3F01A

Crystal structure of synaptotagmin i c2a domain with cu(ii)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
143
structure length
143
Chain Sequence
GSPGIGGGGGGILDSMVEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Synaptotagmin-1
publication title Crystal structure of synaptotagmin I C2A
rcsb
source organism Homo sapiens
total genus 22
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3f01A01
4IHBA 3P2BA 2DMHA 1QASA 4FJYA 1DJIA 4LT7A 2Q3XA 2UZPA 2B3RA 2WXHA 3ZW3A 4EZJA 4Y1SA 5CCHE 1GMIA 3IBEA 3PYCA 3S2AA 1UOVA 2CM6A 4PS8A 5EDSA 4JPSA 1BCIA 1WFJA 3R7QA 3ZVVA 2K4AA 3CSTA 3L17A 1QATA 3NSJA 5JHBA 1V27A 2RD0A 3R7RA 5CCGE 1RH8A 4LDCA 3HIZA 1A25A 4XE0A 4F1SA 3B7YA 4F92B 1RSYA 2CHDA 4EZKA 3APCA 2WXKA 1UOWA 4FA6A 3FBKA 1E7UA 3QAQA 4Y1TA 1DJXA 3CSFA 2R83A 1DJYA 3TL5A 3MJWA 3PS6A 2ENQA 3HN8A 3F05A 3PREA 1DJWA 4EZLA 4OVVA 4ANVA 2X38A 1HE8A 5H4YA 1W16A 3NZSA 4GB9A 3IM1A 2V4LA 4NS0A 2YOAA 2CHXA 1E8YA 2LHAA 4V11A 4WWPA 4HLEA 3L16A 2CJTA 2WXFA 3APFA 4ICWA 3SD5A 3T8MA 2CHWA 3LJ3A 4KZCA 2YRBA 4WEEA 4FHKA 1DSYA 3ML8A 2KI6A 4ANXA 2WXLA 3F01A 1DQVA 5H4ZA 3QARA 4L23A 4TS6A 3TJPA 1E7VA 1E8XA 2CJSA 1DJGA 2WXNA 2D8KA 1DJHA 2ZKMX 1UGKA 2K3HA 1CJYA 2WXPA 5JHAA 4BFRA 4L1LA 3W56A 2A4ZA 2DMGA 4AJWA 1YRKA 1E8WA 3QJZA 4AOFA 2WXOA 3L13A 4F91B 3OAWA 2WXMA 1W15A 1WFMA 4MJJA 4L2YA 4TV3A 2WXIA 4HVBA 1K5WA 3TWYA 3ML9A 3NZUA 2FJUB 2QZQA 3DPDA 3L54A 5G55A 2Y3AA 4J6IA 4DNLA 4F93B 3QK0A 4TUUA 4NP9A 3KWTA 4G11A 4URKA 2K45A 2Q0ZX 2Z0UA 3M7FB 3PRZA 3L4CA 2WXQA 4ANUA 4DK5A 4QJ5B 2FK9A 3QR1A 4NPKA 1TJMA 2CHZA 2WXRA 4ICXA 3OHMB 3DBSA 3W57A 3ZIMA 4PS7A 4L1BA 1TJXA 1E8ZA 3APDA 3FDWA 5G2NA 2WXJA 3F04A 5KJ7E 1BDYA 2QZ5A 4QAMB 2K8MA 2CM5A 4WWOA 5T8IA 3L08A 4KZ0A 5CCJA 4QJ4B 3L9BA 4GNKB 2WXGA 4WWNA 4WAFA 1BYNA 2NCEA 4FJZA 3PFQA 4PS3A 1DJZA 3KWUA 4A55A 2NQ3A 2BWQA 2ISDA 4BGDA 3RDJA 2ENJA 4FULA 4KITB 4XZ4A 3RPBA 3ENEA 4OVUA 1RLWA 2EP6A 2N1TE 3GPEA 3QR0A 4FLHA 4XX5A 3N5AA 4FADA 2ENPA 1E90A 3F00A 3HHMA 2JQZA 4QJ3B 4ANWA 2NSQA 4IQHA 4NPJA 2A5UA 4FHJA 4LCVA 3JZYA
chains in the Genus database with same CATH superfamily
5FOJA 3INOA 4MNGE 4FNRA 4OKVB 3D9AL 3DRQB 2F53D 5TH2B 1TEYA 5HXMA 4LQFH 4Z7VB 3IXAA 3RVUC 3LMJH 4YXKL 2GW5A 1H9DA 2F53A 5DYOA 5TJWK 4BBWA 1DQQA 3S5LG 2KZ1B 4JHWL 1FL3B 4AH2A 4GKZA 4XX1E 1EFQA 2X70A 4FMFA 5H37A 2BHUA 1U8PA 4XP1H 4F7EB 1A7PH 2AXGB 1K72A 2DLFH 4NKIH 3IDNA 2XNAB 3VM5A 2J1ZA 2PYED 3TEWA 3UIZA 4N9GB 3V7MA 5I6XB 2PYEA 1JV2B 4HJTA 4JR9L 1AZBA 3QRBA 2DQCL 4XBMA 1EZSA 2J6WA 1Y0LA 5IF0B 3BWAA 1S7QA 2R23B 3E6HA 3FPXA 4HK3J 3GSOA 1XTLA 1C7SA 1G4RA 1PKQA 3A4FA 2ZAHA 1YPZF 3BKYL 3GS0A 2OV0A 3CU7A 2AEPL 5IMKA 1XGYL 1UQSA 4JM2D 4QI3A 3X1GA 2F7RA 1JZEA 2VDKH 2B59A 3BDYH 2Z34A 2ITFA 4WTWA 2XQBL 4ZX6A 1AE6L 1CPUA 1I31A 4AI7A 1BQHG 5FOBB 2PXYB 3CXHJ 1D5BB 4JFYA 5C0BE 2A9DA 1EEYB 4PRBA 2YRBA 2VXVH 4HT1H 3C6LC 4MQ7A 2H1XA 5D7SH 3EGSB 5F0JB 4CJ1A 3MA7A 4LFHG 5K39A 4RGNC 4OZIA 3BP6A 3FQXB 2EDMA 5JLZA 5CEZL 3FH5A 1U8NB 2WNGA 4Q6IA 4U1HA 1GKEA 1MFNA 1HILA 3ABLB 3WS3B 3CX5J 2ZF9A 3A6CH 2VIRB 3RGVB 4TLTA 3OKKB 3ELQA 1EEZB 5CNHA 3U2SA 2MPAL 3AMLA 3ZT5A 2PF6A 2QHLA 2R39A 3GSQA 4LEXH 4HW6A 1JS4A 1HKLL 1G7MA 1KCUH 1R75A 1LWRA 5KSAD 2DQUL 1XGUB 2KT6A 5ELIA 1F41A 4G11A 1XDTT 5KEZA 2D3VA 1EZVY 3QR1A 5T1JA 1MQKH 2RMNA 5BV7L 2ZOKB 2CGYA 4TVUA 3GMOA 1MHHB 2UX6A 4Q14A 1UH3A 3CHPA 3QZNA 1SYVB 1DLHB 1G9MC 1QPPA 2N0KA 2NY5C 4EI5B 5JW4R 2YMOA 4W68A 4PJGB 4KNSA 2CQVA 2XJKA 4P3CH 4XPAH 1CBVH 3SBWA 1A5FL 1QSED 1WFIA 2QGCA 4YXLH 1QSEA 3FQRB 5HHVH 4C54A 1AKPA 2B8OT 3KH4A 1IV8A 2H3XC 2NSQA 4QPEA 4UM8A 1J12A 4F80A 4JDTL 3UZEC 5DVPA 2BWDA 1IC5L 3CD4A 1USZA 4ELMB 3A4DA 2Q3XA 4BUQA 2MHAB 2Y25A 2ZG3A 1L0QA 3DK2A 2BWIA 3K1KC 2VDNH 3LSOA 3ZTDC 3HMWH 3VVVA 5I1EH 3NJVA 2H32A 3MAWA 1QI5A 4LQFL 2DLIA 3GKZA 1WHPA 3LMJL 3EYSH 4TPRH 3P3UA 3QJOA 1Z9SA 4NQDB 1GYVA 2APFA 2N0MA 4F33A 3O9WC 4Y9CA 5JNYA 2VDMH 4XP1L 4D0DA 4ZODA 2DLFL 1GGCH 2HFEA 4NKIL 1T0MB 4FXGA 4N4YB 1XCQB 2G5RA 4C56D 3GF8A 4XE0A 1PBYA 1XSKA 2P48B 3TBWB 4YNYA 1OCRB 1MJJB 2E86A 4PLKC 5C86A 5F7MC 4LLYA 3K4AA 1NGYB 4XE5B 1A3LH 3KPPB 3VXSE 4XCNA 3RILA 2W94A 2C1PA 2FE0A 4ZW7A 3TU6A 2YSSA 1Z9OA 2IQ9H 3TO4C 2BHZA 1MZYA 4JO3H 1GSKA 1CDYA 4BV1A 3PQYD 4H8VA 3LCYA 3QQDA 2I5YH 3MGOA 5E8DH 3P3RA 2VDKL 3PQYA 2KZKA 3BDYL 2Y1ZA 3MZTA 2AK4E 4JKLA 4Y9EA 5L2KE 4WEEA 4YAQB 3ML8A 4LP8A 1BQUA 1A1OA 4X98B 5B8CB 2R9HD 3AT8A 2BNRE 4X4YB 2VXVL 4HT1L 5D7SL 1XBRA 4PHZA 1XH3B 2ITCB 4YZFF 1J5CA 2VW7A 4KNTA 1HXMA 1L9RA 3O3DA 3NK4A 1TQVA 4AM0B 1IAKB 4XHQA 3RFZB 3C9NB 4CSPA 3A6CL 4G71B 4P0DA 5CBEB 3NIFF 3TWYA 3QR2A 4B60A 5CIPB 4HS6B 1M1XB 1YNKH 4G8FB 4LEXL 4X6CA 5LN4A 1KCUL 3WKYA 4PBVC 4HEPG 2EIJB 1ZVSA 2EZ0D 5KSBF 2LLNA 2V2TB 2VSDA 2X9XA 3A4AA 3P9LB 1CXLA 2IANA 1MQKL 4HIJA 3VM7A 4K71C 1QO3B 4WFEE 5K33A 3CDCA 4TNVF 2XXFA 3P4NB 4KXCA 1LK2A 5E8OA 4CL7A 4AUUA 3ULUC 1WC7B 2OYMA 3GM0A 3OXRB 2RH0A 5MEPB 1EUTA 3FT4B 4RRPA 4N0CD 2AERT 5JOEA 4F7CA 2PPEA 4K4KA 3MO1A 4WENB 5FGSA 3AUVA 4Z7OF 2AVFA 2JKTM 4P3CL 4XPAL 3A22A 3BWUC 3GM8A 2ZSVB 1CBVL 1CG9B 4IKKA 2CLVB 1KTCA 1NUGA 