4U0RB

Plasmodium falciparum reticulocyte-binding protein homologue 5 (pfrh5) bound to monoclonal antibody 9ad4
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
221
Chain Sequence
VKLVESGGGVVQPGGSRKLSCAASGFTFSDYGMAWVRQAPGKGPEWVTFISNMAYSIYYADTVTGRFTISRENAKNTLHLEMSSLRSEDTAMYYCTRAIFDYAGYWYFDVWGAGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Reticulocyte binding protein 5
publication title Structure of malaria invasion protein RH5 with erythrocyte basigin and blocking antibodies.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 44
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2014-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u0rB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u0rB01
1T3FA 5KZCB 1UCTA 4PJEA 1QFOA 4JO3L 3X13A 4LVNC 1ZKAA 4HCRA 4TVPL 1PD6A 1PZUB 4XBEH 3MRJB 4NC0B 1T1WA 1Z0NA 4K55A 3AM8A 1P9MA 4D2NA 1EK3A 1N8ZA 3MLZL 1G0XA 3MJGX 5DHVA 5HGGS 4N8VB 3FFCB 4U1SA 1KNOA 2ADJB 3SE8H 5CKAA 1MWAB 3PWVA 1KIQA 1SEBB 4C57C 3K46A 3LEYH 3U4EB 2APVA 4X80L 1ZHNA 4NOFA 2AEIT 2NX5B 5A2LH 3D0VA 1IJ9A 1K4CA 5TE6L 4WUUD 1F4XL 4U7KA 2JJSA 1FFOB 2ED9A 4ZFZA 1ERNA 2MHAB 5CJXC 3D39E 2DYPA 2NY0D 1J8HD 5F72S 1KT2B 4UOJA 3KPRE 4KTDH 5AWNL 4KHXH 5D1ZD 3MV9A 5DD6B 4C83A 7FABH 3RTQA 5IMKA 1S9VA 1J9CT 4DN4L 3CDGB 5CLWA 2HWZH 3VFGH 4BQ8A 1FVDB 1F4HA 2NNAB 4M61B 4MB3A 2Y06H 1VHPA 4YDKL 4NQVB 1HH6A 2Q6WA 4Z78A 4HZAA 1CD9B 1MLBB 3OKMB 1HQRA 4G6KL 3PWJB 4ZD3H 4M1DH 1G9MH 4U3HA 1FJ1B 4HFWB 1CLZL 5E2VH 1AD0B 3DHMA 1HHIB 2OR9L 4WCYH 4XCFL 4JHWL 2QKIB 3QDGD 1X4ZA 3DO7A 3QUZB 1BQLL 5IV2B 2LTQC 4RA3A 5HY9B 1A3LH 4NPYB 4QRPE 4D3CL 1QRNE 4FQHA 5T5FL 4QRRA 1G7IA 1IC1A 3I50H 4HBCH 4XPGL 1Y18B 4EXPX 4QHUA 5F3BA 4JY4A 3DVGB 1AIFB 4XX1G 3CD4A 3BQUD 5IEKA 3VGBA 1P9MC 3QIBB 4MNQE 1U36A 4ODVL 3MRIA 5DK2B 3U82B 5SWSD 4TQEH 4KV5E 5SX4I 1JFQH 3IDYB 4ZFOL 2V2WB 4K3DH 5GISL 1RZIA 1PG7L 3TCLA 3TO4D 1E4XH 3QDAA 2FDBP 4MNHA 2HJLA 2HT3C 3QO0A 5DJ6A 4LIQE 2NY5C 3OB0H 4WEMB 3NCBB 2FCBA 2JJSC 2V5MA 1YUHA 1H9VA 1NLBH 3JTTB 3BSZL 4JQXA 1XF2B 1BD2D 3QBTB 4TTDD 2BVPB 4JHZA 4L3AA 4G7VH 3RTQC 2YA1A 2YD3A 2YXFA 4N90D 5TDNA 5EZIL 2EYTB 1KSRA 1JGLL 3RHWK 4GAYB 3HC4H 4JRWA 2GIYA 3PQYA 3OXSA 1TZGL 5EO0B 1CI5A 4UILL 1MPAL 3MMEA 1DBKH 4YFEA 1VGKA 5FGCE 2FO4A 3P11H 1JYWA 5HGAA 1TCRA 1FFRA 4OCYH 1CDUA 1Q38A 4HWZB 2YN5A 4WFFE 2LFGA 1LMKA 3SKMA 4ZOAA 4HUWB 4ORGA 4QF1B 2IANB 2PO6B 3BAEL 5D2NE 3GJEB 4CRPA 2X89D 2XA8L 3TN0C 1B6UA 1BREA 1QNZH 4NN6B 4QGTA 1IQWL 1ZHLB 5FO7B 3VFOA 3RFZC 3X12B 4MQTB 1FL5A 4DVBB 1TETH 2NY1D 2DQTL 5ELIA 3TYFA 3LPFA 4POZC 4KK6C 1FYHB 2V9QA 4KUZH 5C6PB 3MR9A 4Y4KB 4I18C 3IDUA 1UJTA 3EAKA 1A6VH 2VR5A 1LEIB 1GAFH 1IKFH 1G84A 4WDIB 4OLEA 2QQKL 3QUYB 1PSKL 5C0NC 4EIGB 2FGZA 2PXYD 1E6OL 1UB5B 4N0CD 1FO0B 2WQ8A 3V4VL 1JK8A 1HIMH 1S7SA 5H2BA 3PDOB 5ALBL 1IC4L 4YHOH 1AKJA 4IOFC 1SJXA 3QSKB 5EN2B 3MLYL 1EO7A 1BZ9B 4JRXB 1CDGA 1FORL 3OAYH 1TTUA 4NFDA 4TSAL 5FK9B 2CDFA 1BFTA 5DRXB 4OCMC 1T2JA 2Z31C 4U1MA 1OSZA 2J7LA 4JLRB 2D7OA 4WI9A 3KLHC 1AD9B 1X44A 2EYSB 4UTAL 4L3CA 1QLEL 3O0RH 2BXZA 5HYJB 1NCDL 1S7QB 1CXEA 1U8IA 2CKBL 4KKLD 4F7MB 3H0TB 1DFBH 3MA7B 5D96C 5LJYH 3WDHA 4BJLA 3NCYS 3BP6B 1IE5A 2IPKA 5IB2B 4I3RH 5E4EC 2PW2A 1NGWA 5LXGH 3NPZB 4YE4H 1MFDL 4UIKL 2ED8A 5E6IA 1VEPA 3Q5TA 3O2VH 4BK4A 1FG9C 3GGWB 5FUCC 2B8OT 5B3JE 2Y72A 4L8BB 4HKBA 3O9WC 3BRGC 1C08B 1NBZB 3OPZH 4IDJL 3WIHA 3LN5A 4UQ3B 4GMSH 1DANU 3K8LA 1KB5H 3BJ91 4LRIA 1NBVL 3QUXB 2J4WH 3MRBA 5E2WL 5CEZL 3QUKA 5EC1A 3B8YA 2GUOA 1MCFA 3C60D 4CU7A 4EI5A 4XP5H 1QRKA 3MLUH 4L8CA 1H3GA 4RDQG 2WUBH 4X0KA 1N4XL 5TPWH 3OX8B 2J3SA 5GGRB 2W9EH 4N8VG 1KXQE 5E8OB 4WGVB 3RI5K 5C0JA 3A6CL 4C56E 1D7FA 1N7ML 4Y4FA 5E8PB 4JVUA 1DL7L 4N0UB 1N6VA 1MOEA 4FP8H 2IBBA 3SO3C 1DQQB 4UBDC 2P5ED 2FLRT 4Z7WF 4WY7H 3HE6C 4KTYA 1I8MA 3EJYD 1WAAA 2AXFB 5C0IB 2X09A 4RBPH 2UV3A 2XQYG 4NJAL 2EDTA 5CSBA 3O3AA 1G6RA 5CILH 3N1GC 3BZEB 2BSRA 3RVXC 3LRSB 5E8EA 4M4PA 2BFVH 4GH7B 3O6FA 1D5MA 2EZ0D 1BVLA 4PBXA 1FCCA 1II4E 3EYOA 3OR6A 3O4LB 5K9OA 3L1OL 4Z76B 1NANI 1YEJH 4R9HA 5EBLA 3IAPA 4ZPTA 3WL9B 1ZTXL 5T3ZH 1ROWA 2LAAA 1YZZA 4GG6E 4Z7UF 5DR5L 1KJMA 3FB7B 4Q0XH 4PBVC 3MO1B 4OZGB 3D9AH 3KS0J 1H3PL 5C3LD 4HIJB 1C1EH 4F80A 5M7QA 1JGVH 3IFLH 4M9PA 4LRIC 4GAFB 5DS8A 1CE1L 3LKPA 3GSRB 2VXUL 5T33L 1WZMA 3JWOH 4J4PA 4NQDE 4FXLA 3UTSD 3EO1B 3GIVB 3WFZA 3NA9H 4CJ0A 1QBMH 1P4IL 3TEUA 1WJ3A 4G9FE 1NUFA 2FATL 5DWUH 4D0CA 5HDOA 2Q7YB 3FN9A 4Y4FC 3S4SB 4HWBH 1ZHKB 5ETUB 1OY3B 2XIDA 4F7EB 2DJUA 3BP4B 4YBLC 3RKDD 5JW4Q 3X3FH 2H2SD 2XZQH 4Y19D 4NRZB 5DA0B 3GKWH 5H8DA 2HT2C 4LPYA 4JANA 5IIEB 2A38A 1KJ2H 5HPMB 1YMMA 3CLFL 1JPTL 1NH6A 1CXKA 3X3GL 3OKDA 1V3JA 2PYEB 4N5UA 5GGSA 4LVNB 5GZNC 4U1IB 4YDVA 4BQ6A 4G5ZH 4GRLD 2Z8RA 4LKXB 4WW2A 3O6FC 3VXRA 1B6DA 1MRFH 4LCIL 1UM5L 1V3KA 3BKML 3JV6B 3TO2A 2XA3A 4MJIA 4KVCL 4NNYA 12E8H 2NXYD 5B38B 1PG7W 2HFFA 5TF1H 2RIKA 4OD1H 5C09E 2M26A 2RB8A 3Q1SH 1CD1B 4EDXB 4QXTA 3FRPG 4CW1B 1CF8H 2EDYA 1NBYB 5DJYB 1QBBA 3RDTB 2Q86B 3AREC 5GS2H 2IALA 5DK0A 1RZ7H 4HUVA 1JNLL 4OLVH 3PF2A 4UQ2B 4AMKL 2VXQL 1FH5L 4R8WH 3SDAD 4JFQB 1FZMB 3FAXA 3VGGA 5IVNA 