3B83A

Computer-based redesign of a beta sandwich protein suggests that extensive negative design is not required for de novo beta sheet design.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
95
structure length
95
Chain Sequence
b'MLQPPFNIKVTNITLTTAVVTWQPPILPIEGILVTFGRKNDPSDETTVDLTSSITSLTLTNLEPNTTYEIRIVARNGQQYSPPVSTTFTTGSLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TEN-D3
publication title Computer-Based Redesign of a beta Sandwich Protein Suggests that Extensive Negative Design Is Not Required for De Novo beta Sheet Design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 13
structure length 95
sequence length 95
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3b83A00
1IT9L 1KN2L 5ABDE 5C1MB 1CGTA 3WS6A 1EAPB 5KVFH 3LMJL 4P23B 4C56A 4EXKA 4NPYA 3JVGA 3V4PH 2AJXL 2OSLB 1TJHL 3ALPA 4NKMA 4KVNL 2YWZA 4LQ1A 3VFRA 4P59L 2X1XR 5FYKU 3MV9B 5IB4A 1JL8A 1T21A 2ZUTA 2Y23A 2BVPA 4APQC 1S8DB 3DETC 4PJ8A 1UACH 2XWBB 3ZE2E 5F6IC 1HQ4A 3AC0A 2FATL 3H42L 2NY6B 1G0XA 4RMRA 4YX2H 2IPTH 1KYOJ 2APTA 1O7VA 3T3MF 5TF1L 4F7CA 4LLMA 4YPGA 5C08A 4R90L 5D7LD 4N1EA 3TBVA 1FV1B 4P2OC 1E4XH 1N3NA 2AS5M 4JN1L 2L4OA 5JIKA 1B4RA 5HYJB 5D1QC 5HI3C 5EIIA 3I3DA 5DC4B 1A4KB 2HVKA 3L3OA 4PD4J 1NMBL 3N50A 2H8PA 3WIHA 5CZVL 1EGJA 1NCAL 3ARRA 5KS9A 1MRCH 4OCXH 5CJOL 3MA9H 4Y2DD 4XI5C 3F7YA 4ALAL 1I7RA 5K9KA 3VXPA 3SGKC 1K2DA 4DFHA 3TESA 4HWEH 3FQRA 1RHFA 2O61B 4B0MM 2AJZA 3ESUF 2R29H 3TV3L 3ZT6A 1HHGA 4DGYL 5EORL 2FIKB 4OZFB 1TVHA 1F6AB 3MLRH 2Q86B 1L7TL 4JFOA 4PRPD 5JPMA 3DI3B 4ZS7L 5KVGL 1XCTB 1FC1A 4MD4A 3TN0A 2FBJL 5BVJA 1HNFA 2WBJB 2VLRE 1YEJL 2C3VB 4ZO8A 3TPKA 6FABL 5DUBB 5F9WC 1QFHA 4GBXC 4HK3N 5IMOA 2NYYC 5HYQA 1AFVL 1E4XI 2FGZA 2P5WA 4KH2A 2VOTA 1MVFA 2QQKL 4XP4H 4JRYA 3HLAA 1DZBA 3QUXB 5IVXA 2W0FA 1UB5A 3UTSE 1IAIM 3BT2L 2XWTB 2F74A 3VDAA 4NZRH 1TQCC 4GFTB 1KN4L 3KYOB 4PY7A 3NCJH 2R8SL 1A6TA 4F7PA 3FMGL 4K23L 3B9AA 2DQHH 1QA9A 4H1LA 4Y5XA 5KSAA 4J3XA 1BZ9A 3EFFB 1A0QL 3VH8A 2ATKA 2ADGB 3WLWD 4QF1B 3VGFA 5D2LE 4KK5D 4MNQE 2ZG2A 2HT3C 3PNWB 2R4SH 3OJDA 4Q0XH 3TJEL 3LKSB 2A74A 4LKCB 1JBJA 1S9WA 3D69A 3K80A 5J3HC 3WDHA 1GGCH 4R3SB 5I8OH 3PWJB 2D7PA 1E4WL 1HHJA 3P9LB 3I6KA 1RUML 1G6RB 25C8L 4CDGC 1CICA 1RZ7L 4M1DL 4ONGL 3QUYA 5J12C 3RZCC 1UGNA 4Z7WB 2YC1A 1ZA6A 4AG4L 4LLDB 2JELL 4UAOB 4OZ4A 3CC5A 2F54B 1DSFL 3HA0A 5HHMD 2F5BH 4G6MH 1EGJH 5FUOH 4U33A 5BXFA 5GJTL 3RGVA 4JHWH 1AY1L 2QKIB 2VDML 4BH7A 2XQYK 3EOAA 3IKKA 1SM3H 3DI2B 5DFVD 3C08L 1IQWL 3SDCD 4DVRL 5IWLC 2NY3C 5HBBA 3MRPA 2A0LD 3F6IA 1C5CH 3L3DA 4KMTH 3RTQA 4PJCE 5LKNA 3RDTB 1N5AB 1VGEL 2IPKB 4QRRB 4LGRB 1XF3B 2V2XB 2FECI 3MBED 5HHOA 3JUZA 5DA0B 3WFZA 1OT1A 2VMFA 2DJUA 4I48A 3R06A 1EEYB 3CFJA 2MWCA 3WIHL 2OQJA 3DTXB 5T3XL 2EKSB 4ODSL 5ESAB 4P9HC 1PKOA 3AROA 1M7IB 1NGPL 3IFOA 3LHPH 3D0LA 4PJBE 3ZDYE 3F8UB 4KWUA 3UAJD 4NNPH 4PJ7E 2GIYA 1UZ6E 2Z35B 1EAJA 3BMWA 2IADA 4HS8L 1J86A 3RI5K 3WFDL 2XPGB 2A83B 4FQIL 5JQ6H 2P24B 4IRJC 1XF4A 1AGBA 1KBGL 4U05A 1QEWB 4P4KB 3S37X 3H2WA 1T5WA 3O8XC 5DJAB 3PP4H 1IILE 4HJJH 4OF6A 2VZSA 4U2ZA 2Q6WB 1IEBA 1ORSB 4H1LH 3V0WL 2ZCLL 5T3ZE 2JCCF 3AMLA 4XPBL 3DIFB 4QTIH 3S3SA 2FNBA 3L7EA 1LE5B 2YD8A 4NQDE 1RZFH 5MEOB 3IYLW 4LASL 4MJ5A 4UTBH 3MRIB 1OD9A 1VFBB 2VE6A 1FNSL 4JAMB 5K9OA 1C12B 1MFAL 2IBGA 2YD1A 5IM7A 4UV7H 1HHKA 8CGTA 4GUPB 4IRZL 1LWRA 5F96H 5IIEB 3HE7B 3K7UA 5GGVH 4BZ2L 2UWEA 4ZFFA 3V6OA 2CD0A 2X1PA 4UQ2A 2IAMD 4XCFL 5BJTA 4OGYH 3NPSB 4DCQB 4AMKH 1BM3H 3FFCE 1DQML 4M7LL 3RU8L 2I9TB 1FIEA 2EC9T 1DBKL 3X3GH 4LSSH 1QD0A 3JUYA 2EH7L 1MRFH 1FVCB 1ORQB 3WD5H 5J13C 1ZT4B 1QR1B 4YJZL 3LN5B 4OM1H 1KJMB 5IESH 4PRAB 3GJFA 4MAYB 4X6CA 5EU6D 5E2WH 3DO3A 43C9A 1NGQH 1T0MA 5TE4L 4PJDB 4NQEE 4JZOB 3UYPA 5LJYH 2DOCA 5J06A 1NGZA 1CFVH 4GW1B 3X13B 2BSSB 4LLQA 5C0BA 3OXRB 2WQRA 3LIZL 4GKOA 1HSAB 1ZAGA 2VXQL 1S7RB 4R9HA 2NCMA 1N26A 3NN8B 2DN7A 3O3UN 4CMMA 1MHPH 4G9FB 4LFHD 4PJ5E 3VFVA 3ARFC 1WQVT 4R0LC 3EFDH 4ODUB 3SO3B 2F5AH 1CFQA 2IANB 4E41B 1JZ2A 3FB6A 4G8EB 3TBTB 1HHHB 1Y6NR 1MFCL 3ES6B 3O9WA 4F15B 4TTDD 1YEHH 5HHVL 4XXDA 3F62A 1W0VB 3PE9A 5KW9L 2R23A 4KGLA 4I0KA 4LLAA 1QQDB 3N1MC 4ZPVB 4QXUH 5KSUA 1I7TA 4RGNE 2I9LB 3ARUA 1MFDH 1T89C 2V7HA 1ZLVH 4MA1C 5GGSY 1PLGL 2JIXB 1ZS8B 3FO2A 5E9DA 4J2XA 1MUJA 4G7YL 3WL9A 3BH9A 3HR5A 1EK3A 4TULL 3RWFB 4PLKD 3T0EE 4XCNA 3MREA 3HAEA 3PGDB 3NGBB 4NHUB 5ISZB 4WW1B 3R0NA 1MELA 2XT1B 1C1EL 4H5SA 1BZQK 4WFGE 1OM3H 5E95B 3QDJD 4K3JH 4MD0A 1OL0A 1KULA 4NJ9L 2BHUA 1EIBA 4OAWA 3WJLA 2DWDB 4CMHC 3STZA 4KC3B 3MRLB 3F7VA 2M2DA 4LVOB 4NSKA 1MH5B 3GHBH 2Y4SA 3ARGA 1QYGH 4EQ2A 1FFNB 5DQJB 1IAOB 3C6LD 3OV6A 2Z31D 5LGHH 1LILA 1U93A 3O6KL 4OZHA 5IHBA 2HJFB 2YPLE 4XVSH 3P73A 3NABH 5EZOL 1ZANL 3GNMH 3DXAA 3VFUA 3KLHD 4CVXA 1VFMA 3MUGA 3N0PB 5JW5B 3Q5YA 2BJML 2Y5TB 3MGOA 1TXKA 3VGDA 4MLSA 1WBZB 4C56D 1U3HA 1NCDL 1FVDB 4G8GE 5EO9B 1NFIB 4NO0A 2E6JA 3VGGA 2ZSWA 5F9JB 4EUPB 1YQ2A 5EBLA 5C0CD 2O93L 5EUOB 3O45A 2D7QA 5FM5O 5DVKA 4BSWA 3KPOB 3BKMH 1X6NA 4XVJH 3VGEA 5JO5B 4UBDD 1GH7A 5DK0B 3CMOL 1AE6H 2A2QT 1KTRL 3DX8A 5CEYB 1KJ2A 5EOQL 2AI0L 3NZ8A 2HLAA 4ETQB 3O6FD 4X4YA 