3B83A

Computer-based redesign of a beta sandwich protein suggests that extensive negative design is not required for de novo beta sheet design.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
95
structure length
95
Chain Sequence
MLQPPFNIKVTNITLTTAVVTWQPPILPIEGILVTFGRKNDPSDETTVDLTSSITSLTLTNLEPNTTYEIRIVARNGQQYSPPVSTTFTTGSLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computer-Based Redesign of a beta Sandwich Protein Suggests that Extensive Negative Design Is Not Required for De Novo beta Sheet Design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
molecule keywords TEN-D3
total genus 13
structure length 95
sequence length 95
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3b83A00
5J6GA 3H9SE 1F97A 1U91A 2NLJA 1KCKA 1I7ZA 4K7PL 1ZA3B 3F7YB 3DO7A 2CKBA 3EDFA 1DQJB 5I16B 3PWNA 5IF0B 1QZ1A 5ITFB 4O02H 2UUDH 4TSBH 3BYYA 1YUHB 1EH9A 4JR9H 2NXZB 1ITBB 2CMRH 3DI3B 3DVNA 3SGDI 1EEZB 3ZYIA 3UPCA 1W72B 2A6KA 1U8KB 2ATPA 3KPSE 1UQSA 3BPNC 2MCG1 3B5HA 1MCNA 3MRKB 4OQTH 3U7WH 3P73A 4G8GE 2DYPB 5IEKB 2X2YA 3FRPG 3WLBB 1NFDB 3V7MA 2NY5H 1D5MB 4GAYB 4PJ7E 4S0SD 5E00A 5EZLB 1CDIA 3MA7B 4RNRA 5DUPH 4XMPH 1NFDE 3BUYA 4ZXBC 1F4XL 1YY8B 2LFGA 2DLFH 4POZD 3D3VE 2YKLH 3OL2A 2C7UA 3O3BB 4HKXB 3A6BL 1AO7B 1CFQA 1T1XA 4NM8H 5CILL 4NO0D 4S10A 4GBXC 2FJHA 1BVKA 3O2DA 3RDTA 1HSBB 1ONQB 3K74B 4S1SH 1FZMA 3DGGB 4F7EB 1TENA 2V9TA 1OPGL 4LARL 1VGEL 1MCOH 3OB0K 4MLIA 2COQA 4KDVA 4G6FB 1XF2B 2NNAB 4KUZH 4QHMB 1UCBH 2EECA 3LS5H 5D7LD 2JE8A 4JY6B 3UMTA 3PQYB 4JG0H 3BIBX 5FGSA 1Z2KA 2D7QA 3KG5A 3T8XB 2DYPA 3OAZK 3I85A 1CGVA 3EO1A 3VXMA 12E8H 4G8FB 2YZ1A 4XXDB 3T1FA 4LNVA 2W65B 4Y2OA 4YHPA 1I7UB 1QBMH 2ZJSH 4HKJA 3WIHL 4LP5A 5C0BA 1P2CB 3VXTA 4LCYB 3QUMH 4JANA 5KVGL 4HS8L 2VSCA 3GSVB 3FO0L 4BZ1H 2OTPA 3QEGL 2DQCH 3OWEA 1E28A 2DQIH 1YEGL 3Q5YA 4KJYB 1YQ2A 4RA3A 2VAJA 5ITBL 1CN4A 4P5KB 1OAKH 4ZUSB 3L5WA 5F9OH 2VXUH 3VWKD 5GGVY 5CD5C 1BWWA 2VQTA 5BW7A 5LGJA 3P77A 1N5YL 3UBXB 1HK6A 4GMTL 4LKCA 5DJ0B 3RL2A 2VISB 1H5BB 3C87A 3F58L 2V2TB 3K8LA 1DQMH 1NBYA 3VE0A 3FB7A 4LSUL 4P5TC 4F2MA 3V5KB 3MRQB 5K9OA 4ZG1A 3GMMB 3O2VH 2B20A 5HGGS 4OD2A 4CN1A 3MRLB 5TFSL 4MXVF 3SDDA 1UJTA 2WP3T 2AV7A 5I2IA 1V7NH 2W9LA 3WXWH 1LP9B 5F7LB 2CK0L 2NY3D 1ACZA 3GSVA 1CU4L 1AO7D 4KI5C 3L5IA 3LEVH 1QYGL 1LNUB 5ISZA 1ZHKA 4GSDL 1U8PB 5CEZH 3QXAB 3QA3B 3FB8A 2V7HA 4OLUL 5I8CA 2H26A 5DC0A 4L4VA 4P59H 1E4WL 2ZUQB 4UB0H 3V5DA 4FQIL 3WLBA 3FO2B 2WNGA 5GSRA 4DKFL 4YHOL 4M3JA 2FD6L 1BJ1H 4W6WB 3X3GL 4HXAL 4WGWB 3MLUL 2DM7A 1N6QL 1FC2D 3I3BA 4F2MB 5SWZA 1B0GB 1MWAH 1U95B 1F6LL 1HOCA 1IKFH 4JKKA 4XVTH 4FQQA 5D1QD 4PJAF 3FO1B 4Z78A 1Z6JT 2NXZD 4HKXA 4MNQA 4OCRH 5DI8B 2ARJQ 5HYEA 1PG7W 5JOPD 1IGFH 1FL3A 2WINA 3VFOA 3EOBA 1B0WA 1VEOA 4NZUH 4F37F 5K9KA 3SGKC 1F4AA 3DWTA 3QJFA 1BFVL 1ZS8B 1KCSH 4YDJB 4YPJA 2Q86B 2XWTB 3KPNB 5HDQH 5B22A 2DLTA 5F7UA 2O5XH 5I1JL 5E08L 3CFEB 4U6XB 3VXRB 1KPUB 3G6DL 3KPPB 2GTWB 3LMJL 4MA7L 3G08A 1KB5A 1JCKA 3L1OL 4Z95L 1RZ8A 5IGXH 3K4DA 1TDQA 3IVKB 4K3DL 4QWWD 2IBZY 4PRBB 1TVHA 3C60D 3FB5B 2ENSA 3QRGH 4MWFB 5D7IA 2RFXA 1GHFL 4JFED 2E6PA 4X98A 3FTGB 4QNPE 3IETA 1R5VA 1GVIA 1PG7X 1XR8B 3FFDB 1KCUH 5D9SA 4N1EA 5IW1B 5GGQH 3TN0D 4GXVH 4PUBH 2P45B 3HUJF 3UAJC 3D39A 1MHHB 1DQQB 2E27L 2GITA 4MCYA 3DETD 4GJTB 3HE7B 4XBEL 4FFVD 2R2BA 4XP1H 5KVDH 3VGEA 5FYLL 5T1LA 4Y16B 1ZGLB 4H88H 2Z8SA 4UIKL 1A9EB 2D31A 5I1CL 3QQ3A 2QEJA 1RUAH 1WWWX 3QDJE 3S5LB 4NQEE 5IVXE 1QSFD 4WI7A 4XP6L 4Q9CA 3BP5B 2WWMD 1KB9J 1MCEA 2FX8L 3SGEH 1FFNB 4HCRA 4LFHG 3PE9A 5T1DH 1M05A 5L8KB 3TO2B 4J3WA 3D18B 3I84A 2JJWA 3VXPA 3RHWK 4L5FL 1UH2A 1IEBA 1X5JA 3P40A 3OKNB 1GZPA 2ZCHH 1MH5A 2Q76B 5C07D 5GGVH 1JGDA 4XWGH 4OAWA 5JIHA 2OR7A 3FT3B 3DUUB 4JPKL 2EE6A 2IQ9H 2VZ3A 3O8XB 4OCXL 5BRZA 3UTZB 3KWWA 3RFZC 2VITB 4IRJA 2EZ0C 1A7PH 4R4FH 1J5OH 5TQ0H 3DX9B 2FIKA 3OAYH 4C58B 4XPTL 5F9WC 1IKNC 2UUDK 4PV9B 4HFUL 1IC7H 3LQZB 3NMEA 5FUZH 4PRPD 2MKWA 3REWB 4ZNEE 1EZVX 2J8OA 1IC5L 3SN6N 5EG6C 2WWKT 2UVFA 5CZXC 5J7CC 1SY6A 3VFPA 3BI9X 1XMWA 5DZLA 5C0NC 2PXYD 2VDLH 3DBXB 4HG4K 2R0LH 4JKLA 5BQ7A 1TIUA 2DQHL 5CP3A 5IKCB 3BH9A 4CDGC 2BRQA 5C08E 1R3LB 4MQSB 1T6WA 1X4YA 1G0YR 3PL6D 4M8QA 4JDVA 3MOAL 1TTFA 4QKXB 2AJZB 4Q6IA 4O9HL 4YBQC 4U1SA 5D7KE 1JUFB 1OWWA 3DV4A 1AIFA 4OZIF 2NY6B 5DYOA 4D0DB 5F7YC 1ES0B 2DIAA 5HI5D 2G5BB 4M5YH 4DTGL 3QNZB 6FABL 3CLEH 1BMGA 4LSVL 4ONHA 4V2CB 5F93C 4WJ5B 2P5ED 3NCCB 3V0AC 1P4IH 3O8XD 5IIEA 5K93A 4PRHB 3IVKA 3RVTC 2LTQC 5D2LB 3SKMB 3UTTA 5I0ZA 5F3BB 3VFPB 1A7NL 3TN0C 1HKLL 4C4KO 2CRMA 3DUSA 1I9IL 3X12B 8FABB 4UBDD 1NKRA 1IM3A 5BV7C 1AQKH 4YQXH 3T08A 2MQCA 2NY6C 3M17A 3MXVL 5EIVA 3RNQA 3B2UD 3UO1L 3GNMH 5MEND 3ZKXC 1ZVSB 3P30L 5I17B 4YJZL 5AD0B 2Y7QA 4QHLB 5FKPA 3QJHA 1QSFB 4PGCB 1AGCB 1LK3H 1NJ9A 3QXDB 2UY6A 4G7VL 5TQ2H 1EV2E 5D1ZB 1EZVY 1G7PA 3KNBA 4NN6C 4O2FA 4XNYH 4L4TA 1GGIL 4N1HB 2DQUH 1ZA6B 1S9YB 1D5BA 3EFDL 1U8OA 1RIHL 2IH3B 1X5YA 4NFDA 1XR9A 4KVCL 3TH2T 5I1IL 1TZHA 1A02N 2IG2L 2DQEH 2VDPL 3FO9B 3ARUA 5DLML 2OL3H 1MVUA 4GBXD 4QNPF 3KLHC 4QXTA 1KJ2A 4Q6YA 2CDEB 3C60B 5IG7A 2FRGP 3W0WE 5FUOH 1WF5A 1EX0A 1TZGH 