1U6AH 3CXHJ 1U8PB 1UYWL 5TDOB 5C71A 4U6VL 1UB6A 2NY2C 3BP5A 2JELL 4ZNCD 3I6KA 3DX8A 3RY5A 4IOIB 4JY6B 2W60B 1Z0MA 2FZ3B 4FZEL 3SCMA 4ENEC 2OMNA 4MD0B 3T65B 5IB5A 1MI5E 2X4UB 1I3VA 1CN4A 2RFXB 5HGBA 5L7XL 1FFNB 2VDRL 2VERN 1N5YL 3P0GB 4P5TB 2VISB 3WFEL 2B0SH 4C4KT 2VLRA 4HT1L 4MXQC 1I7RA 2LTQB 4PJ8A 1K3IA 3TZVA 3LRGA 5F7EH 4DK6A 2Y7QA 4TNVK 4Z8FL 4H25A 1H5BA 2O93L 3MV8A 1EGJA 2ZG1A 4LPVA 3BUYB 2HJKA 2JIXB 4KV5F 1P4BL 5C7XH 3OR7B 1INQB 2AQ3A 2D7PA 5DHVB 3S36H 2MCG1 5E08H 4PLNC 2PUQT 4NWTH 5DJAB 1WVZA 3S5LA 2GEEA 3PWVB 3OGOE 2O61B 3N0PB 4QTIH 3HUJA 4XPBL 3V2AR 5LBSL 4PJEE 5F9DC 4RWYH 4JHAH 3EFFA 4CN6A 4WHTA 4LHUA 4ZFZB 2ZP0T 2DYPB 3OKNA 5DD3H 3JUZA 2I9TA 3RU8H 1LD9A 3MV9B 1M1SA 5T3XL 4C83B 3RTQB 4HPYL 2CRZA 5INDA 5IMKB 3OKEB 1OLLA 3QFDB 1XF3A 4HKJB 2Q6WB 1H3XA 4NN5C 4LLQA 3MA9H 4HIHA 3TBTB 4HPOH 1T4KB 1DLFH 1IILE 1KPVA 5DDHA 3UC0H 5GS0C 3SCMC 4WNQA 2CUMA 2DLGA 2GCYB 1QR4A 1QSZA 4KZDL 3WKNA 4R7NB 3T0AA 1H0DA 3OAZK 4X6DE 3N9GH 4XCNB 1N6QH 3EYSH 4PS4L 4PJ8C 3TN0B 3SOBH 2OM5A 3PL6A 1BVKB 1G7IB 1R3HA 1CLCA 1RU9L 3GIZL 3IRZA 1H5BC 5JXAL 4JY4B 1J1XH 3DPBA 4N1HB 1QR1B 2X5PA 3BH9A 3BPOC 5IM7B 4NC1C 4I18B 1TQCC 5HI4C 3VGHA 1ZLUK 4M6AA 3SGEH 3V4PH 4O2EA 1RZIB 4LAQL 4PBWD 4XVTL 3DRQA 3V7MA 2VLLB 4RX4D 3BT2L 4LSPL 3QO0B 1I1AB 5DJ6B 4QRRE 1UZ8A 1TNMA 3D2UA 3SE9L 1WUNT 1JIBA 3NCJL 4OCNC 1BFSA 1AE6H 3FO1A 4YEFA 3MLVL 1WFNA 3WUWG 4BSVA 4PRPD 3PP3H 1F2QA 4KY1L 3L95B 4P2QD 5JA9A 3WHE1 4FABL 4CAGA 3ARGA 1KC5L 4JREB 3C5JB 3MMEB 3UBXI 4MX7B 2Z31B 4XNQB 3I9GL 2DM3A 5HGAB 1TCRB 4J12A 3MYZA 1RFDL 3EO9L 1A7PL 3KLAB 3KJ6L 3WFCL 3SKMB 1BEYH 4N0YH 1KFAH 4XVSH 3UYRH 1BF2A 3H9HA 4V2BA 1JTOA 4UIMA 1KV3A 3MUJA 1NGPL 1QSED 3NCMA 2BVUA 4JY5H 1NCAH 1WBXA 3VWKD 1ORSB 5KOVC 3NIGF 4U0RC 1E4WH 3CUPB 1LEGA 2XTJC 1U8QA 1A6WH 3PQYE 1WK0A 1FL5B 1L4IA 1PKQE 2YXMA 4JFPA 1GHFL 1AY1H 4BA8A 3N1QC 1GCFA 1PYWA 1XIWC 2D0HA 2PETA 1A4KA 3S4SG 5B3JF 1FP5A 4LLYB 4UT9H 4WU7A 4S1QH 3H7LA 3FB5A 4FQIL 2J5LB 2QR0A 4OF8A 4IJ3C 5AD0A 2DLEA 3NVQA 3O9WB 3ARFC 5E2UL 1CDIA 3QEGH 3GB7A 1A64A 3GSNL 3O45B 5J57B 1CLOL 1HH9A 1JRHH 2P8MA 5T1DH 5HYEA 1A1NB 1NBQA 3HPJB 3PWPB 5H2BB 2VMFA 5C08A 4DAGL 5J1AA 4DGIH 2NZ9D 4J6RL 4JFFB 5B38G 3T0WA 3J8F7 5C1MB 5FUCE 3ARGC 3Q6GL 1P84K 4U1MB 3O2DL 5IWLA 1OSZB 1N59B 5DRNA 3FO0H 4MHHG 2Q8AH 3SO3B 4L3CB 3NCFB 4K94L 1WCBA 1CD0A 4LPCA 2WBKA 4R26L 1HI6A 1JHLH 1LK3L 2I27N 3HE6B 1T2XA 4RMTA 1Q72L 5JIPA 1XT5A 4OF0A 2XWTA 2V2TB 4JG0L 1U8IB 1YC7A 5CWSA 4I13B 5J6GA 1UQSA 1XCQA 3QA3A 3RBGA 4KJPC 4YHMH 2WBWB 5I2IA 4J3XA 4PYGA 4HJJL 1NGWB 3FJTA 4UUJA 4AY0A 4GG6F 4BZ1H 2FJHA 3EJZC 5L6YH 4R96A 1RHHB 2YD8A 5D1QD 1ODAA 4EJ1C 3Q3GA 1NGYA 4LCWD 2CLZA 2YUZA 5IQ7H 2JCCB 1GGIH 4ZS7H 4NZDA 4XP9L 1O7VA 1DQMH 3MLRL 4HKBB 2A77L 4NHUA 4U31A 1NCWH 1T5XA 4JN2B 4ODXA 3GSXA 1GOGA 5IBTL 4FQXA 2FH8A 4HEME 5EU6E 3IS0X 4TRPL 3MRBB 5ILTL 3GMMB 1CXIA 2LU4A 1S5IH 4UI2A 1BIIB 4ZFGH 4OJFH 3OXRA 2P43B 2DIAA 5K9JL 4L8CB 1OARL 2PF6A 3AC0A 1Q0YH 1J0ZA 1VSCA 2GHWB 2WANA 3ZKND 3M17A 5I1CL 3VG0H 2CO6B 4YBLB 3ME0A 3GO1H 1T7WA 4P9MH 4G8FA 1Z5LB 3DRTA 3T4AA 4ZXBA 3EYUL 4XGZB 4LAJH 3SKJL 5KG9A 4ONFH 2H9GA 4GO6B 1MJ8L 2FECI 3MCLL 4YHKH 4JCMA 1ZSDB 3KXFB 4UTBL 1D9KB 1KBGH 3MOQA 1MAMH 3FTGB 4P5KB 4EEEA 4R7DB 3BEWB 3TYGL 1DBJH 5J89A 1U93B 4PJFA 1G7PB 1CLYH 2KDGA 1UKSA 5K9OB 4M5YL 4PRAB 3EHBD 1I4FB 3QFJA 1BZQK 2HRPL 2D0FA 5EBLB 3IGAA 2OL3L 3A67H 4OB5H 1WAAE 5D6CA 3T09A 3D39D 3MLWL 2BRRH 3KPRD 4GAJL 2F9BT 4UAOC 3RVUC 4PJAE 2XRAH 3NACL 3AREB 3DX7B 1EVTC 2GAZA 4FQXC 5JIHA 1HHKB 2R56H 2WW8A 5DS8B 2V2XA 1P69B 4H8WL 2YD9A 4JZNA 4YXKL 5FHAH 3VXMA 1ORQA 5E1AA 3P4OB 4O00A 5FYJL 4TUJA 1B2WH 2UZIL 5GRYA 2C3WA 4EUPH 5EIQA 5EWIL 2NY2B 1X5AA 3DYOA 2XG5A 3IFOA 3C5SB 2ZCKL 4KQ4L 4EXKA 3BGAA 2B4CL 4ZNEA 4PG9B 1JZ5A 4MQXC 4M1CC 4QRPD 1OP5H 1F6LL 2IPUK 3NIDE 5C0AD 1BLNA 1VADA 3GMLB 4JANB 4P3WA 5C0CB 4TOYH 4ZXBC 1YMMB 3EDJA 1YY8A 4P49A 1ADQH 3UTPE 2AK4E 1MHHA 3QCUL 3U7AA 1KTLB 3TT3L 5DURD 3SE8L 4UINH 5DFWH 3VXRB 5CGMA 2AK1H 5D2LE 3EBAA 3QHZH 4MA3B 4BQ9A 3QUZD 3LEYL 5KS9A 3QCVH 1T22A 4XRCB 1MIML 1CFBA 1C16B 3VWJA 4TVPE 1LO4H 3HC3L 2GITA 4QXTB 3QULA 1OL0A 2HTKD 3OJVC 1LP9E 4KHXL 1QKZL 2EC8A 43C9A 2XI9A 2BVQB 1KELH 5D7IA 2UVEA 3IDXH 2HWZL 3VFGL 4HUVB 3L3HB 1R5WA 2Y06L 4HBQA 3W5NA 4JEGB 3P0YH 1LDPH 3VE0B 4ZDHA 4EKXA 1C7TA 4ZQKA 4ZD3L 4K8RH 4WFFD 1G9ML 2VLKA 1MFAH 2ZPKH 5E2VL 2VB5A 1MREH 1KIPB 3BP5B 1EFXA 3I6KB 4WCYL 4HLZG 4LCUB 3BVNB 2X4PA 1G7JB 5LGKA 1RUMH 3VXUB 1A3LL 1UWXK 5E7FA 4X6DF 2J8HA 2VOTA 5IB5B 4MXWH 1MCWM 3I50L 4HBCL 5HGBB 5E8NB 3HI6L 4KDWA 1MQKL 3RUGA 5F7DA 3VA6A 3FO2B 3RVWC 2Y7QB 2YUWA 4TQEL 4H25B 2HH0H 4F3FB 1H5BB 4K3DL 3MV8B 5F89B 1YYLH 1E4XL 1N5AB 5JHDA 1BJ8A 1A6AA 4LL9A 3MRFB 1AJ7H 4G80A 1VEMA 1TQCB 3VWJC 3OF6D 4YFLF 1YN6B 4KXZH 4Y16B 4PD4K 3HUJB 4LLMA 1NLBL 5GGVY 4EIZC 2RCSH 5GZOD 4AG4H 4E5XB 1HHHA 3TBWA 1TITA 2VJXA 4G7VL 2QQQA 1Y6NR 3AUVA 3EFFB 4PGCA 4WU5A 1AGFA 1TVBB 3OHXA 4Z7UB 1FL3A 1TZHA 2I9TB 1NAKH 1DBKL 2YUXA 3P11L 5CBEB 4OCYL 5INDB 3UROR 5J3HC 4LLQB 3BWAB 4Z0BL 5GGTL 2D7QA 3QWOA 1KPVB 3B43A 3IT8D 4WNQB 4KJQD 5KBNC 1XH3A 4PRHA 1I1YA 5ICXB 