3B83A

Computer-based redesign of a beta sandwich protein suggests that extensive negative design is not required for de novo beta sheet design.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
95
structure length
95
Chain Sequence
MLQPPFNIKVTNITLTTAVVTWQPPILPIEGILVTFGRKNDPSDETTVDLTSSITSLTLTNLEPNTTYEIRIVARNGQQYSPPVSTTFTTGSLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords TEN-D3
publication title Computer-Based Redesign of a beta Sandwich Protein Suggests that Extensive Negative Design Is Not Required for De Novo beta Sheet Design.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 95
sequence length 95
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3b83A00
1BEYL 2OZ4H 5E5UB 2VLKA 1WCBA 2Q20A 1LGVA 3PL6B 4C83B 2R2EA 5T33H 4KJWD 4LNRB 3N50A 4ODUB 1SYSA 3WV0A 2X4TA 2RJMA 4BFIB 4PJ8C 3QEQD 3LHPL 4QHUA 3S5LG 4NPYA 2QSVA 4YEFA 3HUJB 4LPUA 3R0MA 3UTZB 3NIGE 3WIHL 2WWKO 1GZQB 4ZFZB 3RI5K 1T0NA 2XZQL 5I76A 3QWRA 2B1HH 2HRPL 3QQ4B 1KPRA 3HHRB 5HI4C 5JORB 4X6CA 3FONA 3FB8B 4WUUE 3E6FB 5C71A 1EO5A 5D8JL 1KJ2B 2UY7A 3C6LB 2VL5A 4I48B 4F37F 3FZUC 3HC4H 4OF8A 1N0LA 2YPLB 1C5CL 3VXRA 3RVXD 4PRHA 5J13C 4HKXA 4KJPC 4NO3B 4LKXB 3QQNA 4KUZH 3DUSA 5FA3A 4QOKE 5KANG 1FN4A 4L8DB 5GRJH 1QYGH 5ICYB 5DRXB 3H3KA 1NANH 3PIQB 1UKTA 4YHPB 2YMXL 3OKMA 4HBCH 4KI1A 3CVHB 1R3LB 4LSTH 4ODXB 1AFVH 3SDYH 4QF1B 3I9GH 4NT6B 2FL5A 3D0LA 1CLZH 3IJHB 5SX4I 4A2LA 1X3DA 1U8IA 3MTRA 4NNYA 3MUHL 5GSVB 2D0GA 43C9B 1IEAB 3CVHH 4K9EH 4OZ4A 2BSTA 4E0RB 4LLMB 5E8OB 2MHAA 3MFFB 2FATH 4HJGA 4X7DC 3VXUE 5I2IA 1OF2A 4YFDB 4RGOL 2O5ZL 4KROC 4MDJB 3WS6A 5AD0A 4JFHE 2IH1A 2HTLC 4DZ8A 4QOKD 3VCLA 5SWQB 3UDWA 4JLRA 3TPKA 3ZT5A 5JR1L 1VFOA 4G6AC 5T1KB 4PG2C 4KXZH 4PRBB 4QCIA 3VGGA 1K8IA 5IGXH 3ZHKA 3V8OA 3T4AB 1EAPB 3BGMA 3QUYB 4OCLC 5CCKH 3EGSA 3JSSA 3ZSTA 2PTTA 4FOMA 1AGCA 4QRTB 5DR5H 4L8BA 4FQHB 4CJ0A 1U0QA 1I9JL 5J11C 4Q0XL 4EQ3A 4QHMA 2AJXH 1BHGA 3O9WA 3ZDZF 5DJCA 8FABA 1CDUA 2VDKL 5KSVA 2E7LA 3QO1A 3RKDC 4YQXL 1AIFB 4MXQD 2Q6WB 4WV1C 1BVZA 1CLYL 1QA9A 4K8RL 4YFEA 3WBDA 1DFBL 5EO1B 2FGWL 3UYOD 1MAMH 4NRYA 4DK3A 4UOJA 1RUKH 2ZSVA 3QDME 4GXVH 4H88L 4NOFA 4U1MA 2DWDB 3OF6D 4LPCA 3D6GA 4D3CH 4G7YH 4JFHD 1T22B 3MREB 2W0FA 3OX8A 4CU7A 1DN0B 3TYFB 2EE3A 3FO9B 3U9PH 1HNFA 2CJUH 4IJ3C 2APVA 3QHFH 5IVNA 3UP1A 1I85C 1A5FL 1MIML 3H3PH 1NGXA 3V0AC 1WAAA 5C0FA 3S34L 1NGWB 3O6KH 1PJ9A 5FAAA 2F54A 2AERT 1JZ6A 2WUCL 1JMXA 32C2A 4NQSA 5MEQB 4KKNA 1HYRC 3QEGL 7FABL 2KZWA 4DCQB 1JJUA 3BKYL 5C0IB 1A7PL 5AZ2L 4ZNCD 3QI9B 3B2UD 4FN0A 4U2YA 1R24A 3VFUA 4NO0D 3M1BB 1G9NH 1ZLVH 5CZKA 2FX7H 1QRKA 4PFEA 5J9PA 3QDMD 4MQSB 1XIWD 4OF3A 5EA0L 4HS6A 5HHNA 4IEFB 4DVBB 3CU1A 1HN1A 5IK3A 1G0YR 1V3MA 2YUZA 5JLZA 4ETQA 4LEOB 1OY3B 1A6WL 1BREA 1R5VB 5B38G 2PXYB 3LEYH 4JCLA 1EEYB 1NFDF 4OCXL 3BH9B 1RVFL 2J8UF 1S7TB 4TN9A 2Y7QB 4L1HA 3MJ9H 3CU7A 1T20A 1BP3B 5F6HI 2Q8AH 1FORL 1NCWH 1BX2A 3FT4A 3HNTH 1UQSA 3RVXC 1JRHI 2FWOB 3GI8H 4KK5D 4EI6B 3D3VE 4P3CH 4LHUB 4FQJL 1N5YH 3NIFE 4PTTB 1Y6MR 4MA8H 3GSVB 3FMGH 4OQTH 4KAQH 4LLUA 5ACZB 1ORSB 4NUGH 1CFQA 3KYKL 3O6FD 4IOSD 2DQHH 4EXPX 1VENA 4JFFA 1PSKL 1CS6A 2X9YA 2NX5E 4XCYA 4XWGL 1F6AA 1X5AA 1NH6A 3EO1A 1BIIB 4HT1H 4GW4B 2JCCE 1JHKH 1IMHC 2YA2A 3OGCA 5E2WL 4I0PC 4GG6A 1YPZE 5LBSH 2F5BH 3PV7A 2HMIC 4QHKJ 5IMKA 5C92A 3FO2A 1JI2A 5CGMA 3GSWA 3D39B 1P69B 4OZGE 3SHSA 1I7ZB 1IBGH 1WFNA 1GCFA 1U8KA 4ZUSA 4K71B 4MZ3A 2H2PD 5C0BA 4XBEL 1JNNL 2ZCHL 3D3VD 1FFPA 4YDJA 5EC2B 1JNJA 1ES0A 1XEDA 3PWUB 3FB5B 3PGCB 4OI9A 3QDJB 4PJCA 2CH8A 3INUH 5D7JB 4ZDHA 4HV8A 5EOQH 4LP4A 4JRYB 3HG1B 4WWKA 1HSBB 4PJFF 2CXGA 3IDXL 3SKUD 2B4CL 2B0SH 4ZFOL 2ADIA 2X4PA 4DOHB 4AJ0A 3T2QA 4KZDL 1GGCL 4W6WB 3A6BH 2X4OB 4ZD3L 3TZVD 5KAQF 2ATKA 5ALBH 1UACL 4CMMB 4UQ2A 1IAOA 1TJGL 3FOLA 2DLIA 3HAEA 5TH2A 3MV7E 1M7DA 3WFBL 1FVCB 2WM0A 4MXQC 1KGCE 4NKIL 2OR8A 3FQUA 2BSSA 1EHXA 4BQ8A 2EIDA 3Q3GA 5HTSA 1P4IH 3TO2A 1E6JH 1FO0H 5JW3H 15C8L 1A3RL 4HAGA 4U33A 4YE4H 4CVZB 1IKFH 3CX5K 4M1GH 4P59H 4ELKA 4OCYH 1JPGA 2YPVL 4HUUB 1GSMA 3KXFD 4KUCD 3LEXA 1VEOA 2VDPH 4A6YL 4EDWH 3IF1B 4XP6L 4G8IB 5DFWH 5FGCE 1I7RB 3F7VA 5L88L 2ICCA 2Z31D 1JPTL 3EO0A 3N1GC 4PJAA 3SDAD 3V79C 5DGQA 4OD2A 4CADA 4YBQD 3W5NA 4NHCL 4FQ1L 2R1YA 3H3BC 2Y9RT 2XQBH 4G9FB 1LO3L 1A7OL 3MV7D 1ORQB 4OZFG 3EYUL 3LN5B 5BO1H 1HKFA 3B2UC 5DS8A 5ETUB 1IC4L 2OQJA 1X5HA 2JIXA 3ROOA 4QRSB 3WS3A 1X6LA 5MERB 1AO7B 3W81A 4KY1L 3RWGB 1MEXH 2VLKB 1FE8L 1KCRH 1XIWC 3CSPA 4JHZA 3OB0K 5DD5L 1QFUL 1QHOA 4WO4D 5HDQH 4XCEA 2R2EB 2WSKA 1U8QB 1V7NL 3ZKNC 1EEZB 4RFNB 1SYSB 5JDJA 1FRGH 3T0BA 2X4TB 3T4YA 3H9ZA 1WTGT 4OSUH 4FRWA 4NPYB 3K74B 4PJIA 3TBWA 3B2VH 3QUZA 1RJYA 2PYEA 2EKJA 3LRGA 1E6OL 2IC2A 4PRNB 1NC4A 4KK5C 3RDTC 1T0NB 5I76B 3KJ6L 5DZOA 4G80A 1PDKA 4HQQH 3OTTA 1KPRB 4X6CB 3FONB 2DJ4A 2CK0H 1SHMA 1A7NL 2VL5B 4Y7MA 1EMTL 2B8OT 3WEXA 4IHOA 1NBQA 3BT2L 4U1LA 4LIQL 2GJJA 3BQUA 2VC2L 3VXRB 5E03A 4PRHB 4IOIA 5HGHB 4HKXB 2VQ1A 3QPQC 3HMXA 3DUSB 5FA3B 3VRJA 2AAVA 1FN4B 2QHRH 4OD3L 3WHE1 3QFJA 5E7BA 1HK6A 3JTSA 3OKMB 8CGTA 1NBVL 4UNUA 1BVKB 5HXMA 2X41A 4MA3A 4KQ3H 3IAGC 3O6LH 1BJMA 2QL1A 