2YJQA 2C8NA 2FWLB 4YXLL 1RCYA 2YFOA 5IP4A 3A23A 3QWNA 5HHVL 1A6UH 2EDQA 1DFBH 4G8GD 4BSVA 1U93B 3QWQB 4WUKH 3B8YA 4GMSH 3KLQA 3ARGB 4G8GA 4IMLB 3H0TB 3ME0A 2GQHA 2VDNL 3HMWL 5I1EL 3V0AC 1BZ9A 1TU2B 4TPRL 3WN5B 3EYSL 2F5BH 3IDUA 5C97A 5DMKB 4G6KH 4MNQD 3RGHA 4B3VA 1QRNE 2VDML 1KXVC 1DP0A 4FA8A 4I48B 2CO6A 4MNQA 1GGCL 3LH2H 5L4IA 2QTVA 2FX9H 4Z3HA 3L5HA 5C70A 2BFVH 4RAUB 2IGFH 3C08H 2WZPD 2E8ZA 1H8NA 2FBJH 3ETTA 1D9KB 3INUH 2IMMA 4POZD 4FQ1H 3MJWA 2NW2B 2K6WA 3PS6A 4LCCA 4XO8A 3RWFB 4KQ0A 1A3LL 1W72A 2HAZA 1I7UA 4KKLD 1AO7E 5CSZA 3BN9C 3F7VA 1HE8A 2IQ9L 2NXYD 4R0LC 2J44A 4OSUL 2I5YL 5E8DL 4HDIB 1UJ3A 3N2JA 3L2NA 4DKAA 4KZCA 2D2CC 1NCBH 2HKFH 3FL7A 2HVJA 1E9QB 2UXTA 3F01A 4IRJA 4K73A 2ADJB 3QYNA 2KYIA 3FB6B 3REVA 4HMCA 1E8XA 4WW2B 2ZXWB 4TLSA 4DPAX 5A2LH 3CGTA 4LLDA 1BF8A 5I8EB 4AQ1C 5F7KC 1BLNB 4LKCB 4ZMOA 3CCHA 2X2JA 3LKNB 5DFVC 1SJMA 1YA5A 3DJSA 2QQQA 3VXUE 3FB7A 2OYLA 3ZKSD 4P2OD 1IZKA 5KN5B 2X09A 4FQPA 4FFYH 4X2UA 4P2OA 4PGBA 3QZBA 1OAQH 2CG9X 3IDJB 3SY6A 3O8XC 1PTZA 1EEQA 1EV2E 1QFWM 5GS1B 4A2HA 1GS6X 1M9WA 1YNKL 3U0WH 2E7LC 3VXMB 1SFDA 5EBWA 5CZXD 4D7PA 3V0VB 3U83A 1L3WA 2D0HA 3KYNB 3L95A 4DTGH 1A4KB 1TCRA 2WXGA 2XV0A 4XAKD 3BWZA 4N5UA 1BW8A 3Q0HA 2OSLB 5EBMA 1X4YA 1XR8B 2YD7A 5GS0C 4DVRH 4P3DA 1UVQA 3OLGA 4MX7A 4WV1B 4JQXA 3DECA 3EBGA 3T2LA 4PJDE 1OD9A 2X2HA 2BNQD 4E9XA 2B2XH 3O4OC 1AXSA 2A99A 3OR6B 3QDGD 3GSRA 3LN9A 1CD1A 4MHHG 1KNOA 4KROB 2C9QA 5FDYA 3VDBA 3FCSB 1GZHC 1NAMA 4JRLA 1KG0A 1A6UL 1DFBL 4LVHC 3L2LA 4OGAD 5D6DC 3HC0B 4WUKL 3E2HC 4GMSL 4ZW6A 3FYEB 1CU4H 3HUJA 2IOOA 5C7XH 4PWHA 1V7NH 1D6EA 5DLLA 3BIKB 3S6CA 1M7IB 4U1LB 1AQMA 1U8KA 4UNIA 4MB1A 1S7UB 2F5BL 2PMZA 2NY0C 5E94B 4PRDB 2XTJE 4G6KL 1P1ZA 4LLUB 2HG5B 1C12A 3UBGA 3A21A 3AB0C 3LH2L 3E3QC 4OJCA 2ZWKA 2FX9L 5TTRA 3GLDA 2BFVL 2IGFL 2BC4A 3C08L 1N2RB 4EZLA 3EO1B 2FBJL 1XCTB 2E46A 3INUL 4NAMA 4LPTA 4FQ1L 1D5RA 4KXAA 1EMTH 1I8KB 3UH8A 4GYBA 3ZHNA 1FFNA 1CFMA 2HX9A 1MCOH 4JANB 1LJMA 4KHTH 5T1LB 3X13A 1AXIB 2RJMA 3FTZA 2VLJD 4XN7A 4FQHB 4TKWA 2KLRA 2FZ3B 5F7HA 5EC1B 2WTOA 1BX2A 4K8RD 4KVNL 2VLJA 5AKRA 3G08B 5F7AA 2UZIH 5ALCH 3U25A 1OCZB 2JCCE 3BH9A 3H56A 1NCBL 2HKFL 4BJLA 5AYQA 1QSFE 1EZUA 2JKWA 3VFRA 4PGDA 2GBVA 1IBHA 4UV4H 3VFVB 4K0OA 2HN7A 2ZOWA 5EEZA 1CE6B 2DEWX 1BJ1J 2XX0A 4GSUA 2P24B 4CKVX 4UOW0 1J05B 3K2MC 2ZNXA 3CVHB 1C9SA 3L7EB 1JBJA 2HLEB 3RUGB 3LS4H 3MPCA 4L1DA 3V5HA 2W65B 4WFHE 3BZFA 4FQXC 2DWEA 4FFYL 2Y7NA 3D12B 4XCEB 4CVXB 1AGEB 4OLWH 1OAQL 3R4RA 3WG7B 2CBMA 2IG2H 3B9KC 3VX1A 3VD4A 3IN0A 3U0WL 1MPAH 1UASA 4N2GA 1FCGA 4GKSB 4N8PA 4XT1C 1BP3B 5J6GA 4ZS7H 2O6FA 1DQJA 5T8IA 5CJXA 5K9JH 1UM4H 3LRHA 1JHLH 4M5YH 2EDOA 4Y2DB 3WFEH 3PWLA 4BCZA 1QFOA 5IMMA 4DTGL 5JUEH 1LEIA 2WY3B 2XQYK 1FYTD 1FAIH 4PGCB 1T5XB 5HVWA 5I1LA 3GRGA 1N68A 1ZHKB 2AK1H 3T0AA 5IIEA 5DK0B 5HVFB 5HGAB 4DVRL 3BZ4B 4P9MH 2ID5A 3DVNA 1M56B 4Z23A 2CBOA 4B97A 4XVUD 2V9UA 3FFCB 1IC7H 1KB5H 1LWJA 3QULA 3ZR5A 1ET5A 3FO1A 2B2XL 2CDEB 3UBXG 3C8KA 3O6FB 3DV6A 4MCNA 4OCNC 5TK4A 4AQEB 3RL2B 4L3AA 3V52H 4AWJC 4ZFQA 5H35B 1BXAA 3D3VE 1ZLUH 5BOJA 1XIWB 3EJUA 4X6EB 3GSXA 1IMHC 3HS0B 1CU4L 2EDYA 3OKMB 5C7XL 1K5NA 1KGIA 4AT6A 1V7NL 2XXMB 5JHDD 3KLKA 4KGJA 4U1JA 2PPAA 5I1DB 5CCGE 4G8EA 3RKPA 4J3OH 2ZJSH 4PD4J 3ABZA 3D85A 4PV9B 4RMVA 3OR7B 5E00A 2NZIA 3BVDB 2R0WH 1YEIH 3QFGA 3QUXA 1D7CA 1ZXKA 3RIKA 2BSRA 5AW0B 1DJYA 1P9MA 4QXTB 4HEMA 4HV8A 3ZHLA 5AVSB 4PREB 1TQBC 4LCWB 3WTTA 4H26A 2OYPA 5FA3B 4NQTA 3OKEA 2ZWYA 2K7PA 3HRZA 4IBUA 2IWGA 3MRBB 2Q87A 1EMTL 2OX5B 4ZTOH 5FC9A 3UTPD 2H6PA 3ZDZE 5MEQA 1MCOL 3CC5B 3SJVE 4KHTL 1MFUA 4G70B 5DC9B 3RHWF 4YLQT 1CQKA 4NN6B 1ZGLA 1JXJA 1AR1C 1OCOB 4GSXA 1PNCA 1U8MA 2E6QA 2UZIL 3ECWA 1BFOA 2A9BA 4RETB 3OG6B 4X4KA 5ALCL 3WO4C 1WCBA 5I71B 3GBLA 3MOBH 5HPMB 3SPHA 4NRYA 1VJSA 1OOAA 3ERXA 4UV4L 3CDGB 4OFKA 3ZYZA 3UJTH 1EAPB 1TLMA 1OTSC 2GEEA 2IXQA 3PCYA 5E4AA 3FW6A 4HJ1A 2OMUB 2O5XH 2WUBH 1X3DA 1OV8A 1GGUA 3HLAB 3R18A 1OT2A 1GCYA 3LS4L 1Q90A 3D0LA 4WNQB 1Q1PA 1CZ8H 5GRXG 5ITFB 1GJWA 3V6ZA 4NOBA 2ADGB 4OLWL 3DX7A 3MLWH 3N9GH 1NPUA 1BZ7A 2IG2L 4BH8A 3V4PA 5IFAH 4UZSA 1MPAL 1IVLA 3TBCA 4WVRA 4HUNB 4ZS7L 3BUTA 4NQCE 3O2VH 1RV6X 5K9JL 1UM4L 3QIBB 3R1GH 1JHLL 2BSTA 4M5YL 2FWOB 5FYJU 4QLWA 2X4QB 4WHTA 3WFEL 3ZHKA 2BWQA 5JUEL 5LDSA 1FAIL 1BVZA 2P4AB 5D71H 1FDLH 2AK1L 2EC9T 5DQDH 5CJBA 4P9ML 3RDTB 2XCMC 2P5WA 4HJ0D 1GYUA 1BVKA 1JPST 3DO7B 3DMMB 2AGJH 3O2WH 1AY1H 1WLHA 3EO9H 1KB5L 1IC7L 1V55B 3AJ7A 1KJ2H 4L0PB 1TNMA 3ZW3A 4B9CA 3VD5A 5HHPA 3PXLA 5IVXB 2FBOJ 1SDDA 1RHHB 2TAAA 2ZKHH 2CKBA 4WTZA 3W38A 1L6ZA 1I1AD 3OMNB 4Y8AA 2X6VA 3JVGC 1XXDC 4FERA 1F02I 3HVNA 4PS8A 5MI0B 1XGQA 4F27A 1D5XA 3FHAA 4AV0A 2ZAIA 3GKWH 2VQUA 3IS0X 1FFOA 3LQAC 3D08A 4NFDA 3V9CA 3U2IA 2VR5A 4L2LA 1H5BB 5I6NA 3T3PF 4AIZB 1NOAA 2XWZA 2ZJSL 3VFWA 3ORJA 5B39A 1AG0A 2R0WL 4MJID 2NUTA 2J43A 1PD6A 1RUAH 1K4DA 4P4KC 3M1BB 1WH0A 1U2CA 2MPVA 4JO4H 3ATEA 4EXKA 2W88A 3ARZA 5I0ZA 1T0NA 1Z1WA 5I23A 3QVAA 4GXFA 3SGEH 1VCBC 2M83A 3N1GC 1M71B 2HB0A 3QDME 3I02A 4UTCA 2VLME 2P44B 1G7JB 4ZTOL 3PWJA 4HPHA 4G7RB 1GAFH 1EHXA 1GYWA 