2PW1B 2A73B 5B4MC 1ZTXL 4JE4B 5FUCC 1G6RL 3OB0K 4WFGD 4LLWB 1A14H 5I1KL 4N9GA 2A9NL 4UMGA 2J4WL 3BISA 4UUJA 3HZYB 2HH0L 5IV2B 3FQUB 5T3XD 4S1RL 4HIIB 2VLKA 3LRSB 1H3TA 5FAAA 2AJSH 4PP2A 3NFSH 5FYJU 5FGBC 3RL2B 1N0LA 3ZHDA 1DBJL 3HAEH 4YAQB 5DJZB 1OVZA 1KIPA 2WW8A 4HUKB 3TFKC 2X4NB 3RP1A 2NY7L 2Q7YB 4PJIA 1YEGL 1PKQB 1P7KB 4MCZA 3HI5L 1PAMA 5HHPB 1XAUA 1T20B 2FZ3B 2YUWA 1N2RB 5DTFA 5C7XL 1EFQA 5IEKA 3CJJA 4APQA 1CE1L 5CKGA 4L8BA 1NBZA 2CLZA 2AEWA 3MLWL 4RX4A 3NCYP 1AD0A 2EEBA 4WI9A 5J8OA 5FB8A 1EERB 3BUTA 5I1HL 3MV9E 5E8OA 2ZUUA 3NAAL 3MV8B 4P2OA 1G7PA 3MLSL 4TNWK 1OSPH 1OF2B 2ENYA 5F97E 1SYVB 1Q38A 1OW0A 4Q9QH 1J5OH 5D1QA 3RIFF 2OL3A 4JPKL 5BS0E 1UWEL 2RB8A 1KB9J 1A7OH 1PEWA 2M8XA 5GGRY 3LEYH 4LCYB 3R1GL 3D3VB 2MFNA 4ZDHB 4MAUH 4UV4L 4N1HB 2UZIL 4HZAA 3P4LA 3QH3A 5ACZB 4Z78B 3D39B 4L4TB 3EJJX 3NMEA 3SGKA 1FNAA 4M9OA 2XKSA 3U2SB 1HK6A 3H7BB 4QY8B 1Z9SA 3VFTA 1FE8L 2NXZC 3A6BL 4Y19E 5HGAB 2VAAB 3VFSA 3EZ8A 4AEEA 4JKMA 4PG9B 2VDNH 5D7SL 1IZJA 1AD9A 1NUGA 1MCLA 3BGAA 3TO4C 4OFIA 5L2JB 3BH8B 2WIMA 2CLRB 5F1NA 4MNHB 3OJMB 3U6RA 5FGCB 4GBXA 2X4UA 3T1FB 3QI9B 4JLRA 1TQBC 4NWTL 3BJ91 1WEJL 4JFDB 4XWOD 4YEFA 3GBML 3TT3L 1MWAB 1FP5A 4CKVX 4MDJB 5DUPL 4P23D 3WE6A 1RUPH 5CHNB 1OCWL 4YIQA 1RZKH 4NP4L 5C07A 4U1IB 2ADIB 3SDAD 4XAWL 4MJ6A 1S7SB 1F4WL 3MRQA 2J6EA 3GMQB 2DYPA 5FA3B 5B39G 1KJ2L 3VFOB 1DBAL 3EJZC 1YDPA 4X6FB 5FHAL 3OF6A 1J0KA 2QSQA 4JRXD 5JW3L 3DVGB 3BW9B 3L3KB 2NZIA 2GSGA 1OOAA 3HS0B 4OCNC 5C0FA 1WFUA 3UXFA 3I75A 1BAFL 3GMNB 2AK1L 4RGMB 2HA1A 1A2YA 2LFGA 4HH9A 5DJCB 2APBA 1AR2A 3VE0B 5T33L 4MA7L 4J6RH 3JSSA 4M4RA 5HYJD 4ODTH 5C0IB 4LVHB 2UYLA 1J0IA 1Q0YH 3OR7B 4KJQD 4OTXH 5ID0B 1R24A 1J87A 4XMKH 5GS3A 4Z5RB 3RZCA 5FA4A 5GHWL 4ETYA 2OL3H 2OZ4H 1HWGB 3GRWH 5HY9B 3GKZA 1RVFH 1FFRA 3B83A 2B4CC 1ZHKB 4XCYA 1EJ6A 3S4SG 1DANU 2FJHA 4Z7WE 3MV11 5H94B 1A6WL 2IH1B 1EHNA 1NMCB 2J8OA 5IWLA 4YO0A 1KJ3H 1UEYA 5I76A 2F54E 3GSXA 2Q76A 2DIJA 4ZUTA 3LN4A 3QDGB 4PP1C 4UIMA 3BSZH 4NUGH 3IDYB 1F6FB 4GH7B 3SPVA 3G5YA 2JLLA 3WLBA 1G7LA 1Q0XH 4S0TD 3O4LB 2AJYH 3V7AE 5JW4R 4EJ1C 1GGYA 4ODVH 4ONFH 3DMMC 1A47A 2LU4A 1T22B 4HHAB 1MCHA 3B2UD 1FL5B 5J9PA 1OPGL 1TIUA 4FQXB 5GRVK 1HH9B 4GRWF 1FGNL 3EDFA 1M4KA 4U4BA 5KSBF 1JHTA 3QFJA 3T08A 4ZQKA 1N7MH 1MJJB 4GRLB 1GJIA 4IRJA 4AH2B 1B4JH 5HHXL 4X4XA 4ZAKB 2X42A 1MAKA 1IEAA 1KCRH 4JZNA 3DLQR 4DEPC 4Z7OF 1MOEA 3EDDA 2ZJSL 3O8XA 4UINH 4OLXH 1HE7A 1XGTA 2J6EH 2EH8H 4QXGH 4Q58C 2CO7B 3C5ZB 5DMKA 5E00A 4RAHA 5EA0L 5C0BD 3EDKA 4X98B 4PB0H 5DRXB 2R0LL 5I1IH 2G2RB 1OAZH 3MV7A 3N1FC 4CW1B 3U4EB 2VDRL 4X5WB 4N8VB 1VACB 4EDXB 3MOQA 5IVZA 1UYWH 3QUZD 1NGYA 3HB3C 5CZXC 3QSKB 1PQZA 1HXMB 2CKBA 1I9IH 2A6IA 4GXVL 1Z6JT 5JOEA 2WMPA 4NFDA 3GM0A 5E8PA 4WWID 5GSRA 2CLVA 3BEWB 1CFNA 1RFDH 4QOKB 3ZSTA 4PGCB 4MNGB 1AJ7H 5T1DL 3DRTB 3QG7H 1IGML 1QNZH 2BC4B 4O51A 2B5IC 2JB5H 4QRRD 4JPIB 1CE6B 1SYSB 4P99A 4HPYL 4Z7QE 3KJ4C 1UADC 5I1EL 1N8ZB 2A6DA 4OZHF 2XI9A 5GS2D 5AWNH 3MRFA 4B7IA 5E6ZA 1A02N 4NKIH 3NIGE 4P3DB 3JWOH 3WSQL 3VMPA 1PSKL 4QXTB 2WAHA 2GSIA 5B3JE 1KJVB 5JXAL 4ONOA 5DHYA 4HKBA 4K7FA 5GS0L 5IGXH 4GKZA 1W0YT 3C09B 3F12A 5MENE 5EU3A 2O5YL 3MBXL 4I3RL 1T5XB 3OZ9L 1PZUB 3HRPA 4PJDE 1F3DJ 1ZT1B 3W9DA 1AGDA 4J8RB 5E2UH 4QRQB 2HFEA 1CQKA 3G6JE 3QFDB 5CAYB 3ARFA 4P4KD 5I8EA 1C8PA 3ULVL 4S1SH 4DN4H 4R0LA 2IJ0C 4NO5A 1DDHA 3P30L 1CDHA 3PGFL 2GEEA 3OJVC 3NFNA 1D5IL 3B9KC 5IR1A 1FAIL 3S5LA 5C9JB 3M8OH 4PJXB 4FZ8H 3QHFL 4L9LB 2NY0B 4JKPL 1KELL 4AL8H 4PRDB 3QG6B 3TC9A 4E41E 1YEDA 3S36H 2AJUL 2DMKA 2CO6B 2OMNA 4P9HL 3I3EA 1T89A 1N64H 4OIIH 3ARPA 4X9BA 5L6YH 3KYMA 4YHYC 1G7MA 2XZQL 1ZHBB 2AKRA 3O4OC 1U8PB 1BZ7B 1FZJB 2KZWA 4WUUA 2VLJD 3PDOB 4RFOL 4OCRL 4V2CB 3OAZH 2NY5L 3TA3B 4P9MH 1S7QB 1ZGLM 3OKLA 4KTEL 3U9UA 1R5WB 3WNMA 4BQ8A 4FQ1L 1Z3GH 2CKBH 4YDKL 2XY2A 1OARH 3TZVD 5ESVA 3GSVB 4PPTA 4Y4KA 1X4XA 2PR4H 4ZUWA 3FO9B 2B2XH 3UTOA 4LMQI 8FABB 4O2EB 4D0BA 4HIEB 2RBLA 5E6YA 1IBGL 4HKJA 4XC3L 3FB8B 1BLNA 2M26A 3DHJA 2IBBA 4YHZL 1HIMH 1PYWA 4MAYD 2R1XA 2YN3A 2ZPKH 4X9IA 2AK4B 4XVUD 3KPSB 3LKPA 4LP4A 4FTVA 3WIIH 1RK1B 3D18B 5LXGH 1G7JA 1GSMA 4L4VB 5DXWA 1CTNA 3KPMB 2BSRA 2VLKD 1KIQB 5JUEH 3O81A 3V52H 4LIQE 3BN9C 5F6HI 1OAKH 1OLLA 4G9FD 2AEPL 4PBWD 1PW3A 4UOW0 4U3XA 1ZT7A 4L3EA 3GMMA 3QEGH 1EUTA 4IRSB 1IMHC 2IAND 1T4KA 1HZHL 1N0XH 3PHSA 4N0FB 3LY6A 3NCFB 3WHE1 4NWUL 1DLFH 3SO5A 3OAYK 2ZUQC 4LQFL 1GVIA 3SCMB 2R69L 5D4QA 3I02A 1YC7A 1GAFH 3K3QA 1VSCA 3EOBA 2DQCH 1KFAH 2E5EA 2HG5A 2CK2A 4L8CA 1EEUA 4NPYB 5FUZH 1H8NA 5TDNA 5ALBL 5EBWB 3M1BA 4KUCF 5EUOE 5IB4B 2ZKHL 5GRJH 3U9PH 4NN7B 3SQBA 3IRZA 4IS6A 3KDMB 3VG0H 4QRTB 4PJ8B 5I18L 4F7TA 5HI3D 5CKAA 1HQ4B 1EX0A 5EULV 5IW3A 4YC2B 1CL7L 4PJ9D 1YY9C 3SDDC 2Y06H 4HEPG 3QUKA 5FHBL 5ISZD 4F7CB 2DL2A 5D93C 5BZWA 4LLMB 5C08B 1XGYH 1S5IH 3X11B 1R3LA 1UZ8A 2HTLC 2A1WH 1N3NB 5FGBA 3VDBA 2EDRA 5IB1B 2C3GA 5EIIB 2E9JA 1GC1H 3L3OB 5GGQL 1MCWW 5JORA 4N8CH 2H8PB 1H3GA 3B6SA 2ZUWA 4U6TA 5KS9B 1ZE3C 3FOLA 5HDQL 4ERSL 4WVRA 3LKNA 4NQXB 2D7NA 2VR9A 4PRHD 3F7YB 1NL0H 3TWCL 5GGVY 5K9KB 3VXPB 3F7RA 2VQTA 1RUQH 3Q6GH 4KUCD 5EO1A 1Q9LA 2AJZB 3VWKC 1ZLSL 