2FL5B 5BRZE 4GRWE 3K4DA 3WFDL 3D0LB 4NFBA 4TSAH 1U8IB 2H2PC 5F7HA 1BZ7A 4J3WA 4NNYB 4U1GC 4Q2ZA 2NY3C 4YHOL 3HA0A 5TQ0L 4OZ4B 2BSTB 1R3IH 1VACA 5DA4A 2DQGH 4XPFL 1RURH 2MHAB 5CJ8A 1T04A 1S9YA 1JGVH 4HJGB 4HWBL 1TTUA 4Z7NF 5I2IB 4AEEA 1OF2B 4HEME 4MCZA 5INCA 1E28A 4U1JA 4XCFL 4XP1L 5CLTA 4NWTH 1GGYA 1I7UA 2V7NA 1IKNC 5AD0B 3ARFD 3VH8A 3TZVC 2C7UA 1N3NB 4ZPVA 1DANT 4DZ8B 3VCLB 5JOFA 4JLRB 4LSVH 1UEYA 4G8GA 4M3JA 2NY5L 3EYVB 3ARWA 3VXQA 4EIZC 3GBMH 4H0GA 1ZLWH 3DIFA 4QCIB 1K8IB 5FGBC 5FYKU 4FQIH 1P5VA 3I50H 3BGMB 2PTTB 1P6FA 1AGCB 1BD2D 1MI5A 5C2BH 1G6RB 3RWHB 1VA9A 4L8BB 3MUJA 5BRZD 3NVQA 5CGYD 5DRZA 1J05A 2AVGA 1H3PH 1VGEL 2XFXB 4MAUL 4QHMB 5GZND 3O9WB 3SKOA 4A2MA 4JGMA 5DJCB 4E41D 5C9KA 5KSVB 3BW9A 3QO1B 1G6RH 2VDRL 1QA9B 1MLCA 3CVIL 4NRYB 5HHOD 5FO9A 1TPXC 2X7LA 2ZSVB 2Z31C 2HVJA 1S9VA 2AI0L 5D71L 4U1MB 3SDAC 1J0ZA 1S7VA 2AJUH 2W0FB 3OX8B 5F7WC 4AT6A 2YWYA 1T66D 2J88H 2IQ9H 1C8PA 2A1WL 3GIZH 1S7SA 4YHLH 4HIJA 2AJ3A 1CLOH 3QWOA 4L4TA 4M9OA 4ETYA 2R9HD 2YEZA 3MA7A 3GHEL 4O51A 1OAUL 4UIKL 3B9KC 1E27A 1LVEA 1RIUL 3REWB 2EH7H 4FFYH 4X4XA 1LDPL 1NGXB 2APFA 1X4XA 5C0FB 4S11A 4WY7L 3K8KA 2F54B 5I9QB 1FNSL 1JYXA 32C2B 1FFNA 1PVHA 1MCBA 5DRWA 3SGEH 3NZHH 1UWEL 3OKKB 2F8VA 5DT1L 4GW5A 1R24B 4JY4A 3VFUB 1QBLH 5DWUH 4S0SD 4KI5F 3V7MA 4XNXH 4HIIA 2DB8A 3MV8E 1J87A 2GHWB 5I1IL 1OPGH 3DX7A 5J9PB 2IAMA 2DJUA 3U4AA 3WCYA 2C3XA 4PGDA 4L4VA 3U0TA 3L5WB 1OM3L 3JZ7A 4Y4HA 5F9OL 3ULUH 2DJSA 2J4WH 1MRCL 5IK3B 5ANME 3TT3L 5TQ2H 4ETQB 1ZGLB 4BYHA 3MOAL 1ZHNA 1J0KA 1CXFA 1FVDA 1NEZG 1GC1C 2Y36L 2V5YA 5F70A 1NMBH 2VXSL 4Z0BH 4WFGE 3VA2C 3B43A 1T20B 2HT4D 1F13A 3M8OH 2XWTA 3VWKB 3L3HA 3A6CL 4TRPH 3BGAA 4LDLB 4LOUD 4O5LH 4TVPL 4Q9RH 3ULSA 5E5MA 3FT4B 1AD9A 1UQSB 4Z9KB 5DD1L 2VL4A 3GSUA 3D1MC 3EYFA 3SKNA 2LAGB 1XCTA 4URTB 5J8OA 4M1DL 2ARJA 3FB6A 4LLUB 1RZ7L 5SWSA 3QUMA 4DUWA 5ESAA 3A67H 3UJIL 3K81A 1CFQB 5CJQL 2JE8A 1X5YA 3QIWD 4YXHL 3MV8D 4JFFB 4CU6A 4F3FB 4XCYB 3UTTA 1F6AB 2ZP0T 3EO1B 2NY2D 4R26L 3LH2H 4N9OB 1A1MA 3OG4B 5GHWL 3VD5A 4KHXL 2AV1A 5L9DL 3WJLC 3OGCB 5L2KA 4GG6B 2V7HB 3AAZA 4OLYL 2HYMA 4BM7A 2HLAA 3HNSL 5E08H 3MCLH 3RY6A 3KDMB 4ACPA 5IMKB 5JIIA 3FO2B 3KPRE 1EJOH 5DK2B 3BVNA 4WEBL 5FECA 3BI9X 3IDYC 3DUHA 3ZO0A 2ICWA 1G1CA 2DM4A 4WI5A 3KLHD 1U8KB 2MKWA 3DXAE 4BUHA 4J4PA 1I8MA 1KTDA 4ZUSB 4XI5D 1IM9A 3FFCE 4JQXC 5C0BB 2OS7A 3RIAF 3ARFC 1FFPB 3T2NL 4YDJB 4QO1A 1OAKL 1ZE3C 1ES0B 3HKFA 4RGMC 5E8DL 3RWIA 2IGFL 1YJDL 3CC5A 5JO5A 3MPCA 1ITBB 5C07E 3VGAB 1LEIA 4PJCB 1M05A 2XZZA 4GKZA 4HV8B 4ZDHB 5C0AD 5D2LF 2DM3A 5GGVY 1U41A 2ADIB 2X4PB 4W70A 4JQIL 35C8L 4PBWD 4HSQA 4LL9A 1T5XB 1F97A 3B4NA 4R9HA 2ATKB 4HUNB 3S37H 5GZNC 3MLZH 2Q76B 4UQ2B 3K3QA 3C09B 3FOLB 3FQTA 5A2LH 3HAEB 2DYPA 4FXGA 4OAWA 3REVA 1M7DB 2DQTL 3HC3L 1GAFL 3KPRD 1I8LA 3FQUB 5DYOA 4UNVA 2BSSB 1FV1A 1OSZB 1M7IA 2BMKB 1F11A 4LFHD 3DXAD 1CDGA 1HINH 2P5WA 2ZUUA 4PY7A 1ZLVK 4LRIC 4D2NA 4Z7OE 3P0VL 1TETL 1T66C 1T2JA 2DBJA 4Z95L 1JPGB 5C07D 3CXHK 4MWFA 2BVQA 4QRPA 2O61A 2C26A 2R9HC 1NLBH 3O2VH 3I2CH 5T3XL 3WXWL 3F7VB 2DIAA 2OTUA 4P2RA 2B5IB 3NFPA 4TVSa 3EO0B 4PJAB 2EDWA 1QLFA 4JFPA 1FQ9C 2VJXA 4OD2B 4CADB 4Y1AD 3QIBC 1KB9J 2R1YB 2NXYB 4N0YL 4F80A 1MHEA 4FP8H 5DS8B 1S5IL 2OQJB 4Y2OA 4X9HA 5C09E 2JIXB 3CSGA 3O8XA 1LO2L 4Y16D 3ROOB 1LK3H 3WS3B 3LDBC 5J57B 1I1RA 1LK2A 1RMFH 3OPZL 1YQVL 4OBRA 4UBDC 3WO4B 3C5ZD 4GBXA 2ZCLL 4XCEB 4YK4B 4M7ZC 1D5BB 1AR2A 5FIEA 5TPWL 4R2GB 2HKHL 4JFED 2PF6A 3K2UL 4QXUH 3R06A 1J88A 4BQCA 3EO9H 4G9DA 4HH8A 1YYLH 3G5XA 1MFBH 3FN0H 2DLGA 2HT4C 4KRPB 4PJIB 1TZGH 3TBWB 1GGIL 1WQVT 3QUZB 4K3JH 1RJYB 4X7TA 4XVJH 2XKNA 4LOUC 3U0WH 5DJZA 1NC4B 3RY4A 1V7ML 4JM2C 2NTSP 4G80B 3AS2A 4YC2C 4HK3N 4KVCL 3V9FA 4XZUA 4Q6IC 5I6XB 5C09D 4KH2A 43CAA 1NCTA 2ID5A 1P1ZA 3QIWC 3OJMB 3WEXB 4OKDA 4WW2C 4ZSOA 4JHBA 4IHOB 2HT2D 1YC7A 1KCSH 4U1LB 5DC0A 3BQUB 4IOIB 4CDGC 4XPHL 2VQ1B 2UWEF 2V9RA 2J2ZA 1ADQH 2C9AA 2FDBP 5I8CA 3VRJB 1BECA 1QQDA 5D1QB 1QP1A 3VDAA 2DLFH 3QFJB 1RV6X 3D69A 5FCUL 5CP3H 1OQXA 1ZWIA 3JTSB 4LGPB 3QIUA 5F1IA 5F89A 2VZTA 3HMXH 4MNGE 5F3HA 4HC1L 3LQAH 1QSFA 4LAQL 4M93B 4MA3B 1KLFA 3KLHC 1KJ3L 2HFTA 1TJIH 3UJTH 4XI5C 2NXZC 5I1HL 4KV5F 1BZ7B 2BOCA 2O5YH 4Q2ZB 4PPTA 3O81A 1H3XA 2AJSH 4KGLA 4UNTA 1VACB 2X89A 1KJ2L 4NOBA 4YWGL 1T04B 1S9YB 4WGWB 4DW2H 4JVPA 3OXSA 4WJ5A 3TYGH 3T0WA 1E4KA 4MCZB 5I30H 4U1JB 4R6UA 5KSBF 2DICA 3MJ6A 1HHJA 1I7UB 2V7NB 1P7QD 4OQ1A 5I17A 1G84A 3ARSA 4LSPH 1XGYL 3VH8B 2ZJSH 4PJ9D 5FGRA 1S9KC 3EYOA 2C7UB 4ZPVB 5JOFB 1EGJH 4G8GB 4K7FA 1DBJH 4OKVA 4YHMH 4P9HH 2VYRE 4AIXA 3VXQB 2E8ZA 3DIFB 5I71C 5EPMA 5K9KA 1BQLH 1G7HB 1MI5B 4LSRL 4PLJD 4KRLB 4G7VL 5DJXA 4G6KL 3T0AA 4TSBL 2LU4A 5DRZB 4PD4K 4H26A 3SKOB 1RZGA 2AQ2A 2AEPH 2GW5A 4MAYA 1CFVH 3BW9B 3WNPA 1DQMH 2PYFA 3MLWH 5A2KH 4CDHA 1DSFL 4WUKL 1MLCB 5FYJH 3S97C 5EU6A 3S3JA 1D5XA 1NFDE 3D25B 4P5KA 1JZ8A 2X7LB 1LWRA 4LHUG 2HVJB 1S9VB 5F44A 3Q6GH 3VXSA 3F7PC 1S7VB 4AT6B 5DHYA 2XXCB 4GFTB 2YBRB 1OP5K 1CGSH 4QHKI 1G7LA 2IF7A 4HIJB 1CR9H 2AJ3B 4L4TB 2FB4L 1S78D 3QSKB 2YEZB 3MA7B 2Z9TA 4XMPL 5I75C 3V5KA 4O51B 1KENL 1E27B 4H8WH 4WFEE 1G7QB 4Y16C 4WTWA 