4J4PC 3K8MA 5AQ0A 1DDHA 1IQDA 3MUHL 3R19A 3W39B 5F7NC 5GRVL 2RQEA 4PJ7A 4JX0A 2K3HA 3LEYH 4CAGA 4J27A 3MOBL 3IDMA 2XBZA 3CFTA 3O4LA 5JPNC 1XMWA 1DBBL 1HHHB 1LEKB 4PVMA 3UJTL 4L9LC 2CRYA 2VRKA 2VR8A 2EIEA 2O5XL 4RGOH 5AVYB 5D7LA 5SX5H 3WIHA 1HCYA 2OTWA 5GS2D 2L0DA 4C59B 2P8LA 1A2YB 1HYRC 3KLLA 1LWHA 5IWLC 1CZ8L 1U36A 3N3EA 1MRCH 3VD3A 3PNWB 3MRLA 2YUZA 3ARFC 3TBTA 1OAUH 2QSCH 1VENA 5ACZA 1OKEA 3HG1D 3KW8A 1JPTH 2HT4C 3MLWL 3N9GL 3QCTH 4X7TA 4FAAB 5IUSA 5M95B 3HG1A 5IFAL 4S2SA 5FKAB 3X2QB 1QI3A 1DSFH 2VMJA 3WEXA 1KGCE 5CZKA 3O2VL 3R1GL 1SF3A 1L6PA 4Z5RA 3ZXAC 1JZJA 2XKNA 4CBPA 1T66D 1KBBA 3CLEH 4M4RB 1A7RH 8FABA 5D71L 2VWEC 1NEZB 4Q97A 1NGZA 4KZEH 1FDLL 1D3CA 5GS3A 3TZVC 1SYSB 3V4VA 4L3EA 1DQDH 3ULSB 3OM3B 4JRYA 1LQBC 4ZQKA 5JZ7C 1PDKB 4GQPH 5E9DA 2OMZA 4XHJD 4P2YA 4MCZB 4X5XA 3O2WL 2AGJL 1UA7A 4P5MB 2VLKE 4IOIA 1AY1L 3EO9L 2AC0A 2J1KA 1KJ2L 2J56A 3GPSA 3SSGA 3IF1B 5C0AA 3GXFA 1YQVH 4ABWA 2ZKHL 1NGPL 1OCWH 2UZXB 3UROR 5IJKA 1GZPB 1DVFC 4N8VA 2UZYA 5HHOB 4KFZC 2FX7H 4O4YH 4OD2A 3GKWL 3PXJA 1JNNH 4FA7B 1S7SA 1OF2A 4F7MA 1BAFH 4N0UE 4N68A 4Y16A 4AYMC 3MN8A 1KBVA 3BD3A 4FJ6A 4JFED 3OHXB 3FFDA 4JFEA 1RUAL 3T9WA 3U0PB 3WGUB 1ICTA 1I4FB 4YJZL 4JO4L 3S4SA 3RI5F 2N01B 2YOAA 2CHXA 1E8YA 1IC1A 1DR9A 5JW5B 3CHXA 3ZZQA 1Y1DA 5BQ7A 1MHEB 1CLCA 2IALA 4XNMB 4B0MB 2W92A 4FCAA 4L37B 3BSZH 1K8IA 2VDRH 1GAFL 4FTVE 1ZT4B 5DD3H 5CGBA 4FTDA 3U6RA 2RALA 3BISA 2H8PB 2ZF8A 3Q5YA 2Q20A 4YBQC 1TIUA 4PJEB 3B7TA 3GQFA 3HC4H 4JO5A 1WYJA 1CGWA 3LEYL 2FNBA 5TDPA 3LZOA 3M07A 1R3KB 3RPIB 3MYZA 5HJ3A 5HDBE 3WMPA 1ORQB 3K5RA 1XX9C 1JMZA 4W6WB 3SYPA 1ZA3A 4L29A 4OZGB 1Z5HA 5IJVA 4ZSOE 4EUPB 3OSKA 3SGEI 1BVOA 4RGOL 1J87A 3RLSA 1HCVA 4G6FB 3TOPA 1KPRA 1TJMA 4KVCH 5HDLA 3UTTB 1XHHA 4KX9A 4U1SA 2OKMA 1MRCL 1RUKH 1YUHB 4LSQH 3VFNB 1MRDH 1WFNA 4WWOA 5IBUB 1OAUL 1V8HA 2QSCL 3BPCB 4NUGH 1JPTL 3QCTL 2VM4A 1DJZA 3BI9X 3C5ZC 2OL3B 3EADA 5I8CA 4IJ3C 5KVEE 5GGVY 2VLRA 1AD0A 1DSFL 1I9RH 2QMJA 2YQ3A 3CV5A 4V1DB 1GY2A 2J8UA 2WCGA 3IJ8A 4NUJB 3FK3A 5HGHB 3HE6A 4NQUA 3HTLX 3PDDA 1KIPA 2IADA 4QOKB 3CLEL 4BIKA 1A7RL 4WNSA 5BRZE 2QGBA 1MIMH 2X53A 4OUUB 5DS8A 5AFAA 4KZEL 1IEAB 4PV8B 1DQDL 3VFUB 5MHSE 1KCVH 3NMEA 4PEEA 3WUWA 5HJDA 4UYQA 4GEJA 3IAGC 2NZ9C 5J89A 1S7WA 3MRDB 2PR9A 3LRSA 4AV4A 3QRGH 4E41B 1UZ6E 1YQVL 4LBEB 3RFRA 1OCWL 1V27A 4LEEA 2WQVA 3VVWA 5I1IH 3DVGA 2Z8VC 4E9YA 2P8PB 5BCAA 2A9AA 1NKOA 4QRPE 4XMKH 2FX7L 4O4YL 2O5NA 3V0IA 1JGDA 5HGBA 2WWKT 4WI4A 4I0CC 1OT4A 1BIIB 2HRLA 1B2WH 4AEHH 1JNNL 3PPEA 1N67A 4R4BB 4ESKA 1P5UB 1BAFL 2CWRA 4L1SA 3W1ZA 1FGNL 1IGJA 3GJEA 4AQ8A 3Q2VA 3RNQA 3RIAF 5CUSH 2Q7AA 1A1NA 2Y07H 5F7FA 1VFUA 3S5LA 2EDNA 3M46A 1HS6A 4FG0A 4OZHA 5CD5D 3MBEC 3ZKND 3EF4A 3US0A 1YMMB 4M4PA 4U1NB 4PI0A 1RKRA 2BXZA 2CALA 1PGRB 3C09C 4G6AD 4X0NA 5JOFA 3NVQA 4PUBH 2A73A 3O11B 3RVVD 4U4BA 3VWKC 1T3FA 3ARXA 3O9WB 4LL9A 3AU1B 2OMNA 5GRJH 3BSZL 2NRDA 2HT3C 4X6DB 3QQNA 4YFLF 1NCNA 2VDRL 3TA3B 4N1EA 2B1OA 5FB8B 3IDGB 5DD3L 7CGTA 4U7MA 3LKQA 2A6JA 1G94A 2XG4A 2ZX5A 3HC4L 4BDVB 3JV0A 3TT1H 3EYFB 4U3SA 2LGNA 3VJ6B 3GSVB 5T1MB 3BRGC 2GY7B 2H4EA 2NX5D 3I6LD 4N1CA 5E6UB 5DEZA 1ZHLA 2KQNA 2V9TA 1TYEB 2JLLA 1BQHA 1ZK9A 3DXAD 5CN1A 2GTWA 5DXWA 3DXAA 4N8UA 4LFHD 4ZTPH 5H37H 4KVCL 2HX7A 2ICWA 2VN3A 5C07B 2QADC 1AH1A 1RUKL 2EJ1A 4LSQL 4MD4B 1MRDL 4B0MM 5JW3H 3UG4A 1BYNA 3KEHA 4NUGL 1EH9A 1ZSHA 3QJHB 1NICA 3B3IA 4P4RB 2JIXD 3F5WB 3K7UA 1S6NA 4YE4H 1IFHH 3ARBD 2EKSB 2YRZA 2C3HA 2V9QA 4X4ZA 2JIXA 3P0GB 1I9RL 3EJTA 2JJSA 2ATKA 5IEHA 1JZHA 5A2BA 5I30H 5AW6B 1PMYA 4QYOA 4PJ9B 3QG6A 3VMNA 4EUPG 1LE5B 1HKFA 2C4FU 4RH4A 2MEJB 1DJIA 2JE8A 1MIML 2XQYG 3NFNB 2F08A 2CNYA 3QEUB 4M9PA 2QQNH 1KCVL 5EZJB 2DPKA 1KT2B 5HVGB 5EWIH 5IBUG 5TE7H 5D1ZB 4R2GC 1CYWA 4K71B 2DL9A 4XPTH 3TYFA 5E8PB 4BWUA 1ZDQA 2WSKA 1FNGA 3QRGL 2C1OB 1Y18A 3JV4A 5AW3B 3V6OE 2H0FA 3NFSH 1ONQB 2NR6C 1TZHA 1IRAY 1FG2B 2PWFA 2H5UA 1ZWIA 1S78C 5EU4A 1FL5B 3S48A 3FBKA 3Q3GA 3MV8B 4XMKL 4EZMA 2F54E 5T5FL 2IBZY 2JCCF 4AEHL 1B2WL 1MCCA 2V37A 2JVUA 4OVVA 3EJCA 4G9DB 2X38A 1Z9MA 3ARTA 4LPXA 5IMOA 3EJZD 3GZPA 3S9DB 1OGTB 4LNRA 1WAAE 4AZ8A 3BVWA 3KGSA 4E42A 1CF8H 2EXWC 3RZCC 5JPMB 1SXNA 5CUSL 2GSIB 2Y07L 3IAPA 1WAEA 2X41A 1NFDA 4HIXH 1TETH 2G4GA 5JIHA 1S7RB 4BHUI 3FO9B 1AC6A 1PZDA 4O2CA 3NA4A 4Y4HA 4PUBL 1AHKA 1Q0EA 2EDJA 4WHYG 3H1ZA 3ZL4H 1E30A 5HYJB 1TJGH 5GRJL 3QWRD 4HMDA 3CZFB 3BH8B 5AVUB 2WWMC 1PX8A 2C7UA 2H0PA 4FI8A 4UQ2B 1AIFB 4H4NA 3D87B 4HVBA 5I8OH 4YC2C 4B5EA 1INQA 4G7SB 2CCWA 3DRQA 3B34A 1RZKC 4NLAA 5TH2A 3TT1L 5DEGB 1YY8B 2WBWB 3QXDA 4Z7VA 4N3UA 3OF6A 3X14B 5I6PA 1FL3A 1AZRA 4WDIB 5LGJB 4F7EA 3DV4B 2H32H 4IRSC 5BUGA 2AXGA 2EIDA 1E8ZA 2XNAA 5EG6C 1BREA 5E56A 3ZZ1A 5JORA 4N9GA 4ZTPL 6PCYA 2EO7A 1YAIA 4QNPE 5EBLB 5IF0A 4C4KT 5JW3L 2PO6D 2IBBA 4ZQTA 1SZNA 4WK0B 2VSMB 1T1WA 1NCWH 4KKAD 4AQ1B 4F8LA 4YE4L 2VRQA 4RMTA 1IFHL 1H8LA 4K15A 4WSJA 1JHTB 2ZP9A 3W0WE 3GINA 4QEGA 3BKMH 5I30L 5AB9A 1UB6B 2W07B 2PYFB 4HEPA 4W9DC 4AC2A 3I74A 2AAVA 2PXYA 5FOBA 4D0CB 2C3GA 1D5BA 3WIIH 1EEYA 2R56H 3B83A 5E23A 5LBVA 2F7OA 4GO9A 2FQDA 1ZV5A 3EGSA 2V33A 