1BJ8A 2HVJB 3EDJA 3CVIH 4JM2C 3BD4A 3UTZB 3ZKXB 3B9VA 1HHGB 5F7MC 3TBYA 1G7IA 4A6YA 5IMMB 1TVHB 4Z0BL 3QCUL 4JFOB 5JPMB 1W2KT 2RCSH 5I71B 3W5NA 4K8RH 4TPRL 4OQTL 3AXLA 3L3IA 5CINH 1TZIA 3ZYZA 3SJVA 3KNBA 5BVJB 4I3SH 5ITFA 3IFLL 2DLFL 3UJTH 3GIVB 3LPWA 4PD4K 2IQAA 3SKOA 1UA6H 3P0YL 3DYMA 2EDKA 2UV3A 4XNYL 4JFZH 4JRYB 3HLAB 5DMIL 5GIRB 5C0AB 5E5MA 3ULVF 3F58L 2ILLA 5IVXB 2GQHA 4P57A 2UUDK 1X6LA 2GTZA 4J1UA 3HNVL 1GGIH 2IFFH 1H15B 1KACB 2HKFL 1YNTA 3UTPE 2HJKB 4Z0XB 3D3VE 4ZG1A 4G80A 4F7PB 1RZGB 5TDOA 1G6VK 3ISWA 4HDIA 4JO2H 3T0AA 3V6FB 1QA9B 3LD8C 4H1LB 3BIAX 3D39E 4L4TE 3FZUC 1QSVA 4KI5C 2APXA 3BPOC 1YJDC 3VH8B 1CGXA 3BGMA 2ATKB 3VXRB 3MLXH 3SDXA 1AI1L 3HRZA 5D7KD 2CDGA 1PBYA 2NY4C 2Q20A 3MNWA 4NNXA 5SWZA 1T6WA 5IFJA 4M7LT 3QZWG 5E8EA 5GS0D 2A74B 1YN7A 1S9WB 4F2MA 3D69B 2YN5A 2P46B 1W72A 1KENH 3FQTA 5FGCE 2BSTB 4IDJL 2OLDA 1YMMB 1CICB 3LH2H 3QUYB 3ULVD 3KXFB 4FXLA 3P0VL 4U6XA 2YC1B 5E99L 1LNUA 3Q6FA 4JFDE 5FYJH 4OZ4B 3CC5B 3MRRB 3N1PC 3OMZA 2LVCA 2FYYA 2D4DA 5IHUH 3RHWK 2CR3A 1FVEA 4OFVA 3V6ZA 4MMXC 3BWAA 3RGVB 5BXFB 5IJKC 3HI6H 5IW1A 1P7QA 1NLBH 2DTML 3DV6B 3WFHA 3V2AR 1EVUA 1OGTA 4XPGH 1U8NB 3MRPB 5JR1H 3MV8D 2VH5L 3RTQB 3WNOA 5T1LB 3C60C 1SY6A 3QNXA 4M7JL 4X80L 5DWUH 1K5NB 5ICXB 1QRNA 3J7HA 1KCUL 2OTUA 2F58H 4R2GC 3QFJD 4YHPA 5KVFL 2F15A 4I48B 2EDTA 3VGHA 4QTHB 3CFJB 4WHCA 1AIFB 2OQJB 2D03L 2OS7A 3RKPA 5B39A 5GQBA 3ROOA 2DM3A 1VPOL 4X8JA 3O3DA 1WCBB 4KRLB 1MCBA 4HWUA 1B88A 5EBMA 3D0LB 3UZVB 5I1CH 1AGCA 4XVTH 2E7LC 4P0DA 4YDLC 2IADB 1OAXL 2P43B 5HVHC 3G5ZA 2ZCKL 4QRPD 4M5YL 5IBLD 5I1DA 1UACL 1AGBB 2DM7A 2YSSB 3LS4L 1YPZB 2VZTA 2XZAH 2DQFA 1OWRM 5TQ0H 1T5WB 3MV7D 5AZ2L 4BZ1H 1QFPA 2GJ6A 5ADPL 3DPBA 1IEBB 1E4XL 4HEME 2N7BA 4TOYL 4DZ8B 5L88H 3DMMA 1FHGA 1NAKH 4POYA 3AAZA 4NHCH 3MNVB 3L7EB 1ZVYA 3O2VL 2EDDA 3RWDA 4FFYH 4RA0C 2X4OB 5BZDA 4M93C 1IGYB 1R3JA 3O4LE 2VE6B 4MXQC 4OF7A 1TJIL 3QEUB 3S4SA 3U0TA 5IM7B 1ZA3A 2FSEA 1BWWA 3MFGB 1HHKB 5FDWA 4K3GA 4HWEL 4J3TA 1BOYA 4OIBA 3ARBC 1URLA 3FRPG 2H41A 2UWEB 5BJTB 4UQ2B 4NM4H 1INQB 2EYSB 1S9VA 4MLIA 2X6MA 1F02I 4TSBH 5J57B 3DVFA 1MREL 2FCBA 5CP3A 5DHVA 2RIKA 4MDIA 3LQZA 1FZMB 4PG2C 5T1MB 1NBVH 1YNLH 1I8MB 2WINA 4X6CB 4XP4L 4RMTA 2NX5A 4I0PC 3T0WA 4EBQH 43C9B 3DUSA 1VGKA 2EXWC 4OJFL 4AENA 5H2BA 3QIBB 3ARFD 3M07A 5IJVA 1JF6A 4XGZA 2NY2B 1MQKL 3ECBA 1YC8A 3NCJL 4OFYD 1WZ1L 3NFPB 1D5MA 2IQ9H 4JKWA 3V5DB 4PYGA 5HI4D 3OG6B 2BFVL 2YUZA 5TPWH 2HMIC 4R4NC 1IARB 3EGSB 3VFVB 3HMXA 5A2FA 4KKBC 1UEMA 2XN9A 2R2EA 3EYQC 3GDBA 1B2WH 3WIFA 3QDGD 5MI0C 1JYVA 5DD6B 5EFIA 3UX9B 3D2UA 3FB6B 2Y07H 4MNGE 2DQDL 4GAJH 2FX7L 4P46C 5IQ9A 4DUWA 5FECA 2EKJA 4UTAL 5I66A 3O9WB 1FO0H 4KZEL 5DFWH 4N0UE 1B0RA 1MY5A 5KVDH 3QQ4A 4UQ3A 4FQXD 3UPRB 5BO1H 3WJJC 2OI9B 4LARL 3S8WA 1RZIB 4J23A 2FJFA 5CLWA 2HN7A 2F19H 3FO2B 3HHRB 3AREC 1MAJA 1MUJB 3BH9B 1A7NH 3C8KB 3VJ6A 1RU9L 3QIWC 4XCNB 3MLUH 2JCCE 3HAEB 4X7EC 4NJAH 1C5CL 3TGXA 4U1GB 3C5ZD 4XBEH 1UCTA 1YNKL 2R4RH 6CGTA 4RWHA 4K71C 3X3FH 3GMRA 4L8DB 1N4XL 4OAWB 3U7YL 3UMTA 2QHRH 1H3WM 4LCWA 1G9NC 3STZB 3F7VB 2HWZL 4PB9H 1MVUA 3PQYD 1YEFH 4PJXE 4NSKB 4HH8A 7CGTA 3ARGB 4M48L 1UVQA 2XTJC 3QDHA 4Y0GA 2Z8WC 1R3KA 4HBCH 1CR9H 3BP5A 4FQLH 1JF5A 1UENA 4Z7UA 1PX3A 1NFDB 2HT4D 5I1JH 5JIHA 2R2CA 2WWKO 4Z8FH 3DXAB 4JFYA 4QOKD 1ZHLA 1PZ5A 5E6IC 3MUGB 1KPUA 3E6HB 2ATPA 1FORH 1TENA 4HJJL 4U1NA 4J3VA 1IGFH 4RWYH 1PD6A 3QO1A 4NO0B 3DWTA 5ICZA 2IH3B 3ZMRA 1FFPA 3O45B 4LPUA 4RMWA 5TH2A 2EDHA 3KWWA 3MODL 4JB9L 4Z6AT 4J3UA 1SJHB 1LDSA 1KPRA 3ULUC 4PRID 4Y4FC 5F7EH 3DX8B 3VRLF 1EHXA 3NZ8B 2HLAB 1H3XA 4D0CB 4JY4A 1VKXB 1JPSL 2AK4E 3CLEH 3KPSE 1NUFA 3BDYH 1QR4A 3QEQA 3CCHA 4N9GB 5IG7A 4UT9L 2R2BB 4UUJB 4L4VE 2DF3A 4XB8A 2P49B 3MXWH 3TFKD 3HMXL 1AR1D 1CVRA 3PWPB 3STLB 4AMKL 3X3GL 3CFKA 4LSSL 1F58H 5ENWA 1CGSL 3MLTA 5B38G 4PP2B 2X9XA 1F5WA 1LO5A 4MA3A 1II4E 3WKNA 1YYML 5BMFH 2C5DC 2G60L 2DJSA 1F90L 2H2PD 4PJIB 4FQJH 3VD4A 3SDXF 4QRSB 4ONHA 2FEDD 3BHBB 5DTFB 1OLZA 1BIHA 1RJZA 1NBZB 2CLZB 5F6IB 1SMAA 3RWEA 2VZ1A 4LLVB 3SDDA 3TA3D 5FB8B 1MF2H 4POZC 4NZTL 3EO1A 4Q97A 5IT2H 5E8OB 2G9HA 4XTRD 1T1XB 4TVPH 1K8DA 4ZTOH 4OI9A 4XPTH 2JK5A 4UNVA 3E6FB 3JV0A 2OL3B 2I5YL 2ED9A 1UFUA 4PRBB 2DQIH 3KYKL 4TQEL 1QFWL 5D8JH 4ZXBD 5C08E 5KTEH 4RMQA 4HD9A 1YEHL 3K81A 1FZOA 1U8IB 2EXYC 4HKXB 5HGBB 4OKDA 3FONA 3QH3B 3TO4D 1BF8A 5DVNA 4RAVA 1IVLA 3BI9X 4WTXA 4UT6L 1SBSH 3VWKA 4JM2A 3C5JB 5KS9E 5E24E 1I1CA 5SWZD 4BK5A 2X2YA 5IFHL 4DUVA 4YUEH 1B0GB 3T4YA 1AD9B 2KL6A 4JR9H 2Q3AA 5F1NB 1XMWA 5F7LB 4X8XA 4NKQB 3OR6A 3TH4T 3U6RB 4PTUA 4GBXB 1OM3L 4JLRB 4PJAF 2CUHA 3O2WH 4HUVA 3OXSB 4NRZA 1OAYL 2AXGA 3GHEH 4JQVC 1MEXL 1CXHA 3FRUB 3T1WA 3U7AA 3BESR 1S3KH 4XAKE 5C07B 3GHBL 2FR4A 1L7IH 3CAFA 2P5WE 2O5ZH 4BSVA 1NCUA 4JDVA 4MJ6B 2R39A 2VJXA 1MIEH 4JRYE 2EEAA 5BOPA 1JPTH 2DYPB 4X0KA 1L9MA 4K94C 3HG1A 3BN3B 1YDPB 5IVXE 4YWGL 1SVCP 2GSGB 2YD5A 4Z95L 1PGRB 1NFKA 2D7TH 4QHNA 3UPAA 4EZMA 3DNKA 1HNGA 5C0FB 3MX0A 3I75B 1S9KC 4HH9B 1NDMA 5D70H 4OCLC 4CVZA 1PFCA 3PL6B 4Y16D 1KEGH 5MEPA 3LS5L 1HYSC 5TDPA 4POUB 4MVBC 4X4ZA 3CZJA 4OF3A 3DGGA 3LKOA 5J12B 1U3YA 2VL5B 3I84A 