3AS3A 4I3GA 1DTUA 1NCWL 4PP2B 1XGYL 4Z76B 1U8QA 4M7KH 5ADOL 4PRNA 4N8CL 2VLRD 1Q72L 3ZE2E 2D03H 5BMFH 3BP4A 4FNLL 1I8IA 5F96L 5IB1B 4P2RD 5IVXF 5CBEB 4XP9L 1I75A 1HI6A 5B39A 1LO5A 3VG9C 4OCYH 2OXHA 1BQUA 4GLRH 3UDWC 5ILTH 1KLUA 4MDIA 2AERT 1UM4H 2CH8A 2DQJL 2HG5B 4PLJC 2R0ZL 2JK5B 4NOBA 5HJ3A 3OGCB 1T1WA 5AYUL 4NKDB 5FM4A 5E94B 3G9VA 1YMMB 3IJYA 1L0YA 4DFIA 1KEGL 4IHOA 1A3RL 3V6OA 2IANA 1QP1A 2CIKB 3H0TB 3QUZA 1NBZA 3GO1L 1WIPA 4MA3B 4OD2B 2A6IB 4IRZL 2ED9A 4JPWH 3H3BC 2ZSWA 5FB8B 5C6TH 3GBLA 5D71L 2GT9A 1BQSA 3DPBA 3NCFB 5HGHA 1EFXD 3ARZA 1MRFL 1JNJA 2Q7YB 3N1QC 1VPOL 1HHIB 2A74A 5EU5A 3HPJB 5ANME 5D1XA 2E7MA 3WIIL 2BVQA 4QRUB 4U1MA 5HPOA 3GRWL 1NEZG 3KXFD 2WLYA 4L9LA 2OK0H 5DEZA 1U3HC 2PETA 1GL4B 1L9NA 1OGAA 5D7IF 3EO9H 1OAQL 1U95A 1BZ9A 4WI9A 4QXWA 3RTQA 3D3VB 3TZVB 5TF1L 4N0FA 3ZKND 1CL7H 1WGOA 5MI0B 1PYWB 5SWZB 3QIUD 1A7QL 1KTLA 3LDBB 3UJIH 5IHZB 4ZTOL 5ABDE 3MGTB 4YDIL 4UT9L 4FTVB 3SE3A 3O41B 1KEMH 5F1SA 4TTDD 2GUOA 3RA7L 5LKNA 3O4LE 4QHKJ 2B7DT 5HHPB 3IDJA 3KPSB 3HI1B 2MMXA 4OTXH 1HWHB 1XCTB 2GJJA 1T22A 3M8OH 4HGMA 4MJIB 4R96A 3HPJA 1RUML 4NM4L 2BNQD 3VXOB 3RWCB 1XAUA 3QWQB 4ACPA 5E2TH 4PJHF 5CFHA 3QB7C 4NBZB 5DRZB 2VXQH 4HIXH 4K94H 3BHBA 2HT3D 3JWOL 1A1NB 1RULL 1RZ8B 5KW9L 1D5IH 3RTQD 3ULVF 2X4SB 2EYTA 5CGYD 3O6LH 3BIKB 4DKEH 1IILE 4PRDA 2XQBL 4Y0GA 3HC3L 2HKHH 1CLOH 1W8OA 5GISH 3WNNA 3VA6A 3GGWA 4U6VH 1P1ZA 7FABH 5LGKA 3PDGA 2EDLA 4X4MA 4PJBE 3X13A 1FO0L 1R5VB 2HWZL 2AV1B 2FIRT 4ZFGH 4QRPE 1JZ5A 2A73B 5T3ZH 1FLRL 1PY4A 1OTTD 5C0CD 1KJ2H 1ND0B 4FQXB 2DBLH 2NTSP 1H8SA 1ONQA 3GSUB 1NANH 5GGRB 3U9UB 4LCWD 1T21A 2A6JB 6CGTA 4MNHB 3AC0A 4ONGL 2G2RA 4JO2L 4PJ9D 5EC2B 1TVBB 4Y8DC 4H1LA 3LN5A 3Q2CA 3NACL 2KPNA 2YA2A 1MELA 1W72L 3VXNB 3FMGH 3IGAA 4XWOC 1DLHB 4F58L 2X4TA 4NRYA 5JNYA 1FJ1B 3WJLA 3U1SH 5FGBA 3MV9B 5C86A 1N7MH 2CUHA 1E27B 3NFPB 4OZHF 3WIFA 3H9SD 3KPRB 2IALB 3WFEL 5FA4B 5I1AB 1CDGA 3ECBA 2UY7A 3X3FL 1H3XA 4HV8B 4BFEA 4HS6A 3VI4E 1UXSB 1YMMD 1VDGA 4MVBD 2E7BA 1MJJB 3S3PA 1UB5A 1XF3B 1RU9L 1IQWL 1ZANL 5FXCH 3P4LA 3H3PL 3ZO0A 1FVCA 4J4PD 3FONB 5A16B 4HT1H 1HQ4A 2XKSA 2V7NB 3U36A 4ZDHB 4WNQA 2RBLA 4AL8L 1DDHA 2SEBA 2J8UA 4ONOA 4P2RB 2VWEC 3VXUA 4JREC 1KTLB 5HVGB 4JKMA 1ADQH 1ORQB 5KVFL 1WSST 2OI9C 2BJMH 4RZCB 5FCUH 3O41A 3WS6A 3Q6GH 3QZWB 1JP5A 1IAII 2AV7B 4PD4J 3FJTA 4F7TA 4C56A 2NMSA 3L9RA 3RPIA 3UPRB 5E2VL 4HIHB 2PXYC 4LSTH 1MEXH 1UKQA 2DKSA 3HMWH 4GBXB 4G6MH 5HYFA 3OR6B 2ZOKB 1U6AL 3HPLA 2DICA 3C5ZA 3KPMA 1CVRA 3QIWD 1IGTA 2BVPB 2CDFA 4XP4H 1MI5D 3KJ4C 1YNLH 2Z31D 4WHTA 4MJIE 3DX8A 1AQDA 5ERWB 1HEZB 3MLPA 4PJFF 3U7YH 3RNQB 1DP0A 2Z4QB 5I74C 5IB2B 3PGFL 1T04B 2KZ1B 1EXUB 4JO4H 2X4UA 4XNUL 3F7PC 5JW5B 3L7FA 3VFTA 3DX6A 5ICXB 4L4TB 5D6DC 3EAKA 2A83B 1G7HA 4WI8A 5EO9B 2LQRA 1CIDA 2IBGA 4RRPA 3S35L 3KR3H 3PP4H 1UKSA 2ZCKH 4NQDB 1Z9MA 4JFQA 1F8TL 2B0SH 4W4OC 1CT8A 2YWYA 1MFCH 3TJHC 5CJOH 2XTJE 3PWJB 3LD8B 1A6TB 3FO9A 5E8PA 5LBSH 1T2QL 3MGOA 3IDIA 3MJGX 4Y2DB 1WISA 1EO7A 4EBQH 2FATH 4LRIC 5EDXA 5DC4B 3OJ2C 5J1AB 1DJSA 2VZVA 2HFGH 3P9WB 2DMKA 5EZLA 3GHEL 1FNFA 5JOPE 1ZLUK 5JZ7D 2A9MH 4K8RL 1T66C 4KC3B 2X05A 3QI9C 2Q8AH 3NN8A 4PRNB 1W0WB 4QXTB 3RDTC 4PJIF 1CD9B 1G9NC 1CDUA 2QSVA 5DJCA 2IFGA 5D1ZA 4XCFH 4HDIA 4M93B 1BX2A 1GOHA 2EC9U 3BZFA 4H20H 1XGTB 5LQBH 3PL6B 5D7JB 3ARGC 4FFWD 3QXWA 4ELME 3MRCA 4QWWC 2HVKA 3GHBL 2Z8WC 4K8RD 4QT5B 4M8VA 2EKSA 1S7UA 2V6HA 3MRMB 2XQYG 3HI5L 4PV8B 3O3AB 5DFTA 4L3CB 5IBUG 4R3SB 3BO8B 3EJYD 2Z35A 4EXPX 4PJIB 4QGTA 5EA0L 5E7FA 5JHDD 5IM7A 4BZ2H 1UWEL 2AEWA 1G9EA 4EI5D 5JR1H 4YHIB 4MDJB 2VTFA 4JVUA 3HC4H 4L4VD 5J1AA 2I9TB 3V79C 5ESQA 1FFNA 3L5XL 4QXGL 4OGXH 5C9JA 5HXMA 2VERN 3DHJA 3WKML 5K9JL 1QO3A 2X9XA 3IFLH 3VXPB 1YUHA 5D1QC 1T5WB 1C7TA 3BAEH 4MA3A 3LH2H 1ZHBB 4PD4K 2X7LA 5DFWH 3UBXI 3ARDB 1Q9LA 5JQHC 3ALPA 4XCCH 4C57C 1RUPL 1QSFE 2FWOB 4PGDA 1ZLSL 4AJ0A 2F8OA 4L1HA 2ILLA 1SM3H 2EH8L 3CC5B 5KSUA 2DTSA 2BFVL 4Z7OE 3CH1A 4IMKC 4KPHH 4CU7A 2CXGA 3VGDA 5J12C 1Q9KA 3U0WH 2R69H 4I4WA 3T0EA 3SDCA 3DV6A 2R8SH 5IP4A 4JO1L 4MX7A 4Y16D 4F57H 2OJEA 1FNGA 1AGDA 3GI8L 4MDJA 5I9QC 3ULVD 4YE4L 1CD1B 4FN0A 3RX8A 2VDOL 5I6XB 2X4UB 1KTRL 5I1HH 1XIWB 3GJFH 1A3QA 4GRLA 1K4DB 4GG6A 1QLRA 5EIIB 1O0VA 4JM4H 5H94A 2AJZA 4YEEA 3G5YB 3ILPA 5E99H 3SE8L 3MRGB 1X5GA 2N1KA 2YBRB 3OX8B 5T3XL 2E7HA 3DYOA 1IM9A 5E8EA 1CLYH 1CDHA 3EYUL 2DF3A 3L7EB 4ZUVA 1RD6A 1Z9SA 3MRBB 5JO5B 4Q97A 3F7VA 4HUVA 2H26B 4RGOH 3HE7C 3IS0X 3GBMH 4JY6A 1T89A 3P9MB 4WDIA 4NT6A 3GMNB 5E9DA 2R0WH 3VWJB 3DVIA 1X5ZA 1IGJA 1CGUA 4A2LA 3HC0A 1J87A 3MRIA 4GKSA 5CD3B 4XZUA 5GJTL 3VXRD 4EI5A 3ZDZF 4PJ9A 2BSSB 4Y4KB 3AB0C 4LGPB 4F8QA 5DWUL 4P3DB 1T3FB 1GGCH 1SJEA 4Z7WB 3WLWD 4OLYH 3D87B 1JNLL 1HOCB 1W0WA 4ZODA 1A4JB 2JIXD 5CEZE 2JCCE 4GXUN 2QHRL 3PG2A 1RK1B 1VFAA 1EHAA 3N06B 3VXSD 1QTYT 4G43B 1MFEL 3HZYA 2VH5H 2ICWB 3MLXL 1JZ7A 2MNUA 2A6DA 5A3IC 3QJFB 4M6OH 2VXTH 3U46A 1P84J 2V7HB 3EHBD 1OTSC 4Y5YA 1H15B 4LQFL 4G9FA 1L9MA 4P2OC 4OLZL 3E1F1 4R4BB 3WS6C 2J8UF 3VXQA 4AG4H 2AQ3A 3MZTA 2FR4A 2YD7A 3JV6B 4HS3B 2OL3B 1FJ1A 4RQQA 3SCMC 4P5TD 3QUYB 3BE1H 1CLZL 5EC2A 1FRGL 1N5AA 3O2DH 3SCMD 