4X9HA 1U95B 3FQXA 4AKPA 3G6JB 1GYAA 2X89D 1U8NA 5TE7L 1JP5A 4KTEH 5CP7A 3WS3A 4XPTL 2BW5A 3BLKA 3R7RA 2VIRA 3RGVA 2DLHA 3FSZA 3OKKA 1EEZA 3CBKB 2YPLD 4CN6A 1RSYA 3NFSL 3ZDZF 1RFDH 4K2UH 1HK6A 3KYOA 5ICXB 5DRNB 4ZNEE 4RFOH 3TPUB 1UD8A 4Y88A 1XGUA 3MCKA 2HKAA 1TLKA 2AMGA 1W16A 4UQAA 3OWEA 5CZVH 2ZOKA 4Q6YA 2A6DB 3BSGA 5C2BH 4GKOA 5AB2A 3B9EA 1MHHA 3F7QA 3WFHB 2WB7A 3QUKB 1SYVA 2OMXB 3CJJA 2RBLA 4FHKA 4KPHH 4EI5A 3STLB 1J5OH 3CX5K 3E2HB 2VZ1A 4ZD3H 2OA9A 4PJGA 4HIXL 1TETL 5KYYB 5FWRA 4HF5H 2C9SA 5I2IB 5JIMA 2NY0B 5DD5H 4G7QB 3ZL4L 2WQSA 3FQRA 3NA9L 1TJGL 2ZXEB 5BW7C 3AB0B 1JI1A 3VXSD 2EYSB 4BKTC 4TN9A 4QRTA 4G72B 5I8OL 2VDPB 1Q72H 1W0VB 1N0LB 3SDXB 2ESVD 3QNXB 1ODAA 4QIRA 2WN2A 5IW1B 3IPEA 1PAZA 1TTRA 4NQDA 4NFBA 1ZVNA 2B15A 4PW3A 2YPKB 1Q0YL 2CJ3A 2ROXA 2FHFA 2EH8L 4M6NH 5LBSA 2EEAA 5KVMC 4G6JH 1XCQA 15C8H 3BP7B 3VWJD 4HUMB 3QYCA 2R1YA 5E4IA 1DN0B 5DWUH 3TBWA 3O2DA 1N64H 3U4KA 2GSGB 2AXJA 3G5XB 5KANG 1EJOH 3KPPA 4XZ4A 4AKQA 3T2QA 4FLHA 4PFEA 1Y7VA 1O6VA 1BPVA 1NCWL 4JBSA 2QR0B 3VXRB 4NQVB 1DVXA 1PZ2A 3AS2A 5LUMA 1QTPA 1W72H 2EUZA 4FEMA 3I84A 4HKXA 1F6FB 4M1DH 4DEPC 2E9BA 2DEXX 4R4NC 1ZGLP 3BKML 3D39D 4QRQB 1PZUB 3CNKA 3V4LA 5A7EA 2D7MA 3CFEA 4PRIE 4R5VA 4OV6F 5CKGA 4YHLH 4YAQA 3WIIL 1TSRA 3B9KB 1L0YA 2W9DH 2R56L 1MI5B 5B8CA 1TYRA 2NY1D 4X4YA 5CEZE 3MRQA 4PJIB 1KTJA 1XH3A 2ITCA 2YK1H 4JY4A 5FCSH 3CN0A 3E0GA 3V9FA 5FO8B 4F15B 5T1KD 4KTEL 4RSVA 2ZICA 3RFZA 3C9NA 3L4XA 2WBJC 4MTMA 3FTWA 5CBEA 4JO2H 4M1CD 2BIPA 2IAAC 5SX4H 3V10A 3KPNB 4HS6A 5CIPA 1M1XA 4MNGB 3RTQD 4G8FA 1UZ8B 4K2UL 3T4AC 4AW4A 2CLRA 5I6MA 5IW6A 4YFDB 4RFOL 2CE6A 3GLAA 3VGDA 1VB9A 5DJDB 4XOAA 1N59B 2JTYA 2YS4A 5F1IB 1A9BB 9PCYA 1GPOH 1OOWA 3P9LA 3OB0H 5CZVL 3FQTB 5EU3B 3MLRH 1QO3A 2HH0H 3AU0A 4BFJA 1FORL 5C2BL 4HULB 3CZSA 5JIQA 3OXRA 3M8OH 4KPHL 5MEPA 1J5OL 3FT4A 3IKCB 4CVZB 4OBRA 3VSQA 3AVEA 4ZD3L 2V8LA 2ZWSA 4OFQA 1QRND 4IGBC 1NZRA 2W5PA 1VADB 1CG9A 4HF5L 5JTWA 5IVZB 2DLGA 5DD5L 2O6PA 4HK3N 1S46A 3WY4A 3IJHB 3FQ1A 5FO2A 4Z7NE 2B7DT 2VJ0A 3K2IA 3NCMA 1NLDH 1U93A 4XP9L 1JVKA 3MRCB 3S3DB 5C0BB 3ARGA 1AO7D 2HP4A 4AEIH 1NAMH 4IMLA 3H0TA 5C71A 2Z6FA 3OAYH 1Q72L 3NIGE 4WI0B 4DWHA 3KYMA 5CJ5A 2Z8RA 5B1AB 1TU2A 2MKLC 4FLOA 2J2ZA 3O6MH 3WN5A 5KJ7E 4QAMB 4PLNC 2EADA 3ETSA 1JDDA 4ZO6A 2Y7SA 4I48A 1P1VA 4M6NL 1AR1B 2UX7A 4XXDA 4HKZB 3UTOA 5F7LB 4G6JL 15C8L 2ZX6A 4OLZH 2CCVA 1MH5B 2Z7WA 5DWUL 4J3WA 2MIZA 3DX3A 3LPWA 1N64L 4I0KA 4XX5A 2ICEC 3APMA 3BVTA 1EJOL 2IIJA 3VD9A 2O72A 1F6AB 1BAGA 4FI7A 5T1DH 3P2BA 3SGKC 1QASA 4LE8A 1W72L 3GIVB 3UMTA 1QLEB 3N1PC 4JFDD 4M1DL 4HDIA 5F1NB 4Z0BH 1A3ZA 2BOLA 4JFDA 4DFHA 2OW7A 4YHLL 3PY9A 1MCEA 3H3PL 4K94C 2W9DL 1RJLB 2DYPD 3FB6A 4K8RH 2Y23A 4WW2A 4XNBA 1W6WA 3HPLA 4JJ5B 4YVNA 3R8QA 2YK1L 4PG2A 4K7FA 1BLNA 3PWPE 2XQ0A 4LKCA 3L6FA 3LKNA 4ADIA 1YEJH 3ZK0A 3JUYA 5KN5A 2WVVA 2LU4A 4MB4A 1HT6A 4KY1H 3M1OA 4H7VA 4ABVA 3BW9B 4YDJB 3IDJA 4JO2L 1S8DB 5GS1A 4OV5A 4PLOB 3ZYJA 3UBXA 1MZZA 3VXMA 1CIUA 4JCLA 1JPFB 3JWNC 3V0VA 5LAPA 2OI9C 3K6DA 4EN2A 3SD5A 1GPOL 4KFMA 3KJ6H 4G9FE 3KWWB 1A4KA 2HH0L 2QDWA 3MLRL 2VSKB 4Y5XC 4ZPTB 5DYFA 2FTAA 1IO4C 3ARSA 1NOFA 2OSLA 4AYFB 3M8OL 2DQFB 4JZOB 5DHVB 3QQ3B 4EN3D 2QVIA 1KCRH 1GJIA 4KI1A 1ILSA 4WV1A 1MIEH 3HC3H 2XZAH 1GTFA 4AOFA 1U8JB 4DK3A 2KBGA 3AWFA 5SX4I 3F62A 3MLUH 1PFOA 1QRKA 1QBMH 3OR6A 3FN9A 3WL9B 5HI5C 2XIIA 2A83B 3FCSA 3FZUD 4QHKJ 4G8AC 3MODH 3BN3B 4P4KB 2WLJA 2AK4B 5BJTB 4JKKA 4F8QA 1NLDL 5FYJH 5L2KB 4CNIB 5FXCH 4AEIL 1NAML 3WFBH 2OTUB 1L0PA 2BNRB 3WCYA 4AYID 1HVXA 2WXJA 3BIKA 1M7IA 5KVGH 2QPSA 4GJTB 3O6ML 2K9UA 4JGMA 3CN2A 3KPQA 5DSCA 4LLUA 2HG5A 4XCYA 3BYYA 5AYUH 5IHZB 2AQ2A 2AJ3A 4C8XA 1C8QA 1T83A 1TJHH 1Y07A 5DMYA 4Q9QH 2A0LD 1N2RA 3CU1A 3HEIB 4OLZL 4PM1A 1XCTA 1J8HB 3LH8A 4Z7WE 3F00A 4XPGH 3GUFA 5JPNB 1EHKB 4M5SA 5D72H 1EVTC 25C8H 4L9LB 1I8KA 2NNAB 1TPXC 3LIUA 4JANA 1B9KA 1W0YT 2NTSP 5T1DL 4A2FA 4FQHA 4CW1B 2FZ3A 4Y1SA 1SLWA 5G4NA 1XD1A 1PG7W 3G08A 3SIKA 5ECGA 5I5MA 3UAAA 3VGGA 3WLWC 4Z0BL 1A7QH 3E1ZA 1TVHB 3ARFB 4PR5B 5B4MC 3STZB 2YSTA 2BS8A 2FH6A 2MMXA 1QPXA 4K8RL 3VSUA 5ANME 2BOBB 2P24A 1TQTA 5GPRA 3AQYA 1J05A 2X1WL 3CVHA 4Q6IC 3L7EA 2PPFA 4WK4B 5JDSB 2Q3ZA 3RUGA 1YEJL 5DZAA 3NABH 4Z7QF 2YGQA 4F3FB 1GGIH 3H9SE 2W65A 4KY1L 4XCEA 4CVXA 1AGEA 1A7BA 2BVUA 3AGWA 3TZVB 4KXZH 5E5UB 4NB7A 2IH1B 3OC8A 1KCBA 1C5CH 1USQA 4WWKC 1CGVA 1H6UA 3D3VD 1EJ6A 5HI3C 5ANHA 1U3HC 3V4PH 5HYQB 3T1FB 2ORBL 2I24N 4Y2DA 4YL9A 3FQ4A 3UEQA 3KJ6L 3UERA 3P1VA 4PGCA 1T5XA 1YG9A 5C8JA 5LBGA 3OZLA 2BW4A 1ZHKA 5ISZB 3RVXD 1DVFB 5I0WA 3HG2A 3ISRA 5DK0A 1QPKA 3LOWA 5HY9A 4A63A 1P6AB 2XYBA 1JWSB 2E6JA 1K2DB 4LARH 4D8OA 4MMYB 1OLZA 3QQ4B 3UL4A 3GXIA 1MIEL 3HC3L 4Z7IA 2XZAL 3FFCA 3TPKA 1I8LC 4X7SH 3LZPA 4NN7C 1ZTXH 4R96B 3MLUL 2QKIB 1W8EA 5DUJA 2CDEA 3ZRFC 1QBML 1B2YA 2QSQA 3O6FA 3WHE0 3RL2A 1FVEB 2KQMA 1HC1A 4Y9BA 5H35A 4OLXH 1OD7A 2W1NA 1G7IB 1V3JA 1XIWA 3MODL 1FE8H 1UG9A 2G2PA 2DQHH 2VERN 2WVSA 3EJSA 3H9HB 5DUBA 5JO5B 5CR1A 3WJLA 5FYJL 3HS0A 1LQSR 3OMZA 4ZUUB 4U6TA 3WFBL 3DYMA 1CDGA 3OKMA 3SYAA 5IHBA 4CU8A 5I1DA 5KVGL 2WB1A 1YNTF 