3B83A

Computer-based redesign of a beta sandwich protein suggests that extensive negative design is not required for de novo beta sheet design.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
95
structure length
95
Chain Sequence
MLQPPFNIKVTNITLTTAVVTWQPPILPIEGILVTFGRKNDPSDETTVDLTSSITSLTLTNLEPNTTYEIRIVARNGQQYSPPVSTTFTTGSLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TEN-D3
publication title Computer-Based Redesign of a beta Sandwich Protein Suggests that Extensive Negative Design Is Not Required for De Novo beta Sheet Design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 13
structure length 95
sequence length 95
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3b83A00
3CSBA 4FFYH 1AHWB 5I71C 3D3VD 2HRPL 2UWEA 1PSKH 5IF0A 2HKHL 4G3YL 3S98A 2ARWA 2Y36H 1D6EA 5FK9B 4R26L 5GGVY 2AEQL 4QY8B 3BPNC 4ZUSA 3TH3T 3VXSE 3EJJX 3X3GH 5JNYB 1KTLA 4U6TA 3VFNA 1VA9A 2IFFH 4MWFA 4RDQF 2R0KL 5F7DB 1NSNH 5IQ9A 3DHMA 2CLRB 3AC0A 1LWRA 3LEVH 3P9MA 4XCNB 4TPRL 1LVEA 5EIIB 4P0DA 1J1XL 3NFSL 5ETUB 3RBGA 3IETA 4N8VB 3MRPB 1YYML 4I4WB 3GSQA 5DJ6B 5EH1A 1ROWA 4OZFH 4LPVA 2BSRA 2D7QA 5LCVH 3WNNA 5GJSL 1R24A 1EDQA 1J1PL 3GUTB 5E2UL 4BUGA 1JHLL 4OD2B 1FNSH 1G0DA 1BM3H 5L88H 5ICXA 3OKMA 4QRRA 3B6SB 3VXMD 2OI9B 1ETZA 3B2UC 2O5XH 1WK0A 3FONB 3BYYA 1EFXB 1KEMH 3PV6A 3MOAH 3KDMB 2X4QB 1FZKB 4L8DB 1NGWB 3QNZA 2K3TA 3DRQA 2GI7A 3N1QC 2PYED 1ZGLM 1EHLL 4QYOB 3QDGB 4GQ9L 1PW3A 4OFKA 3FFDB 3BAEH 5DVKA 3WBDA 4NUGL 5T1KB 4HS6A 4F57H 3QEQD 4YHMH 5FAAA 3B5TA 1J5OH 1JZ7A 2QQKL 1QBLL 2E9JA 4HWNA 2J8UB 5I9QC 5KAQG 2I9TA 5J89A 4LCUB 1ZT7A 4Z77B 4RGMC 2DIBA 4KXZI 2PW1B 3JV6B 3RY5A 4UMGA 1E4XI 1S7QB 1CXIA 5EDXA 3JVGC 2P1YA 2UV3A 2UYLA 5DEFA 1BFSA 4PGDB 4M61B 4P4KD 2QQNH 1NFDA 2ERJB 3ARFC 5IEKA 1HHGA 3HLAA 1Q9OB 4DCQA 1RZKL 3GSXA 5C0AB 2R2BB 1B4JH 3HMWH 1I1AC 4RWHA 5DUBB 4C83A 3CFDB 4WV1C 1TQCB 3SGKA 3UDWC 4KROB 3PP3K 4G8GB 3C09B 1KCVL 1UZ8A 4LPXA 4APQC 4MJ5A 3HUJF 4KKCD 2AQ2A 4U1LB 5HYSG 5C92A 1J0HA 3RUGA 1MIML 1U2CA 3VRJB 1VFAB 3TLRA 5HVHB 5L6YH 3QFDA 2PXYA 2EDKA 5HYQB 1ZWIA 4LRNL 5D6DC 4RWYH 1QSZA 2C3XA 2AXGA 2XFXA 1ZSDA 1J7VR 2FX9H 2ZOKA 1XT5A 2OXHA 4EDWH 3GHBL 3I02B 3K7UA 4Q97A 4DVRL 3U9UB 3V52H 2ICWI 4GUPB 4Y4KD 2BNRB 1VSCA 4UQ2A 4YXLH 1OGAB 3RIFF 1MY5A 3Q6GL 5CUSH 3KLHC 1FAKT 3QDJA 4KKNA 4PRNA 1F3RB 4YXKH 1XAUA 4Y4HA 4Z8FH 3V0WH 4KK9C 2D7MA 2MJWA 5I1DB 4OM1H 3HI6L 2CR6A 5EC1A 3RY6A 5J8OA 4X6EB 3IDIB 3LKRB 3QPXH 1JI2A 4NQDB 2X4PA 4RGNE 4RGOL 1KPVB 1W0VA 5C0CB 1ZLSH 4RFOL 3NPSB 1CGWA 4I2XA 2YPLE 2GITB 5EUOF 5D1XB 2VDLH 1U3HA 1X9QA 2VXSL 2EEBA 4GAFB 5IMKA 2DQFB 3MV9A 3MLVH 3VFSB 3GSRA 3IFPA 3G08B 3KPOA 2BMKA 4HEME 2VLRE 1W8OA 3QQ4B 5F21B 3N85L 4HJJH 3KXFB 4FABH 5I1KH 2JB5H 3KJ4C 3VD7A 2K7PA 5EA0H 4QOKE 4YWGH 1HI6B 3JUZA 3EGSA 2B20A 3AS0A 3A6CH 1IGTA 5JOPD 3QNYB 3IFNH 3BT2L 4QHNA 5JQHC 3CLEL 3GJEB 3EDKA 3QDAA 4PJ7A 1ZT1A 1CLZH 2CLVA 3OKKA 4LASH 4XC1L 4M7KH 3UYRH 5CJXC 4GBXB 3TYFB 2VLKE 4JQIH 5IW3A 1S7TB 3H3PL 5EBMB 1BFOA 2VUYA 1X4XA 3VMPA 4H1LH 4MS8D 5DLMH 1T1YA 2CKBB 3HB3D 3T0WA 2Q76B 3OB0K 2EXWD 2YA1A 4I48B 4JFDD 1AGFB 1X3DA 3CSYA 2GHWB 2ZG2A 1D5MA 1DBAH 4R4ND 1WUNT 1OCWH 4Z7VE 5E2WH 43CAB 3CC5B 3KYNA 1Q8MA 4LLQA 1MQ8A 4OF5A 4PJGB 4ODUB 1PG7L 3EYSH 4JM4H 3ZTJG 5IB2B 4K7PH 2CDEB 1FZOA 2I07B 2ITCB 4KAQL 4DUVA 3BSZH 2J5LC 3Q0HA 5C71A 3KLDA 5AWNH 5CAYB 3ULVF 1CLOL 4KI5C 3R1GL 3QHZL 1A7NL 4NZRH 3QBTB 2V5RA 4HWZB 2YBRA 5CILH 1IRAY 2YPKA 1JHKL 2NY5H 3NIFF 1BP3B 2ADGB 3STLA 2A6JA 4EN3C 5I75C 3RNQA 1NAMH 3FB6B 4X0KB 1V3JA 5E6ZA 2AEIT 2MQ3A 5IKCA 3LRHA 4LNRB 3U30C 1MFBH 5MEQA 5D72L 3VU2A 1NCCL 5ICZB 3KLAA 4GXVL 3SKOB 3UTSE 1ORQB 3O6KH 3WUZA 3S4SB 2FX8L 2VDNL 1A1NB 5ICYB 1LE5B 3CDFA 2Z8RA 3PWPE 3V4PH 3WDJA 2E6JA 3X11B 2JJWA 4F9PC 2AI0L 4HUNB 3IB4A 5SV3A 3PDOA 4GKSB 4IRZH 3VXPA 4J4PC 3DLQR 3IDYB 2WLYA 1KJ2A 4JO2H 3ARDC 4Y16D 5C0FB 1P4LB 4K94C 3IFOA 3LIZL 1HYRC 5T1LB 4OQTH 3HUJB 2F54D 4S0SD 4UU9A 4Q58C 3RRQA 2EO1A 3MRJB 2YKLH 2WBKA 5E8PA 3ZKSD 1AC6A 4WW1A 3CFIC 3IDNB 1R3JB 5EULV 4E41E 3GMMA 4PRHA 2OMBA 4V1DB 3L7EB 5AZ2H 3WJLA 4R90H 1NCAH 1N6QH 2JJVA 1CVSC 5DQJB 5C0BD 5FYJH 4P5TC 1C5CL 4JFFE 1PDKA 1WT5C 4OF3A 3TFKD 3B8YA 4KPHL 4NBYB 4PPTA 3ES6A 4K3HA 4EI6B 5E7BA 4OZ4A 5EO1B 3ORJA 4X80H 1RK0B 1NFIA 2GYSA 4H8WL 2GAZB 1FFNB 4YHYB 1KB5A 5JR1H 1MVUB 2ESVD 5TE4H 2MCPL 5FYKH 4UAOB 2XTJD 5IMMA 1OTSC 3QYCA 4I18B 2FEDC 3P0GB 1WVZA 1XCQB 4QNPF 2V7HB 1HDMA 2HMIC 3IDGA 1MY7A 2XWBB 4LPWA 2VKWA 3ZYOA 1AHWC 4EJ1C 3VGAB 1DE4B 1A7PL 3IDXL 4TSBH 4HXBL 5BXFA 5DQDL 4X6DA 5D6CA 1N5AB 4XVSH 2RHEA 4LSQH 5CEZL 2R56H 5SWSB 4M7LL 2BDNL 4PJCF 3C60D 2H2PD 1NGPH 4QXGH 2X6MA 4FTVA 4PGEB 5HHOA 1A4KA 1QSEE 1JRHH 5FYLD 3DV6B 3RY4A 3GIZH 4ODHL 1CTNA 2VDQL 3BWAA 2Z35B 1SJEA 4O2CA 2ICWB 4EI5C 4IS6B 3NVQA 4GW5A 3PWVB 3O3AB 2CH8A 3O2VL 4G9DB 4PFEA 1U8JB 4DQOH 3C8KB 3FRPA 5HHNB 3QA3B 4M8VA 2N4IA 5EORL 4IEFB 4P2RA 1DBKL 1FV1B 2A9MH 3WJJC 2Y7QA 3G6AB 5EIVA 1NANI 1LEIB 5KS9B 3RDTA 4IOIA 4ODVH 3O45B 2Q87A 1T0PB 1UCBL 1EVTC 1FPTL 2AJYL 3L5JA 5TFSH 2V5TA 4RAUB 1ZANL 1BVLB 5CP7A 5DRWB 1W72L 4P2QD 1G7QA 2OI9C 3CXHK 2DYPA 3M8OL 