1MWAH 2K3TA 2CIIA 4OBRA 2G5RA 4QOKA 3CNKA 1TETL 3MGTB 3QT2A 5IVXB 5EBWA 4K3HA 3STLB 2ZUTA 3X14B 4MS8D 1R0AH 4U0RB 2EDEA 4OZHE 2XTJB 4HIEA 5DJ0A 2R23B 1A6VL 4XC3H 4LDEB 1GAFL 3MREA 1IKFL 1XIWB 2R2HB 1JGDB 3HFMH 1GL4B 1A7BA 4XPTH 1MVFA 1D3CA 3BN9D 2J6EA 1EX0A 4W6WB 4NIKB 4AIOA 5MENA 2NY3D 1PQZB 3UEZA 3DRQB 4KTEH 4FQPA 2CLVB 3ARFB 2Z91A 1HHJA 1L0QA 1ZV5A 4WFHD 5E9DE 1O7SA 4ZUVB 3BH8B 1UZ8B 4YHOL 1R3LA 4ODBD 3F7RA 5T5NG 3U9UA 5I1JH 3BD5A 3VI4E 3ARZA 5EIIB 1MCRA 4GKSA 4P2RA 3FOMA 3BGMB 3LMJH 1CBVH 4BSVB 1SQ2N 4WFED 2DS4A 2VZVA 3UYOD 4JDZB 3O0RL 3ARGB 9CGTA 5MEOA 4QRTA 5B8CA 4LFHG 4DW2L 3G9AB 1PX4A 4XNXH 4YUEH 4G8EB 1KPUB 4PRID 1BFOA 1DFBL 1EHXA 4JVWA 3CFDB 4DN3L 4NJ9L 4TN9A 3MACH 4MDIB 5ITFA 1KLUA 1DSFH 3H9HB 4M8QA 4UIMB 2CO7B 3W2DH 5LXGL 1U8NA 2ZUQC 1EHLH 2ZUSA 35C8L 4LSVH 1R24B 3WHXB 2EIZB 3O2VL 1YEEL 2ZUXA 3G04A 3P4MA 2CH8A 4Q6YA 4EN3D 4F8QA 1QRNB 5JW5A 4JFPB 4IDLA 1B0RA 5EO9A 5I1DA 1A4KB 3T0VA 1NFIB 3OPZL 3KYKH 2E3VA 4L1HA 4GMSL 4WU7B 3K4AA 3OMZA 3K1KC 4X9GA 2WWMD 2QR0B 1KB5L 2C5DC 1CGXA 2J4WL 4MNQB 4PV9A 5AD0B 4Y2DD 5BO1L 3ARBC 1OTTD 3LS4H 5J6HA 3MLUL 1AGBA 4NQDD 3GB7B 5GRUH 2WUBL 4NKOA 2MOVA 3L9RB 5TPWL 2IQAB 3OKLA 3ARWA 4JKWA 1HH9B 2W9EL 2VDOH 4QCIA 4G9FD 1VFBA 1E28A 1K5NA 2KQNA 2I25N 3RWDB 5C08B 4IS6A 2FEDD 5B39A 4MLIA 4FP8L 1DQJB 3QNZA 5GS3A 4YWGH 4B7LA 2JK5A 5CEZE 4IMLA 3CZFA 5I75B 2VDKL 4WY7L 2AXGA 4I4WA 3QHFH 5BZDB 1DUZB 5B8CC 4X6FB 4PJBF 4Z7NE 1JCKA 4UU9B 4KI5E 3OAZH 5CP7A 2XOTA 5CILL 3V5HA 2E6JA 1X5XA 5K9QG 2AKRB 3ROLA 5I74C 5A2FA 2BFVL 3RX8A 3SY0B 2XWTB 4Y1AE 5IHZB 5J6GB 1UQSB 3VXOA 3QA3B 3QQ4A 5KTEH 2V17L 3Q5OA 4WV1A 3P77A 4YR6B 5TH2A 4LLUA 5C09D 5T3ZL 1FO0H 1HYSD 4F7PB 3G5XA 4UUJB 1KTDA 3IDGB 3F6IA 2Y25A 4Q0XL 1WAAF 5KJRH 1J12A 2D03H 3EW3B 1ZVHA 4FFVC 5ALCL 4ONHA 1NGYB 1C1EL 4PJAF 3HKFA 1JGVL 3MV7D 1A7QL 3IFLL 5D7JB 5ID0B 1U95A 5DC4B 4ONGH 4OFKA 5BOZG 5LGHH 1ZT1B 3TIEA 4UAOB 5CP3A 1VCAA 1NDGA 1T5XB 3V5KB 1PZ5B 4FQXB 1RUAH 4BYHA 4PGBB 2FX9H 3NA9L 5IW6B 2A74A 5DF0A 3V9FA 4J3SA 5DWUL 5E6YA 5GIRA 5J11C 4HWBL 4LSTH 4PLJC 1MCSA 5I8EB 2BRQA 5DK3A 5E5RB 2ZJSL 5E4IA 3PIQA 1MI5D 3X3FL 2OJEA 4ETQA 3AGVA 2FYYA 2XZQL 3BE1H 5FYJU 4LGSB 3S5LG 3GKWL 4QXGL 3NIDF 1UJ3A 1IAIM 1YY9C 5E5MB 1KJ2L 4B50A 3M17B 4LGRB 5C86A 1BBJB 3V7AE 2DL2A 2K7PA 3EKCA 4ZOEA 4G8FB 2E7HA 4LHUG 4EVNA 3QEQB 2YPVH 1IAMA 1MRFL 2H9GB 2BOBA 1MVUB 4OQTH 5D2LF 5LVEA 4X9IA 12E8L 2LVCA 2VIRB 1T6WA 4JFDA 5TF1L 3CFKA 4OD1L 3GBMH 4X4YA 1EAPA 3Q1SL 3S8WA 3O41A 1BX2B 4PJFB 5DEFB 3WV0A 3VD4A 4XH2B 8CGTA 1LP9F 5HGDA 1JZ2A 5EC2A 1RZ7L 3L6FB 4NQEE 1KXTB 3L5HA 3LDBC 3PUCA 4IM8A 2YKLH 1ETZA 1LNUA 1FVCA 4NQTA 4WW2F 4CADA 5ANME 1U6AL 1T5WB 2V5RA 1L6ZA 4HC1H 4BUHA 5CJQH 4XMPH 4HQQH 2XV6B 4L4TE 3T0EA 4M43H 2ZUVA 4LMQI 4M7KH 4NNXA 5KVFL 2WBJA 3H9ZA 3QRGH 1YYMH 3QH3A 3IFOB 2A6IA 2DICA 1UH3A 1ZEAH 3REVA 1FPTH 3O8XA 1UM4L 3T4YA 2AEWA 4C56B 3MRKA 1WITA 5DO2D 1NGQL 1I1FA 3RL1A 3MJ9H 5F7EL 4W4OA 2EDQA 3TCXA 3CFCL 4ORZC 3UJJH 2Y9RT 3SDYH 1BLNB 1BJMA 3V5DB 4MA8H 1MY5A 2BHYA 4H88L 3T77B 5ECJE 1S7XA 4CDHA 3VXME 1AO7E 1WQVT 1JWSA 5HHNA 2HN7A 4U6TA 1MHHB 2GYSA 3JXAA 3S36L 5CUSH 5E08L 3WJLC 4PY8J 4YDJA 4QTIL 2W92A 4U6XA 5E56A 1FZJA 5IFAH 1AXSA 3O6MH 4E9LA 1T22B 2ADIA 1S3KH 4HS3A 5AAWA 5I1GH 4QRRD 2KUTA 4RWYL 3JBG7 4JHAL 2VL5B 2R2CA 4OF5A 2P8LA 4JKKA 2GITB 2G5BA 2RR3A 4KK6D 5DD3L 5IROA 1P6FA 1UCBH 2YEZB 3QULB 3RU8L 4GG6B 1F00I 5GSVA 2BY3A 3LHPH 2ZKHL 1DN2A 1G7MA 4JFXB 2GK0A 4Z5RA 2VR9A 3SPVB 4EBQH 2VITA 3GZKA 5D7IB 4GKZB 2Y6SD 4XPHL 1R5WB 1YQVL 4X6EA 1WF5A 3MA9L 3KVQA 5MEPB 4PJ7B 3E6HA 4HPOL 3RQ3A 1A7RH 1DLFL 2DQGH 4PJXB 3UC0L 5C0ND 5E70A 2WBJC 2W0PA 3ZE2E 1EEUA 1LO5A 1EFXB 3S35X 3SDCB 4HMDA 1FRGH 4YHIB 3O8XC 1ZT7A 5F1NA 2X4PB 4X7DC 5DTFB 3DV4B 4Z95H 1ZA6A 3DMMC 1OP9A 5T3XE 1N6QL 4IOFD 3SOBL 3CX2A 4W4OC 3KR3H 4U7SA 2NY7L 5J1TC 3PQYD 3RBSA 4Z7QE 2VABB 1J1XL 1T1XA 4R4BB 4OZHF 2ARJB 5DD1H 5EA0L 4F37F 1JWMB 3PGDB 1JZ6A 3FB6B 5SWQA 1IAOA 3V52H 25C8H 3V4PL 3QI9C 4XVUC 1LE9B 1IZJA 4CVUA 1IGJA 5IT2L 3H9YA 5IBUB 4TSBH 5F9OL 2AJVH 3FT3B 3PV6B 5KSUA 1T0PB 3PJSA 2IH1A 2QV2A 4XNMA 1JRHI 2ARJQ 4NBZB 5IROC 4X7TA 2PTVA 1AE6L 1U2HA 3EZ8A 3VI4F 2QHLA 3TBWB 2EDLA 3AROA 4ZAKB 1R3JB 5I9QB 5C07E 1AGFB 1MFBH 5DMIH 5ISZA 1XGTA 2H1PL 3GMRA 3JWDC 5JHDE 1NPUA 2A6JA 4I2XE 1S7UB 1ZVSA 4XCYB 4NBXB 1TXKA 3RVTC 4N0YL 2DWEA 5DUBA 3UYRL 3QEUB 5DFVC 1FNSH 4FNLH 4A2MA 1ES0B 4JY5L 4F7TB 1NCAL 1G7LA 1AKJD 5A1AA 5DHVH 3I3DA 1EJOL 1XH3B 3MRNA 1TCMA 2YR3A 3I6GA 3V7AG 4KGLA 1E4WL 1CICC 1A6WL 2ITCB 3WE6A 2X4NB 4LCYB 1AY1L 4XAKE 1F5WA 2ZUQB 4U3CA 2NY5H 5DEGB 1WWAX 4UBDD 1I8KB 4UT9L 1EZVX 1KB5A 1TIUA 2VZSA 1LILA 3EFDH 2GJJA 3ARDD 4GMTH 5BJTA 1C7SA 4RNRB 3MREB 3PDGA 4KRMB 4ESKA 3QEGL 4JKLA 4PRHE 3UZVB 3FOLB 1VACA 4QRUA 1QTYT 4LSUH 3U0TB 4PB0L 3QWQB 1JRHL 4QOKE 3RWFB 3IJYB 1CT8A 43CAB 3ULSA 2FHCA 1FYTA 1HHJB 5E6ID 3ARBB 4OIIH 4ELKB 1WT5C 1PDKA 2VKWA 3BO8B 2YBRA 5FF6B 2EH7H 4DGIL 3VRIA 4XBPB 5K9KA 3NFNB 4P4KA 5HVHC 3BRDA 3DXAE 1IM9A 1DR9A 1LGVA 2VZ3A 5GGUA 4P2RB 3T3PE 2NLJA 2HJFB 1OAUH 3FO0L 3VXSE 1AR2A 3CC5B 4Z7NF 3VFVA 2OJZL 2VO5A 4OV6F 1FL6A 3H3PH 4KI5F 5MENE 