4U0RB

Plasmodium falciparum reticulocyte-binding protein homologue 5 (pfrh5) bound to monoclonal antibody 9ad4
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
221
Chain Sequence
b'VKLVESGGGVVQPGGSRKLSCAASGFTFSDYGMAWVRQAPGKGPEWVTFISNMAYSIYYADTVTGRFTISRENAKNTLHLEMSSLRSEDTAMYYCTRAIFDYAGYWYFDVWGAGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reticulocyte binding protein 5
publication title Structure of malaria invasion protein RH5 with erythrocyte basigin and blocking antibodies.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Immune system
total genus 44
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2014-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u0rB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u0rB01
1YNTB 4X7CC 4AIZB 1UB5A 2I07B 4QHMB 5M7QA 2X10A 3ABZA 3MYJA 3QEQB 3SN6N 3V5HA 1QLEH 1N5YL 3C5SA 1BX2B 5C09D 4G6FB 5GJSH 1RVFL 1MCQA 4QY8A 1G9NC 4JANA 3F7YA 4R0LA 3HE6C 2NY1C 2VTFA 3V5KA 1KTLB 2CR3A 2HT4C 1LEIB 3L3KA 3BH8A 2H2PD 1D7FA 2F58H 5LGJB 1FIGH 3I6GB 5C07A 1RV6X 4LF3A 1N2RA 3WN5B 2FEEL 3GMOA 1FG9C 4O2FB 5DD5H 3RAJL 5EU6D 2DQIH 2L7JA 1QLRB 1FL3B 3DARA 5D9SA 3VGBA 5LXGL 4KHTL 2O26U 3OKNB 3G6DH 4S1QH 1NDMA 1B0RA 3GMRA 3KPRE 2AGJL 1FVEB 1F3JA 4JPIB 5DJCB 2BOBA 3NZ8A 4PJFA 3KPSE 4UT6H 3WXVL 3NZHL 1YY8A 4D9QD 3NA9L 4X6DB 3MRQB 5FOBA 4OCYL 5C0FB 1NMCC 4D9RE 3MNVA 2I25N 4GBXA 5T5FH 4JPVL 4BH7B 2IQ9H 5F97E 1ZWIB 1U58A 5CEZL 5C0BB 1X5AA 2NX5E 2YPLE 4MJ4A 4JVPA 5ESAA 5KSVA 5K9JH 1IQDB 3ZE2E 2ED8A 4DEPB 4LLDA 4GOSA 1EXUA 1CFQA 4OLXL 2MQ0A 3DGGA 1T21A 4TQEL 4IDJL 1XIWD 2W65B 1U92A 5DF0A 3ULVD 2HFGH 1AXTH 3UTSA 4YHYC 4RDQF 1GZQB 5FGCB 4ODVL 1A1NB 3U1SL 3SO5A 1MCKA 1VPOH 1MREL 2P5WA 4ODWA 4WU7B 5FYKD 1MAKA 3KAAA 4KMLB 2AXJA 3C2SA 3O3EB 2X4PB 4MQSB 1Q8MA 2D7TL 3MCG1 1HI6B 1W8NA 1PG7W 4OFVA 4U6VL 3TIDB 1WUNT 2NX5D 5IHLB 4ZNEE 2FRGP 5IFHL 3K46A 2YPLD 3ULSA 3AREC 3WE6A 4J3SA 4QRUB 5DHVA 4P3DA 5FYJL 4D0CA 1OWRM 1H5BA 1EEUA 1FZJB 2R1XB 1CD9B 4NRYA 4GW5B 2Q7YB 1KEML 2GSGB 3P9LB 4ZNCD 3MRFB 1HH6B 3P4OB 1A22B 4J3XA 2HJKA 4WJ5A 2WLZA 4BQ8A 2EEDA 4UTAL 3LPGA 2FX8H 1A9EB 1MHCA 4JHWH 2RAMA 3I84A 1DR9A 2RFXB 3CGTA 2G2RA 2NY4C 3WJLC 3S37X 4MNQD 2W1NA 4V2BA 3L1OH 2YKLH 3MRKA 4KQ3L 4XWGL 4JQIH 4YHOH 2N7BA 3ARZA 5IESL 3UTTB 5FOJA 4AIOA 5CBEA 2H32A 3MACH 3BX7C 1H8OA 1CXEA 4GBXD 3HI1A 5DLMH 3RA7H 2ARJB 5KAQF 1QFPA 3VXQB 1EX0A 1LEKB 3MBEA 5IVXF 4B7IA 2FEDD 4OLYH 2A6KA 3QWQB 3RUGE 5J6HB 2DOCA 1J1PH 4IIQB 1UC6A 4Y16B 2ZPKL 5DMKA 3QDJB 4Y5YA 2X4SB 4AM0B 4A6YA 3SGKC 4P2OA 3SGJC 4JRYB 4EJ1C 1PZUB 4PGCB 4NC1C 3UTQB 1KULA 2EH7H 4LEXH 2QQKL 4Y4FD 5TF1H 3GZKA 1DP0A 3DUHA 2FO4A 2JIXB 4OF6A 3UTSD 1I7ZB 1OLZA 2F5BL 4FXGA 3TVMC 3UTZA 3ZKMD 4PGJA 3ARUA 2XRAH 4G42A 5KSAB 2C3GA 4RFNB 2LV4A 3ARGA 4Q0XL 2D9CA 2P5WD 2PF6A 1TJIH 2K7PA 4QRPA 2WUCL 2YD9A 3WHXB 3AM8A 3CFKB 3OF6D 4OM1L 5I73C 3LEVH 1D3CA 3L5WB 2FNBA 4OLUL 4PPTA 3RU8H 4XP5L 4YFLI 2AEWA 4NCDA 5CSZA 1RIVH 2NR6D 4MB5A 3V52L 3GKWH 2YD2A 1B4JL 2JJWA 2QBWA 3VRLF 5DMIH 2C4FT 4GSDH 4KV5E 4MSWB 5D7KE 4E42B 2AJUL 3OAZH 2P24A 1W8OA 1MCFA 4D2NA 3EYOB 3MLSL 2BNUB 1A7RH 4OZ4B 4YIQB 5I19L 1Q9KB 2Z8RA 3W9EB 5D6DC 1DE4B 3LH2H 3DX7A 1AKJA 5BZDB 1OARH 1GIGL 5DJ2A 1IAIH 4X99A 1CFTA 4Y1AE 4OT1H 3B2UD 1CXFA 4XX1G 4KZDH 4IBLT 5I6XB 2OI9B 3BPOB 5JPMB 4KDTC 2CRYA 1NFDA 5FXCH 1GC1C 1KN2L 4PGBA 4ZAKB 3U6RB 1BF2A 4LCCB 4K71B 5ICZB 1BLNB 4NKOA 2XQYG 2AJSL 5D7KD 3HA0A 1KOAA 3ZSSA 4DZBA 1RUQL 1CWVA 5F6IC 2GIYA 3TO2A 3QNXB 1F3RB 3QHFL 1N64H 3VFTA 1T20A 3F62A 5E00A 5CEZE 5BRZA 5JLZB 3MA7B 2YD8A 1A4KB 3KLDA 3MGOB 4EIZC 3TESA 4I18C 5D70L 2IFGA 1MFAL 1MCDA 4L29B 4GG6A 4XP6L 5E1AB 2OL3H 3RNKA 2P43B 1KB9K 1OSZA 5KJRH 1MI5B 4QRPD 3RVUC 4R90H 3UC0L 4HIXH 5BW7C 3IDJB 4Z76A 2Z31B 3KPPA 2R2CA 5IMMA 5D1XB 4WEUD 3FOLA 2L7UA 3PV7A 3MOBH 5E6IB 3MUZ1 3C8HA 4NCC2 3NGBB 1WZMA 2Y4SA 4XCFH 1CD1B 2I26N 1RSFA 3ZZ1A 4R0LC 3E6FA 4KUCD 3OMZA 3IFNL 2IH3B 5HGHB 1PVHA 4QTHA 4KZEL 4OZIF 1N6UA 3B2VH 2P7TB 4EI5D 2NYYD 3HHRB 3S5LG 4RISH 4LSQL 1CBVL 1TPXB 4XWOC 3QB7C 4WV1A 1MCWW 5FAAA 1K5NA 3TWCH 8FABA 4JFXA 3I50H 4UQ2B 4XGZA 2YK1H 5AAWA 3JTSA 2CKBA 2ZOLA 3PQYB 4IRSB 3THMH 1KNOB 3ILQC 4OF7A 5FUZL 3TYFA 2Y5EA 4MAUH 1OGTA 2R1WB 2LVCA 3QDAA 2BVUA 5F9AC 3FAXA 1J1OL 1WBYA 3JWOH 4OGXH 3DSFL 3OXRA 3WFDL 3G04B 5HHOA 5LVEA 4M5YL 5L88L 2E9JA 3QRFM 3PWJB 5BRZD 4AEIH 3F6LA 4Z7QE 3GHBL 1X44A 1FJ1A 5L2KD 3PHQB 3BH9B 3GO1H 3ZL4H 3EYVB 2XTLA 1AFVL 2GY5A 4HIEB 1AHWB 2XA8L 3BW9B 5JHDB 5HHXL 5EO0B 3I6KA 5FO9A 5C0JB 1IGCL 2PNDA 2FLBT 4R7DA 1A7QH 1C5DB 5EUOF 5BS0E 1YYLL 2X4TB 3QQ9D 3SDAC 5GRWA 3TZVA 4L8BA 4PJGE 4ZDHA 1FLRL 1QFWH 5IKCA 5IWLA 3MODH 4WFGD 3FQTB 1A3LH 4Z7WF 4N8PA 4IOIA 5JDSA 1AD0A 2VDRL 4M7LT 3V0AC 1Z9SA 2XOTA 3TBSB 1K4CB 4LSVL 3PWVB 4G8FB 5GS0H 1A5FH 3NCJH 1EZVX 3RL1B 2XTJE 3HNSH 4G9FD 1GVIA 5A1AA 2AI0L 4MCZB 1AGDB 1YEJL 2EO9A 3LIZH 5DDHB 2HMID 1IQWL 1IM3B 5D2NA 2OZ4A 5MENE 4PREB 3TPUA 2R2BA 3QO1B 1BZ9B 2HLFC 4JN1H 3GBLA 1RULL 4BZYA 5HHOD 3H7BB 1FPTH 1TJGL 1FDLH 2ZUSA 3O2WH 2UZYB 3LSOA 1QTYT 2ESVA 3BZEA 2XPGA 1T7ZA 1JGUH 2EKSA 4ZFZA 5FUOL 1X6LA 3MBEC 1DL7H 1UFUA 1NLDL 1EIBA 