2CGRH 3V6OC 1R5VA 1JZ4A 2XZQH 3L9RB 5J3HC 4JPVH 4NNYB 2F74A 1MWAH 5FHAL 1KENL 3QWOB 3IKCA 4FQJH 3H2WA 2VLLB 4L4VB 5JW3L 3MO1A 1JZ2A 3A6BH 1IQDA 3D3VB 4KQ4H 3I75B 1AGEA 2VDRH 3D69B 3QQ9D 3BP4A 4JE4B 2YEZB 4XZUA 3V79C 3MLYL 5I8CA 1J8KA 4FG6D 4ZMAT 3BUYA 3UBXA 2VAAB 2EDFA 4PJ5D 5CJ5A 4OV5A 3I3EA 2VRAA 5DSCB 5D1ZD 3MLXH 2APBA 1NPUA 5C07B 15C8H 5FO9A 2P44B 1A7RL 4DKDC 2XNAB 2P8LB 4GW4A 2V2WB 4JRXD 3IRZA 3QRGH 1CDUA 4XNUL 4HBQA 3WIHA 1M7IB 1TCMA 4LVOC 2JCCE 1YPZA 4ZUVA 4WW2A 1JK8A 4GS7B 5F9JB 4Z76A 4PYGA 4F7MB 2CPCA 2F5AL 2ZNWA 4YDVA 3DUUB 4LHUA 2LTQB 3VH8B 2P8PB 1ZEAL 4HUXB 2J3SA 1Y6MR 5E9DD 1OM3L 4WJ5A 1I9JH 1RJZB 4HPOH 4XC3H 1QA9A 3ROOA 3NIGF 4XP6H 5C6WH 5KTEH 3W0WE 1EV2E 1U6AH 2D31A 4OB5H 4WWID 5GRJH 3MZTA 4AEIL 1KBGH 3W9DA 3VRIA 3QQ3A 5T3ZL 4NN5B 3QCVH 1ZMYA 2NY7H 3QULA 3TT1L 5C08A 1IGCH 2PYEB 1ZGLP 1CICA 3CVHH 4M1GL 2YD2A 2R2HA 4NPYB 1I8LA 1J0JA 5IBUB 1JIBA 1BIIA 1JL8A 4XWGH 5C1MB 1IJ9A 2PO6A 2GSIB 3QEQB 4PJXA 4PJDA 1H3XA 2CXGA 5FDWA 2R0ZL 3QUMH 4HV8A 3O9WA 4WY7H 4BSVB 4FQ1H 5DD6A 1WF5A 3GKZA 4R4FL 3V7AE 3S37H 2H1PL 1F6AB 4TSCH 1V7MH 4ODTH 3M07A 1NJ9B 1P1ZA 2BVQB 4Z18A 1HXMB 1TTUA 5DDHA 2I60H 3UPRB 3EO9L 1YY8A 1OHQA 3OR7A 4P4KB 3NPSC 4K8RC 1EK3A 3DX8B 3D18A 2X70A 3MBEA 4HULB 5E5MA 5K9JL 1ZS8B 2N7AA 5DTFB 4D94A 3JV4B 5GGUA 5IEHA 2ICCA 1LP9A 1UM4L 4ZTOH 3LSOB 5D9SA 2CRIA 4U6XB 5JA8B 2H45A 2R39A 1I3VA 1KCSH 5D1QD 1NBZB 4PJCB 1RIHL 3IDMA 1DQLH 4ZAKA 5HYIA 3LN4B 3C6SA 3MC0A 1ADQH 5BW7C 3RTQD 3MRKA 5F3BB 2VXUH 1CG9A 1I9RL 5MEOB 1B0WA 4GBXC 4PJIF 3CPLB 4Y4KB 1FO0B 2XWTB 3K4DA 4MA1B 2A0LD 2BNQD 1M6OA 3AREA 4WFFD 4MQTB 5BS0A 3B83A 1QRKA 4UDTB 2C3HA 5EC2A 4F7PA 4XI5C 3FT4B 3QEUB 2OZ4A 4D0DA 1SBSH 3DGGA 4KJPD 3FRPG 4X8JA 1W0WA 2NLJA 2QEJA 5JMRA 2ZUXA 4HWEH 1TENA 1YEJL 1NFKA 3NFNA 1UXWB 4HCRL 1HOCA 3NZ8B 2OQJB 3CXHJ 5AZEL 5T3ZE 1CTOA 2PW2B 2EH8H 2XA8L 3CFEB 3OMZA 3LEYH 3ULUD 5E2VL 5F7MC 2OP4L 2H32B 3TIDA 1SEBA 2KL6A 4TVSa 4WUKL 1LO3L 1QVOA 4NWUL 5BO1H 3VXSA 5GRUL 3DX7B 5GS1A 5EUKA 3K2UL 1NMCB 4S0TD 3QG7H 1FZJA 1A6ZB 4XH2A 1U36A 4K3JL 2I5YL 4LLVA 3UBXG 2H2SC 3SGJA 4X7TA 4X83A 3X13A 1MAMH 4X98A 1AD9A 1QRNA 1KN2L 3U9PH 4OLUL 2VKXA 4NHUA 2ADJA 3IU3A 5HHXL 3CZJA 3OJ2C 3TN0C 4OIBA 2YK1H 4KJWD 4K94L 4P9MH 1G6RL 1ZHBA 2VDOH 4UINH 4CADA 4JFDB 5EZJB 4Y5XA 5FM8A 3SKMA 2V2XB 5J6GB 1SHMA 3GM0A 4HSQA 4KRPC 5HXMA 5IW1A 4F37K 2VERN 4KDTC 1RUAH 2P5ED 4UZGA 1KEGH 3SDXB 4LHUG 3MXVL 4JFYB 3JV0A 5CCKL 1FHGA 1GPOH 2ZUVA 3I3DA 4FQIH 4M7JL 4IRSC 2DQCL 1XGQA 5D7LD 2JJSC 4BH8B 1P2CB 3WDHA 2HFGH 3TBVA 4P23A 1NAKL 3F58L 4NO2B 2IAMC 1UJ3C 43C9B 5E1HB 1OD7A 2YRPA 3ARGD 5ERWA 1S7UB 1HQRA 3O11B 3ZDYF 1EHNA 3U4AA 1RZ8B 1I7ZB 1L4IA 1HYSC 3Q3GB 4KTDL 4HUUA 2BERA 3HNTL 1IAOB 3DRTA 4M43H 3QFJD 4PJBA 3QXUA 4U6YA 4WI7A 3BQUD 4N0UB 2CMRH 4I18C 1DANT 4LSPL 1GAFL 1K2DB 4NJAH 3WE6A 2IADA 1ES0A 3GNMH 3IXTA 5DRNA 1WJ3A 1XF5B 4U0RB 1F4WL 2MQ0A 4BSWB 3K8MA 5C0JB 1CK0H 1RIVH 3EOBB 2X1WL 4MLIA 5IUSA 5JPMB 4GH7B 3OR6B 4HAFA 4AQOA 4Y16B 4ZOCA 3EDJA 2R0WH 3FB7B 4U33A 4M62H 4KI5E 4OCYH 3QI9C 1WTLA 3HRPA 3H7BA 2F54B 2JB6A 4N1CA 4HKXB 4JZNB 3UEZA 4FA8A 4IRJC 2DWDB 1C7SA 1H15B 2WWKT 5CSZB 4NZUH 1E6JL 2HFEA 5L2JA 2BSED 4OCWL 1RSFA 2PKDA 4MD0A 4YHLH 4DGVL 2IQAA 1J05A 3ZHLA 2Q6WB 2OX5A 1DQJB 2XRAL 1ZLWK 5BJTA 4HK3N 1B2WH 4L9DA 5F7FA 5FM5O 3JZ7A 5C0BB 3VWKA 2J8OA 4JANB 2OK0L 4Y4FD 4AIXA 5DMYA 5KJRH 2OSLB 3UO1L 3S8WA 2P49B 3OXRB 1WICA 4Y8AA 5IJVB 4KQ3L 1YEHL 3VXRE 2PYFB 4YJZL 1JF1B 4GXUN 5D7IE 1JGLH 1NUNB 2ESVB 4HDIB 4GRLA 5DHYB 4BFBD 4M3KB 1FJ1A 3WN5C 4KFZC 4AENA 4YZFE 1I3RA 1Q0XH 5IHLB 2CJUL 2YPLA 3T1FA 2WUCL 2JIXD 5EZOL 4FQ2H 4NM4H 5F8QC 5TDNB 4GMSL 1DTUA 3CXDH 3BZFA 3ULVC 1XF3A 2IC2A 3GSOB 4PRPD 5DJZA 1I7UA 3C60B 1RFDL 3UJJH 3P11L 5C09E 2YC1B 5DA0B 4LDLB 1MELA 2FBJH 3U0WL 4AT6A 4BFGA 2BVEA 1WLHA 1CYGA 1E27B 2VLRA 3UAJC 2PTTB 3FCTB 1GJIA 5KN5A 3AB0B 1QKZH 2QSTA 4YK4B 5SWQB 4MQ7A 3DROB 5KSBE 1J1OL 4OZIA 3HR5B 3NFPB 3SCMA 3TH4T 3MRCB 2VZVA 5C0IB 3RWFB 3FB5A 1FNAA 3D9AH 2LTQC 3LRGA 5FYJU 4N0RA 1X7QA 1OAYL 1I8MA 3J7HA 1DLFL 4HS3A 5E24E 2WZPD 5I1LA 2QHLA 4P2QB 4PIRF 4C59B 3BE1L 1VADA 5FYKU 3AS1A 5D93C 4NN5C 2R2CA 3HFML 3QUXA 1DSFH 1TPXC 4MZ2A 2JJUA 3RZCB 2E7LA 3VGFA 3V6FA 5IMLB 3O0RL 5FYJD 2KZ1B 3V6BR 3OKNB 3ULUF 5KVEH 4U7KA 4WO4B 3OF6A 4KHTL 1IGIH 4LK4A 1FNEB 3TNMA 4J3VA 1QBBA 1VFBA 4KMTH 2FR4A 4PJ5B 3FT3A 5D1ZB 2W65B 4WHYH 1A1MA 4JM2A 1CWVA 1QHPA 5FYKD 5EU5B 3RL2A 1B88A 3MBXH 5IK3A 3DURA 2B7DT 5B8CB 3QA3A 4PJAE 5GGQL 4JRXB 3W2DL 1JZ5A 2BOCB 1RJYA 5I17A 3KYMA 2AV7B 4U1IB 4F8QA 3BD5A 4K8RL 1K5NB 3CMGA 4YUEL 3GMRB 3L3GB 4P5MB 4DN3H 1CGTA 4NBZB 3KPLA 3V6OE 1F8TL 1SM3L 3UTSA 1A22B 4BH7A 4XMPH 2RGSA 5TE6H 4M03A 1ITCA 4IDJL 5E9DB 2CDGB 3ZKXB 1MQKL 3UTPD 4PB0L 3BZEA 1YQVL 3H9HB 3HC0A 3MLTB 1FFPA 1PQZB 3IJYA 4AY0A 5KW9L 4KKCC 2ZPKL 4O2FA 1JZ8A 5HHVH 3WFCH 3QJHB 1A5FL 1QLRA 1MAJA 2Z92B 5AG8A 1S5HA 1K4DB 5I1JH 1RU9H 2YEZA 1S7XA 3OX8B 5J0BA 1QSFD 1CGSH 1JI1A 4ZYKB 4NKDB 2HVJB 4HIJB 1RUPL 1MFCL 1F58L 4JY4B 4ZS7H 4LLDB 5ITFB 4UDUB 4Y4KC 1KYOK 1U8NB 2G60L 1R3IH 3CX2A 4E41A 1RV6X 4ZUWB 1EUUA 3VFWB 2LU3A 5IFHL 4MA8L 4S10A 1CXHA 4X6FA 