1XGRA 3C9NA 4X4XB 4R90H 3I6GA 1I1YA 1RUMH 4R7NA 4TOYL 3GNMH 3UPRA 1KNOA 3C5ZC 5D7SH 5D7LA 1FFNB 2X05A 5IBTL 3ROLA 4H25A 3UROR 4ZFFA 1PY9A 5DRWB 4NQEE 2WMPA 3WLBA 4GW5B 4JY4B 4JDZA 4HIIB 1CTNA 4I2XA 3E1F1 5DC4B 5TF1H 3BPLB 5CZVH 5CD5D 2EE6A 3DX7B 2IAMB 3ORJA 3G6AB 4PGDB 4L4VB 1QHPA 4Y4HB 2X70A 4TYUA 4H20L 4YDKL 4ZMAT 1CF8H 1KTLB 3H42L 5HGBA 5DUBA 2X9XA 4NYLA 5A2IH 2R4RL 2W92A 3QB7C 1BPVA 3V6FA 1ZHNB 3E3QE 1B4JL 3WHE0 4Y5YC 5ISZA 4ORZC 1FVDB 2VITA 3TFKD 3QCTH 4WFED 4NNPH 1LE9A 2UVEA 3DWTA 5T1LD 2A6KA 2XWTB 1G9NL 5IUSA 3L3HB 2HT2C 1QG3A 3QRGH 4YHZL 3ULSB 5E5MB 1AD9B 1I1CA 3JV5A 1UKSA 5MEPA 5EU4A 3GSUB 4EN3B 3EYFB 5FV2A 4N68A 1L0QA 3SKNB 1XCTB 4OCSL 1RIVH 3HPJA 3OR7A 4NQED 2ARJB 2G75A 4APQA 3SE3A 2X4UB 4OCMC 5SWSB 3QUMB 2XKUA 4I13B 5ESAB 4PJDB 4NZTH 4BZ1H 2VE6A 3EZ8A 5IHUL 2X4RA 1NBYA 1FFQA 1TVHB 3UTTB 3VFVA 1ZLWK 2P5EB 3TIEA 5IESH 5FUOH 4CNIA 1QSEA 1AI1L 5DGRA 1A1MB 4RX4A 3QUMH 4B53A 1A47A 3G9VA 4I3RH 5E70A 4XX1G 5C70A 1KB5H 5L2KB 2R23A 3AAZB 1KB9K 5GS0L 5T3ZL 2HLAB 3V6ZA 4KHTL 1ERNA 5IQ7L 3C2AL 3ZKXC 3BVNB 5FECB 3O41A 3ARGA 4WNQA 2ICWB 4KKBD 5LGKA 3ZHLA 4YX2H 1I8MB 1KTDB 5GRZA 1IM9B 2VDOH 1ROWA 1S8DA 3TBTA 2EXYD 3CC5B 3ARED 5JO5B 2C4FT 4S1SH 3GHBH 3MRBA 3SN6N 3ZYZA 3AM8A 4GKZB 1QFWL 2W9EL 3B5HA 4ISVA 5HGDB 1MVUA 5AZEH 3R1GL 4KZEL 4PLJC 1T3FA 4R4ND 5JQ6L 1J86A 3CMGA 4JREC 4NC2B 3HE7A 4V1DA 2DBLL 4KU1A 5TGBA 1DP0A 1CT8A 1T4KA 4DGYL 1A6ZA 1FC1A 2DYPB 1MCOH 4OAWB 4HIHA 5EC1A 3REVB 3EYSH 1CL7H 2ESVA 1OAXL 5EO0A 3LMJL 5DYOB 2NY4B 1FV1B 3IETA 1AGFA 3MLRL 4NM8L 1GH7A 3BPCA 3QO0B 1F11B 2P5WB 4PY7B 3F65A 3CDFA 3DJ9A 1ZVSA 2NY7L 1DJSA 2IQAA 5D5MF 5DK3A 4Z7VA 4MWFB 2BVQB 4J8RA 4QRPB 2O61B 4K23L 3WN5C 2AABL 3MACL 4JO1L 3BKMH 4P2RB 2OTUB 1GIGH 3NFPB 4UTBL 3S36H 2FD6H 2C1OA 4JFPB 1GRWA 1J1XL 1I3RA 3J8F7 2FIRT 2B7DT 5E9DB 4PJBF 5EB9A 4CJ1A 1MHEB 3Q0HA 5DRNA 5D7IE 4YLQT 5JXAH 5C1MB 3O8XB 1CDBA 3DI2B 2H6PB 3FN9A 1YNTA 4EDXA 4FQLH 3CFIC 1FL6A 5CD5C 3BEWA 1LK2B 1A2YA 2VH5H 1JGEA 4X7SH 2OSLB 3X3GH 1OT1A 1ZK9A 4GBXB 1L7IL 5TFSL 1WBXA 1TQCC 4DFIA 2R56H 3R06B 1UEMA 5EIIA 2ED8A 4OIIH 1NL0H 4G9DB 2VZ3A 5C0CE 3G5XB 1EZVX 3TFKC 1I9RL 4X4YA 3BP6A 4FQ2H 1EFXA 1NC2D 3SOBH 3NCFB 4F9PC 3NA9H 4GMTH 5JHDB 4OLWH 4U1IA 5KVGL 4X7TB 3R0NA 2XKNB 5AG8A 2FEDD 4PJ8A 3X14A 4IRJA 2R0LH 5DJZB 5ADPH 4AYFA 2XRAH 1EZVY 1JPST 5GGSY 1H3WM 4KDTC 1F00I 3I3BA 4XT1C 2AJVL 5TDPA 3L5IA 1NGPL 1H8SA 43CAB 2C3VB 3BMWA 5I74B 1P1ZB 3STZB 4ZSOB 1FRGL 4K2UH 2XG5A 5IFJA 5DJAA 1MCEA 2ZNXA 1R0AH 2Q86B 1MH5A 4DAGH 2FZ3A 1A14H 2ZZUT 4Y2DD 1ACZA 3TPUA 3W0WA 1INDL 5C6TH 3MBEC 5KVEL 2A38A 1QQDB 5FYLL 3AMKA 3QULB 3VRLE 1FAKT 3E3QC 3D69B 4P5TD 1A9BA 4M7LL 1ZWIB 3Q6FA 5C0CD 3VI4E 2BVTA 3QIUB 5F1IB 1QRNE 5F89B 2BY2A 4OF6A 5F3HB 4Y5XA 1QSFB 4AIOA 3MXWL 4WU5B 4KKBC 3TGXA 1E4XH 2R8SH 2YXFA 4Y4FA 4FMFA 4P0DA 1B2WL 2P47B 4JY6A 2BOCB 1CE6A 1KXQE 2YXMA 1IEBA 3H7LA 3I84A 1XF5A 3AREC 4XVUC 3WE6A 4U1HB 1F3RB 3K1KC 4LAJH 2R4SH 5EUOA 4DTGH 1MHCB 5IEHA 5CILH 4U05A 3OXSB 4LK4A 3GIVA 4WJ5B 4X6DE 4XP5H 1WT5C 5D1XD 1I1AD 3ZTJH 5C0DB 4KTDL 3HUJF 3RX7A 1U8OA 2OL3A 5GGVH 1P6AB 4R4NC 3RUGE 3GM0A 4LVOB 3WDJA 2BHZA 3EYOB 5IV2A 5K59F 1ETZA 5D96B 1BAFH 4K7FB 4OKVB 2J8UA 2ZKHL 3MLVH 4U31A 2AEWA 3U1SH 2XWBA 1NCDH 4KVNH 3ULVL 4YDLB 4P5MA 2D31B 1QRND 1RPQA 1C1EL 5DJXB 3L9RA 1KBGL 3QFDA 1NLDH 4H26B 4GAGL 5C2UB 1A6TA 1FPTL 1RZGB 2CDEA 3H9YA 3IGAB 3ARBC 4JKPH 3H2WA 5I8KH 4WCYL 2F8OA 4UB0L 4U1SA 1NGZA 3GSRA 1CU4L 2ICWJ 5EU6B 4X7EC 1D5XB 2WUBL 4IS6B 4P5KB 2YRPA 4O02L 5CMAA 5I18H 4D0DA 3VXSB 3WUZA 3L3OA 5IBUB 4HKBA 5DHYB 4HUKB 4K8RD 3OAUL 4JPWH 2G60L 4OLXL 3CLEH 5A2FA 1G7LB 4GQPH 2PTVA 3GBNL 1MRFL 3V5KB 3F7YA 5K9JH 4OTXL 1SBSH 2VDQL 1XGRB 2IWGA 3C9NB 3AMLA 4DEPC 1LEGB 1T6VN 3I6GB 1I1YB 1GXEA 4LSQH 5F7EL 2BNRA 4R7NB 3GSQA 4ZOAA 5HY9A 3PE9A 4KPHL 1K9TA 1KNOB 4ELME 5KANI 5D7LB 3ROLB 4H25B 4ZFFB 4F7MA 5L0QC 4GAJL 5L7XL 3WLBB 1A8JH 3PV6A 1VFMA 5F96H 5F1NA 1KEGH 5C3LD 4I2XB 2QQNL 4L9DA 3E0GA 1MVFA 1ACYH 3DVGB 4M6OL 4ZODA 5KJRL 2FEDC 3QEQA 1K6QL 4UUJA 5HGBB 3BAEH 5DUBB 4NYLB 1S3KL 3G6JE 1C16A 3RPIA 1CQKA 4XNZB 1MFCL 5I16A 3V6FB 5ISZB 2QSQA 2VITB 4NCC1 5HGGS 1LE9B 2A6KB 1FYHB 5JW4Q 4ZS7H 4ZO6A 4PRAA 4OGXH 3TF7C 3HAEG 5EU4B 4HJ0D 4Y2DC 2I24N 4Z78A 2H1PL 3HPJB 3OR7B 4LKCA 2NY0D 2G75B 4XXCA 2EE2A 4APQB 5IB2A 5MENE 2VE6B 3U2SA 2X1OA 3D0VB 1U92A 4M1CC 2X4RB 3AU1A 4AEHH 1NBYB 3HMWL 3TIEB 1AY1H 3QHTC 4CNIB 1QSEB 5HDBF 5E6IC 4MNQA 2V5MA 3LKOA 1UA6L 4X0KA 4Q9RL 5E6ZA 5HVWA 5KVFL 5EWIH 1DN2A 3OSKA 1ZANH 2GEEA 2GUOA 3V6ZB 3HE6A 1FYTB 3L3DA 3O41B 3KJ4B 1KIUA 25C8L 3IU4H 1JGDA 3ARGB 2ZG1A 1I1AC 4OGYH 4WNQB 5IVZA 3SE9L 4TQEL 3FL7A 4GXUM 5C86A 3ZHDA 4AH2A 1DQQA 5DVMA 3PDGA 1BBDL 1A1OA 4JJHA 4DKAA 1S8DB 3DX6A 3TBTB 1VEMA 1OGAD 3PDOA 4BQBA 3MRBB 1UKQA 5IVXF 1QEWA 4HX1A 5MEND 4M62L 4DVRH 3SCMD 4ISVB 4TTDC 1F4WL 2D9CA 1MVUB 3BDYH 4LU5L 3L3GA 2MCPL 4U0RC 3ZT6A 2VLJD 1ZT1A 1T3FB 3K8MA 1WIPA 1Q9LA 2ZPKL 3HE7B 4KK6D 4V1DB 1N64H 3PDDA 3BPOC 4RIRA 1CT8B 1T4KB 4X80L 3GI9H 1Q1JL 1A6ZB 2BSED 1A4JA 2F58H 4HIHB 5EC1B 5HI3D 5EO9A 1T2QH 1MCKA 2ESVB 3V4UH 1VFBB 4ZXBD 5EO0B 1FGVL 3BE1L 3P30H 