3D3VE 3LPFA 4KU1A 4ZPVB 5IIEB 1S5IH 4NM4H 4OV6F 3MRBB 4QRQA 4XMKH 4P2OC 5DK3A 3BI9X 2AV7A 3HNTH 4KRPC 5MEND 1OAKH 3HC4L 1WJ3A 2YRLA 5IJKC 3H9ZA 4GT7A 3TN0B 3BGAA 3ULUL 3B6SB 4RGNE 5ETUA 4LLUB 4X5LA 1YEKL 4N9GA 2HTLC 1G6RB 2YA0A 2Q6WB 2HKHL 3RI5K 4YEFA 3ARGC 2GKIA 3F12B 1ORSB 3S9DB 1HSAB 3VGFA 1KENL 4P0DA 1NDGA 1QO3A 2FZ3B 2PW2B 3P4LA 5IB3B 3ZT6A 2DM4A 4GRWE 4EVNB 3L3JB 5ALBH 1MJJB 1LEGB 3U2SA 4DTGH 5BQ7B 3GMNB 3QUYB 4M02A 2EDYA 1S7QA 3ARDB 3VI4F 3TT3L 3MV8E 4ZFOL 4NUGL 4LSRL 5SWQA 3AC0A 3FB5B 4X7SL 1IGYA 2DBLL 1OAUL 4FFWC 1G7PB 2FSEB 5FHBL 5I75C 1CF8L 4F2MB 3VFPA 4EUPB 4Y19A 5EU5A 5H37H 3TJEL 4S1SL 3CX5K 1KELH 1H3PH 4KJPD 2ARWA 1I3GH 3EYQD 3FFCA 1INDH 1IGFL 5FKPA 4TSBL 2OMBA 1ZHKB 4NT6B 2EXYD 5CD3B 4HIIA 1FFPA 3QDMA 5GPRA 4DKFL 1WCQA 5E8EA 5GGTA 2ZG2A 5LGHL 4YHMH 3JWNC 2HN7A 2RR3A 3PJSB 1A6TA 4Z8FL 2NY2B 4XNXL 1RI8A 3M1BA 4TUJB 4Y7MA 4H0IA 4U3HA 4M6ML 1QSFB 1XGRB 2MPAH 2Y25A 3MRPA 1NMAH 3D25B 2X6MA 3IB4A 4HG4K 5KW9H 3DPBA 3EJYD 5HYSG 5H37G 4GW4B 5FM5O 2GUOA 3GRWH 1N26A 1DQTA 3EOYG 5D7LB 2H26B 5J1AB 5I1AA 2GK0A 4WO4B 3ARTA 3BQUB 2MCG1 1IL1B 3DMMB 5J9PA 1N5YH 1T22B 2IALA 3I6LE 2XQBH 4W68A 2XNAA 5F3HA 1A3QA 4YDLB 3REWA 1BVLA 4LASL 5MERB 1XCTB 4IIQC 4F33A 4QT5B 4X4XA 4LGPB 3CSBA 3LKOB 2Q7NA 4OCMC 1LD9B 3S8WA 4H25A 1X5FA 2WIIA 1EBPA 3WDIA 4KHTH 4CU6A 3GIVB 1K2DA 5EWIH 2IPKA 2PR4L 3HUJE 3V6FB 5E9DB 3U79A 4Y19D 3IU3A 1DJSA 3IFLL 4RFNC 4L9LA 2XXCB 4BFEA 5A2IH 1BPVA 4HBQA 5IMKA 4C55A 3EJZC 3WO4C 4WV1C 3NZHH 3IDGB 3M17B 3NA9H 4MJ5A 1XGPA 3NACL 4XI5D 3TH2T 4NQSB 4OCYH 1W72A 3ZHDA 4U6HA 3D2UA 3VXOA 4OGAC 1RJYA 5BV7L 4HJJL 4GG8B 4JPVH 3EUUA 3RVTD 3HC0B 1P2CB 2H6PA 2ADFL 3VW3H 1RFDH 1HEZA 5CEZH 2LVEA 9CGTA 2CLRB 4JRXA 1NKRA 3L3OB 3BP7B 1NANI 1YNKH 5D2LF 4OLXH 4ZUSB 3HG1A 2I5YH 5C0CA 1HCVA 4F7EA 2ZCLL 8CGTA 2OI9C 4JZNB 3LN9A 1S7WB 4ODVH 3V79C 3CH8A 3HS0A 4KRLB 4QXTA 3BAEH 4BJLA 2X40A 4MA8H 1ZHNA 3U1SH 3TA3B 4ZAKC 4WHTA 1MREH 5I16A 5EO9B 1UG9A 3ULUE 2PO6A 2V5YA 3GJEA 4DJMA 3SDYL 2R69L 5GRZA 3U4BH 4C58B 2IPUK 5GS2H 1TZIB 4U6VH 5HDOA 4GMSH 2YBRB 3ZHLA 3BP6A 2IBZX 5IFHH 3RGVB 5IWLC 3ZMRA 4YGVA 1JGDA 1EFXA 1FNAA 5DA4A 3VFRB 1ETZA 4ZOCA 3ILPB 3R1GL 1K3ZA 3EGSA 1I8LA 4PJAE 2VLRB 1U8PB 3GMQB 2CDEB 4Z7UE 4KQ3H 3O3DA 4XWGH 1YC8A 3BT2H 1P7QB 3HZMB 2Y23A 2F8OA 2GHWB 4FP8L 2X1XR 4MHHG 1U8KA 2PCPB 1I1FB 4Y2DA 3D9AH 3VXSE 5CP7A 5F7LB 2A6JA 3AUVA 5I8EB 3FQUB 1HQ4A 4MAYB 1ZT1B 2NW3B 2Q3AA 1JTOA 4YXHL 2BCKB 4Q74A 5K9QI 4Z7VF 4GXUN 1BD2A 5CJQH 2IANA 3AU1A 1G6VK 1N6VA 5GGRY 2I27N 3WUWG 1AH1A 2VABA 4CVZA 3PDOB 1NLBL 5CEXA 4ODTH 1TCRA 3QEHB 2VUYA 2QQKH 1MCNA 5GRJH 1S9YA 5KOMC 2A0LD 4YBLC 4Q0XH 4LSSL 4D0BB 3SE8L 3HMWL 2B39A 1SM3L 1I9JH 2JB5L 4EDWL 2ED7A 2VXVH 4ODSL 5F89A 3GB7A 4NQVA 4CVWA 4PJXE 4Y5XB 2H2SD 3QCUL 4OKVB 4ZSOA 1JWMB 2E8ZA 1B4JH 2ATKB 5GGUB 1BVKA 3VFVB 3QFJA 2PXYB 3PIQB 2A74A 2AJUH 2UZXB 5TE4H 3HI5L 4ZODA 4HQQH 3BZFB 1H3GA 3QIWD 2JELL 3WIHH 2BVTA 5I19H 4Z78A 2J8UE 5IQ9A 5SX5K 1KB5H 3QQ4B 4UU9A 4ZQKA 2AQ2A 3P0GB 5IB1A 3FOMA 1I7UB 5E24E 3PE9A 5D7IF 4NKQB 1I1AD 1OQOA 2BVQB 3O6MH 3PHOA 1A64A 3V6BR 3MCKB 3ARFD 1WBZA 5DS8B 1YMHA 3V7MA 1FH5L 2XFXA 1KN2H 2VAJA 4OCSH 5JOEA 4JB9L 1RIHL 3MJ7A 4N8VG 4NQDE 1C16B 2XN9B 3HFML 3S34L 2NY5H 3IDUA 4WI9A 3K2MC 4P2QA 3PWLA 3BD5A 2CIKB 4B0MM 4Z0BL 4NO0B 3EZ8A 5GRVL 3BIBX 3S5LB 1HCFX 4NUJB 1CFNB 2F8XC 2HJLA 3LN4A 1R5VB 4F37F 1KPUA 4JO1H 4KMTL 3SDCB 1OTUD 4X7TA 3IVKA 5EH1A 3VXRE 4IOFC 4XHJD 3MOAL 1R0AH 2H41A 3HKFA 4Y8DC 4GS7B 4XP6H 1RJZA 5IW6B 5DWUH 3TBTA 3UC0H 5JOFB 3H9SB 2YRPA 4MNHB 4EOWL 4NQDD 4JKLA 1EFQA 4WWKA 1NC4B 5FDWA 5HI5C 1K3IA 1HHIA 1ZSDB 3O45B 4GUPB 4ZUUA 5JW4M 4GRWH 4G6AC 1RIUH 3FB8A 3QFDB 3EYFA 3DRQB 4RFOL 3DJ9A 3SBWA 1UCBL 3KGRA 1JPGA 2G5BA 3IFNH 1U8IB 1V5JA 4HK3J 1G7IB 5C0GA 2IMMA 4BELD 2WBWB 3BPNC 3HB3D 4YNYA 4X7DC 3ZE0F 2V2TB 4GQPH 4K3HA 1UVQB 1R3HA 3F5WB 5CGYD 4PJ7B 4KK9D 2X1PA 1CBVH 1Z5LA 3W11C 4LCWE 3TPKA 3TN0C 2P48B 3LKPB 4KHXL 2XZAL 1NGQL 3EJJX 3U9PH 3VD4A 2FR4B 4PBVC 5FB8A 4JJ5A 2F54A 1MAMH 2KH2B 4L9LC 2YD7A 5EU6B 4FQHA 3HZYA 5FUZH 4HPYL 3N9GH 2ENYA 4P2QD 1CGUA 1NH6A 1XF1A 1T7WA 4JDZB 5A2KH 5IROA 2YEZB 4U6YB 4JCLA 1J1OH 4Z0XB 2VXSL 5F7WC 2LTQB 4MXVE 4M5YH 3QUYC 1TQCB 3SQOL 3L3DA 3ARDC 5DJ0B 5EC2A 1D5BB 2Q8AH 3JXAA 4C56A 3MLPA 5CJBA 3GHBH 4PTTB 2QQLL 3QSKB 5SX4I 3LS5L 3ZE1E 2XA8H 5K9KA 5HHXH 2UWEE 1RUMH 5E03A 1IGCH 2RGSA 2VDNL 1W0VA 3L7EA 5TE6L 4OCNC 1CTNA 1CDUA 1FVCA 1JI2A 5E6ZA 4OFYA 4HKZA 3JV4A 3EO1A 1FLRH 3KPRB 3G5XA 2OL3A 4M62L 1IGJA 5DJZA 4HKJA 2PO6C 5T1KA 3U48A 2W60B 1U9KA 3KPSB 1XIWB 2CRZA 2PUQT 3IRZA 2VDRH 4HUXB 1CGXA 3O4LD 3OKEA 1NEZB 1XZ0A 5MEPA 3ES6B 1RUPL 2D2OA 1ZS8B 5F7DA 5M95B 1Z9OA 43CAA 3OKOB 4KKLC 4PJBE 2AI0H 1FL6A 3BKYL 3IDYB 3BWAA 1FP5A 5I1CL 3QUZD 4RAVA 5DQJB 4PJIA 5EOQH 2NX5B 3ZYOA 4FNLL 1T3FA 2YPLB 4OIBA 5C86A 1I8LC 2V2WB 1ZLSL 2F54D 1NGXA 1EA9C 2NTFB 3PF2A 3UX9B 2P8MA 1RULH 4MXQC 1NDMB 4JR9L 4NQXB 4P4KA 3U4EA 3HZVA 2D0GA 1BVZA 2DYPA 4U31A 4Y2DC 1TJGH 3C9NB 3U7YL 4HGWA 2FB4L 4S2SA 25C8L 5D6CA 2WANA 3G9AB 3CDGA 4MNQB 1M6OB 3WEXA 3D85D 3W82A 1QUNA 1NLDH 4LLVA 5L2JA 4OFDA 3WKML 1IM9A 2Q8BH 2CK0L 4L8SB 3UJJL 