2Q3ZA 4PJIE 1IFHH 2O5ZH 5K9QI 4LEXH 2ITCB 3SDDD 3RY6C 1NKOA 5SX5K 2PCPB 4GS7C 3CMOL 3QHFH 1ZHBA 2NY3B 5T3ZE 1WLHA 3SDAD 5SWSB 3CX5K 1NFIB 4W4OA 5JXEC 3RWIB 5JOFA 4KJPC 4R2GD 3UBXA 5CZVL 1SVCP 5ACZB 4KQ4L 1LEKA 3BP6B 3W11C 1H5BA 2XZCL 1FVCB 2NW3B 4RBPH 4F9LA 3H9HA 3C2AL 3PV6A 4GQPH 1IZJA 4HV8A 4QRRD 1KPUA 4P2OD 3OAYK 4HPOH 3BGMB 4TYUA 5T1KA 2F54B 5HPMB 1INDH 5F9JA 4KMQA 2A0LC 1DLFL 4P2RA 4M6NH 3L5HA 5EWIH 5CJXA 1WBZA 2JLLA 4ORGA 3CFCH 5EULV 4BELD 2DL2A 4K3GA 1AHWA 3Q3GB 3GB7A 3AMKA 4RZCA 3L3JA 4KHXL 5E94A 3KPRA 1RSFA 3FHAA 3KVQA 1FL5B 1NUGA 1P9MA 3UTPD 1NL0L 1TLKA 1K5NB 2NYYC 4IOFC 4JCLA 3N50A 4PJXA 3JVGC 1MJJA 1NCDL 1XT5A 3BYTA 3QEHB 1JWUA 1R3IL 5IVZB 4NJ9L 1CFSB 1UZ6F 3ARFC 3K8KA 5D1ZC 1PLGL 1DBKH 5CUSL 3FQNB 1N8ZA 3I3EA 1A7OH 4ODSH 5TGBB 3PQYD 3T3MF 1IGYB 5D7LB 2EDNA 2NY0D 3KYAA 3OHXB 4I3SL 2HFEA 1TNNA 3FRUA 2EIEA 4QY8B 5LCVL 4OM1L 4KY1L 5IF0A 1I3VA 5C3TA 1IT9H 1NMAL 4YHKL 1RHHA 3HNVH 5B39G 5F9AC 5I71B 4LL9A 3MLVL 2IC2A 3KGRA 3L9RB 3LKPB 1HHGA 3U0TB 2CRZA 4G8EB 4D0BB 4HHAA 1SEBA 2H45A 5IUSA 3L7FB 3HPLB 3O3DA 4NGHH 1QOKA 2QL1A 1MFAL 1RJZB 4ZO6A 2UZYB 2RGSA 4OBSA 3BKJH 4YEFA 2Y9RT 3KPMB 2R56H 4IIQC 5DD3L 4PJXB 1KT2B 4UT6H 5H2BB 4TSCH 5D8JH 5B21A 1G0XA 2CLZA 1Q9OB 4OT1H 5B4MD 1E6JL 4YGVA 4QHKI 3WUZA 5EU7E 3UROR 5BJTA 5IT2L 15C8H 1SBSL 2UVEA 2F5AH 3OKEB 4LLWA 4B41A 2DOCA 3OHXA 3KHOA 4PJBB 2XG4A 5HHNB 4FQ1H 2C3XA 2UZIL 1OGAE 3H7BA 2HP4A 1IGCH 1DN0B 3SJVA 5CCKL 4HWZA 3QI9B 1MFDL 4JZJB 1V7MH 2X1PA 4R6UA 4KK8C 4FQHB 2PCPA 4X7TB 5IMKB 2I60H 3BIKA 4LSPH 5C0DB 1CFNA 3W2DL 3D9AH 4OCWH 4D3CL 1NCAH 5KBNC 4JDZB 1Q9WB 1K6QH 3RGVD 5E0QA 3PQYA 3JV4B 4AMKH 2W9EH 5J9PA 4GMSL 4X5XA 4HUXA 1KACB 1QBBA 3INUL 3GSOA 1UG9A 1A7RH 3TJEL 4PJAA 4H0GA 4NWTH 5IB4A 4M7JH 1WZ1L 2KQMA 3B3IA 4TULL 1NEZB 1YEIL 3W39A 2YPVH 1DUZA 2PYFA 3H9ZA 5ESVA 1I1YB 4UOJA 3RKDD 4NQCA 4AEIL 1QBLH 4KUCD 1RZJC 4NZJA 4KI5D 1H0DB 3WN5B 5C92A 4WIQA 4BH8B 2AXFB 4W6XB 1A4KB 3MZGB 1PEZA 4WI4A 5KZCB 3MOBL 3RL2B 1YEJL 1FLTX 2I26N 3I02B 3VFSA 2YD8A 4POYA 1UENA 3G5ZB 1HHJA 3CSYB 3QDMB 3O45A 4U6HA 1YPZA 1IC4L 2AJXH 5TE6L 2HYMA 4OIIL 2FEDD 3SE4C 3OF6A 3ULUE 4DVBA 3LKSA 4LCUB 1A6ZA 3IT8D 5J11C 4HAGA 3GIZL 5E03A 3VMOA 2DLGA 5FYKH 4KQ3H 4XX1E 5BOPA 3WUWA 2FX9L 5DEFA 3S34H 4MNQD 4L3EA 4MS8C 1BZQK 4XBPA 3B83A 3ESUF 3V52H 1IGML 5C2BH 3GI9H 4K71C 2VLKD 5DRXA 3RTQC 3B9KD 4KTYA 3CNKA 5HHOB 2RR3A 5CEZD 1XIWC 2I07B 3GI9L 5FA3A 5AD0A 5C2BL 3V52L 1I7ZB 3GDBA 3V0VA 1DQJA 4PJDE 3UTQA 3UZEA 4EUPB 2FX9H 3C6LC 1GOFA 4MAUH 5DMGD 3VFUB 4KQ3L 1N0LA 2QBWA 4JE4B 5FYKL 2AJ3A 3MFGB 1I8LC 1UZ6E 1I8IB 5IB1A 2AEQH 3GIZH 4GH7B 4EN3D 3F5WA 1FYTD 3BWAA 3IJHA 5HGAA 4UQ2B 4ZUWA 3CFBB 8CGTA 3MOBH 4ISVB 3LY6A 4Z7WA 5FECB 5DJAA 5INCB 4Y4KC 3RGVC 4LLVA 1C12A 1QBLL 3PWPB 3G5YA 4AK1A 2R2HB 2VUOA 1I9JL 2UYLA 4HQQL 2YPVL 4RIRB 1ZGLM 1CGTA 1ZA3A 2GI7A 2R9HD 2D0FA 4TULH 4XMKH 4DJMA 3SGEI 1AXIB 1WZ1H 3MXWH 4M7JL 4J12A 4NWTL 5FM5M 3KNBB 1C1EH 43C9B 3QIBB 1QSEA 2B5IB 2JJVA 3MRKA 2A38A 3VGAB 4JFXA 3INUH 1EEZA 3RVWD 4UNTA 3P0YH 3PIQB 1L7IH 2W9EL 3V7AE 1S9VA 1JVKA 4JZNB 5FKAA 4G9DB 1MIEH 3OGCA 1JPFB 1K6QL 2EE2A 3MV7B 4NCC2 4XAKD 3VI3F 4XP5L 4OCWL 5HGDA 1G7IA 2BVOA 4R9HA 3W2DH 3JV6A 3U4EA 1FZOB 5FYJU 4LSPL 1U58B 3QUZB 1AKJD 1D9KA 3CFKB 4OQTA 4PJ9C 3C8KB 1OSZA 3IDMB 5GIRA 4MQXD 1KF9B 1X44A 1ZT7A 3AUVA 4FQ1L 1D6VH 4NNPH 3GM0A 4N90D 2VR4A 2PW2B 3WHXA 5AWNH 5BV7B 1X5LA 5D2LE 15C8L 5E8NA 5F1NA 5IT2H 1EHLL 1LO5B 3G5ZA 3QDMA 2BNQA 4RX4D 1FGVH 2D7TH 2R9HC 4OT1L 1S7TA 4ZO8A 2F53E 1E4XH 1KYOK 1FBIL 1KB9K 2OTUB 3NCJL 4TSCL 2P46B 2DD8L 5D8JL 3VMPA 1BAFL 1UB6B 1TJGH 3PGDA 2P43B 3BWUC 4CUCA 3BKJL 1J88A 1MFAH 3QUZC 4N9GA 3AXLB 1LEGB 2X1XR 2ZG3A 1EBPA 1OTUC 2OQJA 2OZ4L 2GCYB 1ZTXH 1OOAA 3QXVA 3MLVH 1INQB 5TDOA 5DEGA 4GRLD 3LV3A 4KROD 2E7LC 1YNKL 4UQ3B 3RAJL 1I1FA 3SDCC 3T0EC 3TIEB 3T0VA 3L3GB 4RFEB 4KY1H 3A67L 3CX5J 4LVHB 5CSBA 4XNXH 3UXFA 2AI0H 4U0QB 2QADD 3NFNB 4RA0C 4ODSL 4ZAKD 1A7OL 2H8PA 1R6VA 3QWOA 4LCWA 1PLGH 4JZOA 4RX4A 2WBKA 4PRPE 3LCYA 1MCCA 4JFPA 1R3IH 1F90H 4NNYB 4OI8A 4K07A 4LVNC 3EO0A 4Q6IC 2YC1B 4ZYKA 4HULB 5J0BA 5D2NE 5GSRB 4F15C 4U1SB 2GSGB 1VGKB 4F7MA 4TN9A 4AH2A 1O7SA 4NKMA 4HKBA 4WI2A 1I85A 1YYML 1WZKA 1GC1L 2R2HA 3EYQD 2OJEB 4KHTH 1BECA 4QOKE 5GRZA 4LHUG 2EXWD 2ICWI 4DW2H 4O5LL 4PR5A 1P7QA 5EWIL 2FSEA 3HNTL 4M6NL 1DLFH 3AGVA 3GMRA 2QKIB 1INDL 2VMFA 1QFHA 5T33L 1WV7T 4HPOL 3RI5K 4AEFA 2OR9H 1BBDH 3HCVA 3C2AH 1NDGB 3FT2A 2XZCH 3MRHB 3VRLE 4KQ4H 2VL5A 2QQKL 4OB5H 1U3YA 5EUOA 3QUKA 3EOAB 4MJ2A 2X1WL 5HHNA 5DJ6B 4G6KL 4XAKE 4G6KH 4MNGE 3QI9A 3RKPA 1F13A 1UZ8B 3QHFL 4OB5L 2QQKH 5I1LA 4C4KT 3C2SA 4GRWF 1ETZB 1Y18A 1ULVA 3T0AA 3S97C 3IDMA 5GIRB 4LEXL 2O5ZL 1BBDL 4I48A 3REVA 5IBLD 2C4FU 5C0ND 2OR9L 3O2DL 2X6MA 3RZCB 4IS6B 5T33H 4KI5E 1FRGH 2LABA 1CLZH 3HNTH 2FYYB 3NIDE 3ZTJH 4O5LH 4DW2L 1CFNB 2GFBB 4KHTL 5IEHA 2A6KB 3S98A 1GC1H 4YDJA 1YYMH 2XWTA 3U30C 5IB4B 5EBWB 3FONA 5A16A 1EDQA 5JIPA 3ARPA 3K3QA 5HHQA 4M6OL 1LDSA 2YN5A 5IV2A 4N8PA 4KRPD 2KQNA 2J8UB 2VUYA 3MLXH 4X6CE 5JNYB 1MFEH 4Y1AA 1PZ5B 2JJUA 3VCLB 2BCKB 4KK9C 3ZE1F 1F90L 2QHRH 5E1HB 2L0DA 3MV7E 4Q2ZB 1NEZA 