1D5ZA 1FNFA 3BKML 4XVJL 3GSOA 4B5EA 5CD3A 5JW4M 4JFHD 5IOPA 4OLWH 5DMGC 2W0LA 5JQHC 4U1SA 2QBWA 1FFOB 3BKYL 4Y5YB 5IJKA 5CP7A 2BNRD 2FJHB 4OD2A 3KXFE 1KUMA 1OTSC 4JG0L 2NY3B 1JNNL 2BMKA 4S1DD 3QZWA 4LBEA 3NA9L 3GSXB 2Q76B 1BVLA 4YLQT 4KGJA 3D9AL 4ZUTB 1NKOA 3LN4B 4ZFOL 3FJTA 1A1NA 4UIMB 4PLNC 4H8WH 4MWFB 1XGQB 2P42B 4R6UA 4X6BA 1GGBL 2AJSL 1JJUA 1N59B 3NFSL 1CIUA 3LDBC 2XA8H 1JHLH 3V4VL 5C0AD 3GSUA 5J9PB 2VERN 5HHOE 3VXUA 5A16A 3IB4A 2IWGA 2D0FA 1G9MC 2J7LA 1I1FB 3HI1A 4HG4J 4WWKD 2E7LA 4OCYL 1I3UA 3LQAC 1CG9A 1OP5K 3E8UH 3GO1L 3CDYA 3QPQC 2EC9U 1TFHA 3DURA 5I30H 4OIAA 1DUYA 4IRJB 3TO2B 5ERWA 5EC1B 4KY1L 2C1PB 1JPFA 1IEAB 4ZNCD 3K4DA 3SE3A 4ZUSB 4XNMB 2Z92B 2FWOA 4P3CH 3O8XB 3VXRD 3NTCH 4ZNEA 1WAAF 4P4RA 1KLFA 3SKMB 1CGUA 4IM8A 5SV4A 3WHXB 4KKCC 5JXEC 4M8QB 1K4DA 2YPVH 4Z7NF 3GUTB 1HHIB 2VWEE 3FN0H 1RUKH 5DMKB 4JFFA 3RX7A 1J5OL 4LRNH 1XR9A 1QSEB 3SOBL 3PDGA 2FO1A 3EO9L 4XP9H 3P40A 1YMMD 3CVHA 1EMTH 5EU4B 4U7SA 1QUNA 5CJ8A 5EG6C 2E27H 3IXTB 3BQUD 5IVZB 3GJEB 5L9DH 1JZ4A 4MA8L 1NGYB 2FH8A 3INUL 4KROC 4AEFA 5EC2B 2YD7A 5J6HA 2CKBB 4CBPA 2A6IB 5C86A 3ARBA 1JHKH 4NT6B 1X5AA 3PJSA 4RQQA 4S1QL 1JWSA 5GSRB 1CFNB 2VDNL 1YJDL 5D1XC 1T1YA 1KC5L 3ILQC 4HGMA 1Y6MR 4BQ6A 3NPZB 3A67L 3VRIB 5T3ZH 4P2RB 4PG2A 1PJ9A 2UWEE 3BD3A 4XB7A 5F44A 3V6OE 5C09A 3FT2A 4Z7UF 2IPUK 4KFZC 2P5EA 2ESVA 3RUGB 1A3RH 1INEL 5KOMC 1H8SA 4F33A 1GIGL 4I0PA 4PTTB 1KSRA 3MRFB 1BOGA 2CR6A 1RUPL 2BNQD 4HQQL 1TETH 5HDBF 1M71A 4D0DA 4F57H 2GSIB 1XGUA 32C2A 5DHYB 5IBTH 1EEZA 5I15L 4K7FB 5FKPA 4NM8H 4GKZB 1ODAA 2KQMA 5JHDA 3AGVA 3SE9L 3B9KD 1AXIB 3BP6B 4X6CE 4G8FB 4NUJA 5SV3A 1DLHA 1V7ML 3IFPA 4HS6A 1JWUB 5IBUG 1CLOL 1QHPA 2DMBA 4NO5B 3I9GH 1DDHB 4WY7L 3U48A 1WC7B 1I1YA 1RZ8A 3NFNB 5IR1B 1OB1A 2R2HA 4P46A 1T6VN 1J0JA 1D9KD 1T7YA 4I9WE 3O0RL 1ND0B 4I0CC 3VI3F 3GI9L 2A77L 4WEMB 2EDBA 2CK0H 1LO0H 1KLUA 3I50H 1YEDB 2D31A 5DQ9B 4WGWB 2CGRH 3WJJA 4MA1B 1Q9OA 4TUKH 3GRWL 4F9PA 3BKJL 4Z7OE 1WF5A 2PXYC 2AKRB 1XGRB 3UYRH 1JZ6A 1J9CT 3AREA 4WUUB 2HFFB 2FD6H 2K1MA 3CVHH 4DTGH 4TUOA 3OSKA 4HIHA 4JY5H 2E8YA 2B1AL 3GSRA 1Z9LA 1KJ3L 2X89D 3WXVL 2Z8RA 1Y18A 1NC2D 4OBRA 4ZS6D 3SN6N 5ESVB 3I6GA 3H9SA 5E9DE 2P8LA 4NC1C 4Y4KB 4ZUWB 4ZO6A 2Y7QA 4D0BB 3BZEA 2NR6C 1BJ1H 2RQ8A 4N0RA 4LCIH 1F8TL 4ODVL 1BIIB 1IC5H 4CMHB 3Q48A 5A2LH 2XRAH 3CK0H 4U1JA 1Z2KA 1T03H 3FB5A 5DJXA 4I8DA 1UM5L 4KZDH 1X5FA 4PJHA 4FTVB 2YUVA 3QDAA 4KHTH 5DMJB 3KPPA 4WHYH 3RNQA 4ELKA 3K46A 4KK9D 3V0VB 3P2TA 3JWDH 5CILL 4GAGH 4JHBA 2VYRE 3ZT7A 4MS8D 5E6IA 1R3IL 1QLEL 1KCRL 1RQ5A 3HNSL 5I1AA 1NFDE 4L3EB 3GMMB 1JGVH 2HRPH 4OZHE 4X6EA 2VABA 1RD6A 2VUOA 4LSRH 3DXAE 4CADA 3MR9B 1GOFA 2CUIA 1AGEB 1BQHG 3ABZA 3VXMD 1BEYH 3I02B 5F7NC 5F3BB 5I1IL 5DURD 3BPNC 1OAZL 4X7FC 3DUUA 4Z18A 5C0JB 4L8CB 1M7DB 3NCYS 4YDIH 4XP5H 5E70A 1IGTB 2ITDB 3OBAA 4HW6A 1FNGB 1YY9D 1C16A 1UKSA 1OD7A 5TDNB 4ZFZA 1TTGA 4Y4FA 5DD3H 5DJDA 1UYWL 4X99A 2YA0A 1A6UL 3DBXB 5HTSA 4KAQH 5GISH 3RVVD 4IS6B 4WU5B 5HGHA 3A6OA 2AXFA 5E08H 1CDYA 2X4TA 1PDKA 3UJJL 4K7PY 4F7TB 4KJYA 2ICWA 5IQ7H 5KVEH 3QUKB 1AJ7L 1BMGA 1VFOA 3REVB 3GMPB 4OGAD 2LABA 1S7UB 1UZ8B 2JB5L 5GGTL 4JVWA 4BKLA 1LE9A 1ZLWK 5M95B 1QSFD 3O11A 3PWPE 1EZVY 3H7LA 4C83A 5FF6A 1E6JH 4KI5F 5FK9A 1UWGH 3FAWA 3B6SB 1DQDH 5IB5A 3O3BB 4OGXL 2YA2A 4P3WA 3JWOL 4XNQB 1KTLB 2V5TA 2NTFB 4HIXH 3CXHJ 2AJ3A 3LKQA 4OD3L 4LDOB 4LKXA 4LLYA 1Q9LB 4Y2DC 2YRZA 4M1GH 4PJIE 1NMAH 4X6DB 4JO4H 1ES0B 5GGUA 4LSUL 1G7IB 4S11A 2PYFA 3BPCA 1FBIL 2Q8BL 2WUBL 5IROC 3UTQA 1IAIH 5FYKE 1G1CA 1XCQA 2PYEB 4PJEA 1F4YH 4GG8B 1CU4L 4WFHD 3AXLB 3GB7A 4TTGA 1TZIB 5C70A 5HGGS 1FLRL 4JO3H 3SJVB 15C8H 1SBBA 5F7DA 2OMBA 5CMAB 1XF2A 3ULSB 1FH5H 1T1WA 4FA8A 4JHAH 4IBLT 3K0WA 4ORZC 2I24N 3KPRB 1G9NL 1UJ3C 1EJOL 4AL8L 2XKUA 3I3BA 3S36L 3ZTNH 1RULH 1AQKL 1IGIH 3FO0H 1WCQA 1MI5A 4FP8H 4J1UB 2H32H 1WFTA 5B8CB 4XP6H 2DLIA 4BM7A 2FX9H 5L6YL 1LD9A 2BOCA 2NY4D 3HE6C 4TRPH 2AABH 4HDIB 3AS0A 3DX9A 3E0GA 2MSPA 3IKCB 4KV5F 1P4IL 3S7GA 4G5ZH 4Y1AB 2RGSA 1QVOB 3PG2A 3MRJB 4EQ3A 4P9ML 5JOFB 1KG0A 3SDXB 1HDMA 5A40E 1IAII 3HRZB 1Z3GL 1XIWC 3DO7A 4NNXB 3MNWB 5IFJB 1AGFA 2BDNH 4TUJA 3NZHL 4X7SL 1V05A 1YN7B 4KK5C 1FLTX 4JQVA 1NQBA 2VXVH 1HIML 2W60B 1KT2B 3GSNA 5JDJA 2ZSVA 2H45A 4K9EC 5SWSA 2Q7NA 4N8PA 1CDJA 1W8OA 1LNUB 3QAZC 3Q6FB 4O9HL 1NC4B 1DEEA 3C60D 3W0WA 43CAA 3P0GB 1MCEA 2OTWA 4U3HA 3C87A 5C07E 3TYFB 3V6ZB 1U95A 4YDVA 4R2GD 3V52L 2P1YA 4WHTA 5C2BL 1T7VA 3WN5B 1OAKL 1RJYA 1OGTB 4QNPF 3OAUH 5JOPE 1QO3A 4OZGA 4RNRA 4LHUD 3QNXB 3SDCC 5DFVC 4P5MA 1RIUH 3CPLA 1LK3H 2A0LC 4BQ9A 1QRNB 1DLFL 2OJZH 1XT5A 2DWEB 3V8CA 1AKJA 1IFHH 3MBEC 1SEQH 3UDWA 4I13B 2DQCL 1FYTD 1D6EB 5I1LA 2CIKA 5B39B 2FGWH 3ROOB 3EOYG 5B21A 3P4NB 4PBVC 5FUZL 2X4SB 4RIRA 4HUUB 4X8JB 3O3DB 3RI5F 3U7WL 1TNMA 1EA9C 4HUXB 5EBMB 4AIOA 5I2IB 1FSKB 3U9PL 5F72S 3G5ZB 5HD8D 3BPLC 1AH1A 2VUYA 2X4RB 3MLZL 3UAJC 1DN0A 1FO0B 1TPXB 2DQFB 4F80A 4JFEA 4GXUM 4HWNA 5HHQA 4A2LA 4YHIB 2X44D 2GJ6B 1S7WB 5DSCA 1V3KA 4M61B 1MCIA 1TVBB 1EV2E 3DMMB 4OM0H 1QLRA 3AAZB 1U92A 3QHZL 3RWDB 3DGCR 4ELMB 4EI6A 1B6DA 4N8CL 2F53A 4NOBA 1R3JB 4LPVA 4M43L 2PTTA 1WBYA 