1EDQA 3CLEL 5FKAA 3HC4H 1S9VA 2YD5A 3ULUH 4GQ9H 4PJ8D 2OMNA 3DVNB 3MGTA 5EU3B 4EI6A 1YEKH 2LFGA 1DBML 2HKHH 5C0AA 4H20H 4NKMB 5MEOA 1OLLA 4EBQL 1IARB 1MCWM 2AK4E 1IEAA 2DAVA 1KENH 5T1KD 1JZ5A 3BRFA 2DWDB 1NCDL 4Y4FB 3NPZB 1T80A 4N90E 1AO7A 2NY6D 3GM0A 5K59F 3OKMB 5T1DL 2OJZH 3G5VB 3VCLA 4DK6A 4OLEA 1YMME 1DDHB 3HCVA 3TT3H 3IFOA 4WNQA 1KG0A 4LSRH 4PRBB 5BJTA 3KJ4B 4X7SH 2BFVL 1A21A 4FA8A 2DBLH 4R4BA 1KYOK 3GJFH 1A6AB 1CF8H 1S9XA 3O6FA 2X44D 4ZXBB 4S1SH 3NH7L 2KZ1B 3TA3C 4YDVB 1HSBA 3OXSB 3S36X 5HGBA 2BX5A 2ZNWA 3TNNA 5D7JA 4OZGB 3LKSA 4OD2A 1IGFH 1A7NH 4WJ5B 4HF5H 4TSBH 3OTTA 4N90D 3O6KH 2DB8A 1DN0B 3NFNB 4HGKC 3LQZB 1FNGB 4HZLB 3RGVC 4AEHH 2OM5A 5EC1B 5LGHH 5T33L 5E99L 4AG4H 5KSBF 1CQKA 4XZUA 4FQXA 2ZKHH 4U0QB 1HQRB 5GQBA 2CH8A 4M6MH 2J1KA 3LPWA 3RTQD 1CK0H 3ETBF 5B38G 3ZYIA 3WFCH 5INDA 4PRIA 1LVEA 3ZKXB 3T2OA 1P9MC 4HX1B 3CUPB 1R3IL 3KYOB 1RK0B 3TCXA 1HOCB 3VXPB 2YA1A 1MCJA 4LEOA 4Y5YB 4MDJB 5DK0B 5SWSE 4HH8A 3FB6B 4Y4HD 1XR9B 1AJ7L 5EBMB 1RZ8A 3BUYB 4TSCL 1CICB 4P57A 1OGAE 4U0RC 4OF0A 4WWKC 4JDVA 2ILLA 1C5CL 2UZIH 1TJHL 4ZS6C 3OKKB 3PGCB 3DETC 3RWIB 3GMMB 1JFQH 2ADIA 4JFQB 1TTUA 3V6OA 3SBWC 1YY9C 4MCYB 5I8CB 2NXYC 2PR4H 4P46A 1MHHB 5EORH 1GJIA 3L5HA 3BEVB 2VAAB 4APQA 3NAAL 2XA3A 3C8KA 5SWSD 1UA6H 3O0RH 4FQIL 1ZLVH 4KI5C 2DQFA 3B5HA 1I85A 4P9MH 5JPNA 5EOTB 3KXFA 4MA7L 3WLBB 5I1KL 3NACH 2BZDA 1FFNA 1Q9LA 4BQ6A 5CHNB 1T1WB 3MRNA 4Q9BA 3FO2B 5KOVC 2R9HC 4ZUVA 4EI5B 4IMLA 4OZHA 5HYSA 1K8DA 3UJTL 4RQQB 4NNPL 2YWYA 1A1OB 1EEYA 2ADFH 1I1YA 3X14A 5JW5A 2NXZC 5C08E 1GHFH 2CDGA 1NFDB 2VLLA 3VFNA 1NGPH 3CVHA 4JM2A 3RUGA 3PGFL 5DUMH 1ULVA 1IKNA 2C3VA 3CFBB 3MV01 3VG9C 5HJ3B 4LBEA 1ZGLA 5LQBL 3RBSA 3ROLB 5IBLD 3FT2A 4PTUA 2VR5A 3E8UL 1G0DA 4XBEH 2GJZB 1YECL 1LO3L 4HWZA 4WCYL 3MLZL 4X7EC 4F57L 4XXDB 4YHZH 1T5WB 1KTDA 2LABA 1CDJA 1KXQE 3SDYH 4J12A 5L2KB 1DUZB 3DBXA 4LHUD 3AB0B 3RDTD 1VACB 4G7VL 4F7PB 3GHEH 1M05A 5LAXA 5C08D 4J1UA 1JGVL 3VDBA 2PYEA 2FJFA 4UILL 5ACZB 5KG9A 3GSQB 1G9NL 4ELMF 3SY0B 3MYZA 3FOLB 1JWSB 4P46D 2HT2C 5IFAL 4H1LH 3VMOA 1JPST 3TC9A 4Q9CA 3BXNB 4NO5B 3R1GH 3TH4T 5IEHB 1SMOA 2DDQL 2DJSA 1UH2A 2OR7A 3CXHK 4JZOB 1CLZL 5KVFL 2H8PA 1VENA 4NOFA 5JO5A 1UEMA 2K1MA 1FYTD 2Q86B 3MQIA 4Y1AA 4OI7A 1KJ2L 5IP4A 4G7YL 3UROR 4G8EA 4G9FB 3DX8A 3P73B 4G8IB 4YXHH 4NFBA 4WDIB 4RZCB 1CE6A 4KGLA 4CRPA 4R3SB 3ZHKA 1X3DA 4P4KC 3BKJL 2A77L 3OHXB 1MUJA 1M71B 1R3JB 2D03L 3QJHA 1T0NB 4CDGC 4LQ1A 3B5GA 4LLMB 1NLBH 3ZSTA 4OV5A 1BAFH 4JFEE 3EFFA 3BGMB 2HJFB 3FHAA 3VFWB 1NBZB 4PJGB 2M2DA 2PTTB 5FGSA 5LJYH 4O2CA 3T0XA 5FGBC 1OY3B 4DCQA 2VSCA 5L0QB 5EUKA 3FO1A 1N59A 5IF0A 3MMEA 5J6GB 3ARBD 4P23A 1KJ3L 3BIKA 4E5XA 2YXFA 1PEZA 4KAQL 4O58H 1YEDB 4LSSH 3SE4A 1DBAL 4OUOA 4NQEA 4U1MA 1TCMA 2XTJB 1QEWB 1SM3H 3LHPL 2JB5H 3LAFA 4NRZA 1GYAA 2ZCHL 3QCUH 4ZD3H 4FMKA 2ZP0T 1ES0A 1KB5B 4NZRL 2YPKA 5MENB 1MJ8H 4PJEF 2GSIB 4D0DA 1S9KC 3KWWB 1BOGA 2JELH 3W39A 4KTEL 3TIEB 1KV3A 2X4RA 3NCBB 2GK2A 3G6JB 1MQ8A 5IR1B 1G7MB 4DKAA 5A2LH 4EN3B 1MPAL 2UY6A 1SMAA 5EIIA 4C54A 3WUWA 4QHNA 1MLBB 1OP3K 3EDEA 3O6FC 3LKRB 4LAQH 2B20A 1S7TB 4K7PL 4PJHA 1FH5H 4JB9H 4LP5A 5GS0C 3B43A 1I7RB 3N1MC 4G6KL 3RI5F 3HFMH 3S34H 5EBWA 3RWEB 5D7JC 3AS2A 2ICWB 1IAKA 3T4YA 1YPZF 2BOCA 4LSPL 4Z0BH 5IMLB 5D2NB 2HLAA 1UQSB 2J88L 1JNLH 3BO8B 3I75A 3AAZB 1T1YB 3LRSB 5LWYL 4FQXC 3B3IB 4HT1L 1BFOA 1JL8A 1UJ3B 3GMLA 3ROOB 1IBGL 1WTLA 1DUYA 1MCSA 4NQED 3D69A 2DQGL 3P40A 5D1ZD 3T4AB 3DX9A 5HDQL 4NN6B 1KCSL 4OIAA 3TBWB 5BS0A 5C2UB 2QHRH 1RMFH 3GSRA 2R8SL 3T2NL 2WUBL 3QXAB 4NC0B 4I0PA 1MJUL 5B3JF 4G6MH 1I4FB 4RFOH 1KGCE 1UCBH 5KN5A 4M61B 1Q0XL 4CU8A 5JNYB 4KPHL 4YDJA 4TNVF 5KS9E 2DL9A 2VDOL 3I85A 4N9GB 4Y5VA 1OVZA 3KPOB 4PGZA 4N8VA 3KS0J 4PG9B 4ETQB 3WLWD 1JUFB 4JFPB 1HDMB 2GJ6A 1QYGL 2GAZA 4HV8B 1VKXB 2OTUA 1EUTA 4LRIA 4Q9RL 2EIZA 1CFVH 4KHXH 1XGTA 4X98B 4CNIA 5E5UB 1QFOA 1NGQH 2Z93A 1TQBC 5E8DH 3RDTB 3IJSA 4L3EA 2A9NH 3UEZA 4APQC 5IBUB 3RWDB 5DT1L 3MNWB 2CSPA 1D6EA 5A16B 1I85C 5I15L 5ANMA 3LEYL 3DVIA 4LOUC 4M7KL 1MRFL 5DK2A 5KVGH 1QBLH 2VXSH 2V17L 4XNMA 4JY5L 3FHQA 1V3LA 3EDKA 5AWNH 3SQOH 1IEHA 3FRPG 4PIRF 1AXSA 4FQQA 1S7UB 4S11A 1GSMA 5F1IB 1Q9OA 4WVRA 1GAFL 2FECI 4JKPL 4JM2C 3D3VA 5EO1A 3DXAE 4ZXBC 1J88A 2VDNH 3G08B 4DGIH 2UUDH 2V7HA 1UCTA 1LNUB 1PQZB 5TE6H 1XCQB 4K94L 3GNML 3VXME 5EBLA 4XCNB 3GUTB 5SWZA 4R96A 3HUJB 4B5EA 4R2GC 1QP1A 3W5NA 5K9OB 4M62H 3VGAC 3W5MA 3RQ3A 4OZIE 3GSXA 4UDUB 4D8PB 4I9WE 3RWJB 4NSKB 4I4WB 2XWBA 5I8OL 1NGZA 2IWGA 5IK3B 2HRLA 1EV2E 5E2WL 4OQTL 1DVFD 2R4RH 4LKCB 1YEEL 2GJ6D 3RP1A 3V7AE 3T0ED 3ARQA 4WU5B 2XNAB 1IAOA 4KDWA 3MV8A 1BIIA 5I1CH 1JNHB 1LK3L 5FECA 3VXUE 2YD1A 5DR5L 4X5WB 3MJ9L 4M1DL 3QEGH 4FNLH 4YZFF 1ZLSH 2BK8A 4Z5RB 3OR7A 5DRNB 2R29L 3BN9D 2ITCA 2BDNL 2EDHA 1CICC 2BY2A 3SKNB 4AJ0A 1U8OA 4OGYL 5E8OA 1AP2B 3KYKL 5JW3L 3MJ8B 4ACPA 2CK2A 1VFAB 2Y7QB 4CW1A 3G5ZB 4ZS7H 4BA8A 4U3CA 25C8H 4HMEA 1NUDA 3MLVL 3UPRB 1WAAF 4GFTB 1FZMB 2FJHB 3RWCB 1FO0L 1QA9B 1Z9MA 3BUTA 2EYTB 3WD5L 3EDDA 3WFHA 3WKMH 5EUOE 5DYOB 1JN6B 2CK0H 1JNNH 3UJJH 4FZEL 4LHJB 1D5ZA 2JKXA 5BXFB 1XGQB 1VFBA 3FQXB 4WUUA 3TO4D 5CCKL 2EDRA 3IDNA 