1Z9LA 1EFXB 1HL8A 3DOHA 4PV9A 3NJFA 3SEPA 3OR7A 3VXUB 4WHCA 5DR5H 4OZFG 2G5UA 3FN0H 4FZEH 2X4NB 4GRWF 3MKKA 4NQEB 3HZ3A 3S34H 5AYUL 3L5XH 4YHIB 4WRLA 3RJQB 4GRLC 1I75A 1TJHL 2JELH 3RPKA 4Q9QL 1AZCA 1TNNA 1OP9A 4PREA 4LCWA 1SJVA 3IYLW 4XPGL 3S35X 2WLMA 5FA3A 3L3HB 2YXMA 5D72L 1EANA 25C8L 3DX1A 2OX5A 3RWGB 3WLBB 3CC5A 2IGLA 3C75A 3MRPB 2WHVA 3ZDXF 1GC1C 1CYGA 2UY7B 1BFSA 1TF4A 4JPIB 5B7EA 2YD9A 3FOLB 4HISA 1A7QL 2VLLB 2MWCA 5HPMA 4UOJA 5AD0B 1CDUA 3DJZA 1MFDH 4BFOA 3CDGA 1TJIH 3VGBA 5FM5M 4UM9B 4PJDB 2VAAB 4UTAA 3C5ZB 4M7LH 1PJ9A 1F90H 2X0UA 3UBFA 3KBFA 2OMUA 5INDA 4HKJB 3IE4A 1TITA 5BOPA 4E5XB 5EF3A 1GGBH 1U3JA 3ZIYA 1XH2A 3NABL 4WNQA 2DS4A 5F71A 1GGIL 2EYTB 3ECUA 1C08B 4OLEA 5FGCB 3V2AR 2R4SH 2KUTA 2NY2D 5E0QA 3WIHH 3BWUF 2WW8A 1IKFH 1ANUA 2PPDA 2YKKA 4S11A 4Y1AE 1IARB 4PRHE 3QFJE 1T5WA 3EJPA 5A3ID 2N4IA 2ZG2A 4O2FA 1C5CL 1F4AA 2EILB 3IFNH 4TTDD 5F7WC 2IAMC 2Y2TA 1FFPB 4Y4FC 4YQXH 2L7EA 3QIBA 2XTJB 3V4PL 2EDEA 2FWOA 4GS7B 1UWXH 2X4QA 1H15B 1VHPA 3MDJA 4X8GA 3LAFA 1WWWX 4W4OC 3WI9A 1KBPA 3GHEL 3RDTD 4Z3FA 3FTXA 5CGYC 3VTTA 4Z3IA 3QJQB 2E4TA 1TO4A 3FCTA 3RDTA 4LARL 4PW9A 3VE0B 3DO7A 3DMMA 3T0WA 4KY2A 3V4VH 4N2NA 2FWSA 1QBLH 3EUUA 3L9YA 3MROB 3P77B 4KXZI 4X7SL 2F8XC 1ZTXL 2AXHA 2Y22A 4MFHA 4WU7B 1SBSH 3FTGB 1A6AB 3FC8A 3L8QA 3ZT6A 4KH2A 3AM8C 5IVXA 1RHHA 3EG9B 2XV6B 1JXGA 5EFIB 4OLXL 3T2PA 1QVOA 4IBTA 3VYPA 3HE7D 3Q2CA 4TNWK 1FE8L 3LNHA 1QSFB 2DQHL 1OP3K 2QZ5A 3CE1A 3MBEB 4PTUA 3GBMH 3C09B 3SPVB 1PZSA 3MLXH 2EEFA 3VI4F 3VWKB 5JYLA 3QAZC 4OFVA 3LIZL 5EEWA 1A9EB 4OJFH 1JE6A 2VE6B 3IU3B 2YHGA 5DR5L 3O0RH 2XN0A 1SXSA 2QVTA 3FN0L 4FZEL 4X4MA 3M1BA 5GQBA 1BBDH 3S34L 2X40A 3L5XL 2BIQA 4OFPA 4M7ZC 4UT9A 1AHMA 4NIYE 1CTNA 5F44A 4I5BB 4LCCC 3ZKQD 1M71A 5C0JB 4GFTB 2VDQH 4M6MH 1JGLH 4NNPH 3UTSE 3D30A 4HCGA 4L4VE 1TTAA 2VXQA 5D9SB 1WT5A 4GUQA 5BVJB 2YA1A 5B21A 3DHUA 3MRRB 1UJ3C 2FD6H 4LPCA 4MMZC 1T04B 2DAVA 3LB6D 1CGSH 2VR7A 5I17A 3G04B 5F1SA 1U58B 3OJMB 1P7QB 1JZ4A 2VC2H 5F96H 1MFDL 5DFAA 1LEKA 1EAOA 7FABL 4M7LL 4DKTA 3S97C 3T2NH 1F90L 1JK9B 3MUGB 3CSGA 5CKAA 4U2ZA 1N9PA 5EC2A 4XNAA 5J3HD 1GGBL 2LE9A 3N44B 3B1TA 1MLCB 2R4SL 3NAAH 3PNWA 1M2OA 3WIHL 3EFOA 1IKFL 3DGDA 4ICWA 5IB3B 5AAWA 4NXSA 3P9MB 4XPHH 1J8SA 5FKAA 3IFNL 3DYPA 3FHEA 2FR4B 2X1QA 1U2HA 3TJPA 3B2DC 4ETYA 2FO4B 2AV7B 4R2GB 1L5GB 1DJGA 4OY9A 4YQXL 3IPBA 1IT9H 1JIBA 1O9WA 1F3DH 5I5RA 5IEKB 5I19H 5DJXB 2WP3T 3BC9A 4M4RA 4XRCB 2GCYB 1MHPH 4G8IA 5DJ2B 1M2VA 4E5XG 2XN2A 4R7VA 3ULSA 2VW6A 4B3EA 3QUMA 4YDLB 2OYKA 1HU8A 3EYOB 3BQUD 1UEYA 2I85A 2YO3A 1UENA 4LSRH 4MCZA 3V4VL 4HUVB 4P5MA 1D5MA 4W6XB 4TNEA 1NKRA 1ED3B 1QBLL 5I1CH 3D2UD 3SJVB 6FABH 2VM3A 3ILQC 1HEZB 3WEBA 5KS9B 4P46C 1CFSB 1SBSL 2CMRH 3D2UA 4LRIC 2BP5M 5I0VA 2UZXA 4OF5A 5FO9A 3RZCB 1GH7A 2JJTA 5GGRB 1JXFA 3V6FB 4B9IA 2PABA 4ONFH 2P45B 5HHOA 2CHNA 4NXKA 1PS3A 1J1OH 1CE1H 5LDUA 3LNIA 5DO2D 1EJFA 4Y19E 5T5NG 3MLXL 1KY7A 4WGVB 1E6JH 2EDFA 1J5HA 3RPBA 1SLVA 1RUPL 2FJSA 3QCUH 4OJFL 3MV7D 5C0CE 5E5MA 2RQ8A 3OHXA 4FFVD 2VZTA 3O0RL 3V7AE 3ULAB 4LCVA 5KVFH 3U0PA 4HJJH 1BBDL 1BIHA 2PLTA 1I4FA 4YC2B 4KVPA 3RVUD 1VEOA 2XETA 4HPYH 4PV1C 5D7JC 2D0GA 1OF0A 2XN9D 4CA4A 5CZRA 4PYHA 5JW5A 1S4IA 2GTZB 2HWZH 1MHEA 4NZDA 1X4ZA 2XN9A 2VDQL 4M6ML 1SXZA 4NNPL 4L37A 4IRSB 1CXFA 4NQCB 4L5FH 2WKOA 4KK6D 5E1AB 3ZDYF 5JOPD 4IOFD 5F0MB 1RIUH 2DY2A 5D5MF 3DARA 5F7YC 2H8PA 2FD6L 2B9AA 4PJEA 2G30A 1A6PA 1CGSL 5SWSD 2DI8A 3RPIA 1Q9OB 1MCFA 3IFOA 1ORQA 2VC2L 1UH4A 4QD2E 5F96L 4EE2A 4R97B 2ZUTA 4OZGA 3T0ED 2ZYSA 2DIJA 4EUPA 2OULB 3T2NL 1MREH 3SDAB 5FUZH 2XQYA 3ULVF 4X5PA 4A6YA 1DQTA 4XB7A 3UTTA 1PPIA 1FVDB 3A24A 3DSNB 5AVXB 2HTKD 4UU9A 4Z18A 3JTBA 1MCHA 1YUHA 5DZ9A 2NMSA 3NAAL 2WNWA 3C6LD 4IIZA 2YRLA 5AZEH 3BPCA 4RGND 4Z3EA 3JTTB 3C6LA 2ZZUT 4QUOA 1KYUA 4XPHL 1AMYA 4FG6D 5SWZE 2OL3A 2AQ3A 3P73B 4ABUA 3NCFB 2QELA 1NCTA 4V1DA 3QEQE 3UZQB 1NINA 5HGHA 1IT9L 1ZIAA 4FZ8H 4PWKA 5I19L 2WXOA 1M05A 3L9RB 2IBZX 4QOKA 2OMYB 3IGUA 1MCRA 2B08A 4OUUA 1MHPL 3V6BR 4BUGA 1IEAA 2E9WA 4XR8C 4RBPH 1GKOA 3P4MB 1NANH 3SOTA 3QDMB 3TASA 5F3FA 4ZXBC 5K9OB 4LSRL 3EHBC 1FIEA 1T2QH 5I1CL 1SJEA 3AABA 5A6IA 4QHMB 5J1SC 2CMRL 3DKHA 3NJGA 4X9GA 4LBEA 1ECZA 4PY7B 4KZ0A 2X87A 3LNDA 1UM6H 1QWUA 2DQJH 2P8PA 1KWGA 4ONFL 4NBZB 1J1OL 5K59E 1CE1L 4LCYB 3L3IB 2X4PB 1MFEH 1BIIA 1M42A 5ADPH 1R3JA 4IBLT 5FYKU 2XYCA 5J06A 3AMKA 4R4BA 1E6JL 1G43A 1FH2A 2OMVB 4X6BB 5L0QC 1RJZB 4B53A 1NMCC 3QCUL 2A5UA 4PRPD 1BPLB 2H2SD 3N6YA 3UZEA 5I1KH 4GSRA 5IHHA 5TQ2H 2AJUH 2X0WA 4HJJL 3VFMB 5KVFL 5EOQH 3S3PA 4HPYL 2DM7A 5KYNA 1YMMA 2QVMA 4U1NA 3HHSB 3DHJA 2OQJB 4YDKL 1KY6A 1PCSA 1SRDA 1HCFX 2FEJA 2HWZL 3HRZC 3O11A 3AG3B 1FNAA 5EDSA 4GG6E 3W9EB 1BCIA 1NCJA 3O9WA 3AU1A 3DTXA 5ABDE 1QFPA 1EDQA 1SN0A 4L5FL 3NYKA 2DJ4A 4HGWB 4PPTA 1PSKH 4X6DA 3ZQ9A 4XWGH 5FB8A 2R69A 3IDGA 1OTTC 1RIUL 3GXPA 3QZOA 1CF1A 4PLKD 5C09E 4LZKA 3WEMA 4HFUH 4FI6A 4BDVA 1CD9B 3IWUA 4AX3A 2WYTA 3RB7A 3EDFA 3EYFA 5D70H 3VJ6A 3GSVA 5T1MA 1YVLA 3DROB 3TO4D 1JZ3A 4KJQD 1FNHA 1JOIA 1J0JA 2VLKB 4ECNA 4JREC 3TO4A 3BT0A 5T3XD 3S3CB 4JPVH 1MREL 3HCVB 1TEGA 