4EKXA 5DRXB 4P9HC 1BWWA 4WEBL 2DLEA 2LU4A 1T5XA 4G5ZL 1F4YL 2LAAA 4PP1D 1IAKA 3MA9H 1YN7B 4I3SH 5MHSD 1UYWH 1IZJA 4NQSB 3KPPB 1EEQA 2R15A 1LO4H 2BC4B 3EFFA 4FS0A 4BK4A 2EE3A 1R3HB 2ICES 3KPNB 4NKQB 1XCTA 1MH5B 4CNIB 3MNWB 4ZTPH 1CXEA 1G1CA 1KULA 4JKMA 5HYJD 4UIKH 3OKOA 5DMKA 1EEYA 4CJ1A 2WP3T 4HKBA 4HMEA 4LSSL 3H0TA 5SWZD 1R0AH 5D7KD 5I1GL 1X5KA 5D1QB 1RZJC 3U46A 3FQRA 2GUOA 1EGJA 3MREB 2BNRE 4P59H 2D2OA 5ALBH 3MV8D 1OGAE 4L9LC 4OZFB 1R5WB 2VDKH 4PGBB 3RTQB 4XBEH 3QO1A 3BW9A 4KK8D 5JW4M 1YEGH 4CMHB 2ITDB 4GG6F 3O2DL 1YN6B 1NCDL 2DMKA 1EX0A 3BKJH 5C0CE 4P4RA 2VIRB 5I66B 4DFHA 2BNQB 1SEQL 4UT9L 2YR3A 4MS8C 4R96B 4IDLA 5FKAA 5MERB 2ZUTA 2QSCL 3HB3C 4HWBH 2EIDA 4XVTL 1YNLL 2DJ4A 2DBLH 1PD6A 2AXHA 3SDDC 1HN1A 4I3RH 4ZFFA 4HUWA 3OGCA 4YHOL 4WHTB 1FAIH 4PJEA 4WU7B 3BEWA 5C0GB 1II4E 3NTCH 1NBQA 2H8PA 1ZA3A 1F00I 4QXUH 3HKFA 4PGCB 4KZEL 4W6XB 3BH8A 5A2IH 1CFSA 1WCBA 2YHGA 1IGJA 2BNUB 3V5HB 5IB4B 1IVLA 4U31A 1CDCA 4HK0B 3QCTL 4YFEA 1P6AB 3QIBC 5GS0D 4HH8A 5JIIA 3RWHA 3O2WL 2HFFA 4R7DA 4BZ1L 4Y5YC 1JPFA 3CFJA 1S9VB 4LLUA 3WFEH 1WITA 3VG0H 2DMBA 3ZTJH 1YY9D 1AQKH 4JG0L 4NQTA 3REVA 4CUCA 1A14L 4XNQA 1EO8H 35C8L 3GGWB 3UJTH 1KCUH 3EFDH 5E08H 2ICWJ 3RVTD 1C7TA 3PXHA 4NRYB 4X4YB 1NCUA 4WI5A 1G7HB 5KSUB 1YEIL 2C9AA 4MNHA 1CLCA 4KKLD 1FVCB 3HZYA 5GZND 4U0RC 5TE7H 2H3NA 4Z9KB 3S7GA 1JPGB 2FLBT 2X4SA 2YD5A 2NX5D 5DVNA 3QEHB 4R8WH 4Y16C 4M1DH 5I0DA 3DETD 1IC4H 1IT9H 3PWUB 3TA3C 2OR9H 2P5EB 1QNZH 4PG2C 3BISA 3KPMB 4IIQB 2OL3B 3G5XB 2KKQA 4MD5A 2IH1A 3QEGH 1FGNH 4GLRI 3QUZD 4QHUB 3P4OA 1TVBA 5A3IC 5LWYL 2EDHA 4Q6IB 3T4AB 5D7LB 2GT9B 1F4XL 4HUVB 1H3TA 4HIIA 2X4NB 2F19L 4PV8B 3SE3C 4R4BB 1B0GA 4XT1C 4W68A 2EKJA 3ARGB 4K7FA 3H9SE 4DN4L 1KJVB 5FV2A 2HAZA 3LPFA 4H0HB 1VPOH 2FJGB 2XIDA 4B50A 3C5SB 3EYQC 3KJ6H 4D8PA 5F3HB 4K23H 5FFLA 1Q0YH 4Z7OF 2WV3A 3QFJB 4R7NA 4NP4L 3BQUB 2XTJC 5BVPH 1LNUA 3VG9B 3I85A 3PDGA 1MFAL 4PREA 1K8IA 4Y19E 4ZQKA 5F6IB 2AJSH 4H20H 4Z78A 3HUJE 3MJ7A 1NGYA 1TIUA 2GFBA 4XNXL 2KBGA 5C6TL 1LEKB 3EYOB 1W72A 5I1EH 1ZVHA 5HI4D 4FFZL 3ULVL 3QZWA 4EBQL 4R3SA 4G42B 1NCWL 4Q7DA 1ZHNA 4F33B 4JFYA 4FNLH 4XAKE 1LO0H 3CFCL 1FVDA 3C60C 5I30L 1BD2A 5CINL 4TQEL 3MCG1 4V1DE 2VJXA 1EXUB 5J11C 2G9HA 3DV4A 1A6AB 2P46B 1U8OB 1MCWM 4H25B 1M71A 4PRIE 3MNVB 5DFTA 3BKCH 2AJXH 1SJVA 3V5KB 1XGRA 1HHIB 5KOMC 1YYLL 3RGVD 3GBMH 5ACZA 1J0YA 4EOWL 3AB0C 1F42A 1AO7B 4H1LB 5F88A 1AGCA 3ZKQD 3QJFA 2DI7A 5TF1L 1B4RA 3NABH 4QGTA 4UUJA 2F58L 3VD3A 2DWEB 4GG6B 4LPTA 3BIKB 4PTTB 4Y4FB 4LSUH 3MXWH 5H35A 5JLZB 1RUMH 3TCXA 4TYUA 2ZCLL 1IM9A 5EUOE 3EOAB 3OWEA 3JVGA 2GCYA 1OLZA 1S9YB 4M6ML 1F4HA 3MSPA 1ITBB 3BOVA 4GKNA 3ARFA 4MXWL 5M95B 2Q7YA 1WFUA 1H3UA 2EE9A 2V17L 1OAZH 4QCIB 4WV1A 4F58L 3UDWA 3O6LL 5DJAA 5FGSA 4YBLC 5JXAH 3FO9A 4APQA 1AD0A 1DJSA 2YSSA 1QQDB 1NAMB 1XGPB 3H6JA 1AI1L 1JWUA 3T8XA 3T08A 2JIXB 3QQ9C 3SJVA 4H26B 1GOHA 1NMBH 3CD4A 3MRGB 4FG6C 1BFVL 5DJ2B 2NZ9D 4NSKA 4PRPB 5L2KD 2C4FT 2QL1A 3ZHDA 4B5EA 5D6DA 1D9KD 4XAWH 2BVOB 5F96L 2AXFA 3O4LE 1KTRL 3DO3A 2CK2A 4OQ1A 2C7UB 3K2MC 2Q1EA 1ED3B 4IHOB 4G6KL 4OM0H 3JTTB 1DQQB 5FA3B 4JDZA 4W4OC 4PRAA 1FP5A 4N0YH 1DUZB 1Z2KA 4HPYL 4YX2H 4N9GA 4G8IB 3K8LA 1BVKA 3VFOA 2BY2A 4EIGB 4L3ED 4JFEE 1I3GH 1U8PA 5C0EB 1BLNA 4L4VE 2BHUA 2X41A 1T2JA 2C3VA 3D3VE 5HHMD 3D39D 2FSEB 1BQHG 1FDLH 1TCRB 1GYAA 4JFQA 5FF6A 2AJVH 3WUWB 1I8KB 2A83A 4ONHA 4K2UL 3MFFB 3MRQA 3NIFE 4QTIH 3QT2A 2FECL 4NRXA 1BGXH 3GO1L 4ZD3L 5E6YA 3CLFH 3N0PB 4XMLH 2VN4A 3G6JF 5E03A 5E70A 1ACZA 2L4OA 3FT2B 1UA6H 1QR1A 2J8HA 1A4JB 4I5BB 4G6AC 3Q5YA 4ZDHA 1A21A 1NC4D 4MZ3A 1QUNA 1XIWD 1BJ1H 4AM0A 4JR9L 4P9HL 4ZOAA 1WC7B 3PGFL 4KRMB 4OD3L 5MP6L 1PY9A 2R1XA 4ONFH 5BV7H 5DXWA 3CUPB 5C0DB 1J0ZA 1YEEH 5CJXA 2VSCA 5ADPL 1IGFH 3PIQA 4JB9L 1MCNA 1UZ6F 4KUZL 5EOQH 1KTKE 4YBQC 3HS0A 3VXME 1HNFA 2AJZB 1OSZA 4PJFA 2DMCA 4YHNA 1EFQA 3CMOH 3GSWA 4FZEL 3GSUB 1N2RA 4FQHB 4HZLB 4K9EH 1MJUL 2D7PA 1WZ1L 2V9RA 4PJ9D 2J88L 3E2HC 1MJ8H 2PR4H 3HNSH 3Q1SH 3QIUC 4LU5L 5K9KB 3RPIB 5D7SL 1SY6L 3VFUB 2PYEE 5A40E 1CE6B 2C3GA 4E0RA 4NC1C 1DFBH 3LB6D 5TQ0H 5DK0A 4DKFH 3V7AG 5EBWA 1UVQA 3RZCA 1RZJL 4JKWA 3TBYA 4F7CB 4Y89A 4DZ8B 4HCRA 3WO3B 1LO5B 3U4BL 5DD5L 3U0TA 4WO4A 1ZA6A 2O93L 3SE8H 1QSFB 3VCLB 1D5IH 1INQA 3QZWG 4NCC1 4CMHC 4EN3A 4Q74A 1UQSA 1H5BB 3N50A 1JZ6A 2XY2A 5DR5L 5JDSB 3PHQA 4MD4B 3HZKB 3MJ9L 5IM7A 1KB5H 2EDJA 3X14B 1JYNA 1CL7H 3OKEA 3B9EA 3GJFA 3VE0A 1MWAB 3QIWC 4QNPE 1OP5K 3HC3H 4NQED 5SX5K 1U92B 2V7NA 2DQGL 3EJZC 3LH2L 3A67H 1PZ5B 1DBBL 1X6LA 5IESL 4O58H 3VXRA 4NZJA 4OF6A 1LDPH 1RZ7H 4HF5L 2P5WD 4HKJB 3S5LA 4PJCE 4J4PA 4NDMB 4RAVB 5HYJB 3MRRB 5CBAB 3ARDA 3ALPA 3RWGA 5F7UA 1G6RA 2BOBB 1N7ML 3NH7H 4OFDA 2V2TA 1S5IL 1M4KA 4OJFH 1UJTA 3UTTD 3ULUC 4JFXA 2EXYC 3ZKMD 4RISL 2NYYC 1RJLB 3K4ZA 5SWZB 3CFBB 3I6KA 2DM4A 3HCVB 4QT5B 4YO0B 2FEEL 3DUSB 3TNNB 4U6VH 2XQYK 3MV8B 4M6OH 5GQBA 1OSPH 3W9EB 2F5BH 2EDQA 5DI8A 3R8BB 2VDPL 5EO9B 5C09A 1I75A 5CJBA 4S1SH 4ZNCD 2BRRL 2EDXA 4JG1L 3O3EB 1KNOA 4P5TA 5EU6D 5CD5C 1P4IH 1WT5A 2ZCKH 3BKMH 4M62L 5EOTB 1JZ3A 3CH1A 4OLYL 1L9MA 3EDEA 1UB5B 1UKSA 2KZWA 4BFIB 5I6XB 1EJOL 2HVKA 3ROLA 