3OB0H 5SWZD 4Z7WE 3OAZK 1UH3A 1PD6A 4LQFH 2XKNA 4P23C 3GSNL 4PJAB 4EBQH 2R2HB 4LFHD 1H3UA 1NFIB 4Z7UB 1XF5A 3CFCH 4GXVH 3H0TB 4WHYG 3MA9L 2B0SH 3BP4A 2BNRE 1T1XB 3CSGA 1IKFH 3GJFB 5T1DH 3VRIB 4YBQD 3MRGB 4WHTB 4PRHE 5I1GH 3VXSB 1G9MH 1FSKB 3F7QA 3BZ4B 2BFVH 3RY4A 1CD0A 1EEQA 1SHMA 4KJQC 5AUMB 2EDFA 5T3ZL 4F15B 2Y5TB 2NLJA 3CLFH 3H9HB 2XZZA 1T4KB 3KLHC 2J4WL 3NH7H 4GMTL 4NGHL 1ZTXL 2DWEA 3WNNA 1QLFA 5EU7E 4F7TA 3QIWB 3QI9A 1OSPL 4PJFF 2X4QA 3PWPD 5IB5A 2BNRD 2DQEL 3U36B 4OTXL 3NIFF 1XF4A 4FQJL 5EA0L 1KJMB 4YHLL 1FHGA 5F9WB 1HNGA 4I3RL 3ZYJA 3GKZA 1KIQB 1I1AB 1JV5A 1UWXH 3CPLA 3EFDL 3ARFB 1BECA 3K2UL 3JUZA 4P9HL 1RUAL 1IC1A 3FTGB 2HFEB 4PJXB 2BSED 3VGDA 3NIGF 1Y18B 2H1PL 2HFFB 1P4IL 2EXWC 4WUUD 4ZO6A 3FN3A 4XXCA 1R3IH 5ID0B 2VLKA 3HPLB 3PP4L 5DRZB 2CXKA 3REVA 5CEXB 4GAJH 2R56L 4TUOA 5CWSB 2JTDA 2J8UB 1IILE 3CXHJ 4NN7C 1EEZB 4TSCH 4XB7A 1FGNL 3AMKA 5CSBA 1UKTA 4X6CF 3SPVB 4XCYA 4XTRC 3LZFL 4LLQA 3FQNA 1NBQA 4L9DA 2YC1A 2JJSA 3K8MA 1YEFH 2GITA 1CLYL 1R3LA 1U2HA 4I0PC 2UV3A 3UAJD 3OJDB 4R8WL 3TLRA 3G9VA 4Q6IA 2P8PB 1AR1D 4NQDB 5C0ND 5ID1B 3I3EA 4Y5VC 1QG3A 4ZSOB 1IAII 5HHQB 3OJ2C 2K9UA 4XVSL 1I8MB 3RNQB 4AEEA 1A7OL 3MRIB 4HCRH 2ORBL 3S3JA 2FX7L 2FL5B 2VKXA 1ORQB 2HT3D 4X80L 3WSQL 4ZFOA 2DIAA 2XTJC 1VFUA 1SEQL 1O5DT 1JF1A 1KUMA 3OKLA 4MA7H 5I1KH 5B38A 3VXRB 2CGRH 3WS3A 4LVOB 5EZLA 4XAKD 5DD3L 3VWKD 3NOIA 4GKSA 5TQ2L 1A6UL 3E0GA 1KEGL 2B4CH 2OQJA 3GBML 1TDQA 3BDBA 2WBJA 5EZJA 4NWTH 5IBTL 3IGAA 3BEWA 5BMFL 5JQ6L 2P5EA 3LQAL 1CDIA 1AQKH 1U8HA 1J7VR 5AG8A 1RZFH 1X5ZA 1TETL 3BKMH 1S7RA 4S1DC 3X3GL 5C2BL 1JJUA 4JY4A 4M1CD 4M6AA 5LQBH 1IAIM 4EN3C 4MD4B 4MDIA 4ISVB 4P4RB 15C8L 3S35L 1BGXH 4DGVH 2N4IA 4M43L 5BVJA 4LKXB 4IM8A 1MHEA 2YS4A 4NN5B 4QEGA 1YECH 4WCYH 3VD5A 4F57H 3MLZH 3LB6D 3LN4B 5F1SA 2VB5A 1A2YA 35C8H 4L1DA 2AJZA 3CVIH 1LDSA 5HVHC 4LLWA 3HPJA 4QCIA 4RMTA 4G7VH 1N5AA 2EO1A 4LCWB 4G8GA 3HE7B 4H1LB 1JGVH 5KZCD 1FNEB 4OSUH 4RGNC 3SCMA 5F96H 4HFWB 2YN5A 1EBAA 4KJPC 3EYQC 4W4OA 1TZGL 4RIRA 4UQ3B 3PL6A 1NFKA 5IFAH 1FYHB 3QUXA 4IHOA 1R24A 5ITFB 1UZ8A 3VXTA 2EYSA 3U7WL 2LAAA 1ODAA 3UJIH 5HYJE 1H15A 3D39A 1MY7A 4TUKL 4OUUB 3T8XB 4PJDB 1CLZH 1T1ZA 2IC2A 4NN6C 3SDXF 5KVFH 5T3ZE 1A9BA 4UDTA 3MROB 4ONGL 3W0WA 3O4LB 1KLFA 1RK1A 4XVTH 3KPNB 5CD5C 1QFHA 3VFOB 3MR9A 2W9EH 4NQCE 2GTWA 4DK3A 4PR5B 4RGMB 1F3DH 1Q94A 4RMQA 3QUZB 2WBJD 1MAJA 2N1KA 2D03H 1OTTC 1T89A 3RVVC 2P5ED 1DSFL 5J4MA 4QO1A 3OX8A 3KDMA 4ODUA 3Q3GA 1FFQA 4PJ9B 3HZYB 5AEAA 4AENA 1YN7B 1LP9E 3NFPB 5HYJD 2O5XL 2HTKD 1UXWA 4PJ5E 3PGDA 3CZJA 4ZUTB 3P30H 1AIFB 3DGCR 3RDTC 3RVXC 1RAMA 1I75A 1KJ3H 3K8KA 5DXWA 1UYWH 1CLOL 4FFZL 1G7JA 4WENB 3WXWL 3NTCL 3C09C 4N5EC 3QH3B 4KUZL 4M9OA 4OZFB 2HVJA 4OLWH 3D85B 4M8VA 1QFWI 1G9EA 3Q1SH 2MQ3A 4R4FL 1GGUA 5F8RC 5EPMA 3WNMA 1SYVB 2YMXL 2ZCHH 4JLRA 3V9FA 5DQ9A 3CFDA 5DEFA 4O02L 4HUKB 5T1LA 4NZRH 2F9BT 2R23A 4YDKH 2HH0L 1GOGA 1MCBA 4UUJB 4PJ8B 1INEH 2LU7A 3PL6D 2B2XL 3T1FA 2JB6B 4K2UL 3QUXD 4PJ5D 4FZ8L 4MA3B 4GAYA 3FO9A 5HPMA 1ZVHA 3IJHB 4IRZH 3D39D 3DI3B 4Y8AA 5GZOC 4MD0A 4HUWB 1WIPA 5DI8B 5C0BE 1T0MA 3W0WD 2NY6B 4HIHB 4JG0L 5I76A 4U1HA 3PWNA 3OAUL 5IJVB 4Z7VE 2LE9A 1QFWM 1AE6L 2WBKA 4G6KH 3U4AA 1BJ1H 2W92A 4HUMB 1BM3L 1Z3GH 4G5ZL 3DTXA 1ADQA 1T04B 3LEXA 4YUEL 3QI9C 4LSPH 3EOBA 5IV2B 1KCRL 1F6AB 4ZO9A 4Q7DA 4X4MA 3IRPX 2HP4A 1NGWB 4F3FA 4JFDE 5ACLA 3SGDI 1P4LA 4FABL 4I0KA 1BQHG 3LRHA 5DC4B 4N0CC 5L7XL 2W0FA 1EAPA 5D7IA 5GGSB 4DKEH 1HXYA 2P8MB 1E6JL 2AKRB 5LWYH 3U4EB 4HDIB 1F90L 4JY6A 4HS3A 4BH8A 1ZHBA 4WFHD 2Y06H 1NL0H 3D0LB 1IT9L 1I3RB 2VISA 3QIUA 2B1AL 1G7HA 4M93B 1AXIB 4KKBD 3RKDD 5B22A 4YPGB 3W9DA 4QRTA 1KPVA 2UWEA 2CDFB 2DQGH 4X5XB 4O51B 5HDQH 2BVPA 2VXUL 4I5BB 4IS6B 3QJFB 3SJVA 3RTQB 4HWEH 3ZDZF 5CUSL 2R8SH 2Z4QB 4E41A 2V5TA 3MV9D 5C0DB 3C5ZD 1HINH 2UY7A 1BQUA 4JDTL 1PW3A 2EYRA 2X70B 3FO0L 5TDPA 3MRCA 4HK0A 2XACC 4FFVC 4KPHH 3UTTE 3ULUC 1FFOB 1GOFA 5F44A 5F9JB 3W81A 4MQXC 4NO2B 1JBJA 5MEOB 4R9HA 4Y4HB 4O2EB 2JJSC 1IFHH 1JHKH 1DLHA 3X11A 1QYGH 1GGCL 2GI7A 4WEBL 1D9KB 3PXJA 3VU2A 3HC3L 3Q2CA 3TYGL 4Q9RH 4X0KB 3STBA 1MCOL 3B8SA 1QRND 1HYSC 4Z95L 3SDDD 3FCTA 3NCMA 4XVUC 4GRLA 3HCVB 2QADD 5FYLE 1ZVYA 2EICA 2ZSVB 4HUUB 4R4BB 4G6JH 5I15H 2F74A 1RUKH 4LLYA 4YAQA 4HAFA 2AW2A 5JORA 1X7QB 5EG6C 1EO8L 3D0VB 4LHQB 1FC1A 5D93B 5SWSB 1AD9B 3O11A 3LDBC 3P11L 1FSKC 2I9LB 4ONOA 3HMXL 4NQUA 2GT9B 1T03L 5EULV 1ED3A 2Y36L 3U0WL 4JKPH 3IETA 3QIUD 3U0PA 4ODHL 5FHAL 4FTVA 4L8DA 5A2FA 4MNGA 3DV4A 5DJYB 1FZKB 3H42H 1EZVY 4NZTL 1YJDL 4M9PA 5T5NF 3B9KA 3CSPA 5E8PB 3QG6A 5IM7A 3SJVD 3GNMH 2EE3A 1U8JB 1PJ9A 3QULA 5CIPH 5TGBA 5F1OB 4P2RE 1BIHA 4HHAB 4JGMA 5D1QA 5JR1L 1KLGA 1X5HA 3L3GB 1ZGLM 4K8RH 4POZD 4DKDC 1IC7H 5C0RL 3RPIA 1CG9A 5E2TL 3ESVF 5F9WC 3WFEL 3ZE0E 3KYMB 5GIRB 1DBKH 4YHNB 5TQ0H 1JPTL 1YNLL 3DRTB 3IXAB 3SCMC 1YEEH 1SJEA 1XFPA 4RMUA 1TENA 1YMMA 4PRAB 4WGWB 3DO7A 2DQJH 3CU1A 4CMHB 4FXKA 4W4OC 3CDYA 4LHUB 3EYSL 1JPFB 1LK3H 2PW1B 3E6HB 5AZEL 3RPKA 1KXVC 1MCIA 3MJ9H 5C08B 4M1DH 4ELKB 5DJ6B 3QT2A 4JQVA 1UM5L 4YPJA 3V4UH 3FRPA 1NCWL 3FQRB 3ZKQD 1P4BL 5J13B 1N4XL 5E94B 3C60A 2BDNH 5H94A 4NJ9H 