5ECJE 2KZBA 3PE9A 4WFGE 5FUZL 4DEPB 2SEBB 3TVMC 1CICB 1UXWB 4IU2B 2PCFA 4PG9B 4RQQB 5E6ZA 1GL4B 5C07A 1KEGH 4EAEA 1WD9A 4MD4A 4OD3H 5JQHC 3BUQA 2D4FA 5AZEL 3TEXA 3WAKA 1FL6B 1KEMH 2YWZA 4P4RA 3DX4A 3F5WA 4X5QA 3VXOB 4N0UB 2WZ0A 3Q8FA 4PJBE 1DBJH 5DHMC 2WBJB 4FZ8L 1T1YB 3GEWB 2PPCA 3I9AA 4I9WE 1LE5A 1SEBB 3N40F 3WFZA 1I7ZB 1RPKA 5TGBB 3T4AB 2E7CA 3JV6B 2N7SA 4P49A 2H45A 3MCG1 4NZTH 3VGEA 3WY3A 1KT2A 4JHAH 1TQWA 3CZJA 1IQWH 4WO4D 1XF3B 1UD3A 3G3LA 3LKPA 1OTUD 5D1ZA 4BE5A 1EA9C 1ROCA 3ZZLA 4FTVB 5E8PA 3ULUD 1Q0XL 4HCFA 1TENA 4EDWH 3MRGB 4DP1X 4MLSA 1OWRM 2CBPA 3GC3A 2EABA 1FG2A 3MV8D 5F3BB 1UM6L 2DQJL 3HZVA 4XXWC 2FNWA 1FL5A 4DZBB 3MV8A 5HDBB 1TQUA 4OVUA 2J6EA 1JF6A 1MFEL 4ZOBA 4YOKA 3TH3T 4NBXB 5ADPL 2FECL 1CK0H 2ZWLT 4ZSOB 4G9DA 2FIKB 4ODBD 3T71A 3WNOA 1TVDA 1OGTA 1NANI 3B43A 3CFBB 5KVDH 5L8KB 4DAGH 4JRXB 3FSWA 5I1KL 1TXKA 1XF5B 1CFTB 2GSIA 1W91A 3QWOB 4H0LC 5TE6H 5TQ2L 2AJUL 2I32A 3F64A 2CM6A 2NPLX 1S7RA 4MD0B 1D7FA 1VKXB 4PJHB 1TUPA 4Y4KB 5D7IE 5A40E 1NCGA 3OG4B 4N28A 5HYJA 1KXVA 4J3UA 1JHKH 2GHWB 3IKKA 3CZFA 3FH8A 3ECQA 4MXWH 5DA0B 1PSKL 2N1KA 1L4IA 2V5SA 2FECI 4XWGL 1FZJB 3EJJX 5DRWB 2R7EB 4JFHE 3UTQB 4YUEL 4Z95H 4ZNCD 5BRZB 4P2RD 1F1GA 4HFUL 4ZUSB 1T4KB 4DP7X 5MEND 4S1DD 2HCZX 1UWFA 5D70L 1YY8A 3BN9D 3ZIMA 4WI5A 4CMMB 5D1XE 3N1QC 1ERNA 4WDIA 5LGJA 4R0LA 3DV4A 1TZGL 4JPVL 3MFGB 5C0IB 1DDTA 1G6RH 1FIGH 4WFFE 4OF8A 4G42B 4JN1H 4TQHA 4Y2OB 5B1JC 3S98A 1MFVA 4TS6A 1KEGL 3H55A 1GOHA 4OD3L 5IMLB 4QRPB 4NT6B 3DVFA 4LESA 4ZW8A 3ABMB 3SZ6A 2F9BT 1ETB1 3O2DH 1F4HA 1RZJH 1KEML 3B37A 5DFVD 5DO8A 4AQ1A 5IG7A 2H3NB 3JWOH 1WS8A 1DSWA 4IRZA 2WO2B 2WXMA 1JHTA 5INCB 1AKJB 1WEJH 1RU9H 3ML9A 2ODIA 1DBJL 3O8XD 2ZWZA 2W07A 3D09A 5D2LE 2PYFA 4DNLA 5CLYA 4WSKA 3O8XA 1P0SE 2JWYA 2YIHA 3MJ8A 3POCA 5ID0B 1U41A 2WCPA 2E7LA 2FEEL 3EZ8A 4KDTC 2Z91B 4E9RA 1TJXA 4NZTL 4I87A 1U95A 1Z2KA 2OI9B 3G6JA 4JHAL 1IQWL 4Y5XB 3L9BA 1XBDA 3QUYB 4WI8A 1DUYB 5GS0D 2OCJA 4JFXA 3VAEA 2C3XA 4EDWL 3D51A 3QDHA 4B95C 3ATDA 4AV5A 4IBVA 5ICXA 3K6SA 2E76C 5AVTB 2OMWB 4S0TD 4YSPA 5CIPH 1LO3H 4ZFOB 5G4MA 1CK0L 1DUZB 2R59A 3K6OA 3BAKA 3KPRE 5F1OB 4FNQA 2FEEI 5BS0D 4MKMA 1DVZA 3KPSE 3L4WA 5IM7B 1GZHA 3WFHA 5KVDL 1J0HA 4DAGL 3QUKA 3RE0A 1IM3B 1HAUA 2K4WA 2OMXA 4I1RA 3VCLB 1CN4A 4E2OA 4E0RB 5D6DA 2G60H 3STLA 4ODWB 5EN2B 5IOKA 5TE6L 1PLGH 1WP6A 3ESNA 1IEHA 1SDAB 4PJFF 3H6JA 4UQ3B 2BVPA 1YJDC 5KYYA 4MZRA 4GUPB 5FPIA 4AYSA 2AITA 2IWFA 3PWUB 5DMGC 4QRUB 1RH8A 3U6XA 5D4IA 5D4JA 5ESQB 4JDVA 1LP9E 1UADC 1JHKL 2CH8A 3ARRA 3FT2A 4TLKA 4J1UA 1I3GH 5C9JB 1HHKB 2EYSA 1BAWA 4R7XA 4Z95L 3P54A 1W0VA 4I0PD 1Y6KR 3SDXA 4AEFA 1NUNB 4WLCA 4CMHC 3WEOA 1IE4A 1DBAH 2PTTA 2F53E 5FW8A 4LO9A 4OGYL 2YPKA 3FUNA 4JQVC 4M8QB 5DK2B 3OWRA 1G6RL 1FIGL 3BP7A 1U91B 4WUUD 5EIQA 4JN1L 1K85A 2PYEE 4WUUA 1S9YB 4ISVB 4BSWB 1UGKA 2GSGA 3G5XA 2MQCA 1OT1A 3PFUA 1H0DB 2F54B 1J5IA 2JB5H 3RWCB 1SOQA 1WS7A 2ZUQC 3O2DL 1RZJL 2QR0A 3FRPB 1PKQE 3JWOL 4FQXD 4OGQC 1ETJA 4BFEA 2QZQA 3LV3B 1WEJL 1RU9L 3AWGA 4FQXA 2JLPA 3BT2H 4LVNC 4QRQA 4UV7H 1SFHA 3M7FB 5CINH 4OCWH 1UXMA 2YD0A 1AG6A 3RX7A 4NRZA 3TBYB 3B9KA 4B9FA 4D9QD 1MI5A 1LO0H 5BO0D 5E24E 3LYRA 4FNLH 4XGZA 1U3HB 4OZIE 3L7FB 4N2HA 3T3ME 5DHYA 1IUZA 5K93A 4TSAH 2ZX8A 3ULVD 3OQRA 1CBJA 4RGMC 1YO4A 5TDOB 4JL2A 2V2TA 4MNGA 5J7CC 1UZ8A 4GH7B 3NIDF 3G6AB 2GVYA 2LFEA 1W8NA 5DJDA 1A4JA 4MJ4A 2A38A 4RISH 1JZGA 1CD0A 1LO3L 5F1IA 5JXED 4NN7B 3IETB 4LSUH 3GXMA 2D7TH 4JPKH 2D3JA 1SBBA 1A4AA 1KZQA 1JK8B 4HK0A 3E9TA 3JWNG 4AQ8C 1AR2A 2ED9A 2DN7A 2WQ8A 2R1WB 1DZBA 3MCYA 2ATAA 4X8JA 2G60L 4Z7UF 3IKCA 3JUZA 1U3NA 5DJ6B 1PLGL 4FEIA 3HZYA 5KTEH 5EZOH 1KPUB 4UTBH 4OTXH 1E65A 1HXYA 5DQJB 2E47A 1VADA 5GZOD 2GUYA 1U8HB 5AW4B 1GCFA 4NNYA 1JF1B 5BQDA 3VI3F 3W0WB 3IJHA 3QAQA 1QSEE 2Z8WC 4LAJH 1BQRA 4AIXA 3PP3K 5AKSA 4NM4H 4ADGA 1I3GL 4K3EH 3QCVH 5BRPA 1CYXA 2Z31C 4GRLB 2JI2A 3MRCA 4MHHI 5C0BA 4OZ4A 2FHCA 5ABZA 5KOMC 4CSZA 2JKIS 2ZP8A 2NDFA 3STBA 2BRRH 5K1JA 3TN0C 4AUYA 3LD8C 4YSUA 5BVPH 2D0FA 5BXFA 1DBAL 4ZS6C 3TT3H 1QW8A 2MTPA 3MUUA 4WEUD 4F7KA 4UQCA 3ZO0A 1GW0A 4HKZA 3DX8B 4F9LA 2D8KA 3PXHA 1Z32X 2HT2C 1MH5A 4HWUA 2EVFA 3QXTA 4C83B 4PJ5D 3GGWB 4RZKA 1OTSD 1BOGA 1F4YH 1LK3H 2A6KA 4N2IA 5EU6B 3RAJH 4C56E 4D9LH 1TTUA 2LAAA 4PJ5A 4HLJA 1F6AA 2JB5L 5FWQA 1OIOA 1WBYB 4LSSH 4K7PX 5FV2A 3GLZA 5CAYB 3DPDA 2NUPB 2R1XB 4GO8A 1DEEB 1BXXA 5F93C 4QJ5B 3BT2L 3KXFD 3TJHC 4UV7L 2PP7A 3PQYE 4F2EA 2CO3A 5CINL 4OCWL 4IBWA 2YKLH 3KXFA 1RJLA 2BMKB 4FQIH 4YBLB 1LO0L 1UUSA 2OZ4H 4G9FD 4JJ5A 2MQGA 2IAMB 2MKWA 1ZLVK 4Y4FB 2F1EA 4FNLL 4PCTA 5I0XA 5CN2A 3U6XS 2BSCA 3ZE2E 1NDMB 2CXKA 5CM1A 3A6OA 2ENJA 2IC2A 5D1QC 3CVHH 3FRPG 3BW9A 2NT0A 1YDPB 4TSAL 4YDJA 2A9MH 1YY9C 2EP6A 5CBAB 3D69B 1S8DA 4PVBA 4B5ZA 2ENPA 1ADWA 3QDAA 2PW2B 1M9SA 3OKDB 1K3ZA 2E0PA 4FXKB 3I2CH 4N6QA 4AMKH 1JPFA 4N2LA 3QXAB 4RISL 5EULV 2AMUA 3OKLB 3L3OC 1UA6H 3O3EB 4LSUL 5F6IB 2D7TL 4JPKL 1BFVH 1YEWA 4A7QA 3KWWA 3WNIA 4ZPTA 2IANE 3JVGA 2VMCA 4J8QA 5AVZB 4Q2ZB 1CD8A 2YGPA 2IFFH 2VDLH 4AYFA 2QLYA 4LAQH 2DQFA 1FNSL 4JZOA 3AREC 3QQ3A 5DHVA 1VZIA 1FNEA 2OCFD 3BUYA 