1JNLH 2C4FT 4YDLB 4OLYL 1ED3A 1GGCL 2X42A 5DWUH 3LOWA 3VDBA 2FZ3B 1JF6A 1IAKA 5GJTH 4OZIE 2AI0L 1ZGLA 4XNXL 1FZMB 3DGGA 3O8XA 2R0WL 3A67H 3G6JB 1B0RB 3RAJH 4CJ0A 1MY5A 5IMMA 4CADA 4JKWA 1YNKH 3BPCB 4Y19E 5K33A 3O45B 1ZTXL 1CLYL 2OZ4H 3EYUH 3IRPX 4V1DA 5C0IA 1YA5A 3KYMB 5IW3A 3UTOA 1AQDB 5DMGC 3BP5A 1YNTB 4PTTA 4JM4L 3KPLA 3OJVC 4JRYE 3VGBA 1AO7E 1TJGL 1BAFH 5DEFB 1Q8MA 1BFSA 2DD8H 1FBIH 1E4XL 3NCJH 2QR0B 2D7TL 1P2CA 4YE4H 5L2KD 1FGVL 2Y23A 3QEQD 3OKMB 2H2PC 4R97B 4F57L 1EHLH 4JO1H 2R8SL 5AWNL 1H3VA 1TITA 3RVVD 4P46D 5F70A 5B3JF 2VNCA 3U0WL 4NNPL 4F7PB 1D6VL 2D0HA 5HVHB 5FCSH 1N2RA 4LGRB 1VADA 5IEKA 1ZVYA 4MZ2A 2FL5B 3Q5OA 5IMMB 4N0CC 2EH8H 5J13B 2EDBA 4GRMA 1FNEA 2VJXA 4XP5H 4XCCL 4Y4HA 5DRXB 2GJ6A 4U3HA 2BSRB 1G6VK 3FQNA 5E6ID 4NO2A 2H32B 4KRMB 3FAXA 3STBA 1MIEL 3ZDXE 3WJLC 1IGYA 1OW0C 1L7IL 3QUXC 4IIQA 4OCNC 3P0YL 2XN9A 3RZCA 5EFIA 4QXGH 3L5XH 3HC4L 1RZIB 3KPSA 5JMRA 5JR1L 1LNUA 1C1EL 1T22B 5HVHC 4RMQA 4BZ2L 3MXWL 2IAMA 4JFOB 1MI5E 4XMKL 4YBLB 5EA0H 3CU7A 3QA3A 4OKVA 4HQQH 3VRLF 5CJXC 1I9JH 1IC1A 5JXED 4NCDA 1HYSD 3SHSA 1TCMA 3ABZA 3GHBH 2X4SA 4CW1A 3TBYB 1DE4B 2BSED 4GW1B 5J06A 4APQD 2ATKA 2JTDA 5DJ8B 3FT4B 5CWSA 4XCFL 3VD3A 3FB6A 1RHFA 3FCTB 5CLTA 4NO2B 4NHUB 2UZXB 4LHUA 4P3DA 3C5ZD 3MV11 1ZVSA 43CAB 5HI5C 2A73A 2AEQL 1IRAY 3GHEH 4E41A 3NIDF 2VZTA 2XN9B 2YRZA 3C60A 1JPGA 2HFGL 4MAUL 4EBQL 4ZNCD 3OX8A 2ICCA 5ID0A 5SV3A 2XTJC 1D5BB 1T2QH 5LBSL 1QEWB 4PGZA 3LRSB 1T5XA 2B0SL 3DXAD 3DUHA 1F8TH 1I7RB 3QDJD 5DMJB 1DLHA 1EJ6A 4YPGA 1IGMH 4R4BA 1F00I 1K8DA 3G6AA 3S35H 1G84A 4LPUA 2FR4B 3S34L 4L8BB 2JB6A 3HC0B 3MRIB 2WP3O 4YDVB 1FHGA 4PG9B 5BZDA 2DM3A 4JO4L 4JREB 1KUMA 1D3CA 2YD3A 3PGFH 3IU3B 4OIIH 4N1CA 2AJXL 4U0RB 1IC4H 3B6SA 2WBJA 4TNVF 5TE6H 2PNDA 3JUYA 4RDQF 2C1PB 4NUJB 4QHNA 3U7YL 1FIEA 3KYNB 3MV8A 4E41D 5IW1A 2BXYA 2RJMA 1YEJH 1G9MC 2V9QA 2HTKD 5INDA 4PRIB 4JJ5B 1HXYB 2A6DB 3OGOE 2FO4B 4XP4L 5HGHB 3BN3B 5FGCE 5HYJD 4XCEA 5DJ2B 4J4PC 4EUPH 2MSPA 4AEIH 1T1WB 3HMWL 1MEXL 3WYRA 3PF2A 4LSTL 1WTGT 4X99B 3QNYB 1YEIH 1H8NA 1G7QB 2IANB 2AXGA 3V6FA 4MDIB 2EDRA 4I0PA 1JNHA 3Q6GL 1A7RL 3TJEH 4P2QB 5H37H 5FCUL 3QDAA 2BSTB 4HIEB 2MFNA 4AQOA 4Y4FB 4X5LA 3ZSTA 4GMSH 4OBRA 1MH5B 4AMKL 3D1MC 1D5XA 3RY5A 2WAHA 4ENEC 5MEPA 1RI8A 4HLZH 4NN7C 2E8ZA 1MOEA 4XCNB 5EU4A 1J7VR 4AL8H 5FB8A 1NCAL 5F6IB 4D3CH 3D9AL 3BW9A 1NDGA 3FT2B 4BUGA 1CICD 2I60L 3H3PH 1NDMA 4GLRI 3UTSE 1ZANH 1RU9H 1V7ML 1MFDH 5CCKH 4MNQE 2FLBT 4JFDB 4M7ZB 1IGCL 3OR7B 5C0AA 3W9EA 2UZIH 3X3FH 5KSBF 1X4XA 3F5WB 1BBJB 4YFDB 2F5AL 1D9KD 3D85D 2K3TA 4RMSA 1MCWM 1SBSH 2BMKB 4FHBD 1DUYB 4Q74A 5C08A 1WT5A 1JNHB 4U1JA 4MLSA 2X89D 2DMBA 4D2NA 2P8LA 3IFPA 3U79A 3UYPA 1N7ML 4G80A 1U3HB 1E6JH 1EAJA 4NN7B 2M8XA 3CGTA 4UT6L 4F3FB 2V9RA 1KPVB 5DD3H 2R56L 1UFUA 2AK4B 3LQAC 3FMGL 1W72H 2XYCA 2BY2A 1UWXK 4NGHL 3NACH 1UJ3A 3PABA 5JLZA 4ONGH 1H8OA 4LF3B 3ARGB 3EGSB 2BC4B 1F6AA 3UYOD 1KSRA 3VI4F 3HNVL 1WCQA 4YHKH 1NMAH 1IT9L 2EICA 2DBLL 2APFA 3VJ6B 4PJCE 1PKQB 1U8MA 3VFNB 4KV5E 1EEYA 4PY7B 2DB8A 4OM1H 5CKGA 5LCVH 4PTUA 4ZFGL 4I3SH 5ANMB 3PXJA 3CIQA 2EO9A 4PG9A 4X9HA 4WWKC 1X9QA 2HT3C 3D25A 3SPVB 4U6VL 7FABL 1CXLA 5CUSH 1B9ZA 1DBKL 2Y6SC 4LKXA 1KOAA 2XOTA 3HC3H 2FZ3A 2IH1B 4NJ9H 4LPWA 3TZVC 5L8JB 5FYJE 4DKEL 3FO1A 1QA9A 2R1WB 2WMPA 4IJ3B 1D5IL 4WW2A 3EYFA 5ECJE 1NCDH 3DRTA 4HIXL 4K94L 1ZLVK 1NL0H 3WCYA 4Y5VB 5E2TL 3QFJE 4EVNB 3L5JA 3T0ED 1RUMH 4KHXH 4U2ZA 5E8NB 4OTXL 1U8OB 1M6OB 4JQXC 5IKCA 3CFCL 3V6FB 4MJ6B 1S7XA 2LAGB 1EEYB 4FQXC 3T2QA 1KEML 4C54A 4OZGB 4UT9H 1HQ4B 1U8NA 4PJXE 4KK8D 1R3KA 4JAMB 1P6FA 1LEGA 2BHZA 4A2MA 2KKQA 2FJGA 3OJDA 4PJEE 4JZJA 4URTB 5AAMA 4PJGE 3EYQC 5CZVH 1VESA 5TF1H 1LVEA 5C0DA 3PNWA 2H9GB 3C09B 4NRZB 4W81A 3W5NA 3SQBA 1OAQH 1EVTC 3D2UD 3D39B 3E2HB 3WKNA 3BPOB 3CMOH 2AK4E 2OK0L 3UTSD 5EUOE 4X5XB 3WIIH 1F02I 1IFHL 1NGYA 1VEMA 3KXFE 3CFJB 1VPOH 3S5LG 1N26A 5FO8B 1MRFH 3BE1L 5GPRA 2XI9A 3RDTD 2N56A 1MCKA 3WUWB 3MV01 4XX1G 1JZ6A 5D71H 4M61A 4AG4L 2GJ6B 5IROA 3OKMA 4L29A 2HJFB 2P8LB 3IFPB 4JPWL 4OLZH 2OSLB 3CDGA 3QUXB 1CD0A 3GO1H 4LQFH 2KUTA 1A2YA 1FL3B 4RAUA 2VXTL 2HT4C 2ADIA 1KEGH 1AGFA 2FHCA 1PGRB 2UV3A 4I0CC 4NKMB 3KPQA 5AYUH 3R06B 1J8HB 1ZS8A 4ODWA 3EYOA 2R0ZH 2VITA 2VH5L 2HLFD 2DQJH 1UM4L 5E5UB 4NC2B 5FO7B 4IEFB 5ILTL 4J1UB 1HNGA 2V2XB 4OCYL 5ESAB 3AAZA 4U6HB 1YPZB 5BS0D 4OFDA 4U4BA 4XP9H 5BMFL 5DVOA 2D03L 4GW5B 1Q72H 4NQEA 4Z18A 2Z9TA 3RPKA 3ZYZA 4LHUB 3T3PE 4CW1B 5EOCJ 5JPMA 4ISVA 3SBWA 4M7KL 3QUYC 3RX5A 1XGYH 3K4ZA 2ADGA 5JW5A 1JPST 5FUOL 3C8DA 5B8CB 1U93A 1X3DA 3KJ4B 1QPPA 3GBML 4RGOL 1PZUB 3RIAF 3QUMA 1FZJA 1OHQA 5FGCB 3TESA 5J1SC 3ILQC 5IFJA 2J6EA 3OKOB 5DLMH 3O3BA 4PRIE 5T3XH 5HSFA 1GXEA 2VDPH 1KIPA 2DQEL 4OIBA 2CK2A 5E99L 3SE8H 1QRNB 1QFWI 5D96B 4NIKB 5I1IH 5C1MB 4KVCH 1KXQE 5EO1B 1G7HB 3TO4B 4UNUA 5FEBA 5I1HL 1NFDA 2VDOH 2DQUL 2VLLB 3T8XA 4K9EC 1N3NA 3GI8H 1U8JB 1QHPA 4GW4A 1M7DA 3BIAX 4G7VH 5TQ2L 3TO2A 1LK3L 1U8IA 4P5MB 3BVNB 2R69L 3QEQE 4HUWA 4P2YA 3QH3B 3SKNB 3FN9A 4B7LA 1P4LA 1FO0B 3EO1B 4AQ1B 3GNML 5JPMB 4KPHL 3MXVH 1KPRA 4MQ7B 4POZC 5E8OB 4KRPC 2BFVH 3QYCA 4MCZA 1T1ZB 5BZDB 2XWBA 3BDXA 