1UWXH 3W81A 3JZ7A 4EI5D 5IUSA 1SBSH 4MMXC 3WHE0 4DK3A 4QNPE 2FJGB 3U36B 3LAFA 5T1KB 4RISL 4YHML 1K8DA 4Y4FD 5I74B 1OAKH 4AQOA 1BAFH 4CMMA 3HRZB 4BZ1L 4NT6B 4DCQB 1INDH 1QQDA 2ESVE 3P4MB 4X6DB 5T1LA 2XY2A 5IQ7L 2Q7NA 1GGIL 3I84A 4ZS7L 5F7MC 1B0RB 4HH9B 1P7KB 3WO4C 3S37X 1JNJA 4K7PX 2ICES 3ILPB 2ATPB 1NCWL 4N5ED 1MY7A 1FLTX 5F7YC 2A0LD 1F3JA 1QSFA 1OF2B 2Z35A 5GZND 3R8QA 5DRZA 4FQCH 3O6FD 4AIZA 4PV9B 1EVUA 2XG4A 1RJLA 4FN0A 5IOPA 1S5IL 4OJFL 3WN5C 2UY6A 4RFOH 1I3GH 3ZE0E 1KUMA 4FQQB 1CFTB 4U6HA 3LH2H 1Q0YL 3K8KA 4P4KC 2P24B 2OYPA 3D69A 2Q8BL 4JFEB 4J1UA 3OV6A 3ZDXE 4E41E 1MHPH 1PGRB 2E7BA 1U58B 5J0BA 3UAJC 1ZE3C 3RWJA 3DROA 2JK5B 1ZLWK 4IRJD 3CZFB 1MCBA 2HFTA 4NCDA 4P9ML 2X10A 3BWUC 4CL7A 4J4PD 3CJJA 3GMQA 4WWKA 3WFDH 1A4JB 4ONFL 2V7HA 3HZYA 3FT2A 3UTPD 3VCLB 3GM0A 3V5HB 4ZSOA 3RGVC 4HLZH 2DQDH 3ROLB 1VDGA 1KBGL 4JR9L 1MAML 3S35L 3N06B 4ZUTA 5F1IB 3VXOB 1GGYA 1MCCA 1CLYL 4HXBL 5EU7C 1I1RA 4MCZA 3T2QA 1JWUB 4DUWA 4Z7OE 4TVPD 3KYNA 4NRXB 3A67L 4OB5L 4QHMA 1BQHB 1KTDB 2ZOKA 2X42A 2BRRL 1J0HA 4MXQD 5KSAD 4G6MH 2B1AH 3JWOC 5EUKB 1PKQB 2XRAL 3B9KC 4D0BB 1IQDB 3QNXA 1Q9WB 2R56L 1W2KT 1L0YA 4M7ZB 4NZTL 2UUDK 3LDBB 3LQAC 3TIEB 2GKIA 5CD3A 1FV1A 4MJID 3WFBH 2ICWA 3VW3H 1Q1JL 1OW0A 1N2RA 3AMKA 5JOEA 2VLME 1IM3B 1B2WL 3QG7H 5C0EB 2Z4QB 2EEAA 2A74B 2CK2A 4RGMB 1KCSH 4PJCA 3HAEB 3OKYA 4XXDB 3QDME 3BKCH 5JO5A 2X1QA 4H26A 4KJWC 5IBUG 4D9LH 1KTRL 4NZRH 2FD6H 2OJEB 4ETQB 1TJHH 4HD9A 1OB1A 4TOYL 4XNYL 5F70A 4R90H 4WWKC 3CDFA 2E9JA 5FYJE 3UTTA 5BRZA 1ADQL 1X5LA 4WFGE 2QTEA 5K33A 2MTPA 4RMQA 3KNBA 3VFSA 5HBBA 4JKMA 4R0LA 4UINL 2AK1L 3QHZL 1NC2B 5GGRY 4G6FB 3WIHH 2AV1A 1NCNA 3SCMD 5ICZA 5I1IH 4MB5A 3QCVL 1XCTA 4TNWK 1JP5A 2JF1A 1IGCH 4MVBD 2XWJB 1ITCA 1T2QH 3CFKB 5EFIA 1LO4L 2QSCH 2QQNH 1UT9A 4NSKB 1LE5B 1YPZE 3IVKA 4X4YB 5BVJA 2VLRD 4LASH 2FX7L 4Q7DA 2V5SA 4PJ8D 1P5UA 3TZVD 4XTRC 4KMLB 5FYKH 1KB9J 4JRYE 4L4VB 4UDTB 1KELL 3IDXL 2VQ1A 5L2KA 2AW2A 2OK0H 3NPSC 1RZFH 3MOAH 1LNUB 4UOW0 5F7FA 1LDPL 2R39A 4CADB 4Y8AA 3KAAA 5FV2A 4K8RL 5I71C 5HI4D 3M1BB 1MFAL 4JFDE 2ZPKL 1I9IH 1G7QA 1MREL 3WIFA 5E94A 2JKXA 3QIWA 2MJWA 4O51B 5CCKH 1T20B 3L5WA 5HHOA 1TVDA 3HLAA 1MSPA 1RUML 1A6ZB 2WBJB 2CK0H 1NEUA 4LHUD 1BWWA 1A1OA 1XEDA 2I9LA 4DZ8A 3IKCB 5I0ZA 3GHBL 1CVRA 4Z7QF 1JPGB 3DMMB 1HDMA 2DM7A 3JV5A 4IRZH 5MERA 1U8HA 3RL1B 4J3OC 4MD5A 2X4OA 1S8DB 2XZAH 5CINL 4R0LC 5HHME 2HH0L 5CKGA 5HHPA 4HULB 1S7XB 4G8IB 1CFQB 3T0EE 1INEH 3R06B 4PJBB 1YYLL 5HHNB 2DQFA 5BCAA 3QWRA 1AJ7L 1BP3B 3DIFA 5D1XB 4NQCA 4YDJB 5JZ7D 3QI9B 3UTQB 3IDJB 4JG1H 1B90A 4TUKL 15C8H 2RCSL 3C8KA 4AG4L 1AXSB 5E9DD 3ALXA 3KPOA 4HS3B 1IAIH 1FNFA 3PL6D 4YHLL 4LVOC 3V0AC 1I9EA 3HZKB 2XTJD 2VWEE 3DETC 1F6AA 2G5BB 3QZWA 1T04A 1NAKL 2VLJB 1JGEA 2BVYA 3WIIH 5E0QA 2C1PB 1HXMA 3MRMA 3SO5A 4O02H 3B8SA 3RWEA 4S1DC 1PLGH 3HI1A 3G5YB 3G5VA 4DJMA 3WXVH 3LN4B 3CU1A 2R1WA 4J23A 2P5WA 3KYMA 4WI6A 3D2UD 3B6SA 2NTSP 1I8IB 2BVEA 1LO5B 3RVVD 2DBLL 2DQCH 1MWAL 4PJIA 3RIAF 1U42A 3W39A 1UEYA 4BH7B 3SKNA 4GG8B 3VFNB 3P40A 4NFCA 3SJVB 4F15C 1R0AL 3DX9B 4LHJB 4ZFFB 2XN9A 1CICB 2G9HA 1D5XB 4XC3L 3IDMB 4NO0A 1BVZA 4PRBA 4QY8A 4Z7VE 1KPRB 2BNQA 3FCTB 4XPTL 3TH3T 5B39G 1IAOB 5JMRA 3V0WL 3QJFA 2C3GA 2FIKB 3RY4A 2AK4B 5JMOC 3FHQA 1HSBB 2A83B 5I8OL 4KTEL 5EBMA 4MB4A 1FC1A 5IMLA 2Y07H 3I6LE 4GBXA 5D2LB 2MPAL 2C3HA 1HNFA 1A9EB 3B3IB 5KSUB 4JZJA 2OR7A 4KJPD 4APQB 2WINB 3H9SB 1ZOXA 2ZSWB 4O58H 3U6RA 5I1JL 2ERJC 4J8RB 4RGNE 4FQ2L 3TH2T 1QYGL 4MDJA 1OVZA 4OUUA 5GS0H 5JORA 1K2DB 3VFRA 3LMJL 5FGBA 1CBVL 4LIQL 1CG9B 1P7QB 3T3PF 3FQWA 4HUKB 5CEZD 3HZMA 1B0WA 1XGTB 32C2A 2AEPH 3SE4A 3DVNB 2CIKA 4CJ1A 4U3XA 1BQHG 4JFYA 1MCJA 3CK0H 2DLTA 3DARA 4MCYB 4I77H 4XNXL 4YUEL 5FGRA 4CVWA 4KI5D 3P73A 2A6JB 4E42B 1ZVSB 5F6HI 3TV3H 4HK0A 4X9BA 5TGBA 1GRWA 2DWEB 2VYRE 3MACL 4QNPF 1DSFL 2D9QB 4XZUA 4Y1AD 4WHYG 4DOHB 2C3XA 3O6KH 1W0WB 4MA7H 4MSWA 1KYOK 2FRGP 2UWEE 3ARTA 3I6GB 3QPQC 4WUUE 5ISZE 1A9BA 4JFOA 3WS6C 3MYJA 3WE6B 3HAEG 4E0RA 1P2CA 2DM2A 2NXZC 3VRJB 1CDBA 4PRDA 4PJGA 4FTVA 3DURB 3T8XB 3KYKL 5GRJH 3OL2A 3F58H 5KN5A 1S7WA 3NFPB 2VR4A 5CGYC 3QXAA 5ENWB 5EULV 3U1SH 3WO4B 5F1KC 3AXLA 4HDIA 4GBXC 3LS4L 3BDXA 3F7PC 3VMPA 4I5BB 2DKMA 5GRUL 4JZJC 1QUNA 4QRUB 5EUOA 4OCLC 3OAUH 4OLZH 3EDKA 3B4NA 3ZE0F 3K7UA 4WI4A 4OGXH 2D2OA 1MJUH 2B20A 3JTSB 1CVSC 1ZANH 3WN5B 1SYVA 4YIQB 1BZ7B 1KGCE 3U4BH 5FUOH 3ZDXF 5FGBC 1WIOA 5K9KB 4YWGL 2ADGA 5EB9A 3WYRA 1NL0H 5FEBA 5LGJA 5AEAA 3TNMB 5L2JB 5HI5C 1KIRA 1R6VA 3RVUD 3ZKQD 2C1OA 2NLJB 5DJXB 3RZCA 1KEMH 3QDJB 2XZCH 4P3DB 3U7WH 2AEQH 1KG0A 4NKDA 2PN5A 1FYTE 5GHWH 5D9SB 3MJ8B 8FABA 4ZOCA 1Z3GL 4G8GA 1MELA 1X7QB 1F2XK 3R1GH 5KTEL 3RGVB 4MQSB 3MFFA 3VFUA 3NTCH 1U2CA 3ES6A 5EZJA 1K8DB 4CVXB 1FO0L 5JPNA 3ZHKA 3VD5A 4K3GA 3WMSA 1BD2E 4Z7OF 3NAAL 4BSJA 4JJHA 3B2UC 3DECA 3PP4H 1MFEH 5KJRL 2D03L 4M1CD 3S6CA 4V1DB 1I7TA 2AJYH 5T1LB 1XGYH 2XACC 2N7AA 3TFKC 4NQED 4S0TD 4ZXBD 4ONGL 1TQBC 3HMXL 4OZHB 5LGHL 2ORBH 4NOBA 3K74B 4JM2A 3B9KB 4ODSH 1F3JB 2Z35B 4KROD 1I7ZA 2VXTL 4KZEH 1RUAL 5DRWB 2FX9L 3ZYJA 4EUPA 5T3ZE 2R2EA 4AIZB 1RJLB 4OCWH 1QLFA 1U3HD 2NY6C 4RGOH 4L4TD 3TJHD 5IW3A 