1SLUA 5DEFA 5KTEL 5EZOL 3ZE0E 4TL5A 3KS0H 4UTBL 4OTXL 4OZFA 1U8JA 4JS7A 4FCHA 3FTVA 1WF5A 4GAYB 2NY4B 4PHXA 2EE6A 1KGJA 3EOTH 5EORH 3WTSA 1EXHA 5TE4H 1BSIA 5DGQA 4Z77A 1OK0A 3CLWA 1Z0MA 4HHGA 4P4KA 4QXVA 4KJYB 5I73C 4NM4L 4KK8D 1F45A 3UBXI 4K3EL 3QCVL 4PRIB 5L2KA 2CDFB 3SCMD 1IC4L 3CC1A 2Q8AH 4NI3A 1MAMH 4G8GE 4NHUB 2P28B 1P4LB 2BRRL 2CHWA 4GP5B 1ESOA 1LEGB 2Y6TE 4RWYH 5BVPL 4H44C 4QRBA 3TT3L 2FVNA 3NP3A 4J4PA 3E6FA 4P5TC 1VFAB 4BH7B 5DZLA 3VTAA 3IXTB 4BUHA 4MNQE 3VUAA 4AGQA 4IYKA 2WIIA 4ZDHB 1KPVB 1J8HA 4P23B 3QEHA 2VM9A 4HWNA 5JPNA 1F4YL 1LK3L 4FQ2H 3RAJL 4D9LL 5DZJA 4L9LA 5BV7B 2A4CA 1QKZH 2BERA 1JN6B 2XA3A 4G7VH 5KG9B 2NY6C 2AW2A 2UWEE 4LSSL 3J2PA 2Z0UA 1N6VA 2BZDA 4QO1A 5K59F 2B5IB 4S1RH 4HLZG 5IWLA 3W57A 5E5RB 2BHYA 1HX0A 2HT4D 3ARFA 1VCAA 4PR5A 4UT6A 1CGYA 2L3BA 2YKLL 3STZA 1D7DA 4OFYA 4PJ8C 2PUQT 2OJ1A 1XV8A 3NJMA 2OZ4L 2BOBA 3NQIA 4KRPC 2YC1A 3SDDB 4N5ED 3GBDA 4UTAH 5DT1H 4NI6A 4XOCA 4F3FA 5F6HI 4PRAB 4Z7NB 3AXLA 2ZWNA 3QHTC 2P46B 3CVHL 1G9NC 4B9ZA 4GAGH 4GG6F 5HGDB 2EUXA 1S7VB 2A9ML 4XVSH 1F4WL 2LV4A 3L1FA 3TZVA 5JZ7D 3UC2A 3NIGB 2IH1A 5AVQB 4R6UA 5G4OA 3HB3B 4KKPA 5DC0A 1SVBA 3BDBA 4AMKL 4EEEA 1XGPB 1GMIA 3AS1A 2Z4QB 3UC0H 1UA6L 4P46B 4N8CH 5HYQA 4DERA 1MRFH 3T1FA 7PCYA 3MV01 4B96A 1BFVL 5ISZD 1DVFD 1KJ3H 4GBXB 2DEYX 1MW1A 4V2CB 3GBNH 5I9QB 5ISZA 2Z64C 1DVFA 2QPUA 1NC4B 3K46A 1A14H 1IAIM 2IFFL 1URZA 2VDLL 4DVBB 4ZMQA 4LAQL 1JWSA 3P30H 4XAKE 1LE9A 3ALXA 2GI0A 1JTOA 5GISH 1NEUA 4HWBA 1ORSB 1WBZB 4GW1B 1KB3A 1UXLA 2MCMA 5J11C 4YZWA 1GS8A 4R96A 1P6FA 2QKIA 4DZ8A 3EOTL 1KLFB 1S5HB 1FVEA 3AADB 4CUCA 5TE4L 2BNQE 4KK5C 3V5KB 1G7IA 1SHXA 4NN5B 2MFNA 5JO5A 3D34A 3U0TB 2N59A 5D7JB 4KMLB 2Q8AL 1QACA 4PJBF 1MAML 1R0AH 1X5IA 1EFXD 1OSYA 5KWYC 1V3MA 3PWPB 4RWYL 1EFXA 3BFQG 3VFPA 4Y7OC 4NQED 1YSOA 4YBQD 3HN3A 3ET9F 1A02N 1V5JA 2LW3A 2VABB 4NQEA 2GI7A 3U9PH 4OLVH 4YHIA 2H2PD 2X2IA 5TF1H 4NCDA 3F65A 3WOVA 4AL8C 4WKXA 1Q9LB 2OMBA 2X4UA 4XAWH 3AAZA 4S1QH 4IK7A 5E7BA 2E27H 4FQ2L 4MS8C 3L3HA 3F12A 3BE1H 4GO6B 4KTDH 4MAYC 4PU2A 3KLSA 4M02A 1FCCA 3QK0A 1QKZL 2BH0A 4X7CC 3WLBA 4G7VL 4NKMB 4FLQA 4HXBH 1K9TA 3MRPA 3ZN6A 3ZYIA 4S1RL 3H42H 2HMIC 4JPIA 1I8UA 3FOLA 2VLJE 2KMWA 4DP8X 1FN4B 2VLLA 3V8CA 3VTMA 2HFFB 5DMIH 1HHGA 5AD0A 4TSBH 4WWNA 3GS7A 4QY8B 5LXGH 4UM9A 4PJDA 2VAAA 3C5ZA 1ET8A 1AGCA 4MXQC 3GSNB 5JW4N 4ENEC 1HFUA 1UFGA 4ALAH 5GGUB 4KITB 3FBQA 4HKJA 1HXKA 3JQOB 4E5XA 4UTAL 5DT1L 3KW7A 4KQ4H 3DUHA 1FH5H 2JQZA 3QP3A 2EYTA 1HH6B 4KMTH 3RZWA 2IH3B 4GAGL 3TWCH 1O9VA 2VDNB 3LZLA 3PABB 4XVSL 3AQZA 2N3JA 2AAAA 5E1GA 4J8RB 3LH9A 1MQ8A 4KJPC 4G59C 5ALBH 1E3ZA 4ZAKC 3FT1A 2VDMB 2WGNB 1FFPA 1GZQB 2BNUA 3UC0L 2IMNA 3ATFA 3ELAT 4N8CL 3QJFB 1MRFL 3ZKXC 1H15A 3DC0A 4DJMA 1ZLUK 2JXMB 3F85A 1KJ3L 1NBVH 4FQQB 4P5KB 4AYGA 4ZO9A 1YPZE 2RD0A 2WNXA 3GBNL 4PS4H 1PQZB 1A14L 4ZMAT 4JHZA 4F92B 4Z7WB 1FYTE 2RGSA 3P30L 3APCA 4HS8H 1D2PA 2YARA 5GISL 2APXA 3DK0A 3IJ7A 2QV2A 3B6SB 3MROA 3P77A 3QUMH 1ADQA 1N3NB 2AVGA 2FB4H 3GDCA 1NMCB 4WU7A 3FTGA 1E5CA 1A6AA 3EG9A 3HBZA 4HAKA 5EFIA 5FYJE 5AEAA 4KX8A 1QSFA 5IKCB 2E74C 1ZRUA 1ITBB 3MBEA 2EH7H 3UTSD 2BSSB 4YX2H 4N22A 5KVGE 3RB5A 4M03A 3SPVA 1J0ZA 5D2LF 5ANMB 3HA0A 4I2XE 4X9FA 3VWKA 5I1AB 1R0AL 1E7VA 4KAQH 3POHA 1A9EA 5JHDE 1HINH 2VE6A 3IU3A 2LTQB 3V0DA 1LYQA 1O0VA 3FUFA 3H9SB 5D7EA 5BZWB 2BVYA 3ZU8A 3VQ2C 4JM2C 1M4KA 3U9PL 1J7VR 3HAEG 1D9KC 5TF1L 5L4FA 3QNYB 4HEME 4XAWL 4S1QL 4I5BA 2QT6A 3VXNB 5C0JA 2AJVH 2E27L 5FDWB 4KTDL 3BE1L 4Z7UA 4D7BA 5I16B 2WXQA 4M8RA 2CHZA 5D9SA 1YMHB 3KJ4C 2HRGA 5BVJA 1LNUB 1R5WA 5FYKH 3TVMB 2QADD 3MRRA 1P4IH 3H42L 2AJZB 4GG8B 4FKKA 4JJHA 3A4EA 3IRZA 3AITA 1P7QD 3F2LA 3G04A 2XLLA 5DMIL 3II1A 2EIKB 4TSBL 4RMQA 1NKGA 5EU5B 4JQIA 1P7QA 3U7WH 5LXGL 4H8UA 3ZMEA 3EJRA 1CFBA 3DETC 2WVTA 3L1OH 1JK9A 1RLWA 4BFNA 3MUGA 4ALAL 5F9JA 2CU9A 5KSAC 5F3HB 4JY5H 2EDHA 1JL8A 2O26U 4JFUA 4KQ4L 1FH5L 1LTXA 3CX2A 4LIQL 4LSDA 1JZDC 1MLCA 4KMTL 4GY4A 3SPGA 5IJDC 4MS6A 4U6HA 4PB0H 1FYHB 4WY7H 1ASPA 4J2XA 3BEVB 3TWCL 2E8YA 4A6YH 3MREB 4ZI8A 3TXAA 4HOXA 2G3NA 5IB3A 3MX0B 3P9MA 2GUOA 1H3PH 1YCSA 2FEDD 5ALBL 2FR4A 1RIHL 1MXDA 1SN2A 2FO4A 2AV7A 1L5GA 1TKWB 4WZ9A 2XA8H 5EDXA 3R0MA 5IEKA 1R34A 5DJXA 1SUHA 1NBVL 2P9RA 1OB0A 2NR6A 1S78D 2IPKB 3G5ZA 3I3DA 1I3UA 2GCYA 3FUKA 5DJ2A 1TTGA 4PS4L 3FU7B 3UPAA 1QA9B 1S9WA 1FZMB 4U1IB 3IMBA 1P2CB 4HS8L 1JF5A 3EYOA 5E08H 4NJ9H 2JTDA 1ZTXE 4HUVA 2GIMA 2TSAA 3B2VH 3DOSA 2P47B 3C5SB 1E4KC 5BPPA 2QSTA 3QUML 1HEZA 5KS9A 2FB4L 4HZAA 1CFSA 4KROC 3RZCD 5GZND 5KBDA 1RUQH 4L8SC 3S35H 2NCMA 1AQHA 5BO1H 1UD6A 3D18B 2NNCA 3KBHE 4LHJB 3RZCA 1JPEA 3PGCB 3AQXA 5GGRA 5HDWA 3V6FA 4O02B 2EH7L 4YX2L 2W8CA 4YK4B 2NY5H 3HI5L 3K2UH 5DHXB 5EEVA 4JM0A 4WHYH 1DJHA 3GJFK 3NIFE 1ES0B 4KAQL 2WWMD 4HETA 5HHMD 3ETBF 5IZ7A 1HINL 4PN6A 3RWDA 4DO6A 4UINH 3JTSB 4XNQB 2VQ1B 2EXYC 5KSBE 1T83C 2FJUB 4OZIF 1N26A 4Y1AB 2DIEA 3Q8BA 2NW3A 4PRHB 3QFJB 3MNDA 1QWNA 3ROOB 2GTZA 1ZLDA 3QO1B 5A6LA 2AJVL 4OI9A 1HDMB 1X7SA 2X5PA 3DIFB 1JFHA 2CO2A 1VERA 4IRSA 4NQCA 2CO1A 4LPUA 4NZ8A 5E1AA 3CVIH 1PZCA 1MY5A 4G7YH 4PSRA 2EEDA 4Z7OE 1WQVT 