4XPTL 1BQLL 2XG4A 4MQ7A 4K3JL 5IVZB 3C5JA 3RL2A 4S0SD 4P46B 5H2BB 4Z77B 4KTDL 4OGYH 3IKKA 5TDOB 5JW3H 3LV3B 3GI8L 1G6RL 1U0QA 2IAMA 1KIRA 3UTPE 1MI5E 3MLVH 2E6QA 3NABL 4QWWD 3ARSA 3MUGB 1ERNA 4YXLL 1FO0H 1OW0A 4H8WL 1V7ML 1INQB 4FG6C 5TE7L 1FE8L 2NZ9D 2P44B 3WD5H 5DMYA 1FYTB 3H3PL 4FTVD 5I18L 5DD6A 3SOBL 4QRRA 3I02A 5B8CA 1NC2A 2Z0BA 1LHZA 3B9KD 5GRYA 2EIBA 4J8RB 5CCKH 2F53A 2EIEA 1HH9B 3MRLB 5SX5H 3VWJD 1D5XB 2P1YA 4F8QA 3KPLB 1AY1L 1KPRA 1XR8B 2ZSWB 4OF5A 3HRZA 3ZDYE 4PJCA 1MFEL 4BKLB 5C9KA 1XF2A 3MA9H 1CT8A 1UZ6F 3MLXH 4V1DD 4NRXA 3C6LD 4ORGA 5GISH 3ARBB 3O4OB 2DIBA 4HJGB 1DQDL 1BEYL 4MD5B 3O3BA 1I8KB 4M8QA 4MJ6B 1TZHA 3AY4A 5ILTL 1ZLUK 1C1EH 2FECL 4TPRL 2DM2A 3S37L 1D5MA 5T3ZH 1OP5H 4H26B 4U2YA 1MCPL 4AYFA 2DN7A 3SKOB 2J4WH 4XNQB 1QLEL 1QBAA 1U3JA 1OB1B 5HY9B 2X7LA 3GMPB 5GJSL 2DQUL 4L8CB 1J8HE 3DIFA 4MJID 1OD7A 2DQEH 3HE7C 4KK8D 1GGBH 3NCEB 4YC2B 4L4TE 5JHDE 1VGKB 2F58L 4FQJH 5EA0H 1FIGL 1QHPA 5HI3C 1FQ9C 1M7IB 2O93L 2FHFA 3CH1B 4YHLH 1OM3L 5DD5L 2HG5A 3S96B 2DQIL 3D1MC 3EFDH 5ISZA 1Q9WB 3FFDB 4P9HH 1RUAH 3LOWA 4RAUB 5TFSL 4S1QL 5GGRB 5JUEH 5MEQA 4TVSa 2OYPA 2BHYA 4HLJA 2H1PH 2ADJA 2EDKA 2MNUA 1P4IH 3A67H 1LO5B 2OLDA 4U7SA 1JMXA 4CBPA 3P77A 4PGDB 1C08A 1VGEL 5E70A 1YUHB 1A4JA 3PP4H 2OXGA 2R56H 5K59E 5KSBA 4L4TD 1WZ1L 4JKMA 2AVGA 4RGMC 1BZ7A 4POYA 1A3RH 3IKCB 4AT6A 4YHKL 3OKDA 4Q6YA 3N0PB 4U6XA 1F6LL 1I7TB 1KXTB 2A6IA 5IVXB 1CLYH 2BNQE 1C7TA 4WW1B 5DZOA 4PJ9C 4WFFE 2JCCA 4R8WH 5FA3A 3P9MA 5D1ZB 5TDNA 1EGJL 4KJWC 5E2UH 2BSSB 2C1PB 3P4MA 5F6HI 4KK5D 4K7FB 3OJMB 4XVSH 1AXTL 1A7OH 3LN5A 2ORBH 2FX7H 4MWFA 5DURD 3G5YA 3VE0A 4YBHA 5D96B 1IGTA 1MFCL 4X80H 4D9LH 1SEQH 4PLJC 3LKQB 1WC7A 5A2JH 5HYEA 4GRMA 5FEBA 4GRLC 5DD3H 3STZA 5TQ2H 3MSPA 1A6UH 2LU4A 4CJ1A 1PSKL 3IAGC 4G9DA 4E0RB 5DHYA 2BNQD 3GBMH 3UBXB 1BBDL 4PY7B 5ISZD 1HHJA 3BMWA 4KY1H 5DJXA 5IBTH 1JTTA 3T77A 1EHNA 5JQ6H 2PTUA 2E7LA 2ICWI 3T0VA 2VLJA 3OGCA 4LCIL 4UZGA 1P7KA 3VI3E 1WBXB 1GPOH 2DLGA 4UTBL 4HJ0D 1XF3B 4JHWL 5C2BH 1ZT7A 2NPLX 3PNWA 3X3GH 5CINH 5EBWB 4JFEA 1X5GA 1SYSA 3QXDB 3DUUA 2YKLL 4JQIL 2P47B 4YHOL 4XRCB 4XPHH 3UXFA 4Z6AT 1KIPB 2EE9A 3MACL 5AZ2H 3HR6A 4J4PC 2G9HA 1MWAA 3RA7L 5DLML 4R7NB 2H3NA 5GS1A 4DFIA 3EOAB 1FBIH 2DI8A 2FH6A 1J0YA 4JAMB 4M7JL 5CJXA 4XBPB 3CDCA 3C6SA 5D1QC 3VJ6B 1DCLA 5I17A 3D69B 4K23H 2A73B 2FIKB 2HRPH 4O5LH 3QZWB 1AQDA 3QUMB 4JFHD 1OAXH 3NN8A 2EH7L 4WIQA 5TF1L 1VEOA 3Q5OA 3UP1A 1S78D 1K8IA 4LMQE 3U7WH 5FYLH 4NJAH 4ZUWA 3RKPA 5DRXB 4CJ0A 4MS8C 1BMGA 3V8OA 2WNGA 5HBBA 2ZUWA 1CZ8H 3HR5B 3TNMB 3FRUB 4HW6A 1YYML 4ERSL 1AGEB 4JQVC 1DVFB 2NY3C 4WFEE 1VHPA 2FBJL 2GAZB 4FHBD 5DVLA 3T0EB 3C60C 1U91B 3WL9B 5C0IB 5ICXB 4IRJA 5A3ID 5DMIL 4GSDL 3U9UA 2WW8A 5D7LE 4E9LA 1YEGH 4KROD 3EAKA 5D7SL 1S7XB 5CSGA 4M48H 5IMOA 1A7BA 3ZYZA 1CL7I 2IAMC 3F58L 3GGWB 4NKDA 5L8LB 4DVRL 4ZPTB 1D9KC 4M7LL 2O5XH 5CLTA 1OW0C 4OZIB 3GK8L 3MO1B 3FZUD 1IAIL 4IMKC 4RMVA 2GTZB 4QOKD 5DC9B 3VA2C 1CLOH 1DZBA 1U6AH 2O61B 3OV6A 4WFED 3WXWH 5C8JA 4KUZH 4R4NC 1FNSH 1LE9B 3JVGC 4QLRA 2C7UB 4R4FH 1RPQA 1BQHB 3QNYB 2QSTA 5I66A 1QR1B 2YMXH 5HGDA 3GJFK 2X4UB 2I9TB 3DYMA 3BPCB 5D93C 1U8LA 3S3PA 1Y0LB 1DANU 3TO4B 1DEDA 1CXKA 5IEKA 5DEGB 2D31B 2B2XH 5D4QA 1R3KA 3ECBB 3QEUB 3QRGL 5SWZB 4LNVA 2DD8H 4FZ8H 4YXKH 5KS9A 5HDBF 1PYWB 2CD0A 5E08H 5IVNA 2XYCA 4R90L 4BSVB 3JZ7A 3AY4C 4HIXL 5KVDH 5ENWB 3F7VB 4JG0H 3TCLA 4KI5F 2R0ZL 2VN7A 3OAUH 4JM4L 3TFKC 3MOBL 5EUOB 1U8MA 1AE6H 3M07A 1NBYB 3VD3A 3Q6FA 5E5MB 2OR8A 4G5ZH 3U0TA 2HYMA 4X8JA 5IB2B 1QOKA 1N3NB 5IBLC 4ESKA 4YUEH 3JV6A 4TRPH 3MREA 1KCRH 2SEBB 1GGYA 1WITA 5CFHA 1DQLH 5F71A 4Z7WB 3SKMB 1VB9A 5I74B 4FABH 1KJ2A 3DI2B 4BQCA 1UH4A 2XXMB 5L7XH 3B2VL 2QL1A 2FYYB 2X4NA 4RISL 3WHE1 1NGYB 5E8OB 3S6CA 1F4YH 1KN4L 3L6FB 4P5MB 3PWPB 1PBYA 1G7LA 3O41A 2BNRB 3TWCL 1FVDA 1IT9H 3I50L 2QQNL 4KKCD 5F7MC 2B1AH 3QYCA 2ZOKA 4HKXB 4QNPF 3DXAA 4WY7L 2AV1A 2DTMH 2VXUH 4BSWB 1FN4A 3VFSB 1S7VB 4OM0L 4UMGA 4PJEE 3QQ3B 2FX9L 1SY6L 4NHUA 3ORJA 5CUSH 3VXMA 1AGBA 3JWOL 1ITCA 2VLRE 2EDNA 2YD6A 4PV9B 3IF1B 4JDTH 5CJOL 5ESQA 4UT7L 5C7XH 1R5IA 3WIFB 3RWFB 1OCWL 1ZLVK 4G43A 4JHAL 3QPQC 3CMOH 3ZL4L 3O2VL 1E4WH 1OPGH 2ADGB 3L7FA 2C1OA 3AXLA 1CGWA 1GGCH 4WEBH 3CSYA 3PDGA 2QV2A 3NMEA 1ZA3A 3TYGH 1JK8A 3VXNB 3HE6D 1T7XA 2NY1D 2V9RA 1YN6A 3WNKA 2HT4D 4Z95H 4PP1C 2W59A 1PFCA 1FG2A 1HHKA 3QWOA 1UXSA 5F21B 2Z91A 3U30B 5HHNA 1YPZE 5GJTL 1KJVA 2D3VA 1BREA 4PJIF 3AREA 4PGEA 1QFWL 1G9MC 43C9B 4NM8L 3V0VB 4N0YL 3MV7D 5J7CC 4JZJA 4L4VE 1TMCB 4OFKA 1JRHH 3MRHA 4ZYKA 3ARBC 5GSRB 4LDLB 3I9GH 4WWID 2YUWA 2AJVH 2I60H 4RRPG 4NZDA 4QXWA 1PAMA 2ATPA 3WJLA 3QDGE 5I1JL 1Z0NA 2AEPL 3HMXH 3JV0A 1J05B 3SO3C 1DBJL 5IB5B 3U0WH 2WAHA 3VWKB 3LIZL 4ODHH 4C57C 5FHAH 4YJZL 5ICYB 1M7DA 1XH3A 4JFYA 2PYFB 4NZTH 1YJDH 5FYKL 5J0BA 3PXHA 2NNAB 5D5ME 5B3JE 1PZ5B 2PKDA 3MRJA 3VMNA 2V5RA 1B90A 3L3HA 2Y72A 5JR1H 2FO1A 4YC2C 4L4VD 4BFIB 4M7ZC 1FPTL 3BOVA 3SGKA 5C0RH 3O2WL 2F19L 4HUVB 5E2TH 5GS1C 1YNLH 4I2XE 4WTWA 1DL7L 5LCVH 3QDGD 4U1IB 3KNBB 1ITBB 4MVBD 4L4JA 3TVMA 4HEME 4JFFD 1S5IL 4NM4L 1CXLA 5I9QC 2XN9E 2FLRT 3BP5A 4G80B 4YHIA 1MLCB 5C1MB 5HYQB 5KZCB 