3F01A

Crystal structure of synaptotagmin i c2a domain with cu(ii)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
143
structure length
143
Chain Sequence
GSPGIGGGGGGILDSMVEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of synaptotagmin I C2A
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Synaptotagmin-1
total genus 22
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3f01A01
1WFJA 4KZCA 1YRKA 2FK9A 2JQZA 2WXQA 4DK5A 2NCEA 1DJHA 4IHBA 4KZ0A 4ANWA 4QJ5B 4EZJA 4GNKB 3QJZA 3ML9A 4LCVA 4F92B 4FHKA 3PREA 4TUUA 2UZPA 2Y3AA 1DJGA 1E7VA 4WWNA 3B7YA 4F93B 1UOVA 4WWOA 4L1BA 2DMHA 1WFMA 2BWQA 3L9BA 2QZQA 3PYCA 3F05A 3QAQA 1DJXA 1TJXA 3W56A 3HHMA 3R7QA 4LDCA 2WXKA 3F00A 3TL5A 3ZIMA 4LT7A 4QAMB 3ZVVA 3L4CA 4JPSA 1A25A 4TV3A 4AJWA 1DJIA 1UOWA 2X38A 4ICXA 4L23A 3HN8A 3RDJA 2WXOA 3F01A 4NS0A 3IBEA 2EP6A 3JZYA 4V11A 4EZKA 4ANXA 4QJ4B 2WXJA 4BFRA 1E90A 3L17A 4F1SA 1DSYA 4L2YA 4IQHA 3P2BA 1W16A 2CHZA 3QR1A 5CCHE 1DJYA 1QASA 2RD0A 4FADA 4ICWA 2WXRA 3FBKA 2ISDA 3RPBA 2LHAA 2WXHA 2K45A 2Q0ZX 3L54A 4NPKA 4PS7A 5T8IA 3DPDA 2CJTA 2WXFA 2KI6A 4OVVA 2D8KA 3APFA 1W15A 2Q3XA 1E8WA 3SD5A 2V4LA 3FDWA 2DMGA 3NSJA 1E8YA 1RH8A 4Y1TA 4XZ4A 4ANVA 4QJ3B 3S2AA 4J6IA 4NP9A 2K8MA 4PS8A 4L1LA 3KWUA 3N5AA 2WXLA 3ML8A 3TJPA 3MJWA 3NZSA 2QZ5A 1V27A 1DQVA 3DBSA 5CCJA 5G55A 4BGDA 3T8MA 2CHXA 3M7FB 2ENQA 4XX5A 2NSQA 3W57A 2CHWA 3QK0A 1K5WA 3ZW3A 3KWTA 4TS6A 3OAWA 4ANUA 1RSYA 3ENEA 4Y1SA 1E7UA 2K3HA 3PRZA 3L13A 4FA6A 5G2NA 2CM5A 2ENJA 3OHMB 4MJJA 3TWYA 5EDSA 1TJMA 2N1TE 2Z0UA 4OVUA 5JHAA 4WAFA 3QR0A 1GMIA 3HIZA 4HLEA 5H4YA 4G11A 4PS3A 4EZLA 3CSTA 2NQ3A 3NZUA 1CJYA 2K4AA 2ZKMX 3PFQA 4AOFA 4GB9A 4WWPA 3APDA 2A4ZA 5CCGE 4F91B 1E8ZA 1QATA 2CHDA 2ENPA 2R83A 2WXNA 1BYNA 3PS6A 1HE8A 2CM6A 1RLWA 2YOAA 4FLHA 4XE0A 1DJZA 2A5UA 2WXGA 3CSFA 3GPEA 2YRBA 4WEEA 4NPJA 4DNLA 3LJ3A 4FULA 2WXMA 4KITB 1DJWA 1E8XA 2B3RA 5JHBA 4FJZA 3QARA 4FJYA 1UGKA 3L08A 2FJUB 2WXIA 3IM1A 4A55A 3L16A 1BCIA 4FHJA 2CJSA 2WXPA 4HVBA 3F04A 5KJ7E 5H4ZA 4URKA 3APCA 1BDYA 3R7RA
chains in the Genus database with same CATH superfamily
2QDVA 1JZDC 1L9NA 5FUZL 3LXAA 5A16B 3GHBH 2ZUSA 3OMZA 3EOTL 3KL5A 4DEWA 2XY1A 4JS7A 4HIQA 4MMZB 1M2VA 3V5HA 1W80A 2ATPA 3BVUA 1GKEA 3C9NA 3H9SE 5E23A 1I1RA 3MCKA 4JZJC 5HY9A 3E8UH 3KJ4B 2R1XB 4FERA 2LABA 1UQSB 2I9TA 2CO4A 4R0LB 4KNUA 3KPQA 4GKSA 3D39B 1G43A 3BD3A 2QVKA 3H54A 4JRYD 4ANXA 4FQJL 3VDCA 3CMGA 1PQZA 4MVBC 5D2NB 3QQ3A 4JZOA 4M1DH 4WV1B 5JO5B 4O02L 4IQHA 3CZKA 3QCTL 4FTVE 2NW3A 5IHZA 3LNFA 4PVMA 3P11H 3EGDA 3WGVB 1XX9C 4N2AA 4Q6IA 3R1GH 4NQQA 5LQBH 3KXFE 4PG9A 4K3EH 1ML0A 3PXLA 3ELQA 4NQED 1KV7A 4YIQA 1E30A 2AK4A 2ALAA 3CHQA 2BSSA 1UKTA 1KTDA 4DUWA 3NPZB 2YC1A 3QQ4A 5K59F 4CKQA 1XSKA 2AV7A 3FBQA 4NUJB 3GT6A 3V4UL 1NLDL 3DHJA 4X6FA 5D2LF 4CADA 2DLFH 2BP3A 1S7QA 4LLYA 4Q9RH 4FHBD 1CD9B 4XNBA 4PJ6A 4ZFZB 2QBWA 4JFXB 1QNIA 1A0QH 5JORB 1T0MA 3P9MB 3SDCD 4LRNH 1FFPA 1CYWA 2CJUH 2FSDA 4FCAA 1O7DC 4HIPA 4LSQL 3JV4B 4QXVA 1MFEL 5JNYB 2VJ8A 1AKJD 4DERA 2ZSVB 2VDPL 3U2IA 5K9KB 4FA6A 2F58L 1PLBA 1NFIB 3S5LB 1TJMA 2V3DA 1LNUB 3U1QA 3IJYB 5FS5A 5H4YA 5HPMA 5LGKA 3IJ7A 4AEFA 1G6VK 2DIBA 4BFIA 3OR6A 4DPCX 5F8RC 3Q5OA 5D1XE 2NW3B 4HAKA 5C08B 1BMZA 4G9DA 2IH3A 1UB6A 3BT2L 4QHMB 5DEJA 1E65A 4HUCA 2GUYA 4R7XA 3BPNB 3BN9D 4PJ9D 1RL1A 3K0WA 4HUXA 5F7LB 4F3FA 4W6XB 3G6JA 2I32A 5D96C 3KPQB 3SDDA 1T4WA 4NIKB 4I3GA 1SJVA 2MMXA 2FGWH 1SJXA 1ES0A 3IM1A 4FLQA 2WZ5A 2WB7A 1ED3A 2APFA 1IVTA 4WO4A 2WUCL 3NUKA 4IS6B 4OFQA 1TZHA 1A47A 1F58H 3CDGA 3CQFA 2OR8A 4QXGL 1U6AH 1ASPA 1GC1H 4L9DA 4P9HH 4ANWA 3NIFE 4R5XA 3ARSA 4HKJA 3PF2A 1UWGL 4UT7H 2X4PB 3K1KC 1N4XL 2R0WL 4H2CA 1RFDH 3X3GH 1FNAA 1KACB 1TKWA 3QFJD 4DGWC 4L1BA 5BQ7B 2AXGB 2F7PA 3JBG7 1WCQA 4JFVA 2JF1A 3HRZC 4DGVH 4DN3L 3D6GA 4P2QB 3WIHA 2NNAB 2K9FB 4JRYB 1A7BA 4FKKA 1HIMH 2YA0A 3QDJB 3PWJB 3SODB 4NC0B 4U1LA 1DBML 1K3ZA 4PB0H 4B9KC 1J0HA 4AYFA 2VDOB 3HMXH 2COQA 1E5YA 4RSVA 5EZJA 4LIQH 5E1GA 3NIDB 3VA6A 3S34H 1SJHB 2X4NA 1A4KA 3ATEA 2ISDA 2FLBT 2XQYA 3V6BR 4NAQA 1J10A 1EO8H 1FNFA 2AXFA 1IUZA 4RFOH 3IDNB 2GBAA 4LPXA 3VXRE 1QSVA 2R0ZL 1MHHA 1Q9LA 1M3JA 4G6KH 3BW9A 4HJIA 4J28A 3BJ91 4HJSA 4WU5B 1TVDA 1VAHA 3CFJA 4NJAL 4NZUL 3VI4F 4YS4A 4OGAD 1KYAA 1GC1L 3HG1E 1IEAA 1F3DJ 4PJDA 4YEFA 4P59L 3S4SB 5JHDD 2A1WL 1BD2D 1HKLL 1FNGA 1J5CA 5CEXB 5DD3L 5L8KB 2HVJB 2R39A 4WI7A 2XWJA 4AK1A 3WTVA 4BKSC 2OS7A 3LN9A 1CMOA 4HG4K 4ZS6D 5LCVA 1MRCL 2K3HA 4M7JL 1AXSA 1PY0A 3QDMD 4NIYE 3RFZC 1R1CA 1AFVH 2AQTA 4PJEF 4XCFH 4BFRA 4IJ3C 4F7TB 3VFTB 5ITFB 4OR1A 5HHMD 2MQCA 3DO7A 4X50A 3U7WL 3RZCB 1ZGLB 3TESA 3LPWA 4TUKL 2BSRA 2MPVA 1LDPH 4PJ7F 4J8RB 4QKXB 3RVXD 5F7UA 4AMKH 1X7SA 1QD0A 4PUBH 5E2TL 2CM6A 1S5HA 4DH2A 4NRZB 2EH7H 4X7SH 2LFEA 4IMLB 3UAEA 3US1A 3MV9A 4QHKI 5I0WA 4QGYA 4XMTA 3MX0A 3UO1H 1HEZA 3MLZH 1GZPB 1SLUA 1NAML 1TCRB 5IFAL 4WW2B 5IMLA 1TU2B 4JO1L 1CBVL 1TITA 1MKFA 5C0AD 3SGKA 3KLHD 2Y72A 3QPXL 3ZSSA 1FVCB 1ZHLA 4LSUL 4TNVK 1BP3B 1E0OB 5E4IA 5KN5B 2ZWZA 4X6BA 1AGDB 3RWFA 4ZSOA 4GRMA 2BOCB 4TNWF 1BEXA 1NFIA 2AKRA 5I1CL 5IKCA 4Y9EA 4GBXB 3JWDC 