5HDBF 3GHBL 1MFCH 2B1AL 2J88H 2KDGA 3L1EA 1IARB 4D0BA 2PYEE 32C2A 4N8UA 4E9QA 2CLRA 1P4LA 5TQ2L 4WKZA 1DP0A 3KLDA 1JV2B 1WAPA 4C47A 3T0XA 1FYTA 4G43A 1NOFA 4S1DC 4DKAA 1IGJB 3DWTA 4AITA 5HYEA 4PRPE 4F7TA 1U8QB 3KXFE 1JWMA 1ZA3A 3DJZA 4NQXB 5DXWA 2BLFA 1CE1L 2R23B 2P52A 4YL4A 3NA9L 1TZ8A 3X1GA 3VFWB 5JHLH 2A9ML 1CT8A 1F45A 5D2NC 3S34H 3BJLA 3L4ZA 5D7IF 1QHQA 1EDQA 3AGVA 1T5XB 1EFXB 3T71A 5GRUH 1OK0A 2EDBA 4D9LL 1MJ7H 3ZQWA 3BPNC 4XNMB 4NNPL 1H3VA 4RZCA 1A9VA 4NUGL 5E6SB 1F3JA 3R0MA 5GS0L 3D0AA 1ERNA 3D0LA 1UD6A 4RNRB 5TFSH 2VDNL 3BH9A 1WD8A 2FO1A 4LPCA 3UAAA 4N26A 1JWUB 2YD1A 3G9AB 4PJ7E 1KIUA 4FA6A 4YBQC 1NUDA 1PSKL 1U36A 3B2PA 4JHWH 4JG5A 4Z7QB 4LHUB 1JOIA 3B4NA 2PCPA 3IFPB 2LT9A 4N0UA 1AXTH 4HJTA 4P2RB 1X44A 3P3YA 3R0NA 5C09D 4LCCC 5BZWA 3HW7A 3OXRA 5DJ8B 1AP2A 1JHLL 3X1FA 1YYLL 3QZWG 1FNLA 4NIKB 5JIHA 4D9QD 1MFCL 5E2UH 3QXWA 4XMTA 4LNRA 5C0AB 2ZPKH 4KBPA 1MHHB 5JXAH 1M7DB 4AKQA 1S5IL 4HT1H 2JI1A 2H3KA 3VSVA 4G6FD 3L1GA 3CMOH 3WJLA 5BMFH 3FB5A 5JOFA 4XNDA 4N2AA 4BH7A 3HS9A 1HQRB 1PNDA 1WBZB 5JHLL 5LBSL 2GBVA 1RJLB 2OJEB 3HA0A 3K2IA 5KJ4A 4FFYH 4JG0H 4GW5B 3L4CA 5GRUL 1PZUB 1WZMA 4JO1H 3MC0A 1C7SA 4DVRH 2NX5A 5EO9B 5TFSL 4W9HC 3X1BA 4IMLA 4HH9A 1HOCA 2FBJH 4NDMB 4ZUWA 4A2HA 2FVNA 4XPFH 1QFWL 4UZGA 4HUUA 3OF6D 2XPGB 4AMWA 5L4JA 2VMEA 1BJMA 3AM8C 3WXWH 2VN6A 2DLTA 3U9PH 2XQ0A 3NJMA 3S37H 2YO3A 1QBAA 5JHBA 3PGCB 2FX8H 5HDBE 3WO3B 5B1BB 1WFMA 1KG0A 2PNDA 3QJXA 2L3BA 4P5MA 4AH2A 1VADB 2VLME 2WKLA 2Z1KA 4N20A 5E2UL 1P84K 2FJSA 4LO9A 2IPUG 2FLRT 3LZNA 5CSGA 3RPBA 3T3MB 3WY1A 1GCFA 1YNKH 2ZPKL 4TNVK 5T1MA 5CEZD 4Q6IC 1C16B 1CD8A 2ORBH 2VIRA 2X5PA 1Y7VA 2V2XA 3VD2A 5C0CA 3GK8H 5JHDA 1G0DA 5BMFL 2J1WA 4JREC 1O6VA 5D7IE 3UCQA 2F54A 1E5YA 2D8KA 3G7TA 4K5MA 4PJDB 5DJ0B 3DARA 4DERA 4TVSa 1QSEB 4JG0L 5IEHB 4G8GA 2WZ0A 2ZOUA 1BVOA 3ZJAA 3UJTL 4CSSA 4JO1L 3ZYZA 4DVRL 3G6JB 2DH2A 3BQUB 3GJEB 4E5XB 1EAPB 3D2UB 5BQDA 5MEPB 3MBEC 2FBJL 4HFWB 1JUFB 4XPFL 3HAEA 1NDMA 4HJ0D 2WUCH 1P1VA 4D0DA 2DYPD 2AJSL 4AGLA 2AJUH 1MW3A 3LB6D 4JE4B 3U9PL 4I2XE 3WXWL 3S37L 3F7QA 3LNEA 5EOCH 2P7TA 4EZLA 2NY5H 2FX8L 5EU4B 2X4RB 4URTB 3WS3B 5EEVA 1TYEB 3A21A 3CLWA 5DEZA 3GMQB 4PRNB 4QRRE 4MCNA 2CIIA 1I8UA 4UM9A 2FNBA 4MJIB 1GOGA 5CIPB 1IJ9A 3LPWA 1JGIA 2YD9A 3ML9A 4H26A 4A7QA 1OE1A 3TBVB 4ZODA 3S8GB 3UCRA 1PZ2A 4KY1H 3Q6FA 4AQ8A 2DMKA 2Q3XA 4GP8B 3LD8B 1NTDA 4NEHB 3PNWA 4HVBA 4Z7UB 1KJ2B 2ZJSH 4NUMA 2QHLA 1XGPB 3GKZA 1UOVA 5D2NA 1LDPH 4L8SB 3FKUS 2TSAA 4U1NA 5HHOA 5DS8B 3CXDH 2CO6A 4KKBD 1D5MB 1JF5A 4LVOC 3AT9A 4MNQA 1JV5A 3FOMB 4KY2A 4KK5D 3WFCL 4PW4A 4HJGA 4PP2B 4J2QA 4TN9A 4HWNA 4TRPH 4AVHA 2N3JA 4TNWK 5CWSB 4JFOB 4E2OA 1CF8L 4GINA 4IS6A 5FCSH 2WD0A 2EDEA 2PWHA 3BAJA 2FIKA 5D7EA 2QVMA 2AJUL 4K5PA 1DBKH 4F9LC 2AVGA 4MRBA 4HZLB 3MYJA 2NY5L 3DX9A 3BFOA 3PHOA 4LGSB 5JHDE 4JAMA 2EUXA 5K9JH 2NXZD 5DQJB 1KCUH 3NEEA 4U3HA 4X7DC 3NJXA 4P9MH 2F54E 3PWPE 3QA3A 1ZE3C 1TSRA 1VIWA 2BMKA 1N12A 3MNMA 3LAFA 2C4FU 2YFOA 2R2EA 4PRIA 3C6SB 4KPHH 4PGCB 4Z23A 4PJEE 2YZ1A 1U8HA 4KY1L 1PQZB 2VDPH 1SXZA 1SJVA 1U8CB 3O81A 4KXAA 3DOIA 3HAEG 5FYKE 1N5YH 5FC9A 3KH4A 4P2QD 2ZJSL 5BRZA 1LEKA 3H9ZA 2BS9A 2BFVH 4CN1A 2APTA 3ATAA 1YNTF 4QOKE 3RNQA 3VXRD 3MREB 4ELMF 4J3TA 5A2JH 3TU6A 4DCQB 4OD3H 1JF1B 3QIWB 4KX7A 2X0UA 5AKRA 4UZSA 5D7JB 4OZFB 4NN5B 3VXNA 1QTSA 4XCYA 4ELMA 3O0RH 3FN3A 3TVMC 1MFUA 3LH2L 4RFEA 2EUWA 2VLLB 1F3DH 2Z31D 4EI5A 4KDTC 5JO5B 5DHEA 4X6DF 5F96H 1DBKL 4OI7A 2R9HC 5HPMA 4WEBH 4V2BA 5JYLA 2Y7QA 1KXHA 3BPCA 3GBMH 2HVKA 3F85A 1INEH 2IPUK 3MKKA 4YBLC 2VR3A 4P9ML 5CR8A 2XHNA 2K1MA 5I28A 2QQQA 2TSBA 2BZ7A 2CBQA 1B3IA 1G7PA 5IVXB 1OEZW 3FTVA 4KPHL 1PDKA 2NCEA 1JZ5A 1CXEA 3KLLA 2FJHA 3CN3A 4XN7A 3FTSA 4FA8A 1E27B 2XV2A 1XIWB 4OH2A 4BIKA 1Q0XH 2VDPL 3MLTA 3K6NA 4KXBA 4HOWA 1HXMB 1ZT1A 1GPOH 1LJMA 5B39A 5C2UB 2C1OA 3SKUD 3D69A 1TETL 1EFXD 1N70A 2XZQL 1LE9B 1R5WA 3AG2B 2YC1B 2BFVL 1B4LA 1PFCA 3BW9A 4JFDB 2JKTM 4WWNA 4I1NB 4MYWB 1KXQA 3FHQA 4MB5A 3ZDYF 1BBJA 3L5JA 3IS0X 4OD3L 4HJJH 1AQDA 1VFAA 5B7EA 3BWSA 4W68A 3CFCH 3TCLA 2EP6A 3WIFA 1KBVA 2V8LA 4LHUD 2IDQA 4PPTA 5SWSB 4KNTA 2WLIA 3O0RL 3FQXA 3GZQA 3MUJA 3IMRA 2DIAA 4PVBA 3MCKB 4QY8A 3D0VB 2ADIA 3AS2A 4OD2A 4G8EB 2Q76A 4G7YH 3FH8A 4EE2A 4L9LC 5KUKA 2GYSA 4Y0GA 2GEEA 5C0AD 3GBML 3KG5A 5FM4A 1INEL 1KB5A 4BRVA 5BRZE 1NCIA 3JXAA 3S35L 2OMUA 1XHHA 2R83A 5GZOD 3BLPX 3TC9A 2CO4A 2B7DT 4B5ZA 1N18A 4LSQL 4CMMB 4FQLH 4U1JA 