2R2BA 1BQSA 3QFJD 4JO2L 4KVNH 4XBGB 3OKOA 1S7VB 4I3SL 1FNHA 3LKQA 1QFWM 3T0BA 1DUYB 4U6HB 3O81A 3TH4T 3T1FA 3BE1L 4G43B 1UWGH 3QQ3B 1YN7A 4J1UB 1I7UA 4NO5B 2BXYA 4Y4HA 3RZCC 3VFTA 1QSFE 2EH8H 3RWJB 3CZJA 3I75A 3SGDH 3GK8H 2F74A 4P57A 3ZSSA 3VXMD 1AO7D 1ZLSL 1OGAA 2YPVL 2YSSB 3MNVB 4Q9RH 2XYCA 1VFOA 3FT2B 4OQTL 4UNVA 1ZS8B 1S7RA 1Y0LA 3AVEA 3GNMH 3N85L 4KKAD 1M7XA 3UJTL 2D3VA 1BOGA 1FE8H 3GBML 4NFBA 3B83A 4JGUA 2BMKA 2HT4C 4ZPVB 2ZG3A 1VGEH 1YPZF 4MCZB 1JPFA 2G75A 5K93A 5I1AA 5KANG 4N8PA 4HWEH 3UMTA 1FBIH 2H8PA 1QLRB 3PHOB 2ZOKB 4PLOB 1UKQA 1WBYA 4MAYA 1L0XA 2YKLL 3MOBH 2AJZA 3GRWA 5JXEA 3RVWD 3OGCA 5JNYA 2CKBB 4ZSOE 1F11A 1I1CA 3QNXB 1M71A 4PY7A 5CJQL 3NPSB 1NC4D 3PWUA 4HQQL 1FV1B 2ICWB 3DSNA 5I18H 4LRNH 5I71B 2NMSA 4JKPL 1DEDA 3VWJD 2XICA 2ZSVA 3QRGL 5FCUH 2ENSA 3NZ8B 4Y4HC 4UZGA 1LWRA 1J0IA 1T0NB 3SGKA 4H26B 3EIFA 4NC2B 4QHKJ 3MJ9L 2BOCA 2W91A 3SDYL 2GJ6B 2WV3A 1RSFA 2AQ2A 1B3JA 2XZZA 5F8RC 1CXHA 1OAXH 3MLTB 1KLGA 1OQXA 3NZHL 2VLKD 1T1YA 4MHHI 2X1WL 4R4ND 5J3HD 3BPCB 1CQKA 1EFXD 5CUSL 4PJCE 4R0LB 3IAGC 2GY7B 1XR8B 2IF7A 1XF5B 3C08H 3BXNB 3VDCA 2QADD 4H1LB 2AV1B 5IFAL 4K23L 1S3KL 4P2OA 1XCTB 1I3UA 1OAZH 3T3ME 1X5JA 5JDSA 3IVKB 1WFTA 1EEQA 1FZOA 4MAYC 3UTTE 5C9JB 2R1YB 1UCBL 3VRLF 2WWKT 5HYQA 5BRZE 1MFNA 3LHPL 2OCFD 4YHPB 1OT1A 1IGFH 1WWBX 3MRJA 4M1GH 4PP2B 3INUL 5JHDD 4ALAH 3SGJA 3UTOA 2FO1A 4P46B 3ZDZE 4N8VA 3FFCA 2ADJA 6CGTA 1G7QB 1SEBA 2C3VB 3OJDA 4G7YH 1FRGL 1ZLWH 4U2YA 3U4EA 1QFHA 4KDTA 4PJ9B 2VXVL 1T0MB 3SGKC 4MNGE 1FAKT 4UT6H 4Z95L 4QHLA 3G6JB 2X05A 3Q6FB 1RZ8B 3TWCH 3KR3L 2MHAA 4DZ8B 4URTB 4PUBH 4RAUB 4XAKD 4XAWH 1V5JA 1IC7H 5DD1L 4P99A 5B22A 3ZT6A 4F15B 2AJ3B 4Z7VF 5JLZB 1PAMA 3CDGA 3ULUC 3V52L 1FVDA 4M61A 25C8L 2O5YL 4NQVA 3Q5YA 2F53E 1MLBA 3OKMA 1JMZA 5HHOE 3ULVC 3PWJA 4MWFB 1EBPA 4PRHD 4TSBL 4P2OC 3UTSE 2AJVL 3DIFB 4HFWA 3K3QA 3FN0L 4NQCB 3KLDA 4QOKD 1HHIA 4YXHH 5GGQH 2HA1A 1RIVH 4HF5H 1U9KA 2QKIA 4NNPH 2VSDA 2UUDH 5IV2A 5HY9A 4NPYA 1MFBL 2D4DA 3EOBA 3S98A 2ERJB 3DVGA 3ELAT 1NFDB 1T04B 3SGJC 4X6CE 1IGMH 1D6EB 2AJXH 3AS3A 1HXMB 3VXSD 4X4XA 3RWEB 2V2WA 5MEND 3AB0B 5JQ6H 5LCVH 3G5VB 1EHAA 1FNSL 4KDTC 4FNLL 4NM8H 4ODTH 4X99B 1UADC 3KYMB 2YPLE 3D3VA 1GOFA 3B6SB 3U7YL 3DWTA 4L3EA 3W39B 3JTTA 1YEHH 2UWEF 1XF2A 4M02A 4KGJA 3SKNB 2BVPA 4OFDA 4NYLB 2UZYB 2F54B 2NY5L 2ESVD 2EYTA 2XN9B 1EFQA 3T08A 5JPMB 4ISVA 5DVNA 2G9HB 3EFDL 5EO0A 2DMKA 4D9QE 3GHEH 4NUJB 2FX8H 4NO0B 5L8JB 2NXZB 1A2YA 2P5WE 5IF0B 2BNQB 3SDDB 4HKXB 3STZB 3QJFB 4HUWA 4LSUL 2PTTB 4QF1A 2IANA 5D7SH 1JGUH 2PO6A 1ZMYA 4AEIH 3C2SA 1X5FA 4JPIB 3TPKA 1MCNA 1OAYH 1K3ZA 4OIIL 4Y2OA 1UA6H 2IFFH 5BOPA 3S3SA 4JZJB 1G9EA 1EPFA 4PP1C 3SE3C 1ZHLA 2EH7L 1RIHL 1AGCB 4DVBA 2F19H 3F65A 3IRPX 1T7ZA 2O5XL 1LO0H 1DANT 5JORB 3TVMB 2F8XC 1CQYA 1OAUL 1KCVH 1YJDC 4NQXB 1WEJH 1JNNH 2H32B 4Y4KA 3H3PL 32C2B 4OI7A 1LEIA 4MLSA 3WNNA 2FWOA 1SM3H 3KPSE 1FGVL 3VH8A 4HK0B 5TGBB 2DDQH 3PWNB 1UB5A 1FO0A 1WZ1H 1OAKL 3HG1A 2BK8A 1BAFL 1CFVL 3PDOA 1MLCB 4PLJD 4WO4D 1LDSA 5F6HJ 2OP4H 3AS2A 5EN2A 1INDL 1AGDA 4KPHH 4F37K 4YO0B 3IFPA 1BZ9A 4JRXA 1YY9D 5FK9A 1WC7B 5DRXA 1T7XA 3IU4H 3KLSA 4OD2B 5BZWB 4PJGB 4FTVB 2EYSA 3L5IA 1T89A 3LKSA 2WUCH 4NO3A 1ZGLB 3QIUC 2R0LH 2HFEA 4XPAH 3KDMA 4YAQA 5HYJA 4FQCL 2PO6C 2IAMC 3QXAB 1L9NA 1AHWA 4JDVB 5EG6C 5C2UB 2PR4H 1XGUA 1M7DA 1CDHA 4HDIB 3UDWA 3NN8A 3LPGA 3V95A 2OLDA 3WFHB 2PTUA 1S9XA 1ZA3B 2W0LA 2XY1A 4NN6C 4UDUA 4AL8H 4S11A 1YEDB 4NGHH 4ELME 2WSKA 3BP6A 3LH2L 4JZOB 2ENYA 1A47A 5IB2A 1DQLH 2QBWA 5FA4B 1HILB 1BMGA 5L88H 2R9HD 1SYVB 1MHPL 4H1LG 3W0WE 4DGYH 4Y4KC 2CR3A 5F9AC 4NQSB 4QEGA 5EORL 3MX0A 5LGJB 3GGWA 5DSCB 5C07B 4DKEH 4MQ7B 4L8BA 4Y0GA 3VGDA 3RWIB 1C08A 5FYJD 1NBZA 3WFDL 4RQQB 4PB9H 5DZOA 3RZCB 4OQTA 4UQ3A 5GJTH 1F4YH 3PABB 4PYHA 4QYOB 3QUXA 3CCHB 2DQDL 1ND0A 3EDFA 2LAGB 4G8GB 4K7PY 4U1HB 4KQ3H 5A3IC 3OX8A 3DUSB 5EU5B 5GGRA 5E8OA 1DBBL 2J6EH 3MFFB 1XGQB 3VFUB 2ADFH 1FG2A 3O11A 2X2YA 3U4AA 2Z9TA 4MGXA 1OAQH 1C5DB 4QWWC 4UV7H 1QEWB 1Q0XH 1P53A 4G6ML 4N0UA 2B1AL 5IBLC 1DQQA 4X9FA 4M3JA 1T89C 5F3HB 1DVFB 1SMOA 2DQUH 3TA3B 4JRYD 4OBSA 2A9NH 2O26U 4BFIB 2AXFA 2JB6A 3D0LB 4HC1A 5C0IA 1AHWC 5IESH 3IFNH 3UDWC 3WFBL 3VW3L 3EOTH 3SDXE 4PJHE 3QCTH 4FG6C 4KJYA 3BZEA 3QG7L 1PG7X 4JFDD 3L7FA 3LRSA 4C4KO 4XX1E 1KCSL 4PJ5B 2ID5A 1N6UA 2DMCA 3KHQA 4M03A 1QSEE 1JHKL 2R2BB 3BKCL 2MQCA 1MF2H 3BGFC 3LKQB 1YA5A 3BP7A 4P5MB 3QDGA 4NHCL 4OCXH 2VZ1A 4NZRL 2FD6L 3WL9A 4F33A 1SY6H 4G6JH 1TJHL 3MRGB 2FIRT 5FYLD 3FB7A 4FXGB 3MO1A 4OZGA 4WGWB 4R90L 1B88A 1OTSD 3DXAB 4HIJA 1EBAA 1E4KC 2AQ1A 3VFTB 4K2UH 3TBVA 3C6LB 1P84J 3ISWA 3MCKB 3GSRA 4XPFL 4KMQA 5HHMD 2ZNWA 4P57B 3W9EA 1U8JB 5SWSA 1OGAB 3T0ED 3WIHL 4GS7C 4CUCA 5I1IL 3EO1A 5E8DH 1Y0LB 3C09C 4XMLH 4LSQH 1IGCL 4OLUL 3C2AH 1T2QL 3E3QE 3EUUA 3U79A 2QSCL 2ZCLH 3O8XD 3BW9A 4RIRB 2Q7YA 3T3MF 1KN4H 1ZHKA 5ETUA 4LASL 4F7EA 3WJJA 2NY0C 4JPVH 4XP6L 1JPFB 3A6BH 3TBSB 3VD7A 3DOSA 3MRCB 4NRZA 5EH1A 2OXHA 2ATKB 2APXA 5HPMA 2CUHA 2NY4D 1A6TB 2OK0L 5DC0A 3ZKXC 3MOAL 1WBYB 1EMTL 3LKNB 5KSBB 2AGJL 3FQRB 4LKCB 5I15H 3P9MB 4U1IA 4NN7B 1NLDH 4XVUD 2P44B 3ZDZF 1I9IL 4KUCD 3DVIA 