2YRPA 3VGGA 4DVBA 2XZQL 1N5YL 5IBTH 1MLBB 1CI3M 1OAQH 5AENA 2DQHL 3T0EC 1E9OA 3L9BA 4F7PB 2OZ4L 1CDCA 4MXWL 5GRUL 4OIIH 3F58L 3GHPA 2WXKA 3A4FA 3SY0B 4HEME 1PSKH 3ARDB 2ENYA 2ED9A 4N2NA 5ANMA 2VT0A 2EO1A 4A2FA 4IDJH 3JZYA 1M3IA 3B9EA 2OL3H 3RX5A 2ORBL 3KCPB 1OT4A 2HTKD 2X7LA 4PUBL 5BZDB 1KB5H 4O2FB 4TSAL 2FWOA 5D5MF 5T3ZD 3PAUA 3DX3A 3SKNB 2R0KH 2JTYA 1Z9PA 4O5LH 4Y19A 5D72H 2OMZA 2IOOA 3UO1L 1B0GA 2X53A 3CIAA 1S7TA 1LP9B 4ISVB 4OZGE 3F84A 1U2CA 4ZUSB 3TWCH 3G5ZB 1NKGA 3GD1C 4C56B 1CICD 1SFHA 1YUHB 4JKMA 3SPCA 3WGUB 5IG7A 5K9OB 1NL0L 2RGSA 3QQ3B 2OTWA 4JZOB 4IKJA 5KSBA 1PQZB 4K23H 4QOKA 4YHOL 3WTUA 3US9A 3C5ZC 4ELMB 3GMQB 3D39A 2A77L 3BZ4A 3FUNA 4N8VG 3KEHA 4R0LA 5EDXA 1TDQA 2H2PC 2MQ3A 5CILL 3RJOA 3PWNA 1L7IH 2OMYA 4AYEC 3L3HA 4KKZA 1U8MB 5FO8B 2GT9A 3A3YB 4WJ5A 3NZ8A 4ELMF 5B7FA 4AQOA 4JFDE 5I30H 3NYKA 4GW4B 1G7PA 4OTXH 3ENEA 3EFDH 3L13A 1AYRA 2ZP9A 1BVNP 4U1SB 4Q97A 4E0RB 1ZHBB 4HUUB 3MLRH 1RUKH 3VQMA 1RIHH 4Y2OA 4NLAA 3EO1A 3QQDA 2RJMA 5IJVB 4AUYA 5D2LE 3L2MA 1JPFA 3LB6D 3VXQB 1L9PA 1ZT7B 2NNFA 3CZFB 3GXDA 1KEGH 1P69B 3L3KB 5ALBH 5DJDA 3BPCB 3SZKC 1B0IA 4ZUWB 1FYHB 1XF5B 5D1QA 4YQXL 3KGUA 2IDUA 1CVSC 2OCJA 3VFSB 4OZ4B 3STLB 5F21B 5CN2A 3RWEB 2NY7L 3S2CA 3FT1A 4AGOA 5F1SA 5FPIA 1AYOA 1S7RB 4NZJA 4I77L 3ZUCA 1L3NA 2ZX6A 5C71A 2FBRA 5GZND 5DRNB 1NC4A 3MROA 5H35B 5KSVA 4M7ZC 4QHLA 4Y2OB 4PJIA 5FKPA 1EJ6A 2CLRA 4K07A 5IVXE 1HNYA 3P73A 4K3HA 4WNQA 3FTZA 4KKBD 1WLHA 1Z0NA 3FKUS 2XWXA 2XV2A 5D1ZA 3DX0A 4EI6B 4WUKH 2ZYHA 5C07B 3GLAA 2RA1A 4L8SB 4MB5A 1DQLL 4MJ4A 1MQKL 3L3HB 1TJIL 4FQIL 5FO8A 2G4EA 2K0RA 5E2WH 4WV1C 1RJYB 3QULB 4MD0B 3NJIA 4FFZA 2F54E 1G9NC 3P0GB 1XEUA 3IE9A 3MNVB 2VLKD 3FU9A 4HJGA 1UZ8B 1NIFA 1P5UC 4PJFF 3DIVA 4WW1A 4YHNB 1ZAGA 2CHZA 1MUJB 2E7BA 4OIAA 3IDGB 4L9LA 4WFEE 5BRZD 2ICWJ 1PMYA 4GP5B 3NZHH 3UTOA 2H6OA 5DUBA 2X4OB 5IB3B 2OMZB 5IBTL 3MCLL 5JXEA 5GGQH 4NCC2 3MKGA 3V0WH 3LQZA 3WJJA 4O2FA 3CD4A 2VDKB 3L2LA 1AXIB 4O02B 1S7SA 3RL1A 1VRSA 4BUHA 5ICYA 5G4NA 2BW5A 4QJ3B 3GGWB 4PSPA 3FT3A 2YAPA 1FL6A 2R51A 3SE4A 2J73A 4XN7A 5JXAH 2CA3A 5CIPH 4NQUA 4EEEA 2Y1VA 3QA3B 4S1RH 5FDYA 1G9MC 5E70A 3CFKB 3ZSTA 4XVSH 3AY2A 2WO3B 4KROD 3S88L 3U6XS 4G8IB 4XP5H 2X6VA 2DM3A 1MFCL 5TF1L 3CE1A 3ZYZA 1WFNA 1OB1B 2PCXA 3TCTA 2Q7AA 1HZHL 5J13C 5ERWB 3AM8C 2ZUQB 4F9PA 3DMMD 5LXVA 4ODUB 2C3VA 1QBAA 4PS3A 3W5MA 3REWA 4WEBH 3SDXA 4AOFA 5D7KD 2ZF9A 2P48B 2ZUWA 4PAZA 5IMLB 3DO3A 4WFFD 4BGLA 3W2DL 4Z77A 1I1FA 1M9SA 4HETA 3MLUL 2A9CA 3ESPA 3HC0B 1BQLH 4X5XB 1IBGL 5AAPA 5MENE 4KKBC 2H47C 5JTWA 1D6VL 4NRZA 2IBZY 4BHUI 2EYSB 3NIGE 2C1OB 4PJBE 3ULSB 3PP3H 4Y4KB 1KWKA 4HHGA 2NY7H 1W0VB 5CEZE 2G3MA 3C6LD 4NRXA 3DO7B 1A6ZA 2ROYA 1MFNA 4CMHC 3AADB 1YNTB 2CD0A 3HLAA 5EZLA 4KZCA 1PEZA 1IKFH 1F90L 5SX4H 1LLAA 4GH7B 1OV8A 3BVNB 1J8HD 4BCZA 2F7IA 4NUQA 3V4VL 2OX5B 3LKSA 4G6KL 4Z7UE 2CBQA 1OD9A 1YQ2A 5I1HL 3ULVH 2BJMH 4IRJA 2SODB 3E9UA 2ARWA 1CXEA 1XSOA 3CMOL 1F5WA 2X9YA 5DO8A 4PYGA 3T2NH 1G7IA 4KHXL 2BNQA 4JRWA 1GS8A 2DLTA 1JPTL 3O6FD 4M5YL 3F7RA 43CAB 1EJ8A 4L23A 1LD9A 2Z8SA 3TYFA 4AL8L 5IB5A 3MV7B 1XIWC 1RJZB 2FLRT 2AEQL 1E4JA 3WIIL 1OCRB 1QI5A 2R9HC 1G9EA 5C9JA 2DYSB 2X4RB 5HHOA 2G5UA 5J6HB 3BD5A 2P8LB 2VKXA 4OZGA 5CCHE 2VITA 3WNJA 1I4FB 4PBVC 5BW7A 5DT1L 5L4MA 1MHEB 5BV7L 1AZZC 1UEMA 3FMGH 4ZXBB 5LNEA 4DZBB 3FCTB 3HPLB 1RK0B 5FW6A 2PW1A 4OLVH 2VTFA 2AK1H 5J11C 2V5YA 3TPUA 1MPAL 1IZJA 2QSVA 2JI2A 4LEOB 3WFHA 4EDWL 4F15B 2Y6SC 5IIEB 3GLEA 3PE9A 3QIBC 2X05A 3OAYK 4MQ7A 3B37A 5AVYB 3ZPDA 1X9QA 3JZ7A 5H94A 1SBSL 3P30L 3TO4B 2NNAA 4LIQL 3RTQA 3MBEC 3FT2A 3RDTA 1LO3L 2HKFH 1S7VB 4DKAA 3L3JA 5HDQH 2FUTA 3M86A 1YEJH 3FCBA 4QRFA 1FZJB 2PKDA 1ZHKA 3GS7A 3HAEB 3K6NA 3RY6A 3T2LA 1MXDA 3FSAA 3US0A 1QFWI 1F6LL 2HVKA 5GGUA 3TVMB 2BC4A 1QBML 2H1PH 2VSKB 1IIKA 2FHFA 3N1MC 4IKNA 4HOXA 2B39A 5FECB 1JWMB 3MXVL 3PP4H 4KXZH 3BDYH 3HC3H 3Q01A 3ULVL 2BP8B 2AJYL 3CFDA 5CF3A 1VFUA 2PWHA 3AT0A 2Y5QA 2ZXDA 4PRPB 1KBWA 1KC5H 3SE9L 1U6AL 1RLWA 4CUCA 2HT2C 3VFGL 1HL9A 2H1LM 5EIQA 4LPWA 3Q9PA 1BZ7B 1VA9A 4GIAA 4KUZL 3MRLA 4F2ME 4P4RA 4KVNL 4Q74A 4G9DB 1S7WA 2SEBA 5HD8D 1Z3RA 1NLDH 1XBRA 2I07B 2PPDA 5FCUH 5TQ2H 3DSNB 4H8QA 4HCFA 3QUMB 3OHXA 3P9WB 4OD1H 3UOAB 5DURD 4YBLB 4P05A 1FO0B 3T6WA 4EPSA 3BRFA 2B1AH 1XXFC 2XBTA 5IR1B 4UU9B 5TGBB 3UTPD 4F92B 2QADB 4JR9L 3RX9A 5D2LA 1OTTD 4DN4L 4LDOB 4PJ8D 2FTAA 4HWEL 2NUTA 5A2CA 3VRJA 5EEYA 2H3XC 2HAZA 1JGDB 5AW2B 4JFXA 1J8SA 2BWQA 3K7UA 4LU5L 4JZJB 1EAPB 3VMOA 2C3XA 4DAGL 2VLJE 3SKNA 3SBPA 4I4WA 4MQSB 4X7TA 3UCQA 4NUJA 5EEUA 3I9IA 3SDAA 5KJRL 1C5BH 1FL5A 1XGRB 4V11A 2K8QA 4FQXC 5B3JE 2FB4L 3UG3A 2ZXWB 3B3BA 4NAJA 1CLZL 3O0RL 2XXFA 2JTDA 5ABAA 1UXLA 5DRZA 3TNMB 2QKIA 3DPBA 3QO1A 4MD4A 5IMOB 3EO9H 5LNGA 5BVJB 1IGMH 3QS3A 3FU8A 1XTLA 1RUPL 3KXFB 1BEYL 1N9PA 2B1OA 3TCLB 3U9PL 4J3BA 3O9WC 1GAFL 1MXGA 4MSWA 4PM1A 4OJCA 5D7EA 5KW9L 1XB6A 1A3ZA 5KVFL 1XV8A 4KRPC 3ZQ9A 3VSVA 4K55A 5HHOD 1TZGH 5E1HB 3T6ZA 1EEYA 1LJMA 4KK5D 3EADA 5HHVH 3VCLA 2CALA 5HDBE 2GITB 3BFOA 5L8LB 1A9EA 1S9XA 4U1NA 3AT9A 4MKMA 4X4YB 1UZ6E 4Q6KA 5D7IB 2AJVH 1H3PH 4K8RC 3KDMB 