5F7KC 1SM3L 2AXFA 3E6HA 1EEUA 5I1DA 3ARYA 1QSED 1ZLSH 1RUPH 1A7NH 3VFSB 4LLDA 1WBXA 4JRXA 1P7HL 2BNQE 3LH2L 4HJGB 4QRUA 2DS4A 3BAEL 4RFNB 4YPGB 4BQ8A 3IFLL 5MERA 3ME0A 5F9JB 3WKMH 5K9JH 1AP2B 1W0YT 4L8BA 2FGZA 5LGJB 3ARFB 4OGXL 1F11A 3CLEL 4LSVH 5FO8A 1QQDA 1N3NB 4M5YL 4DTGH 4JM2A 5E56A 4IOSD 3MRLA 1YPZE 3GMLA 3UBXG 1M1SA 1UWEH 1IAOA 3LD8C 4LFHD 3GUTA 1P7KA 3CZFA 2CSPA 5E7BA 2ESVA 4O9HH 3GSXB 5MEOB 3HI5H 3KPLB 2B8OT 3IDUA 3MUGB 3JSSA 1K8IB 5AUMB 4F9LC 3KPQB 4M1CC 4UDUA 5LQBL 2DQHH 4H20L 4AENB 5DK2B 5HHPA 5C0CA 2ZG2A 1J0KA 1FN4B 4H0IA 4KJWD 1IC5H 2V2WA 1UXSA 1RV6X 1WFTA 5FUZL 2Q8AL 1CQKA 1U3JA 1IC7L 4K8RH 4HFUH 4IRSB 4ZFOB 2A9ML 4EI5C 4AIOA 1HILA 3QAZC 4UIMB 1X5HA 4OZGE 5F1IA 3SEPA 4XRCA 1KTDB 4X6CB 5EU6D 3BPLC 5TQ0L 1J5OL 1A7PL 1J18A 2X1QA 5DQ9B 2FATL 4MD5A 3VWJA 4JPKH 2FEEL 2NX5D 2ZCHL 1P7KB 3J7HA 3L95A 5CJOL 1I8MA 2V5RA 1MFCL 3OF6D 5ICZA 4OZFG 4JY4B 1I1FB 4L5FH 5FYJD 2ZCKL 3KR3L 3PP4L 1IM9B 5E8EB 4GKOA 4MSWA 3DXAE 4X0KA 2J5LC 4YDLC 3PWNB 1AD9A 1I7TB 3GMPA 3V6OC 1FVDB 5T1DL 3MNZB 2R2EA 1NCTA 2FX8H 4AENA 5K59F 5C70A 3PJSB 1EGJA 5EU3B 5E9DB 4XNUH 5ISZD 5EU5B 4MNHA 4FRWA 2YSSB 5I1CH 4Q7DA 4B7IA 1HSAB 4UIKH 1UB6A 3PGDB 4H88L 3SY0B 3MREA 5FYLH 1KXVC 4XP1L 4OQ1A 4XBEH 3SPVA 4EUPG 4L9LC 4HUWB 4QLRA 2YC1A 4PUBL 3L3HA 4GXVL 4OZFB 3RIAK 1INQA 1YNLL 4WUUD 4GW1A 2Q6WB 3EIFA 2XFXA 5FDWB 1U6AH 5F9WB 4PP2A 1GHFH 4G6ML 5DJDB 3AY4C 5E2VH 2CIIB 1M71A 1II4E 1QA9B 4K3DH 4JRXB 2EEDA 2G75B 4K94C 3LB6D 4G9FB 5MHSD 4Z95H 4F37K 5IGXL 2BJML 1T80A 4WWKA 3LMJH 5KVFH 3G6DH 1ADQL 2JKXA 3HI1A 2O5XL 5I1JH 4PJ7A 5TH2A 2VE6A 4OZGA 4PGEB 4PP1C 5J6HB 4ZYKB 1KCSL 5M7QA 1BFVH 1TMCB 3VGGA 4ZXBB 5DJ6A 4IM8A 4HT1L 2F53A 1VGKA 1MVFA 3CD4A 1ZHNA 4JM2D 4OCRL 1IQWH 2A6IA 3SO3B 3DRTB 1T66D 4KK6D 2CLRA 4WHDA 4DOHB 1MWAL 3K7UA 4I18C 4PBWD 1P7QB 4Y5VA 1BX2B 3BQUB 1N6QH 3MLUH 4HXAH 2BNRA 3WFEH 2FD6H 3X3GH 3ZKMC 3QQ3B 1BLNA 5DUBA 3SDAC 5BXFB 3TA3A 4P46A 5GS1B 3RX7A 4ELMA 2WBJD 4FQIH 3L3DA 2PYEA 1CIUA 5A43C 4IBLT 4G8IB 2K7PA 2NY3C 4P59L 4KGJA 3U1SL 3EJYC 5EUOB 4F58H 3QBTB 3WFHA 2E8YA 2IF7A 4D0CB 2H2PD 4PRPA 1QYGH 1QG3A 3B5TA 3OJDB 1QSZA 4JO2H 2IQAB 2CK0H 4KDTC 4ZPVA 2D7PA 3WXWL 1A1MB 1V7NL 2IBBA 1G7JA 4I48B 5SX5H 2EIZA 2DWDA 5T5NG 5TFSH 5D2NA 3HUJE 2CUIA 1KJ2L 3L3KA 3VDCA 1FLRH 5FYKE 5DURD 1J11A 1CXKA 1U36A 2QJDA 4LMQE 4YGAB 5FO7A 5T3ZL 5JMOC 5GGSA 2BXZA 4JFYA 1FO0H 2HWZH 5DYOB 4D0DA 2Z31C 2IAMD 2ZUSA 4WO4A 1NGYB 5B4MC 5BRZD 5C0FA 3S6CA 1DQML 3TA3B 1A6TA 2E9IA 3F58H 5GISL 1CLOL 2HKHL 1MHCB 2XQBH 4GMTH 5F3BA 1N5YH 3JZ7A 4LBEB 5HYIA 3O6LL 3GJFA 2AVGA 4GG6F 5IBUB 1CFSA 2XY2A 5KW9H 1ZKAA 2QADC 5E4EC 5HBBA 1RULH 3JWOH 1NC2B 1TQCB 1T0PB 5LAXB 2VXQL 1I1AA 4RGND 3ZKSD 2XTJD 3W5MA 2EYRB 2DQIL 2DQCL 3QEGH 3FO0H 4BZ1L 4NM4H 3QUML 5KVGH 1WFOA 3IDNA 3DX7B 3M8OL 1QBML 2ZJSL 4IOIA 2NZ9C 2HMIC 2HLFC 4WV1A 1JTOA 1RJLB 4KKCD 3RUGF 4AT6A 2EIDA 1FCCA 4QTHB 3PL6A 1WCBB 3BP7A 3RA7H 2MQ0A 3IJSB 2YPLE 5EH1A 3R0NA 3QZWA 2PO6D 4JFEE 4YDIH 4ZUVB 2IAMB 1XF5B 3EOBB 4JG0L 5I71C 3O3AA 4ZTOH 3LS5L 3MX0A 5D6DA 3PWVB 3HHRB 3UJIL 1X6NA 1JPFA 1A7QH 2H32H 5IQ9A 5DURB 3VD9A 1F3RB 1G7IB 2BVOB 3IKCA 4AY0A 4G8GD 1CL7L 2R1YA 4HUXB 1IGJB 2HJLB 3RUGB 5I75C 1HWGB 4AIZB 4KK5D 3EO9L 3T0XA 4N8VB 5CILH 4NM8L 2H32A 5F7MC 3A6BH 1MY7A 5DTFB 2RHEA 3GRWH 1ZT4B 2DLFL 3B3IB 2X7LB 1F5WA 4LMQI 3DECA 4NQCB 1VA9A 4XMPL 4NPYB 3H2WA 4HWZB 4L4VE 1M4KA 4KH2A 3T04D 1XF1A 4JM2F 1XR8A 3KDMB 3CC5A 4F7PA 5D9SB 3GSWB 4U1IA 4RFNC 2W0PA 4JHZA 3VGHA 5C6TL 1T0NA 4IRZH 1XF3A 3CFIC 4P48A 3J8F7 4NQDA 1CTNA 4X6BB 2R2BB 1MLBA 2EZ0D 4HUUA 4M93C 3VRIA 1B88A 1HQRB 1A3RH 4I4WB 3TPKA 2HLAB 3MOQA 1XGUA 3FZUC 3TBYA 4J4PA 1ZSDB 2CMRL 1PY9A 1FC1A 3WDIA 2XNAB 3QFJD 3U4AA 3MMEB 4GO6B 3MUGA 1GCFA 5FOBB 3O4LB 2D7MA 3HN3A 4MD0A 3QIUA 5F7HA 1IEBB 4O2EB 2ZUQC 3B8SA 4FNLH 5F96H 5JOEA 2WBJC 2DDQH 2BY3A 4F7TB 4N8CH 2OP4H 5KANI 3WN5A 5ADOH 4D9QE 3BH8A 1AP2A 3MCLH 3GSQA 1FCGA 1A4KA 1NCWH 4H1LG 5D7JA 2ARJB 1TZGL 4X9BA 3UPAA 4QRTB 4BSVA 1EIBA 3I6LD 3MCG1 4DKAA 2R4SH 1WZLA 2V2WB 3LPGA 4Y4HB 2OL3L 3GRWA 1XF4A 4XH2A 4LCUA 1KLGA 1KJVB 3S35X 1BVZA 4Z7UB 4DZ8A 2JJTC 5GS0D 2AXGB 4G8FA 2IG2H 4U3CA 4H0HB 3C5JA 2BERA 3DIFA 4KKLC 3QCUH 1RIHH 4KTEL 3MGTA 3DBXA 3EFDH 4PP1D 1RIVL 4WUUE 2EDYA 1NH6A 5EFIB 3L3JB 4PJ5B 2DAVA 4E41B 1GGIH 2GUOB 3SGKA 4B53A 4WUUA 1I8MB 4XNYL 2ZUTA 1KCVH 3ZE2F 1TTGA 4HC1A 3FQRB 4O51A 4JFOA 5ISZB 2MCPL 1LK2B 4R8WH 5LG1A 1UQSB 2QSTA 3P30H 5E70A 4ZS7H 4PFEA 1A3LH 3UO1H 3QCTL 5IVZA 3T4YB 1DVFD 3WIHA 4XNQB 2CXKA 3GM8A 1LMKA 5CEXB 1OQOA 1D5ZB 2EKJA 3CFBA 4YQXL 1AQKL 4Y2DA 2VXSH 1LE5A 1I9IH 4OZIA 2VDRL 1HKLH 2J8HA 1AR1C 3EYVB 4YDVA 3V5KA 2DLEA 3RZWA 4G7YH 1JGEA 2ARWA 2WM0A 4I0PB 4I9WD 4ZTPH 2M2DA 1P5UA 1RK0B 3MBEC 4TSAL 1P4IL 5C0BD 3MV7A 4WTZG 3IU3A 1OAYL 3HG1D 5T5FH 2EYTB 4KAQL 4FQQB 1QNZL 3HRZA 3EOTL 2JIXA 3B43A 5F72S 2UWEE 6FABH 5IEHB 2BDNL 3U7AA 5FDWA 4YFLF 4JJ5A 5H35B 5EC1B 3ZKNC 1WAAA 2Y4SA 1T21B 2A6JA 4M7LL 1RPQA 4ODHL 2BNRD 5DF0A 5I15H 1O5DT 5IQ7L 1MCSA 1KIPB 4NDMB 4H1LB 1NBYB 3MOAH 3CFEA 3O9WD 3DMMD 4PREB 4L8CA 3QO1A 4GS7B 3G5VB 3VG0H 3O9WB 4X6DB 4XXDA 4Y5XC 4LDLB 1LE5B 4NC1E 4OZIB 