3PG2A 4P5KB 5SV3A 1CE1L 2ICCA 3IDMA 1NCWH 1HXMA 1P4BH 1U3HB 2BMKB 5I1LA 1T6WA 1N4XH 3OJVC 2FJGB 3ARED 3DROA 4Q6IB 1FFRA 4XPTH 4K3JH 4ENEC 3QDHA 4DGYL 5JTWA 5ALCH 1T5XB 4K07A 1MIMH 3FN9A 3IDIA 2DQCH 3GI9H 1G6RH 2BC4B 1A6VL 2MCPH 5C6PB 4NC1E 1S5HB 1BQSA 5IHZB 3NABH 1H8NA 1N8ZA 2NY4D 2Z92B 1CFSB 4IRJC 4YXLH 4YQXH 2FHCA 1ONQA 4H8WH 1V7MH 4I3GA 1AGCB 5DUBB 1FE8H 5TE7H 3OR6A 1NBVL 2R1YB 2OCFD 2IBGA 3H3PH 4KJYB 1DEEB 3RY5A 4F7MA 5I18H 5IFJB 3SOBH 3K4DA 2OSLA 1JIBA 2VSDA 4D3CH 2A2QT 4OAWB 3V4PL 3WNPA 5HD8C 3UCRA 1HHGA 1KELL 2Y6SC 3DX6B 1ZGLP 4GKZB 4CAGA 3QIBA 1TVBB 5GSVB 5B39B 3GSVB 2A6DA 3ZE2F 3MRRB 1AY1H 2IQAB 5KSUA 3TV3H 5C09E 5FA4A 1QSEA 4PJ7E 1S7SA 5HYJB 3RRQA 3OQ3B 4YHML 32C2A 2NY0C 4OCRH 3V8CA 5HI4C 1MHEB 4I18A 3TVMD 3VH8B 1DQDH 3X12B 1RZKH 1BEYH 3RWHA 5EU6E 4DUWA 4YZFE 4NQCB 4AIXA 2Z35B 4UBDC 4XH2A 5F88B 5ILTH 5KW9L 4MA1B 3RIAK 3S37H 3X13A 3GRWL 2HKFL 2V9QA 1MHPL 5INCB 1MCPH 2CLVB 4TTDC 2JK5A 4JFOB 4OQTA 3BHBA 5D2LB 3ET9F 5GRVK 3CZFB 1IJ9A 4QHUB 1YDPB 2DQUH 4UIMA 4D9QE 4EUPG 1LP9B 1T7YA 2XQBL 4NNXA 4PJ5B 1R24B 1QACA 4PUBH 3MJ9A 1CDGA 3LQMA 4JO2H 4U1NA 4YR6A 5HGAB 4WW2A 1OM3H 1OF2A 3QXTA 2VLME 2XWTB 3BESR 2COQA 3I3DA 4OZHF 1N0XL 4X6EA 4LU5L 5EWIL 1ZHLA 3K7UA 5TFSH 5C0EB 3ARYA 3GSOA 1OAQL 5DEZA 3L95B 4LNRA 1CYGA 2VQ1B 1KCLA 1WLHA 1J9CT 4JM2F 5FK9A 3RUGF 4LVEA 5I8KL 1G7QB 4CN1A 1FO0A 1VGEH 3E2HB 3ULVE 3D18A 3FONB 5EU4B 4QYOA 4PP2B 4PB0L 1U8NA 2YSSA 1QSED 4PV8A 5FYKE 1WZ1H 4PB9L 5I1DA 1LE5B 1J1XL 5I0DA 3GSWA 5IB4A 4JPWL 4HS6B 2VLMD 3VW3L 1RFDL 4H5SA 4M3JA 1I8IB 4QHKJ 2E3VA 5AD0B 5C07E 4YHKH 4WTZA 3U83A 5B4MC 2VO5A 4MQTB 3U46A 1LDPL 3A6CH 1OWWA 4XP9H 4Z7VB 3GSNA 4N0UB 3RVUD 5DVMA 5GS3A 1RZJL 4X9BA 3FQWB 1EGJH 1YNKL 4MLIA 4XPGH 1PKQA 3FB7B 3CFDB 2WWMC 3MFFB 2I5YL 2IF7A 5JQHC 5H35A 3SDAA 2QJDA 3MV9B 3C5ZB 1MEXL 4X6CA 1B0GB 4PJFE 4JFDB 2IADA 4LSTL 1ND0B 4MNQE 5EN2B 3BAEL 1MFCH 4MA8L 1GZPA 3NIFE 4OB5L 3AROA 3TBYB 3QXVA 4OQ1A 2EDWA 4XCEA 4QRSA 4GAYB 3U4BL 2K7QA 1Y6MR 5C07D 4GMSL 5F7EH 3GSUB 1PSKH 3H9YA 4NNYA 1BBDH 4XWOD 3H6JA 3NIGE 1QRNB 4JO3H 3MRMB 3SDDB 4DVBB 2UUDK 1T0PB 1JGEB 1S8DA 1I9IL 4JZJC 2QADB 1F02I 1YNTA 4AIZA 2I07A 4LCIH 4QHMA 2NY7H 3QEQA 3B83A 1TITA 4UTBH 5EZIH 3SKJH 3DHMA 5LBSH 4U1LB 3ILQD 1A6ZB 1TVHB 1BX2A 2JJVA 2X4OB 4YK4B 2R2EB 3BT2L 3MC0A 3UTSE 1Q1JH 2D7OA 1KTLA 4IJ3B 4HMDA 1LEIA 5I30H 4RWYL 4HLZH 5JZ7C 5LGJA 2P5WE 3D9AL 1IEBB 3I6GA 1BF8A 3IYLW 4RNRB 3WN5A 2DL2A 4O2FA 1LQSR 1BBJB 4X6FB 3LD8B 2FIRT 4XP1L 1QLRA 1FL3A 3K1DA 3TBVB 1GL4B 1RZGB 4M7JH 4PS4L 2E27L 3OKNA 4U1KB 5CJQL 3BRDA 5J11B 4RX4A 4PBXA 3V5DB 2ZCKH 3RX8A 2W91A 5JIHA 2HAZA 2WINB 4ODTL 1FVEA 2A83B 4JPIA 5DJCA 5IJKA 4OZGE 4HWUA 4KRMB 3T3ME 5GRJL 3SDAD 1F4WH 3BDXA 4X6DA 3MRQA 4R97C 5DQDH 3OWEA 5C0FA 4KKAC 4G3YL 2ICEB 3MRCB 3VFUB 3J8F7 4HLZG 4BH7A 1FNLA 3BIAX 1I9JL 1ZWIA 3ZKSD 4HPOH 1YYMH 4ERSH 1QR4A 5C0BA 3STLA 2VXVL 3KYNA 2ERJC 2XT1B 2FBJH 4AK1A 2UYLB 3WFBL 1IQDA 3NPSB 4YGAB 3R4DA 5HVWA 4PJHF 4U49A 1A1MB 4ETYA 4LPTA 1FAKT 5TE4L 5D7SH 5EU7C 4HQQL 1EAJA 4K9EL 5GRUH 3WIHL 2CUMA 3QEQD 3EHBC 3OB0K 3CFJB 3F58H 4P2RB 1NAMH 1JZ6A 1GZQA 4DVRH 1KB5L 3SDXA 5JXEA 4G6FD 2HLFD 1A1NA 4X4ZA 4M7LH 4CN6A 4WU7A 3GK8H 3RVWC 3O3EA 5IOPB 2X4PA 3O6ML 1HI6A 3ZKNC 2V7NB 4QGYA 5BCAA 1HWGB 4QRPE 3TIDA 3U30C 5DJDB 2CMRH 3L3IB 1KCUL 2EDBA 4OCSL 2C3WA 4QRUA 1FL5B 2ZUQB 4OCWH 3MBED 3AGVA 4DN4L 1FZJA 2BSRB 2NY5L 2R1XA 2RBLA 3QIBC 4GW5A 2Q7YA 2GSGA 1U8QB 1F13A 3L9RB 3P9LA 4KWUA 3MRFA 1HH6A 3P4OA 1UM4L 2C4FU 4P2OD 1A9EA 2DLFL 4QTIH 4V2CB 4KRPD 2RFXA 4JO1L 2N7AA 3QRGH 4XMLH 4K94C 3VWJB 4MX7B 2HTLD 1R0AL 1BFTA 4NC2B 3ARGD 1FCCA 4W4NA 4YO0B 4K8RC 2CIIB 5IW1B 4AH2B 5I1IH 5DWUL 2ARJA 2B5IC 2R0WL 3VXQA 4V1DB 1LEKA 1NFDE 2R0ZH 4LIQE 3T65B 4CADB 4N9OB 4JM4H 3C6LB 2E9IA 1UWXK 5J6HA 2VXTL 1L0QA 4IIQA 1XGUB 4Y16A 3HZKB 3WMSA 1OP9A 3QDJA 2X4SA 4AM0A 1MSPA 1RIUL 4M1CC 1X5JA 3NIDF 4JRYA 4KQ4H 4Q58C 3VDAA 4PGCA 1DBBL 4K55A 5TH2B 4FFWD 1DQJB 3UTQA 3V6ZB 4CVUA 2JIXA 5ELIA 5CEYB 3CC5B 1I7ZA 1WVZA 1WWBX 4WW2C 5KSAA 5BRZE 4UOJA 1AKJD 3O3AB 1SJHB 5L2KE 2QKIB 3WHXA 1KN4H 4MJIB 4GG6E 3FT3B 2QQNH 3L5WA 3U9PL 4XP4L 1U3HC 1W0WB 2Q87A 4LVNC 1A6WL 2VMFA 1MAML 4WY7H 3VA6A 1MVUB 3QUKB 3KHOA 4WI5A 4OM0H 4MSWA 3N9GL 2EEAA 3BGFB 4E42A 1ZT4B 2FX9H 1SY6H 5DD6B 5IG7B 2VL5B 3EYOA 4GKNB 2BNUA 1EPFA 5I1HL 4WFGE 4YIQA 1Q9KA 5CJOH 3W9EA 1S9WB 4UT7H 2GFBB 1OCWH 2VZOA 3DYOA 2Q8AL 5BZDA 4JHAH 4XT1C 1CL7L 4JFZL 5F1NB 1J8HB 1KCVH 3O2VH 3CIQA 5JPMA 4L4TB 4XBGB 4MB3A 4X9IA 1RUML 4G9FE 2CRIA 3QO0B 3U6RA 4ZAKA 4GRWF 3RJDA 1JI1A 3SEPA 5ICZA 1BLNA 3S36L 2QEJA 1FZOB 2FDBP 1UWGH 2AEQH 3NFSH 5GJTH 5FO8B 3RGHA 5I0ZA 4U6TA 4JRYD 3QNXA 4NM8H 4RWHA 3HAEH 4N0YH 1ACYH 2DLHA 2FH8A 5JLZA 3MA7A 4NYLB 1A4KA 3MGOA 5HHOE 2WZPD 4P49A 1JWUB 3KPMB 2VH5H 2WM0A 3B9DA 4L29A 3CXDL 3IFPB 5E1AA 3GM8A 1MI5A 3EJZD 4NHCL 4JO4H 5I1JH 3IDJA 2AEPH 1WCBB 2Z31A 1B3JA 1DBJH 5DTFB 4I8DA 3ULVH 3EIFA 5D1XA 4JQXC 5EOQL 5E6IA 4OGAD 1A7PL 2EZ0C 4POUB 3KPTA 3ZDZE 2BNQB 1CD1A 4NO3B 5FYKH 5ISZB 5HXMA 2YOCA 4DAGH 3TH3T 2IH3A 5HGHA 4NDMB 4P9HC 4JN2B 1OAYH 3G6JE 3V4VL 5D8JH 5GGSY 4WUKH 2OXHA 2F19H 4AL8H 2WMPA 3WN5C 