3ILDA 3WAJA 1QP1A 1P4IL 2WSPA 1HQ4A 3CDFA 5GSRB 5HI4C 2R69H 3VDAA 1T2JA 1ZA6B 4PJ7E 1OGSA 3U30C 1VDGA 1VGKB 3II3A 1Q9OA 1TTCA 1NC2D 3U7WL 2NT1A 1NC2A 1ZGLM 1B0GB 3L1OL 5C08D 3BX7C 5FX3A 4YGVA 4L18A 3SDAA 1U8QB 5KJ4A 5LNGA 2DKSA 4JY5L 3TNMB 4W81A 5LJYH 3UG5A 2DQDH 1A65A 4IOSD 5D7LE 3A47A 1FVDA 3S37X 3DSNA 3VG9B 1CLYH 4TYUA 2YXWA 4PB0L 4WY7L 3ZE1F 3NCJH 4EKJA 4A6YL 2E9IA 1CWVA 2H1LM 5AZUA 5A2IH 1HHJB 3L3DB 4NRXB 4JPQA 1H3PL 1BWWA 3CFNA 5EZLB 4N0CC 4GRWH 3P73A 5FM4A 3HG1E 2DWYA 4R8WL 4X5LA 5BOZG 2IOIA 3E7JA 2XA8L 1DVSA 1JAEA 2OMYA 3I75B 4NUQA 5FR3A 1WUZA 5K9KB 2WLHA 4LEOB 4L3EE 3QDMA 5AB0A 2BS9A 3H7BB 5E08L 2GJZB 4NJ9L 4KO7A 3EGXB 4L4VB 5E9DE 4DN4H 3B2VL 5L88H 4X5WB 5ICUA 4OF0A 1F11A 3ZLQC 3TCXA 4QHMA 4R3SB 3LNFA 2EDWA 1RUQL 5C6PB 3S35L 5KSVB 3K80A 4PY7A 5BO1L 3DTUB 5LHDA 3ZUCA 4U2YA 3KG5A 3MGAA 4RWHA 1GTNA 2I27N 2Y7MA 2Q8BH 1MCPH 3NPSC 3ULUH 4LCYA 4YIQB 3L3IA 4J12A 2X4PA 2NY5L 3NJXA 3K2UL 4BEIA 3IGKA 1X5LA 3DDGA 2BY2A 2OMVA 4X6BA 5GGVH 2F2HA 2ARWA 4BKSC 4M6AA 3ESUF 1MFBH 1T6BX 3WIFB 5BW7A 3AY4C 3MRJB 4HJGB 2MSPA 2IDTA 2V17H 4ORGB 3SBRA 4UINL 4F9LC 5DWPA 3PIQB 1MJ8H 2NXYC 3PF2A 3RJDA 3VFMA 4BZ1H 4GIOA 5FGRA 3ARDC 4JFEE 4NP9A 5JW4M 3K71B 3BKCH 1DFXA 1J48A 5D6CB 4DK5A 2O4EA 4O51B 5I76A 3HHSA 3FHQA 4CMHB 2H9GB 4WFGD 4JGUA 4LOFA 3UMNA 4P2AA 3W9EA 5DUML 3NZ8B 4LRNH 1BV8A 1AANA 1KC5H 3VYOA 3CVIL 4NN6C 4G7YL 1C8PA 4AGLA 4X6CF 3SD2A 1IM9D 1I9EA 1MDAA 4UQDA 3QNFA 3U36A 3VXPB 4CN4A 1HNYA 3PV6A 2UYLB 4ABQA 1IM9A 3HBGA 4P2CG 2HKHH 2GJ6D 2R69L 2Y9RT 3RU8L 2GK2A 3GT6A 1NFKA 4W6YB 1C5BH 1KB5B 1WWBX 2GJ6A 2V0AA 4UDTB 4F58H 2XX1A 1SHSA 1R5VB 3UZVB 3KLHC 2WLLB 4R4ND 4YH6A 5B22A 2NSMA 5E7FA 5CZXC 1WG3A 2SEBA 1CICA 3GEFA 4IU2A 4PI2A 2DQDL 3UYRH 4RQQA 4K5NA 5E6ID 4UILH 1P4BH 1CLYL 2L7UA 2ITDB 1GSMA 4YHPA 1QFUH 3NCJL 2YD5A 3BAIA 4JPSA 1MFAH 4IBZA 2O5ZH 3HW7A 1OE2A 4IHOA 4Y19B 1FL6A 2X4SB 3VXOA 1FVCB 1XR9B 4N0UA 5AVRB 3DHMA 3WELA 5C0CB 4QTHA 1JWUB 4KBPA 5AWNH 4LNVA 2V2WB 2WBJA 1T1YA 5E70A 5DRZB 4IRZH 4JGNA 1WAPA 1DJXA 4RGMB 5IK3B 4QRRD 1I7ZA 5EOCH 3N42B 5TGBA 3T4AA 4QRRA 3JV6A 4NM8H 3BOVA 3N41B 2GBTA 1R3HA 1A7OH 3EBIA 3IAQA 2Z92B 1XF3A 4DN4L 5L88L 5F8RC 3LPPA 4FFZH 2FL5B 4FTVA 3TH4T 4J6RH 2EIBA 1KDJA 2Y72A 3QIUD 2HLAB 2ZD0A 5E95B 3LVTA 3BGMB 2J5LC 3MRGA 3K4ZA 4A68A 1Z7JA 5HDOA 1C7TA 4IGBD 4ZFZB 3PHAA 4DZBA 3ECVA 2Q8BL 4N3TA 1MCPL 3ULUL 5GS0H 4IGBA 3AFLA 3QORB 1KTRL 4PW4A 1PX3A 2J7LA 3DJRA 4AJWA 3FF8A 5T33L 1H5BC 2FIKA 1Z5LA 2WMPB 3KNBB 3PL6B 4JRXD 5GGVL 1WFUA 2XWBB 3CFBA 4JRXA 4WI9A 1IGIH 2V17L 1E27B 5KVFE 4NERA 2FJHA 2B39A 1XF5A 1A7NH 1CFTA 1MJ8L 2Z31B 3QWOA 5C7ZA 3BAWA 5AW7B 4M29A 2AV1B 3LN5B 4K8RC 4BZ1L 3DO4A 1GGYA 4GFXA 1YLBB 1NQBA 3BKCL 1A6TA 4Y9FA 4HMEA 4MD0A 3TN0B 3VFSB 1G7QB 5J56B 1VKXA 3LKRB 3LD8B 4PJHA 2ED7A 3DX2A 5EB9A 1J1PH 2VXSH 3ISWA 4FKEA 5SWZB 3SKNB 4L5FE 1DVUA 1G1OA 4P99A 4WFFD 4LRNL 4Q6KA 1R3LB 3VRJB 1HJBC 3QEQB 1KC5L 3BVVA 1FZJA 2R7EA 2I07B 2DTMH 4A7SA 2A4EA 3UTQA 3JT2A 2CPCA 2EEBA 4MA7H 5BRZA 1IKNC 4NBYB 3IGFA 1T4KA 4ZUSA 2HKHL 4MWFA 2BVQB 4FNPA 4G6MH 2ICEA 3DX9A 1C5BL 4CMMA 5KYXB 2VDPH 3D1MC 2E7MA 3H4FA 1BF5A 4F58L 3SB3A 3TCLB 5F70A 2ETWA 3SGKA 3QS3A 4CSSA 4ZZKA 4AY0A 4HJEA 1I8IB 3SGDH 1DEDA 1G0XA 3I6LE 2AJSH 3W11C 2EDKA 3H53A 5C0IA 4PVLA 1JPSH 4XNZB 3PYCA 4YDVB 5B1CA 5KW9H 1H19A 3UYRL 2F5AH 3DXAE 2GFBB 4UILL 1P4BL 1NDGB 4YN3A 3VFTA 1QFUL 3OPUA 4NT6A 4P2QD 4R7DB 4BK5C 4HOWA 1AZUA 5IMLA 1MFAL 2O5ZL 3QXUA 5ICZB 4ZMZA 3GRWA 4APQB 4F24A 5KANI 5CMAB 2CRZA 1VLXA 4H20H 1QSZA 4Z3TA 1UOWA 4AEEA 5INCA 1AKJA 3HUJF 3BZEB 1YEEH 5D1QB 5AWNL 3A67H 2XDHA 1X44A 2CKNA 2VL4A 4I3SH 1U8CB 2VGLM 3QXWA 2K0RA 4ANVA 1XSJA 5A43C 1BYOA 5EOCL 5ID0A 3JZ7A 3AT9A 5BNXD 4N0RA 4R26H 4TF4A 1UTDA 4NM8L 3FULA 1HI6B 3KLAB 2Z91A 1U3ZA 1A7OL 4W9IC 3L3OB 5LGHL 3S5YA 4Y5XA 3QUYA 4FFZL 4XMLH 1DUYA 1YEFH 4J3OG 4J6RL 1NGQH 1NCOA 4LOEA 4JPWH 3QDJD 1QLRB 1H3TA 4KKRA 5C09B 3FQUB 2XUWA 3SE4C 3FTSA 3QDJA 3AREB 3QPQC 1JYNA 3TO2B 3MNWB 4LDEB 2F58H 2NLJB 2OMWA 1V10A 2ZYIA 3MHZA 5E2VH 3L3GB 4NNXA 5GS0L 4ODUB 4U1GC 4DGYH 1DTUA 2ZONA 4ZFOA 3ZBMA 3K0WA 3NDYE 4PGJA 3AG2B 1DUZA 2BCKB 3L4ZA 5CWSB 4WI3A 2NY3B 1ACYH 1PIFA 4CC0A 5IM7A 4FXLA 2WJ5A 1SM3H 1IGIL 4Y0GA 3VCLA 1KLGB 5FYLD 1A7NL 1BM7A 1F8TH 1O7VA 1KIUB 3BYTA 4N86A 4ODVH 4ODWA 5EN2A 1XTMA 3TBBA 3SE3C 2ZSWB 4UQ3A 1DCLA 3KPMB 3QPKA 4GUPA 1KENH 1R24B 5IT2L 4R5TA 3JYBA 4DN3H 2VXSL 3FU5A 5F89B 4QRUA 1T1ZB 5DDHB 4UUJB 1OW0C 4P8QA 5ESQA 4OAWB 1T21B 4P5TB 4JFPB 5F72S 4PJBB 4Z78B 1OAXH 2WGXA 5C9JA 1HHKA 1NGXB 2DTML 4L4TB 1BD2D 3PHSA 3SDCB 4LBAA 4MA7L 2OSWA 2V5YA 5IROC 1BD2A 4M8VA 2GAZB 1H8SA 4KRNA 4OQTA 4G6ML 2XN1A 2VDPL 3TIEB 4AK2A 4JO8A 2NY6B 1NIDA 3N43F 2VZ3A 4P48A 4U4IA 1BQ5A 1JNHB 3KGTA 3KYKH 1IVTA 2Y5TB 2D3NA 2AJSL 4M8QA 5DK2A 3Q9PA 2W91A 1R17A 4HAGA 5D2NE 5KW9L 5B4MD 3E9UA 2LLLA 1U91A 1U2YA 1ZT7A 2F5AL 5E8NB 4PWEA 1FWXA 3T3PE 3UABA 1ZHNB 1S9YA 4ISVA 3ALWA 3NGBC 5GGTA 1BQSA 1QUNB 4PJ8B 4BSWA 1FG9C 5FF6B 3KVDD 4MCMA 4NWUH 3DJ9A 1OSPH 3TGXA 4KRPB 3RWCA 1WBXB 1OSEA 3FRPA 2AXFB 2BVOB 4ZW5A 3S8WA 5AKVA 1FHNA 4KO5A 3ILEA 1RK1B 4H20L