3GS7A 2OL3B 4RDBA 2F6AA 1TCRB 3NZ8B 4LLWB 4Q4IA 2BOLA 3M17B 4AEIL 6PCYA 2EJ1A 5F8QC 3OMZA 2AXWA 3QBTB 2ZIDA 1K8IB 1Q0XL 1PCXA 4JRYB 3HZKA 3HTLX 3KPMA 3LPFA 1GPOL 3WD5H 4AK2A 3QULA 4C4KT 4TQ8A 2OR7A 2NW3A 2VXUH 4XNQB 2BC4B 5CBEB 2DQUL 3T8MA 4UMSA 2FHCA 4M7JH 1RH8A 4AYID 3K6SB 1VCBC 2DBJA 3ABMB 3KPRB 5DMKA 2EYSB 2OXGB 3KGSA 4MXWH 2WIIB 2Y5TA 4L4VE 3DX7B 1YZZA 1YMHA 2Y72A 4GQZA 3FCGA 3DV6A 5KSAC 1EERB 4X6DE 4XRCB 5A6MA 3IFNL 2WAHA 1UACH 3HNTH 3O3UN 1NEZB 5DURB 4GKLA 2A73A 2JTDA 3WTTA 5FPIA 4F9LA 4KQ4H 1RY7B 2KHAA 1U3JA 3NA4A 3TWYA 4OIAA 5I19H 5ELIA 5A2FA 1A6AB 2ZOTA 5B39G 4JPKH 1DDTA 1ZVNA 4XOAA 3GMRB 5LBVA 5D6DC 2AAVA 3UYPA 5IJVB 3FCUB 4MD0A 4KX9A 2I5YH 1RIHH 4MYPA 4PU2A 3SCMB 3FO9A 3CVDA 3PQYA 5ESAA 1E0OB 1TMQA 1AZNA 3DLQR 4XCNB 3CZFA 3VVWA 4Z3EA 1BFOA 4IK7A 2QGCA 5DD6A 4TYUA 4ETQA 1KXQE 4EDWH 1I1YB 1DLHB 4PVNA 1VDGA 2IH3A 1A4CA 2F18A 2QPUA 3ZE1F 4QI3A 4ZX6A 5JW4N 3BUDA 4WENB 2OYMA 1LO4L 4PB0L 3NCWA 3HKZA 4J39A 1QSED 2JJTC 4NRXB 3WD5L 2J12B 2V9RA 2VXUL 1HDMB 5D96B 3ZDYE 4Y4KB 5KOMC 4AL8L 4X99A 5CILH 4TLTA 1AY1H 4W9KC 4WJ5B 5D7KD 4ZFZA 2YQ3A 3BQUD 4R2GB 1U9KA 3N0AA 1MHEB 3RHWF 3D2UD 1BF8A 3MJ8A 2VITA 5F9DC 3GMOA 1TU2B 4U6VH 3ZE2F 4EXPX 5C07B 2LLGA 1WC7B 2BVOA 5IFAL 2BCMA 3TVMA 1G6RA 1M7IB 1UACL 3M8OH 3FRPB 1KULA 3HNTL 4G8AC 4DFHA 3N06B 5EZLA 1MVYA 1DVXA 3DBSA 1F90H 4FHKA 2NT0A 2WLNA 4KQ4L 3BGMB 4E9LA 5I19L 5GGSA 1WWBX 3NZHL 3BKJH 3AC0A 2DS4A 4N8PA 4MJID 5ANME 3S5YA 4MQTB 3VXUB 1KXTB 1F4XL 5C0DB 1RIHL 3GSWA 4PGEB 1BWMA 4PRHA 1KIRB 1CG9A 2X9ZA 3KPLA 3PRZA 4OVUA 4XBGB 3SOTA 4GQ9H 4EDWL 5ECJE 5SWQB 4POZD 5D1XE 2CRMA 1U8NA 3HS0A 5E8NB 5DA4A 5F9WB 2WTRA 2VT0A 2YR3A 2H32A 4HAFA 4AGPA 5EBWB 2ZYSA 2AFNA 2NNCA 1NCBH 5JDSB 2VR4A 3A4AA 1ZGLB 2B14A 3OX8A 4U3XA 5CILL 3ZPDA 3ME0A 1WUNT 3IDGA 2ICEA 4BHUA 3Q6GH 1BEXA 2I85A 2OQJB 3P3UA 3GSVA 4LGPB 4DTGH 1QW8A 1XO8A 4HETA 4AGNA 1ZLVH 2BVPA 3OJDA 3O9WB 1HHJB 4BUHA 3TTYA 3QNXB 4F92B 1IGFH 3EO1A 1DJWA 3SOBL 3FTYA 3PQYE 2BX5A 1JCKA 4FNPA 5D5MA 3ZK0A 4AUYA 3M8OL 4YSRA 2I9TB 1CN4A 2HRGA 2NQDA 2QPFA 4LNVA 5DSCA 2JI3A 2A0LD 3AS0A 3L4XA 4TVPD 4BFFA 3CFTA 4HWEL 1FVCA 4PBWD 5E4IA 3BKJL 5AD0B 3HPJB 4BZ1A 2Y1ZA 4P5KB 5GGQH 1FN4A 3P3TA 4GBXB 5J9PB 2OTUA 2ZWSA 5BNXD 2VH5H 1MIMH 3BUYA 1T6BX 3QQ3B 4GQ9L 3MODH 1JZHA 3RKPA 1SDAB 2Q20A 3H1ZA 3O41A 5LWYH 4XNZC 3SDCD 3TH2T 5KVGH 1MHPH 3P0VH 5I6KA 4E42B 3VGDA 3VCLB 1Y18A 2YS4A 3LB6C 4UIMA 4HPHA 5DK0B 1NCBL 4HOXA 3P9MA 2NUTB 3P73A 3ULVE 1C12A 5FKPB 3QCTH 3QIWD 4KKAC 3O11B 3QIUA 3T0EC 3CFEA 3ESNA 3TJHC 5D7JD 1S7WA 4DTGL 1D5IH 3G6AA 4KNQA 3I3DA 5EWIH 2ZSWA 1DO6A 2OMXA 3CZLA 1NC4A 5BUGA 2OMYA 2A4CA 1IGFL 5ETUB 3TV8A 5AEAA 1PNCA 1DQQA 3P3RA 3VFUA 1PZAA 3EBIA 4WK2B 2DQ6A 2E7MA 1EFQA 4PRBA 4UTBH 1AOHA 2DICA 2B9AA 1RZIB 1C5BH 2G0LA 3A22A 4FL4C 4N2OA 3L1OH 5L4FA 1YRKA 4GS7B 5B38A 2BRRL 3K8KA 5KYUB 3PABA 5D6DA 2F5AH 5E8EA 4RWYH 4MDIA 4YSPA 3QDHA 3C60B 1SYSB 4PTTA 5AL0A 4KK5C 1NFDB 1H9VA 4FYSA 4HUXA 1XIWD 4LARH 2UZYB 2VH5L 1MIML 2CHZA 4Z7VE 2EDYA 3U30C 3C5SB 3M1BA 1Z9PA 4BKLA 4LRNH 3NIGF 4M6AA 4WO4C 5LWYL 1WHOA 5KVGL 3B9AA 1MHPL 3P0VL 5K39B 4JFDD 3HN5A 4HZ1A 4PH8A 1ROCA 2ZWKA 4XGZA 5I74C 2A6JB 5C09A 1ZPUA 3RJQB 1N26A 3QCTL 1NBQA 5LCVA 2B39A 2FATH 3NSXA 1A4AA 5DJXB 1PJWA 5AVSB 5G4MA 1PPIA 2OJZH 4GRWB 4G42A 4HUVB 1D5IL 4OR1A 3UABA 2BO0A 3GM8A 3H4FA 5SWSD 2BZDA 4Z77A 3HOGA 4IRZL 2E8ZA 3Q48A 5EWIL 1IO4C 2JI2A 3UX9B 3W0WE 5IB5A 4EUPH 3ZKXB 3CU1A 4OV6F 5HYQB 4J12A 1DUYA 3W82A 5IBUB 4PJGF 3JV6B 5I16A 3QUZC 1IAOA 1VFBA 2D9CA 4XOCA 1QHOA 3UC0L 5F9OL 4BUGA 4GUPB 2CHNA 2DAVA 3TNMB 1I3RA 4PJGA 1NCTA 3DYPA 2DKMA 3F5WA 1ACYL 2UWEE 2ZQKA 4JRYD 1VFOA 4MD4A 2BIPA 2IFFH 3CLFL 2R69A 4QRSA 3N04A 5EBLB 5JPMB 4LRNL 4M1DH 6CGTA 3NOIA 3OF6A 2ZONA 4WEUD 2X6BA 3K8MA 3CUPB 4PW9A 1OQXA 3RUGF 1AQ8A 3KPPB 4KHTH 3RFZC 3CVBA 1CURA 2MHAB 5I71B 3KPRD 4ES8A 4MNGE 5I5MA 3L6FB 4F7EB 1F6LL 1P69B 1IILE 4YHLH 3SYCA 2FATL 2G2PA 3L5WA 3K6IA 1SJHB 2AXJA 5B38G 4HMEA 2OJZL 1I85A 4FJZA 3RUGA 2I9LB 4B9GA 5DZVA 4P3CL 5J6HA 4CNIB 1S8DB 5ABZA 5DURD 1QR1A 1XVSA 1DEEB 3QJVB 1F58H 1O7DE 1S7SB 1KLGB 4M61B 1JN6A 5EO1B 4Z7OB 2YSSB 5IV2B 5L7XH 3FN0H 1SBBA 1NEPA 5CAYB 1SXBA 1F13A 2HT4D 2IPKA 2ZUWA 4IEFA 2ZKMX 1ONQB 3Q9QA 5F7HA 3C5ZB 2APBA 4XH2A 5L4MA 1X5IA 3SCMD 2EH7H 4G9DA 2YLKA 1JK9B 2XZCH 1IGTA 5AYUH 3WUWA 3ECWA 3CIAA 3WN5B 5HBBA 3OC8A 4UM8B 5B1AB 1S9XA 3RJDA 1EVUA 3T6ZA 3IJYB 1GC1H 2VLJB 1P9MC 3ZHDA 2HYMA 2VISA 