4G8EA 3IVKB 4CW1B 2FNBA 2IBBA 4TVPD 1T1WB 4FP8L 3B2VH 4MQSB 3L7FA 5IV2B 4RAHA 3TYGH 2GJ6A 4URTB 5FOBA 3SQOL 4WGVB 3ILPA 3CVHB 4OFVA 5HPMB 1YNKL 4XPBL 4X9GA 5C9JA 5CGYD 4HK3J 5KANG 1V8HA 3PQYE 1J86A 4LSVL 5LGJB 1RAMA 1GHFL 1NEZA 1RIUH 1U95B 5LXGH 2W91A 3LD8C 4O02H 3V4UH 4Q6IC 4U1HA 1UWEL 2VLJD 5FM5M 3UROR 2CIIB 5F97E 5JHDE 1IE5A 5JOPE 2B2XL 4Z7UA 1JN6B 3VW3L 4LHJB 4RFEB 2V5MA 1EZVX 4JFOA 4ELMA 1MPAL 5F7NC 3WIHH 5IT2L 3C5ZA 4EI5A 5B21A 5L0QC 1NBYB 1FYHB 3EYUL 5F70A 3PHOA 5FO7A 3CDYA 3TVMC 1AR2A 1OTTC 1PLGL 5I66A 3BQUC 1N59B 3WJJA 3BRDA 3MRHA 4JFDE 5E7FA 2ED7A 4PJAA 2YUWA 4YGVA 3SQBA 2CDFA 4N1HB 4PY7A 3NIGE 6FABH 3N1FC 3QWRD 1BX2A 2RB8A 2YXFA 2D4DA 4LSTH 1KIRA 4PTUA 3JWOH 3ARBD 1CXKA 1CGXA 2NX5B 4LQFL 3OAUL 4M7LT 1X4ZA 4J1UB 4KY1H 1T03H 1DQMH 3O3UN 5C70A 3WLBB 2NMSA 1GZPB 1WFNA 1XGTA 3H9YA 1D5ZB 2R0LH 1HEZA 4J3WA 1CI5A 4NKIL 2AV1B 3DBXB 3ZE2F 5TGBA 1MLCB 4WTZA 2A74A 3AU1B 5GZOD 3QUZB 3H42L 5CBEB 2E6PA 4G9FD 2Y6SC 1KIUA 2XKNB 2FD6H 3BHBA 3SDYH 4HBCL 4O5LH 4ZFGL 3W39A 5BZDB 1A02N 4JO4H 1I85C 4L3CB 1DQDL 5J13B 4U6HB 4NT6A 3V0VA 1AY1H 4BZ2H 1P4BL 3TIEA 1T22A 1T89A 2IPTL 4Y4FC 3DMMA 1PYWB 3C6LC 4LAQH 1LD9B 3B9AA 4HIXL 1U8QA 1IILE 2G2RB 2CUHA 2HLAB 2BFVL 4IM8A 4DK6A 5ILTH 1T1XB 1JJUA 3VXOB 3L95A 3GZKA 3U2SA 4RCAA 3AMLA 5FCUL 1A6PA 25C8H 2E27H 5D71H 3M1BB 4F7EB 4GAJH 3N1PC 4UQ3A 2FIRT 1AFVH 3MCLL 2GTWB 2QR0B 3ZTNH 2VMFA 3ECBB 1P5UA 3DTXA 3RVWC 2XZAH 4X7SH 3LPGA 3ARWA 4ZSOE 2RAMA 4XB7A 3P0YL 2W9LA 4KGJA 3T2NL 2DQDL 3EJYC 3UTQB 2BSSB 4JKPH 2C1PA 4MJIE 1EBPA 3T4AA 4E42A 3S5LG 5C9KA 4KUCD 3X3FH 1AE6H 2NXZD 4GG8B 4LAJH 5C0BE 2AK4E 3BP5B 4PJIE 4ZFOB 4WUUA 5F1OB 3RGVB 4XPGH 3L5XL 4L29A 4QRRD 4X6CF 5A1AA 3ILQD 4F80A 2FJGA 5DVMA 1DDHB 5E99H 2R4SH 1GC1C 1KELL 3DI2B 5B39B 4DGIH 5EO0A 2ESVE 2QADD 4JFPA 5D7JA 2XTJE 4JGUA 2NW3B 2W9EH 4LRIA 5E8EB 2IMNA 1DBJH 3G9AB 1CFQA 5C2BH 3WS3B 1QFWH 4RNRB 1F3DH 5LQBL 5DQ9B 3LY6A 3QCUL 3WDIA 3WNOA 4U3XA 3I2CH 4GRWF 4MCYB 4NO0A 2E6QA 3IJSA 2PTVA 3GMNB 3FO2B 3TO2A 1AJ7H 1BQLL 2X9WA 5JOFB 4LF3A 1MHPH 4XRCA 3HN3A 5BCAA 3UJIH 4LKXB 4XPTH 1ZVSA 1FORH 1T80A 3WFDL 1P6FA 3BVNA 4LP4A 3FQUB 2OTWA 4Y5VA 1U93B 2NTFA 2XY1A 3LMJL 2H9GB 5L2KB 2VDMH 1WBXA 5F9WB 1GIGL 4BQCA 1NMAL 4AEFA 4HX1A 1NGXB 1V7NH 4TUJB 3DIFA 1NEZG 1AO7A 1D9KB 5CHNB 2X4TB 4GAYA 4S1DC 4Z0XB 1XMWA 3K46A 1ORSA 4YGAB 4N5EC 1LK3L 4S2SA 1FFOB 1RUQL 5FOJA 5JO5B 2PUQT 3SOBL 4CN1A 1DUYB 1OAQL 3SBWC 2DQEH 1F02I 1TDQA 2A1WL 4P2QE 1JBJA 1S7RB 3NOIA 4NN6B 4UTBH 3STZA 5KAQF 3UTZA 4HIEA 2FO4A 3L3KA 2PXYD 3ABZA 3VXQB 5CKAA 3D25B 2I9LA 4NQXB 3R0NA 5GGSA 2DM7A 3CDGB 5ID0B 1U8MA 2BVYA 3WHE0 3O41B 4RIRA 1HH9B 3KYKL 4L3EB 1AXTH 4DKEL 1CLYL 1ZXQA 3B3IB 4QHMB 2ICEA 1A6VH 4ISVA 5INDB 1FN4B 4LCWA 1G7JA 1Q94A 5HHMB 5TDOB 3D39B 3MODL 3P30L 5FB8B 4Z5RA 3O4OB 5LGKA 2R69H 1OAXL 1KT2B 3IU4L 2V9QA 1EEUA 4MCZA 4KJQC 1TJGL 4WI6A 2Z93A 3QDJD 4W4NA 3RWEB 4Y4HD 3HPJA 2B1HL 4D0CB 4QHLB 3MCKA 3ZKND 2QJDA 5DZOA 5DJ2A 3GK8H 4WRLA 3T0XA 4QGYA 3BP6B 5J9PA 3ZDYE 4D9LH 1CR9L 2BSTB 5E00B 2P24A 3L5HA 4TOYH 4OZGF 1S7WA 1JGDA 12E8H 2C7UA 1NC4B 2LE9A 5KSAA 4NKOB 1U3HD 4U1MA 1XIWB 4WTZG 5C0RH 2ZUQB 1LEGA 3MV9D 1CD0A 1FVEA 3INUH 3J8F7 3BGFC 2NCMA 2WWMD 1JF6A 4L8SC 3H9SA 1T1ZB 3ZL4H 3MLUH 1MCSA 3PNWA 4PP1C 5HPOA 2E8ZA 3PGCA 4OSUH 4GAGH 4IMKA 1JUFB 2GJZA 3K3QA 3O2DA 2HH0H 3RWDB 4OTXL 2I24N 1CF8L 5ID1B 2FIKB 3TN0A 4B7IA 3STBA 4DK3A 4NGHH 4JO3L 1MSPA 3FQWA 4PJ9B 4U1GB 4LKCA 4UNTA 5IVZB 2XQBH 3ULUL 4Y19A 2HT4D 1UKTA 3FN9A 3RWCB 2A73A 4X4XA 2HRPH 3VD4A 2HKHH 4G3YH 3LKQA 2YRZA 1HHKA 1UEYA 4DEPB 2P45B 4U1KB 4IRSA 1I7TA 3OKYA 4R26H 4JZJC 2W0PA 2AEQH 1JWMA 3BN3B 3D0VB 1PKQB 1T5WA 1UJ3A 2IAMA 1GGUA 3UZEA 4PRIA 1ZGLA 1IZKA 2R0KH 2FWOB 4KK8C 1HSAA 3MUGA 4TPRH 4K3DL 3H3BC 1J1XH 3AXLA 1U91A 3E1F1 3NFSH 2ZSVA 4U3HA 4J6RL 4K7PY 5T5NG 1YYMH 3MUY1 4U1JB 3OJDA 3G5YB 1K6QL 5C7XL 2DDQL 2P8MA 2KUTA 5CEXA 4OGAD 5E94B 4Z0BL 5GJSH 3DO7B 3QHFL 3MR9A 5KSVA 1J1PH 4NQEB 5B38A 5E2UH 4MA3B 1JHLH 2IANB 2VL5A 4NC1E 5EUOA 2OL3L 4EZMA 3FHQA 5FECB 3MOQA 2IALA 2ILLA 1SJHB 2P5WB 2ADIA 1CE6A 3EW3B 2CO6B 5I1AA 2IH3A 3RI5K 4XP9L 1MRDL 3QI9A 3UTTB 4PJHB 1EHLH 4GQ9H 4IRJA 2ZOLA 1FZMB 5GS0C 1DN0A 4KUCF 4XBGB 4QRPA 4HD9A 2B4CC 2DB8A 4NUGH 4JN1L 2V6HA 3L3HA 2BNQE 3EDFA 2HKFL 3BMWA 1BQSA 1TTFA 4F3FB 4X7CC 4Q9RL 3BX7C 1YY9C 5GSRB 2QQKH 1QBLH 4WFFE 1UC6A 1JTOA 3O4LA 5B3NA 2GEEA 3RVTC 5EU6B 4L1DA 4NBXB 4RDQG 4O4YL 3WCYA 4YHZL 1ND0A 4A2MA 5BRZB 2R1WB 1PKOA 5J56B 1BF2A 1NLDL 1WZKA 3FHAA 1RZKH 4DVBB 4PRHD 2ED8A 3FB8B 1IEBA 4XNZB 1S7SA 3VMNA 1OVZA 4RMSA 3KHQA 4I9WE 2EDBA 2GSGA 3UPCA 4JFEA 4X5WB 4RAVA 4BFEA 3ULUE 5CWSA 1KCVH 2Y72A 3L3OA 2BVPB 2SEBA 3T0EB 2F9BT 1K8DB 4JFZL 4D9RD 4P3DA 2Q8AL 2BCKB 5IFAL 4JHBA 3SDCC 5DEGA 2DBJA 1MIMH 4Y1AA 1F6LL 5KBNC 1EUTA 2VLJB 4JFHD 5ESAA 1D3CA 3KWWA 4HXAL 1KCKA 4L8CB 4LRNH 2VXQL 1YUHA 2JCCF 5CD3B 5HYSB 5GGTL 5J13C 1R5IB 1C5DA 3ARZA 5J12B 4LOUC 3GHBH 4PV9A 4TUOB 4DVRH 5HJ3B 1WV7T 4Q2ZB 5J1AA 2J1KA 3TJEL 3MRIB 4C56E 3F6IA 3O6FA 3Q6GH 1XZ0A 5HGHB 1RQ5A 3RUGF 2FJFA 3JTSA 1NUDA 3HI6H 4FTVD 4S1RL 3VDAA 3F7YA 5HHOD 2VABA 1JGVL 3O3DB 1VKXB 2DQIL 3BXNB 3KG5A 