5I1DB 1A6WH 4ZUUB 1DO5A 2F8VA 2QEJA 2R4RL 4MMZA 4HS3A 1K4CB 4I3SH 2PW2A 5B21A 3RGBA 2Y5EA 3Q8AA 1MLCB 3B8SA 2CO1A 5A16A 1NMBH 1XCQA 1JE6A 4P59H 1JV5B 3FPYA 4HGMA 3RTLA 3HN5A 3GSVB 2A9BA 2E7CA 1ESOA 2VZUA 3D7PA 5TE6H 3OKEB 4LLDA 3FZUD 1J11A 3S35L 4HP5A 4WVRA 2IAMB 2R0ZH 3V4PH 5D4IA 3SKOA 3UDWA 3L4YA 1FV1A 3VGAB 2YO3A 1CCZA 5EU4B 3MRGB 1KEML 4RESB 3O4LD 3QWOB 3DETD 4YNYB 4LCUA 5LVEA 2EXTA 4NHUB 3G5XA 5DS1A 4D8PB 2KHAA 2IGFH 4XXDB 4JO4L 3PL6D 5F3HA 1CE6B 3MBXL 4LP5A 5DLMH 5EC1B 2XACC 3B2PA 2Q7NA 1KJ2B 2R1WB 4RA0C 5BZWB 3U2JA 2AVGA 4FQXD 1OZTG 2NUPA 1LE5A 2EIZB 3ZK0A 4L48A 1R9FA 1NA8A 2YWZA 4JBSA 3EBAA 5TD4A 1HH6B 2CO7A 1IX2A 4XVUC 3JV6B 2MKWA 3FQ4A 4R4NC 1MNUL 4P48A 5EU7C 1QSED 3IS0X 4HGWB 3IGKA 2HX9A 3PWPD 4JFFE 4OLUH 5DGRA 3ZUNC 5BOZG 4ZW3A 1BSIA 3MODH 5CEYA 1SLVA 3A21A 2E7LC 2F68X 4QAMB 3MLPA 1A7RL 5CNHA 2DQGL 4LLMB 2WNGA 2L0DA 4FA8A 5LDUA 4NKOA 3A4EA 4UQ3B 3QJTB 1ODAA 1PX3A 3EDDA 1A6UL 1OAUH 3VB8A 1A1OA 3OKMA 5AEAA 1IGTA 3GMNA 4ZFFA 1XCXA 2XOTA 3P4NA 2ZOLB 3NBNA 3CSBA 4JQVA 1U8IB 1IFRA 4Y5VA 4K7PY 2IDCA 3WN5C 1CI5A 1AHWB 3BMWA 3LVTA 1QZ1A 2DLIA 1MCPH 2QQLL 1ORSA 1AVAA 3C75A 3VYPA 2KKQA 4FG0A 5ICZB 4L8CB 4MNHA 1R47A 3E6HA 3WKYA 4RWYL 1IM9D 5KW9H 1KBGH 3RGHA 3LIZH 4B97A 2OTUB 1C5CL 4NN5C 5E8OB 2QGCA 3B1TA 4HCIA 4YXHL 3NJLA 4QO1A 1MG3C 4NQVA 3M1BA 3MACH 2OV0A 3CXDH 1ZVYA 3D4YA 1BW8A 3TBWA 3II2A 4PJHA 4GW5A 4PJFB 2FYYB 4IDJL 2DIEA 4HPOL 4N6QA 5C08D 3VXUE 4LEBA 3P3SA 4O2CA 3GIVA 3DROA 1QFPA 1SF5A 3CAFA 3O8XC 4M4RA 1LO2H 1NH6A 2X89A 1IC7H 2WKOA 1HINL 4KXDA 2GTWB 3H0TB 4Z7OF 4DFHA 2EDKA 2YRBA 5D6DA 2Z7UA 4ZAKA 3FUJA 4V1DE 2ZOKA 1RZGB 4I1RA 3CVHB 5L0QB 2EICA 1EHLH 4XCNA 1TO5A 2CHNA 2JI3A 3ARYA 5EZOH 4DQOL 2BLFA 3EJUA 1G7HA 3T3MB 4G8GA 4AGPA 3VFWB 3L1FA 4G1EB 3PDOA 1BXVA 1FFNB 4OU3A 2BNUA 2JQZA 1UA6L 4GQQA 4PRDB 4ZTEA 2K4WA 2NZ1A 3BIBX 2K1MA 3BWUF 5I6XC 1ZJAA 3VH8B 1R0AH 1MVYA 1RJLA 3CPLB 5EEXA 3KYKL 4XCFL 5LAXB 3T8XA 3FT4B 3ULVE 1DCEA 3N40P 3KJ4C 2QQKL 2YZ1A 3D2TA 3RP1A 2WSKA 2NXYB 3NFSH 4ZPVA 4PBWD 4U6XA 1OAZH 1E6JH 2ZG3A 5E6YA 3CX2A 5JIDA 4A6YB 1FG9C 1TTBA 1T2QH 5HYJE 4PP2B 5TFSH 2VLME 4A38A 2BP5M 2JFCA 3SE3C 5B1BB 3F7KA 2QHRH 1H8NA 3SHSA 5C0BB 1CICA 4RH4A 2AERT 5L6YL 5AFAA 4JG1H 3RLSA 4JVWA 4C83B 3QIBB 4EJ1C 1G0XA 4UTAH 1TQTA 4FLRA 3MR9B 1G7LA 1QLEH 1TZAA 1YEFL 1PG7L 3DUUA 3HG3A 4YSTA 2VRAA 1KGXA 2F54A 1DBBL 3M46A 4FXGA 4NZTL 5AB2A 4H1LH 3CN3A 3CXHK 3CXHJ 1PZUB 3CZJA 1EQWA 2ZQKA 3FF7A 1MF2L 2J57A 4Q6YA 5FHBL 4L4TA 1ZLUK 2P26A 2F74A 4UT9A 5I73C 4S0TD 3WJLC 4JCMA 1DSFH 4BQ6A 3VRIA 1QSFB 1XGTA 5KSUB 1AGCA 1XBDA 2DQDH 1USQA 1UACH 3X14A 5AZ2L 3WMSA 4GRLB 1CD1A 2ED6A 3LIZL 4QRQB 3T04D 4XPGL 1NMAL 2A9MH 5D1QE 5DMIH 2IALA 4H0GA 5KANG 1FO0L 4JO3H 1F90H 3VI3B 4ZG1A 1AIFB 4DZ8B 2H0PA 2OI9B 3ZDYB 4NPJA 1BAFH 4GRLA 2B4CL 3MV9D 4YHKL 2IVFC 1CG9A 2R29L 1R3HB 4FJYA 4I0PA 4KK9D 4LCWE 1QFUL 1G1CA 1JTTA 5IQ9A 1MFAL 2H5UA 4LFHD 4URKA 3SEPA 4FZEL 1E9PB 1G5GA 2I60H 2ZUYA 3NDZE 4BSWA 2Q86A 5F7KC 2NY4B 3DA0A 4L4VE 5CSZB 3ARBD 4Q0XH 2R4SL 1HE7A 4M8QB 4PLOB 3X3FH 3E8UL 1SJEA 2HN7A 5FWQA 5L7XL 3UADA 5BOJA 4F93B 1V5JA 2D4DA 3IRPX 3QPKA 3R8QA 1DZ0A 5CZXC 1FWXA 1H3TA 5FYJL 2P5EA 3WENA 3DJRA 2V2WA 5T1LA 1G7LB 2IAMC 3DUUB 1BZEA 4OF0A 4NO0B 3RWDA 4X5WA 3UBHA 5LXGL 4K3DH 1JZGA 5F7YC 2NYYC 5JHDA 1M6UA 4GG6F 1SVCP 4HCRH 3GO1H 1W0WA 4I2XE 4XO3A 4ZD3H 2WXRA 2AEPL 4PP2A 4IBVA 4N8UA 3RIKA 3RGVD 2LHAA 4GKZB 2B16A 3CMOH 2YPVL 5EU7E 3C8KB 4P2OD 5EWIL 3RNQA 5CD3B 2EDDA 2YN3A 5FB8A 5F3BA 2DQDL 1DL7H 3DURA 4IOSA 3DRTB 3LB6C 2D7PA 4OGXH 3ALPA 1IBDA 1LILA 1JF1A 3P02A 5JQIB 1WK0A 1N2RA 3SCMD 1NBCA 1YMMA 4B5ZA 4FABL 3BSZA 5ESVB 1L9QA 4HXBL 4PRHB 4KQ0A 3QI9A 2Z92B 3RUGF 3VD9A 2F8XC 1FFNA 2N56A 3FT9A 1TEGA 3HE7D 4HWUA 2UYLA 5ENWA 3NIFF 2XKUA 5IQ7L 1BQLL 3ZHLA 2CXKA 1G7HB 1MPAH 3INUH 1HU8A 3O3EB 4FABH 1RY7B 5I6KA 2ITCB 4QRPD 4TLSA 4XI5D 3FO1A 1CLYH 4P23D 4UIMA 5EN2A 3SDXE 2VN3A 5DFVC 1R5WA 5FXCH 5LWYL 1MCJA 4L8BA 3C5SB 5BV7H 1PZBA 5B1AB 4JDVB 3AABA 2ZKMX 3ATAA 5DZOA 3F7QA 1JPGA 2R69A 4JL1A 1E8ZA 2GTZA 1ILUA 4OJEH 5I1GH 3IF1B 2R4RH 1C1EL 4LCYA 5AKRA 1UD6A 4M03A 4YSOA 3PY9A 4JM2C 3BKMH 5I23A 4YX2H 2LU5A 3TA3B 1PDKB 1BCIA 3Q2WA 1MCEA 4K7FA 2ZXQA 2G3XA 3MRFB 2J8UA 2QKSA 3N42B 1WT5C 1E9QB 1F8TH 3IDIB 4I87A 5CGBA 4CL7A 1CDUA 5BRQA 5I2IA 1SFDA 2KS0A 2YLHA 5J89A 5B8CA 4JO2H 3BUQA 4F7MA 1CVRA 1N3NB 5IV2B 4Q2ZA 4W6WB 5KYXB 3EF4A 1CXKA 5DO2D 2DQJL 3BDBA 5IOKA 5ANHA 4ACPA 5ESQB 3AS3A 4XXCA 2C7UA 2B3IA 3BUIA 3FUDA 5D8JL 2N0KA 3TL5A 1DVFD 3ECVA 3E6HB 4TQHA 5FGCB 5BV7C 5ICZA 2GIMA 4YHKH 5GGSB 3WEXB 3ZR5A 5D6DC 4KXBA 4P2CG 5JYLA 5D93C 4WI0A 1JVLA 2HLAB 2RMNA 3VFGH 1Z9SA 2QQQA 4XCCH 4ZMAT 4PYHA 4MS8D 4XNXL 4OLXH 4E5XA 1RULL 2IOMA 2AZUA 2VGLM 1ADQL 3I75A 1GYCA 1DLHB 1T1WB 4NQEA 3RB5A 5KS9B 2FYVA 4NBZB 1VB9A 2E8ZA 4CBPA 4AT6B 4UAOB 1JGIA 2DWDB 5EUOB 3VVVA 5IW6A 3DMMC 3MLXL 2YD2A 1R34A 2CKBB 4P4KC 3OXSA 1A5FL 2DDQL 3PLYA 1R5VB 3I9GL 4KY2A 1M7IB 5EO9A 2YD1A 1J9QA 4NDMA 2AW2A 4B41A 1EEQA 5JIIA 3RA7L 1XF2B 2B5IC 1EZLA 5CFHA 5IB4B 3V6OC 2WTRA 3VU2A 4Q58C 1EXHA 1OOWA 4R6UA 1KULA 2GJ6E 3KGRA 3UJJH 