2R0LL 2VDLL 3D69A 3NFSL 1ZWIB 2GJ6E 2YZ8A 3GGWB 2CLRB 2VC2L 1DQLL 4YAQB 3LEYH 3OKDA 3T0WA 1ROWA 2VLKA 4P99A 5CJ5A 1VFUA 1KPRB 4XPTH 2DJ4A 3ESVF 3RNKA 2BY0A 3BPNB 5D1XC 4R4FL 3FB8B 3DYMA 4GFTB 5IOPA 3TT3H 4OCXH 1U8QB 2IQ9L 3V6BR 2Q86A 4LQ1A 4NQVB 4XWGL 5GGVL 1DVFA 5J9PB 2V2TA 2G9HA 5JXEA 4HCRL 4N0YL 3BSZL 4QHUB 2DRUA 5TGBA 5DJXA 5DMKA 1DDHB 5CBEA 2XWJB 5TDNB 4GAGL 4EN3A 5KSAD 1ZLWH 4QY8A 4NQXB 4Z7UA 1NGWA 3E6FB 2ZUVA 4NSKA 3R1GL 2JCCB 4LCCB 4XP6H 1EK3A 1LP9A 4Z7WE 1RUAL 4GRWE 1TXKA 2X4NA 3QG6A 3F12A 2DIJA 4D0BA 4X4YA 3SDXA 3V0WH 4DUWA 4RSVA 3TFKD 1FIGH 1OSPL 3NZHL 5KVDL 1GZQA 3FQRA 4FOMA 3ROOB 3EYFB 2E27H 1QFPA 4JZOB 4HK3J 1NFIA 2DM2A 4S1RH 4WO4C 5GGQL 1KCUL 2LV4A 2WIMA 3Q48A 2CD0A 3B9KA 1DANU 3MRNA 1ERNA 3ZYJA 4FQLH 1H3WM 1OM3L 4NT6B 1TNMA 5C0JB 2A74B 5FV2A 4C56E 4LOUD 3HZKA 3QRGL 3OG6B 3HCVB 5DA0B 1FSKC 3IFOA 3NCBB 2NLJB 3VWKC 3ZKXB 3BGMA 3HI6L 4WW1B 1A21A 1QR1B 3QG7H 5D72L 3VFWB 2VL5B 1MRDH 3HUJA 2VLJA 4PRAB 4X6CF 3L1OH 2EDTA 1QKZH 4YFLI 4MA7H 3ZE1E 5HDBF 3AM8A 5L8LB 5E08H 1IQDB 4PR5B 2PYED 4Q6IB 2VZSA 4HLZG 4OZFH 5HDQL 1A1OB 2YD6A 3VFMB 4ZUTB 2YWZA 3CDCA 5F71A 4WO4B 1CBVH 2XKUA 1S7WB 3HMXA 3JXAA 4NZUL 3HAEB 5D5MB 1IGFL 1J0HA 1IL1A 4LCIL 3EBAA 4TNWK 4B50A 3ILQD 2H6PB 1FZKB 1J8HD 1GRWA 3EOAA 4XVTL 3HS0B 1IKFL 5DJ8A 1MJUH 3AMLA 4IRJD 2ERJB 1R5IA 1FFOB 4HS3A 2NX5E 1YY8A 5E95B 4ZMAT 3TCLA 4QRPD 2V5MA 1C08B 1FQ9C 1KIRB 2APVA 2I24N 2ESVD 2GQHA 4NQEB 4MAYC 4YHOH 4DKFH 5E5MB 4JAMA 2CRYA 1BHGA 2P5EA 4MD4A 4B0MM 2FJGB 4UB0L 4CMHB 4JCMA 5CIPH 4Y1AB 5GZND 4HIJB 1JGDB 1XCQB 1E4WH 4K7PX 2YRLA 3TH3T 3M17B 1LD9A 4OLUH 4HD9A 1NC4A 3IS1X 2XG5A 3RIFK 1EJOL 1EVUA 1CE1L 2J2ZA 5E6YA 5SWSA 5CEZL 4TTGA 4GSDH 4JFFB 1ZE3C 3BESR 1S7UB 3NOIA 3VRJB 2RAMA 3LEVL 3UTSB 3EYOB 3JV5A 1CU4H 5B3JE 4WI6A 1BD2D 5CKAA 3MFFB 2Z35B 4EEEA 3A6CL 1T7XA 3QNXB 2HLAA 2GFBA 3E3QE 1T83C 3DARA 4FZ8H 4J3TA 4WENB 3CFJA 4RMWA 1ZGLP 2IH3A 3QP3A 3FN0L 3VXUD 3WE6A 4L3ED 3O2VL 3NZ8A 4JVWA 2LU7A 5CIPB 4OUUA 5FF6A 3K1DA 2VLJD 4RMTA 3AM8C 4EQ2A 4LSUH 3O3UN 2WSKA 4PGBB 5FYKD 2DQDL 3X12A 5EBGA 4PJ5E 2XNAA 2Z91A 4NPYA 3V6ZB 2P5WD 3E0GA 4XWOD 4BH7B 4QOKA 1ZHNB 2B1HL 3BMWA 3I75A 5J57B 2HVKB 3WS3B 2N7BA 3BN9D 3MO1A 2VXUL 5F9OL 2Z8VC 4P2CG 1CGXA 4ZPTA 5I1EL 1OAKL 4OLWL 3QEHA 3A6OA 5HVWA 5ITBH 5F6IC 3ARDA 1QFWM 1YEGH 3QNYA 2QTEA 3T2NH 1BGXH 4Z8FH 3K4AA 4HS8H 4KRLB 1MCHA 3WIHH 1L0QA 1BM3L 1PW3A 1CICA 3HLAA 1TZHB 4FQ2L 4WW1A 1QR1A 12E8L 2P5WB 4I0KA 1MAKA 4PRAA 3UX9B 4LK4A 4OLVL 4HH8A 4JB9H 4Z7WF 5K9QG 1RJYA 5TDPB 4U7MA 1NPUA 3I3DA 5EUKB 4S1DC 3PWPE 4ORZC 5CGYC 1UCBL 1FG2A 4KUZL 4PJDB 5H94B 3QDME 1AIFB 4HKZA 3V6ZA 3I9GL 3VXUB 4ZUTA 3TH4T 1QSVA 3MUY1 3U6RA 5IJVA 1MCOL 5DXWA 1VGEH 1OPGH 1QR4A 4LARH 4UV4H 5F6HJ 3SGJC 1H0DA 3QIBA 4S1SL 2DWDB 5MENE 4GRLB 3CH8A 1SJXA 2ADJB 2W0KA 2VR9A 1J1OH 3I02A 2VABA 2YKLL 4XCYB 1BFOB 2Z0BA 3RPIB 3IU4H 4KJPD 1CQYA 1G9NH 1F4XH 3PP3K 4XPGL 5DGRA 5DUPL 1JMZA 1U3HD 4H26A 2NY5L 4ZQKB 4D8PA 5C0GB 4TUJB 5T3XD 2F8VA 1R3JA 3KLSA 1XGRA 1REIA 3U7WL 4WHYG 4XVSL 4OQTL 2ESVB 3SDCD 4WEUD 3O3EB 4R7DA 4Y5XA 4CU8A 2NXZC 3OXRA 3IDNB 2Q1EA 3TYFA 2EXWC 1OL0A 3HZVA 2IPUG 4JR9L 5DK2A 3UTQB 4EUPA 3QUZD 1A6WL 4TSBL 3MFFA 1AFVH 1KB5B 3E3QC 4O02L 4KVNL 4PBVC 1S7TB 4Z5RB 2OX5A 4RGNC 3O0RH 3QWRA 1BREA 3RWFA 4K7PH 5GS1C 5C6WH 4MWFA 4L8DB 1ZWIA 4P9HC 5I66B 5DRNB 1SHMA 2HRLA 4CU6A 2GCYA 5GGTL 3MCKA 4U7KA 4Q0XL 5J1TC 3B4NA 4PGBA 1CDCA 2W1NA 4H26B 2C3WA 1FNLA 4UNVA 4OZFA 4R26H 2JB6B 1RZ7L 1UWGL 4P9ML 3KXFA 3KS0H 1GGTA 1QBAA 4Z7NF 3PP3H 3ZTNL 2Z93A 5C6PB 4P23B 4M1GH 4NHUA 4WUKH 5JZ7C 4PJEB 4M02A 1CYGA 1IGIH 5GS2H 3QULA 4UBDC 4R7NB 4FXKA 1T5XB 4HK3N 5CMAA 1WAAE 5GRXG 5CJBA 5DMKB 4UAOB 1ND0A 4HXBL 1LEIA 1JRHI 3H9YA 1QLFB 2DJSA 1A6ZB 3G04A 1J1PH 4MJIA 3MRDA 4HLJA 1T03H 1INEL 1AR1D 4NHCH 2QHLA 3VXMB 1BIHA 3QCVL 4PJ7B 3RWCA 1NUNB 3U4BL 3LRSA 1OGAD 3ZDZE 1KCRH 5DJ0A 1G6RL 2OI9B 4F9PA 2X4QB 1K85A 4L3CA 2DQFB 4EN3B 5E4IA 4HH9B 1Q1JL 4QRRA 3OB0H 2IMMA 1PVHA 4MB5A 3V4UL 2VB5A 3CXDL 2NX5A 3KYKH 4LCCA 1MSPA 4Q9BA 1IM9D 2XFXB 4NN6B 3VXTB 3QFJA 1CD8A 4MHHI 3WO3B 1DEEB 4I5BA 4M9OA 2ZNXA 4EKXA 2VDNL 4HEME 5DK0B 2VN7A 3KYNA 3MV8B 3FQTA 4MQXC 1WWAX 5JXAL 5JW4R 1TPXC 4TQEH 4YHLH 1YEHL 2BRRL 1TZIB 3TIDB 1CL7I 4ZSOE 1U8PA 2HRPH 1JK8B 1MF2L 3O6FB 4Z77B 1JHKL 3BKYH 1WBZB 4XRCB 3HUJB 5TH2B 4XCEB 2VISA 1NBVH 1XGQB 3CUPA 3G5XA 4MA8H 4IRSD 3GB7B 3MUJA 1QHOA 4Z7VA 1RZGB 5DJAB 1B2WH 3LQAL 5CSGA 3X14B 5I2IB 3TCXA 2ZUYA 1KJVA 5SWZE 4UOW0 5KZCD 1B0GA 2XZQL 2XZAH 2EYSA 3CK0H 4NQTA 1MNUH 3ZHLA 3DSNA 4OJFH 1KFAH 2A9NL 1NAMA 5DI8A 4PJ5A 2ZWLT 1DBBL 5FA4A 3M07A 2BNRB 5TE4L 1BVLB 3ORJA 3WJJA 4M43H 3IF1B 1NMCC 3K1KC 1RUKL 4XC3L 4GBXA 3SDXF 3CXHJ 4ZSOB 4WY7L 1TVDA 5KVMC 4OF7A 1OVZA 1L6XA 5I66A 1RZKC 4JZJC 1A1NA 4JFDE 3VXRA 3BEVB 3IGAB 1RHHB 3G08B 5GQBA 1KG0A 3HG1B 4CJ1A 2ICEB 3M45A 1RZGA 4NYLA 4FFVC 3ULUL 1KN4L 3F7RA 4O4YL 1Y0LA 4XZUB 2EH7L 1SEBB 3RY4A 1RMFL 2FECL 5JDSB 4FA8A 3C6LD 2IALA 5I1AA 3QHZH 3F7QA 4PJGF 3TO4A 4CBPA 2NXYC 1S5IL 3LN9A 5CZXD 5TE7H 3V8CA 2XKNB 3I6GA 4P9HH 4CADB 4EDWL 1WWCA 1YC7A 4JKPH 5HHVL 2IANE 4GRWB 1RZJH 4RFOH 4P5MA 4AEHL 5DD1L 5EUOF 