4RGOH 2P5EE 3KS0H 4RFOH 4MJ6A 4JO1L 1A8JH 3VXMA 1MREL 2ENSA 1IM3B 1EEZA 3ARBB 1A7QL 3S34L 5HI4C 3KYAA 3L3IA 2VXSH 1QACA 4QXTA 5EPMB 4Q9QL 5D7LE 2AQ1A 1FC1A 1ACYL 2P47B 1F3JA 3MZGB 1QPXA 4M5ZL 4P2RD 3RKDC 5ISZA 1I1FB 2HT3D 3RDTD 3QUMA 3ZDXF 1JE6A 4PRDB 3N85H 4CMMB 3VI3F 4ORGA 2W60B 3RGVC 3FQTA 4LEOA 2EYSA 3UZQA 1WWAX 2BXZA 4G9FB 5HGAB 2VTFA 1MHHA 2DYPD 3U36A 2R9HD 4OUUA 1GC1L 5A2FA 3BT2H 3BDYL 3CLEH 1VFOA 1ZT4B 1K3IA 3QFJE 3ULSA 4JZOA 1KTDB 1ONQB 3M17B 5F7HA 1OP3K 4NUJB 4XC1H 1AP2A 5FDYA 5IVOA 4N0CD 5HGBA 4X5LA 4ZUTA 3MRMA 2IPUK 2UWEB 4I77L 3H3PH 5IF0B 3OGOE 3H7LA 1D6EB 2DIJA 2UZXB 1U58A 4CN4A 3O8XC 5L8LB 2HTLD 4ZUSB 4YEEA 2X4UA 2ARJA 1S7VA 1GGIL 1YMME 3LKOA 1KTLB 3VFVA 2VR5A 3VFNB 1M05A 4MWFB 4NFCA 4QRQA 4EUPA 3NCBB 5IQ9B 4WWKC 3WFBL 3WIFA 4PJ7F 1PG7H 3P9MB 1DEEA 4KAQH 2AK1L 1T83C 5EU4A 1G7MA 3IETB 5B38G 3HC4L 3GSQB 4YHIA 5HBBA 2K7QA 3PDDA 2BSRB 5F9WC 3EIFA 3T09A 1CLOH 2AEWA 4X5XA 3R1GH 3QHZH 1A7NH 4LHUD 1R24B 4X4ZA 5FGCE 4C4KT 1OOAA 1JHKH 3U82B 4U1SA 2NXZB 4GG6E 4CDHA 3HAEH 4O2EA 4L3CA 4FXGA 1IFHL 5ICXB 1GRWA 3OKMB 4QRRB 4OIIL 1ETZB 4M1CD 3EZJB 3QH3A 4XCCL 5D72H 3PV6B 4NN6C 1IKNC 4DKFL 1NCCH 2FZ3A 4GXVH 1MFEL 2QADB 2BY3A 4LPUA 3T0BA 3QNZB 3DRQB 5INCA 5C08D 2FX8H 2VDNH 1CICD 2NQCA 4MB3A 4KMLB 1EAPA 3UP1A 2BX5A 1P7KA 2R2EA 1CZ8L 2AI0H 3N9GL 4H5SA 4XP1L 4HS6B 2PO6D 2GTWA 1RHFA 3O4OC 4WGWB 2NY2D 3O9WD 4PRPE 3LIZH 2I9TB 4R97B 3MX0A 3N1GC 1C16A 5I76A 4C58B 4J3UA 5LJYH 1I1RA 3EO0A 5AYUL 3PQYA 4FFVD 4Z7WA 4RMUA 2UYLB 5DEFB 4M6NL 4MAYA 1WBZA 1AGBA 1NFDB 5IEKB 4L4TE 1HHGB 3HLAB 2WAHA 4X4MA 3VFPA 3GSXB 1FRGL 1JPTL 3MBED 5JHDA 4A6YL 1XIWC 4L9LA 4OGYL 5LAXA 3ARTA 4C83B 5BQ7A 1A6WL 3LKPA 2WK2A 1CL7I 3C2SA 2LFGA 2A38A 2M2DA 4QLRA 2O61A 1RJCA 1C5CH 1O7SA 1UZ8B 4KPHH 4MJ5B 4JPIA 5IVXA 5ESVA 5ACLA 2MNUA 1U3JA 3RUGB 1VCAA 3QDGD 4HUKB 4H8WH 4ZAKD 3PP3H 3QFDB 2PXYB 4KGLA 2W0FA 2MCPH 2YUZA 1ZWIB 2M1KA 2NY0D 2ENYA 3RA7L 2XFXB 2AXGB 3HG1E 1ZSDB 3MROA 4PJ9C 4U1GC 5IWLA 3CVIL 2ZOKB 3SDDA 1OARL 1JMZA 1J8HA 2FH8A 4F2MA 5E2TL 3LB6C 2E7MA 3TCLA 1A7PH 3IDXH 5CLTA 5DK2A 4HXBH 5DQDH 4AEHL 4DEPC 4HJGA 4UQ2B 4MAUL 5DHXB 1HWHB 1HSBA 5CEZH 4M93B 1T04B 4M7LH 3ARED 2BDNH 3QDJB 4PRNB 4Y4HB 3FMGL 2EDLA 1Y0LA 5BS0D 5EC1B 1JNLL 5C0AD 2DAVA 2O5ZL 3NA9L 4JN2A 3VGEA 5B22A 2X4PB 4ODHH 2VDQH 3QIBA 1W0VB 3CNKA 2BY1A 4OLVL 4Z7OE 4I2XB 3E6FA 5IROA 3NA4A 4Y5YA 5CEYA 5C0ND 1MF2L 1U3HB 3O2VH 3TPKA 4J12A 2A77L 4ODXA 2YXMA 5IMKB 3MV9B 5EORH 5IBTL 1XF2A 1DBKH 5DFWH 3GSRB 3IFPB 1D6VL 3KPOB 1RZGA 1F11A 1TETL 1UCBH 1FPTH 2AJYH 2HG5A 2B39A 1ZANH 3ZZ1A 1L7IL 4RMQA 1BBDL 1W72H 3IJHA 1J18A 3M8OH 3EGSB 1IGTB 1FN4A 1JF5A 3UBXI 4OF8A 2OS7A 1J88A 4F9LC 4QHNB 5FHAH 2KDGA 3VDCA 4PLJC 1KENH 4PJ7B 1ZT1B 2CLVB 3OKKB 4JHWL 4PBWD 5DJXA 3P0VL 3TA3A 5JW3H 3ZKMC 3ZE0F 3WXWL 3GMPA 4PG2A 2EDTA 5GS0L 1LK2A 4XB8A 1GGBL 4YEFA 2EH7L 2B4CL 1QRND 1NBVL 1BFOB 2DTML 3MLYH 1Z9LA 4EUPG 4TSAL 4D9QE 1C12A 1T1YB 5A43C 1UEMA 3E8UL 3TJHD 3FJTA 3RZWA 2ZSWB 4MJIA 3SE3A 4YAQA 1QO3B 3CSYB 2VOTA 4IOFC 1A7RH 1D5MB 3L1OL 3V5DA 5HI3D 3KYNB 4LLQB 2AK4A 5DEZA 4PJIA 2IQ9L 2VR9A 5KVGL 4XNUH 1FZOB 4AK1A 3P4MA 4PLNC 3CFKA 3BPOB 4ETQA 5FKPA 3VFTA 2F5AH 3NACL 4P23D 3Q48A 3S35X 1ZEAH 2YBRB 4XNZC 3GSNL 4M8QA 2YPKB 2CO7B 3OV6A 1OM3H 2A6IA 3STLB 2A6JB 2F53A 2Z4QA 5GRYA 1A9BA 5IKCB 5SWZE 5D7KE 4AEIH 5I0ZA 3MLWL 3DVFA 2QKIA 3PP4L 5BOZG 5MEQB 5T3ZH 1I9EA 1YPZF 1UH2A 2YD6A 3HZVA 2IEPA 3KLAB 1WQVT 2VZ1A 4KZDL 4XCYA 4BA8A 3TT1H 4NN7B 2X7LA 1RZIA 3OPZL 1LQSR 4BKLA 4N68A 4M1GH 5EZLA 1OPGL 3B5GA 2MMXA 5J12C 4OLWL 5IW6A 1OGTA 4Y7MA 1M7DB 1ODAA 3PDOB 2FWOA 3VXPB 4DGYL 4U7SA 4ENEC 2R0ZH 5M94B 1KJ2B 2E7HA 3IFOB 3SO5A 4MA7L 4R4FH 4U1JA 2H1PH 4ZNEA 1Z9SA 2QQLL 2HJFA 4UU9B 3DSNA 2Z0BA 1SVCP 3WHXA 3BKYL 3EO9H 4ZS6D 1INEL 1GL4B 1G7LA 5FUZL 4CU6A 1KCRL 4U2ZA 1QR4A 5E8PB 4WW1B 4M5YL 3LQZA 3GMMB 4HLZG 4PRHB 4S1QL 5K9JH 1WAAF 2RCSL 4J2XA 4PJDF 1U2HA 1WBYA 2MPAL 5C6PB 3QXAA 4LSRL 1WEJL 3G6JE 3VWKD 1UM4H 3BN9D 3MJ8A 4YDJA 4YPGA 2DF3A 4FRWA 3ES6B 5TDPA 4LBEA 2EC9T 5GZOC 4OCRL 3RFZC 4OZ4B 1RIHH 5JPNA 1Q9LA 1NFIB 3T3MF 5I1CL 3ZLQC 4NQVA 1INDL 1FQ9C 1KB5B 1TZGL 2EZ0D 2FL5A 4GRLD 4F8TA 5IMMB 8CGTA 1NGQL 1FL3A 5F1NA 1YEKL 1TMCB 1GOGA 1TVHA 4X9HA 1ZHKA 3IDGB 1I9RH 1UZ6E 4DFIA 2J4WL 1MCOL 4Y88A 3PL6C 1LP9F 4LDOB 2YPLD 5BXFB 3AMKA 4X6DB 5D6CB 5IHZA 1BOYA 2C4FU 5CJOL 2D0HA 4ZFZA 2NX5E 1MJ7L 3ZMRA 5CJ8A 4FTVB 4BQ6A 3WEXA 5T1DL 2VLRD 4HC1L 4AL8L 3NAAL 2WLZA 1YEDA 4I0PC 3BWAB 3GKWL 1SJEB 4O2CB 2A2QT 2AS5M 1I1YA 5F7YC 2Q86A 1YEJH 4GW5B 4TRPL 2J8UF 3QDMA 4HCRH 1RURL 3FN0L 4G6ML 3MNZA 1A0QL 4YDIL 2RQ8A 5AZEH 5EG6C 3SCMD 1VEOA 4C54A 4P2RB 2XA8H 3MLZL 1IGYA 2WANA 2Y7QB 4RZCA 5E2VH 3RDTB 2OP4H 4IOIB 4LFHG 5MENA 5HDOA 4ACPA 4DUXA 3VFRA 4WUKH 2EEAA 1I4FA 5CP7B 1UKQA 5HYSA 4F7TA 1LO3H 1G7QB 2DYPB 4GOSA 2BRQA 4Q6YA 5FXCH 2K1MA 4NWUH 5L9DL 1R5VB 2OTUA 4KKAC 1UWGL 2JF1A 3GJFH 4LCCC 2F74B 5GRUH 3KPRE 3K2UH 4JPWL 1FFRA 3QUXD 3EOTL 3IKCB 4LLAA 4G7VL 4MNGE 4P2OC 3RWJA 2FATL 2CIKA 4K3JH 2I5YH 2MSPA 2R8SL 2J12B 3MO1B 2QQQA 4FFWC 5DJ8A 4MGXA 3S36X 1IQDB 5CP3A 4QF1A 1KN2H 1AGEB 2BJML 3BP4B 4OLUH 3OF6D 4XZUB 