3H42H 4HGWB 2YD5A 2AV7B 3WNLA 5DD5H 5D7LA 1JTTA 2ZUUA 2OTUB 3QO1A 5CCKL 4HXAH 1G6RL 5B38A 2X89A 2CK0L 5A16B 3WSQH 3ZYIA 4EDXA 2Y1VA 4O5LL 5AAMA 1NBYA 5DJYA 1FLRL 2DOCA 3RDTA 2Q86A 4E41B 4XMKH 3BQUC 4LCWE 3NFSL 2W38A 4OCRH 2NR6D 4OZIA 2XZAL 4S1SH 5CJXA 4UQ2A 3PGCA 3PGFH 3VGFA 3LEXA 4JFQA 2ICCA 2BNRB 2WNGA 1ZVYA 2OZ4H 1U8PA 4H20H 3RVTD 1RUKH 1U3YA 5I17B 4L9LB 4QXWA 5DFVD 5K9QI 2AJSH 1QFWH 4YGAB 4JG1L 3KYOB 5CP3H 15C8L 2PXYA 4IOIA 2W60A 2FZ3A 2MFNA 2Q76B 3OKKB 2YK1H 3GUTB 1IAIL 3MODH 1CU4H 3CLEH 4TTDC 2L7UA 4MD0A 3T65A 2X4UA 3MRQB 4YHNB 2Q1EA 3HAEH 2H3NB 2RFXA 2JE8A 1AI1L 4OM1L 2DI9A 4P5TA 1MCWW 2VISA 3ARYA 3D85B 1FZOB 2FR4B 2DQHH 3RPKA 4YXLH 2DLHA 2X40A 4X6CF 4O02L 4Z18A 4FS0A 4RMVA 4HV8B 3E0GA 3BUYA 2JIXA 1NCBH 3OR7A 1RZKC 5C6TH 1INQA 5IW1B 4PJDE 1ZWIA 3H3BC 1PX3A 2R29H 1R5IB 5F9WC 5DJAA 2FB4H 4MA1B 2DQCL 2DTMH 2O61A 3OJDB 1J8KA 1VENA 2OL3B 3BKJH 1RMFH 5ACLA 3RDTC 3P9WB 2NY1C 3WD5H 4QHLB 4P23D 3D87B 5CJBA 5MHSD 5B4MD 5ISZD 5AZ2L 4XP1H 3HB3D 4LU5H 2P7TB 2DQJH 4I48B 3DJ9A 5FO8B 4OZ4B 3TGXA 4LCCB 1WFUA 5BS0B 5IEHB 3OKEA 3UCRA 3QFDA 5K59E 2UYLA 4HKJA 4TTGA 5BXFB 3VXPA 2DL9A 4LOUC 5FYLH 1KEGL 3TBTA 1S9KC 2PXYC 2XPGA 1T4KA 5CEXB 2NX5E 4N0CC 1GZQB 3HMWL 2Y07L 1W72A 2AERT 4W81A 3P0VL 1LVEA 2WP3O 1JF1B 4EDWH 2GCYA 3KPPA 4O58L 3QQNA 4P5TC 2PCPA 4R7NA 1WCQA 4X8JA 4XCNA 2W0KA 1KGCD 1TZIA 3RNKB 3TN0A 1YPZB 5GS0L 5I1EL 1FNEB 1QFUL 1BVKA 5TE4H 5C0AE 3EOBB 5DHXB 5C2BH 1DEEB 2H6PB 2AEPL 5IVOA 2YD7A 5IB4A 4DTGH 2FLBT 1DBAL 3CK0L 4S10A 1QR1A 5IM7A 2GY5A 4I18A 4X4XB 1HZHL 1UZ6E 2X9YA 4MAUH 1YECH 1AC0A 2HVKB 4X7SH 1U3ZA 1FNGB 1EGJL 1FYTD 1V7NH 2VLLA 5CZVH 4W70A 1I1AA 3D3VB 2XQBH 3O6KL 3DV6B 2FH6A 3ARQA 5JW4N 2D31A 4P4KD 1IM9D 1SVCP 4L3EB 4EUPG 3MBEB 1VB9A 5D72H 2BSED 1SVZA 3O3DA 3EO0B 2JTDA 3PHSA 2HVJB 4IIQA 2HYMA 3UAJD 2MWCA 2HFGH 5BQ7B 5I1HH 2EKSA 3REWB 5GRJL 3L95A 1UXWB 3F58L 4ISVB 1KOAA 4XT1C 3MGOA 3C5JA 1LO2H 5JUEH 2Q87A 3U1SL 2BERA 4JGJA 2Z31A 4MX7A 1A2YB 4ODUB 4XNQA 3NMEA 3K4ZA 3AU1B 3KLAA 5SWZB 3QIUB 1B4RA 1EO8L 5T3ZD 3OAUL 4LP4A 4OLZL 1MEXL 1Q9LB 3DGGB 3JWDH 2IAMB 4ELMF 4OGXL 1MJUL 4Z6AT 3L3DB 4YPGA 3U2SB 3DVFA 1ZANL 1ORSA 2FBJH 1JPST 5FUOL 1ACYH 3E1F1 1JNHB 3CUPA 3KPQA 3MRHA 1NL0L 3LIZH 5ADOH 1G7HB 2YOCA 3PDDA 4AH2B 2VQTA 1RUPL 4TPRL 1V3LA 4PG2A 1QSFD 4LLYA 4J3TA 2XZCL 2J8UF 1EXUB 2IANE 2A9ML 3MGAA 3U7WL 5FKAB 2AEQL 5C0BB 3BHBA 4IRSD 1CD8A 3O9WA 2EDFA 4GRLA 3SGDI 2D0GA 5I1KL 1UGNA 5GHWL 2FWOB 1I1AC 4QTHB 2EZ0C 4RZCB 1HWGB 4XVJL 4I0PD 3RIAK 4AENB 4ZO6A 3VH8B 1J7VR 3UPRB 3O45A 2V9TA 4OSUH 4M5ZH 4LDLB 3M8OH 5DEZA 3NTCL 3HG1B 3RWCA 4X83A 1A1NA 2X1OA 3HPJA 4IIQC 3PWPA 1RJZB 3PP4L 1BGXH 1MFEL 4NKQB 4JO1H 4GRWF 2QSTA 2AJYL 3I3EA 4JFFA 5ICYB 4JQIH 1AGDB 1HE7A 1XGYL 1Z9OA 4J2XA 3IFPB 4JO3H 2YZ8A 1IEBB 4JREC 1J1OH 3CMOH 4MXVE 4WWKD 3WXWH 3IETB 5HHQB 1N59A 3KPMB 4QRSB 4NBYB 1EA9C 3LKSB 4NO3B 4ODSL 4U1GC 4OAWB 2HFEB 5CBAB 2IFGA 3KDMB 4YAQB 3HE6A 3SDXF 4PJHF 4DFHA 2JJVA 1AHWB 2V2TA 4OLXH 5IB1B 1XGUB 4RGOL 2BDNH 3U83A 1M7DB 3NN8B 5C3TA 1S9XB 4KVNL 4UDUB 3MQIA 5GS2D 2VXSH 1NJ9B 2KQMA 4JRXE 5DI8B 3RKDC 4YBHA 1UWGL 3QAZC 2H2SC 4RGNB 4XTRD 4PG2C 1RHHA 2EDDA 3IF1B 5AWNH 3BGFB 4K9EC 1VERA 5D8JH 1CR9H 1CZ8L 2J5LC 2DMBA 2JCCA 3TP4A 5HYJE 2I5YH 3GK8L 1DN0B 4LPUA 4GRLC 4D0DB 4KKBD 1DBMH 3AAZB 4OF6A 4JPKL 3LKOB 4BFBD 1UC6A 4JN2A 5IGXH 3DGCR 3EGSB 2X1PA 3JWNC 4LBEB 2RGSA 3SKOB 3GNML 1CLZH 4L5FH 3GMMA 2NXYC 4WUKL 1JYXA 4YHYC 1BIIA 1FE8L 1ND0B 4RWHA 3FQXB 4WFHE 4GS7B 1VGEL 3ZSTA 4FQLH 1UM6H 1R3IH 3C09B 4D3CH 1BJ1H 1FG2B 3O11B 3BYYA 4HWEL 4GXUN 1FBIL 2UWEB 4WUUB 5LG1A 3O2WL 2J88H 3D18B 3UTTD 4OD3H 5BRZD 4HK3N 2IQ9L 2NY0B 1J8HB 2QSVA 1BHGA 5DYOA 5SV3A 1T03L 3OQ3B 1D5IH 1NGXB 4WFEE 3SDAC 5GSRB 2IPTH 1IFHL 2OI9B 5D1ZB 4JN1H 1SJHB 2JB6B 1Z5LA 5GISH 4XGZA 1HQ4B 3ZKXB 2IG2H 3N1PC 4PRIE 3LSOA 5ABDE 4HG4K 1HINH 3E2HC 4KJYB 3BZDA 5DMGD 5I18L 1ZSDA 3L7FB 5CZXC 3KXFA 1D9KA 4P5KA 3FTGA 4BKLB 1VPOH 4R7DA 3BEWA 5FCUL 3GJFB 1U93A 4WI8A 1DTUA 1G7PA 1JPSL 4N0UE 4PRAA 1I4FA 5ERWB 3BP7B 3QDGB 4F33B 4UNTA 3AY4A 5DJZB 3ZKMC 5L2KD 4MJ5A 1TZGH 5EOQL 5E7BA 1S5HB 3AREA 3DX7A 3L3IB 1QHPA 3TBVB 3BQUB 2EDHA 1HHKA 4TSCH 4HW6A 3W9EB 1PKOA 5A2IH 4GSDH 5SWSB 3QIWD 2A1WH 3C08L 2F53D 3O4LE 3AS0A 5HHOD 3BAEH 3P4OA 1S9WA 3TO4B 3GM8A 5KAQG 4RX4A 2XA8H 1OAZL 3NABL 3RNQB 1H8SA 3C5SA 2R69H 3ZDYF 2NYYD 3BW9B 3LQAH 4OZGE 4DVRH 2NTFA 4H0GA 4PG9A 2AAVA 4P4RB 1BD2B 2JJWA 2BCKA 5SX4H 1QBAA 3DUUB 3GMLA 4HJ0D 2E9BA 5C0CA 4P2QA 1YNTB 1IGFL 3V4UH 3LN9A 1IRAY 4ALAL 3LV3B 3O4OB 3QWRD 4BK5A 4NQCD 1KTLA 1PSKH 4PJDF 2X4QA 4HZLB 3FONB 1D9KC 1GC1C 5FCSH 1R3KA 1LK2A 4G7YL 2BSTA 4Y5YB 4MA3A 4LNVA 3V4VH 5IR1A 1NCTA 5D7LB 2D7TL 3QO1B 2YPLD 4UT6L 4XRCA 5F9WB 3TWCL 1C16A 3AY4C 5HYSB 1RZJC 3MLYH 4YHZH 4XAWL 2PYEE 2NY1B 1C5CH 4RDQF 2BVQA 3MV7E 3V6OA 3HA0A 1HXYA 3L3HA 4OZIB 4OTXL 1X5HA 4D9QD 4TUOB 2HTLC 2FHFA 3PGCB 2OS7A 5K59F 3RGHA 3VE0A 3LEXB 1ONQA 2P5WD 1MCOH 2CKBH 2MQ3A 4LPTA 2XKUA 1SJEA 5I1LA 1KIPA 4YXHL 4JCLA 4LCUA 3MZTA 4P9HC 4R97B 1N0LA 1RIVL 2PXYB 4HF5L 3BVNA 4NNPL 4GUPB 1G7JA 4U49A 2VDNH 3QRFM 4RSVA 3VXUA 3QPQD 3VH8G 2FSEB 5AYQA 4IEFB 5DQJB 