1KIRA 4LSQH 5KOVC 5JUEL 1FH5L 5KSVA 3IAPA 3S96B 5F7EL 4JLRB 1CZ8L 4OFYD 3F6IA 3RWGA 1T20B 5L6YL 4R4ND 3DJ9A 5HI3C 3U9PL 4X7TA 2FEDC 5F9DC 4OF5A 1TJHH 3KYOA 2XA3A 4NRXB 3QEQA 5L9DH 3GMQA 4YXLL 4LLDB 1ZHLB 4HJ0C 3D25B 5GHWH 4QCIB 1F3JB 1CFQB 3TYGH 1G9MH 5DD6B 5HYJE 5SX4I 2R1XA 5ADPH 5DJYB 3BP7B 5E9DE 1GAFL 5L2JA 4XNZC 2HKFH 3DRQB 1HHKB 3B9DA 4Q58C 1T7VA 4CVXB 4DEPB 4K3EL 1HXMA 1NUDA 5SX4H 2NY0B 4M62H 1E6OH 5FM5O 4RAHA 3BUTA 4U1LB 4S1QH 1F42A 1LEKB 1IE5A 2DIBA 3VRIB 1MUJB 1YEFL 4LSSH 4V1DD 1ZT1B 3V9FA 1H3PH 4TVPE 1WVZA 2J7LA 4F7MB 4YHPB 1FL6A 1FNAA 1U92A 2XICA 2R23A 4NQXA 3PWLB 4N8VG 5JPNA 4NRZA 5ALCH 5MP6H 4JN2A 4BQBA 1T2JA 4YXHL 4P5KA 1T5WA 5C0BE 3ARQA 5CJ8A 2AJUH 4YR6B 1DQDL 1FPTH 35C8H 3HRPA 2OJZL 5M95B 4ESKA 1FDLH 1QD0A 3MA9L 1S7SA 2W60B 1UC6A 4R97C 4X6BA 2D7OA 4M03A 5F44A 1J0IA 1WICA 5F1OB 2Z92B 4S2SA 5ESAA 2VDKL 4PJIA 3N9GH 4AIZA 4JN1L 5EU6E 3RL1A 1JGVH 4XT1C 1XGRB 5EO0A 5FAAA 1OT2A 1LDPL 4X7SL 5F97E 1MRCL 3TM6A 2YD5A 4DZ8B 1IAIH 4JRYB 3UTTE 2K1MA 1FVEA 2EC8A 3H9SA 2AGJH 4Y5XB 3T0EE 1ZT4A 2F74B 2VZUA 2X09A 2ADIB 3TN0A 4D8PB 5SWSD 5J13C 3NBNA 1HH6A 1MI5A 4K7FA 1BD2E 2J88H 3BKML 4M8QB 5F7DB 4PJAE 2PW1B 3C6SA 1EUUA 4MB4A 2FEEI 3V6OE 1WWBX 2WUCH 3ILPB 3SCMB 4PLJD 3O6ML 1QSFA 3MLWL 3BH8B 1WUNT 3ZT5A 4ELKB 2X4RB 5DDHB 4O2FB 4JGUA 3CMGA 5HTSA 4ENED 5FECA 5IV2B 3NH7L 4ZUUB 4YHYC 5T3ZD 1JHLL 2GTZB 3ES6B 2CO6B 3QQ9D 3T0EB 1JL8A 4JG1H 5BJTB 3JWDH 3TA3C 4EOWL 1CGSL 3TC9A 1V3LA 1PG7L 4X6FB 3UTTB 3O6KH 2XTJB 4LSDA 5EBLB 1PKOA 1SJEB 3JWNC 3DUSB 4ODUA 1LHZA 3OSKA 4OGYH 4WU5A 4YHZL 2EDFA 4POUB 1XIWA 4XBGA 4FXKB 4RRPG 4YDKL 1Q9LB 3VXSE 1G7PB 1JBJA 2JIXB 1HXYA 4RWHA 1OGTB 2APBA 4PJEA 3TA3D 4QHLA 1UM6L 3U0PB 4Y4KD 2OTUA 5D70H 4P3CH 1I3RB 4ZAKB 2PW2A 5DMIH 5I8EB 5F7NC 5JO5A 3UAJD 1NANI 2VSDA 1FE8L 1YECH 3BPCA 4U6XA 4LPXA 3WXVL 2APXA 1J12A 2ICWJ 1V8HA 3GFUA 5B39B 4NKIL 4TTDC 3EHBC 1AXTL 3OQ3B 1YY9D 3SDCB 1RIUH 4UILL 3KJ6L 4PTUB 3TBSA 3K46A 4GOSA 4JQVC 5DGQA 1ADQA 3CU1A 4EJ1C 2GTZA 5D7SL 3EFFB 1FSKB 1F4HA 1U8IB 1BQLH 3VFVB 4OUUB 3TWCL 5AAWA 1JYNA 2AK4D 5EU4B 2XRAH 4ODUB 4RCAA 2ZCLL 1XIWD 1KJ3H 3FFCB 4WHYH 1KIQA 3E8UH 3TBTA 1CLCA 5E8DL 2NY5C 3WFBL 1PQZA 3GSQB 1S3KL 1RUQL 4HX1B 1EFXA 4UDUB 1TPXB 1I9EA 3CDFA 5FYLE 4M48H 1QVOA 1T6VN 2SEBB 4MB3A 1MCFA 4I2XA 2WW8A 2V5YA 2RCSL 4LLQA 4FFYL 1Y6NR 4QHUA 4XH2B 2JF1A 1MLCA 3O2WH 4J3OC 4FQCH 4JFPB 3Q6FA 4J3XA 1DSFH 3C5ZC 3D18A 2HA1A 2D9CA 3ZT7A 2P49B 1CICB 3HLAB 4JM2B 4FMFA 2C3HA 4IIQB 1BOGB 5F88A 4N0RA 4RGMB 5ALBH 4ZXBD 2P24B 3CVHB 3SE9H 3VFVA 3UPRA 2XIDA 4M7ZC 3FT3A 1FAIH 4P5TA 4QHNB 5L88H 3L7EA 4Y4FD 1BQHA 4HBQA 5C08D 5EPMA 4G3YH 4OKDA 5CINL 4G9FD 5J11B 4YO0A 3WLWC 3RIFF 4WHTB 1JWSA 3TP4A 1PKQE 4RMUA 5I76A 3MYJB 3O9WA 2AEPL 1UKTA 4LLUB 1GH7A 1T04A 4LLAA 5I1KL 3MREB 4PG2C 5DZNA 1GPOH 5M94B 2BOBB 3S88H 4YAQA 3FTGA 4DN3L 1OTTC 2VLJB 5D7JD 3VD4A 3GZKA 3RBSA 2MQ3A 1NGQH 4NYLB 5GRJL 1Z3GH 2GJZB 3OKKA 1N4XH 1U3ZA 4MXQC 1JPGB 4HUNB 4XPHL 3B2VL 2NTFB 2O5YL 4UT7H 3BRDA 4G8EA 4LLMB 1ZHKB 4J23A 5DR5H 1HSAA 4MNGA 1J9CT 4FQJH 1LE9A 4JPVL 4JRWA 5H2BA 1MHPH 1S5HB 2G75A 4PJ8A 1MIMH 4O00A 5FM8A 1M05B 2J5LB 4QEGA 2LE9A 2XA8H 5T3XE 4KZDL 3QQNA 5IJKA 1MCPH 4PRDB 1BIIB 5I6XC 1MCDA 5HDLA 4BQ6A 1T20A 4PJBA 2YD2A 4NWUH 3RU8H 1TCRB 3P11L 3SBWC 4ZXBA 5IJKC 3N85L 5HI4D 5IHBA 5FK9B 4IRJB 3UZVB 3NAAH 2EXYD 3GJEB 3HR5B 3IDXL 4KUCF 2CLVB 4CNIB 2EKSB 5HGBA 3CZJA 5TPWL 1YEKL 4WWKB 3VGAC 5DJDA 4NQVA 3QDMD 1AHWC 4QXUH 2G9HB 2OMBA 3ARBA 2QSCH 4U1LA 5HHQB 4TUKH 1EMTL 3GK8H 4HK0B 4A6YA 1OP3H 2C4XA 4PS4L 4EZMA 2H6PA 3LN5B 1QFOA 3HS0A 1CXEA 2F53B 2H41A 1UB5B 2X4TB 4NRYB 3ZHKA 4GG6E 4AIXA 2E7LA 2MPAH 4LIQH 5B38B 5ANMA 5T5NF 4PG2A 3WSQL 4BSWA 1ZT1A 1NUFA 3DYPA 1N64H 1LWRA 3VXNA 3Q0HA 2I5YH 2RFXB 1DBAH 1DN0A 1SJHB 2V17H 4MCZB 4HH9A 3MJ6A 1U92B 1IEAA 3O9WC 2X40A 4GAJL 3PWLA 4XVJH 4YUEL 1NLBH 5KSAC 3LKQA 5GRUH 4CVXA 1NGXA 2X4PB 3ULSA 1E27A 2C3VB 4J3SA 3BP4B 3SQOL 3SO3C 2CLZB 1AR2A 2IADA 4YGVB 3RGVB 2FBJH 4LASL 5C0JA 4I18B 2N7AA 2YD9A 4ZD3L 4KZEL 3LKSB 4JJHA 2AABH 1MQKH 3SKJH 3VFGL 4XI5D 4HWEH 5HD8C 1JK8A 3BD3A 2BMKA 3MBED 2CKBB 3S4SB 2VAAA 4WW2F 3MODL 4IHOB 1HZHL 2YEZA 1ORQA 3MBEB 1XCQA 1DBJL 5IHUH 3H6JA 3QPXH 4KK5C 1FVEB 3H9SB 4LGSB 5KSAB 5KJRH 2Y5TA 2NY7H 1NLDL 1KN2L 1W72A 2DWEA 3NABH 3K2UL 3MV9D 1Q94A 4M4PA 1H3UA 2QQNH 2X5PA 4K3HA 3TBVA 5CEXA 1K3ZA 3FQUB 3CDYA 4U1GB 3ULSB 3QNXA 2FX7L 4DQOL 4P4RA 5I73C 3I2CH 4PJ9B 1JGLH 3MBXL 2W9DL 5E1AA 4G6AC 3PWVA 3S3JA 5EZOL 1GYAA 3OKEA 4LLWB 2MHAA 1MVUB 4HWBH 3MGOB 3V4VL 4P46C 3L6FB 3WBDA 3SDAA 4UINL 4JFEA 5D96C 4OD1H 1T1YA 2PUQT 1KC5H 2YMXH 4RWYH 3U2SB 1RJYB 2Z31A 1P4BL 4PLNC 3RI5F 5C0RL 2F53D 1CF8H 3QPQD 3DMMB 4YX2L 5E6ZA 2C7UB 3THML 1U8KA 1A2YB 3MYZA 2Y36L 5E2WL 4HJGA 3PHQB 2GIYA 3MLYH 3REVB 1RZKH 1XZ0B 2LAAA 1JRHL 2WIIA 1JYXA 4KDTA 2VDMH 3C08H 5IW6A 1I4FA 1SYVB 4W6YB 1N59B 1XCTA 2HFFB 2FYYA 4XAWL 2GSIB 1CXHA 4KRPB 5BZWB 4U1IB 4XHQA 3MA7A 1C7SA 2EO1A 3ZLQC 1G1CA 5D6CA 4N0UB 3FCTA 1IAOB 5IIEB 3VU2A 2B2XH 2CDGB 3QFDB 5E1AB 5E2UL 2YUXA 3GJFK 4HUKB 4NQCE 1DVFC 3S96A 5LJYH 1LGVA 2ZSWB 4MVBC 5C8JA 1YQVL 4ZFFB 3RDTB 4HC1H 1CFTB 3L5WB 5DSCB 