5I8CB 1G1YA 1FBIL 4AMKL 2D7TL 5HHXH 2HTKC 3TT3L 5TPWL 3BUYB 3UBXB 3VWJA 2ZWLT 1TZIA 4OV5B 4P48A 4K94H 1G6RH 4U7MA 3FQNA 4KRLB 4JM2D 5FO9B 4MJ4A 3FAXA 3QIUA 1OY3B 4GW4B 2EECA 3ARXA 3B9KA 3IFLL 3MXVH 5CCKH 2IJ0C 4HFWA 1YPZB 4WW2B 4M7JH 1JK8B 1EA9C 2DQCH 2PTUA 4Z76B 1PVHA 4HH9A 4XCFL 3UZVB 5KVFL 1NAKH 3F58H 3UTSD 5DJYA 4YDVB 3DWTA 4LHUB 4LVHC 4WJ5B 4OCNC 3SGKC 5A2LH 1BFTA 4NRZA 4F37F 1FL6A 1QA9B 3ROOB 1P5VA 3V7MA 2GK2A 1KGCD 2WUBL 2X1QA 1XR9A 3CU1A 2D31B 3HE7C 1IAIM 2JKXA 4KTDH 3W9DB 4UBDD 3HNTH 3QQ3B 4Z7QF 3VRIB 4ZXBA 1VACA 1W2KT 4ZUUA 2PXYC 3A0OA 3QULB 2W9DL 3QIWA 5C08B 4NO5A 4LSPH 5DD1L 1CICB 1GAFH 1S78D 3S3JA 2R2HB 4KMQA 5C07D 1KV3A 3T65A 1F4WH 2NXYC 2X40A 1BIIB 3NCYP 1N4XL 2QSVA 3VMOA 1PG7W 1IAII 4NCDA 1TJIL 2PO6B 2FHCA 3NCJL 4PJXB 4E41D 1QBML 4PJDB 3P4LA 5FDWB 3VXUE 3QNXA 4HV8B 2NY2B 3O9WB 5L2KE 4KVCL 2AKRA 5DD6B 4Y4HC 2R23A 4ETYA 4OCSL 3ZKNC 1HH6A 4PJBF 4G43A 4AJ0A 2AGJL 1P1ZB 2CRMA 5SX4H 4NQCA 1QEWA 4PLKD 4TTDD 5DDHB 5HHPA 4LIQL 1E6JH 4OCWH 1YY8B 3OR7B 4DGVH 1TQBB 3D18B 3QUKA 4GSDL 2X70B 4JKLA 5DVLA 3AY4A 4LEXL 1WTGT 3MBEB 3TO4B 2XRAH 2P43B 2CLZA 4WHYG 1UXSA 2A9NL 5E5MB 1QFPA 5M7QA 1EVUA 4PY8I 4PJGF 3OB8A 1FCGA 5GGUB 3BPCA 5IEHB 3ZO0A 1LP9B 3AAZA 3V4VL 2OK0H 2DKUA 5I8EA 4EXKA 5IIEA 1HXYA 5D9SB 3UO1H 3VDBA 1E4WL 4KQ3H 1F5WA 1YEHH 4HFUL 4KHXL 3RNKA 4EVNA 3IDMB 4WI4A 4C56A 5HHME 4LNVA 2X4RA 3D39E 5K9QG 3FQXA 4ZO8A 4ZAKB 4JHZA 3HE6C 1MHCA 5EOCJ 3C6SB 4JPKL 4P57A 2NY0B 1B6UA 3MRKB 4YE4L 5IJKA 2CD0A 1WZLA 3ZE2E 1JNNL 1A9EA 1CG9B 1T2XA 2CJUH 3MRNA 3WIIL 1C1EL 3MGOA 2WUCH 4GFTB 2V5SA 5EZOH 4DAGL 4MHHG 4GMSH 4Z95L 5IHUL 1MRFL 2P7TA 1LGVA 5C3LD 1M6OB 3AREB 1NEUA 1RFDH 1ZLVH 3P11H 5BS0B 2QHRL 5DD3L 3QISA 3U0WH 5ENWA 5EC2B 4F7PB 3QPQC 4YHKL 4D0DB 5EOCL 5I1IL 1WFTA 2IBZY 2VISA 3DGGB 2RFXA 4X8JB 1W0WB 2NLJB 4CVZA 2DL2A 1G9MC 4PJ8C 2HA1A 4B7LA 4W6YB 4Q0XL 5CIPA 5I2IA 2IG2L 3NFNB 5IOPA 1UT9A 5K33A 1HOCB 1J1OH 4TVPL 1H3GA 4XBPA 3TVMA 4OGAC 5LBSL 3PHSA 3ALXA 4YDLC 4Z7NF 1YECL 5D96B 5GGVL 5HI5C 2BXYA 1IMHC 3WO4B 1NCBL 2Y23A 4KTYA 3LN5A 1T4KA 1OAYH 3TIDB 1DLFH 1EMTL 1SEBB 1JMXA 1T7WA 1GH7A 2KQMA 3Q6FA 3ZT5A 1W0YT 3BE1H 1QVOB 5KVDL 1YC7A 1P84K 3VXSB 4A2LA 3RIAK 3DXAA 5HTSA 5GS1B 1YMMA 5EUKB 3HFMH 5FUOL 1SYVA 4OZIF 1FZJB 4NN7C 3CDCA 1T04A 4XH2B 4O00A 4LLVB 4QWWC 3HI5L 3O0RH 1JV5A 4X7TB 3X13B 4X6CE 5I8KL 4X98B 3ZSTA 1AD9B 1QRNB 3D48R 4LIQE 2OBGA 4KHTH 3KPSE 4NHUB 2ADJB 3IU3B 4G8FA 1DEDA 3BEVA 1ZHBB 4CADB 2HN7A 1I85A 3SKMB 4Y5XB 2N7BA 5IW1B 5GGTA 3S88L 5GGQH 5D5MA 3W2DH 3W5MA 1DL7L 2ZP0T 4XVJL 5DJCA 5JUEL 3C6LA 4XXDA 4K8RH 1OD9A 4GRWE 1NGZA 4QKXB 4YUEH 2H6PA 1XGQB 5EFIA 1HHHA 1VFUA 4MJ2A 5D2LA 3GFUA 1F8TH 1SM3H 5T5FL 3MRFA 5CEZD 3TBVB 4P23B 2VXVL 3KPQA 3WJLC 4JRYA 2O5YL 2YD7A 5F7WC 4IDJH 5E4IA 2AEPL 1FIEA 2EICA 5DHVA 1MQKH 4PB0H 3EYVA 1YQVH 3UTTE 5ERWB 3BIAX 4LCIL 1HQRB 3T0VA 3SO3B 1CD9B 5SV4A 5KW9H 1SBBA 2ZPKH 2FDBP 1HQ4A 1MLBA 1A6TA 1VENA 2LAGB 1A5FH 4HUUB 2VYRE 4M6AA 3DRTB 5KS9F 3UMTA 4P46C 1QFUL 4PJBB 2D03L 4U6YB 4WVRA 2JE8A 1A7BA 3IAGC 5ALCL 1L6XA 3QUYA 1HIML 3WE6B 2IADB 1ES0B 3IXTB 5DRNB 4MX7A 1RUPH 1MFCH 1F58H 3QO0A 2ZSWA 1QO3A 1QSVA 3B43A 1H8SA 3B2UD 2G60H 4LARL 1CU4L 4L4TA 4YXHL 4NZDA 3RHWK 3MV7A 5IFHH 4MA8H 4OBSA 4TVPE 4AQ1B 3B8SA 3JV5A 1BD2D 4WEBH 4PG9A 4M4PA 3FTGA 4G5ZH 3H7BB 1QYGL 1F4YH 2JB6B 1TXKA 1T21A 4R0LA 1E6OL 5HYFA 2HFEB 5L2JB 3AM8C 1PX3A 4M3JA 2B5IC 5BMFL 4MD0B 1ERNA 2IQAB 3I6GA 3MRBA 3MTRA 4QRUA 1J05B 1RZFL 4CL7A 2VLJE 5IHBA 5BJTB 5DWUL 4B0MM 1KN4L 3HG1A 2FJHA 3U0PA 4OGXL 4MNQA 3MRLA 3VWKB 1KLUA 3RDTC 3SN6N 5CZVL 1A6UL 3EHBD 4LSSH 1YDPA 5KG9A 1IM9D 5I1GH 4OZGE 3K74B 4WHCA 5IBLD 3ARFD 3RU8L 3WFZA 4JRWA 2R9HC 4JGMA 1M7DA 4EXPX 1N3NA 4GRLB 3FRUB 1BQUA 3TEUA 2WQ8A 3S96A 1FJ1B 5J57B 5K93A 4JHAL 5JXEC 4AENB 1JP5A 5CS7A 3MV01 1I3RB 3GMLA 3O2DH 1NCDH 4APQD 3SDAA 4XTRD 4DW2L 4ELKA 5HVWA 1P7HL 2YPLB 3T1FB 2JTDA 3SBWA 1ULVA 3PWLB 3SJVD 1SEQH 4UT9H 4OLZL 1M7XA 3BZFB 1XF3B 2QSCH 5DJZB 1I7UB 2XPGA 5T3ZD 4XVTH 1CT8A 1YNLH 2NY4D 4Y2DA 4AT6B 3SE4C 2VLRB 4CBPA 4YHOH 2COQA 3S35L 1K4CA 2E9IA 4P5KA 2DKSA 3O3BA 1I8IA 5GGRA 5KN5B 4WHDA 3I50L 4GQPH 1XH3A 4WI2A 3ZYZA 4MQ7B 4G9FE 2IPKA 4YBHA 5AD0A 3MJ6A 4KVNL 4OZIB 3SCMB 1ZTXL 2IWGA 4KZEH 1RMFL 2OTPA 6CGTA 3FB5B 1P84J 4KK9D 3TP4A 5DUPL 1HZHL 1X7QB 1I8MB 3QCTH 1UCTA 3GI8L 4HS3B 5A2KH 5I1LB 4ALAL 1MCPL 5T33L 3O2WH 3OZ9L 4BZ1H 5C8JA 2R1YA 4PJEF 1VADB 4POUB 5H8DA 3SKJL 2DRUA 4JG0H 4YH6A 1A14H 35C8H 4A6YA 1B9ZA 3QUXB 4HHAA 4OAWA 5E8DL 3HNVL 5DYOB 3V6FB 1HHJA 4L8SA 3WSQL 1UACL 1I8LC 1YEIH 3FOMA 1RPQA 3TNMB 3RAJL 4LDEB 3MLRL 1VFBB 4UV7L 2FR4B 4J3TA 2X42A 2C1OA 3D85B 3FT3B 4O9HL 5EZIL 1IC7L 3O9WC 1A1MB 2AJ3A 4JM2B 3RL2B 5AG9A 4H88L 4OZHA 5IK3B 3DURB 3WMSA 2J2ZA 4YDKL 4LPYA 5B3JF 4DZBA 1DBML 2NY3D 1RJYB 5I17B 3KYMB 4BQ9A 1YMHA 4J23A 4QXWA 2LABA 3IGAA 3NIDF 5LWYH 2D0FA 3KPLB 1F4XH 4UTAL 3MMEA 3UTSB 4MDIA 1BZ7A 2F19H 4BH7B 3HMXL 1S9WA 1MUJA 3FFCA 5ANMA 1G9NC 1Z9OA 2HJLA 4OT1L 3LQAC 4D3CL 4DN4H 3BZEB 4U49A 1IKFL 3FO0L 3HC0B 3BPLB 3U4EA 1FFPB 3IJYB 5DUML 2XACC 1CFVL 1WGOA 4O2FB 3RVUD 3RZCD 2LU7A 2ADFL 1R3LA 1YEFL 1BOGA 1QLRB 1RUKL 