3B1UA 5I2IB 1GL4B 2R1YA 3HPJA 3ARGD 4HS8H 4F8PA 1T0OA 3QZMA 1KJMA 1N0XH 1T7WA 1YPZA 4PRID 3LSOA 4QXTB 1KJ2A 4JCLA 4WDIA 3LZFH 1PDKA 2BIPA 4AIZA 4GAAA 3C6SA 3G5XB 4LKCB 2DQIH 3TLRA 4G6MH 4GAYA 4Z7WA 4G11A 4R97C 1G7MA 1KG0A 3CZGA 4H7VA 4OCSL 2E6QA 4UV7H 3VD0A 4FXGC 2DRUA 2B1HH 1A9BB 2D3JA 4W9EC 2R83A 5C0ND 3W39B 1DVFB 4JQXA 4M1CC 2F53A 3H7BA 4FNQA 1CGTA 1L9RA 1WWWX 2XKSA 3HC4L 3CXFA 4AENA 1CDYA 1ZS8B 4A63A 1T6VN 1CYXA 4J3VA 5MERB 4BSVB 3DXAB 4WI2A 5DD5L 1AO7E 4M6ML 1AQKH 2UYLB 2D03H 2YFNA 2RAMA 1DQDH 2ZKXA 1ZWIB 4LCCA 1BQHG 3BIKA 2Q2EB 1ZGLM 5E2TH 3NTCL 3TP4A 3OGOE 1BGXH 3L4TA 1N19A 1NANI 1PZSA 3S35H 5ITBH 2CCVA 2BMKA 2NY2B 4KBPA 1LQSR 1GY2A 3GM8A 4PTTB 1KYDA 5B4MC 3IFPA 1A9EB 3FU3A 3EKCA 5KSAB 1ZT1B 4D7PA 2M83A 3CU7A 2DQ6A 1EEYB 3PYCA 2BNQE 4I0CC 4ONFH 2EXYD 3QAQA 1ODUA 1DJXA 1IGML 3GSOB 2NX5E 4LDCA 3WS3B 1NAMA 4TSAH 2FDBP 3EJSA 1JGLL 5HHNB 3V4PA 3VACA 4ETYA 2JKIS 3FFCA 5DJYB 3AREC 3Q1EA 1KXTB 3WTTA 1JYWA 4WHDA 2OXGA 3DX9B 3IDYC 4I0PC 3MA9H 1U92A 4J3OC 1XF1A 3T08A 3AC0A 1UYWH 2ZX7A 5MEND 1PY9A 5E5MA 4MXWH 5GRUH 4IGBC 1XSIA 4BCYA 3QUZD 5J4MA 2J6EL 1IGCH 2IWGA 1KJVA 4JHAL 2BINA 5T3ZH 4O4YL 5AYUH 1DVFA 5DHYB 4QOKE 4HZLB 1E8WA 4I89A 5DZJA 4CA4A 5EU3B 4JO5A 1NMAH 3FF8A 3MUGB 1NCUA 4N6RB 2P8PB 4RVBA 4APXB 1JNLL 1D5MB 3IJ9A 3P0VH 4PRNB 3QCVL 1JV2B 3FQWA 3TBVB 2WBJB 3P2DA 3HHSB 1J8HE 4ZQKB 2NUTB 3BN9C 3CJJA 4PJ9C 3TJPA 3WDIA 1QG3A 4QR7A 3VM5A 4DP2X 1RD6A 2VZVA 5E9AA 1BOGB 4KKRA 4NFBA 3O41B 3CK0L 1MCRA 3FT0A 5C7XH 5CKAA 3UZQA 3C5ZD 2IAND 1KMGA 3F85A 3ARWA 2Z4QA 1S7WB 4NC2B 3QE5A 4UMGA 2JKSA 4IRSD 5DVPA 4OVUA 5I18L 2X6BA 4XNUL 1NFAA 1HSAA 4X0KA 5IHUH 2V7HB 1CE1H 2OI9C 4MXQC 4UT7L 4XPFL 3GSNL 3OAZH 3UYRL 3FH5A 5A2JH 4OCNC 4HDIB 3BRGC 1BZ9A 2LLNA 3CLEH 1E4WL 4KUCF 3IJHA 4NNYA 5F0JB 4CVZA 2DWDA 3LRGA 2WLHA 4X9GA 1DDTA 3H4HA 7TAAA 1IEBA 3P11L 4R3SB 2YFOA 4JDZB 3IE4A 3IJSB 2FT8A 3ARDD 1KXQE 3RB7A 4DP6X 3F58H 3HE7A 2CGRH 4OT1L 4X9HA 4PJGF 2K78A 4HBCL 3ARGC 2J7LA 3N85L 1URLA 2UY6B 3HZVB 1BJ1H 4GI9A 4AZ8A 4TLUA 1ZD6A 3FQTB 1H19A 1JHLL 4LL1A 2WHVA 4M7LH 3SCMA 3RWJA 5D1XA 4KY1L 2BP0B 1QW8A 2J56A 3BUPA 5DFTA 5IGXH 1D6EB 1KJ2H 1H3VA 1Z9LA 3LVEA 2NPLX 2LE9A 2XA3A 4Q2ZB 3HA0A 5C0DB 3AS1A 3KPSB 4HSCX 5C0JA 2C9AA 1OGAD 3HZMB 2Z3FA 3JXAA 1NC2B 4A7QA 3DBXB 3G9VA 5EU6D 3EYUL 1YJDC 1RZKL 1BPLB 1T7ZA 4G8FA 4ZNCD 4LVHC 2OJZH 3LEYL 2DYPB 5C09B 4BFBD 1DR9A 3DTXA 4G82A 2VXVL 5IJKC 1NIAA 1D5RA 3WY3A 1HCYA 4JEGB 4EUPG 1EHLL 2ZUXA 3ABLB 5EFIB 3KYKH 5I9QC 1MW2A 2J71A 4JRFA 1LD9B 3MFGB 1HXMA 3MRHA 4OVVA 4Y16B 1SJMA 4BINA 2P5ED 2W81C 4PJ5B 3EFDL 1CGXA 1LK3H 1QMUA 4OZHB 4N9OB 4A2LA 4ZZFA 3FO1B 4QRSA 4BH8B 5F2FA 4M4PA 3OLGA 4MX7B 3AZUA 1MFMA 5DJ2A 1VZHA 2ICEB 3IS1X 4R26H 4A2GA 3RZWA 5LG6A 5F96H 3VJ6A 5IJDC 3BH9B 3FUMA 1HXYA 3LRSB 1HXYB 5ES4B 4GQZA 1NIDA 2JELL 5EF3A 2H26B 1LEGA 3K2KA 4WGVB 4PRHA 5IY5B 5FO7A 4G8GB 1KTBA 1YEFH 3JTTB 1URIA 4ODXB 4Z3GA 4D9RD 4U05A 7FABL 4YDJB 1Z1WA 3WD5L 4OQ1A 5IMKA 1DTUA 1JF1B 3F5WB 3LKQA 3ZDXE 3T4AA 1ET5A 1XCWA 1D7FA 3RU8L 1U8QA 2X87A 4I9WD 4XP6L 2GSIB 3MLRL 2GTWA 3IPBA 4QF1A 2KZKA 1I7ZB 5ALCL 5KG9B 2ZAIA 4NJ9H 2QGDA 3VFVA 5FOBB 3DOSA 2B2XH 4HLZG 5C07D 1NJ9B 2CR0A 2KUTA 2O4EA 1ZLSH 4LNRB 35C8L 4QYAA 5C0CA 3WS6A 4P5SA 1T5WB 1J0JA 3OWRA 5CSBA 4PU2A 4ZFOA 1RULH 4FE9A 2A0LD 4ZNEA 5J5EA 3FN3A 3GI9L 4JFUA 4WY7L 4EO5A 2HZHA 4G7YL 4X5WB 4F24A 3FONA 1DEEB 2F8IA 5C0CD 4YBHA 4A04A 1IMHC 3VXPA 4LSTH 3GBNH 5C0DA 5T3XL 5IF0A 1GC1C 4YO0B 1RP8A 1CWVA 2M8XA 1DQJB 5FF6B 1QEWB 1DVTA 3EBGA 3QIWC 3TEYA 3FT3B 1D6EA 3B7SA 2MH4A 1P5VB 1SJEB 3ELAT 3HI1A 4I18A 2JK5B 1MCLA 4HIXL 1ZKAA 2EXWD 3RVUD 5GS0L 3HB3C 1ANUA 1MWAH 3LZLA 2XNAB 3AY4A 3QFJE 4TV3A 3G9AB 4IW4C 5I0VA 4O00A 4P2OC 4KX7A 5LBSL 3H6JA 5FGSA 4UNTA 4PJXF 4NQDA 4C47A 3F3HA 3Q2LA 4XP9L 1QUPA 2X4SA 3P54A 4PJ8C 3HJ0A 1DQQA 3P0YH 1Q4NX 1KGCD 2OSXA 4NOBA 4HQQH 4ZW7A 1IC4H 2N4IA 4OLYH 1H6TA 2AEIT 5D7LD 4F8LA 4IOIA 2ODIA 4A7UA 3V7MA 3S37X 1UD8A 5JQ6L 3LKRB 5JPNA 4WWKA 1OEZW 1UZ6F 5J0BA 3ALWA 3CH1A 4QRAA 4FYSA 4NN5B 2ICWI 2WWOA 3ZL2A 1SUJA 3AXHA 3M88A 4U4IA 4M48H 4H25B 3EYQC 5D9SA 1G0DA 3OGCA 1QSEE 3CGTA 1RZKC 1YY9D 4NQCE 1BV8A 2E56A 2ED7A 1BD2E 3ROLB 2FSEB 1KCSL 4KQ4H 5I73B 1FHGA 4OKVB 3PHSA 4JPWH 1RCYA 1NC4B 3BN3B 3SBWA 3O41A 4W4NA 2GI7A 3WHE0 5I1GL 1QUNA 3MBED 4N5UA 2FO8A 1T5XA 4FFZL 4MHHG 1Q94B 1IC5H 5LBGA 3TWYA 5CU9A 1SBSH 3NPSB 2CRMA 3P30H 2Z1PA 4XO8A 3LN5B 2PABA 1JWSB 1EDYA 4P23B 4XNYL 2ITEA 1FZKB 3V6FA 2XSKA 1PAZA 4N2OA 4N6RA 4APXA 2B59B 1FYTD 1EXGA 3G5YA 4G7QB 1E5BA 5FYKE 5L2KB 5EA0H 2BIMA 2KYIA 4FFZH 3LKPA 1ORQA 1YQVH 2WINA 4FX5A 4MWFA 1D9KD 4UILL 3I6GA 1V7NH 3QNYB 4GRWB 4BFEA 2HFFB 5IW1B 3WI9A 1H0DA 3WKNA 3UZEC 4KHXH 3F7VA 4NYLA 1GZHC 1HHGB 1MZZA 2FBJL 2WC7A 3RKDC 1A6AB 5I1JH 4TVPE 4HS3B 5AWNH 1WFJA 4NUGL 1OE3A 3QPQD 1U3ZA 1NUNB 5KSAC 5E0QA 4XAKD 4WUUD 2HJKA 3CN0A 3S3BB 3L3IB 3MLVH 2F9BT 2X2HA 3FUIA 3QRBA 1PBYA 1V7MH 2ILLA 1FZOA 1PIGA 1PJ9A 1RJLB 4R8WL 4XB7A 4JFZL 5AWNL 4BZ1H 3IFPB 5KVEH 3F05A 5ISZB 5HI4D 2OTWB 5I1HH 3VXOB 4P3DA 4H8UA 1D2PA 2A6DA 4PRDA 3FUFA 3G5ZA 1U4EA 1NM4A 3BP4B 4RFEB 