1KLUB 4JANA 3B8YA 3BVUA 3VFRB 4JFXB 3NDZE 4S0HA 2IFFL 3BVNA 2OYLA 3UAFA 1TIUA 2GFBB 3ZR6A 3EZ8A 3RHWK 1NGXB 2DYPA 5K59F 4Y4KD 5IW6A 1K4DB 1MJ8L 5LQBH 2SEBB 3JTTA 1SQ2N 4R2GD 1AG6A 1W16A 4KKRA 3B8SA 3RY4A 5DJ2A 1XMWA 5H94A 3VXQA 4HOZA 3LS4H 1A7RH 5ESVB 4YHLL 4HCRH 2EEDA 1FZMA 1FZJB 3PUCA 5ID1B 2Q7YA 2A5UA 3QPKA 4Z7AA 3SPVB 1OP9A 3OZ9L 5GZOC 2DQTH 4LSRH 2O5YH 5HDLA 3HPLB 1GKOA 4WHYH 3ZXAC 2I32A 1RP9A 1FGVH 2AXFA 3ILPA 4KUZH 1F58L 4WUUE 3V95A 4PJ8B 4MA3B 4CU8A 2WINB 1QFOA 3K0YA 2BFGA 5L7XL 3AQYA 1H6EA 5AZEH 4KRMB 3FN0L 5SWZB 3VXUD 5K69A 3MLXH 2QADB 5IB4B 3FCTA 1GRWA 1L3WA 4WWID 2XZCL 5AYUL 4Y5YB 3DUHA 2L7EA 1NM9A 2X88A 3LKRB 3NACL 2D03H 5I0YA 2ZKHL 3FSAA 1G7IB 2ICWB 3MRMA 1RURH 3VU1A 5EUOF 4AG4H 5L2JA 3PIQB 2W0FA 3WGUB 3ARWA 4DGIL 2GTZA 4M93B 4KDVA 4JPIA 5DD3L 3RUGE 3V6OC 4UTCA 1AZVA 5ESQA 2K7PA 1RZGA 1QG3A 1AG0A 2R0WL 5EUOA 5LQBL 5DRNA 1JE6A 4K7FA 4S0SD 3L08A 4LDLB 2X10A 3UG3A 1E5CA 3WEAA 4XXCC 3QQNA 1M53A 4EOWH 4H7VA 3O9WD 3LS4L 1A7RL 4BHUI 3ATDA 4JFSA 3CN0A 3B9DA 3BYTA 4W6XB 5KYXA 1RJZB 5F88A 4MQXD 5IOPB 3WUWG 5I6OA 4LSRL 2DOCA 1F6AB 5AW5B 2AK4B 5LAPA 2QJDA 2BSTA 2IAND 4MXVF 4XBPA 6FABH 3MOQA 2O72A 2WWOA 1KFGA 2NSXA 1FGVL 2D31B 1Z3RA 4KUZL 3QUHA 1J9CT 4QYAA 2ADYA 1AQMA 3FHAA 2MOQA 3J07A 1JZGA 5AZEL 3IDXL 4G9FB 2PABA 1U8LB 4JQIH 4YGVB 2A2QT 3QUZA 4P2QA 4ZMWA 1F11B 1QRNB 3I6KA 3MXVL 1SXCA 3TASA 5B7FA 1QUPA 1AAJA 3H9YA 3MLXL 5CN3A 3WO4C 4GBXD 1FLRL 4YFDB 4EI0A 4GW4A 1V05A 3RY5A 1PLBA 3L3OB 4OZ4A 5LUMA 4PR5A 1LEGA 3VXRA 3E6HB 1TNMA 3FZUC 1KCVL 3BQUC 3SBQA 1GYUA 4A7SA 2FSEB 3ETBJ 4L1DA 3S4SA 3LIZA 5DF0A 1J12A 3T0EE 2FH6A 4E41B 2MEJB 3EFFB 1OQOA 4P23C 3VA2C 3RWIA 5DVLA 5JORA 4FXKB 5CSZA 4F7CA 1MLBA 2Z31A 4U1SB 1CDUA 3ZGIA 4JR9H 3RFZA 2ZT9C 1LGVA 1T22A 2VZOA 4FQHA 4Z7NB 1T5WA 2UXGA 4HWUA 3U6XS 4YK4B 1HFUA 4EOWL 4WW1B 3ZIYA 1A3QA 1EA9C 1JV2A 5KVDE 4M8UA 1ZWIB 4A7UA 1IGJA 1O7SA 2CLVB 3FN9A 1U8QA 4RGNB 1BQUA 2A9CA 4D8PB 4W9DC 4NQXA 1BVZA 3LD8C 2F1EA 2R23A 3KJ6H 4QGTA 4POZC 4N6RB 1OY3B 3OPZH 5D8JL 4L8SC 3NRFA 4UTAL 3SBWC 4N2HA 1T5XA 3NPSB 1EFXA 2DJ4A 4NPYB 3IU4L 5BOPA 4XNMA 3C60D 3VFOB 4M8VA 5JQHC 3RZWA 4Z7QF 4XOBA 2WXJA 4BK5C 2IXQB 2QTEA 4RNRA 3EOAB 4F7MB 4A6YH 5EEUA 3Q2WA 3CD4A 1JWUA 2DWSA 1P9MA 5FM5M 1X6NA 2PN5A 3KGUA 2EICA 2R27A 1ED3B 5FYJU 4LHUA 4YLBA 2VLRE 5F7WC 3VMOA 3IFPA 4HAKA 4P2RA 3TS8A 2HUHA 4G7QB 1XCWA 4KITB 5DJ8A 2VQ4A 2AQQA 3BZEB 3CLEH 4IHBA 3SY0B 1UWEH 4FD0A 5F1OB 5C0AA 3TBSB 4O2CB 1MHHA 1M7DA 3WMSA 3CNKA 4MXVE 1MDTA 1RIVL 4UDUB 5JW5B 4YOKA 1KCKA 4NZUL 4L1BA 1Z2KA 5INCB 5GZOA 4M3HA 3AT8A 5IKCB 1JP5A 4MXQD 2DLEA 3KJ6L 3S4SG 1CGXA 1HQRA 1WBZA 2AW2A 3RU8L 3QZPA 3OPZL 1RJLA 2OJEA 4NM8H 3UYOD 4MA1C 1Y0LB 4GW5A 3V5HB 1N7MH 3WKQA 3V4VH 5KBPA 3L81A 5F3HB 3X3GL 3UAEA 3PDGA 3GPSA 3LV3B 1L6XA 3QJZA 1QAWA 3F62A 1JYVA 5EO9A 3FSWA 1E2VA 2YAEA 5D7JC 1NPUA 2DQIH 4NN5C 2A6DB 4NDMA 1L0QA 1WZKA 3O3EB 3TT1H 4ZO6A 1QD0A 1QTYT 2H2PC 2XPGA 2ZWLT 4GMTL 3KL3A 2ZYRA 1KEGH 3T3MF 4YDJB 1OF2B 3TT3H 2BWQA 4JFZH 3VH8B 1KN4L 3PGCA 3V6OA 2Q8AH 2XWEA 5HVGB 3V0WH 4BFGA 5JMOC 3QWQB 1Z5HA 5CCGE 3VO0A 1GA2A 3CLEL 4GSUA 1VB9A 1EO8H 1OCWL 3AAZB 3FUDA 4XXCA 1VKXB 1IFHH 1UWEL 1PBYA 4I3SL 3JV5A 3DECA 3ZRCC 3IE4A 3IYLW 3OAUH 2GCYB 3WMQA 1C16A 1WBXB 1S78D 1XIWC 3QUMH 4N4YB 1DJXA 2IG2L 4CSPA 1OGTB 4UIKH 4RMUA 1YAIA 2DBLH 3G6JF 4PJDA 1TR7A 4NM8L 2ZXGA 4LHUG 1QSEA 4AMKL 4Y2NA 5IEHA 1N7ML 5GJTH 4BK4A 2NDGA 1UOKA 4P2RE 2EINB 1PVHA 4QMEA 1X6LA 1D7CA 5T3XD 2VLJD 3G6JA 3BQUA 4H8QA 3GJEA 4V1DB 4XAKE 2G9HB 4E5XA 1LK3H 3D2UA 2F53E 4NZRL 2AMUA 1ZTMA 2DQIL 5MEPA 4HFWA 1JUFA 1M56B 5K1VA 5E7BA 2DQEH 4HC1A 1T5KA 1ZKAA 3HG0A 1KEGL 5FYJD 4EDXB 3OGCB 3TT3L 3ZSTA 5I18H 3GD1C 4JFZL 4NC2B 1BXVA 4OFKA 5DFVD 1KB9J 5E5UB 5EU4A 2Q8AL 3V0WL 3L45A 2X4RA 5E5LA 3WS3A 2MKWA 2XQYA 4AUJA 3NIDE 4I5BB 4RMRA 1QRKA 1EO8L 1SXNA 1IKNC 2HT2C 3GMQA 5AOIA 3DURB 3T1FB 4L8CB 2AEOA 2CDGB 5AW4B 4MJIA 3WDJA 4YXHH 5CIPA 2Y07H 3GLAA 4Z7UF 5KZCB 3OAUL 4MASA 4OCSH 4GG8B 5D93C 3V0JA 2DLFH 1RK1B 3TBVA 2WNKA 3K5SA 3HI6H 3U83A 3VRLF 1WCQA 1FHNA 2D4FA 4UYPA 3MUGB 1FC1A 1A64A 2PW2B 5SWZD 4Z7UA 1KJ2A 1QWUA 1E4XL 4L1TA 4CKVX 2QR0B 2B59B 2DBLL 1XGPA 2QADD 4L8SA 4LVHB 5DS8A 4AI7A 3O6LH 1A7NH 4CVUA 5GJTL 1EVTC 3DVGB 1D5MA 3PY9A 3FOMA 4BK5A 1IBYA 3QZMA 3GO1H 4PP2A 2JKXA 2R39A 3O8XC 1IGCH 1BCIA 5CWSA 4JFOA 4NB7A 5GISH 4B9JA 3TESA 2E7DA 2JELL 2DQEL 4IBWA 1K8DB 3QWNA 5EBMB 3VB9A 4BKTC 3OC5A 3HUJB 5KJRH 