2VDKH 4AJ0A 2NY1D 3S4SB 3AM8C 3U0TB 3KHQA 3BVNB 1G1YA 4BELD 1S7TB 4UDUB 5FDWB 3L5WB 1CT8B 3Q6GL 2QADC 1NCNA 1BD2A 4DEPB 2ESVD 2E9IA 1H0DA 2FX8L 3BXNA 4LMQE 1S9VB 5D6DC 5HJ3A 4MCYB 3MRMB 4FQHB 5JXEA 1BBDH 3E3QC 1P4LA 2CRIA 4K8RL 1KB5H 5DC9B 2HTKC 2IAMC 2YEZB 4NYLB 5GRUL 4ZOCA 4LCUA 2BRRL 2FL5B 3PL6D 4F3FA 4FFZL 4NN6B 2CRMA 5EOCL 3V4UL 1U8OA 4PGDA 1DBBH 4ZUVA 2WINB 2JJTC 1TCMA 2NX5B 3BIKB 4YBLC 5D71H 5F6HJ 4KKAC 3DROA 3GSNL 2HMID 1VGKB 4YXLL 4R4ND 3NIDF 3LEVL 4AENB 1LO4H 3FN3A 3V8OA 3RZWA 1CWVA 1GGIL 2IFFL 2Q3ZA 2YD6A 1MCJA 2GI7A 3ECBB 3SKJL 4K94L 3T2PA 1T0NA 2MCPL 4FXKA 4CVWA 2H1PH 1D5MB 3MUJA 4JO2L 3FT4A 5D1XA 1NDGB 4CU6A 1JPST 4NC0B 5C0DB 3MYZA 4U1KA 3MOAL 1TTUA 5T1KA 3MLXL 4N90E 2DI9A 2R2EB 3WIFB 3FO1A 1KCKA 4OCWH 4U0RB 4PJHF 3H8NA 3KR3H 4XP1H 3KJ4B 3DX7A 5F1IB 3RA7H 1W0WB 5EFIB 3D2UB 4L3AA 4O58L 4C58B 1IQDA 5IQ9B 4PJGA 2YPKB 3IDUA 3VD9A 1S78C 1B0RB 4P2RE 4U3CA 1KIRB 5ITBL 1UQSB 5DEGA 3RUGE 3QIWD 3BGFB 3DSFH 4TTDC 3T2NL 1I9RH 4JZJC 1JGUL 5I16A 3L9RA 5JDSA 1XF5B 2X05A 4NKDA 5HGDA 5H35A 3NCMA 4HAFA 3IFNH 4DW2L 5IHUL 5AZEH 1JZ5A 1NBQA 3K8LA 1NJ9A 1D6VH 1M7XA 4YNYA 3CSBA 4XPGL 5JR1L 1AO7D 4YE4H 3ULUF 3MSPA 2V2WA 1J8HA 3PWNA 3MJ9H 3S96A 2D4FA 3IU4L 5DWUL 4YGAB 1AHWC 1NCBH 3X14B 3GMRB 3HR6A 1QSED 3GBNH 2GY5A 2I60L 3ROLA 5HVFB 1J1XL 1RJLB 5C3LD 2W65A 5E56A 1MVUB 5E6ID 4RFEB 2VO5A 1G9ML 1F00I 4MB4A 5BQ7A 3T2OA 3M45A 3LQAL 2PXYA 3BP5B 3MXVL 4JGMA 3B3IA 3VXQA 3QDMA 5I1CL 2NNAA 1WUNT 2ARJA 5C0ND 3SBWA 1KNOA 2LAGB 4P2QD 1CGWA 3G08A 5AYUH 1I3GH 4U49A 3VRJB 5E8NA 4JFYB 3C6LC 1A6AB 1PZ5B 3I6LE 4M1CD 4LOUD 1QKZH 2Z31C 1CXLA 4WUUE 1G0DA 1JYWA 1JZ3A 4C55A 2VISA 2GTWA 5CWSA 5F1SA 1XFPA 4Y4FD 2AW2A 3MRKA 1JWMA 1IM9B 4LSQH 3NACL 2ICEA 3WBDA 5L88L 5ICZB 1FFPB 1LEKA 4WV1C 2HRLA 3HCVA 5F71A 2FLRT 3VXSA 3KS0H 5EZIL 1UKTA 3BMVA 3TVMD 3MCKB 1NAMH 2H9GA 4RGNC 2AERT 4X7TA 4ZPTB 4PJEF 1ROWA 4M6ML 5DZOA 2ICES 1MNUH 1M6OB 5L7XH 2DL9A 3T8XB 4WJ5A 5GRVL 4UBDC 4JY4B 4LU5H 3WFCH 2JF1A 5L0QC 1MCRA 4FTVE 1N6QL 3QEQB 2VN7A 5IG7B 5C0EA 2FEEI 5EOCJ 3JV5A 3R0MA 5D1ZD 3O6FC 3BO8A 2DJ4A 2OP4H 1E6OL 2VZ3A 5J1AB 4HUNB 2GCYA 5AD0A 5TE6L 1VHPA 1O7SA 3EIFA 4PS4H 1NBVL 3L3JA 2X4QB 2BXZA 2BOBA 4L3EE 3T2QA 4I5BA 3IETA 1XR8B 4YGVA 1LO5B 4MA3B 4KRNA 2XXCB 4OB5H 4EBQL 5JW4Q 2VLRB 4WW2B 2EDLA 1CLYH 4X9HA 1WFNA 4ONHB 5F88A 2A6KA 5E1AA 5DS8A 1NH6A 1QBMH 5D7IF 4EOWL 1J1OH 3BDXA 4OLZH 1BX2B 3OPZH 4TNWF 4WENB 4YHLL 2A6JA 2IQ9L 5JW4N 1EVTC 3QWOA 3EO0A 2G9HB 4Q9CA 3CH1A 5FUCE 3WDJA 1B2WL 3ZTJG 2JK5B 1BVKB 2P7TA 4LDEB 4MJID 3H0TB 3EAKA 4RDQF 1IE5A 3RGHA 2LVEA 2XIDA 5D7LA 4PGBA 2J12B 4AT6A 3AUVA 2GJJA 1CN4A 3O41A 3MMEA 4WO4D 1FO0L 4EIGB 2BCKA 3S88H 4EUPH 1MRDL 4PY8I 1TCRA 3ARDB 2GAZA 5CBAA 1BGXL 2FIRT 3BD5A 5KVMC 2EIZB 5FYJE 3L1OH 4OZGF 4K8RD 3FHAA 4NNYB 5ADOH 4KDVA 1JYXA 4Y2DA 3VWKB 5T5NF 4JM2B 5D96C 5LVEA 4NRXB 5DD5H 2F19L 4D2NA 5IROA 4MB3A 3T4YB 4D8PA 3LPGA 1A7NL 4NDMA 3UTTB 4M7KH 5FYLL 4EN3D 4HXAH 2OR7A 5ILTH 3IXAA 2YUXA 1U41A 1NCWL 4PRPA 4MXVF 4Y4HB 4X6DE 1I8IA 5SWSD 3ARVA 2R4RL 1K4CA 1X5XA 1CZ8H 4AEHL 2BHZA 5J1SC 4NRZB 1UJ3A 3K2UH 2Q8AH 1ZLUH 2DQEH 5TFSH 2AXGB 3SJVE 5JHLL 2E6QA 2E8ZA 3OHXA 2AEIT 1X5HA 4ORGA 4PJCB 4XWOC 2FR4B 2QSVA 5EIQA 2X40A 4BSVB 1ZEAH 4BH8A 4JDVB 1A21A 3KPRE 2W9EH 4P23C 5I8KL 1CR9L 1D5BA 3BAEL 1CD1A 3RWHA 4LCCC 3LD8B 4X0KB 4Z77A 5GRYA 4ZD3H 5I1JL 1Q8MA 2AJVH 4XT1C 5CUSH 3BPOB 4HLJA 5DR5H 2XA3A 3IJYA 4Z8FL 1VFUA 4XMLL 2Y72A 1JYNA 1XIWA 1NDMB 4Y1AE 1IGFL 4CVZB 5CEZL 4RWYL 1NGXA 2BVEA 4DK6A 3U30B 4YHMH 5DMGD 1JZ8A 1EPFA 5MEPB 1NCCH 3SDXE 5TDPB 3JV6A 3S37L 5GSVA 1DBMH 4FFWD 3U1SH 3LKOB 2DD8H 3WEXB 3U0PB 3UJIL 3CX5J 4Q9RH 1CS6A 4KJQC 1MAMH 4K3EL 3MRBA 2CUMA 4GKSA 1JN6A 1BFTA 5EU7C 4U1SB 5DRNA 1P84K 5F89B 5CP7B 1WITA 5HSFA 4AK1A 1IGCL 2BMKB 3QZWB 1IC1A 1ADQA 2PYED 3CMGA 3PWVA 4H0IA 3LRGA 1NGWA 2C9AA 5DJ6B 3SDCA 4XC1H 4H25A 4UI2A 4HS3A 1F58L 3NIFF 1MFEL 3QPQD 3L3GA 1ZXQA 4XCEA 4OSUH 4FFVC 3MBEA 3T04D 3TF7C 1WISA 1YECH 2OR8A 2YK1H 5BMFL 5A16B 3VXUB 2I07B 1DTUA 2Z0BA 1QRNE 4V1DD 1AXSA 3FFCB 5HHNA 2NMSA 3HI1B 4JVUA 1EH9A 1JFQL 3WNKA 1OTTD 1CG9B 2A9ML 3B2UC 3QUXC 1KGCE 4R7DA 4UZGA 5HVHB 5F3HA 1BBJB 3SE4C 4G6AD 5DK2A 1DUYB 5ERWB 4WI6A 1JPFB 3VFGH 5D2LA 3HMWH 4M6NL 4JM4H 1MF2L 1LO3H 4NQEB 3CUPB 1LEGB 4OQ1A 4P4RB 1NBYA 1X5JA 1MSPA 1K4DB 3JTTA 4M5ZL 4TVPL 4ZTOL 5FCUH 4GQ9H 3P11H 4YHKL 2BP3A 3ZKMD 2R0ZH 1U8KB 3ALXA 5MP6L 4LSTH 2DQIL 4PV8B 5J6GA 3QNZB 1JGDA 2GJ6E 2KZ1B 4HG4K 2FO4B 2P8PA 3UBXA 4PJ5B 3CVHB 2C1OB 4ZTPL 3MQIA 4KPHH 3AM8A 3KPQA 4HFWB 1U8MA 2W9DH 4NRYA 4XBPA 3SKNA 1YEIH 1SBSL 3ARBB 4HCRA 3PJSB 3QUZC 4K9EH 1T3FA 2VDQH 4RQQB 1JWSB 3KJ6L 3IDMB 5D6DA 4YUEL 5FV1L 1VEOA 4DKFL 5IKCA 1T1YB 5D2NC 1K6QH 1ZVSB 4YXKL 2IAMA 1Q9KB 5I73B 5CJQL 3FT2B 1WICA 2VDOH 2P5EB 1A7QH 2C4FT 3CLFH 3FHQA 4KHXL 4YBQC 1ZLVK 3RDTC 4CU8A 35C8H 3AS1A 2EZ0D 4M62H 1ADQH 2E3VA 3QPXH 1BPVA 3O2WL 2JJTA 1JGLH 5CD5D 4I0PB 3S3PA 3EYUL 3GHEL 2BVQA 3T0EB 1RZJH 3TPUA 1TVDA 5CJBA 4D0DB 1M71B 1S3KL 3BUYA 5EU6A 3D85B 3WYRA 3WNLA 5DO2C 2ZUSA 32C2B 4QYOA 1L7IL 2WIIA 2O5ZL 2HJLA 3DRQA 1OGAB 4W81A 1H3PH 5MHSE 4HAGA 1J11A 5DD1H 2NX5E 3S34L 