5HYJA 3IETB 1AGFB 3RTQD 1N26A 1F6LL 5E6YA 2ZWLT 4PJGE 3BPCB 2Q1EA 3QT2A 3L7FA 1HWGB 5FHBH 5HVHB 1ZVSB 4JR9H 4K8RC 1MOEA 1P4BH 2IQAB 1UB5A 3OF6A 4Z7VB 1QFOA 4YUEH 3EYQD 2RFXA 4J8RB 4C4KT 4KMTH 5FHAH 2F5AL 1JF1A 2JELL 3GSXA 2R39A 2E9JA 3ULUD 2C1OB 3NCEB 5IT2L 5DJ6A 5F6IC 5IJKA 1I3RB 3ARQA 4WDIA 1AH1A 3AY4C 2XQYG 4LLAA 2J1KA 5C0GA 3UXFA 1I8KA 1MCSA 5DRNB 3CZJA 4N9GA 1AXIB 1J1PL 3MA9H 3IXTA 1KN2L 4GJTB 2APTA 3CFBA 1YNTB 1DBBH 4EDXB 1MF2H 2XICA 3BEWB 1A2YB 5GZOD 4NO0A 1EO8H 1JGEB 1BJ8A 3KGRA 4DN3H 1CICA 5E2UH 3QNXA 4JO3L 1WBXB 1T1YB 3TNMA 3QDMA 1ZTXL 1NKOA 3DMMC 4K3DL 2WIIA 2Q8BH 5JPMA 2DQJL 4YNYA 4FNLH 4LIQE 5FK9A 5FM5M 3SDXE 3T3MF 4X4YB 1H8OA 3BP6B 1EFXB 3PJSA 2D7PA 3VH8G 1UG9A 3MLXH 2WWMD 4M8QB 5ELIA 4U1IB 4GOSA 2K3TA 3X14B 4PJ8B 3QXUA 5LWYL 1MQKH 2QSCL 4HJ0C 5ALCH 1B0RA 1I3GL 4X9IA 3X3FL 2NY0C 2LVCA 4UILH 3N0PB 2DQDL 5TDPB 1OAZH 3GRWH 5BS0E 1JIBA 1RK1A 3LS5H 4CVXA 2APWA 2IBBA 3O2DH 4Y5VC 3TN0D 1KELH 5IFJB 5DJAB 3O6FA 4NQUA 1YEKH 1MH5B 3TJEH 2FZ3B 1QLEH 3GEWB 5DHVH 2EO9A 2OYPA 3NTCH 3TPUB 4XP4H 4MQTB 4QWWD 3W0WB 5HVGB 2Q3ZA 3QHZL 3U7YL 1MHHA 1A9BB 3Q6FB 5CJ5A 2J6EH 4DKDC 5EU3A 2QBWA 2AXHA 5ICZA 1EHLH 4HF5H 5F9DC 4TTGA 2OP4H 4Y5XB 4MD0A 1LO0L 2YWZA 3OB8A 4GW1A 1R5IA 4Y4FB 5I19H 2A77L 4NRZA 4JY6B 2AK4E 1IEBB 1JWMA 4Q6YA 1F58L 1U8MA 2L7UA 4LPTA 3D3VA 2CSPA 5EUOB 1P4LA 5IEHB 2GITA 5BS0D 3SCMC 1CDHA 2EDFA 1MCLA 4MA1C 1GVIA 4L8SA 3NCJL 4HHAA 5TE6L 3KYAA 4M48H 1U8OB 2OL3B 3BUTA 4LSSL 4JZJA 4OCNC 3DETD 5CJXC 4KK6C 5GRXG 5IV2B 1IZJA 1ETZB 3S88H 2J8UB 2B4CC 1G7JA 2XWBB 4U2ZA 3BZDA 4ERSL 3PQYB 3TZVA 2JCCA 4WTZA 4X6CF 4EI5C 3NCMA 2OL3H 1H15A 4JG1L 1F90L 1YPZA 4P5MB 2VO5A 1F5WA 4ZXBC 1JZ2A 1X9QA 3RTQC 4ODHL 1X4YA 2QTEA 4OGZA 1IARB 2CR3A 3SEPA 5I30L 1KOAA 1T1WA 3QFDB 1WFOA 1OAYL 3BIAX 2PKDA 1A6TB 5F8RC 3UBXA 2ZUYA 2CDEB 1IC7H 3VU2A 2F53A 2AK4D 4K94H 3VGBA 3EYQC 1CE1H 4U1SB 1NGZB 1OSPH 3GSRB 4Q9CA 1IGTA 3KXFA 1TJHL 3VWJD 3IFLH 4GLRH 4PTUA 4WV1B 5CMAB 1FBIH 4G3YL 1M71A 1QPXA 4D0DB 4JPKH 1VPOH 4HKBB 1A6PA 5KVDL 2H2SC 3S6CA 2Z31A 1CZ8L 3SDAA 3NIDE 4NZRH 2XN9E 1F4AA 4OB5H 1KG0A 3F7YB 1EO7A 2P49B 1VFAA 3BDBA 2OTWB 1WFUA 4XAKE 1XH3A 2R0ZH 2NTFA 2YA0A 3MLUH 5F88A 1K3ZA 4ALAL 4IJ3B 1RZIA 3H9SA 5C7XL 2BNRB 5GZOC 4O4YL 4GO6B 5FV1L 4AEFA 5HY9B 3FN3A 4KFZC 1L6XA 2YN5A 4AG4H 1A7RH 4G8FB 5DQDL 5K9QG 1T89A 3PWNA 4W81A 4F7MB 5JIKA 4YHNA 5SWZE 4NZUH 3QG7H 4WO4A 4LF3A 4TVPE 3TVMA 5F1NB 1N8ZA 1S5HA 4FQXA 1U6AL 4L3EE 5GIRA 2HJFA 2WK2A 5D6DA 1DUZA 4LLYA 2EIEA 4OCWH 5GRUL 2WWMC 4ZAKA 3HI6L 3DBXB 1MJUL 5ADOL 3GKWL 3RJQB 3QEQB 3P73B 5FDWA 4UUJB 4Z7WE 3P0GB 5LGHH 1C16B 3O6MH 3BN9D 1QO3A 2MOVA 2XN9D 4DGIL 2BC4A 4RFEA 1N6VA 2C3HA 4S1QH 3NPZB 4XAKD 4N0UE 4JFXA 2FCBA 4NQTA 1JV5A 1SM3L 4PRAB 4PJHE 1PG7H 3WKNA 1IFHL 5SV3A 2E27H 1YA5A 1N0XH 3STLA 1HKLL 2IMMA 1JNHA 4NJAH 1LP9E 1W72H 2YS4A 2YA1A 2ZSWA 5D72H 4QWWC 4Z78B 4L9LA 1FH5L 3HZVB 5I1KL 3GSNA 4LKCB 5DUPH 5HHXH 5IB2B 2OBGA 2AXFA 4ZTOH 3U2SB 3SDDA 5EZOH 1RULL 1U92B 2HP4A 4L3ED 3WFCL 4LLVA 1PG7W 1EDQA 5IR1B 1MFAH 1F4XL 4OLUH 1D9KD 5HHPA 4C4KO 5D1ZD 1WAAF 4MNQB 3L3JA 5HGAA 3LKOB 2P4AB 4X0KB 5DFVC 4NQDE 4MMXC 3IT8D 3TWCH 1T0MA 2YD1A 4X6BA 4W4NA 2XWJA 5DZLA 2GUOB 2FX9L 3WJLA 4F7EB 1WWWX 5EG6C 3HE6B 4WI7A 3L3DB 3ULUF 3MV9E 5D5ME 2DQIH 1N4XH 2ZUQC 2CDGA 2F9BT 2H3NA 1JGDB 1MJ7L 1RJLB 3HZYA 3MJ8A 5GJTL 5IVZB 3ZKMD 2AK1L 4QRUA 2ADGA 4AH2B 1DQQB 4NJ9L 4RGNC 1YNKH 1A1OB 3JV6B 3DX6B 4X6FA 3PDOB 4JQXA 2E3VA 3ARFA 3IS1X 4HX1B 3PHSA 2JJWA 3W39A 1SEQH 3VMPA 1Z9LA 3ZLQC 5C0JA 5SX4H 3BRDA 1QBML 2ZOLA 3L3GB 2JLLA 1AKJA 4LDEB 1ZT1B 2NY5C 2V2WA 1Q9LB 2MSPA 1UWGL 1ZAGA 4NQDD 4Q9QH 1BD2A 4RIRB 5T3XE 5BRZA 1AR1D 3CFDA 2PO6D 1JPSH 3F8UB 2JB5L 3KPOA 4PP1D 2LU7A 1A4JB 4YHKH 3UTSD 3GGWA 2MQ3A 3MV9D 4E41A 4JPVH 4YDIH 2A6DA 4L8CA 3PP3H 2FR4A 4RDQF 2VR9A 3L5JA 3D18B 2FEEL 3BIBX 3L7FB 1OW0C 2APBA 2EIBA 5HHOA 3PGFH 2IFFH 1JZ3A 1UB5B 3IFNH 4GG6F 3ZE1E 1EPFA 4LRIA 4I77L 2RFXB 4N8CL 1SJEA 5DI8B 1VERA 4P46D 4PB0H 4Z0XA 1JF1B 3MO1A 1TENA 1KJVA 2VXVL 2Y5TA 3SJVE 3UTPE 2CDFA 3GSXB 4S0TD 2YKLL 3LB6D 5DJ6B 3F7RA 3QDGE 3KNBA 1ONQA 2AKRA 5T3XD 1DQDH 4KKCD 4MQ7A 5C0GB 3NCYP 2DIBA 4UTAH 3RL1A 6FABH 5F7LB 4M02A 3WLWD 3VW3L 1IJ9A 5I15H 4N9GB 4XMKL 2GI7A 1MCRA 2UVFA 3IXTB 4PJCF 1EH9A 1VHPA 4Z77A 1WZ1H 1QFWM 5LG1A 3AB0C 3CK0L 3T8XA 4XTRD 1RIHH 4NO0B 3I02A 4HIXL 5M94B 3W2DH 4G6FD 3QNXB 3ALPA 3S9DB 3TNMB 3QDMB 3VD7A 5DMGD 2D7MA 1XIWB 2EYTA 2WIIB 3BN9C 3T65A 5JPMB 1KIQB 2QHLA 4YNYB 4U6VL 3TV3L 5FK9B 1QBBA 1TXKA 5KOVC 5BV7B 1PQZA 4YDVA 3SJVD 3UTPD 3PJSB 4I4WB 2LAAA 4H1LA 5E8EA 6CGTA 4JGJA 4QRRD 4FABL 4XNYL 3IDIA 5CIPA 2A0LC 3T0EA 3X3GL 1B0RB 4S1RH 4Y19E 3T3PE 3S7GA 3DHMA 1AD0A 4EJ1C 4CKVX 1OT2A 4CVXB 3O0RH 1FJ1A 2LU3A 5EBWA 3JV0A 2X10A 4I0CC 3WIIH 4HS3B 3O6FB 1K8DA 1DL7L 4PJAF 5D1ZC 3QIWA 1HYSD 3MV8A 4HGWA 4OLWL 4WW2A 1FCCA 2YR3A 3HFML 1PZ5A 1FZKA 1SQ2N 4XPAH 1BBJA 5IB1A 1MHHB 3FCTB 4GRLC 5ANMA 1JWSA 2EEDA 2VQTA 5EU3B 5ICZB 1IGJA 3OZ9H 2JJTA 1ZGLP 1CBVH 3PP4H 2QADD 1N2RA 1JRHH 9CGTA 4MD0B 1DQLH 4HGKC 3ZKMC 3QUXD 3TO4D 3KAAA 4NRZB 5DJDA 1EUTA 3SDCD 3D87B 2WV3A 1DVFC 4Y19D 5CJOL 2BDNH 4PJXE 1JWMB 