3EJYD 5EEZA 3B7RL 3DUSB 3C5XA 5J6GB 2EYTA 3UTTB 4HZLA 1K4CB 3GTTA 4EJ1C 2GJJA 3GBNL 2XCMC 5DQJA 2VCOA 4P5RA 5JQ6L 1KBPA 2RFXB 4DKFL 3U46B 2B8OT 2AK4D 3RVUD 1ZVYA 3C6SA 4K3DH 4PGCA 4OCSL 2HRHA 4BSWA 2DLFL 2PR9A 4PVMA 1PQZA 4F33B 2YEQA 3G6JE 2DH3A 1MZYA 1U8CA 1CC3A 2XWRA 3E2HB 3P9WB 3VXTA 3K2UL 4G9FD 1N8OE 3PCYA 1QRND 3M1CA 2K3TA 4TUOB 1GGBH 2WQXA 4GRLC 4Y4KC 3EYUH 4G8IB 3BVTA 3O6LL 1A7NL 3MREA 5HGDB 1OP3K 4IM8A 1RQ5A 5DU7A 4DCQA 1JF1A 3QIWA 2XQYG 4YFLF 2HLFD 4C4UA 3HAEH 3E1F1 1MWOA 3D08A 5D7JA 2APXA 4OZFA 4E41D 4L3EE 1IGCL 1KGCD 1NZRA 4PCYA 4NO3B 2W0LA 2LABA 5GISL 4NIYE 2VLLA 3KYMB 3OXSA 2FK9A 5JO5A 1Q8MA 1KGIA 2BOBB 5KJRL 3P77A 1XH3B 2NYZA 3VXME 3SN6N 5IVXF 3DIVA 2HFFB 2IGLA 4HKZB 4JKNA 4MZ2A 1JK8B 4AYSA 5TF0A 1BLNB 4A7VA 2NNFA 5A6LA 3FO0H 1HYSC 4DF9A 2QFPA 4G6JL 3ZDXF 4YVUA 3VRLE 4RGND 4OD1L 5IVXA 4XAWL 3IE9A 3AG3B 2XWXA 4JDEB 3RDTB 1MF2H 4FQPA 1E27A 1XIWA 3BUQA 2OMVB 1HXMA 1JWSB 5F9WC 1IC7H 4JFUA 5JHMA 3TBYB 1GY1A 5CLXA 1LE9A 3DO3A 1FLTX 5KSVB 2NY0B 4BGLA 2YC1A 1GGBL 1J8KA 3EYUL 4XPGL 3BWUC 1OT1A 1ZIAA 3EYQD 4JFDA 4O5LL 3MMEB 1Z9NA 1UM6H 1CWVA 2FO4B 4HS6B 4UNIA 3L3JB 1OP5H 1N59B 3TN0B 4Z3HA 1GGCL 3MV01 4MQXC 1B2YA 2A4ZA 2FWLB 2ZXQA 4RX4D 5SWSA 4XT1C 5HYJE 4IGBB 1N64H 1S7UB 3JWDC 1RP8A 1T1ZB 3MCKA 2CO7B 3D0VA 2JKSA 4HH8A 2A9BA 4FQIH 3ALXA 4U0QB 1QW9A 3NFSL 5HHXH 4G8EA 4MAUH 3GJFB 2XQBH 5I24A 3K1KC 2GJRA 3BIBX 2VM4A 1EK3A 4N87A 1CD9B 4X7EC 4N0YH 4I1RA 1I8MB 2LVCA 3P2TA 3GI8H 4CMMA 4UOJA 2FEEI 5J89A 2OL3A 1TPXB 4OT1L 4CU6A 1TCRA 3NZ8A 4WSGA 3M17A 4YHOH 4EPSA 2A3TA 3ET9F 3W5NA 1K8IA 1UYWH 5JOPD 4JRYA 4OZFG 3TWCH 3PGFL 3GRGA 4IU3B 4F1ZA 4DUVA 4XNQA 2BC4A 1T2XA 5CBEA 4ICWA 4HXBH 2FQDA 4TV3A 2BZCA 3AB0B 4ODXB 2WLHA 3K6SA 2NXYB 3LCYA 1EO7A 5D72H 2OMZB 1UM6L 1DBAL 3KPRA 2EYSA 4UILH 4XBEH 2OXGA 2WIIA 3D9AH 4R4FH 4W9EC 4WSJA 2X09A 1Y6KR 1BX2B 3DX7A 3QXAB 2VM3A 3O8XA 4L29B 1HYRC 4F20A 2VMJA 2KUTA 3IM1A 4XRCA 4ANUA 4KI1A 1NEZA 3VM5A 2ARJA 4GSDH 3MV9E 3QRBA 1AXSB 1JZDC 4KKNA 4PN6A 2E4FA 4FQIL 4POUB 5HHXL 2DKSA 4MAUL 4GS7C 1A6AA 4DSYA 4ZPTB 1O6SB 3CZJA 5DWPA 3GMRA 4IMKC 5DMIH 3ZDXE 3GIZH 5IJVA 1OHQA 1TTGA 3HMWL 1FL6B 2YK1L 2YMTA 3SCMA 3C60C 3MOAH 3JVFC 4F91B 2B2XL 5LNDA 5I1HH 2JKJA 2ZG2A 3GI8L 3N1MC 4U3CA 4RGMC 5GRZA 2QBWA 2VMCA 1FNAA 1I1YA 1DLHA 4YHOL 5EF1A 2PTVA 1UFGA 1OAUH 3TWCL 2C4XA 2WWKO 1WFNA 1XWVA 1HKLL 2CE6A 2N7AA 3NABL 4NRXA 1TYJA 5DZPA 1HDMA 4AGMA 4JRXB 2WQAA 5FCUL 1VF5C 3L3GB 4Y4KA 4WJ5A 4V1DD 2R8SH 1JTOA 4UILL 1F56A 1QLEL 5C3TA 1TU2A 2N1KA 1E67A 4GIPD 5C07A 1WC7A 3BE1H 5GHWH 4QDGA 2VW4A 5LXVA 1M7IA 3FRPA 3CDZB 2YOCA 4G1EB 5DMYA 3MZGB 4TUJA 2W9EH 4GSDL 4UZUA 2WXGA 3BGMA 1KB5H 4OB5H 5AB2A 1IBGH 2CQVA 4JRYE 3UAJD 4U1KB 5DMIL 4MVBC 3GIZL 3VXUA 1KXTA 1PZDA 5KEZA 5KZCD 5C0DA 4PGEA 2ZWYA 3PJNA 1KBWA 1T20B 2O5ZH 1QYGH 3MOAL 2UV3A 2FLMA 2WYIA 1KIRA 5I1HL 2IF7A 4NS0A 3AQXA 3UP1A 2WCSA 4TSAH 4XBGA 1N0LB 3PHQB 3QPQD 1OLLA 5SWQA 1L9NA 3JV0A 2B9BA 5JPMC 3BWUF 5E8NA 1OAUL 2QVFB 4UYQA 1UT2A 2YPKB 5EBWA 5L2KD 5I9QB 4JVUA 1NEZG 1T1XB 2G30A 3KDMB 4U4BA 4X4XB 2GC7C 5JDSA 5I71C 1ZGLA 2XVGA 3CSGA 5CF3A 1RI8A 5IHUH 2OQJA 4PLJD 3VXSB 2R8SL 4WW2C 1FZKB 1YEIH 1HZKA 3CSTA 4JDTH 3O9WA 1HHJA 4WJG3 5J11B 3GBEA 1KIQB 2OP4H 3QNXA 2AZUA 4BCZA 2PMZA 1Z66A 1S78C 4I8DA 3L95B 2YRZA 3UTTD 3BISA 2I9TA 2TRYA 2OM5A 3VB8A 4DOHE 1NBVL 2PP8A 5GGUB 1K6QH 1LO2H 1BXUA 2DL2A 3KLAB 3RX7A 2G60L 3C5ZC 1KB5L 1UASA 4NKOB 2FD6H 2ZAIA 4OB5L 1IBGL 1RZJC 1ZE3H 5AD0A 1YO4A 5IZ7A 3HPJA 1RL1A 1UT9A 2VNCA 4P5KA 4ZOAA 5T1JA 4GBXA 5J9PA 2PUQT 1G7HB 4YSDA 3KBPA 4EI6B 1EZVY 1T7YA 1NCNA 3NMEA 3MV11 2VDOL 1FWXA 3C6LC 4LLQB 3WLBB 1PZ3A 3D39B 3FF7A 3V4PB 3QW9A 4ABUA 4HIIB 3LMJH 1J8RA 4ZDHB 4RCAA 2Y0SA 4E42A 4LLVB 5C07E 5DJZB 2TAAA 5DK0A 3FRPG 1E9OB 4AGOA 4L9DA 5BQ7B 3V9CA 2NUTA 3LKNB 1SMAA 5FKPA 4UU9B 3T1WA 3VUAA 1H3GA 3MRDB 3O11A 4H0GA 4DAGH 5IHUL 2E56A 1P7KB 1YEIL 1P6AB 4JDTL 4XP5H 4N90D 1S7XB 5E00B 1G6RH 2PPAA 4U1LB 3MRBB 2AZAA 4Q9BA 1VGKB 2OP4L 5T1LD 2WVVB 4UAOB 1E4JA 5ETUA 4PJ8C 4YFLI 1LVEA 1L7TH 5FA3B 1K6QL 1LO2L 1NFDF 1RZIA 1U0QA 4ZX5A 3CVHB 4JGUA 2FD6L 3CDYA 4JY6B 4QRPE 5KYUA 4L4TB 4Y1AE 4Y5YC 4P3WA 1K2DB 1TQCC 2BNRA 3C60A 1SYSA 5C08B 3SDAB 4AXWB 1T89C 1NFDA 2H6PB 2Y7SA 2UZYA 5E23A 2F0CA 3FCSB 2CRZA 5BJTB 4NAJA 4CILA 4GO8A 2H32H 4M93C 4KUCD 1IEAB 5B21A 2V5SA 3LMJL 2NY0D 4P2YA 2A9NH 4WU7B 4PLKD 3AW5A 4GRWF 5K39A 3O2VH 1BAWA 4DP5X 3U48A 1FFTB 2BJMH 5JOEA 2MKLC 