4EDXB 1OGPA 1FNSL 1P4IH 4OUUB 4B53A 3Q8FA 4H1LA 3QRLA 1JYNA 3QR1A 1I1YA 4R7NB 4JRXB 1FGNH 3CVHA 2R8SH 5LUMA 5DQJB 2VLRD 2K45A 4OZFG 1EAJA 1PG7W 4OZFB 4TQEL 1U3HB 1FL5B 3H0TA 1BG1A 1B4LA 3HAEG 4QHPA 3HKZA 2HMID 4FZ8H 5SV3A 1EZUA 4RA3A 2IQ9H 4YWGH 2JKNA 4AGMA 1NCTA 4PI0A 4QXGH 1A3RL 2DPKA 4M4RB 4Q4IA 2XWBA 3SE8H 3GSXA 3QEUB 2GC4C 2CUAA 4FG2A 2NY6B 5CGTA 4B6ZA 1JYVA 4FLOA 1XCTB 4AYDC 1HT6A 5G55A 5E99L 3EYOA 4U49A 2NT1A 4P5KB 1FBIL 4DCQB 5I8OH 1YPZB 4H1LG 1JERA 1Q1PA 1QX1A 4YOKA 1HDMB 4F58L 1YY8A 1BF8A 2FHCA 4WO0A 4MZRA 1N12A 3TBWB 3L45A 4ZUTB 2A73B 3ORJA 3OQ3B 4UDTA 1LDPL 1SYSB 2EEAA 3G6DL 2ALWA 3EZJB 1OP3K 3VFUB 3VI4E 3KCWA 1ZLDA 4WQOA 1KJ2L 3ECBB 4JG0L 4KO5A 4N8PA 4N3UA 1BZ8A 1MCSA 4M3KB 3OXSB 1G1OA 4J8RA 5H8DA 2XN1A 3TT1L 3VQ1C 4S0HA 1NFDA 3B43A 4ODSL 4WCYH 3GSQA 1NLBL 4LVEA 4F7TA 3N1GC 4OZIE 4AW4A 1HC1A 2QADD 4HGKC 3U1SL 3FK3A 4E5XB 1HYSD 4PJGE 2V8LA 4KVCH 1DDHA 3RBSA 1YNKL 1PFCA 4BFFA 4G6FB 3KPTA 1EMTL 1WISA 1X5ZA 5JLZB 1FZJA 2Y69B 3HBZA 1T89C 5GGSA 3OMAB 4NZTH 1QQDA 5CP3H 4TQ8A 3H55A 5CN3A 4PJ7B 2C7UB 4QPEA 1KTLB 2HKHL 4AQ1B 1S3KH 1RIUH 1YEIL 3U9UB 4PIRF 3M7OA 4ODHH 1QLRA 2XKNB 1P84J 2F5BH 1RURL 3Q13A 4Y16D 5D7JD 1I7TA 4KJPC 3Q0HA 4P5MB 5B8CB 1M1XA 1A1MB 1NUDA 4L29B 4N3TA 3F01A 3TCXA 3T0ED 2IH9A 5F9JB 4W4OA 1XXDC 2G75A 2K6YA 1S9WB 1P7BA 4AMKL 1P0SE 4KTEL 4MA8L 2VJ0A 4OZGB 5ISZD 1RURH 4NKQB 3E1ZA 3TS8A 3TT3H 3T3ME 2O6DA 1NANH 3C2AH 4OCXH 3QWOA 3SE4C 3UJIH 1EIBA 1J0YA 1RJZA 5SV4A 5EU4A 5F8QC 2OR7A 3IF1A 4IRZA 1IBGH 3PWJA 4R5VA 5FFLA 3Q1SL 1ZEAL 5AL8A 3FHQA 4M29A 1SY6L 1XR8A 1E4XH 2V4LA 3H9HA 1TNMA 2M26A 1VJSA 1BJ1J 4KI5C 4YN3A 1CB4A 3LPPA 2GB2A 3STBA 1F11B 1Q9WB 1J1OH 3AW5A 4L8BB 2AXGA 4AVIA 1N18A 1YMME 2PPFA 4UTBL 5DK2A 1D5ZB 1U8OB 3RG1C 3WY2A 1NUFA 2FGWL 4DW2L 2QPFA 5D5ME 5T1MB 3BQUD 2DEYX 4G1MA 1UD3A 1CTOA 3UMTA 3G04B 4PJ9B 5CHNA 2CR6A 4KKLC 2OCCB 1E4WH 4GG6B 4LVOB 1W0VA 1ZTXE 1H3PL 3PL6C 2C4XA 1R3JA 2Z91B 4HIIB 4R90L 1JDAA 1UJ3C 4V2CB 1NCBH 1L6PA 2OYMA 1WF5A 3BH4A 2VLJB 2E46A 1E5CA 2WBKA 3MV7D 1U0QA 1JZ3A 3UYPB 1W72L 4RQQA 2BNRD 4ZBJA 1X5YA 3AQDA 3QDGB 4BFIB 5JHMA 2OJ1A 5JOPD 1BD2B 3FTVA 4FG6C 4TL4A 4PJGB 3KXFA 1C5BL 1IBHA 2XTJB 1ZANH 4A55A 1OB1A 4FKEA 3OSVA 3NCCB 1RVFH 1ZSHA 1U3JA 3DOIA 3MLSH 2LW3A 3O3UN 3ZDYE 5JNYA 2VR4A 1RZ7L 5I16B 1PJWA 4P06A 3GBML 2W38A 5D2NE 2Z0BA 5GZOD 1IAOA 1CQYA 2CA4A 3DX7B 2MHAB 4KRNA 4LLYB 3ASNB 4ALAL 3D18B 3NCJH 4CADB 3FN0L 5EN3A 5C6PB 4AQEB 3V0DA 2VDPB 4PRPE 3HZYB 1WHOA 4GW1A 2F61A 4JKLA 2WAQA 4R0LC 4OQTL 3MGOB 4BFKA 2OR9L 15C8L 3VFNA 3OLEA 2ADIA 5SWZD 4JFED 1Q72L 1C7TA 1RZJL 4LAQH 4OJFH 5F89A 1SXNA 1BQKA 5TGBA 4LT7A 2E7MA 5I6MA 4ALAH 5HJDA 2Q5BA 5A2KH 2X4OA 2Z1KA 1A0QL 3BAKA 3QUMA 1GGBH 1GYWA 3ZMNA 1XGPA 3QDGA 2UV3A 4XNZB 2Q8AL 4W1TA 1H5BA 1JZIA 4PR5A 3MACL 5HGBA 1WHPA 3K4AA 3D3VA 3MRBB 3W9DA 3BDXA 3HZ3A 3WUWA 2VMFA 2F2HA 5J12C 5I0XA 2NY1C 2I9TB 3LNEA 3FDWA 3N06B 1NGPL 3R0MA 5CR1A 1VEOA 2C9RA 4L9LC 2ATPB 1XD0A 3V5HB 1F2QA 1UWXK 4HQQL 1QPPA 1XGTB 3ZE0E 2ZWLT 1AQMA 4J3OF 1YEDB 4QHLB 3BGFB 5GS1B 5JW5B 3C6LA 3TH2T 3MROB 2XJKA 3TYGL 3ZL1A 1RSYA 4QRTB 4L4TB 1Q9WA 1U8NB 3WEBA 1PKOA 3TPKA 4N8CL 5JW4N 3SQRA 3TN0D 5GGTH 1TF4A 3AFLA 2MQ0A 3KNBA 1NBQA 4ENEC 2DWYA 1CTNA 1HQRA 3MU3A 4TSBH 3MLYH 5LCVL 2NX5B 4AYID 4BK4A 5BW7C 2YD6A 3UXFA 4NUMA 4XMUA 3T0BA 3QRGH 4JM2F 3VXSB 4HUMB 4YDKH 3PS6A 4AWJC 1N6QH 4NM4L 3LQAL 1INEL 2GJJA 5EIIG 2Y07L 2AGJL 1ZLWH 4AKPA 1L6XA 1VGKA 2X0VA 3PGDB 2OQJB 3FL7A 4P5MA 5KVGE 1R3LB 3FO9A 1U8JA 2CO6B 4ZYKB 5C6TH 4F8TA 2DV6A 3QEQE 3KL0A 4K7PH 4U6XB 2ZPKH 4HKXB 4PJ5E 4PGJA 3PAYA 1QFWM 1TSHA 1HHIB 1BZOA 3WJJC 1T66C 5HGAB 1JPTH 3B7TA 3EUDA 1KIQB 3PWNB 1N8ZB 3B5HA 3DI2B 4U0RC 3UZVB 2ZCLL 1TQUA 3K3QA 2ZXBA 4RNRA 3GMQA 2VAJA 4LSVL 3VXMB 2FGZA 2Q8BH 4CU7A 1HHKA 4E2OA 2BDNH 2QMKA 2XLLA 1L9TA 3M07A 4MQXD 3CZEA 1DDHB 4XOCA 1WYJA 3HNTL 3NIGF 1JD9A 3B3IA 3C6EA 5E6IA 2GQHA 1DVQA 3ERXA 3F12A 2Y9RT 1UADC 4ZI8A 1BIIA 4QRRB 4RGOH 1LP9A 3GIZL 3SZ6A 4GO9A 5IB1B 1GZQB 4PBDA 4YDKL 1UFUA 2AJUL 4F8OA 4JFEB 2VLKA 3LH2H 4JDTH 2H45A 4M48L 5FYJH 2IJ0C 3OF6A 1FF5A 1V55B 3FFDB 3U46A 2C9SA 1KDJA 5JW4R 1BAFL 2YPLE 1ZPUA 5C1MB 2D4FA 3LEVH 2XFXB 3GRWL 3NK4A 1IL1A 4JJHA 2BFVH 5ANMB 1WBXB 3BQUB 4XPHL 1U91A 2DMGA 4AGNA 1BMWA 4XTRD 4UDTB 1S78C 4MA1C 4I3RH 3WFBL 1TTGA 3REWB 1T1YB 4NKIH 2OULB 4F7PA 1RUML 4GXUN 5CJXA 2AEPH 1Q0YH 3EG9B 1NFDF 2ZCHL 3L1OL 5A3ID 5IKCB 4LCCC 2AQNA 3O6MH 3QEUA 4R96B 4PJFA 4DPRA 2V2TA 5LBSH 1G4RA 3EHBC 2BCMA 5AW3B 5GIRB 1YSOA 4F5CE 1I7RA 2VZ1A 1UD2A 1TCRA 2ZCHH 1FRGH 3L1OH 1WBXA 4L05A 4YDMA 3SQBA 5EDSA 1IL1B 2D31A 3HRZB 3MBEA 1FP5A 4X6EA 2I9LA 2A1WH 4L1DA 5HHQB 1KGIA 2DQHH 3SDCC 4OLYL 4JCWA 3I6LD 3RL1B 1F02I 4MAUL 4Y2DB 3LH2L 4JDTL 1J1XL 3UX9B 4WWPA 4GRWF 5GRJH 3APDA 4OCRL 4MBRA 4MNHB 3CFIC 4HH9A 2Y7QB 3LEVL 3OZ9H 2MRYA 2QVIA 1HSBB 1KCKA 2X40A 5DUBB 3UYOD 1X5LA 4ZX4A 2EDNA 1SVBA 3G08B 5FHAH 4PHXA 4PHZA 4ZDHB 1FH2A 1M05A 4D3CH 3KVDD 1T21A 5KVEL 1IGJA 2DEWX 4MCYB 2XZAH 4L0YA 4ZQTA 4G8GD 3IMVA 3WYRA 3OPZL 3J7HA 5E4OA 2APSA 3L9RA 2DYPD 4PGCB 4PQXA 2APBA 1FNGB 3A6CH 3DNKA 5T1JA 5GSVB 3N91A 