4Q6YA 4U31A 3CDFA 4DAGL 1FGVH 1EHLL 3DHMA 4QCIB 5EWIH 1DLHB 3IFPB 4HS6B 3WXWL 5IHZA 3OGCA 3VG9C 3L95A 4JO1H 1HKLL 1SJEA 5MI0B 4G9DA 4HUMB 1JV5B 4RA3A 3A6CL 1I1YB 4ZFGL 1IEHA 5ESQA 4FQ2L 4P4KC 2R2HB 4P46B 2Z8SA 1FDLH 4DZBB 4D9RE 2FHFA 4DGVL 1KEGL 1EFXD 5IB3B 2XN9E 1EO7A 1IL1B 1CFSA 1KLUB 2PKDA 2D9CA 2NZ9C 3O6LH 3QXAA 4JZJA 4LSPH 5DJ0A 4B41A 4G8IA 2QQNL 1P6AB 5FYLD 1H9VA 3QWRD 3VA2C 3VFPA 2ERJC 4XWGL 3RAJH 4HUWA 1YUHA 3AREB 4WTWA 5L2KD 1RPQA 1U9KA 2V5MA 4Z7NE 1KPVA 4TUOB 4YXHL 2GUOA 4L8SA 3HE7C 3QCVH 3QJHB 2YMXH 4MQ7A 2HFGL 2Z4QA 3H9SB 4JG1H 1C5DA 1AHWA 4ODWA 4K71B 2Y7QB 4H8WL 3L5IA 4Q6IB 3IDJA 3PXJA 3TZVC 3QDJA 1KN2H 5BRZD 2MPAH 4B53A 5DEZA 2VKWA 4KI1A 3FB5B 3LMJH 5DJXB 4QHMA 4MD5A 1U8QA 1Y0LA 4NGHH 2X7LB 2XTJB 4MAYC 3FT3A 2AJXH 3KPPB 1SEBB 3RNQB 3ZE1F 1WWCA 4LCWE 1N6VA 1TDQA 3E8UL 4P59H 1ERNA 3IGAB 4X9GA 4XVUC 4CNIB 3EZJB 4QHKJ 3KPNB 3C6LA 4HCRL 4AQOA 2Z31A 2DB8A 5EZJA 1X5LA 4H0HB 5I1AB 2FATH 3H42H 1M05B 1Q72L 1ACYH 4W6XB 1R3HA 2DAVA 1KV3A 2YPVL 3D87B 1CTOA 4QRUA 4X4MA 4R90H 3OKOB 5GZOC 2H32B 3FFDB 4PJFB 1KTDA 4LRNL 3SO3C 4JN1H 5HDBE 4EVNB 4WV1A 4J4PD 5AUMA 3EKCA 4HV8A 3ZT5A 4G3YL 4GW5B 4XP9L 5C0CA 2PTVA 5DRWA 1RIHL 1F42A 4F15C 1CLZH 3MJ7A 4K7PX 1IKNC 2E27L 5CJOH 5L9DL 3A0OA 4X99B 1MCDA 2FB4L 1MJ8L 3T65A 3QXDA 4ALAH 5BS0B 3QYCA 5HGHB 1MLCA 1U8LA 2AXFB 1G7HA 4KJYB 3TV3H 2ICWB 3MRDA 1P5UA 3O6FA 4GSDH 3C6SA 1FN4A 1F97A 4DGYH 2QSCH 2JJVA 1EZVX 3VI3E 4XNZB 5KVGH 1LP9A 5KJRH 4Z76A 2FBJH 5T3ZL 4PJ9C 3QEQE 5E03A 2YBRA 4Y19B 4BKLB 4KMLB 4CGTA 4GMTL 1ZHNA 5IW6A 4C83B 4HZLA 5KANG 4YZFE 1AFVH 5FK9B 3CFDA 4U7KA 1MHHB 4MSWB 5DJ2A 2QQKH 4WNQB 2IALA 3WFEL 3RVUD 2R1WB 2VQ1A 1JMZA 4FQCH 4WFFE 1TETL 1QFUL 5KZCB 3OKDB 4F57L 3FQNA 3SGJC 3BT2H 3HPJA 4RBPK 3FQWA 4TVPD 1KN4H 4F7EB 3BZ4B 2KPNA 4LLYB 3RPIA 3RVXD 4DQOL 4HJ0D 3FMGH 1S9YB 2PYFB 3BPCB 3BE1L 3RY6C 4XHQA 5B38B 4G8GA 5FM5M 1A0QH 4PJEB 4ZMAT 3CU1A 3I9GL 2B39A 3BEVA 5F7DB 2CH8A 3P4OA 3VXNA 4P2CG 1T1WB 4QT5A 1IM9D 1SQ2N 3HE6D 5K9QG 4NQVA 4NQCB 4WHDA 3TJEH 4GXUN 4OZIA 2VXSL 4OV5B 1EXUA 2IG2H 3CXHK 4L1HA 1HINL 2LTQC 1RUMH 1UXWB 3I50L 1MHCA 25C8H 2X9WA 3H6JA 1RZ7H 3DOSA 1MI5B 4IJ3C 1VENA 1OP3H 4FQQA 2PNDA 3GBLA 4AG4H 1XIWD 1LD9B 3PGCB 5C71A 2BOCB 1IRAY 4WFEE 1CDGA 5AG8A 5C2UB 3RWCA 4Y7MA 3UYRL 3ME0A 3NH7L 3W9EB 3OKKA 2Y36L 2GFBB 1GXEA 4K2UL 5GJTH 3DV4B 3WS3B 2VDMH 1BP3B 3FQXB 5HYIA 3PV6A 4DVRH 1KG0B 3C08H 1IQWH 3CSYA 1P4BL 1HDMB 2IGFH 4ODXB 3DO7B 1VGEH 1AGFB 4TUJB 5C8JA 2EO1A 5DF0A 3UTTE 3GM8A 3MUHL 1XF1A 1DUZA 1NCTA 5KN5A 5M94B 1IC5L 4LVNB 3F5WA 2NLJB 3TNMA 5GS0C 3QIUB 5D2LF 3VFMB 2XRAL 1QACA 4UB0L 1T03L 2E9BA 2ZSVB 3DJ9A 3RBSA 3WIHH 4LSVL 4P23A 2VLRD 3RHWF 2MCG1 2N56A 4ODSH 1X4ZA 2W0PA 2Y6SD 2OSLA 3MUZ1 3SDAA 4LCCA 1FG2A 4IHOB 2H3NB 3TT1L 1KB5B 3ULVC 3IS1X 5A2KH 5ICYA 3JWDL 5JPNA 4GAGL 1WJ3A 4XMPL 3WFDH 4UU9B 5FM4A 4HMEA 1N5YL 1S8DA 4WHTB 3TYGL 1OAQL 4P2YA 4BFBD 1KBGH 4JRXA 3UTSD 4R4BA 4U6VL 4HBQA 3HG1E 5LG1A 3VGAB 2HRPL 2UY6A 4KI5E 4P5MB 3CPLB 4HC1A 3B2VL 3QUML 4R26H 3V0WH 3PWUB 1A3LH 5HYJA 1DQTA 1BEYL 1AKJB 1XZ0A 1A4KA 3ARDD 3RWJA 3ZL4L 2CIKB 4I77L 4YDIL 4XP5L 5L8JB 1I8KA 1S7XB 4KRPD 4MNQD 4RIRB 4XXCC 4IOFD 5E7FA 2DDQL 3OX8B 4UDTB 3ZKQD 3EYOA 3GZKA 4P5TD 1MFAH 2NY5C 1VA9A 1UH2A 2UVFA 1YEKL 1MQ8A 5DGQA 1AXTH 4IRZH 3V6BR 1QLFA 7FABL 2O61A 2AXJA 1DN0B 5I6XC 5KVEL 4EKXA 4XCFH 5L8LB 4M03A 4JFEB 4M9PA 5HHQB 3OKEB 5IBLC 2XKNA 3MUY1 1UZ6F 2VDPL 4M7LH 1DQMH 3RU8H 3ZTJH 2ID5A 3G6DL 3LDBB 1QLRB 1U92B 3S97C 1NANH 4Q2ZA 2QADD 4U1MB 1E6JL 2F53B 1UCBH 4NCC1 4LEOB 1DQDL 5DVOA 1A6VL 4XPHL 1WBYB 5TE4H 1FL6B 4KV5E 3QUXA 2HTKD 3SE4A 3LIZH 3DVNB 3KYOA 3VXUE 3NBNA 1A7PH 1DVFD 3BYYA 1NMAL 4JO4L 1H0DB 1TJGH 5HJ3B 2PO6D 4KUZL 5JIPA 2EYTB 3RIAK 1P4LB 4KKAD 2ADGA 3MO1A 4D9QE 4Z9KB 3AB0B 5I75B 4JO3L 3S9DB 3WCYA 5MENB 4QF1A 4LAJH 3BRGC 3S5LG 4AM0B 4PREB 2WWMD 4RGMC 4ZNEE 1MFCH 5F9OL 3IJSB 2VITB 4PGDB 3BX7C 3G6JB 4LKCA 4LVHC 4JFFE 5HHVH 5LGKA 3P9LA 2VLME 1NANI 4G43B 5KW9H 1G6RA 2F8VA 3ZTNL 3SEPA 4KROB 3OQ3B 4LGPB 1FNHA 4RMVA 4Z7WA 1RUAL 5T3ZD 2R0WH 1Z5LA 3QUZA 3WKMH 4FXKB 1DQQB 1PLGH 2DBLL 5KSBA 5D1XB 4NQDD 3UO1L 4XBGA 5D2NA 3MOBH 1BJ1J 5MEQA 1S78D 4TULH 4M7ZC 4U1KB 2QKIA 2R0KH 5T1KB 2OX5A 5D72L 4XHJD 2VNCA 5HI4C 5C92A 1NAMB 3DX7B 5DZNA 3U0WH 1MIML 3RDTA 1N5AA 2YHGA 3KHOA 5I74B 1WGOA 2IPKA 4QRRA 1V3MA 4HC1L 3SQOH 4PJGB 1XF3A 5CFHA 1F13A 4NJ9H 5IMLA 1K85A 1YYLH 3OAZK 3H3PH 5C09E 1J12A 1RSFA 2P5EE 3MJ8A 3FFCD 1LO2H 4ODBD 1J8KA 3DTXA 3MPCA 5I16B 2EKSA 3L9RB 3RJQB 4FQXC 4NKDB 1L0QA 1M7IA 5HGDB 5H35B 4WU7A 3EJYC 3FOMB 3U4BH 1S7VB 3O6KH 2Z35A 5EZOH 3VCLB 3CSGA 1ZANH 2YXFA 5JHDE 1YEEL 4NQED 1OGAE 2P24A 4RCAA 4YNYB 1ONQB 1QZ1A 2X1QA 1QEWA 4P4KA 2V7NB 4FQPA 2V5RA 2BJMH 1J8HB 5DVLA 3CFBB 2X70B 3ARQA 9CGTA 1NCDH 1LK3L 3MLYH 1CBVH 1ORSA 3ROLB 3C5ZC 1Q1JL 4F9LC 4U1LA 3D1MC 1I1AB 2W65B 3DIFA 1LEIA 1IFHL 4PJ5D 4S2SB 1YMHA 1LE5A 3UZEA 2QLVB 3GJFH 5BQ7B 3VD7A 4HK0A 1VFBA 5IBUB 1LP9F 3L5HA 3B3IB 1IKFL 1FRGL 4EXPX 1C12A 3QDMB 4FMFA 4N68A 5A2IH 3CMOH 1KNOB 4LGSB 3C9NB 3G08B 5EOQH 3LV3A 2AI0H 1N6UA 4GUPA 2VLJA 2HT4C 5I1KH 3HE7A 2A9NH 4Q74A 2J4WH 3GI8L 3U82B 4RGND 