5JOPD 4NPYB 2P7TA 4P48A 4AMKL 3ISWA 1A4JB 5EBGA 2DKMA 3SGDH 1NJ9B 4DFHA 4CDHA 4UQ2A 2Q8BL 1A47A 1JHLH 3DHJA 3P4NB 4ZAKD 3PQYA 4IRSA 1UB6B 1KNOA 3JSSA 1NEZG 2AJ3B 2NW2B 3ZLQC 4GQ9L 1RHHB 2R1WA 2GJJA 3QNZB 1CE1H 5D2NE 3TZVD 1U95B 1LK2B 1IRAY 2ZUVA 2PTVA 4OIIL 5EOCL 3G04A 4Y88A 4H20L 3HUJF 5CZXC 3PWJA 5ADOH 3LMJL 5B3NA 4Z18A 4DGYH 2CKNA 1MCRA 3PHQA 3BH9A 3O8XB 2OJZL 4X4YB 3EYVA 5DFTA 3G5YB 1L4IA 1A6VH 2ESVE 1QKZH 4HIEA 1AHWA 3BW9A 2Q76B 5E2VH 1J86A 5JHDA 5EO0A 2W07A 5C0JA 3F8UB 4DEPC 4JJHA 1C5DA 3KR3H 2R0KH 5E8NB 3UBXI 1NBVH 4GKOA 3S4SB 2X4TA 2QR0B 6FABH 1E28B 2XZQH 3W2DL 3HN3A 2D4DA 3V4PH 5JXEC 1HHJB 1P84K 3FQTA 1PG7X 2V2XB 4KC3B 1MH5B 3HMXA 1SEBB 1A7NL 4HF5L 3O6KL 3LQAC 5DHVH 1MNUL 3TBSA 3QXWA 1K4CA 2ESVD 4G8FA 4AEHL 4LCYB 3RL1A 1QBBA 4AG4L 4MCZA 2IG2H 4YH6A 2ZKHL 1AGDA 4DN3L 1HHHB 4ZFGH 4ONHA 4QOKB 5DDHA 1SVCP 1HWHB 2BXZA 1CK0L 3ULUF 3K80A 1IM3A 1MWAB 3RY6C 2BRQA 3WFCL 4PREA 3QO1A 1BZ9A 1TXKA 4YK4C 4JCMA 1F4XL 2HKFH 4Y19E 1MHPH 2Q1EA 4S10A 5I17B 3DUSB 3MRDB 3FFCE 3H7BA 3BVNB 1E4KA 1ZAGA 5T3XD 3LD8C 1EO5A 1VESA 3QDME 2UZIL 4C83B 4A6YH 1AGFB 3QA3B 4ZPVA 5IIEA 4Y16C 2D4FA 4DQOL 1NUNB 3MRBA 1JFQL 4LK4A 4TVPD 4HIJB 1JVKA 2NTSP 3MJGX 3R0NA 1N0XH 1ZA6B 3OL2A 3JWDH 5T1MB 3TN0A 1DQQB 3MLTB 4LU5H 4FQ1H 2XWJB 4ELMB 2CUIA 3CCHB 4LLUA 1OAQH 3ZTNL 5JDJA 3HLAB 5EORL 4L3CB 4POZC 1G6RA 1RQ5A 2Q6WA 5KSAC 3T0WA 2VE6B 1UA6L 3FFCD 3F12A 3O0RL 1ORSA 5I8KH 1QVOB 1HSAA 4P9ML 4PLKC 2FZ3A 1MRDL 4QHLB 5DUPL 2QHLA 3G6AB 4LAJH 2PW2A 1FV1B 5IB3A 5M94B 1I9RL 4EVNA 3L3JA 2GW5A 3QDMD 4ZFFB 4PB0H 1MJJA 1LEGA 3PWUB 2IH1B 4U1JB 5BQ7A 3GMNA 1FORH 3QUYA 4PB9H 3RJQB 3ARDA 3NPSC 1J1XH 5MP6H 4JPWH 1WTGT 4IOFD 5F9OL 2AERT 3FB5A 4NKIH 3RZCB 1GHFL 1G7PA 2FSEA 1LDPH 1NGPL 1LO0H 4F2MA 4EUPA 5DUML 2WQRA 1RZJH 4PRPA 5FYKU 1VA9A 4PJXF 4F80A 1WT5A 5HI5D 4M6NL 2VDMH 4LIQH 2ICES 1XEDA 5I6XC 4G6AD 3BPOC 1MEXH 4XBEL 4NT6A 1ZHKA 5CD3A 4LSTH 4YHZL 4OB5H 4U33A 2OJEB 2ZUQC 4K71C 4FOMA 4LCCC 1NCAL 1JHTB 3KPQB 3PJSA 4N0FB 4P59H 4TUJA 3GHEL 1JF6A 3JTTB 2CLZB 5JMRA 3BRGC 1QSFA 2E7CA 1K4DB 3MLRL 4I48B 3QPXH 3LKNB 3HE6B 3D25A 1H0DB 2NY1B 3W11D 1BJMA 5J06A 3GDBA 4GW4A 1I9IH 1EJOL 4PJEB 4URTB 5D7LA 2H26A 5FF6B 5J1AA 1B2WL 4JRXE 4WO4A 4PRDB 3BQUA 1IL1A 3K4ZA 1E27A 3VFMB 5L8JB 3DMMA 4EXKA 3FN0H 1YZZA 3HG1E 5EZOH 2OP4H 2Z31C 2LQRA 1T22A 3MV7B 4PY8I 5D1XC 1KB9J 4P5TB 1B4RA 4RWYH 5J3HC 2P45B 3D2UD 5E6IC 5MERA 1KLUA 1XCTA 3QUYD 4QT5A 4JREB 3ARDD 3NGBC 1V7NH 1C12B 2BRRH 3LKOA 2MKWA 4GW1B 2X89A 2A38A 4XP1H 5IGXL 5JW4Q 4Y4KB 2P46B 4PS4H 1NMCB 2E27H 3GIVA 2ZOKB 2V9TA 4FQPA 5ESVA 3V6FA 5E9DA 4HH9B 2YUVA 4PRPD 2HVKB 1BAFL 1YPZB 4JRXD 1F97A 4O4YL 2VITB 5IT2H 1TPXC 3HG1D 5C0CD 3IDGA 3M17A 4PRNB 3UYRL 1DANT 4KK8C 4L4VB 5GXBB 2AJYH 3WS6C 3IJYB 4NQSA 3IAPA 4CL7A 3EO0B 4G3YH 4IRSC 4O58L 2CPCA 2PO6D 4GG8A 3HC0A 1P2CA 4HFUL 3B9EA 4HEPG 3QDGB 3DV6B 4U1SB 2BSTB 3BGFC 2OTWB 2CUHA 5I2IB 4JFFB 3VRJB 2X9XA 4ZD3L 2D9QB 2VDLH 1NAMB 3WFBH 2CLRA 2VJXA 3O9WB 1EFXD 4KKLD 3N06B 1TTFA 1MJ8L 2IANE 3L3OA 5EFIB 4LP4A 3BP7A 4P3CH 5C9JB 2NMSA 5E4IA 1E4JA 3QHTC 5D5MB 1NPUA 4K9EH 2AS5M 2M8XA 3FT4B 3V0WL 1QHOA 2DKSA 4JZNA 1AHWC 1S7WA 4OFPA 1H3TA 3TA3A 4QF1B 5EO9A 4MXQD 4DOHB 3DVGB 4MXVF 4I2XB 2WQ8A 3MNZB 3KLSA 4Y2DD 1TZIA 4LAQL 5HHMD 5C70A 2YBRA 4NWUL 4WI8A 1KCUH 2NY4B 3RGVA 1ZLUH 1JZ8A 1BWWA 1P6FA 1M1SA 2Z8SA 4DN4H 4FQ2L 4HKBB 1EH9A 3VFRA 2YN3A 2UWEF 1BD2D 2IAND 3Q48A 3BISA 4ZSOE 1P1ZB 4CMMB 2VIRB 1UM4H 3PV6B 1CI5A 3ILPA 3QFJE 1OP5K 2DLFH 2APWA 1JNLL 2VLRA 1U8PA 3GMQA 2CDEA 1YJDC 5ITBL 5JHLL 1P9MA 3HZMA 1P7QA 2IGFL 4B50A 2OZ4H 1HILB 2PCPA 1I1FA 4XPAH 3BJLA 4UNUA 5L8KB 5I8EA 3FQUA 4LCUB 4MAYA 4K3DL 1ZT1A 4KK6C 2R0WH 2Z9TA 3DURB 2PETA 4CKVX 4RFEB 2NW3A 2BVOB 1T2XA 2BCKA 5CMAB 3TVMB 5DJAB 4I77H 1L9MA 2VXTH 4PJBF 5KVEL 2QHRL 4ZTPH 3R06A 1RMFL 3SE3A 3PDOA 4K3GA 2EDJA 3QFJD 4XC3L 2YPVL 4P2QE 4G6ML 3QEHA 1E4KC 1DBBH 4CVXB 3RWGB 1ZV5A 5I73B 2MOVA 1RZIB 3IDMB 1G1CA 1C5BL 5DZLA 5FM5M 4UT9L 1F8TL 5C09B 3TA3D 5F3BB 4D0BA 1R5WB 2CXGA 2MWCA 1CFVL 2AXFB 5E8DL 1BWMA 4XP4H 2A9NL 4YHPB 4Y5XA 4OKVA 3RGVD 5DMGC 1A6WH 1JWMA 5GGUA 2ATKA 2PXYA 3PIQA 4J3TA 4H8WC 1F00I 2IBBA 2DS4A 3BZFA 1XT5A 2VRAA 5KVGL 3O8XC 1QBLL 5CS7A 5I1HH 2XKSA 1BFVH 4WTXA 4XX1E 5DHXB 5AWNL 1MELA 2BY0A 4JVWA 3QQ4A 1X5XA 3UYPA 4PJDE 1I7UA 2H9GB 3O4LE 1CL7H 3Q5TA 4JFZH 2BVQA 5ERWB 1VADB 3MCKA 5F6IB 3DSNA 4KI5E 5DS8A 5DO2C 5CP3H 4YDIL 2J2ZA 4ODXB 2BXYA 5K33A 4EDXB 1C16A 1HE7A 4KVNL 4DGIL 3HAEB 4WWKD 2AXGB 1WT5C 3S36H 1KF9B 4ZS6D 2APTA 3DETD 2CIKA 2F54E 3RWHB 3CX5J 4NO0A 3S5LA 3VD7A 4HZAA 5HHPB 2VUOA 3IXTB 4NUJA 4CU7A 4M3KB 1CFNA 5AG9A 2ITDB 2WWKT 1YY9D 1GXEA 1X5KA 4MZ3A 5F1KC 5DFVC 5IBUG 4J3VA 2NXYD 1UB5B 3SDCA 1N0LA 3MYJB 2NY2C 5LG1A 4LPVA 3MV11 2RB8A 3V5HB 1EVTC 2R4RL 3CXDH 3C5SB 1QPPA 4OD1H 4CUCA 4QY8B 4KI5D 4JANB 3F7YB 4KVCH 4R0LB 4NHCH 3V5KB 5JOFA 3H9SA 3N1PC 4MNHA 4QNPE 3L3KB 3BH8B 1NC4A 3EZJB 1ZSDA 3O45A 5C07B 4GUPA 3QEGL 4LF3B 5HVGB 1N2RB 2R9HD 1A7PH 3GMOB 2X5PA 4WO4C 4HG4J 3BQUC 4YFLF 2MJWA 5JA8B 3DMMC 5D9SB 3QFDA 3DRQA 1N6QL 1TNMA 1H3VA 2NXZD 3QCVL 1UT9A 4U3XA 1B0RB 3GMRB 4YDLC 1U8IA 3V4VH 1EK3A 1F3JB 