2G60H 4L8DA 4PLKD 3W56A 2BCKB 1S2EA 3HHMA 4LDLB 1NCJA 2Z7YA 1ZTXL 4X4MA 2YQ2A 2ZWKA 2X89D 3PGDA 4JFFD 1A7QL 4YJZL 3QDGE 1PS3A 5C8JB 3QNFA 3GSUA 1KIUA 3BSHA 3NQIA 4NXSA 3L17A 3KBPA 4PV1C 1KB5A 1RZ8A 4D8PA 3HCVA 1PZ5B 2MJWA 4CC1A 4FXTA 2HJFB 1FVDA 2E9JA 1FV1B 2YXWA 3EBHA 2AAVA 1DBBH 3GINA 4UBDC 3X13A 1VDGA 5KUKA 2EECA 2NTSP 5GXBB 3U0PA 4KO9A 4P2RD 5J06A 1CXFA 1N6VA 4C56E 1X6NA 4P3CL 3EO1B 3C6LB 1YG9A 3QQDB 4NP9A 2TRYA 1IM9A 3OWEA 5DDHB 5CCKH 4TTGA 3L4WA 3MJWA 1U33A 3I3EA 3NZSA 4MMYA 5K39B 5FGRA 4BFGA 2BCKA 4LCIL 1N8OE 1G7PB 2J88L 2UWEF 3GSWA 4L8DB 5DQ9B 1J87A 4QEGA 2VDNL 3TZVC 2NY6C 1DJSA 1K5WA 5EZIL 3JYCA 3U83A 2Y23A 3NZ8B 4B9IA 4B3VA 4W9FC 4U1IB 4WW2F 4ODSH 4NC1C 1YQVL 2DJUA 3GWJA 3KPLB 1E4XL 4LSDA 5TQ0H 5C3IA 9PCYA 2E8YA 4QYOA 5EU6E 1MY5A 1KCVL 4WWID 1OL0A 3CFEA 2EYTA 3HJEA 3NABL 3WUWB 5L2KE 2YPVH 4MJ5A 1INQB 4X8JB 1EJOH 2OCFD 1IC4L 1KBPA 3MRIA 3WFBH 5IUCA 1W8NA 5IG7B 5K9OA 1DANU 1YUHA 3PJLA 2EEXA 4FFWC 3PWPA 4PP1D 1DBKL 4IIZA 5LGHH 3VW3H 1QSEA 4S11A 4W9GC 4J7RA 1B0GB 2HX8A 1FH5H 4PJCE 5DD0L 3O6ML 2E9BA 5E8EA 1OAXH 1N10A 4I0KA 4GUQA 2QVMA 5FUOL 2C3GA 2HTLD 3FH8A 2ZSVA 3PHQA 1WTLA 4FMVA 4NXKA 4P3WA 3V4UH 4Y2DA 2X7LB 4EQ3A 1P5VA 3S98A 3V5KA 5H4ZA 2H6UA 4FQJH 3TO4C 3EDKA 1OPOA 4BUGA 3HRZA 3MBEB 4GW1B 4WW2C 3PJNA 3PL6A 4Z0BL 1F4YH 3MYJA 2FEDC 3RKDD 6CGTA 2A74B 3V0WL 4UCFA 5D7HA 3RPIA 5I6XB 4MAUH 4XWGH 3ZL4L 2I69A 3T77B 2ZUTA 4F15C 1E7VA 5FDWA 2QPDB 2JV6A 3RZCD 4PEEA 3HI6L 1HZKA 3KPRD 2GK0B 4B9JA 4H8HA 1EDQA 2FUQA 3LZQA 2ATKB 1IE5A 3GMOB 1Q0EA 2G2PA 3RX8A 2AKRB 1DJIA 2XXCB 1OAJA 4CBZA 5CLZA 3AVEA 4NNPL 2BZ7A 3GBMH 4FQCL 3S88H 3HEIB 3DSNA 5FOBA 3IMTA 4Z23A 1W8EA 1A66A 4A1RA 3CVCA 3DV6A 4FFWD 4KXAA 4B50A 4CN1A 1GZPA 2RD0A 3UYPA 1SQ2N 2XFXA 2ZP0T 4U2YA 5INCA 2Z64C 4WUKL 2FEJA 2GBUA 4U3XA 5DD1H 1NBVL 1J7VR 4GSDL 3N9GH 4GKOA 1CR9L 2X9WA 4XVTH 2MCAA 5FA3A 3C60C 4YDJA 2F58H 4ZFGL 3TFBA 4ODXA 1D5BB 2RBLA 4BEIA 1GZQA 3MBWB 3MCKB 2HFTA 2J1WA 2Y6TE 3BAJA 5CIPA 1DQDL 2NT0A 3RNKB 4PV9B 4K7PX 3KPOB 5E5LA 1UYWL 3B3IB 3NSCA 5E6IB 2HKAA 1JPST 3W9EB 1OTUD 1I3RB 3QXWA 1EO7A 4OV5A 4MX7A 4C4KO 1KYUA 2IFFL 4NOFA 1CFSA 4WO4D 3NRFA 5DUMH 3CFBA 5E7BA 1AQDA 3A0OA 4HD5A 5K9QG 1YEJL 1JP5A 4MJ6A 5JIHA 2DQGH 2Y7NA 3N0PB 1SY6H 5HGAA 1QR1B 3DUSB 2X6CA 1ASQA 4HT1L 1QABA 1YLBB 4OFPA 1UKQA 1SYVB 3MA7A 5DUPL 4ODVL 5F6HI 4FQQB 4LHQB 4Z95L 2Z93A 3RFRA 4YSQA 2IPKB 1A6PA 4JY6B 2KH2B 1G7QB 2VWEE 2XPYA 2IANA 4XNYH 2IDFA 3UJIL 5GZOA 1NMBL 2OMVB 1FNEA 2OL3B 3HMWH 3TBSB 5EULV 3UAFA 1SBBA 1VADA 1WUZA 2B8OT 3L7FB 1DFBL 5FKAB 2HWZH 4PLKC 2GFBA 3IDNA 4K2UL 3AB0C 3WO4C 1MCOH 1GCFA 3N9GL 4XVTL 5J3HC 3VWJB 4HMCA 3HMXA 4G8FB 4LARL 3C60B 3KXFD 2JCCE 2XETA 1A4KB 4MB4A 4CDGC 1A6TA 5AW5B 5IJKA 1A1MA 1AKJA 1E6OH 5ECGA 5AVXB 4ZJ9A 5FKAA 2DZEA 2EEBA 4Y5VC 2X4RA 1FNEB 4WI5A 2NY1B 4AYFB 2XKNA 4JHBA 4JHZA 4JO8A 4D9QE 3MJ8B 1DQVA 2QZ5A 3CFNA 3IFNL 3BO8B 1AZRA 3DX6A 3EH1A 3MV7A 1NBYA 3TYFB 3ULVC 3MA7B 3LNDA 2QPSA 2WYTA 1PTZA 3U36A 3K1DA 1FG2B 43CAA 1DJHA 3W2DH 4P2QA 5JPNC 3HC2A 3QORD 1F4AA 5MENA 1F6AB 2CIKB 2Y2YA 1MJUL 1PL3A 1WZ1L 1G7IB 3NGBB 4HUWB 3LMJH 1Y6NR 4DESA 1AQDB 5GS1A 5JW5A 2ATAA 3ZRCC 1SLWA 3JWDH 2E27L 2X4PA 3S36H 4HWEH 4HT1H 2TSBA 2WUBH 4ETQB 3VTTA 5HVHB 4ODWA 3U4BH 3K2IA 1UOWA 4HUNB 1RK1B 5IBUB 1I31A 2A7BA 3KPOA 4NS0A 2DD8L 4X7CC 4WK2B 1J05A 3AUVA 1U8PA 5BO1L 1I1AA 4C55A 2V2XB 3DVNA 1OHZA 2H3NB 4H0HB 4UIKH 3RURA 4AJYV 3IFOB 5JW4M 2AXHA 3B6SA 5IVNA 3MFFA 3G6JB 1RZIA 3TV3L 4JJOA 3UTSE 5M95B 2NW2B 1JIBA 3U0WH 3IYLW 3I9GH 3IU3B 3K6SB 2DQTL 2RQEA 2X3CA 4OCRH 4TVPD 3VQ2C 4RCAA 5FYLE 2VUKA 1C8PA 2ICWB 4N2LA 4DKFH 4G42A 4UM8B 3QZWB 5DZPA 3T2PA 2NY0C 5F3FA 1U3NA 3UJJL 5JOEA 3T0EA 1QYGH 4DTGL 4XBGA 3EHBB 1JFQH 4LSRL 3GJFB 4G8IA 4AVHA 1OARL 3CFTA 3EDJA 1IAIM 2A3TA 3L5WA 3NCWA 4YDLC 4ZFZA 5JORA 1I9IH 3T3PB 3TBYA 2BOBB 3MUGA 1S78D 5EU3A 3SGEI 5F7FA 2AV7B 5D8JH 2IBZX 2GVYA 4UNIA 4CN6A 1U21A 2YC1B 4UDUB 1IGCL 3OKOA 4H8PA 4MYWB 1LK2A 3QDHA 4YSPA 4S1SL 5MEPB 4P5TB 4NQTA 2WZPD 1RMFH 4PGDA 4AZUA 4Z7IA 3QQ9D 5ACZA 1HH9A 3BFQG 2R23A 1NDGA 4KI5E 5K1NA 1YPZE 4ZT1A 2MEJB 2VM9A 4FZEH 4ZPTA 4TMPA 3S37H 2WXMA 3EBIA 3ZYOA 5HHNA 3ET9F 4UWQB 3ZQXA 1A9VA 4K3JH 4I88A 1NAMH 5IFAH 1FORL 1NEPA 4P3DB 3CVBA 1JMXA 2G2NA 1CUOA 2OXHA 4G7VL 3GYRA 3ULUL 4Y1AE 1UH2A 4RSYA 1I8KB 4FXKB 1OD7A 3RBGA 3QULA 4MD0A 2XG5B 1AR1D 2YPKB 4H8WH 4NJ9L 4PLJC 3WLWC 1T6BX 2P7TB 3IRZA 2Y25A 3BI9X 2UXFA 4D7BA 1UUSA 3CV5A 5KYYA 1PZAA 3VRLF 3UTQB 2PNDA 3N42F 4AQ1C 1BM3H 4JFOA 2XDHA 4TXVB 4U1HA 4LCCB 4AX3A 5DQ9A 4Y4FC 4ABUA 4G1MB 4LO9A 4FYRA 4BCXA 5I75B 1UUNA 2EE2A 3DXAA 3WLWD 3C08H 3UACA 3S9DB 4GKNA 5DK2B 2PWDA 2BX5A 1G9ML 4H4NA 3DMMA 3VU1A 1ITCA 3RWIB 3L6FB 5HYSA 2OZNA 1ZS8A 1INEH 4QHKJ 1NTDA 4QGTA 1MOEA 3HW7A 4UZSA 3BKYH 4NM8H 3ZDXB 3JYBA 4X4XB 1Z6JT 4JM2A 2DMCA 2JLPA 1YEEL 2G60L 1JUFB 2VXSL 4LKXB 3BVWA 5T1KD 4HK0B 2VKWA 3HC4H 2PXYD 1OAYH 3WUZA 4IBZA 3SOTA 2ZCKL 3NFNB 3C6SB 2EINB 3BP5A 4QRPB 3SPVB 5FO9B 3RWGA 2VR3A 2L7JA 1BXUA 3C5JA 1G1YA 4ZXBC 4RAVB 4EVNA 1AC0A 1EJFA 2R2EB 3E8VA 2YUZA 4XNQB 1YEEH 4I18C 4KMTL 3B9KA 4A7SA 2B5IB 3ROLA 