1NFKA 3VGAC 3OAWA 1QFUL 1S7TB 2A6JA 3MFGB 3CFBB 1G1CA 4ALAH 3I3BA 4LEBA 4BV1A 1JG9A 3TN0D 4DAGL 5DJXA 2E75C 2I24N 4GT7A 6PAZA 4HUVA 4GG6B 3PWNB 4XP5L 4FFTA 4IGBD 3DVNB 4JN1H 1G6RL 2DM7A 3OG6B 1KXVC 4E9RA 4AV5A 1RXLA 1I3GH 4BSVB 5HYQA 4KJPD 1L9PA 1J1XH 4OIIH 3NUKA 1E5UI 2BY3A 1L7TL 3Q05A 4ZQKB 3JV6A 2Z7YA 3UIZA 2C34A 4BXSV 3PXHA 1IQWH 4BZ1H 1EIBA 2HVBA 1H19A 3T4YB 3CBKB 4GUPA 2XVKA 3L3OC 4FQJL 2JFCA 5FHBH 3TO4B 3TNMA 4QT5B 2YAMA 2I7SA 1FAIH 2VDMH 3ABZA 3MLVL 1S9WB 4YDLC 3ZTEA 4N0FB 4HSCX 4ZAKB 3RRQA 5JPMA 5EBLA 4Z18A 2GY5A 1GGTA 3WKPA 4XP6H 4ABQA 1IAKB 3CUPA 1OGAB 4HWBA 4KO9A 3KPPA 2NXYD 2VC2L 2MHAA 2BJML 3HHSB 1YJDH 4Q9RH 2A4EA 2XT1B 3ARFB 3L6FA 4F7EA 1IIIA 4YUEH 1JD9A 2Z64C 1THCA 1SJHA 4Z7OF 1CFBA 3QXVA 3VFNB 3VI4B 2I9LA 5LNEA 4CNIA 1S8DA 4JN1L 1IAII 1MJUH 1OT4A 1DEEA 4MQ7B 2BNRE 4H40A 1MFBL 5KBKA 4NN7B 3O4OB 1S7SA 1KLGA 4M61A 3T3PB 4OIIL 5EO1A 1LLAA 2YSSA 5IV2A 4HHAB 3G3LA 4OQTA 1IFGA 1ONQA 3NPSC 3C5ZA 1IQWL 3POHA 2AV7B 2B0SL 4BZ1L 4A7GF 1JK9A 3ULUC 3EYQC 3WN5A 2IWKA 4UM8A 4B0MM 2DQFB 2WXMA 3HRPA 4O00A 3UP6A 4ZFOB 2WQVA 2VLJA 3B1TA 1XSIA 3QCUH 2EVHA 1KLUA 2HFGH 2HT3D 1BMZA 1ZDSA 2MH4A 2PTTB 3K3QA 3EGXB 4P4KB 2AQPA 3VFRA 3VGHA 2EH8L 4A7GA 5JW4Q 4GRWE 3WTXA 1NWPA 1BW8A 2GFBA 1GHFH 3QNYB 2VQUA 4XP6L 1K4DA 3TNNB 5L88H 1EDYA 2X4SB 4WFHE 2SEBA 4PJAE 1CLVA 3GSQB 4AYDC 2NY4B 1YJDL 2K8QA 3QEHB 5IBUG 1QSFB 3IJ9A 4Q9RL 3LS5L 1DJSA 1X5AA 5ESVA 5FFOA 4YUEL 4BBWA 3EJRA 1FZJA 5ID1A 1G7QB 2UXVA 2M8XA 1BXAA 1DJHA 2R15A 2ADFH 4PMEA 5DUPL 3SPVA 1JXFA 1HU8A 5MENB 3HPLA 4G5ZH 2NNAB 4Y88A 1MJUL 3EZJB 2DYRB 3I74A 4PJ8A 5F6HJ 4XHJD 3BGAA 4MA3A 2WINA 4TF4A 2WBXA 4L8BB 2DQJH 1YEHH 3L2NA 2KLRA 1QBLL 3AWFA 5SWZA 1T4KB 1S9VB 5K1JA 3HG5A 4IIQB 5IB4A 3IMBA 3VX0A 2E74C 2XI9A 3ZKND 5HTSA 4Y5YA 4I48B 2K6YA 2AQ2A 3LKRA 1G7IA 2X6UA 3JWNC 2AJYL 5H8DA 4FLQA 1T89A 2W81C 1BAFH 1WTGT 2ICWA 4F24A 2R69H 1SGKA 4OUUB 4ONOA 3PIQA 3PHSA 3SYAA 4KK6D 1KCBA 3BT2H 4HQQH 5EOQH 5F3BB 3BYYA 2HAZA 2GITB 4KGLA 1YMMB 4L5FH 5F1IB 3FNKA 1I7ZB 3D4CA 5L88L 3ES6B 4PB9H 5LCVL 3VXSD 2XPYA 4HJEA 3WDHA 2VYRE 2GHZA 4Z7OE 1KYUA 1KC5H 2H5UA 5EPMA 3V6BR 4RA3A 4OCMC 1RJZA 4GRMB 5CEZH 5IOPA 5TJWK 2EO1A 3X14B 2ADFL 1WRFA 2HTLD 1F6AA 2AK4A 1NAKH 4H8HA 4WCYL 5FGRA 2ZUYA 1KXVA 5E2VH 4Z7WB 2D31A 2ITCA 1MCBA 3T6QC 3GWJA 2XV0A 1YEHL 4G9FA 4YGVA 1U8LA 4C57C 3L7FA 1GW0A 1PZBA 2F58H 1F11A 1QRNA 2BP3A 3CZKA 5F71A 2Q86B 3UPCA 1FORH 5JUEH 1BPVA 3IPFA 3N41B 4K3EH 2PO6B 4XE5B 3K81A 4J6RL 3L3OA 1IBHA 3SQRA 3E6HA 5FYJE 4NGHH 1OTSC 2DQCH 2GSGA 3D39D 1C7TA 1BAFL 2FSEA 1JXDA 2B4CC 2R69L 3PAYA 4F2EA 4Z7NF 1JHTB 4E41A 1HH6B 4J3OC 4HQQL 5EOQL 5K9OB 3WFEL 3JYCA 1XH0A 4FXKA 4L5FL 4FEIA 4PJ9B 1UZ8B 1P4IH 5KYNA 3VDAA 2AEIT 1F4WH 2VR9A 1A2YB 3AREB 3D30A 3X1EA 3PS6A 1HC1A 2GJ6E 1C8QA 4WW1A 4IDLA 1KC5L 1SN0A 1KZYA 4ELDA 1VZGA 4ANVA 4K73A 1ZWIA 2DEYX 2VSCA 4K2UH 1AKPA 1NMAH 5MI0B 2CLVA 2Z93B 1CXKA 1G1YA 1NAKL 2V17H 4GSQA 3VX1A 3AS3A 2W9DL 4UQEA 3QPQC 4KROC 2Z0UA 3LZRA 4N6RA 3L2MA 1FCGA 4C54A 5K1NA 3ULUF 5TTRA 2UUDK 4UT9A 1V54B 1BGXH 5ITBH 5JMRA 4LVHC 1A4KB 4HG4K 3IGKA 4L4TD 1QFWM 3ZVVA 4NPYA 1WS7A 4M4PA 5JUEL 3M1OA 5C08D 3SDAD 3VFOA 2OJ1A 3MRLB 4K3EL 5I1AB 2YSTA 3VW3H 1N10A 3MJ7B 2IXQA 1KN2H 3EOAA 3CC5B 4NGHL 4F7MA 4PLJC 5G55A 4Z3FA 2DQCL 4F5CA 4WHCA 4Y8AA 3ILQD 5EC2B 1SN5A 2HJFB 3Q44A 4ONGH 1EDHA 1AVAA 1ED3A 2YA1A 3GSNB 1BFTA 1OD9A 2NY1B 3DX6B 5KW9H 4RX4A 5JIQA 1E6OH 2E7BA 2C9XA 5E8PB 2AQTA 1XT5A 3MGAA 1P4IL 1L9MA 1YYMH 3OLDA 4X4ME 4F57H 3BZEA 3SKNB 4PIRF 2CALA 4GI8A 3FFCB 3SY0A 3NSCA 4JMXA 3VMPA 2V4LA 1UKTA 2QZQA 3BN3B 2X1PA 2P5EE 4I88A 3M46A 3TBSA 4O2CA 4UDUA 5JW5A 4R4ND 5CS7A 4XX1G 2C3WA 2ZX6A 3BUBA 1T2QH 2ZAGA 3BXNB 5INCA 3UACA 3DGCR 5FF6A 2VXTH 3T8XB 2V17L 5IKCA 3E2HC 5DK3A 2Q0ZX 4FG6D 25C8L 4WUKH 2VN4A 5L8JB 4R7NB 4BFOA 5KVDL 5LO7A 3GS0A 3LN4B 5DHMC 1EH9A 1Y0LA 4MNHB 5ITBL 1CXHA 1F5WA 3MCG1 5CMAB 2DIBA 2CGYA 4G7RB 1FSKB 3TO4D 3V5HA 4A55A 1Z9LA 5F3HA 1Q0EA 1E65A 1TO4A 4GAGH 3VW3L 3PF2A 2EYRB 4M03A 3HN3A 1KN2L 5JW4M 4ZAKD 3EDDA 1JNNL 2A6DA 1IEHA 3O3EA 2ERJB 1CFTB 2EC9U 2R4RH 4ONGL 2FB4L 1EEYA 5DR5H 2VXQA 5E03A 1OGAD 2AEQL 5T1DH 4YDJA 4ZSOE 1BQRA 1CIUA 3FAXA 4ZRGA 1E6OL 1PG7H 2C3HA 3VH8A 1CICC 1OP3H 2CPCA 3ARFD 3VGEA 2F7OA 4U31A 5E4AA 4LIQE 4F57L 5IQOA 3AAZA 3SKOB 1VKXA 1RHFA 5GZND 1OLZA 5KYYB 2GCYA 1UFUA 4PGDB 4TLSA 4TTDD 1JGDB 1NCCH 1WBXA 3RDTC 4LSUL 3INOA 2W8CA 3ULUE 1U8KB 4A1RA 4ZQTA 4F93B 1OGTA 