4GRWH 2VISB 4DCQA 2F9BT 1IC7H 1X7QA 4EEEA 1HQRA 3TZVA 3PWLB 3MROB 3MRKB 1JWMB 1T80A 3NIDE 2ICEB 3PP3H 4WI4A 5GGSB 1U8JB 5AAWA 3LN5A 3VXSB 1U36A 4XZUA 1DBJH 3H9SE 4ZSOA 3T0ED 5FO8A 3E2HB 4XPFH 1E28A 2H9GB 3EDEA 4MAYA 2MHAA 1YEGH 4JZOA 4PJDA 4U0QB 3RBGA 3IDGA 1K8IA 4GW1A 1RMFL 3OXRA 3HC0A 1G7QB 4F37K 5FO7A 5C7XH 2GITB 4JANB 2J5LB 2XTJE 3QQ3B 4PJHE 3C09C 3MRGA 3QHTC 3AMKA 4OZIF 5C0EB 3HC4H 3NN8A 3BO8B 3RQ3A 5I1HH 4PRNB 1BVZA 2IFGA 4G9FA 3Q1SL 3MLVL 1KB5L 3L7FA 3MLSH 1UKQA 2GCYB 2ZUVA 4ODUA 2IANA 1AR1C 5EPMB 1DFBL 2YPLD 4JPKH 4G8EA 1JNHA 1HHHA 1I85C 2BOBB 4I5BB 3IETB 5I19L 5GPRA 1NUNB 3BZFB 5JLZB 1MJ7H 1IKNA 3NOIA 3VWJB 4CN1A 3R1GH 1OAUL 4PJFE 3CDCA 4UV4H 3ARZA 2R56L 2UZIH 1EBAA 3MJGX 4G8GD 5K9JL 1QBBA 3LN9A 4ZYKB 4JPWH 5F88B 5BV7H 2A6KB 5E1AB 2EYRB 2FBOJ 5DS8B 2H2PC 4H26B 1R5IA 2RFXB 3A6BH 2FEDC 3ULUE 4EI5B 1FNLA 2EDWA 4TYUA 5D7SH 1DL7L 3QWOB 4NO3B 1BQHB 3CH1B 1DQJB 3MRHB 4PJ9A 2UZYB 3TA3C 4OCWL 3IVKB 3PGDA 5ISZA 4XP1L 3RA7L 1ZSDB 3KLAA 4XTRC 2EE3A 4FN0A 1DE4B 4JFXB 4AT6B 4LPWA 4NWTH 5CJXC 2EECA 5CSBA 3O41B 3MMEB 3EOTL 2BCKB 2CDEB 1INDL 5BCAA 3ZYJA 3GBMH 3RNKA 1TCRB 5CSZB 2YD2A 4R4FL 1B9ZA 4MZ3A 4ZXBC 3MYJB 3MRLA 3SGJA 1OCWH 1KXQE 4U2YA 5TE7L 4NP4H 2VXUL 3H3BC 4BK4A 4UILH 4XAWH 2W92A 1F4WH 4Y2DB 4PRHA 2C4XA 4LP5A 5DQJA 2O26U 1KJ2H 4MB5A 4G7VH 2HJFA 5FHAH 4D8PB 1U58B 5JW3H 2XZCL 4OGZA 5EB9A 3GMLB 3IXAB 1PG7L 4NN5B 3GMOB 5DHXB 4KK8C 4PRPB 4HWBA 2Y5TA 1MCSA 1IC4L 1F3DH 2ADFH 4PYHA 1FVDA 2DRUA 2AQ3A 4MA7H 4PJEE 2NXYB 3GBNL 4LRIC 4KJPD 4ZO9A 3P9MB 2I25N 3MV9D 3OHXB 2AGJL 3TJHD 4XNXL 5GHWH 1PG7W 3ARTA 2F8XC 4NQCE 4HF5H 1FJ1B 1D5BB 5JO5A 2NY6D 1CD1B 5BS0D 1B3JA 4DGIL 5FYKH 3IDNB 4QHUB 1PX4A 5CEYA 1JIBA 4OLYH 5AYUL 1MI5E 1REIA 4XPAL 1I3GL 5F21B 5INDA 4ETQA 1I9JL 2PW1A 4KQ4H 3W5MA 3TCLA 5GGRB 1A6WH 1QBLH 1CI5A 2V5SA 2QR0A 3LVEA 1JRHL 4E42B 3HZYA 5IV2A 4Y19D 4NFBA 1NGXB 4HIIA 2FRGP 4JJ5A 4JQIL 4LSQL 3UC0H 3JV6B 4NKOB 5GSVB 2ZWLT 2FHBA 4Y16C 4BUGA 1JGEB 4YAQA 5DJZA 5I0ZA 1T2XA 1KIUA 2X4NA 4U6YA 1FGNH 4HXBH 2J88L 2YZ8A 2Q7YA 3MRBB 5IFAH 4GKSB 1PKQA 1P7KA 4CJ0A 4HLZG 1UWXH 2XZZA 5DRNB 2FZ3A 1N2RA 5IF0A 1A6ZA 2WBJD 4O02H 4OLVH 4FFVD 5HHMB 1GGUA 4K07A 1UH4A 3W0WE 1DN2A 3Q3GA 5SX5H 1NGWB 1VADA 3P77B 4JFQA 2OP4L 3SDCB 5ID1A 1L4IA 3GGWB 4S1DC 2N4IA 3MV8A 3O3EB 4UIKL 1JCKA 5I71C 4Z7WF 3QUXD 2P4AB 3L3GB 1HH6A 5EA0H 5LWYH 3CX5K 2BY0A 2R0LH 4OZGE 1BFSA 3BP7B 5E94B 4L29A 2BZDA 3FTGA 4KVCL 4XXCA 4LCYA 4OB5L 2VDRH 4O4YL 4Z7VA 3MZTA 4WEBL 2AV7B 5ACZA 4R7DB 4Z78A 4LIQL 1KEMH 5F3HB 3BPLB 2YD9A 3T3PE 2UY7A 4WWKC 1QSZA 3H7BA 4QY8A 4GXVH 5HGAA 3QNYA 4QRPA 5DUML 1ZGLB 5T1DH 3MCLL 1J05A 4W70A 1I3RB 4I4WB 3BH8A 5L2JA 2CLRA 2DQJL 3F65A 3W11D 4HWBL 4MNHA 2OJEB 4HPYH 1MY7A 3N85H 2EDYA 4JFEE 2VC2H 1JTTA 2J1KA 5I1EH 5J6GB 1JGDB 1I4FA 3EHBC 3RVTD 2F54D 2P8PB 3S88L 4JFDA 3O2DA 4MDJA 3CZFA 3KG5A 4MXWH 1UM6H 4QWWD 3WSQH 3KPQB 3ALWA 5CHNA 5KANI 1U8MB 3LSOA 1HSBA 4NRYB 4XBPB 4U1IA 1GZPB 1NLDL 2PW2A 5GS0H 5ADOL 2F53E 3BQUC 2O5YH 3M17B 4YBQD 3GMQA 1X5KA 3MBXH 4WTZA 5D7JB 3RDTD 3HPLA 4N0UB 5FA3A 5IHLB 1F4XL 4M6OL 3VFOA 4X6FA 5IKCB 3BW9A 4M7KL 3RGVC 3ULVH 2IAMB 2YXMA 1Q9WA 5ILTL 1S5HB 2LE9A 4ZUUB 4WI7A 1BD2E 4MMZC 3P30H 4U1HA 5DO2D 3GMNA 1IAKB 1D5IH 4ENED 3SKOB 1D5XA 1FAIH 1GL4B 3QHFH 2XYCA 5FV2A 3K2UL 4YBLB 5C0IA 2DQEL 4PV9B 1SVZA 2BVQB 4RISH 4OD1H 3OR7A 2JCCB 4Q7DA 1HXYB 3TPUB 5ID0A 4KMQA 4Z7QF 5EU6B 3BUYB 2ZOLA 2AJUH 4IOIB 4YHOH 1P6FA 4P9HH 2WIIB 3UEZA 2HJLB 4F8QA 2W9EL 2BNUA 2ZP0T 3W2DL 1LMKA 3QULB 5HY9A 2XZQH 4ZOEA 3QJFA 2V2TA 3HNTL 5CUSL 5IHZB 4OCRH 4OFYA 3QWQB 1BFOA 3CFCL 5B3JF 4FXGA 3NIFE 3JTSB 1ZVHA 1SJEB 1DQLL 4G9DB 2NZ9D 2VWEC 3R4DA 5ALCL 4KTEH 5C6TH 3TBSB 5ESQB 4PJDF 4L5FL 3QDGA 1FNEA 3V95A 2B0SL 2RR3A 1Q94A 1G9EA 1XEDA 1LQSR 5EO0B 5EN2A 1CFSB 5GS1B 3TH3T 1D9KC 4YHZH 4EDWL 2DI8A 2DD8L 4JZJB 5DJ0B 2D0HA 3SY0B 4UOJA 1T22A 2MMXA 4PJGE 1FL5A 1CK0L 3HE7D 4FQXA 1MAML 4X5XA 1W8NA 4N0YH 1UC6A 4DN3H 4K55A 1YUHB 4OQTA 2WWKT 4YR6B 1KPVB 1H5BC 4GAYA 1T66D 1U2HA 4AH2A 4E5XA 4YQXL 2GUOB 4L8SB 2AEPH 5CBEA 4MQ7B 1V3LA 1ZWIA 5MEND 1C5DB 4ODWB 4UT7L 1HZHH 3C5ZA 4CAGA 4RFNC 4NWUH 4ZS6C 4LQFH 4KK6D 5DFTA 4X98A 5DRXA 1J8HE 4K3DL 4RAUB 2YK1L 1U8QB 4CW1A 3IJHB 3O2DL 1OTUD 3U4EA 1MWAL 4ZOBA 2KUTA 3FT3B 3PQYA 4DUXA 1VACA 2V6HA 4EDXA 4W6WB 1RURH 4OCSH 3QIBC 5E2TL 2ZKHH 5GZOD 3G5VA 1U8HA 3DVIA 4KK9C 4AQ1B 1HI6A 4E41D 5I18H 3QDME 2XFXB 12E8L 4L4JA 4MS8C 4QOKA 5HPOA 1CL7H 5IB2A 1GOHA 4PGCA 5FHBH 2WLZA 4HWZA 3DRTA 2QHLA 2BC4A 2BXYA 1GPOH 3RY5A 4C56B 5FCUL 4JPIA 4GQ9L 1SYSA 3P11L 3WO4B 4WV1B 5AUMB 3PHQA 2R0ZL 4NC1E 4OUOA 4HV8B 4NKMB 1MJUH 2DQTH 4KTDL 3VFRB 3IDIA 1CDBA 5C0CB 1T21B 2BVPB 2JIXD 4NO2A 2AV1A 3CFIC 1PVHA 1F3RB 5HDQH 4ERSH 4QXTA 1U3ZA 3VXSE 1FYHB 3QXDB 3T65B 2DQGL 3BZDA 5L0QB 3EYSL 4PRIA 3S35L 1MLCB 3CXDH 4ACPA 1U8LB 4YPGB 3TBVB 5FOBA 1ZLSH 5F7HA 1ZT1A 3MRDB 3O6FB 3C6SB 3RVVC 1FN4B 2G75A 4YK4B 4P5KA 4TSCL 4Z0BH 3QCUH 5EUOF 3I2CL 3QFDA 3TEUA 3ARYA 4YFLF 1QG3A 2HVKB 4Z76B 2BHYA 4TPRH 4OQTH 1CL7I 4R8WL 5KAQF 3IFLH 2DLFH 5DC0A 3T4AA 1I85A 2VDOL 4U1GC 4OGAC 35C8L 5IW6B 4HZLB 4MZ2A 1I1AD 2XQBL 1JGLL 3ETBF 1I7RB 