4ODTL 4LSUH 2V9QA 4ZUVA 4XCNA 4EOWH 3PHQA 3HS0A 5J56B 3D3VB 4NGHL 5FOJA 1P4LB 2E7BA 2GITB 4NCC2 3TT1H 2EECA 4C59B 4M5YH 1A3LL 4HHAB 4M9PA 1YJDC 4PJIF 1H3VA 5C0AA 4HWEH 2UYLA 3VG0H 4JZJB 2A9NH 5IM7A 4HCRH 4RISL 4NP4H 4WW1A 4TNVK 4D9LH 1PGRB 4DQOH 1CXEA 4U3XA 1G7JB 1AR1C 2PO6C 3MLYH 4FA8A 4PR5A 4PP1C 3TZVB 2JCCB 4NUJB 4BFGA 4RMTA 3SKJH 1H15B 2HRLA 1YPZB 5J6HA 2WQRA 4MD5B 2ZCKL 4OCRH 5GGQH 3KR3L 4XB8A 3L5XL 4CBPA 3KPRA 2VAAA 2VXQH 2EXWC 1T1WB 1DUYA 3UBXB 2IANA 2F53B 3DXAA 2EICA 1UVQA 1I7TA 3SKMB 5EULV 1OAQL 5F97E 2BY3A 2XPGA 4P46C 2VMFA 3JUZA 1CQYA 1IGTB 3RVWC 2G2RB 2IPUG 3KXFB 1EBAA 4PTUB 1QNZL 1M71B 4F58L 3GUTA 1N6QH 5ITBL 3MRMA 1BOGB 1TPXB 3R8QA 2Z31B 2KH2B 3E6HB 3WFEL 3HZMA 3SDAB 2H32A 3NH7L 3RVUC 4Y1AA 1KG0B 5F7KC 4WI3A 1CD8A 1VFAB 2E7HA 2BP3A 1I9IL 4NO5A 2B1AL 3MV7B 1NCCH 2ZOKA 1XH3B 2NTFB 5F88B 1YYMH 3NACH 3X12A 1MIEL 4XTRC 5DMIH 1RZIB 3H9SB 3VI3F 4YXLH 3QUYD 4Y16A 2Y6SD 1EEUA 4CAGA 1D5IL 3EFDH 3PWNB 2OX5A 1TLKA 4M6ML 4AK1A 1UM6L 3P40A 4YHNB 4XNMA 2W1NA 3C5ZA 4FG6D 4WO4B 3DVNB 2NW2A 2EEAA 1YEIL 3F6LA 5FOBA 1N8ZB 1S5HB 3MX0A 4FQXB 1LEKB 4JFEA 4AL8H 5GIRB 1HHKA 1DUZB 2VRAA 3SGKC 1HWHB 4NQCA 4ZAKB 4WHYH 1SBSL 2DLTA 5FGCB 2OR9H 4OZHE 5FDWB 2EDXA 3ZE2E 2Y07H 4JO4L 1RHFA 5BMFL 1QO3B 2BK8A 1JYVA 4FZ8L 3THML 2BC4B 4RFEB 1RZKL 3U7WH 3MBXL 4N0CD 5CGTA 1DDHB 2EC9U 4WTXA 5CEXA 4KWUA 4JFXB 1WJ3A 4Y5YA 4S10A 1FNFA 4R8WH 5FCSH 4OLVH 1JV5B 4YHYC 5C09A 1VCAA 5T3ZE 2VLME 4HWZB 5CFHA 4HDIA 3BZEA 4NWUL 5E00A 3UO1L 3STLB 4DKEH 1JNHB 3RJDA 4OFDA 1HYSC 3EDFA 1RZFH 1FLRL 2ZSWB 2EIZA 3CFCH 5C08A 1FAIH 1GC1H 3S96B 4UT9L 5JMOC 4FQCL 5I73C 1AHWC 1AXTL 3SDDB 2R29L 4C54A 4PYHA 3LAFA 4LLVB 1RUPL 2QADC 3U4BL 5B3JE 3DURB 4M7KH 5HHPB 1HEZA 4C55A 1A0QH 1JZ7A 3BP7A 3L3JB 3QUXC 5HGAB 5F7NC 3TO4C 3MNWA 1T0MB 1R3JA 5GRWA 4PRPE 2XWJB 1WC7A 3C60A 2Y06L 4LQFH 2G5BA 3EJZD 5GGTA 5GGRY 1ZSDA 4IOFD 1YECH 3DGGA 3JV4A 4UT6H 2CDGB 2H3NB 4ZS6D 4HXBH 3MRHA 1HDMA 2VZUA 3MJ8B 4P9ML 1H0DA 4WHDA 2YK1H 3V4VH 5T3ZD 2VLMD 3W9EA 4QRUB 4XPTH 2ADGB 3IDYB 3D39E 5DC9B 4MJ6A 2A9MH 4H5SA 3ARDD 2A74A 4OF7A 1QFWI 2EDJA 4X6FB 3AUVA 3IJYB 4PUBH 3LIZH 1P7QA 5JDSB 1QLRA 1CLCA 1SVZA 3ARFB 1BJ1J 2XG4A 5TDOA 3ZSSA 4PJ9A 3W39B 5JNYA 1T7YA 5EWIL 4RGMB 3VFTA 4S1DC 3P2TA 1T2XA 5C0JB 2AJZA 4XMLL 2ZOLB 4NM4H 3G5VA 1AKJB 1K2DA 2IG2H 5KBNC 2V2WB 3GB7A 3SO3C 3VJ6A 4MNGA 2NZIA 4J3VA 2FJFA 1BD2B 4GSDH 4HPOH 5BRZB 3TA3D 3CFDB 4GRWB 4PRPD 3DUUA 4R97C 2DQEL 3WXVL 1MREH 2MPAL 4PG9A 1AC6A 2CXKA 3GGWB 3RA7H 5T5FL 4E41B 4PJDF 5L6YL 4FFZL 3N85L 2A6DB 4L8CB 2FR4B 3C8HA 2CRIA 2HTKD 4GRWH 1IGCH 5E8PB 3LPGA 5IG7A 2R69H 4NNXA 4OJFL 2OZ4A 5HHOB 2I5YL 2WBJD 4WWID 5EZIL 2UZYB 4R4FL 1RU9H 1F4HA 1N64L 4HKZA 3SBWA 1SJEB 3TM6A 4Z0XB 3EJYD 3KPMA 1KJVB 5GJSL 3CXDL 1MELA 2CDFB 4JFZH 1FIGL 2DL9A 1JGUL 1NAML 5EOCL 4XX1E 1EUUA 3QUYC 1JZ5A 3KNBB 3B9VA 2AKRB 2Y6SC 4XC1H 1DCLA 1FZOA 5FYKL 5DTFA 4MQ7B 2VUYA 1W8OA 3LS4H 4YHIA 4FG6C 2CIIA 4IMLA 3SY0A 2VXUH 4Z77B 2VDLH 5BXFA 4G6MH 3T09A 4ONGH 1UZ8A 5E4EB 1UM4L 3T8XB 4EEEA 1OTSD 4Z7UF 3I02B 5GQBA 3MQIA 1BOYA 5DD3L 4TSCL 3QQ4A 1JHLH 2EYTB 2VLKE 3WFHB 2BRRH 3T65B 4P2OD 5AWNH 1YNLH 3GMMA 3SQOL 2VAJA 4NSKA 1H3UA 1PQZB 2HJLB 4YDVB 1K4DA 1XF3A 1IAMA 3RVTD 1Z9MA 3MGOB 5FYLE 4H1LB 2ADJA 1CIUA 5E8EB 2OTPA 4FZEL 2LVEA 5CBAA 5EFIB 4HXAH 2GJZB 4LHQB 4IMKA 5T1LA 4F9PA 3IDIB 5AYQA 5CIPB 5EUKB 5ICYA 2ORBL 2BCKB 2EDOA 1MCNA 1G9NC 1MPAL 4K55A 2ADFH 3ZDXF 1AD0B 3DVFA 4JHAH 5E94A 4NN7B 4ODXA 3BYYA 4KDTA 1FJ1B 5EBWB 3KPPA 3RVVD 1HI6A 3IJHA 1K8DB 4XBGA 3QIWB 3MV8B 4CVUA 4HGWB 4WW2B 2VISA 43C9A 3HI5L 1P2CB 1PZ5B 1FZKB 4LLMA 2NY2B 2DD8L 2RQ8A 3RWDB 1IE5A 1J0HA 4LHJB 2DOCA 1NSNL 2X4SA 5DLMH 2G5RA 2LABA 3MFFA 5AYUL 4TULH 1BBJB 4PGCA 5IB1B 5ANMB 1JWSB 4L5FL 2YD7A 3EJZC 1IGJB 3G6DL 2BZDA 4IOFC 1HXYA 2EDYA 4ZS6C 5FYLD 3V4PL 1F4YH 3U46A 5GS0C 3IFOA 1UCBL 1EK3A 2Z93A 3ULVE 1X5ZA 3PP3K 5DJDB 2ERJB 1P9MC 3LV3A 3ARDC 2IBGA 4I3SL 4ZUVB 4XCNB 1SY6L 3PHQB 3HS0B 5IJVA 2I60H 4PB9L 1OLZA 2ZNWA 4F9LC 1CN4A 5L8LB 1W0WA 1NMAH 1YEEH 1YMHA 2R0WL 5DO2D 4AMKH 5C0AB 4JHWH 5BQ7B 2D7TL 2UYLB 2JJSC 1XGPA 5IM7B 3JUYA 4WW1B 3RWJA 3UYRL 4OD1L 1AIFA 3MRFA 4PR5B 1FFOA 5SV4A 1WWCA 1JYWA 3QCVL 2CMRL 5J6HB 4TNWK 1OOAA 2DWDA 1OP9A 5DUML 5MI0C 2HTKC 3KPRB 2VAAB 5A1AA 3P9MA 3EOTH 1JFQL 4BZ2L 1A6UL 2XZAL 3V5HA 3ULVD 1DUYB 3TYFA 4JY5L 2Z92A 1K4CA 2DI7A 3Q1SH 2IANB 2H41A 3DXAB 4LEXH 1UVQB 1I7TB 3BSZH 4LVNB 4LGSB 5EBLB 3NFSH 2XPGB 1NCAL 5KTEL 3EJYC 3QQ9C 4RAVA 3VXMD 3DV6A 5C07B 5KS9E 3DLQR 1NUFA 3FHAA 3BEVA 3GK8L 2V17L 3QCUL 5D7JC 4P23A 3MRMB 1A6VH 1U8NA 3P77A 4GAFB 4DCQA 3RHWK 5E24E 2AP2A 5JXEC 3QI9A 1Z9SA 3HZMB 3S35X 2H32B 1Q0YH 4IM8A 4Y1AB 3K4AA 4HFUL 1E4WL 4HPYH 2FBJL 1M4KA 2AS5M 2OJZH 5I1JL 4NO5B 2ZOKB 4IDJL 5H8DA 1FL5A 1DBAH 3X12B 1QTYT 4DVBA 4OM0H 1TVDA 4Y16B 3VE0A 3ZDYE 4PV9A 2CGRL 5IVXA 3QBTB 5KW9L 1R5VA 2PXYA 1YEFH 2Z4QA 2XA3A 1WAAE 1UJTA 2MJWA 3BH9A 2VLLB 4P2OC 4XNMB 1I4FA 3C5ZB 1XF1A 5I8OL 2NW2B 3O9WD 1XCQA 4JFEB 1HHKB 2XZCL 1RUQH 4G8EB 1SEBA 4XVTH 4O58H 4NQCB 4ZQKA 1S7UA 4EI6A 3IDMA 4OLZL 2LE9A 1RAMA 1NC2A 5HI4D 3KLDA 3QUKA 3WUWA 3TCLA 2MWCA 3L1OH 12E8H 