1S5HB 4NP4H 2E8YA 5GHWL 5DC0A 4WO4D 1S7XB 2NY0C 2HLFC 1MFAH 3SEPA 5I73B 3CZFA 3R06A 4FQXA 4WEUD 2UVFA 2YD3A 1J12A 4EN3D 5DS8A 2EDOA 4HKZA 4XNXH 5C6TH 1JGUL 4DOHB 2CKNA 4FFZH 3ULVH 4E41B 1HILA 2X44D 4EBQH 1NCWH 5IFJA 3CFCH 3AREC 3AVEA 3C5JA 4ODWA 4X6FB 5I30H 5CINH 4TQEH 2ERJC 1T5XB 5TQ2L 3G6JA 1R6VA 2VZ3A 1IAKB 3PGDA 3PG2A 2E7BA 1G9ML 3PABA 4NC2B 2DLFL 4K07A 1YYLH 4LCYA 1G9EA 3TV3L 3RGHA 4Y2OA 3EFFB 3VXRD 4EOWH 1TZHA 1BJ1J 1TQCC 2HJKA 2UZIL 4KROC 5C0NC 3GB7A 1XCTB 3C09C 4ODBD 3RUGE 4HMCA 1DVFA 1G7PA 4J4PD 1PY4A 4F15B 3ARDD 3OAZH 2G75A 4QTHA 5TF1H 3D5OF 5GSVA 3SDXF 2F58H 4LLWA 3LEXA 3OKOB 4RQQA 5D96C 2OJZL 2WBJA 5DMKB 1XF4A 5JW5A 5HVHC 1EEYB 3OJMB 5JZ7C 4MB4A 1KLGA 4HKBB 2XOTA 3TZVA 2ZCLH 3H0TB 1MIEL 3OAYH 2X1XR 4M6MH 3S36L 3U46B 3FQRB 2GUOB 4V2BA 3TBSA 4MXWH 2FGWL 4YR6A 5IMOA 3ME0A 2DQTL 5C09D 3QO1B 3QDJE 2V17H 2A6KA 5HGDA 3BW9B 4F58H 3GSNA 3O6LH 3ZDXE 3HI1A 4P5TD 5DJDA 3VI3E 1FNHA 4WU5A 3SPVA 1CXLA 2R4RL 1AI1H 4P4RB 2IF7A 3NPZB 4W70A 5E8NA 2ZG3A 4I8DA 1R3KA 3SDCA 3ARYA 1BFVH 2VXTL 5FKAB 2BVUA 2DIAA 4C57C 4AH2A 3JWDC 4MVBD 1KJ2L 4TUKL 2OCFD 4GXUM 3TJHC 5D1XC 3TH2T 1AR1D 1OTSD 3DVGA 3MV9E 1U3YA 1N8ZA 5F96H 2FEDD 4Y5XC 2GJ6D 3TO4A 1EJ6A 3GI9L 5C86A 4ZFFB 4HUWB 5HI3C 1GCFA 3OGCB 3AROA 4NM8L 5IB5A 5L7XH 4G6KH 1N0XL 3M45A 4PJEB 3FZUC 2HT2C 3BEWB 4W6WB 4RMRA 2YD9A 2H8PB 3IS1X 5TF0A 4BQ8A 1ZA3B 4HPYH 1K9TA 3KPRA 5T1MA 4BZYA 3BH8B 2OJEA 1CFSB 1H3VA 1WCBB 1IGJB 4MNGA 5DMGD 4EUPH 4PJ7E 4DWHA 1C08A 2Z31A 5GPRA 4KWUA 1E28A 2Z91A 3LS5L 2DQUL 3C5ZD 3RWHB 4EI5D 4XP4L 5K9OA 2HFFB 4R7DB 5FV1L 1PJ9A 1JPFB 2XZCL 5D2NA 3CFJB 4LLUB 3CIQA 4OI9A 4MYWB 3CSGA 3NCYS 3REVB 4XNQB 2ZJSL 4K2UH 2C3WA 3GO1H 4NYLA 4ZD3H 1GGYA 3BH9A 1X44A 2DQHL 3F7VA 4MNHB 3SKNA 3HZYB 3P73A 2H3NB 2X4OA 2XWJA 4POZC 1X5LA 2X4SB 1KG0A 2WM0A 2GTZA 4JREB 2J6EL 3L3JA 2DJUA 5J3HD 4JR9H 3THML 3PJSA 4P9HH 4OD3H 3PGFH 5GISL 5MP6H 3DARA 1MJJA 3UX9B 5JHLL 2NW2A 1FYTA 5ADPH 4JB9H 4MD5B 2IH1B 3RJDA 4KUZH 3P4OB 2Q8BL 1TVBB 4N0FA 4ZODA 3QXDA 3RWIA 3O8XA 4FZEH 3BPNB 4HIIB 1DZBA 4XVUD 3LN9A 4KK5C 1MJUH 3L6FA 3B5HA 4MXVF 1WZ1H 3BUTA 1B0GB 4UB0L 2J88H 4LU5H 3LKNA 5D7SH 1SY6H 4K7FB 3VWKC 4WWKA 3QWQB 5FGBC 3DMMD 1U8LA 1T66D 5IR1A 1DLHA 1IC5L 1RZJH 1T83A 5F7EL 2W07A 4D8PB 2NY6D 1FNLA 5HVGB 1IQWL 1MI5E 1QLEL 2H26A 1FLRL 3VXUA 4Z6AT 4G80A 5E1AA 5H94A 1YNTA 3U4BH 5DD5H 3ZSSA 4PJFF 4R7NB 1LNUB 3OQ3B 4GRLC 4ZO7A 4NQUA 1DP0A 5FM4A 3RVVC 1T0MA 4PREB 1K8IB 32C2A 3BMVA 4ZQKB 5JOEA 4HLZH 3IDYC 2KQNA 4Z78B 3MJ7B 2YRLA 1NGYB 5F89A 4LVNB 3OXSA 2GFBB 5EN2A 5DR5H 1W72B 1OQOA 4PUBL 3LHPL 3MJ9H 3QZWB 1JGEA 1EIBA 4R3SB 5ADOL 1ZHNB 7FABL 1IKNA 5LGHL 4U05A 3REWA 1FVDB 4PRHE 1BD2B 2MCG1 1AIFA 5HDLA 1WISA 1NL0L 2G9HB 3DV4B 1M71B 4I3GA 4XHJD 2QBWA 1XGRB 1D5XA 2DQGH 1GGTA 3OKLA 3LH2H 1PZUB 4WUUD 1DBBH 5IESH 4J8RA 5ACZB 4OBRA 3OSKA 3SGDH 4HF5H 4RBPH 4D9RE 1CQKA 4HG4K 1U8IA 3U7YL 3ARPA 1HK6A 3FO1A 5F88B 4CGTA 1AGCB 3RX8A 3QJFB 5DD0L 3NGBB 4YIQB 4UUJB 1N7MH 5D7JD 1S5IH 3R0MA 5I9QB 2ORBL 4PRBA 4RGMB 5I8OL 1YJDC 4RISH 4YHYC 1UM5L 3NN8A 5H35B 3T2OA 2DI9A 3BP7A 4UAOC 4POYA 1NCNA 1IM9B 2GCYB 4K8RD 2LQRA 4GKNB 3DVNA 3ARFB 3LRSA 4NO0D 2MFNA 4NWTL 3GMQA 3VGAC 2VDPH 2Q7YB 3RPKA 3MLPA 3T4YA 5JORA 2B0SL 1J11A 3QUXC 2BRRH 4NHCL 4JG1H 4WV1B 2E7LC 1MFDL 4K3EL 5DJAB 4FTVE 1UADC 5HHOE 3FO9B 2FLRT 1IEAA 2QSQA 4OLYH 4APQB 4EQ2A 1AD0B 2YSSB 4NNXA 3T8XB 1JWUB 3TC9A 1EJOH 1JWSA 1IL1A 3SJVB 2VC2L 3KYOA 5I18L 4HAGA 4NSKB 4FP8H 2UUDH 2NY4B 1D5BA 2XXMB 1QLFA 4XNYL 1AO7D 3ZDZF 2AXFB 3SQOH 3BFOA 3ZE0E 2CK0L 4XWOD 1YNKH 4XPBH 3RVXC 3DECA 1QZ1A 5SX4I 3OKDA 1EH9A 2GK0A 2M8XA 2ZKHL 4LSVH 2UY7A 3I9GL 1LO2L 1GHFH 1Y18A 2DS4A 4JDZB 1N0LA 4PRAB 2ARJQ 5DK3A 1UWEH 2CSPA 4N9GB 1V05A 3U7WL 2B2XH 4LVEA 4LP5A 3VW3H 1BVKB 3VFOB 4H0GA 1H9VA 1G9NL 1KJ3L 4K55A 4XI5D 5F1KC 3LQAL 4XNMA 1U8PB 1JHTA 2PF6A 3FRUA 4UOW0 4X6CA 1BLNB 3OJVC 3F12A 1MPAH 3K81A 2LVCA 5IT2H 3BPLC 2C3VB 3UTOA 3KPSA 4LCWD 1UB6A 4J3OC 4GW1A 3EYUH 3MGAA 4XXCC 4QHKI 1XR8A 4JFQB 5FF6B 4UV4L 3I6LD 1PLGH 3X12A 2A83B 3S3PA 3PWLA 4ONHB 1RK1A 1LE9A 3MRQB 1F3DJ 4NRXB 1EBAA 4Z7UF 1S78C 4G6JL 5J7CC 2D9CA 5DURD 3GIVB 5I15L 3P9LA 1YA5A 1QR1B 1KJMA 4ELMF 4ZDHB 4ESKA 4FZ8L 4N1EA 1NLBL 4J7RA 1YPZE 2Z9TA 1AH1A 5KSAD 4LQFH 3OAUH 3TBTA 5T3XL 2F8XC 4FXKA 4AM0B 1F13A 3BI9X 4QOKA 3EO1A 3C9NA 3L5IA 4GS7C 3AS3A 3ISWA 3U7AA 2OZ4L 2R1XB 2VNCA 3H9SD 2H2SD 2W59A 3NMEA 4NKIH 1X5HA 2NY3B 2DI8A 3PIQB 3H42H 3HS0B 1S9XA 2XN9E 1OSZB 1P7QA 4PJFB 1MRCL 4YHNB 2VLKA 3GSWB 4HBCH 3TN0D 4ZFGH 1AKJA 1N2RB 4I0KA 1YC8A 2FYYA 1DQDH 1BJMA 4Y19D 1P4BH 4KRPD 2VLMD 4E5XA 2IPTH 1NDGA 4E0RB 4NFDA 1V3MA 3GRWL 5DK0B 5EBWB 1UVQB 5GRWA 4PD4K 5DYOA 4Z7VA 4HIXH 4MDJA 3D0LA 3L5WA 3SY0A 3TBYB 2J5LB 2BFVH 1Z5LA 4IRSD 1BEYL 1Q72L 4BYHA 1WAAE 4HIHA 5KVMC 4XAKD 4PJDE 3U0TB 2Y07L 3WNMA 1ZA6B 4OLEA 1CGYA 4PB9L 5FCUH 5IQ7L 1W8NA 4PRID 1INQB 4P99A 2E9WA 4DUWA 3D85A 3MCLH 5DJ0A 4EN3B 3BD4A 1UQSB 5A16A 5ABDE 4K3GA 3GMOA 3T3ME 1FSKB 5LKNA 2ATPA 1OWRM 3PHQB 3JBG7 5IM7B 1XGUA 3JWDL 3P0YH 3U30B 3T2NH 2DQDH 3OKEB 4GKZA 4BELD 4HG4J 1FL5A 3GJFB 3VE0B 4P4KC 3AUVA 1BAFL 3VXNA 3AGVA 2ATKA 5IB1A 3LS4L 