1E3ZA 1QFPA 4WUKL 3DMMD 2NY0C 3GMLB 4YDKH 4PLKC 2YD3A 4QKTA 3POCA 4J3XA 3ARGD 4FP8L 3RP1A 5IVZB 2OYKA 4AEEA 5HI5D 4N86A 4JHBA 4OM1H 5DTFB 4JO2H 4P4KD 4V1DA 5FUZH 3TN0C 3U82B 2X9XA 3LIZL 4GEJA 1WAAF 3NT0A 4LDCA 1CDIA 4YHPB 2R4RL 5CJQH 2W95A 5DR5L 3ZMNA 1H8SA 3PAVA 4HF5L 1ZLWH 4EDXA 3OGCA 1QSFD 4H88H 5EU3B 1WAAA 5L8KB 1UA6H 3D3VE 5MERB 3FQNB 4I5BA 2XWDA 1WVZA 3LYRA 1SXSA 1NCDH 3T1FA 1JDCA 5IJDC 3BPOB 3DURA 4L8CA 4BKSC 5JOPE 1F86A 2CDGA 4B95C 3CHXA 5MEND 4LASH 4PRAB 3HJEA 1OTUD 4AZUA 3TP4A 4GG8A 1TPXC 1RK1A 4ATWA 1UG9A 2F5BL 4ECNA 3CC1A 3JWNG 4LOUD 4LSVL 4N25A 4PI2A 5A2LH 3JWNE 3WS6C 3MUGA 2PW2A 3O6FB 2VDLB 1QSZA 1YEGH 2IC2A 2B59A 3BESR 5DK2B 5L9DH 3FQ4A 1I7RB 1NBZB 1VLXA 4NUJB 1WWWX 3I9GH 1R3JB 4TUKH 3AB0C 5I0ZA 5GGVY 3DVGA 1YQVH 4QR7A 2XXGA 4Q14A 3TPKA 2FYVA 2F19H 2WQWA 2AJXL 2P5WB 4OM1L 5I66B 4JFWA 4X9HA 5FUZL 5JHAA 2BERA 2ICWI 1QX1A 3MRIB 1AZRA 4Y9EA 3VA6A 4Y9FA 4ODTL 1YMMD 1K8DA 2LE9A 5DQDH 5CJQL 5EBMA 3RZCB 3TYGH 3HUJA 3JQOB 4MLSA 3ARSA 3DUSA 4M7KH 3IJEB 4X9YA 4CUCA 5J6GA 1NBYB 2WO4A 4W4NA 1MAKA 3UTTA 1K4CA 1G9EA 1R5VB 5T1KB 4H88L 1INDL 3P11H 4Y1TA 4O02B 3ROOB 5I1DB 5EB9A 1NCDL 2RFXA 2FEEL 3U46A 3LEXB 3EJPA 4AVJA 4I9XA 1X5XA 2PPDA 5E08H 2MPVA 5F7EH 1XH1A 4PGBA 2CWRA 2EVFA 4NHCH 3SODB 2WP3T 4F33A 4GO6B 2VMDA 4RMQA 3VFMB 2N56A 1GYVA 1O5PA 2J21A 3D5OF 4B53A 1YEGL 5L9DL 4F8LA 4H2AA 4TUOA 1MAMH 2PO6D 2EXWD 3I9GL 2ZX8A 4XO3A 1LWHA 4TUKL 4E68A 5HGDA 3WN6A 2OSXA 4YDVB 1PG7W 1VCAA 4LVEA 4MJ6B 4WHTB 2YGOA 1HINH 2F19L 4YL9A 3VWKB 2IALB 3F83A 1AJ7H 3H42H 2X3AA 3H9SE 4G6AC 4NO3A 3SKMB 4HCIA 3DHUA 5KAQF 4PJ9D 3QI9B 4PHZA 2BOBA 4J28A 3Q8EA 3SSGA 3NCCB 3ARED 3NAAL 1XH3A 2E47A 5A7EA 1N5AB 4K7PX 2ZCLL 4NI3A 2HFFA 1AMYA 4HKZA 1FF5A 1JK8A 2RMNA 3P11L 8FABB 5CP7B 3MCLL 1MCCA 5CIPH 4YDZA 2CIKA 1ML0A 1ADQA 3BZ5A 5F8RC 3A0OA 4O58L 1ZEAH 3QG7L 5JPNC 4KUCF 3ZHFA 5E0FA 1PU0A 3CHSA 1OB1B 4G83A 1HJBC 5E08L 4FYRA 1I8LC 2B5IB 4JDEA 5F7EL 2WANA 1SFDA 3RDTA 1KJ2H 2OMVA 1VJSA 4NHCL 2ADGA 1JWSA 3VMNA 1KTBA 2VXVH 4KK6C 3G5VB 1UWYA 1OAXH 3TBYA 5KSVA 4LPWA 1MAML 2O30A 3VYOA 1H6TA 1ESOA 4W70A 3U4EB 3MMEA 1URIA 2CDEB 1TENA 3K2KA 5DVPA 2FO4A 4Q89A 4HS6A 1IX2A 3ABLB 1PEWA 3BO8B 4N2GA 4WNJA 5IQ9A 3L3JA 4J3BA 1N59A 5CU9A 2X05A 3TN0A 3W11C 2ZX5A 1Y6NR 1ZSHA 3H42L 4HC1L 4PP1C 5GSVB 1T6VN 4AQZA 2NY1D 1HCYA 2W65B 4XO4A 2YAHA 4BJLA 5BO0D 4IGBA 5IOKA 3CU7A 1IKFH 1S7UA 3QP3A 5AOJA 4CMHB 1XXFC 2ROYA 3Q3GB 4NQUA 5G4OA 2VE6A 4JK0D 2CO7A 4RMBA 4Y2DB 2RA1A 3US1A 3VSUA 3GJFA 4TVPH 1NIEA 1OE3A 2FGZA 1AANA 3CH8A 4F7PB 3WU1A 1Q94B 4AJYV 1F4YH 3FTZA 1T0PB 1O0VA 1GTNA 4JFFB 2EDQA 1I8MA 3GIVB 1CTOA 2DRUA 1FL5B 2DB8A 2H2SD 1I8AA 4K5LA 4U6TA 1TNNA 5AWNH 5DS1A 2CM5A 5E4EC 1TFPA 2B3IA 5CEYB 1AR1B 1FO0B 1TQBB 1SLUA 1KJ2L 1UWFA 2EEFA 3QYNA 3OTTA 5IQ7L 3HE6B 4IU3A 3WS6A 1OAXL 2WCPA 4RAUB 3OWRA 3FJTA 4ODXA 2C1PB 3MAWA 3APCA 4PLOB 2NW2A 2OMZA 4DKEH 4OZFH 1H15A 1GIGH 2HCZX 2QV4A 1NGPL 1BX2A 3QXAA 5KAQG 4BFRA 1PIFA 3H9HB 4L29A 4LVNB 4JZJB 3QT2A 4ZOBA 3RIKA 4WQOA 5JTWA 4EIUA 1R3LB 4H44C 4TSCH 1IKFL 1ORQB 4J6IA 1DQIA 1G9MC 2FGWH 4P99A 5E94B 2CXGA 2NY5C 1AXSA 4JS7A 2P49B 3MXWH 4TVPL 4ZPTA 4TQEL 4NQEB 2YRPA 1O6SA 4XPTH 1SVCP 3SHSA 3TFBA 2YGVA 3UG5A 3OB0H 12E8H 3SDAC 3WKNA 1KCRH 1M3IA 2N1TE 3Q5TA 5AWNL 4ZW7A 3UO1L 3FO2A 2VXSH 3T2QA 4YX2L 5EEWA 2QFRA 4YE4L 4MB1A 2ED8A 2HTKD 1NLDH 1U8MB 4L3AA 5D2LB 4C8XA 5DFWH 1B4TA 3T2LA 4FADA 4OY9A 2R1XB 4JRXA 3B6SA 4XP9H 5B1CA 3DROB 2YWZA 3L3GA 1P4BL 1R19A 3EUDA 4G3YH 2Q6WB 3QEQE 3O45B 3PLYA 4G6KL 1ZD6A 1SHXA 3ZDWA 1UXLA 1SM3L 4DKEL 3VD9A 2WMPB 4A6YB 4NXKA 3SYQA 1OAJA 1WH0A 1GIGL 5TD4A 4ZFGH 2D0GA 1HJCA 4XC1H 2DWYA 2MSPA 3QDGB 1E5BA 4N1HB 4MZIA 3EO9L 4G1EA 3RVTC 1INQB 4PG2A 1HXKA 4HXAH 4QHNA 2C5DC 2F1BA 4KK8C 4FNSA 4FZ8L 1V3LA 4NQSB 5AW9B 4U1KA 4XPTL 5FIEA 2YIHA 3IEAA 1AO7E 2FECI 3FW6A 4LL4A 5LJYH 1JPST 2CCVA 3RAJH 1T20A 2VO8A 1DSFL 12E8L 1FQ9C 3FQTB 3KLKA 3RKDD 1L6ZA 1KCRL 1EAJA 4UAHA 1JXKA 3C2AL 1N0LA 3PHQA 5AVWB 1I8LA 1HNGA 2VXSL 3O6FD 3QQ9D 1A8ZA 1KY6A 3SO3B 3KBFA 4YBHA 5IUCA 2UZIH 3TL5A 3BZ4B 1TVBA 1A6VH 4I9WE 1EGJA 3I85A 1NLDL 5CJXC 4JZNB 2YPKA 3MA9H 4PRDB 3RPIB 2KKQA 1T1XA 4XP9L 4X4XA 3V4VB 2Z7UA 4G3YL 2W38A 4F58L 3RJOA 2P5WD 4LEXH 2P4AB 1XCXA 4FF9A 4F8TA 1WA2X 3N85L 3L9YA 5GZNC 1PLGL 4ZFGL 3VGGA 1KIQA 2ESVB 5E56A 3RZCD 5DDHB 4X83A 4FNRA 5F44A 1A7QH 4XC1L 1DVFC 3D52A 1BOGB 4ZJ9A 1AGEB 3RA7H 3O4OC 3EFDL 4BM7A 2V5RA 5T1KD 1NGZA 5GGUA 