2DL2A 3NGBC 4ZFGH 3OMZA 3MODL 5EIVA 2E5EA 5JUEL 3UAJD 1F2XK 5CEXB 3DGCR 1EEQA 3ALWA 3AFLA 4Y5YB 4Z7QF 4NZDA 4UV4H 3EDJA 4Z6AT 4KJPD 5D7IA 5C09B 3RVVC 3WIHA 5EN2A 4HDIB 5E00B 4NDMA 5B8CC 3TBYA 5DD6B 4XVSH 2EIZB 5C08B 3BKCL 3QPXL 3QRFM 3MLSL 1Z9OA 1UENA 4Y2DA 1NAKH 1N7MH 2FX8L 1UZ6E 4M4RA 3BJLA 1L7TH 5IB5A 4I18A 1YY8A 4P5TA 3WD5H 1QKZL 1HEZB 4RFNC 5C0CA 5F7FA 3BP7B 4JFFE 3QEHA 2O5XL 4MA7L 4MXWH 3MNWB 4G43A 3F58H 1R3JB 3FB5A 5E5RB 4F57L 5CUSH 5I1GH 1VB9A 1WC7B 4JRYA 5D70H 3C60B 5FDYA 4TPRH 2G5BB 5FF6A 1W8NA 1MNUH 1DLFH 3DGGB 3JV4B 5IBLD 1URLA 3MRHB 1HDMB 2D2OA 2L0DA 2X4OA 1H0DB 4KROD 5TE4L 4GLRI 5DO2C 2HTLD 3W9EB 4ZO9A 5FYJU 5D1XA 3K80A 1IAIH 4GH7B 4MJ6B 5GGTH 1NMCC 4H5SB 2A74B 5DQ9A 1FO0A 1C5BL 3CSBA 1IEHA 3I3EA 1P7QB 5TDOB 4HJJH 4PJ9B 5JNYB 3VFTB 4M43H 3KYMA 2ZUWA 3IXAB 1WLHA 2AJZB 2Y5EA 3G5VB 3OG6B 1K2DB 4IIQC 3GB7B 3GJEA 1QRNA 5IIEA 4MXVE 1BGXL 3VJ6B 4MNGB 3ULVC 2IPTL 2FJFB 3N9GL 4BQ6A 4LPYA 4OFIA 3RZWA 3DUUB 3LD8B 3T0XA 1X6NA 4PG9B 5IHLB 4NC0B 5F7DA 1A4KA 1X5FA 1DBKH 5EH1A 3ES6A 3DECA 5D7KD 2KUTA 4I1NB 5JQHC 4IRSD 3QA3A 3O2WH 5I0DA 1OGTA 1V3KA 4NNXB 1DQTA 3PWJA 1A7QH 3AGVA 1DBML 5ETUA 1OVZA 1Q9OA 3FAXA 1F45A 1U8JA 4HKZB 5GRVL 3WS6C 5I66A 4F7PA 4YZFF 2ARJQ 1T1ZA 1KPUA 4LARH 3KPMB 3UDWC 5LCVH 2Y4SA 3SE8L 3I75A 3IRZA 4JPVL 2PR4L 1ZVHA 3EOAA 4WWKD 4ZPTA 1U8QA 1JUFA 4LVHB 1FZOB 3QP3A 5DTFB 2AEQL 3E8UL 3IDJA 4ZTPH 1KEMH 3PWLA 1EEZA 4XPGH 5CS7A 3DVIA 3AY4A 4YHIB 3IKCA 1OCWL 2CIIB 4IMLB 5KSUA 3SY0B 3T2PA 3O9WC 5BXFB 1D6VH 1UZ8B 5I1CL 5JMRA 4GQ9L 2DTMH 2E7LC 4JG0H 5I1EL 4PRNA 1HZHH 3G08A 1CCZA 1ZS8A 3CFJA 2DWEA 1XF4A 3RWEA 1PKQA 1JTTA 3GMMB 4I5BA 5I1LA 4NSKB 2P7TA 3MXVH 1TQCB 5BVPH 2A6IA 1WICA 1K4DB 3ZTNH 1XF3B 3M45A 3UAJC 5F21B 4WI8A 3RQ3A 2DDQH 5HGHA 2ADJB 1QUNA 3VFPA 4LASH 1GHFL 5CBAB 1BQHA 2DM7A 4GKSA 5HHME 4GMSL 5T1LB 4WTZG 1MHPH 5GS1A 2AGJL 1BVLA 1YMMA 2PYEE 2D7NA 4TNVF 4P4RA 4PP2A 1GPOL 5AAMA 2CLVB 2XXMB 4Z7VF 5I9QC 2WNGA 5E94B 1BVKA 3QXAA 4RMVA 3KPPB 3UBXG 1HI6B 5DJ8A 3BGFC 3T0VA 4DKFH 4XBGB 4I0PD 1FGNL 2W07A 3ZL4H 5JA9A 2VISB 4Y5VA 3JWDL 1J5OL 4B41A 1GGBH 2HMID 4WUUD 1KXTB 2MKLC 4CUCA 4HS8L 2X4SB 5BV7L 1PLGL 4PGCB 1CGXA 1FHGA 3VFSA 1S9WA 3UZEA 1GOGA 1IVLA 5T1DH 4JEGB 1HXYB 5IBLC 5JHLH 4MQXD 2ED9A 3U46B 5ABDE 2NMSA 3IFOB 1N3NA 2CO6B 4JN1L 2Z93B 5HHMD 3CPLA 3LV3B 3ZYJA 5BZDA 1A6AA 4KTEL 4LVEA 1JNLL 3EYVA 3QUZD 4ODSH 2PYED 2J5LB 4OM1L 4LCCA 5IJVB 1NC4D 4HG4J 4UT7H 2DN7A 4YBHA 1MCQA 1HIML 1G6RA 1OGAA 1W0WB 3AREB 4XP9L 3RWHA 4XCCH 5J1SC 1YMHB 2UZIL 1G9ML 3SCMA 1Q8MA 2XFXA 1XGPB 4PRIE 5GISL 3LKPA 5DEGB 3RWJB 3K0WA 3MRFB 2VLJA 3S35L 1FFOB 3CMOL 1BFVH 3VXUD 1G0DA 1KFAL 4QNPE 1INEH 5CP7A 2BSRA 3IYLW 2R2BA 3P9MB 4ZXBA 1W0VA 3V5HB 4IRSC 1YEJH 3QXVA 3RTQA 2Z92B 1K4CB 4DGVL 4X9FA 4QXTA 4N0FA 4X4ME 4Q97A 3NABH 3VFGH 1ND0A 3DYMA 2HH0L 3REWA 4RAVB 4HAFA 3KYNA 1RFDH 3DV6B 5C0EA 5C0RH 1DANU 1KCVH 2YRLA 3BEVB 2GCYA 4RFOH 4JM4H 1YEHH 4HLJA 1LMKA 4P23B 4WWKC 1U8NB 1LO4H 3P77B 4PRID 1WITA 3QEUA 3OKKA 3DSFH 4RWYL 5MP6L 3V7AG 2APXA 3EDDA 4XRCA 5D2NA 2DAVA 4BSJA 2E7CA 1IQWL 4A6YA 4POUB 4JDTL 4ONFH 1U3YA 1MWAL 5EUOF 3JBG7 4M7JH 2D4DA 3L5WA 5J12B 1FL5B 4MMZC 5E2VH 4F2MA 4O00A 3SPVA 1IGFH 4M03A 3VE0B 4X83A 4PJGA 4PV9B 4DEPB 1ZGLA 5IVXB 1N6QL 2B2XH 4ZYKA 2WANA 2Z4QB 3ZKND 4F7TA 4GRMA 4MS8C 5CEZL 1SJHA 1I4FB 1OD9A 3VD4A 4OFVA 4UAOC 1F8TL 3PUCA 1J8HE 1WVZA 3VWKA 4N1HB 1XCQB 4CU8A 1BQSA 5D9SB 1SEBB 2BJML 3N06B 4ZQKB 1S7UB 3IFPA 4XXDA 3RDTD 3IDMB 3V0WH 1GOFA 1Z2KA 4QTIH 3UZVB 1NC2B 1JWUA 3L5HA 3RGVA 3QUKB 3WUWB 3TCLB 4LRNH 4BK4A 1RZJL 4L4VE 2VSDA 1BEYH 4UI2A 3WHXA 5EORL 4JQVA 3P4LA 1CDJA 4F3FA 2QKIA 4U0QB 4KK8C 2EYSA 3QPQD 5D7IB 5EN2B 4NDMB 3SE4C 2V7HA 4RZCA 3TN0A 2AEIT 3TBYB 4MB4A 4LP5A 2E6JA 3KDMA 3LHPH 2GJ6E 3GO1L 4G5ZL 2DF3A 4D9QE 4JO2L 2ZG3A 4Y2DB 5DK2A 3WO4C 3UMTA 3WIHH 3WSQL 1CFNA 1J8HD 5IMOA 5AUMA 3STBA 1Y6NR 4X7CC 1J12A 4R2GC 2XZQH 5IB5B 4I18B 1YY8B 4P5TB 4MQXC 3OGOE 5C0CB 2HKFL 4GUPB 5K9OB 1DZBA 3H0TA 5IFAL 2NY3D 3QEHB 4IRZL 5D8JH 4BKLA 4XC3L 1QFPA 4G43B 1J1OL 4PS4L 4L4VD 2VXTL 3QUZC 3KYOA 1C5CH 4OZIE 4NN5B 3JVGC 4O9HL 3NZ8A 5FF6B 1JTPA 1PYWA 2NX5D 2VQUA 2YHGA 4XAWL 4O2EA 5IEKA 3EIFA 3KG5A 3V52L 3VFMB 2CKBL 2BOBB 5I6XC 4YFLF 1T5XA 4RRPG 1KC5L 5BS0A 2OXHA 5D1XB 5MEOA 1I1AB 2Q76A 2ICEA 5LXGL 3GSNL 2YMXH 2RCSL 1MRDL 5DQ9B 1FO0B 2GJ6D 4CN6A 2ED7A 4NFCA 4D9QD 3T1WA 4P3WA 1OSZA 4MGXA 3KYMB 2WP3T 2BMKA 3F12A 3KLAA 5KSAD 3D9AL 3GJEB 1QRNB 5IIEB 4N1CA 5K9QI 1C08A 4XNUL 1OARL 4U0RB 2J8HA 4M93C 2CR6A 4NN6B 3FB7A 5LQBL 4RGOH 2HVKA 5CJBA 2O5ZH 1HE7A 5F7DB 4H1LG 1A4KB 1NUGA 2AK4A 3ES6B 2H8PA 2D7OA 5JR1H 4UV7H 4BFEA 3C08L 4FFWC 3TEUA 3QA3B 1K3IA 1OGTB 4J3TA 3VWJA 2SEBA 2JKXA 3PWJB 3C5SA 3MCKA 1S7RA 4N5EC 3RU8L 1Q9OB 1KGCD 2BVEA 1U8JB 3B9KD 3DYOA 5I66B 4F7PB 1T1ZB 4Q0XH 2VERN 4YXKL 1KPUB 3VFWA 1B9ZA 5F1KC 4U6YA 2VDKH 3OAYH 5HPMA 3I75B 5DD0H 4QRPE 4YQXH 3WKML 3EOAB 1W0YT 4AEIL 1D5BA 1CLYH 4K8RH 4ZPTB 1T83A 2FO4B 2X4QA 1DFBH 1JUFB 1JGLL 2FGWH 3VRIA 1FCGA 3IDJB 3VGEA 4RQQA 5F6IB 3PWLB 5A40E 4H88H 1MY5A 4OIAA 4W68A 3IKCB 5KSUB 1LHZA 1ZXQA 1WEJL 1XGTB 2DKUA 4B7LA 2EO1A 2YN3A 3P3YA 2VDNL 