2V7NB 1CD1A 1LP9E 2FX7L 3EYFA 3L5XH 2MQCA 5EU3A 3VXRB 3PWNB 1CGVA 3KLSA 4CRPA 3PWPA 5GIRA 1U8KA 3S5LB 5DZNA 3QDGE 4FQLL 5F93C 1KELH 3ARDB 4JDVA 4WNQA 3RWGB 3IKKA 1G6RB 2V2TB 3QI9D 1ZLUH 2R29L 4JFXB 3MUJA 2V9TA 4IRJD 1OT1A 5LQBH 3MYJA 4PBVC 4BM7A 3W81A 2J8UE 3MV11 3QCUH 4QRPD 3I6KB 4YNYA 3O6ML 4XMKL 4NO3A 3BDXA 2Z8VC 5DI8B 4JAMA 5T3XE 3T77B 1BQLH 5C09B 5JA9A 4MA1C 2A6DA 2X2YA 1P9MC 3O4LD 2CKBL 2VH5L 4OI8A 1KNOB 4P5TB 5FCSH 5C0AE 3WFDH 3CH1B 1JNHA 5MEPA 3JUYA 4CDGC 1RI8A 2HVKB 3KVQA 3ROLB 4G8EB 4JFFA 3IYLW 1CS6A 3LMJH 4G8GE 2G5BA 3IDJA 1GIGH 1NMAH 3L7FB 1XGYL 4FQQA 2GJ6B 3G04A 5FOBB 1FNGA 1LK3H 4JFED 5E6IA 3ILPB 1RUQH 4O51A 5CP3H 5C9JB 1TJHL 2EC9U 3PL6A 2VITA 3SOBH 1IAIL 5I16A 4PY8J 3TPUA 1OAQH 1I1CA 3ARRA 1NEZB 3RX7A 3VFGL 2A1WH 4U1NA 2WIIA 4Y1AD 1G7IA 4U1HB 3ULVD 4X7FC 4Z7UB 1AQDA 1VGKA 4CVXA 3KYKH 4DKEH 1CLYH 3G5ZA 4JFOB 4I0PA 3UAJD 4ELMB 3BZ4A 4EEEA 1HKLL 3C5ZB 1NMCC 4EI5B 3MODH 5EIQA 3P30H 1QSEA 1CFNA 1QRNE 3QR2A 2LV4A 3PHOB 5EBLA 5FO7B 1OAXH 4LLYA 3HAEA 3O6FD 3IU4H 3JSSA 1VHPA 4NQDE 1TJGH 1OW0C 2B1HH 1NUGA 3B4NA 4JDTL 4XCEA 3MRHB 1MCKA 4PJAB 4YGVB 2VQTA 4NKMA 2CDFB 5DRZA 4PY7B 3MLSL 2EXWC 4N8CL 1BBJA 1BX2B 1CR9H 5IB3A 1WSST 4LVNC 1KIRB 4PTUB 5E4EB 4R4NC 2QV2A 4OLXL 4Z7QE 1A3LL 5BVJA 1QP1A 3QG6A 3IXAA 3BO8A 5I1HL 4LCCA 3KXFE 1VESA 3VFMA 5BZWA 1B0RA 3HZMA 4P2OA 1XGTB 5ISZD 1T20A 5JMOC 1L9NA 1HEZB 3VD9A 1KSRA 4YPJA 4I1NB 5TGBB 1I7RA 2A74B 1RHHA 1N6UA 5DMIL 1C8PA 3OG6B 3BYTA 2EIZA 4OTXH 1H3PL 1ZAGA 2Q3ZA 2B1AL 5AUMA 3SGEH 3V6ZA 1G6VK 1CF8H 5HY9A 4PD4J 1E4XL 3BHBB 3W39B 4JO3H 3NGBC 4LLMA 4PJBE 2IGFL 3DX6A 4NT6B 3V0VB 2EYTA 3ULUH 1YJDL 3TIEB 1T22B 4PR5A 3DMMB 3KR3L 4WFEE 3EHBC 1BMGA 3TWCL 2MTPA 3U6RA 2NY6B 1BQHA 4LVOB 1U8QB 5FO8A 1HINL 4NNPL 5IBLC 2APFA 4PJGE 4HEPG 5CSBA 4DTGL 3L95B 2JCCA 1EHXA 3U2SB 3UC0L 2I25N 4KJYA 5E8OA 1MNUL 1A2YA 2EDEA 3BGMA 4UQ3B 1H0DA 3K8KA 2DD8L 4CKVX 4K3DH 1GZQA 3MUZ1 4XTRC 1KPRA 1FE8L 1U8HA 3DTXB 4J6RH 4YHPA 3BIBX 3N1MC 1RY7B 3HE7A 3VXTA 5AAWA 3F5WA 1K6QH 5C7XH 2DDQH 1JRHI 4Z0BH 3W0WA 2VL4A 3QHFH 4OIAA 2XV6B 8FABA 2C1PB 2YS4A 2OMNA 2NY4C 2EYRA 4E42B 5JIHA 3KS0J 2VB5A 3QSKB 4WUUB 2OL3H 1L7TL 4L29B 1PX4A 3IRPX 4YQXL 1EERB 3VD5A 3P77A 5FA4A 3JXAA 3TFKC 3LV3A 2NNAA 3PXJA 4XP9H 5EO0B 1MRDH 4P3CL 4JFPB 2C4XA 5D7JB 4GRMA 1JPSL 1T3FA 2DN7A 3BESR 5HHQA 1J9CT 1CFQB 4KTEL 2EDYA 1HNGA 3EKCA 5CIPH 1RVFL 4JLRA 4X6BA 1KLFA 4JN1H 4U2YA 4NO0B 2HKFH 3IJSB 1UH3A 4Z7NE 4Q9RH 3TO2B 5HDQL 3HMXA 4LF3B 3RI5F 4XRCB 1EAJA 4RA0C 7CGTA 4IMLA 1FCCA 1ZVSB 4PBXA 4Q9CA 3OHXA 2H2PC 3QXVA 1I9IL 3V0AC 1V3KA 4O4YH 5CGTA 5TH2A 4WI3A 4YHZH 3BVNB 3PQYD 5F1IA 3OG4B 2OTWB 4MAYD 4Y5VB 3U1SL 1NLDH 3IF1A 2NTFB 2C26A 3WKNA 3W11D 1OF2A 1U0QA 1WBXB 3HE6A 3TBWA 4NFBA 3RL1A 5JHDD 4HX1B 5DA4A 4OZIE 3DIFB 4L4JA 2VZTA 3D2UA 3N06B 4GAYB 4YK4C 4TULL 4D0BA 1ORSB 4FQCL 1UFUA 4S2SB 3GBLA 2VQ1A 2VO5A 4YIQA 1S8DA 2NY3C 4JY6A 4JFZH 2Q8AH 3HPLA 5IFAH 4OKVA 1WWWX 3STZB 2DM3A 1QFHA 3UTZB 4HIEB 2FO4B 4HXAH 3L3KB 3NZHL 2VXQH 4W81A 2I9LB 5GGSB 2JELL 1U8MB 5GGTH 4RIRB 2WQRA 3SDDD 3HAEG 1I1AA 1J8HD 2ICEB 5SWSE 3MACL 4PJ8A 4ISVB 1J10A 1NDMA 3WFHA 4LCWB 1G7JB 1Q94B 2AQ3A 4ODSL 3RVUC 5F44A 3RZCC 4Z5RB 3TJEH 1JCKA 1KFAL 1EGJL 4QRTA 4MCZB 4UT7L 3I84A 2Z93B 5E56A 4JJ5A 3HPJB 4WO4C 3MCKB 4S1RH 5DHVH 1FG2A 3WKML 1JGVH 5J9PB 4QRSA 3KHOA 5DURB 2DQIH 5D1ZC 3P3YA 1AXSA 3QIBD 2P24B 4JO1H 1MREH 5JIPA 1S7WB 1A7QH 1JGDB 1FSKC 4X99A 5B8CC 2Y5TA 3S34H 5KSAB 5KS9E 1P53A 4U1MB 4HMDA 3ARSA 2VWEC 4Q9QH 1ACYH 1G0XA 3HA0A 1LEGB 1FVEB 4M5ZH 2D4FA 2BP3A 3H9SB 3PNWB 1MCDA 3PGCB 5D8JL 4MLSA 4RX4A 3WL9A 4BSJA 2GJZB 3C08L 4OUOA 2EC8A 1KGCE 1TVDA 1MI5A 4PS4L 3ZKXC 1KC5L 1GC1H 3TN0B 4LFHD 3BDYH 2CRYA 5EWIL 4ZPVA 2YA0A 4FMKA 3GEWB 3FQWB 4LKCB 4Y19B 1PFCA 5BOPA 4KRPB 4XGZA 3TA3D 1KXQE 4PP2B 2A73B 3LZFL 3DYOA 1SYSA 4X4XB 2EIEA 1GSMA 4I77H 1AGDA 5C07E 1JTPA 3LKQB 1HHKB 3HR6A 4WFGD 4PGJA 2XG5A 4IRSB 1I7TB 4LMQI 1Y6NR 5A3ID 4DOHE 3GIVA 3DX9A 1JWMB 4GMTL 5J1SC 1MHEA 3LKSA 2EKSA 4N90D 1GGIH 1FO0L 1T5WB 1UJ3B 2IAMB 4MJID 4L8BA 4PRIB 1ZGLB 1F90L 4ONGL 3WFBH 5JQ6L 1HSAB 2AK4D 3MUGB 4HT1L 2FECI 1OAKL 4UILL 3CH8A 2AK1H 1U91B 3AXLB 2ZSVB 2YUXA 3EYQD 4AIZA 3HC4H 5DT1L 3OJDB 2P8MB 1F97A 1KUMA 3IAQA 5CEXB 4MVBC 4WEMB 5H2BA 4P46A 1OAUL 1KOAA 3MR9B 5KSVB 3MA7A 3VJ6A 1AR1C 4ZPTA 5B38B 5ITBL 5D4QA 4HQQL 2W38A 2VL5B 2F53D 1FGVL 1REIA 1IFHH 1Z0MA 5EUOB 1CE1L 4OIIH 3GSVA 4WI9A 1SVZA 4NJ9L 2IALB 1E0OB 3CCHA 2ADIB 1FIGL 3CAFA 3P4NA 1GGCL 4L5FL 3HRZA 4XCCH 3WS6C 2VE6A 3LAFA 5I1AB 1T2QL 1MCLA 2IH3B 2MHAA 2J6EA 2CR3A 1A1OA 1MFEH 2WBWB 1BIHA 5D1QC 1CFTA 3WXVL 3QI9B 5DMGC 1ZHLA 3UYOD 3ZT7A 3QEQE 2WWKO 1A3RL 1MCHA 5E0QA 4GLRH 4IRJB 2ZOLB 2WINA 4OKDA 1DN0B 3RTQC 1CZ8H 3N9GH 3AM8A 4QRPB 3C5ZC 4XP1H 4UT6L 4K7PX 2ZCHL 1ZKAA 5IG7A 1BZ9A 1VGEL 4R9HA 3L3HB 4EDXA 1KIPA 4AG4L 1KXVC 2A0LC 4OV6F 3O4LB 5DFVD 3MOBL 4X9FA 1T0NA 3GJFK 5AYUH 3KNBA 1ND0B 3HHRB 2NY1D 5CMAA 4M6NH 4PJEE 5E4EC 4HGWA 3ARUA 4KJPC 2IAND 1VB9A 1NQBA 2GY5A 3GHEL 1FRGH 1JPTH 1BECA 2VZSA 1KPUA 4A6YH 4OGYH 4F9PA 4UIMA 1IEBB 1A6WH 3PWNA 3FOLA 1S7SB 5D7IA 4R2GD 3DJ9A 2GSGB 3WN5B 5JXEA 4JFEB 3DNKA