4M56A 1P6WA 4LMQE 2ZP9A 3KLAA 3FC8A 4YHYB 4N2DA 4NKOA 2CZNA 1SDYA 4PJ5B 4JFHE 4JRXE 3RAJL 2OL3L 3IJ7A 5HI5C 1G7HA 2NZ9C 2QVTA 4Y8DC 4EI6A 2AP2A 4H8VA 4LLQA 3WLBA 2EIZB 3QUMB 4YHZL 3ZQXA 3D39A 2OR9H 3T8VA 3V4PA 1U93B 4HIIA 3F7RA 4ICXA 4ZDHA 2EZ0D 3BKYL 1DJYA 4LLVA 2FEDD 5C0BA 5DJZA 3ZQ9A 1NKGA 1WPCA 2Y7NA 5BQ7A 1E9OA 1BD2B 3GB7B 1UWGL 1ZVHA 2NY4C 3LKNA 1A14H 4XE0A 4UU9A 3MRDA 4LEXL 2CUHA 2Z8WC 3QHTC 4F37F 1P7KA 3II3A 1IAIL 1S7XA 1MG3C 5E00A 3BD4A 3FOLB 3MRBA 1OTUC 4U1LA 1VGKA 2IOIA 3QI9D 5FW7A 2WVVA 5J6SA 2BH0A 3ZKQD 3ORJA 1FNGB 3RA7L 5D4QA 4D94A 4U1IA 4LOUC 3HE7D 5FA3A 3WHXB 4NZTH 4CC4C 3CVHA 4QJ3B 4IIQC 3LEYH 3U6RA 4JY6A 2VJXA 1P5UB 5CUSH 4DP8X 5HHQB 2GPZA 4F9PA 4L4TA 4QYOB 4PG9B 1K2DA 1J8HB 4JFEB 5IESH 5C08A 2DTMH 5F7AA 3SDAA 4AXWA 1FNHA 2F8VA 2H6PA 1IEBB 1KELH 5BO1L 3DDFA 3VWJC 3EH2A 3FCSA 5BJTA 2D0HA 2OR9L 1IEAA 3WMPA 1V7NH 3KPSB 1BQKA 3GJFK 1S7TA 2H4EA 1A14L 1ID2A 1ZAGA 3CFBA 1UA7A 3GS4A 5C0EA 1AZZC 3HG1B 3PWJB 1A3RL 4BFIB 3KYKH 4Q9QH 3NEOA 4GG6A 2VJ0A 3PWNA 2WN2A 3Q2VA 1HHGB 1SEBB 1WIUA 2IH9A 3DVNA 2ROXA 4H2CA 4RH4A 1JHKH 4YQXL 2YRLA 2G3XA 4Y2DD 1CFSB 4BSVA 1X9LA 3OLIA 5E6ZA 2WLJA 1LP9E 3MLZH 1LL1A 4NQCB 3U0PB 4ZQKA 4EZMA 3ZY7A 4B0MB 4XVOA 3CPUA 3AG1B 3I6LD 1YN7B 1M42A 3TFKC 4JFFD 4F8QA 2Y1VA 2PO6C 3LEYL 3T4YA 1ZK9A 2EXWC 3FONB 4Y2OB 1A6WH 1T66C 4ZOEA 4WI2A 4LU5H 5C0BE 3MLUH 3TO4A 5TPWH 4QT5A 5IESL 2FX7H 2FCBA 1AR1D 1S9WA 4K7PH 4JVPA 4N0FA 1MWAB 5KW9L 4ZAKA 1A6ZA 4XNUH 2PP9A 4TPRL 4DP1X 1CZ8L 1WS8A 2GIYA 3QHZH 1IAKA 4UCFA 4DO5A 4FZEL 1BVNP 1OGAA 1BFSA 4H25B 2WVSA 3VI4F 4PWKA 3HHSA 1SY6A 4MKMA 4KI5D 2GTQA 2DPKA 5FW6A 2F8XC 4OCXH 4N5ED 1QACA 4OSUH 2H7WA 1UGNA 4RVBA 5TE4H 3T3PF 4Q9QL 5GZNA 1YQ2A 3VFNA 3VI4A 1HWHB 4JO8A 5BXFB 5AW6B 3IMUA 1AKJD 4PBDA 1DVFA 1R34A 2ITEA 4L3FA 3V7AE 3RBGA 1QFHA 5JIKA 4NJAL 3MLZL 4NQED 2G5RA 4PQXA 4U7MA 3LRMA 2DY2A 3MRNB 2ZXDA 4HHAA 1CK0H 2OI9B 3BP6B 3K6DA 4L0ZA 2AV7A 5EF3A 2H1PH 1BMWA 4XWGH 3W39B 4P05A 4FXTA 1A3LH 4JHZA 1JZ8A 2DQFA 5TPWL 3ZOAA 4WWKB 4ZFOA 4KAQH 4OF5A 3QJFB 1ZV9A 3V7MA 1CGSH 4P4KA 2PTTA 2LW3A 2UUDH 3EGXA 1M9SA 3MYZA 5D7LB 4M9PA 5F6IB 1KTJA 3QNYA 5T3ZD 5LVEA 5I1GH 3TNNA 5ID0B 1YEJH 3DHPA 2X4SA 1PW3A 1AE6H 1UZGA 4FMVA 5PAZA 3GSQA 1XL6A 4LOFA 3TZVB 3QEHA 1QSFA 3PAUA 4OCXL 1EJ8A 4MJ2A 3QQDA 1G7QA 4L48A 5TE4L 1B9ZA 1J0IA 1IGYB 1Q9KB 3X13A 1URZA 3QDGD 4WRLA 5MENA 4FLRA 4Z8FH 1TO5A 2H2SC 2L8AA 2NNAA 3DVIA 4AC2A 1DQDL 1T1YB 1WIPA 1AIZA 4XVUC 3UGXA 2LU5A 1CTMA 2X70B 1D6VH 4KTEH 4XMPL 1MRDH 4L8BA 3NZSA 2MQ3A 3CVIH 1CVSC 1T4KA 3IDUA 4XP4L 1S9VA 1CK0L 1NIBA 1FSKC 4CC4A 4QXTB 2HMID 2YN5A 4IIQA 4FTVB 3OHMB 4GOSA 4TL4A 3ZE0B 5K33A 1A3LL 4I48A 4IBLT 4G82A 1NCAL 5ILTH 3C75A 4M5TA 1MJJB 5I76B 4JM2B 4KAQL 2ERJC 4C55A 3C08L 5AVRB 1CGSL 3VWJA 2GKIA 4OZHB 2QSVA 5F3BA 1EAQA 1DVYA 4HWBH 1DQKA 3VI4E 2QKIB 3NH7H 3MNDA 2GITA 1YMMA 2BINA 4GT0A 5F1IA 4CJ0A 1I7ZA 1XF1A 2Y7MA 1YEJL 4WNQB 3IFLL 4W1TA 3ES6A 1U2HA 3CGTA 5HY9B 1JVLA 2ZUVA 5EMYA 3T3PE 3VFTB 4Z7WF 5BCAA 1JZ6A 5M94B 3FT4B 4YZWA 3WV0A 2ESVD 3L5XH 4WDIB 4GRMA 4DZ8A 3UTPE 4WEEA 3X14A 4PJBB 4OZIB 1TLMA 1CE6B 4KVNH 3WFDH 5I1EH 4Z8FL 4Z7WA 3M6DA 3N41F 1X5LA 3D85A 4YDMA 1D6VL 2K78A 4KTEL 4F3FB 2M2DA 2HTKC 3PWLB 4KZEH 1MRDL 3F05A 4JUTA 8PAZA 3CVIL 2YUXA 2Q86A 2D4DA 2FT7A 4PJ5D 5E2TL 4F2MB 2PO6A 4CDHA 1ET7A 4YDIL 3HHRB 5T3XH 4PV9A 1NCWH 5ILTL 4Q2ZB 3VSQA 2CBMA 3LPGA 2R7EB 1AQHA 4IIZA 1G5GA 3HFMH 2I27N 2NYKA 5L4IA 1SJEB 1JHTA 1GGIL 3QO0B 5AAPA 5C9KA 1HH6A 1LM8V 3AT0A 2E76C 2D7OA 1NSNH 4HK0B 4WFFE 35C8L 3HFFA 3L3KB 1BD2D 4HWBL 5DMGD 5K9OA 3B5GA 4MBOA 2X89D 2VQTA 3DXAD 5DVOA 2LQRA 4TNEA 4F37K 4PJ9A 1UZ8A 1DE4B 1YNLL 2XKUA 4MRCA 4PJCB 5FGCE 3AREA 1A2YA 4A04A 4JPVH 1KT2B 1WG3A 2KPNA 3QDJB 4UDTB 4AW4A 5MP6L 3F7YB 3JYBA 3R4DA 1CPUA 5I82A 3T4AB 3T08A 4LFHD 3ZKSD 2ZCKL 1S5HB 2JH2A 3DIFB 3I6GB 3IBOA 4WY7H 2X0VA 4LCIL 3RKDC 1CDCA 3WFDL 4D2NA 5FKAB 1VEOA 1ZS8B 4FFVD 1W91A 2DWDB 4NM4H 4NKIL 3ZTDC 4QXGH 5T33H 4M7ZB 2YD7A 4OQTL 4KZEL 1A4KA 1U42A 3G5WA 1RZJL 2I60H 4N3UA 1TOXA 1W6WA 4I4WB 5D1QE 1J8HD 4JFED 4DWHA 3MRLA 5I1AA 3EYVB 1QUNB 3MJ7A 43CAB 2DWTA 3QR0A 4GP4B 3EAKA 3CC5A 5BUAA 1NCWL 2QPDB 3MRKB 3SE9H 4K3HA 4LQ1A 4R8WH 1KZQA 1BAGA 2MNWA 2FO8A 3HFML 4H1LB 5EC2A 4YSEA 2HJFA 3QH3B 3WNLA 1ET5A 3DGGB 1VACB 1ND0B 3RZCC 3GSNA 3KPSD 1GY2A 3DX6A 3EYSL 4JRLA 2X1OA 5FYJL 2YKLH 4GPVA 5E8PA 2IBGA 5D70L 1BQSA 2J1ZA 4Q9CA 4Z7WE 3ZHLA 3SKNA 3D1MC 2CO1A 3HG1D 