3G08B 1IT9L 3K7UA 3FOMB 5GS3A 1ZS8B 2R0KL 3CFJB 3OKNA 2DWEB 2JK5A 2W0PA 1XF4B 4LPXA 1A5FH 3RWEB 1MIMH 1PKQB 4MLIA 2DQUL 5HHVL 4I5BB 1ADQA 5I1LB 4BQ9A 2P7TB 2A6IB 1VKXA 5FA4A 2NY1B 2WUCH 1MCPL 4RMRA 1FDLL 3QEGH 5CP3A 7FABH 1T5WA 2XN9A 3BKYH 4J6RL 1A7PH 1RJCA 2GY5A 5AZ2H 1MAJA 1MCWM 3VFPB 3MOBL 3NN8B 4HMCA 1BQHB 4EBQL 4GKSB 1HHGB 5EU7C 1V5JA 5D1QA 5HYIA 5GS1B 1BVLB 1ZMYA 1YMMB 1KN4L 2HWZL 5EA0H 4P4RB 1Q72L 4PP2B 3RWFA 2E6QA 4ELMB 1ZHBA 2HFGL 2X6MA 3SGDH 4P2YA 2NY0B 4JN2A 1NJ9A 3QXAB 5ACLA 1A6WH 4TNWF 1ZHKA 4LFHG 5DJ8B 5FM8A 3LSOA 4ZUTA 1RVFH 5E99L 3ARRA 4L3EA 4Y5VB 4PJEA 2VWEE 3BPLC 4ZSOE 4H0IA 1D9KA 2IAMC 1U93B 1FORH 5D1ZA 4RA3A 1YC8A 1EGJA 4Z7WA 3VFSB 1S9WB 2DKSA 4XPBL 4FQJH 4LCWE 2VLRE 1UM5L 2VKXA 1U91A 2VDML 3KYKH 4N0UA 4K7PL 2ZUVA 3CPLB 4ODVL 5BZDB 1A6AB 1PSKH 2W65A 4PJHA 4XWGH 2VZOA 3NAAL 3RHWF 1QR1A 2Y1VA 4LCCB 1IGIL 1LP9A 1B6UA 3D85D 1G7HA 2UY6A 1OGAB 1B0GA 5CINL 3P4MA 1KCUL 5MENB 1JTOA 5KSAC 4NQXA 3SCMB 1A22B 4MA1B 2PNDA 3HNVL 1AJ7L 3LKPB 2C1PA 5TE7L 3ARYA 3C6SA 3AROA 4GT7A 1EAJA 1NCBL 2VLJB 3LQZB 2XA8L 4QXGL 4NQDA 4L3AA 4XBEH 1JNNH 3D25A 3NPSC 1IAIM 2ZCHH 4QY8A 5IFHL 4LCWD 5CP7B 2BSRB 2PO6A 2VLRD 1CGYA 3RY6C 3UTSA 2R2BB 2YBRA 4WEUD 1W0VB 4ZXBB 3WYRA 3GFUA 3RNQA 3RTQB 3IDXH 2R1WA 4Q74A 2BHYA 2B4CH 4QXTB 4N0FB 4KZDH 1CXLA 1GGCH 1ND0B 1XFPA 1DLHB 3P9LA 2M2DA 3P4OA 1G7QA 1XR9A 4ZD3H 4Y4KD 2EDQA 1Q0XL 3EBAA 5C0EB 3KYNB 1UACH 1N6UA 1TJGH 2IADA 2GCYB 4HIEA 4P46A 3QIBD 4X7FC 3WFBH 1MFNA 1NCUA 3ME0A 4NKIH 5FM5O 4U7SA 3QEUB 4UINL 3BOVA 4PJ7E 3VA6A 2PCPA 4NC1E 4XRCB 5D2NB 3VXSE 2D03L 3U7AA 3GMLA 4A6YB 4S2SB 2DI8A 5LJYH 5J1AA 7CGTA 1RUAL 4WENB 15C8H 1A3RH 3JWOL 4U7KA 2GFBA 3NIFF 4HLZG 4X9GA 1A1NA 4JANA 1DEDA 1HQ4A 3CGTA 3G6AA 1IM3A 1EERB 2YPVH 4UBDD 1NGQL 4F2MB 3SPVB 1KTLA 4A6YH 2IEPA 4OFPA 3UEZA 1HSAA 4PJGB 4ZOBA 2EH8L 5BOPA 4ZYKB 3CD4A 5L88H 4F7TB 2CKNA 2P46B 4GRMB 1A6VL 1SJHB 3LQMA 4OI7A 2YOCA 4PBXA 2JCCF 5D7LE 5MHSE 4MAYD 1YPZF 4PGJA 4FQ1H 2OLDA 4C57C 1LO3H 2QQKL 4KDWA 1A7OH 3EYUH 3IFPB 4XXDB 3OKLA 3SJVA 4EN3A 1UXWA 4JM2D 1IC4H 2BHUA 3P11L 1JWUB 1DQJA 1XR8A 1YUHA 3RGVB 2H45A 1MFEL 2X4UA 3SGJC 4KY1H 3VXSD 4PJDA 3VG9C 3BWUC 5DURD 4QRRA 3G04A 1FE8H 1KB5A 1TTGA 1KACB 3WHXB 5DD5H 4X6EA 1QFUH 5EIQA 3UJJL 1TVHA 2P5EA 2QKIB 1FG9C 1V7NH 1YEGL 4KUCF 2EYSB 3O8XC 4M6NL 1X5IA 2BNQA 4RZCB 4N8VA 3O3BA 5ERWA 3TN0B 4ODBD 2YD2A 4BELD 4BSVA 4WFGD 1E6OH 5MHSD 1CFNB 5IMOB 5AUMB 3MJ7B 1CGTA 3KJ6H 3RX5A 2IPKA 3FO0L 2VIRA 2NXZD 3SDXB 4XWOD 4DWHA 4KQ4L 1A7NH 3H0TB 3DO7A 4BKLB 4M5ZL 4RMWA 1EMTH 1T03L 3BT2H 4DUXA 3KYOB 4LIQH 4NKQB 2VC2H 3TO4A 1HH9A 3PABB 2N7AA 3VFNA 2D4FA 3SDCA 3NZ8B 4OUUA 5HGDA 1PYWB 3CX2A 5IEKB 2KQMA 4O2EB 4Z7UA 4HC1A 5CD3A 1JE6A 4POZD 1GGTA 4OD3H 5BS0B 2UUDH 5MEOB 2VNCA 2ICEB 2VWEC 1IC5L 1P53A 4CVWA 3TIDA 3O3AB 1MJ8L 5FO7A 1JF6A 3WFDH 2FECL 1UYWL 3QO0A 3F12B 4APQD 4EZMA 3KLAB 4YHOH 3O45B 4RA0C 5TQ0H 3P0YL 3FFCD 4XPFH 5ILTL 5DEFB 5LVEA 1LO5A 2AJYL 4HWBH 1C08B 3RI5F 2QQLL 4XCFH 3FB7B 2DQCL 1UH4A 2HVKB 5E2TL 3CSYA 4V1DE 2AK4B 1ZEAL 4Y4KC 5J3HC 2H8PB 3GSOB 5FYKE 4M43L 2NY5H 5K93A 2C4FU 1H3TA 1IC1A 1IGML 4OZFH 5E9DA 1E4KC 3B9EA 3VWJB 2SEBB 2W9LA 3C5SB 5DMKA 3MCKB 1S7RB 2P24A 5ESVB 2X09A 4P48A 4BJLA 4MJIE 4LVOC 3BKJL 3KPSE 2H6PA 4KKAC 3VFWB 1VGEH 4MAUH 4U6YB 2F19L 4EKXA 4Z7VE 5HPMB 2OSLA 1T80A 5C0ND 2Q87A 4YDLC 1ZLSL 2VDRH 3X11A 2X4QB 3CVIH 2X2YA 4CMHB 2BFVL 3VXPA 4Z8FL 3VRIB 1OD7A 2ZUSA 1LQSR 4RQQB 2WWKT 1F2QA 2AI0H 3BIKA 5D71H 4V1DD 3ILQC 1A7QL 1NCNA 5IB3A 4LCIL 2W9DL 1FSKB 3K1DA 5JHDA 4MAYC 5A16A 2A1WH 4M7LT 5FEBA 2X5PA 3Q5TA 1V3LA 2OZ4L 4OLEA 3GHEH 2GTZA 4U7MA 1G7MA 1OAUH 4UIKH 3OKNB 2JK5B 2XTJE 5GPRA 4DN4H 1RIUH 3FFDA 5F71A 5T33L 4JGUA 4CGTA 4NC1C 1LDPH 4MJID 4GRWF 2C3VA 3KPSD 1JZ4A 1VKXB 5FA4B 1ZLUH 3STZA 1FNSH 5EZJA 1T5WB 2NY6D 2XN9B 2Q86A 1UWEH 4QYOA 4JVUA 4KGJA 1CVSC 5DT1H 3A0OA 2CRZA 1RZKC 3VGFA 1EBPA 4JRXE 1IAII 3QULA 3MUGA 5I1IH 3ZDZE 2B1HL 1OM3H 3RWFB 4B50A 1ZHBB 4YEEA 5F9OH 4FQPA 1MRCH 2EE9A 3TT3H 5HYSA 4JN2B 4WU5A 1NJ9B 2EC9T 3MOAH 3AVEA 3HC4L 1ZHKB 3LSOB 2ITDB 2Y36H 3JXAA 3LKRA 4XWOC 4ZUTB 5HJ3A 4L3EB 2DDQL 2FGZA 4PJEB 1CGVA 1WZMA 2VXSH 4JE4B 2XTJD 4KUZL 4U1HA 1D9KB 3VGDA 5D1ZB 3A6CH 2Q7YA 4OZHA 4RCAA 3VXNA 5GRJL 1MHCA 1QYGL 4TVPH 4RWHA 4Z7WB 5DD1H 4MVBC 5C0DA 3W0WE 4MHHI 4HBCL 4POZC 3NA4A 4LSTL 4M1DH 4WHTA 1AFVL 3SDYL 3LEVH 3I6KA 1RZ7H 3I9GL 4OFYD 1U91B 3UJIH 1Z0NA 3BD3A 1XGUA 3MZGB 4N0UB 5CJQH 4JRXD 5IKCB 1CLZL 1MCIA 4YXHH 2IJ0C 3HRPA 5F8QC 2W65B 1PX3A 4PJHB 2MCG1 5HVFB 3ZL4L 4NKOA 1QR1B 3CVHL 4IRJD 4K9EL 4R26H 2WBWB 2W38A 4FFVC 2D31A 1LP9B 5GHWH 1EJ6A 3ARDA 4KHXH 4ZUWA 5L9DH 1OQOA 2FATL 1B0GB 4OLYH 4APQC 3P4MB 2OMNA 3GMQA 4NQXB 3V6OE 4JDVB 3IGAA 2KZ1B 3FQWA 3TBVA 2C1PB 4WEBH 2I9TA 3C6SB 1OTTC 3U30C 2VUOA 2R2HA 4L29A 4NQDB 1R3KB 1X5XA 4IS6A 5IGXL 4QY8B 3T2NH 3TA3A 4PRPA 1OAKH 2J8UE 2PO6B 2X1XR 5CCKL 4P4KD 5E8DH 4O2CA 2IGFH 1YJDH 3UTSB 3WUWG 3K46A 5DR5L 5CZXD 3RNQB 2DKMA 4K3HA 2R1WB 4WW2F 2AJXL 5J6GA 4JQIH 1MSPA 35C8H 3B8SA 4NBYB 3DYPA 4L1DA 3FQNA 3P9LB 3P4OB 1XR9B 2WBJA 5DJYA 5DVOA 1LEGA 5DVNA 1MAML 1P7KA 1OWWA 2IADB 3MSPA 4HIEB 4PGEA 