4RGNE 4U1SA 2W94A 3NACH 4RETB 3VD7A 5CILH 4Z0XB 1K8IA 1NEUA 4KK6C 3KW8A 5LO7A 1XF2A 1HJBC 1V10A 2ZKYA 4P5RA 3PABB 3N55A 3SBQA 1ID5I 5E00B 2W0LA 2BVOB 2D0GA 4BA0A 2CLVB 4EN2A 5CBEA 2OZ4H 4IOIB 4M56A 3U7YH 4HEMA 4KQ3H 4HOZA 4YPGB 3L3DB 1N6UA 1BLIA 5KSBB 1FHNA 2LGNA 5I6PA 4QTIH 4PMEA 2N01B 5A6LA 5D1ZD 4ZK8A 1JHKH 1H3WM 1I9JH 2CUMA 1QNZL 1XH0A 2V9UA 4MNQE 1D9KA 1L0YA 2NXZB 3IDXL 4LSSH 3BPNC 5LNDA 1QHQA 4HIXH 2E6JA 2R29H 1NIEA 1JDDA 4N0UB 4I18B 2OBGA 1FYTA 5DTFB 5GZNA 2ADJB 4DPBX 1CF1A 3UFIA 2IGLA 4GFXA 3RX7A 5IEHB 2FR4A 1Z5LA 4X6EB 4PJBF 1AJ7H 1QEWA 4IBYA 5E56A 1RZFL 5TK2A 1SYSA 4KZ0A 3LRKA 3BXNB 3X1FA 1JGVL 1AO7D 3ISWA 3NCJL 5TTRA 5I1IH 4JFDD 1MG2C 1TVBB 3PUCA 1QAWA 1YY8B 2FLMA 1MNNA 4JFSA 2CBOA 3MRFA 5EUOE 2ADFH 5J7CC 1ZVSA 3E38A 1K8DB 1ADQH 3ARTA 1BQ5A 3QUML 3BD4A 2BOCA 2P3YA 1KGYE 5H2BA 3U0TB 4OD3H 5T1LD 4BYHA 5B8CC 1LO4H 5I1CH 5F1NA 1P1ZA 4FJ6A 2YGNA 1B6DA 4YK4C 1UM6H 2FD6H 5E03A 3JVGC 1NCAH 2GTZB 2P44B 3UG4A 4APQC 2UWEB 4UANA 3GSNH 3IETB 1WWCA 1R6VA 2EDWA 3TTSA 1EGJH 1LEKB 4E9XA 5ESAB 1EWHA 3LKQB 4A37A 1UWXH 5J12B 4HEPA 3WD5H 3Q9QA 1U58A 5B7EA 1BMGA 4BZ2L 5ALBL 1OSPH 1VFMA 2VLKB 3NJXA 5AVTB 1J88A 5JIPA 1S9VB 2P24A 1QRNB 2VDRL 3R1GL 5TH2B 1A7NH 4QOKD 4QT5B 1T1XB 4Z76B 1CDBA 4NQDD 3VJ6B 5KAQF 1ZGLP 5HP5A 2EDYA 3CZUB 3B7RL 5FM4A 4YHLH 4NI6A 2H41A 4O51B 3HS0A 3RVTD 3APNA 1LO5B 2DMBA 3MO1B 3ZKMC 1W72A 2NZ9C 4J3TA 3V95A 4MJHA 3ZTNL 4LSPH 2I27N 2J43A 1XO8A 5ANME 3IDUA 3BEVB 2NQDA 1SPDA 2YPLB 3H56A 3DI3B 2DQMA 1I8IB 4RDBA 4LLUA 1OM9A 3DHUA 2IANE 5DSCB 5HYIA 3C8KA 3RNQB 3NCBB 5ABDE 4GSQA 5DQDH 4N8VB 5DT1H 5EFIA 3MRDA 4JLRB 3E2HB 1TZIB 4IKIA 3HUJA 1R3LA 3BW9B 1GGIL 3GI8H 5SX5K 1MHHB 4L4TD 1GS7A 1C5DA 1R3KA 4QRRE 1BYNA 1A3QA 2DWEA 1J0ZA 5T5FA 3IMSA 4MMXA 4Y4FD 2JVUA 2FQFA 3HS9A 4A2HA 1BVNT 2WLLB 3BZFA 3NJKA 4LL4A 1FNLA 5IJBC 2VIRA 2Z34A 3AG4B 4HJJL 5DU7A 4J6RH 4X5LA 3LKPB 2RHEA 1NC2A 3H42H 3K6IA 5MEQB 4W9HC 5HJ3B 4CSSA 5T1LB 3KMDA 3GO1L 5EZJB 1ONQB 2XWDA 1U8KA 2XN9A 3LYRA 4AMWA 1FZKA 3V6FB 3ZT6A 1UM6L 1YC8A 4MXQD 1DUZB 2MCG1 4DGIH 1GH7A 1HQRB 4GT7A 1I7UA 3TNNB 1Q94A 4XGZB 5D1XB 1T5XB 2XBDA 4ZMTA 4DFIA 2O5ZH 3WDJA 1TTRA 3LRHA 3MUUA 1JZ8A 4FTVA 4PRHD 3VFRB 3DXAE 3VFPB 2FQEA 1CGUA 2EIBA 1M42A 3F7YB 3DKHA 1DQTA 3QQ9C 4PREB 3A67L 3LN4B 1AD9B 5BJTB 2YLKA 1ZCRA 1G9HA 3CDGB 4XP5L 2VDMB 3MXWH 5EPMB 3OZ9L 3DTDA 4CVWA 3NEEA 4K3DL 3LPOA 1X9UA 3LKRA 1MJ8L 2YAQA 1T4KB 3BSGA 4NKMB 5AQ0A 1M6OB 3SDDB 1LDSA 3GXFA 1MQKH 5AUMB 5BO0D 3THML 4DGYL 1FC2D 5DK3A 4AM0A 3BGAA 2KT6A 1XH3A 3PPEA 2AV1A 2CUHA 1JRHI 3IMRA 4MAZA 4XPTH 4Q7DA 5IVOA 3BQUC 4LRIC 1FJ1A 1NMCB 1A65A 1U8HA 2XJLA 4I13B 5EBLA 4ELDA 3GK8L 3CFQA 4LLQB 3CC1A 1T04A 5C7XL 4Y4FB 1BEYH 3U9PH 4XVSL 1AO7A 4KC3B 5I75C 3HR5A 1P6WA 3O6FC 4Z7OB 4YX2L 4O02H 5IESH 4TUJA 5E1AB 4H88H 3JV4A 4F2FA 3TBTA 4YHPB 5PAZA 2QTEA 2FATL 3KLLA 1QTSA 4K3GA 3TBVA 1NWPA 4F5CA 4YO0A 3RGVC 3QO0A 4AQEA 2F54B 1BQUA 5E99H 5BS0B 1A7PL 5E08H 2EXSA 2OPCA 4G6AC 1ZE3H 2V33A 4Y1AB 2BRQA 4XN2A 5DHYA 2HH0L 4YVUA 1QI4A 2E74C 3GTTA 5BRPA 2HT4D 4MBOA 3VE0A 4RMRA 3HE6D 3BHBB 5I16A 1CF8L 4F7EA 2H0JA 2WSDA 5E5MB 2R56H 5F9OL 1CU4H 4RAUB 2IQ9L 5EBWB 4OF6A 1DQKA 1FL3B 1MAML 3LD8B 3P0YL 2ENPA 2GC7C 2PR9A 3LRMA 4O4YH 1THAA 3E6FB 43C9B 1KXTA 3EGDB 1CXIA 2YMTA 5B3NA 1I3VA 3B7UX 1NAMB 3BYYA 3DWTA 4IIQC 4NPYA 3BKYL 3H42L 4NM8L 3QJXA 2WZ0A 4OCWL 1B4JH 3WDHA 3S5YA 1HZLA 1R24A 4E9SA 4XR8C 5B39G 3EJYD 4GKSB 2UZYB 4OCYL 1DBAL 2DQEL 4XC1H 3HG1B 4BK5C 5GRYA 1VPOL 1WDAA 3GB7A 1CFVH 3K6OA 3ZY7A 2QELA 2VISB 3LDBC 5ADOH 1W8OA 3U1PA 3BKCH 4X9YA 4PJ9A 4Z95H 3BH9A 1XR9B 3C5ZA 4KROC 1A7OL 4OLWL 4RGNC 3OHXC 5GRXG 4HCGA 2CE6A 3RDTC 1A3LL 1JS4A 2FL5A 3L4UA 1AY1H 2WLNA 3NIDE 2FO4B 3U4KA 5I76A 2FJGA 1BQHA 4GQPH 4ALAC 2Z31A 4LMQI 1SM3H 3QYCA 4LPUA 1B9ZA 1E5ZA 3QEGL 1OWWA 3BVVA 4PJ5A 3QWRA 1TT6A 2YRLA 1FE8L 4M6NH 4JRYE 4UT6L 1C12A 3ZR6A 1R5IA 1C16A 2Y7SA 2YGVA 3BUDA 1BZDA 3MRNA 4L5FH 2YJLA 5ID1B 3UDWC 5HDBF 3V52L 3DROB 4AIZB 5CJQL 4JB9H 4G70B 4XNMA 2GIYA 2ZXGA 5D7LE 4EI5B 3HE6C 3JQOB 3S2AA 1ROCA 1M4KA 5DS8B 2HT4C 1TQSA 3K74B 4ERSL 1BA9A 3GRWA 3KWUA 3O4LA 3VWKB 4RZCB 5AW1B 5K33A 3P4MB 5IT2H 2OZ4A 4OZHF 2IH1B 2OMTA 2CIIA 3WLBA 2PP8A 4ZODA 3RL2B 4H40A 4NZDA 3TV8A 1JGUL 1NGPH 4WTQA 2BP0A 2WY3B 2EO7A 3D3VE 1WC7A 3L5JA 4J8QA 3U6XA 4JZNA 3BCFA 4TQPA 3A6BL 2WV3A 3MNZB 2HRLA 4JHWL 1GXEA 2CGZA 5B1KA 3S8WA 4DKFL 1EJOL 1XZ0A 1TQCC 3QUXC 4TUOB 2XZQH 5I18H 4PJXE 1N5YH 3AAZB 4NRYA 1KIRA 4NQEB 3IK2A 4QTHB 2Q6WA 3F65A 2Q7YB 1LE9A 3QJVB 1LE9B 2ZUVA 3WFDL 1Y1DA 1B6UA 5T3ZL 5K9JL 1XZ0B 1OK0A 2P5PA 4CVZB 1OIOA 4JQVC 3MRCA 4KVCL 2GAZB 2QKIC 4D0DB 4S0SD 3EOAA 5BCAA 1JZ7A 1KN4H 4PJ7E 2KZ1B 2YQGA 4JM4L 1OLZA 2CIIB 3WLBB 1NCDH 5CUSH 1IC0A 4KHTH 4LGPB 3QEHB 1MWAL 1XAUA 5DJXA 3KPMA 5E8NA 1ECZA 1ETB1 2P5WB 4OF5A 3S3DB 3UZQB 1MCPL 1RHHB 5EUOF 5I8KH 4LCWB 3G5VB 5DHDA 1IGFL 5M94B 5E0FA 1ET7A 2BPBA 3A6BH 3ARGA 2BIOA 3JWNH 4U33A 3SDAD 4WI4A 1PD6A 4JKPL 4XC3L 1KENH 4QJ4B 2RFXA 3FOLA 1C16B 2VSMB 5J1SC 3I74A 1D5MA 2VDMH 5ALCH 2KPNA 4GO6B 2EUWA 4J27A 1QO3A 4OKDA 3ETBF 1I1AD 1E6OL 1TVHA 4CNIB 2GW5A 2I7OA 