2BOBB 3NZ8B 1X4XA 4ZS7L 1T2QH 4PJFB 2V2TA 5JXAH 4C56D 1UVQA 2XKUA 4AMKH 4FMFA 3F5WA 1YY8B 4PJ7A 5FGBA 3WFZA 1JTPA 5FOBB 1JGLH 3LKPA 4PJCF 2ARJQ 1SY6A 1Q72H 3MNVB 1JNNL 1BJ8A 4F37K 2FR4A 4GBXB 1F58H 2JJTA 5HDLA 3LRGA 5EU6A 1U58B 1MJ7H 4PJIE 2VDQL 3MPCA 5DD1H 5ESAB 4JDZA 4NO0D 5KSVB 2KKQA 4OFYD 4U6YA 4Q2ZA 4Z0XA 2VZVA 1TIUA 1CGTA 1IZJA 1DLFL 4LQFL 4OIIH 5EOCH 4LLDB 4OCLC 5JMOC 1E6OL 5DJ0A 1EXUB 1CFQB 1RD6A 5FCSH 3LMJH 1D5BA 1OQXA 2Y9RT 1T21B 3DGGB 3CFCL 4GXVL 3TJHC 5KTEL 2HT2D 2B0SL 4PTTA 1U92B 1IKFL 3RZCC 3T0BA 3UTSB 3E3QC 4YE4H 2WSKA 5GZNC 4RMRA 2OTPA 5I1GL 2P5WB 4ODWB 1G9ML 3A6BH 3MXWH 3RX5A 1CGVA 4OBRA 1PX4A 3JUYA 2L0DA 1IVLA 3ULSB 3CLFL 4S0TD 4TNWK 3WE6B 2LU3A 5DHVB 5EB9A 4P3DB 3W2DH 4D0CB 1H5BB 4Z7OE 3KPRA 1JPSH 4NRYB 4UINH 3NVQA 2G60L 1WFUA 4P4KD 2HJKB 1HIML 1NCBH 2W60A 3KPSA 2DYPD 5C0AE 1XIWA 1L7IL 1PKOA 1A14L 1MHCB 4HUXA 2Y1VA 1MNUH 1NEZA 2G2RB 3ES6A 3MRKB 2P49B 1ZS8A 4DW2L 1AO7E 1YEIH 3OKOA 4F9LC 4OLVH 1VDGA 2ZUUA 3P9WB 4DN3H 2H32B 5CBEB 5DQJA 1S3KH 1IM9D 2APVA 1YEHL 2NX5A 4H88H 2OR9L 2YPLA 3HI1B 2V2WA 4Q9QL 3MBEB 2NTFA 2A6KB 1F4XH 2JCCF 1CN4A 4NQXA 5DMKB 4A6YB 4P5TC 1IAMA 5C0AD 4P2OB 1MVFA 4GAJL 4KRPB 3C9NA 4JREC 1P69B 4MAYC 3MBXL 4MNQA 1M6OA 3VG0L 1XAUA 5CJ5A 2FO4B 1AO7D 2E9BA 4Y4KC 4FXGB 3UTZB 1U3ZA 4LGSB 4G42B 3ARGB 4L8SA 4DQOH 3SE3C 4QRPB 1YEFL 1Y6KR 1FGVL 4ZNEA 1OOAA 5L9DL 3STLB 2B1HL 7CGTA 3KYNB 4C59B 3DVNA 3O6FD 5CSZB 3ZTNH 4M1GL 5EU3A 4PRIE 4X9GA 1P5VA 3KPRD 5TF0A 4HCRL 5GS0D 4NKMA 3V2AR 2O5YL 2P24B 2VNCA 5D7JD 2DQHL 1T83C 2DWDA 1MRDH 5I75B 4Y4FA 3KPSD 5DUPH 1E4XH 4FQLH 3WHE0 3EO9L 4MVBC 1I9RH 2CGRL 4Y0GA 3OKMA 3G5VA 6CGTA 3SDXB 4Y5XC 2A9MH 1MFBH 3DX7B 1DDHA 1AKJB 2C5DC 4HWBL 4LDOB 4D9RD 2B4CL 3O9WC 5DJ2B 4PRBA 4X99B 1CFTB 4FQXD 5F9OH 2PXYC 3U82B 1TNNA 3OF6A 2X2YA 4NWTL 3V6OE 1A6AA 3PUCA 2WK2A 4N8CH 4PGBB 5E0QA 4PRID 1AQKL 4ZXBA 1RZFL 3FL7A 3BKML 4NKOB 4YDVA 3O2DL 3OXSA 3WJJA 4M6NH 5DZNA 4DZBB 4OZGA 4DGVL 1BGXL 3TO2B 3H3KA 1DN0A 3VFTB 3NFNA 4LPUA 4YWGH 1T20B 35C8L 3KXFE 1FNGA 3LQZA 4HZLA 4LDEB 3CVIL 5E00B 5BRZB 4XCCL 5EC1A 1NCAH 1EHLL 4LPXA 1FYTE 1OL0A 1ZK9A 3GRWA 1HQRA 4OZHE 4GG6B 5MHSE 2CJUH 3RNKB 3UZVB 4OSUL 1OSZB 1MQKH 4HGMA 5F96L 3MLRH 4Z76B 3KPPB 5J1TC 5IMMB 3F65A 3SDCC 2RHEA 5C71A 1EJOH 1NUGA 4HX1A 3CUPA 3KYOA 1RK0A 3VXPA 1HOCA 1B2WH 4D94A 3NCYS 4MDJA 5DK0A 4APQD 4GS7C 4IOSD 5TPWL 4TOYH 3FB6A 1XR9A 3UJIL 5EBMA 3ZDXF 3E6FB 3BUYA 1CICA 3KXFD 5ECJE 1LWRA 3QUML 4LOUD 1J87A 4QTHB 2CR6A 3QR2A 3OKKA 2GEEA 3PGCA 3RWIA 1QZ1A 4XVTL 5MHSD 4MYWB 2P42B 2W9EL 3GMMA 4JFQA 3WO4B 4WV1B 4X6BA 5IGXH 2P8LA 1K5NB 8FABB 4JFXB 3UPAA 2PYEE 4MCYA 4XGZB 4TYUA 5I8CA 1D6VL 4OJFL 3JTSB 2CKBB 4QGTA 1IC4H 2ZOLB 1MHHA 4JM2D 3N1FC 2K3TA 4ZXBD 3BEVA 2VAAA 4H1LG 1YQ2A 1I1RA 4O4YH 1CXHA 3TYFB 1OGTB 1U36A 3R8BB 5EOTA 3UYRH 1WBYB 3WLBA 2H2PC 3P30L 3OXRB 4R2GD 2GCYA 5HHOB 5CHNA 1T1WA 1I3UA 3FO2A 3JWOC 2JJTC 1UYWL 4EI5A 5KS9F 1FJ1B 4RQQA 4HFUH 1A1OA 3AFLA 4OLWL 5KBNC 3Q1SL 3OG6B 1EVUA 2R39A 2PYED 4I3SL 2AK1L 3I6KB 5FO9B 2LTQC 1JRHI 4ONFL 1TTGA 4R7DB 3CFBA 3QAZB 1TQCC 4YDKL 5HJ3A 4OZFH 4YLQT 1CIUA 1INEL 3ROLA 3OPZH 3TZVB 1MFDL 1E0OB 2BVYA 3V0WH 4L8BB 4ZDHB 5IKCB 2GJZA 1KC5H 4IRZL 2XV6B 2Z8WC 1T5WA 4XXDA 1EJ6A 1CICD 1UACL 1JZ4A 4IOIB 5L6YH 5JDSB 1NCTA 1AD0B 3CDFA 5B21A 1DUZA 5L2KA 1VACA 4Y1AD 4NP4H 4F7PA 5JIKA 5IVXE 4NWUH 4NQEE 3QISA 2JLLA 5ACZA 3EOTL 1KFAL 1Z3GL 3GSQA 4FQ2H 3SY0A 3MXVH 5GHWL 1JWSA 1MCLA 3EW3B 1XIWC 4OZFG 3ULVC 1LMKA 5IUSA 3BXNA 4NO5A 3TPUB 2R2BB 5IEHA 3RBGA 4DKEL 5ITBH 3IDYC 5JHLH 2VWEE 4JZOA 5CEZD 2IGFH 2Y06L 4K3EL 4J3WA 1NL0L 2Q86A 2DQTH 4P23D 3LSOB 5FYJE 2ESVB 3BZEB 2XPGB 2EKSB 4ZFZB 4K3DH 4G9FA 2B7DT 3P73A 4G8IA 1EMTL 4WDIA 4RZCA 4PJHE 4R3SA 3VRLE 3OHXA 4HWEL 4QRQB 1M71A 1R3JA 3BYTA 5KVEH 4YBLB 1T0NA 4LLMA 2AV7B 1L7TL 1HINL 4XC3H 5GGVY 2YPVH 3BGMA 1X9QA 2HJFA 3VFWA 1NBZA 4PJGA 4WI2A 4KMQA 3P0VH 2PTTA 4KJQD 5ETUB 1C5BH 4Z7NF 5GS2D 3NCFB 3KLHD 5CGMA 3EDJA 4UT9H 5J6GA 4L8SC 1IFHL 1JHKL 4BYHA 1F8TH 4GBXC 1NDGB 1QO3B 1YEDA 4P2CG 5FYJD 1K6QH 1QEWA 7FABL 4JRWA 2FEDC 5DA0B 2BVEA 3U2SB 1IMHC 3WIHA 1S7QB 2KZWA 5SWQB 3EYUH 1KB5A 5JIPA 1IGYB 5MENA 4G6JL 2DJUA 2GSIA 1RUKL 4Y4FC 4YFEA 4HMCA 3KWWA 3VFPB 3K74B 4Y19B 5EU5B 3S98A 3ZKMC 3TIEA 4UV7H 3G6JA 2EXWD 2VQUA 3FFCB 4LMQI 4J3OC 5IR1A 1G7MA 1W2KT 1MRCH 5FKPB 1L6ZA 3KJ4C 4MMXC 4EN3A 3MUY1 3MTRA 1NUFA 3UDWA 3CJJA 1MLBA 4HIIB 1FFPB 3QDMB 2GJ6E 3OGOE 3LKRA 4XVJL 2NR6C 3T0EE 1S7TA 5E8EB 1MIEH 5D72L 4YDIH 1KYOJ 3H42L 1CVRA 1H5BC 5AYQA 3QG7L 2HN7B 1I7RA 2KQMA 1A6TB 4KVNH 4XTRD 3WJJC 4L3EE 3M1BB 5BS0D 4ONHB 4ZOBA 3RWEA 2NQCA 3NIDE 2ICWA 5IMLA 3MRPB 1A02N 4HULB 3BFOA 3VFGL 4I0PD 4K8RL 5ANME 1IC7L 1UQSA 2DLIA 2C3HA 1H3XA 2GUOB 3BO8A 3AAZA 1T1YA 1UM6L 3LRSA 1DBKL 5TQ0L 3B2UC 3B3IA 2X09A 2GK0B 5I1AB 1UJ3A 5J9PB 1KT2A 1RZ7L 3ROOA 4U05A 4RGOH 4X9FA 2IALB 1UJTA 2XTJD 2DQJL 3J7HA 4XNUH 5F3HB 3REWB 3T4AA 1BVLB 3ZKXC 3BZDA 1L9NA 3BPNB 3TBWA 4BZ2H 4L3ED 4F33B 1OT2A 2FATH 3V4UL 4X4XB 4Y5YC 1L6XA 4ZO8A 3TP4A 3QXAA 4H25B 2WIIB 2W0LA 4X9HA 4NJ9L 1I4FA 1N6QH 1K2DB 3QCVH 5SWZE 4BSJA 2IPKB 3MLUH 4M61A 5JNYA 3JWDC 4BFBD 3IU3B 3KPOA 4L9LB<