5E8NA 3RWHA 4RMUA 5IMMA 4GQ9L 1NEZB 4XP4H 4ACPA 1IGML 3FO2A 2AJXL 4IDJH 2BNUB 5C0DB 4HUXB 3MXWH 4F3FA 4XWOC 5HXMA 5CGYD 3QUMB 3NIFE 1NBVH 1GOHA 1T21B 5E2WH 5JQ6L 1UZ6F 5F89A 5LCVL 2VAAA 1NCCH 1H8NA 5CSGA 1N5AA 4GBXD 2OX5A 3THML 1ZWIB 3KPSD 3MRFA 4ZO7A 5M94B 5HGHB 3IDNB 1BOYA 1YN6A 4KRPC 4Y16A 4J3WA 1YEHL 1NMCC 2VSCA 1P4LB 4H1LH 4E5XA 4BH8A 5E5UB 1U8KA 2F8VA 3DX6B 2DF3A 3V6OC 1TVBA 4H0IA 1T1ZB 4OGAD 1ITBB 2F5BH 3VFMB 4Z7UA 3GHEL 3B2VL 2FX8L 1GZPB 5KW9L 2R4SH 5GGVH 1A0QL 5CBEA 4P3CH 4NJAH 4R2GD 2UYLB 3Q48A 2EDWA 3VXPB 1I9JH 1RVFH 5DUMH 1CGTA 3BWAA 5D7SL 1JGUL 1KJ3H 5IFJB 2XPGB 2ZG2A 1GGCH 3C60B 2GI7A 1W72B 5ICXA 3UTZB 2BY0A 5GQBA 4AM0B 5D5MB 2XFXA 3KPPB 2NZ9C 1ZTXH 3LVEA 3MGTA 3H7BB 2PCPB 2F19L 4X8JB 3MUGB 5DR5H 4QHNB 5IVXA 2DLFH 3MV9E 4QGYA 1XZ0A 2V7NA 1TZIB 3W0WD 1LO0L 3RX7A 3STLA 1G0YR 2WK2A 3X14A 4J7RA 1KCVL 4X7FC 1WEJL 1QACA 4LEOB 3V8OA 3T2NH 3S3JA 2R23A 5CEYB 2P5EB 4K7FB 5SX5K 3Q0HA 5IB4B 1BF8A 1CDCA 1XIWA 2R2HA 4FXKB 2OBGA 1K4DB 1JGDA 4ZS6C 5T33H 5C0FA 1P7HL 2W9DH 3VDBA 1SM3L 2PKDA 5J9PB 4YBQC 1X6LA 2DDQL 4Y16C 1PQZA 2NY6D 4RMWA 2CLVA 1WZ1L 3B5HA 2FATH 3ARFA 5I76B 3ARSA 3MJ7A 5DQ9B 4ZUVA 3NOIA 4CBPA 3BH8A 4MD4B 5CJOL 2OP4L 2D31B 1AQKL 4KPHL 1TPXC 5E2TH 5CJ8A 5EIIA 3V79C 1KULA 4Q2ZB 5DJCA 1UENA 3O3DB 3BGMA 3IU4L 2QEJA 4IIQB 5JOPD 3QB7C 1LO3H 5E1HB 2EKSB 3X3GH 4MJ6B 1EEYA 4W68A 4KMTL 4JDZA 2QQLL 2R0LL 3K80A 2EE6A 3C5ZD 4XPAL 1JF6A 3MGOB 3ROOA 4G9DB 4NM4H 4A6YB 5I66B 4GKNA 4G8EA 4LCIH 1KPUA 5EBGA 4G6AD 1NANH 1U91A 4LSDA 2IBZX 4BSWB 2YPKB 3CFDA 3A0OA 4U1GB 4AL8L 4LLDB 3E8UH 4KVCH 2L7JA 5HD8D 4NGHL 4MDIA 4MJ4A 3UTSB 1VFUA 4HUMB 2C26A 3RPIA 4OIAA 5JR1L 4YPGB 4HMCA 3VDAA 5L88L 3U0PA 3KJ4C 4ZTPL 2OMBA 1R24A 1S7TB 4DGYL 3WHXA 2EIZA 3ZKNC 4RRPG 3KPQB 3MRHB 2N1KA 1QRNA 3ORJA 3QAZB 3PHQA 4GLRI 4Y19B 1JNLH 1PFCA 2F15A 1NFIA 4I9WD 1F42A 4JM2D 1QBLL 1Y6KR 2ICEA 3UO1L 4X6CB 1F4YL 1T7VA 1UYWH 7CGTA 3OAYK 4MNQA 3WUZA 3BHBB 4Q6IC 4M93C 4GRLB 5JA8B 3JSSA 2GFBB 1F3RB 5JW4R 4HUNB 3I02A 2HKHH 1DDHA 3ZTJG 4L29B 3L9RA 4FZEH 2IQAA 2NZIA 4KQ3L 1MNUL 2J6EL 3EHBC 3KYAA 2ADFL 4R3SB 2NXYB 3W9DB 4WTWA 5CSZB 4YHYB 4Y4HD 3RWCB 4HGKC 4KK5C 4UV7L 4FOMA 1U0QA 1GJIA 1N5YH 3RWDA 2GT9B 4FMKA 1F90H 3ALPA 3FN3A 1Q0XL 4NO2B 3VXQB 1DQJA 2ZOLB 2YD6A 3FFDB 2DQUL 4WHCA 1HK6A 5FO9B 4Z8FH 3ET9F 2A9NL 3ABZA 3CFJB 3OB8A 4ZUUB 4A2LA 5HYSG 2WP3T 4X5XA 5BZDA 1DUZA 1X5GA 4X6FA 5FM4A 5IESL 3IFNL 4UU9A 3TPUB 4XXCA 2H32H 3EOTL 3SDAB 4PGJA 3GJFK 2BVOB 2AKRA 1U8LB 4N1EA 3SY0A 5HVGB 5EU4B 5IHZA 4XPBH 2CKNA 2F5AH 5HHVH 4ZUWB 5D2NA 1MF2L 5GRXG 3PG2A 1IC5H 3E2HB 4QXUH 4YR6A 4XNUL 4K3EH 4OCXL 1DLHB 1I9RL 1NMBH 2XWBB 4U1LA 4H5SB 4F7PA 4OLWH 4G6JL 3IDGA 3FZUC 4MAYD 2ITDA 4S2SA 4YZFE 5JXED 4K8RD 2LE9A 1JZ7A 4K2UL 2M2DA 5T3XH 3GI9H 3P30L 5D7JA 3WKML 5ID0A 2WLYA 1ZT1A 3OBAA 1YC8A 2MQ0A 3TBYB 3V5KA 1PZ5A 2HKFH 1RZGB 4HSQA 1CFSB 2DIJA 2X41A 4PGBA 5E8DL 3PWLB 3RWGB 4XMLL 5IW6A 3DO3A 3C2AL 4ZUSB 3MROA 4LARH 2W59A 4X5LA 2IPUG 4RBPK 5JW4M 2DIBA 1Z6JT 1RV6X 2WMPA 4OZGF 5I8EA 4JPVL 1N0XH 5KVDL 3BDYH 4FFZH 3BIAX 2HTKC 4HH8A 2JCCE 5GRVL 4PTUB 1U92B 5I75C 3LB6D 1HEZA 3P2TA 2V5YA 1RU9H 4HEPG 5E5MA 4UB0H 2J1KA 4XXCC 1ED3A 5DYOB 3LQZA 1BBJA 2B2XL 4JAMB 3L5JA 1NLDL 4AT6A 5AZEH 4QT5B 3C9NB 3H42L 1KJVB 3QEQA 4GT7A 4XVTH 3BZ4B 4S1RH 1MVUA 5DD5L 3LSOB 2Y5TB 2YMXH 1PW3A 4P2OD 5D2NC 4HXAL 5L0QB 2VIRA 2WAHA 5L8KB 4RFNC 1CL7H 1K8IB 4XC1H 4ERSL 2P4AB 1SYSB 3WSQL 1CGUA 3KPTA 4ELMB 1EAJA 1BX2A 5KZCD 3BKYH 4UOW1 5DEFA 1JZ8A 3LOWA 1NUNB 3MLVH 4XH2A 1L7TH 2I07A 2GW5A 2W65B 2YC1B 5D7JC 3K8MA 1ZXQA 4KK8D 1IBGH 3L6FA 4MJ5B 4R6UA 1YDPB 5AUMA 3SQOH 2EYRB 2MCPH 3FFCD 3I9GH 5F21B 2OZ4L 3BFOA 3MJ6A 2DB8A 3QXVA 4H20L 2GJZA 4HAGA 3EO9H 1T5WA 1M05B 2J8UB 3FMGH 5FIEA 1RUKL 1JHTB 4U1NB 4L8SA 3TLRA 1QFWL 4LEXL 1J05B 2NX5D 3MTRA 2H26B 1S9WB 2YK1L 5MEQB 3MODL 1CU4L 1F58H 1OT2A 4AQ1B 1CYGA 3BESR 5DHYA 5C8JA 4ZMAT 2NTFB 1W8NA 5F44A 4C56A 3QXDA 1A1MA 1C5BH 2FNBA 4YXLL 4GRWB 2QHRH 2BCKB 1P1ZB 3V5DA 4PY8I 5EU3B 4M00A 2ZZUT 4PRPB 4ZTOH 3T77A 4P2QB 4XBEL 2XKNB 5C6TL 3NIFF 2OTPA 3G6AB 1HYRC 1OTUC 2R29L 3QISA 2X4QB 4U7MA 3V0VB 2FB4L 3SDXB 4X8XA 4M9OA 4KK9C 1SMAA 1R3KB 2DTML 1LK2B 3F7VB 1ACZA 2BSTB 4FFWC 3BKJL 3L3OB 5IR1B 4LLWB 5INCB 5FKPB 1E4XI 1QSEB 5F1SA 4PJEF 2A6KB 2VL5A 4KRPB 4MS8C 4CU8A 1SHMA 5C0CE 3E6FA 1YMME 1NMCB 2DQJL 2YEZA 4KTDL 4LF3B 3QIBD 4GG6A 2QSQA 4JFXA 7FABL 3SPVA 4P59H 2GSIB 4HKZB 4GKZA 4K94H 4PGEA 1HXYB 3VXRE 3NH7H 4L8SC 4R26H 1LK3H 5MEPA 5FYLL 4PJ7A 4Z9KB 4MJIE 2FEEL 1QO3B 3GRWH 3R4DA 1ONQB 2NY3C 1J11A 4PJXA 4YNYB 4JG0H 4M1DL 3HCVB 4GW4A 2CR6A 4NUGH 4F7CA 1SJEB 5I1LB 4NQDA 1MCDA 1V3MA 4QLRA 2BC4B 3SDCA 4EDWL 1MFCH 2HP4A 4YHIA 5DTFA 3DV4A 3EOAB 4GXUM 3AS1A 3VI3E 1H15B 1W8OA 3T0XA 5DMKB 1CGWA 5KANI 3D25B 3RWHB 1IEAA 2VABA 4R4BA 5IG7B 1DQDH 2ARJA 5IMMB 4O2FA 4XP9H 1JWMA 3PGDA 3MLRH 3FB6A 4KKCC 4PGZA 3ZKSD 4AEHH 3CH8A 2EDRA 4Z7WB 2IAND 1JFQL 2DI7A 5IBTH 2PO6D 1LE9A 4X7SL 5AG8A 2VAAB 5F93C 3KWWB 4OF7A 3VXUE 3FT3A 4PLKC 3PV6A 2XQBL 4GXVH 3ULUH 3MRLB 2HG5B 1H3VA 2KH2B 1RPQA 4OLYH 1CS6A 5HDLA 1MJJB 2VLRE 2PW1A 5C09A 5D72L 3ULVH 1FDLH 3OWEA 4BH8B 4ZAKA 1R3JA 