1OARH 1V3MA 4F7EA 3B5GA 3IXTA 5D1QA 1JNNL 5C09A 2Z93B 3PHOA 1UVQA 4R90H 3U0PA 2VXVH 1NCBH 3NA9L 1E28B 5FYJL 3GSWA 1S7RA 1XGPA 5I17A 3SE4A 4OZHE 1T0NB 2L7UA 3LZFL 4WEBL 1K2DB 4QO1A 3VXUE 1UA6H 4R2GB 2BNUB 4FXLA 5EOCL 3QEUB 2X89A 3D2UB 5EO1A 1S7QB 2R29H 4XB8A 4YK4B 1HDMA 3WDHA 1ZA6A 1A14H 3D48R 4X6CA 1KB5L 4Q9RH 4H25B 2J4WL 5IFHL 4OV5B 4PJ5D 5FHAL 1I8KB 5D93C 5CGMA 1UXWA 5EORL 3SDDB 3MUHL 4UV7H 4FZEL 1G6RA 3F12B 3TVMA 5MEQA 4L29B 2YXFA 5E5RB 3I50H 4M5ZH 1FNSH 3QUYD 2FO1A 1V3JA 4I3RL 3CCHB 4JFZH 1A6VL 4LIQE 4OF3A 5C0EB 1LO4L 5FOBA 1NQBA 1FGNL 5EU6A 1U8HA 3L3OB 1J8HA 3R06A 1A6UL 3WIFB 3ZT6A 4FG6C 4A6YH 5CP7B 4PB9H 3EDJA 4ELMB 2FDBP 1BQHB 1YN7B 2FWOA 3WEXB 4KMTL 1HI6B 1R3HB 1AY1L 3V2AR 4TOYL 3RWDB 4ZS6D 4U1NA 5J12B 3MRDB 1OCWL 5DD0L 3WL9A 3EYSL 1AI1L 3VXSB 4P2QA 3F7VB 4NZTL 3SKMA 4H8WL 3IAQA 3OR7A 1D9KC 3WDJA 1BOGA 1Q0XH 5DVMA 5F88B 3ZSSA 4HF5L 3V95A 3KPOA 1IM3B 2VR5A 3DV6B 4MGXA 1K4DA 1RFDH 1DANT 4GG6B 2XXCB 1JGEB 1C5CL 2CIKA 4L4JA 4U6TA 4XPBH 1FNGB 1OY3B 3GIVB 5EZIL 4XVUD 1UJ3B 1W2KT 4GXUM 4XC1H 1MJ7L 1YY9C 4PGCA 2DTMH 4I5BB 3H42L 3TBWB 2AK4A 4ZOAA 1X5XA 1RJCA 3QDHA 4Y19A 2XQYK 2ZUXA 4BFGA 4PB0H 2NY4D 4J6RL 2W0FA 4OCSH 5C0FB 2D3VA 3MLRL 3VFNA 4XMLH 4Y1AE 5CP7A 5EC1A 4XNZB 4NQCD 2IPTL 4GKZB 1JI2A 1F6AB 1BIIA 2GHWB 1TJIL 3AXLA 3P9MA 4WDIB 5D7IB 5HGDB 5IBTH 1XGQA 3CUPB 5DS8A 3MJ8A 1FV1A 2NY4B 1P53A 5FHBL 2AJVL 4NZDA 3MNWA 3K2MC 5D1ZD 1BPVA 2GSGA 4ERSH 3KPOB 2EEAA 4NP4L 5IG7B 3D85B 4HMCA 1RK0A 2ICWA 4JFFE 4HFWA 1KLFA 4X6FA 1MCWW 4LRNH 5BO1L 5JHDA 3QQ4B 3IFNL 4JY4A 3QULB 4KKCC 4LHJB 4ALAL 3IDGB 1TFHA 1RVFH 2CKBH 5GS1A 4KKLD 1PSKH 3L3DB 1CGYA 1AKJB 2PO6B 1QLFA 4NCC1 3ZZ1A 2R2EB 4WU7B 4ELMF 1TQBB 5FF6B 1CTOA 4ODTH 4K2UL 1DBMH 1O7VA 4QRSB 1X7QB 5EZJA 5JW4M 1S9WB 1I7RA 4EI6B 4LAJH 3OKDB 3Q5TA 3UTTD 4RGNB 4P2RE 3TF7C 1JPSH 3DUUA 3QIBD 2RIKA 1A0QL 3X17A 1U9KA 3KWWB 1GGBH 1S9KC 1DQQA 4MCYB 1LO2H 2WQRA 5B3NA 5C7XH 3SE3C 3IRZA 1JJUA 1SY6H 1WEJH 4JGMA 2AJYL 3CVIH 3B9AA 4HW6A 1SEQH 2ID5A 1E4JA 5F7FA 1KYOJ 5BRZB 4TRPL 4NUJA 1VCAA 2OLDA 3DLQR 1QLEL 2Q20A 5KG9B 2EDWA 3ULVL 1LO0H 5I8OH 1JPTH 2H1PH 2BVPA 2EE9A 4LSRL 2B4CL 2PXYB 4KV5F 4L3EB 3HZMA 1CE6A 3VH8A 2HH0L 5IVOA 2D7NA 3LRGA 3TT1L 2AQ1A 4UI2A 2BVYA 3BEVA 5DRWA 1AC6A 4RISH 4XPFH 1KBGH 5J3HD 1UZ8A 4OSUL 5IWLA 4BKLB 4KKAC 3IFOB 3CSGA 4JRYD 4ODVL 3BZ4B 3WO4C 25C8L 3NIFF 4WFFE 5ETUA 3VW3H 3AREA 3NPSC 3HNSH 4E5XA 2EDKA 4DGYH 5IFAL 2XPGB 5C07B 1PX4A 3QG6B 4Y1AD 4E42B 2J6EH 3B9KB 1UH3A 2VZOA 4KK6C 2ORBL 2X41A 3BT2L 3REWA 1BF2A 3PJSA 5EU3A 3O11A 1OB1A 2UWEA 3UYRH 4YZFE 1F58L 4NQED 1QFWH 1T7ZA 3QWRD 4QRPB 1YEDA 1NSNH 1HXMB 5D7IE 1JWUB 4NBXB 5IHLB 4G8IA 2X10A 5B8CC 2VDQL 3MR9B 4TUOA 5I73B 1A47A 1YJDL 1J0YA 1ZLWK 5JHLH 1C12B 3PWPA 4GT7A 2L4OA 4MXWL 3BJ91 1BFTA 4NRXA 2QV2A 4JRYA 3MV8E 1C08A 1JYWA 2DMCA 5IFJB 2I9LA 1OLZA 1NCCL 3RVUD 2V5SA 1YEEL 3FQUA 3FQWB 4JO3H 2OTWA 4H8WC 4DAGL 3BISA 1AJ7H 4M00A 2OM5A 3LKOA 1KV3A 1S8DB 4DVRH 1WBYA 2VLLA 1KJMB 1HHKA 1Z9LA 1FZKA 5GS0H 4KTDL 1OF2A 5IB3A 2VLMD 4OLXL 1I9RH 3T4YA 3PL6C 5GJSL 3BN9C 3HAEA 3GSUA 1YDPB 5GGRA 1VADB 2DQGL 2YK1H 2VE6B 4NZRL 1UWXH 3Q1SH 5ICYB 1LE9B 3S36L 4H1LH 4LEOB 5JIIA 3HMXH 1QFUH 2FLRT 4FFZL 3SDYH 2A1WH 3WE6B 3DX8B 1CFTA 4YC2B 2DQTH 3FB6B 1YN6B 4Z7UE 1C5DB 2VLKE 4KRNA 3OG4B 1KXTB 5BCAA 1JFQH 2AJSH 2VWEE 4Z0BL 4QF1A 1CICC 1MWAA 1IBGL 1EXUA 2B1AL 4WFHE 1Z0MA 4R0LA 3UJTL 3UTSA 1A22B 2CJUL 3VFTB 1RZIA 3CJJA 5ISZE 4FQHA 2WWKO 3EZJB 3C6SB 4E0RB 1MHEB 5D1QB 1N59A 4NQDE 4Y5YC 4FP8L 4MJ4A 3CFDB 2R0KH 3ARDC 2FH6A 3PQYE 1X5IA 4S11A 4H25A 1H15A 2H2SC 1P9MC 3KPRD 1K3IA 3M1BA 4BK5A 1DL7L 4PJAB 2EC9T 2ZKHH 2DM4A 3WV0A 3D2UA 5CBAA 5AZ2H 5EOQL 3RL1B 5IK3A 3WFDH 4GQ9L 4DVBB 4I77H 3OTTA 4ZOCA 4MQ7A 4LEOA 2IFFL 5E8OA 5E6IC 1FL6B 5JW3L 2G60L 3H7LA 2WUBL 3NZ8B 3BZ4A 3FT4A 4M3KB 5CWSB 2W65A 3D0VA 1EO8H 1G7JB 1YMME 1F45A 1WC7A 3HE6C 2AW2A 3WFCL 1K8IA 5EU6B 1DEEA 5L7XL 4NKQB 3V4PL 2ADFL 2OYPA 4BH8A 2PYFB 2EE3A 5DK0A 3BDYH 3NN8B 3HB3C 2WLZA 4WW2C 1T1XB 3AY4A 3DVNB 4LCWB 1MJ8H 3LN4A 4H5SB 3QAZB 2ESVE 1KENH 4U1MB 1HSBA 1F4WH 3MLSH 5IOPB 2GYSA 2HT2D 3V0VB 3GBNL 1HILB 5A3ID 4HZLB 3P77B 1CK0H 4TUOB 3OZ9H 4U05A 5KTEL 4DGIH 1EO5A 2Z8RA 2BSRA 4X99A 2F54A 32C2A 5HPMA 3RHWF 2ATKB 1DN2A 2EDHA 3GSRB 1JZ8A 5F1IB 4LCWE 4ORGB 1EGJL 4NUGH 1X5AA 4L1DA 1X5KA 1E4KC 4OZHA 5FDYA 3RTQB 4PJGA 3STZB 1UCTA 4WWKD 2FBOJ 1EBAA 1G0DA 4L4TE 1PYWA 4M61B 4NKOB 5DQDH 3OB8A 1FL5A 3C09C 4X4ZA 5BVPL 3IF1A 3O6FD 4JHWL 2BVQB 4MJID 1FYTA 2MTPA 4ZSOA 4YZFF 2A77L 3WNOA 3R0MA 4LPCA 5DC9B 4I0PC 4L9LB 3MROA 4NO3B 2NNAA 5DFVD 2P42B 1WAAF 3MNZA 1OTUD 3QO1B 5DRZA 5IVXA 3TV3H 4ZFZA 4FTVD 4DGVL 2ICEA 3MACL 5ICYA 3SOBL 1YPZF 3FOLB 3HR6A 4PJFE 3MV9E 1M7IA 3HFMH 3T2OA 4UTAL 1AXSB 1L7TL 4F7CA 4X80L 1QPXA 2BX5A 4IDJH 4WFHD 4HKJB 3BHBB 2BOBA 3ARSA 2O61A 1C5BL 3D3VD 3TZVD 4HPYL 4YXKH 4DN4H 4LAQH 2P8MA 2YA1A 2AP2A 3SDAB 5D4QA 4Z7QF 3GMOB 1KGCE 1L6ZA 4AYFA 4DUVA 5B8CA 4YWGH 5LWYH 2GAZA 4R7DB 1DFBH 1MFBL 4UDTB 2AK1H 5GZOC 4D9LL 5A2IH 3OAUH 2EEBA 1UYWL 4L8SB 5GSVA 1NJ9B 2J12B 3QXDA 5F8RC 2VL4A 5D5MF 4WCYL 4R3SA 4GRLC 3T09A 2NY0C 4YNYB 3QZWG 1NGWB 1XGUB