3O6MH 5C0RH 5DJ2B 5CEZE 4FABH 4D94A 1K2DB 4XNYH 2CMRL 2P48B 3FQRB 5DMIH 3PHOA 3F58H 4O2FA 1UM4L 5DI8A 2EIDA 2OBGA 2MQCA 5M7QA 5DD1L 2HKFH 3ARGC 4MD4B 3RPIB 3TN0B 1ZHBA 4OUUA 1EHAA 4W6YB 1U8PA 5C6PB 2EDFA 3PDOA 5DT1L 4JO1L 2AEQL 1EDQA 3TA3A 5IMOB 1T7WA 5HYQB 3T0BA 2IMMA 2P5WB 3C2AL 1S7QA 1YQVL 1FPTH 3BEVB 1R5WA 1AI1H 3AVEA 5BVPL 3VXNB 5JMOC 2EDEA 5CJXA 3GSVA 1FDLL 1UB6A 2VIRA 1HKFA 2W0FB 8FABA 1UB5B 4NQVB 4TSAL 3TNNA 4HIEA 2F74B 3VGBA 2CIIA 4PY7B 2AQ2A 1CDUA 1EXUB 1Z0NA 4ZXBA 1A6TB 1A7RL 1MHCB 4IDJH 5D7LE 3QA3A 2QQLH 4Y5XB 4FQQB 1YY8A 5KSAB 2FLBT 3P0VH 1BZ9B 2LU7A 5D96B 3TO4A 1RK1A 3BOVA 3RAJL 3RWCB 2G5BA 1CFTA 4FZEH 3OKKB 5A3ID 3KPMA 4NQUA 4AEIH 1P5VA 4LPTA 3OJDB 2DTMH 1J1PH 1U91A 5T5FL 3CSYB 1QPXA 2VH5H 4Z7VF 1HHJB 3I6KB 1KCVL 4J12A 4JG1L 2KBGA 1CIDA 4M7JH 1J7VR 4D9LL 4LRIA 1DUZB 5EUKA 5KN5B 1KCUH 1RZKC 3IS0X 3ZKSD 1ZA6B 3F5WB 4L1DA 4PRPE 5EZLA 2MPAL 5ACMA 3TNMB 5I1GH 2BVOA 1LDPL 4D3CL 3VWJD 4LHUG 4JGJA 4JVPA 3T3ME 4DOHB 4DKEH 2D03H 4NGHL 4HX1A 3ORJA 1VPOH 4BFEA 3SDAB 4LCCB 3BYTA 1FG2B 4BH7B 3EOAB 5EBWA 4QEGA 1A1MA 5ICYB 3QRGL 3L3DB 5JPNB 1TZGH 3GKWL 4EI5D 1OAXH 3KDMA 4IOSD 2ZCKH 4QRTA 4M5YH 5HHOB 3LS4H 4JRXB 2JKXA 4R4BB 4G6JH 4A6YH 1A7BA 1ACYL 5AZ2H 3R06B 1X3DA 3UTPD 2XQYG 1G84A 3DUHA 3D3VD 5ADPH 3X11A 1FG9C 1NSNH 2LQRA 4QLRA 3V4PL 4TOYH 1OW0C 5HYSG 1U6AH 3D39D 4M8VA 4L4TD 4Y16A 3VD5A 3IFOB 5IB1A 2EDXA 5JMRA 1XZ0B 2JJSC 3O2VH 4PJAA 4RMUA 3RWJB 4WIQA 5EBGA 4NZDA 3QP3A 2DKSA 1I8KB 2CQVA 1CLZL 3NCCB 1TJIH 3MZGB 2QJDA 1XF4B 3EYOB 4KDTC 4NQXA 3MFFA 3LCYA 4YX2L 2IPTL 1WWBX 1B6UA 5DYOA 4K7PH 1QLFB 2ZUYA 1X5IA 3N1QC 5H8DA 3QI9D 2HVJA 3UTZA 2BNRA 1MCFA 4GSDL 2QSCL 4CJ1A 5HD8C 5IMMA 3QR2A 1JUFA 3OB8A 2XKNB 1MREH 4JFDD 5KJRL 5HHME 4DWHA 4MJ5B 2J8HA 3RWGA 3HZKA 1MRCL 3GIVA 4JCMA 5K9OB 4OCXL 2NXYD 5DLMH 4Q2ZB 3MA9L 4OFKA 3SDYH 1WZKA 2C7UA 3DYOA 1W72H 5FGSA 2GW5A 5GIRA 5C0AA 1JNJA 4FQCL 4OJFH 2R29L 1I8LC 4ZFFB 5ELIA 5E4EB 5E2VH 1CDIA 1H15A 4WWKA 3MLRL 2NY1C 5GJSH 1MQKH 1L6ZA 2HJKA 4Z0XA 2C4FU 3PABA 1RZGA 1WZ1H 3V6FA 1D3CA 1H8OA 2BFVH 2P45B 3MO1B 4KTYA 3VXRA 1U42A 3BWUC 3BRFA 4O5LH 3TIDA 3GJFB 2OK0H 4GT7A 1CF8H 1SY6H 1T0MB 1NGZB 2DQDH 2FX7H 3BP4A 4LLQB 3WNPA 5C0BB 4UTAH 3PL6C 4NZRL 4KZEH 2IG2L 3T77A 4MX7A 2BSTA 1YMMA 4TNVK 2DQHL 4WI2A 3IU3A 3BQUA 3KXFA 4CMMB 4E0RA 1Z5LB 3QUZB 3ARXA 4GRWB 2VLLA 3CD4A 4LARH 3GK8H 5LQBH 3MRRA 2FECL 2B4CH 5J0BA 2EEDA 1A3QA 1CFQB 5KSBB 3B8SA 4XBGB 5D2NB 4GKNA 3KPLA 5MEQB 4Y5YC 3O4LD 1DP0A 2R4SL 1RU9H 4Q0XL 4LL9A 3DV6A 1VEMA 1GGCL 1U8NA 5I8OL 2IGFL 4XXDB 5T1LA 1WAAA 2R23B 1YNKH 2ZOKA 3E3QE 4MHHG 5HI5D 3JWOC 1K5NA 3OTTA 5ICXA 2E9WA 1A64A 5IMLB 5KSUB 1I7TB 3EJYD 1N4XH 3U7YH 5DEFA 2V7HB 3MNZA 3D0VA 4GRLD 3MJ8B 4QTHA 2HWZH 1AIFA 2F5BL 4ZAKD 4G6ML 4PGJA 5E9DB 1EGJL 5FUOL 2BNQA 3WL9B 4M48H 3HR5B 2CPCA 4JHWL 4M4PA 1WCBA 5CLTA 1SM3L 3MREB 4HLZH 4WU7B 3VG9B 3B9KA 4KMTL 5EU6E 4H5SB 4MD0B 3GSQA 3HC3H 3G5XA 2YSSA 3FN9A 1YPZA 3AFLA 1RY7B 2WP3O 4DJMA 5CP3H 4XH2A 4KJWC 5DHVH 4R26L 5BV7B 2XV6B 2OM5A 4U1LB 4H20H 1D9KA 2PCPA 4DZ8A 2ARJQ 1A3LL 5I8CA 3LHPL 1LEIB 3MNVA 5FIEA 3VA6A 1YMHB 5JTWA 2C3WA 4NNPL 1U93B 2J2ZA 2X4OA 4OZHB 3K1KC 1IGYA 2ERJB 3P73B 4HK0B 3MODH 4JB9H 3VFUB 5JQ6L 3QEUA 4CVXB 4ISVA 3LOWA 2DKUA 5D7JD 1H5BA 3MGOB 3NCBB 3LV3B 3PP4L 1U3HB 4PJXF 1AXTL 1JPSH 1R5VA 2VLJB 1XGPA 5AG9A 5C0NC 1TZHA 1UJTA 1KCSH 4UT9H 4Y5VC 5C9KA 3C8HA 1INQA 2EYSA 2ZSWB 5LCVH 5EBLB 3HMXH 4M1CC 4QTIL 4LOUC 2X89A 3DX6A 1X7QB 5LAXA 4WEUD 4WCYH 1NC2A 1HQRB 3TZVB 1RZFL 4UTBL 4BSWB 1FZMA 1CGSH 3QQ9D 2XNAA 4YFDB 5T1MA 2Z91A 2Y9RT 5FXCH 4XZUB 4ZSOB 4M00A 5FO8B 1UCBL 1KJ2B 1E28B 1YYMH 3ARWA 4N0CD 4UV7L 3RPKA 1I8MA 4JREB 3MCG1 2G60H 4X4YB 3QDJE 2RJMA 1F90H 2AP2A 2MHAB 5F96L 2Y1VA 3IDGB 3TVMC 5GGVL 1K8IB 3QIBA 4WRLA 5JZ7D 3HC0B 5FO7B 4OGYL 4LEXH 3TP4A 1DCLA 3MRGB 1BM3L 1A7PL 2D7OA 2JE8A 2VLKB 3H9ZA 3K2MC 3NFPA 4GJTB 4JDZA 1TJGL 4LLUA 3V5DA 4NZTH 1MRFL 3WD5L 1X4YA 2NY0D 1EBPA 3EGSA 1MFBH 3RVWD 3L7FB 4OM1L 4JKLA 5IESL 1KIPB 2JJWA 5D1ZC 5DD6A 2XG4A 5E2WL 1NEZG 1NGQL 1U3JA 4GOSA 2I5YH 4PBXA 4MCZB 1JNHB 1CFVL 5LBSH 3KYKH 4TQEH 1QFWH 3VXMA 3MGTA 4FNLH 4X4ME 5IEKB 4APQB 4C56E 4L8BB 1A8JH 1AD0B 4HSQA 3UPRA 4C4KT 2ORBH 1R5IB 4UT6H 1MHPL 5C0CE 2R0WL 3OKMA 1GCFA 5C0GA 4J7RA 1BQLH 4ZFOA 3WKML 4P2OB 1G7PB 1FQ9C 1RZIA 2W91A 3EFDL 2F5AL 5IFHH 3MOBL 2ZNWA 5D1QB 4N1CA 3C8KA 2R0KL 1ITBB 3LQMA 4PJ9B 1ITCA 5CZKA 4U6HA 3BIBX 1GC1C 3U0WL 3KLAB 2DTSA 1O5DT 2AK4D 3KPSD 3SQOL 4B7LA 4Y4KC 1LP9E 4QXUL 4L8DA 1YYLL 1QSFA 4L4VD 1MFDL 1OAYH 2VXTH 3RNKB 2X4PA 3H3PL 3VFTB 5T3XE 1MEXH 3VFSB 4WO4C 2NW2A 1QFWI 3K1DA 1LO2L 4RDQG 4GS7C 4KK8D 3CH8A 2H2SD 2ZNXA 1BQSA 4PRHB 2PN5A 2H6PA 2IBZY 1NFDA 4IRSD 4K8RC 3U4BL 4YWGH 5TJWK 5F9WB 2X4UB 3W82A 4K3JL 3SCMD 4MQSB 4Z95H 1A1OA 3E6HA 1X5YA 2CKNA 2YRLA 4KKLD 5KS9F 4JCLA 3QXWA 4EN3C 3WE6B 5T5NG 5KBNC 4YIQB 3K4AA 1TTFA 3MLYL 1CBVL 4W68A 1TQCB 4Q9BA 3LS5H 2LAAA 1QYGL 2LTQB 3MRQB 4GMSH 2IH3A 1JI1A 4IJ3B 5TQ2H 3F7PC 1ETZA 5CGMA 5LGHL 4PJ8D 4XVSL 3NABL 2QV2A 4OZIE 5DQDH 3GNML 1P84J 1SJHA 4QXWA 3D48R 4HJGA 2GK0A 5CS7A 5C08D 3BKYH 2VZUA 4X7CC 1A2YB 5INDB 1R6VA 4D0CA 1VKXA 4AIZA