4JN2A 3X1BA 4XODA 3AM8A 2FAUA 3AGWA 1JV5A 4ZRGA 3ZRFC 3X3GL 1CZ8L 1OZUA 1R5WB 1X6LA 4UIMB 5EN2B 2W0FA 3V4PL 4PRBB 3C2SA 4H0IA 1GGIH 3GI8L 3IXTB 4GUOA 2OXGB 3DX9A 3MGTB 4RMBA 1KUMA 1XR9A 3C5ZB 4IBQA 3VXRD 4YFLI 2VERN 3MLYL 2NY0B 3T4YB 2VQTA 4NO5A 3A4AA 3QORA 4G5ZL 2AQ3A 5AYQA 3CFCH 3WO3B 2DTSA 4PBXA 2GK2A 4YL4A 2J55A 4X80H 2OMXA 5KSAA 4E9TA 4ZX3A 1ASOA 2BY3A 5FLVA 3NFSL 4UNUA 4ANUA 3FAXA 1CL7L 1HL8A 5CJ5A 3S48A 3KE0A 3ZTCC 4YDZA 3D08A 3LS4L 3FFCE 4WUUB 5DHVA 3PU7A 2E4FA 3WHXA 1I75A 1RP9A 2Q20A 2C5DC 1ZPLA 4IMKA 5AOJA 4UYQA 5CSGA 2BWDA 1EHXA 1KCRL 3RVTC 3RVXC 1HZHH 1KCUH 3W81A 3FB8B 5GHWH 3MTRA 4F91B 4KTEH 2NNRA 1AZUA 1F58L 3D0LB 5CAYB 4OM0L 3QIWD 4PG2A 5I82A 3RUGB 3U6RA 2AEOA 2EEDA 2F53B 3H7BB 4JFTA 4R5TA 4XBEH 3W39A 1SDDB 4X7TB 5L2KA 4Z7WE 3HS0C 4GOSA 2MQGA 3BEWB 3N41F 4DTGH 3QJRB 4HVBA 1G7MB 3ZDZF 2J4WL 2YUVA 1G5AA 3ZT5A 4W9ZA 2Y7MA 5KYUB 4U3SA 4JRXD 3GTVA 1KBGL 1T1ZA 4M8QA 4HFWB 5E1AA 5IB2A 1JK9A 2IPTL 4LRIA 1O9ZA 3Q8BA 2D3LA 1O6TA 4R2GC 5IR1A 1K4DB 1F0LA 1DJGA 4JAMB 1TJGH 2VUOA 3UPCA 1TJHL 2HLFC 3HPJB 5HPOA 3H4FA 3KLSA 2H0EA 4OM1L 5E9DB 4X6DE 3OGCB 3IDYB 1FJ1B 4I0PB 4MNGB 3O6FA 4K9EH 4UTAA 3ARDC 4XPBL 5IB4A 1AOZA 4PN6A 1FCCA 4RRPA 4Y8AA 2CR3A 5A7BA 2H4EA 2W5PA 3NSXA 4Y2NA 4GMTL 1VFOA 1KN4L 3D2UB 4DZ8A 3ZN6A 3CBRA 4EBQL 1HFUA 4AL8C 3MNWA 3IDXH 4LSSL 4CILA 3GBEA 2YQBA 2IEPA 4TVUA 3W0WB 3LY6A 2EDHA 2XZCH 4AT6A 2WLJA 2GBVA 4P2OA 1TQCB 4EIUA 2VDNB 4K15A 3VXUB 5L4IA 3B9VA 3FJTA 1AGCB 3UYRH 1DQQB 4XPAH 2EKSB 4L3ED 3KW7A 3HAEA 4NQDB 1ND0B 4WTZA 4XMPL 4ZAKC 1HQ4B 4F58H 4WI0B 2XZCL 3TEUA 3N5AA 3SKJL 1MCWW 3I6SA 3QEQA 4AITA 5K5YA 1PIFA 3L3JB 3PXHA 2XNAA 4R2GB 1MFBL 2H7WA 1BFOB 1JXKA 3L9YA 3D4CA 1R19A 2P9RA 4XCYB 4XGZA 1CC3A 4OCMC 4RGOL 2CHWA 1KT2B 3QUZC 4XMPH 1DUZA 2P4AB 3CHSA 3OX8B 4B9GA 4OGQC 4KUCD 1Z3GH 1N3NA 4KK6D 4XPBH 5IV2A 1KEGL 5E4EB 1QFWL 4WSJA 4KXZI 2CBMA 2H0FA 5ETUB 4OJFL 1BAGA 1NEZG 4UTAL 4GP4B 1V3LA 1E9QA 2HA1A 4I7ZC 2GYSA 5HYJD 1E4HA 3D0LA 3EJCA 4YC2B 4TF4A 2EADA 3GSNB 3J8F7 4K7FB 4MMXB 4YLBA 4ADGA 2Z8RA 3N0AA 4WFED 4XH2A 4Y9CA 1R3KB 1T5WA 1F3DH 5F88A 5LBVA 3TJEH 3INUL 4GIOA 2R7EB 2P5WE 5DC4B 1Q9OB 3QNZA 4CGUB 3B5TA 1Q0XL 1WPCA 2Z8VC 5T1DH 3V4VA 3ULVF 5DHVB 4PWJA 4CVUA 5C6TL 4IM8A 1AG6A 1N5AA 2VXTL 4JFFB 2YPLA 5C0EA 3U30C 1KBVA 4WNSA 1UXMA 2EXYC 1TG8A 4XZUB 3EW3B 3O2DL 5I74B 4DOHB 3VMNA 1JGLH 5AVVB 3IU4L 4Y16C 3J2PA 5DR5L 2YEQA 2FH6A 2OX5A 2VZ3A 5BRZA 3HUJE 3F2LA 4HJ0D 2FWUA 2HLEB 4OLVL 4U2ZA 2WMPB 4ORZC 1MIMH 3OB0K 3B2VH 4P46D 3S3JA 2IQAB 5EZLB 4ABWA 5KEZA 4JG5A 1FFRA 1RFDL 4K9EC 1JFHA 2HRGA 3DX8A 3MOAH 2PETA 3CZNA 5I5JA 5HVHC 2ED8A 5DJ2B 4OZIF 2NY4D 4PW9A 4N8CH 2PCPB 1U58B 2AQ2A 2LT9A 3N85H 2XIBA 4EZKA 1DUYB 4S2SA 4PVLA 3TVMD 2R2BB 3MYZA 3QJSB 4P46C 5A6MA 4JN2B 2Y7LA 5A1AA 4MFHA 3RWCB 3IETA 2XI9A 4P2RB 2H32B 1DO6A 2F54D 1OP3H 1HXMB 4ICWA 1JNNH 2ZYRA 2DOCA 3M1CA 4PLJD 4PWEA 3AT8A 1SXSA 3KLAB 1MH5A 3SGDH 2FVNA 3HE6B 4BDVB 1OP9A 3QIUD 4GT0A 4RMVA 3IWUA 1JXFA 4OJYA 1GS6X 2XX0A 4Y1AD 3VWKC 5FIEA 4NAMA 1ZS2A 1GKOA 1ZVSB 3VD1A 5DURB 4FXLA 2P46B 3QXUA 1GAFH 3OAZK 2W65B 3DX2A 4LCWA 2OYPA 1LO2L 4PS8A 3QB7C 4L1LA 3WAKA 4QLRA 1TVBA 2QL1A 3D5OF 4NO0A 5KUMA 4G7VH 3ULUH 5FM5O 5C0JB 5CWSB 4OZHE 2VXQH 1ACYH 1QHPA 4KAQL 2AJXH 2CDFA 5TDOB 4PCSA 4FYQA 4QO1B 5C0GA 5I1LB 3SDXF 2VJXA 3OBAA 1I82A 4TS6A 2GJRA 2BS9A 4N0UA 1WA2X 5F9DC 1F4WL 5FV2A 5GGQL 4KFMA 4NBYB 3QEQB 4P0DA 1B88A 2W9DH 2QGBA 4JDEB 5JHAA 4DVRL 3LH8A 5I1KH 1XGZA 3CX5J 4Y4KD 4O5LL 5D72L 3ESUF 4ABQA 1NGZB 1KCVH 3RY4A 2FIRT 1KLUB 4G8EB 3EXLA 4FFYL 1IEBB 1OQXA 4I1NB 4TUOA 1RZ7H 2VN4A 3V4LA 4UM9D 1QLFA 5KJRH 5CBEB 2J2ZB 3DIDA 3O6KH 3MNWB 4F27A 1IJ9A 4CGTA 1RJYA 2J1YA 1AQHA 3RTQC 1S8DA 2YD3A 1CDIA 1JGEB 4QRQA 3PABA 4M1GL 4UTBH 5C3TA 2K3TA 3NT0A 1HILA 1OAZL 4XAWL 4EF3A 5K93A 2C1PA 3LPGA 4IRSB 4CU8A 5A43C 5F7MC 4L3CB 4FL4C 1GGTA 1YJDL 3QUKB 2GCYA 3GRGA 2VC2L 2EVIA 3KBFA 3JV0A 1JI1A 3B9KB 2ADYA 4KZEL 1K4DA 1MIML 2FX8L 4QRPE 4KRMB 4OLEA 3V0VA 5MI0B 3BCDA 5F3HB 1XMEB 1T5KA 1V3KA 2RQ8A 2YAMA 4XXDA 1M53A 3OXRA 4FQHB 3RWEA 4DEPC 4OZ4A 3STLA 1ITBB 4W93A 4YNYA 4A6YH 5JDJA 3QCUH 2J88H 4WHYG 4LASH 2P8PA 1R5IB 4APQB 1TQBC 3BEWA 5D7SH 4CJ0A 2GHWB 2VXQL 5DJDB 1E3ZA 1IGIL 2X6MA 3OKEA 3U6RB 3TH3T 3EJPA 4HV8B 3TO4D 3DPDA 5ILTL 3UEZA 5E6ID 1PX8A 4YXKL 3DMMB 5HYSB 1XCQB 1Y18B 1GHFH 3UBFA 3PNWB 2WVUA 4HSAC 5IQLA 1ACXA 1KCUL 3Q1SH 1BGXL 2YPLD 3QXAB 5TE6L 1H5BC 3BGMB 5HHPA 2N7BA 1CT8A 1KN2H 5GISL 3FFCB 5DJYA 3WEAA 4YDVB 1HAUA 3B2XA 3QCTH 2Q76A 5GGTL 3VI3F 3U1SH 3T6QC 5E8PB 1B4RA 3PQYB 3QHZH 3QUXD 3TO2A 5B38G 3QDJE 3GXNA 3Q3GA 1FPTL 1NCWL 4LSPL 3NCYS 5GS0C 2WN3A 4I48A 3VCLB 2MOVA 4QOKB 2Q1EA 2VDLL 2PYED 1OTTC 3KL3A 5CJQH 1UD5A 3Q8EA 3ZHFA 4PJIF 5G2NA 3CIQA 2FJHA 4NB7A 3QDMA 3ZDZB 1AHWC 2AS5M 1YDPA 2EACA 4ZUSA 3IAPA 2ESVA 5E7FA 4ZPTB 4AI7A 5HHPB 5HHVL 3Q2VA 4UOJA 3V0AC 4EUPH 1YN7A 1YJDH 3LOWA 3ZZQA 4BSVA 2YK1H 3LD8C 2CHDA 1Y18A 3TNMA 1RZGA 4XMXA 4MCMA 3OSKA 1NCGA 1ZK9A 2FD6L 4ATTA 4ZAKB 1BFTA 5DRXB 1RJCA 3AWFA 3MNDA 4AENB 3R0NA 1T3FB 3CVHL 1CIUA 1XGQA 4L3EA 5E6RB 5HDBB 3U4EB 3BZEA 4FHJA 1KG0B 3IFLH