1RUKL 4P46B 2NZ9D 2DQTH 3HC3H 1GAFH 4GXVL 5C0NC 3DX9B 4D3CL 4G7YL 2PCPB 1FZJA 4TUKH 5JIPA 1YEJL 2HA1A 4B0MM 3FHQA 3GMLB 5J1AB 3U9PL 3MNZA 2CJUL 2GFBB 3P0VH 1A1NB 1TETH 2LTQB 4JANB 3QHFL 4J3XA 1HQ4B 1IM3B 4Z95H 3DVGA 4F33A 3H3PL 3E2HB 1J18A 3O6KL 1HSAB 1IL1A 2KKQA 5T3XH 4ODWA 1BWMA 1CG9B 2BNRE 4MCYB 4G6FB 4X98A 2GY7B 1HOCA 4W6XB 1JK8A 3HCVA 4Y8DC 4P2OA 1Y18A 1OLLA 2FX7L 4PJFE 2NY6C 1BIHA 5C9JA 4N0YH 3V2AR 4J12A 3OKLB 1TDQA 3SJVB 1O0VA 1S5IH 1UXWB 1D6EA 1LO2H 1DQJB 1XR8B 1YUHB 3CDGB 1KLGB 1EFQA 4LCYA 1KUMA 4QRRB 3G04B 1KB5B 3W11D 3LEYL 3D0VA 3OPZH 1YQVH 4X6EB 1ZT4A 4PJ5E 2ZCLH 5IROA 5TPWH 3PHOB 3MJ9L 2HKHH 3K2UH 2Q8AL 3OJDA 1NCWL 1JP5A 3MBED 2BNQB 3HNTL 4N8VB 3O3BB 5ERWB 5ICXB 3GI8L 3D48R 3DPBA 2XTJC 4P3CL 1J7VR 1N5YL 5JZ7C 2BNRD 2BX5A 4MA8L 3FMGL 1GGIH 1FYTA 4BSVB 3OKDA 4OQTL 4KAQL 1EX0A 1QD0A 4NUGL 2OM5A 3ISWA 2V5TA 2DQHL 1V7MH 3OWEA 2IPKB 2VIRB 5I73B 1AHWB 3MRGA 4KVCH 4O2FA 4HT1L 3K4ZA 3DO7B 2QADB 4XVUD 2VKWA 1JHKL 5LAXA 1U36A 5LBSL 2F5BL 3QUXB 3TO4B 1HH9B 3BPNB 4IRJC 3MRLA 4MNQE 4Z18A 3VFNB 2O26U 3SDCB 4OUUB 4XPHH 4PJ5D 4R0LC 4Z7OF 4Y19B 2A6JA 4Z7UB 5JPNA 5AEAA 5CD3B 4P99A 1IBGL 5FCUH 1NFKA 3T04D 1G9EA 2AXGA 4HC1H 1UT9A 4LAQH 4LNVA 3TIDB 4NBZB 3N1FC 3LCYA 5FO7B 1VFBA 1R3HA 1KJ3H 3INUL 5I1HH 5EOQL 5D93C 3CIQA 1NUNB 3FT3A 4P4KC 3CX5J 1SMAA 2B0SL 4HK0A 2KQNA 1KJ2H 3FTGA 3RNKA 4YWGH 1LO5B 3A6BL 5CZXC 3ARBD 4UDUA 1NUDA 4Y8AA 5F3BA 5ALBL 4Y5XC 4IIQA 4K3EH 4QT5A 1PY4A 4JFYA 3SO3B 1Z5LA 4Y4FC 4MNQD 5IHBA 3CSYB 1H5BA 1XGYH 4KMQA 4PJXB 5D4QA 1BQHG 4R97B 3T1FA 5IQ9A 3BD4A 1WTLA 4PV8A 3BESR 4YGVA 1P4IL 3HE6D 1YQ2A 1C7TA 3PWPE 3V6OC 2NZ9C 3VXMA 4W4OA 5HYJE 1E6JL 1FO0L 5JW3L 4YE4L 1IKFL 1F3DH 4M1GL 4P59L 5DMKB 1IGYB 1QOKA 4OCYL 2YSSA 2P24B 4M6AA 4LSRH 4OIBA 4G7VH 4JKWA 3RWCB 1JL8A 4G6KH 4TSBH 5GS2H 2VDPL 4EDWL 3IAPA 4MJ5A 1MCDA 5I1DA 4N90E 4CL7A 3O4LE 5D1XC 5IP4A 1DSFH 1T1YA 4UV7L 4WUKH 3S37X 3X11B 4K94C 3VXPB 2X1WL 3ZKQD 5HSFA 2I07B 3QXDA 1SJVA 2XQBL 5F7YC 4J2XA 3WNKA 3BIKB 4XBPB 1D5ZA 1CD1A 3RKPA 3KPNA 5BO1L 3ZKSD 5IB3B 5ITFA 2R2CA 1W2KT 3ZE0F 4M8QA 5A16B 4YO0A 3GRWA 4Z7NE 2R15A 2FB4H 3PWPD 1MEXL 1X44A 4XMPH 1KCRL 3O2DA 5HYJD 2GTZB 5DD0L 1G7MB 3B9AA 1KENH 1IILE 5KS9A 3OQ3B 5HDQL 4U3HA 3FFDB 5DHVA 3R8BB 5GRYA 3BO8B 4TOYH 3W11C 1AC0A 4GS7B 4MNHA 4CW1A 5EZJB 5IBTH 2HAZA 4WI6A 4N90D 2J6EA 3O4LD 3OAZH 1Q94A 4OSUL 4QYOB 1SBBA 3DARA 1CD0A 3B2VL 4QKXB 2XYCA 2YD5A 3MUGB 2UUDK 2BVOB 4HQQL 1Z6JT 4JAMA 4M1CD 4IBLT 2CK0L 2WQ8A 4H20H 4KRNA 4YDKH 3H42H 3MRNA 5ACMA 5HYSB 2R4RH 4ENED 5E6ID 1B4JH 2GKIA 2EDBA 4U3CA 1J0JA 3OL2A 3LKRB 5HJ3B 2YD9A 4KJWC 4Y89A 4I8DA 1X7QA 3DX8A 1TNMA 3MRQA 1CICD 2Q7YB 4OZHB 3VXNB 2QHRL 4YHZH 5KZCB 1EA9C 1YN6A 5DXWA 5GXBB 4MX7A 2Z8SA 5EBGA 4OCSH 4WHTB 2EC8A 3I6KB 3LRSA 4KQ3L 3O6LL 2P42B 1XGUB 2P43B 4TSAL 1G7IA 5IHUH 3RAJH 3MROB 3S4SA 3PQYA 5EBMA 2ATPA 1NDGA 4NKOB 4HZLA 3S98A 1FNLA 5F72S 4HGMA 1R3IL 1AI1H 4TTDD 2DQGL 3ARDB 1RURL 4ZUWB 4PG2A 1JGVL 4WVRA 4OF5A 4KI5E 4XXCC 5GS0H 2EYRA 3GMQB 3BZFA 5T3ZH 4NWTL 3MZTA 1MAKA 4KHTH 5IQ7H 2JB6A 3X13A 3C2AH 3FQWB 4KDVA 3TBVB 3RZCD 4Z76A 2I9TB 3W9DA 5KN5B 4LSVL 3IDGA 2R2HB 3Q48A 4L29B 3BISA 3N1QC 2N56A 3GBML 5HHQA 4FQIL 3TA3B 4PRPB 3I50L 4WV1A 5TF0A 1QVOA 4O2CB 3ZMRA 2EDLA 5C2BL 2MMXA 3HE6C 1QFWH 5DHXB 2W9EH 4LSDA 3MMEA 1UCTA 4RDQG 1H3PL 5MI0B 3QAZC 5J6GB 4PGBA 4X8XA 1U58A 4IRSA 3R1GH 4KZEH 3FQNB 5JQ6H 5C8JB 1V05A 1G6RL 2OTWA 2P44B 4NZJA 1C7SA 2WBJB 5DJYB 2F53E 2DBLH 1JHTA 4KI5D 4UU9A 4DGYH 1P7KB 3MRJA 4PGEB 1ZLUK 1N59A 1I85A 5CEZE 1U2HA 4G8FA 1OAXH 1GYAA 2XIDA 2AJUL 3KXFE 1T7ZA 3LMJH 2J88L 2IQ9L 1FZJB 3MLRH 4NM8H 3GIZL 3HR5A 1SYVB 4YHLL 5GGUA 1FNGB 1CLOL 3GBLA 1NKRA 1HHIA 3MNZB 5FKAA 4HEPG 3UTQA 2NY7H 3SGDI 3UBXI 3DBXA 2EH7L 5GGSA 4JVWA 4F33B 4FFYL 3IVKA 5HYEA 1M6OA 3P73A 4K23H 1C5DB 3DMMD 1TQBB 2AABH 4RMSA 4IDLA 4YBLB 1IL1B 4CN1A 1UJ3C 3MACH 4JO1H 4JKMA 4ODWB 5CSBA 3H9SE 3EOYG 4UTBH 1W72A 1J9CT 3NZHL 2OI9C 2HLFD 1HOCB 4X98B 1F3DJ 3W82A 1JK8B 1J1XH 3HCVB 1AQDB 1QBLL 2F53D 5DWUL 4U4BA 1T7VA 4P2OB 4XNXL 5D2LE 5ESQA 1Y18B 2EDTA 5C9JB 1OPGL 3LPFA 5CEZD 1D6EB 1BFSA 4X4ZA 1HILB 3HZVA 3ULUL 2J4WL 5BZWB 2DI9A 5TQ2L 4LCYB 4HW6A 3X17A 2GK0A 2Z35A 5JW4M 2V5SA 3ET9F 5IJKC 1UGNA 4BUGA 1L7IH 1ZT4B 5TFSH 5IR1A 5M7QA 3MNVA 3NGBB 5FFLA 1ITCA 1F3JA 1NMBL 4Z0BL 5J06A 2Z8RA 5F9WB 3M8OL 4ENEC 1LNUB 2OK0H 3OJDB 4TRPL 4O5LL 3DV4A 2P8PB 1I9RH 1VSCA 3H9SD 1BZQK 4F7EA 1WISA 5GSRB 3SE4A 4I0PA 1CICC 5B8CB 3OKDB 3BH8B 5KVGH 2YUWA 1WSST 3A67L 1RJLA 4WUUA 3IDNA 1WCBB 3JWDC 1NEUA 3U0PA 2O93L 1KLUA 3MRGB 3U79A 4O2FB 3TVMD 5BV7C 1J0YA 2AJVH 3V7AE 3LH2L 4FQXD 1NGPH 5D6CA 3JV6A 4AIZA 3EW3B 4ZAKD 5LAXB 5A43C 4QOKA 3MRLB 5E08L 3MCLL 4QHUB 4ZO8A 1OP5H 3HPLA 5HD8D 4MSWA 2MNUA 2X4NA 2A83A 2A6JB 1EJOL 5JPNB 1WWAX 1U8PA 1INDH 3FAWA 5KVEH 5FYLH 3JVGA 1UADC 5KOMC 1CGUA 4M7LH 3QR2A 4F7CA 2YUVA 1D3CA 3RZCC 1OL0A 2AXGB 5F93C 2WLZA 3O6FC 3MXWH 5E7FA 4EI5D 5E0QA 4JFQA 3GMPA 1G9MC 1R3HB 1NMCB 2Q3AA 4ZNEE 4OV5A 3U6RA 1B2WH 3D18A 5HBBA 1LD9A 3FT3B 3WDIA 4HK0B 3VXUA 3FTGB 3RNKB 3SDDD 3UC0H 5D7IF 4UDUB 3CXHJ 1WK0A 5CBEA 5F3BB 4IIQB 2NLJA 3S37L 2R1XA 4QT5B 3MLZL