1U8KB 1ZT4B 4Y4KD 3RY6C 2AP2A 5I1CH 5IJVB 5I1HL 5DD0H 5CLTA 5D1QB 5EOCH 3HC4L 1TPXB 3MV8E 3NCEB 4LCWB 5TQ0H 2R0ZH 1LO2L 2WWMC 3B9EA 5JUEL 3QUYD 2LV4A 4C58B 2E6PA 4QRQB 4NC1E 3X11B 1MJ8H 1S7UA 2OQJB 2K9UA 4XCYA 1TMCB 1IGIH 5GPRA 1RK1B 3SDCC 3HUJE 3QEUA 1YNKH 3JWDL 4KI1A 4NKIH 1ES0A 3FT4B 2X7LA 4F7TA 1PEWA 3MLXH 3QJHA 2EXWD 1RIUH 4HS8H 1MIEH 2FBJL 1QNZL 2BSSA 1ACYL 2HRPH 2FEDC 1A5FH 4JRXD 4L9DA 2XFXB 4Z7UE 2ITCA 2OL3H 3V6FA 3LIZL 2X4NA 5AYUH 1MI5A 4LCYA 3LS5H 3RIFF 4RA0C 3QEHA 1XZ0B 2V7NB 1CCZA 4Y5VC 3KJ4B 4KUZL 5DEGA 1I8KA 1M7IA 2HLFD 4PTTB 3GSWB 3VFPA 5ADPH 5GRWA 5HYJD 4RNRA 1AQDA 1HHGB 5C0FB 4H8WH 1TJIH 1UEMA 3FOLA 4I8DA 3PP3K 4M7LH 3U0TA 4LLVB 3RWFA 4M5ZL 3IJYA 3M8OL 2SEBA 5EZOH 43CAA 4CNIB 2HMIC 5FXCH 4TULH 4Q6IB 2VKXA 4M93B 5IVXE 1HIML 4D9RE 3ARBA 1HYSC 3BOVA 3MJ7B 3WBDA 1VKXB 4ELKA 4ZAKC 4GOSA 3BO8A 5I9QC 1UVQB 4JO1L 2CDGB 5FF6A 4XBPA 4JQIL 2XTJE 1KACB 1PBYA 5H37H 3NFNA 4WTZA 2LABA 3GSOB 4XNZB 1J1OL 3CMOL 5DJCB 1OHQA 3L7EA 5HTSA 5ACMA 3WXWL 3D39B 3IJSB 2HJFA 4JJ5B 3TJEH 3KPRB 3LZFH 3CC5A 3IXTA 1EEYB 3QUXD 1BECA 3EDDA 3QCUH 3TT3H 1OOAA 2IMMA 3ROOB 1UXSB 3QXUA 3V6ZB 4OLXL 4GKNB 2BDNL 1WICA 3S36X 1U91B 1AC6A 1HOCA 1YJDH 3IS1X 5CIPB 2FJGA 1MRCH 1X9QA 3U36A 3GBNH 5T1KA 2VXSL 1MIMH 2Y4SA 4Z77B 1SY6A 2P42B 4I3RL 4OI9A 3RPIB 3R0NA 3HC3H 4YE4L 3HRZA 3U0PB 4NT6A 4DCQA 1NAMA 3U30B 4YZFF 1QKZH 5TDPB 4X6DA 5D8JL 2DQEH 2X4SB 1CR9L 4QRPB 3CVHA 4J3UA 2I5YL 3PHQB 4HH9A 1P7KA 5C0AB 1X3DA 4N0FB 1DBML 3ILPA 4OGZA 2ATPA 1R5VA 5IGXL 1MCPH 1OF2A 2ICEB 1VEOA 4IMKA 5I73B 4X4ZA 1XFPA 4L5FL 5DURB 3O4LD 4XP5L 2NW2A 3QXTA 5HVWA 3I02B 2JJTA 1XGRA 1DDHB 1MUJA 4FQQA 1CFTA 4FQLL 4OI8A 3ZT5A 1UM6L 1R3IL 4XCEA 2P24A 3B5GA 4JFEA 2JCCF 4LQFH 3GSUB 1KYOJ 2J88L 1CWVA 3HI6H 1MQKH 4OD3L 1U58A 4OQ1A 3AM8C 5FB8B 1AP2A 1D5IL 2Y36H 1V7MH 2IPTL 4HJGA 2YD4A 1V05A 4JN1L 5E99H 4X5XB 1E27B 3L3GB 5FA3B 2X70A 1ZHBB 1A4JA 2OTWA 2IG2L 3VCLA 4B0MM 3HNSH 1HINL 5FGCB 2ARWA 1AR1C 1X5IA 6FABH 3GI8H 3RL2B 1VPOL 1FFPB 5F1IA 2KKQA 5C08E 5SX5H 5B21A 1KN2H 5D2NB 1YEJL 4WENB 1JWUA 4RFNB 2E6QA 3O3UN 4NRXA 5DO2C 2EXYC 4U1LB 1FIEA 2BHZA 4D8PA 1BQHA 1ZLUH 2ITDB 4S2SB 5TE7H 3D9AL 2EICA 3EZJB 5EUKA 4M6NH 1PKQA 2PYED 4NDMB 2Z92B 4NKMB 2ZWLT 3OJ2C 4GQPH 1C8PA 2OZ4A 4IMKC 4D0BA 1IQDA 4L8DA 5CHNB 3SQBA 1Q9WA 4TSCL 5KSVA 4WW1B 3H2WA 3VD9A 5T5NF 5BV7C 4GSDL 1QA9B 2A1WL 3N1FC 1HCVA 5D7LD 4Z0BH 5GGTH 3JWOL 4FQ1H 2JJTC 1JTPA 2YS4A 1IM3A 3LPWA 5C0EA 2Z4QA 5KVGH 4X5WB 1QBML 4OUOA 3HAEA 4KC3B 4L4JA 4WHDA 3MROB 2R69L 3G08B 3LQAL 3L3JB 4YDIH 4XXDA 5C6WH 4DVRL 3RDTD 4K07A 2F58H 2VRAA 1RHFA 3JV0A 2ICWI 3RAJH 3P4LA 3CPLA 3CSYB 5DA4A 1HEZB 2ZUYA 5HSFA 2Y6SC 1BFVH 3V4UL 4U1JB 3MRPB 2YWZA 1ED3B 3LQZB 3GEWB 1MJ7H 5HI3C 2GTZB 2R0WH 2CJUH 3IU3B 3PXHA 3ARVA 4G5ZL 4LOUD 4AT6B 5IFHH 3FQTB 1WBZB 1FC2D 4YPJA 2EE3A 1NC2A 4JQXC 5GJSH 2XWJA 3WJLA 4XCCH 1EV2E 5JOFB 2N4IA 4NSKA 4YEEA 4P5TD 1LE5A 3F5WB 3GMNB 3CFBA 4YHZL 4YFDB 1CF8L 1QOKA 5CZKA 3EYQC 4DKAA 1C5CL 1G9NC 1RI8A 2X9WA 2I07B 4LPXA 4XI5C 4L4VA 4UDTA 4M7ZC 2YD2A 2JIXD 3QEQE 4OLVL 2AI0H 4YX2H 3DTXB 4R8WL 3ARDA 1JL8A 5AUMB 5ITBH 3BPNC 4DW2H 3GKZA 3FRUB 1OP5K 4AEEA 1MCOL 2GJZB 1NDMB 3FQNA 3M1BA 4IHOB 4RGMC 4DN3H 4NJ9H 3ZL4H 4LPWA 1TFHA 4LDOB 2VDLH 5IVZA 4L8SB 5EU6A 3QG6A 1GPOH 4OGYH 4P0DA 1RD6A 4PJFE 2HT3D 4O51A 1T20A 2NY3B 3QFJE 3LKRA 1VA9A 4PV8A 2VDNL 35C8H 3NIGE 1A6ZA 4EI6B 4M6MH 3K2UH 2Z8VC 3U46A 1AGEA 1YEEH 2DYPD 3VI3F 3IKCA 5ACZB 3GJFH 1W0VB 5DHYB 5C8JB 2B0SL 2C4FT 3MV9D 5FGSA 2YA2A 1JPGA 3DMMA 3QXDB 3RTQD 5LWYH 1A1MB 4XP4L 2LVEA 1JI2A 1S8DA 4I0KA 3MXWL 4G8IA 1CFQA 1JF5A 5C7XL 3QPXH 3R06A 1NCCL 4PJBA 3F8UB 1TJGH 5BO1H 5LKNA 2E7CA 3F7QA 5D1XA 4NWTL 3LEVH 1D5ZA 4PRIB 2X4RA 3QI9A 3UTQA 3IDJA 2FJFB 3SGEI 4ZNEE 3TN0D 1ZK9A 2BY2A 3HZKA 4X98A 1MCKA 2PYFA 2F5BL 3E6FB 3P4NB 4POZD 4U1KB 2VDKH 2VLJA 3ARDC 4EN3B 2R4SL 5GGVL 1JV5B 2C1PA 2AJUH 2B5IC 5BVPH 4P3CL 4PJAA 1YMHB 4PGEB 5A40E 4I1NB 2Z8SA 3G5YA 3ARXA 1I8LA 1I9JL 1RVFL 5DUML 3LN4A 1MHCA 5KS9E 1KJ3L 3WS3B 5BMFH 3HUJF 3T2PA 2V9RA 1I1AD 3ZTJH 2G2RB 4HIIB 1GGCL 4GW4B 3F12B 4YDLC 5E6IC 4Y2DB 3WUWB 4F7CB 1I8IA 1U8MB 2NCMA 2V17H 4NQDB 5JQHC 3HS0B 4FA8A 1RZKH 4BH7A 4G9FB 4GG8A 1N64H 3VFNA 5DXWA 1WTGT 3N9GL 2DLFL 4F2MA 1KENH 3EYSL 3SJVA 3DX9A 5D7IE 1MH5B 4ZFFA 5ALCH 1Q9OB 1PY4A 3MPCA 1FN4B 1CICA 1A7QH 1D5XA 3WDIA 3T2NL 1IEAB 4PJ7E 1VFAB 2CXGA 2GQHA 3BPLB 1RAMA 2Z31D 3IDMA 4IRJA 3KLHD 4O2FB 4PJXE 4Y5VB 1KPRA 3FCTA 4EI5C 2W9DL 2VLKE 2IADB 4IOSD 5D1XC 2FIKA 2AK4A 2E9WA 3OSKA 1YEIH 1HSBA 2A83A 3F7YB 5GS1A 5J12B 1GH7A 5D2LA 1FZKB 5ID1A 5IVXF 3B3IA 1A9EA 4N1CA 4JDTH 4DWHA 4APQA 2WINA 3H9SA 2ZJSH 2ZSWA 3I2CH 4J8RA 5E2TL 2CMRH 3RUGE 2PW1B 4QXGH 5C09B 5EDXA 5D71H 4ZYKB 4HX1B 1K2DA 1WT5A 2GTWA 2CGRH 1CG9A 1P7QA 3ECBB 1LO3L 5KSAA 5IHBA 1LP9A 3QHTC 4N5EC 1S78C 2A0LC 2V5TA 4OT1H 1I8LC 3DVNA 1KCKA 3O9WD 3MV7B 2C7UB 4WI5A 4NM4L 4MCYA 5IJKA 4E42A 5FUZH 3E8UL 1BEYL 5EPMB 3CAFA 1XF4B 1KFAL 3QUMH 4XVSL 1BM3H 2KL6A 2XQYK 3PWPD 4OZFB 2X7LB 2CRIA 1EIBA 3QJHB 1W0WA 3HR5B 4JFFD 5DJ2B 1CE6B 2BSSB 2V6HA 1FNAA 3V6FB 3BIKB 1Q94B 1WZLA 1MI5B 2X4TA 4IRJC 5DJ8A 3QEHB 3TNNB 3VRJA</