4JPVL 3FFCA 2LU3A 2VWEC 1KY7A 2MRYA 3U7WH 5IBTH 1ET8A 5AOLA 3BP5B 2YPVA 1YEKH 5FAAA 3QO1B 4F80A 2VSDA 2ETWA 1XGTB 5I1JL 5KN5B 3QHFH 4XP1H 2N59A 3S97C 3BXNA 3MRQB 5L0QC 2H3NB 2X4OB 4WY7L 3T8XA 3EGDB 3NSDA 3SYPA 1FH5H 5IW1A 2J56A 1RUKH 4NQCD 1EJOH 4X42A 2O6DA 4NM4L 2PCYA 4QXGL 1ES0B 5TE7H 3VYNA 4R7NA 1ZHLB 5D1ZD 3LN4A 3MLPA 4MNHA 4M1GL 4YLQT 5CMAA 1EUUA 1R33A 1I9JH 3OLEA 3U2JA 3RL1B 1YUHB 4HIJB 4KJQD 3TF4A 5C7ZA 2EYRA 1C5DB 1GC1C 1N6VA 2XJLA 3VWKC 1WE5A 1FJ1B 3CZGA 3IAQA 5E2WH 4R8WL 3AUWB 2OSLB 1CFTA 4UV4H 4ERSL 5EDSA 5GQBA 3D4GA 1OGSA 3O4LB 3QI9C 3NCJH 2XG4B 5MHSD 5IVOA 3UTSE 4QAWA 2HX7A 3N44B 1IKOP 1TTBA 3X1NA 1DQML 3B1UA 4XVJH 2XN9E 3SKOA 2VDKB 4PWJA 1X5KA 3U7WL 5IBTL 5B3JF 1YEKL 1ZT4B 3PP3K 1JXJA 5KYYA 2BIOA 5CCKL 3V55A 4PGDA 2FX9L 1FFRA 1JGDA 3QHFL 4XP1L 2B5IC 1I1FA 1RFDH 5LLIC 5TF1L 2FUTA 3V8CA 1U8KA 1IUZA 1CVRA 4ANKA 3LVEA 4UT9H 1UJTA 3ZKMD 4WFGE 3IN0A 4HEPA 1MVFA 4G6MH 1JPSL 1UOWA 4QRTB 4U6YB 3VG9B 5GJSL 3N9GH 3GMLA 1OO2A 2AAAA 1HZHH 3L9BA 2X4QB 1TTRA 5J0BA 1I9JL 1M4KA 3EJJX 5IVZA 4PCTA 5ANHA 3U1PA 2NZ1A 4WWKD 4HGKC 4JLRB 3QFJB 4FEMA 5DTFA 4CSZA 3FFCE 4X8CA 4X5XB 4LKCB 2AEPL 3SGDH 1CGYA 4UV4L 4YHPA 1XB3A 4CMHC 1HSBB 2RJMA 3KWWB 4Y19D 3TZVD 1Q9OB 2MNJB 4Y4HC 3COOA 2YA2A 4WEMB 5D9SB 5EU3A 2V3DA 3QC5X 1UWXK 3DTUB 1EPFA 4DQAA 5MERA 3FQNA 1ZT7B 1XTMA 5F21B 4XVJL 1E3XA 3OV6A 1PL3A 1I1CA 1XQ4A 3MVSA 4JY5L 4FMKA 4N2FA 3F2LA 2IH1B 5IHWA 1KWGA 4PRAA 4N0RA 3CQQA 2KQNA 4KRPB 5BS0B 1J88A 2ZSVB 3QUKB 1UXWB 2Q3ZA 1RFDL 1AR1C 4AYFB 4R7XA 4HS3B 1CB4A 1U3HC 3MJ9L 3HE6C 4UT9L 4NKMB 4CGUB 3O6FA 5DK2A 4LSDA 2AQRA 1HQ4B 1I7RA 1NBZA 3N9GL 4LK4A 4FTVD 4NUJA 1R3JA 1NANH 1ASOA 2FAUA 5KVGE 1J05A 4XN9A 3ULUL 4JQXC 1SZNA 4C56B 4KI5C 4CRPA 3OJMB 3IMTA 1FAKT 3PYCA 3LPPA 3SZKC 1XSKA 4OKVB 3FT1A 4ZXBC 1F6FB 2A83B 2P5WA 5I66A 1Y1DA 3MRIA 4JM4H 4JZJC 4LVNC 4NRYB 3MU3A 4R7LA 1GYCA 4G7VH 1CLZH 4IRJB 3RZCA 3K71B 3N40P 4M4RB 2XX1A 1X7QB 2P80A 1MCJA 3IJEA 4W81A 1NBYA 1S2EA 3WAKA 4NWTH 1R5VA 3LRHA 5DJCB 5T1KA 5CD3B 4HEPG 3S36X 5B3JE 4O02A 1YAZA 2E27L 2ZX7A 3ROOA 5I1DA 3BN9D 4FQQB 4DP4X 3D07A 1QKZH 5I17B 3NP4A 4WU5B 3QQ4B 5EDXA 4ZTOL 3ENEA 5L6YH 4CVZB 3P4NB 2CUIA 2EDTA 3E80A 3PL6D 3BAYA 3ZT7A 3BUTA 5F0LB 3FQ1A 1UD8A 1QBBA 1EV2E 3VD3A 3VFMA 5HPOA 2EXTA 1YSOA 2Z0BA 4HLEA 2EXSA 1QEWB 4J1UA 1Y1UA 5A2IH 2BSCA 4X6BB 2YJLA 3AXLB 2OZ4H 4MCYB 2Y5EA 4ABVA 1WFUA 4YDVA 2WO2B 3T9WA 2WTPA 4FMFA 1KB3A 1XF4B 4ANXA 4P2OB 4RMWA 4MJ6A 4QRAA 4WHTA 2XYBA 3QQXA 3VWKA 4BGDA 1XGUB 3CXFA 2IALA 4LCWE 2D7TL 1V3JA 5HHVH 3Q1EA 4JM4L 3WOVA 3GKWL 2VXQL 3CCHB 1AGDB 1I8KB 5F7NC 2K9FB 3E1ZA 3N91A 3SKMA 4G7VL 4HUCA 1CLZL 2VOTA 3KVPA 3QI9A 2VL4A 1YUKB 1N5AA 2BY1A 3QDJD 3QARA 5I0DA 4NWTL 4IU2B 3W9DB 3FUNA 5TH2B 3V8OA 2GC4C 5CP7A 1M2OA 4Z7IA 4HCRA 3AXIA 3EW3B 3AZUA 2HMIC 3N40F 1MKFA 3MLYL 5FYLD 4AEFA 3UBFA 5IIEB 5AW7B 3BLKA 4RESB 3LKSB 3SO3C 5E1HB 2EDXA 3ESVF 5DYFA 1Q1JH 3G5VA 1DN0B 5E9AA 3CN4A 4ZX4A 3J7HA 3P9LB 3TO2B 4TMPA 3KLHC 4OCRH 4X7TB 4I77L 5E1GA 4XMVA 3DRTB 4NJ9L 5E99H 1RLBA 1B4JH 2XC8A 3OKYA 4RFOH 4ZW5A 3EFOB 1M6UA 4HWZB 3P2BA 1G9NC 2B1OA 2ZYIA 3BO8A 5DGQA 3QE5A 2VWEE 5GSVA 5HHVL 3KJ4B 2G3NA 3TBBA 2IAMC 3E9UA 3ZBMA 4GXVH 1JI2A 3ZL1A 2BNQE 2X87A 5HDRA 3Q3GA 3B7SA 3T2NL 1R0AH 4I3RL 3WEMA 3LQAC 4Y2DA 2P44B 2XBZA 2DWEB 5F7BA 2J8UE 4OZGE 2WNWA 4YHYC 2J44A 2WQUA 4L37B 3CBJB 4F7PA 4FAAB 4MMZB 4XMWA 2FECL 2PYFB 1Q94A 3MACL 4Y5VB 3WIIH 1A7PL 3I50L 1MY5A 3L5IA 4HAGA 3SGEI 2C3GA 4JFFA 3FRUB 3GIVA 4ENZA 1XZ0B 1UKSA 1FL5A 3MV7B 5A7BA 4X9FA 1RUMH 2Z4TA 2D3VA 2F08A 3Q01A 3NPZB 5CEYA 5I73C 2E0PA 2FEJA 4JKKA 1FO0A 1OHZA 5HHPB 3HE6A 4U33A 4KI5F 4ZFFB 5ABAA 5B3SB 1OB0A 4XCFH 1GJUA 2J57A 2X6AA 2K8MA 2X1WL 4GEIA 5F7LB 2E86A 4OCRL 4RAUA 2J72A 1X7TA 3Q1SH 2AJ3B 2C1PA 5T5NF 3L13A 4AQEB 3DPBB 5AW3B 4FYTA 2WLZA 1T7ZA 1B4JL 2E6PA 5E99L 3QUYB 2HPOA 4NPJA 4BQ9A 4AIZB 4BA8A 2FYYB 3ECBB 4MTMA 4UQAA 3O4LD 3H9HA 4JZJA 2J73A 4W9FC 3R8BB 1VZIA 1BF5A 1G7LB 1R3LA 2BIQA 2ZG1A 4GXVL 4MAZA 1HCZA 1ORQA 5LKNA 4OGAC 3UC2A 1TFHA 1DTUA 5E94A 1D5XB 2LU4A 1WITA 4OU3A 1ADQH 4NQEA 2R2HB 4N85A 2DJUA 2JQAA 2HH0L 1N19A 1V8HA 3II1A 5AVVB 1DBMH 3FTGB 3BDBA 3CHRA 3MLRH 5D2LF 1I3UA 4GUCA 3ARQA 2QQLH 3C8DA 4OLVL 1RUML 3MRRA 4WFED 3RLSA 2F7RA 3NZUA 1L7IL 1E4WH 4RISL 3T0BA 2EIKB 4QEGA 2VLKB 1U8MA 3G5XB 5D2LA 1DYZA 2IEPA 2MPAH 4LHJB 2R1XA 4M1CD 4XCFL 2AXGB 3DROA 3U1QA 4YSQA 2MQ0A 2Q6WA 3LZOA 3O45A 5GIRB 1DCLA 5I8KH 3RVXD 2KL6A