4DCQB

Crystal structure of the fab fragment of 3b5h10, an antibody-specific for extended polyglutamine repeats (orthorhombic form)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
218
structure length
218
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTTYGMSWVKQAPGKGFEWMGWINTYSGVPTYVDDFKGRFAFSLETSASTAYLQINNLKNEDTAVYFCARGGNNFLWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Disease-associated polyglutamine stretches in monomeric huntingtin adopt a compact structure.
pubmed doi rcsb
molecule tags Immune system
molecule keywords 3B5H10 FAB Light Chain
total genus 42
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2012-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dcqB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dcqB02
3O4LD 4MNQD 3QSKB 3VE0B 3N85L 4KHTH 3WJLA 2IADA 3BP6A 4NUGL 3WDHA 4YBLC 4NN5B 4QCIB 1N59A 1VGKB 1Q72L 2QADB 4LL9A 2HFEA 5B21A 1YEHL 3GB7B 3UX9B 4MD5A 5HHME 4GKSB 5E8EA 3FQRA 3TYGH 4ZSOA 4Q97A 5ADPL 1UCBH 1B6DA 2BC4A 3TP4A 1CFNB 2XY2A 4GW4B 3SOBH 4RMQA 4ZAKC 4P48A 3LKOA 3LDBC 2JJTA 3KLSA 3MOAL 2GK2A 4QTIH 4QRRB 1UXWA 3ES6A 3RWJB 4NRYA 2J7LA 5JPMB 4LLYA 4UNUA 5E7BA 1RK0B 3WUWB 1NDMB 5I1HH 2NZ9C 2VE6A 4I0PB 1MFAH 3C60B 3LN9A 1WFUA 4POUB 4J6RH 3K81A 5DK2A 3REVA 1CLCA 5E99H 3SKUD 4ZFGH 4NQDD 3EJZC 5DMIL 3R06B 2VZ3A 4ZSOB 3GSQB 4X6CB 1JK8A 1T0PB 5IFJB 1NSNL 4PFEA 1VEPA 3QNXA 3ULVL 1NFDB 2YKLH 2YPLE 1RHFA 3OZ9L 1DVFD 4R90L 3CK0H 4OZGA 5EFIB 4DEPB 1QFHA 1ZLUK 2YBRB 3R06A 5HYQB 4K7PY 3O6KH 3GSWA 5A2FA 3MRIB 3PIQA 3C5SB 3EIFA 3G6JB 1FFOA 4NM4L 2PR4L 2EH8H 5CJBA 2DQUL 3TBTB 4BK4A 2I9TA 5JDJA 4YDKL 4ZNEA 5DI8A 1MLBA 1W72H 4OF5A 4PBVC 1ZWIA 5I1IH 3A6OA 3LKPA 5F7EH 3FB8B 4JKLA 2E9BA 2AW2A 5E8OA 4RAVA 4HQQL 5DT1L 2J8OA 3HG1A 1EEUA 3EJZD 4HIHA 2Y6SC 3H7LA 4CVZA 4IRSC 4XMPH 2IAMB 8FABB 3QHTC 1Z2KA 5IF0A 5FGRA 1NMBL 1T66C 2QHRH 3MNVB 1TJHL 4U0RB 5D8JH 4ZPTA 4LLMB 4ONGL 4P59L 5DMGD 4PJIF 5HGDA 2HKFH 4MNHA 4Z6AT 2R2HB 3ISWA 3OAYH 1IC4H 2MQ3A 3GEWB 1D5XA 1M7DA 4MAYB 5ICZA 1WF5A 5ACZA 1I7ZA 4KKAD 4TYUA 1P6FA 4PV8A 4F7EB 3HMXA 1U8KA 2FD6L 5ITBL 2APXA 2DQEL 2WINA 4UAOB 3WHE0 2VDQL 5I8OH 2AAVA 3QJFA 4HIHB 4KI5E 2EE9A 3KYKL 3PJSB 5C07E 2CDFA 3CFBB 4MS8D 2BY0A 4D0DA 2R1XB 1HXYB 2PW2B 4PB0H 5AEAA 3U79A 4OI7A 4J4PA 5C0FA 4XNUH 4F9LA 1Q1JH 2BOCA 1NC4B 1B4JL 2Z31D 1DDHA 3LZFL 1P1ZB 4UOW0 5DHXB 4LF3B 1F8TL 1ZSDA 1ADQH 3IVKB 3RTQA 1PYWB 2HJKA 1TTGA 5FM4A 4UMGA 4DVRL 3SY0B 1KPUA 1FO0H 1HKLL 2BSTA 4YHPA 4DGYL 4OLVH 4KKBD 4XNUL 2XTJC 5MP6L 2E9WA 2HN7A 2SEBA 3DBXB 3C5ZC 2VE6B 3QNXB 4C56A 3SKOA 2LVEA 4HJGB 4DN3H 1NL0H 2AABL 4OIBA 1TTUA 2NZIA 4GS7C 1D6EA 1NFIB 4X83A 1IEAA 2L0DA 3ARGD 4ENEC 5GGQH 5KVDH 3KXFE 3VFUA 5C0CB 5I73B 5CD5D 5FA4A 2DIAA 1F97A 3BQUD 3F5WA 1ITCA 4M1DL 2LU7A 4QRUB 3VA2C 5HI5C 3NIGF 3RVUD 2GSGB 1HYRC 1AQDB 1QFUH 4GW5A 3S3SA 3T0VA 5CEXB 4LEXL 3ULSB 4AYFA 5HY9A 4F8TA 4KZDL 4KV5E 3GJFA 1YN6A 1NLDL 4S1QH 2ZKHH 4PJDE 3BPOB 1EHLH 5MI0C 4YXHH 5EA0L 3EO9H 4Y2DB 4AMKL 4I5BB 2Y7QA 1ZLWH 3GNMH 3C5ZB 1HXMA 3ZT7A 3DETD 3FQWB 1F2QA 1R5WB 3ZDZF 4CMMA 1JNNH 5JHLL 1MHPH 4P4KC 4BSWB 5I1AA 4YHKL 5SX4I 2QJDA 1U8LA 4OKVA 1FZOB 1MWAB 2PTTA 4YHKH 1N2RA 4Z7OF 4WEBL 5KVFL 4GRWE 1FCCA 5FDYA 2NXYB 4P4KB 2BVOB 4B7IA 3M8OL 3MLZH 4WU5A 4YZFE 5IVXB 3HMWH 4JPKL 2VABB 5T3ZE 3DRQB 3EKCA 4YPGA 3VMNA 4B50A 3U30B 4U7MA 4XRCB 4XMKL 4AT6A 3BHBA 2F15A 3B9EA 5FGSA 2EKJA 3H9SD 3RZCC 5C0DB 4WHCA 3CK0L 1JWSA 4AQOA 5BOZG 4TULH 2DWDA 1CXLA 2BFVH 2BRRH 3OZ9H 4PG9A 3D6GA 2Y25A 1XIWB 3QDGA 1I3GL 4V1DD 1W8OA 1JYNA 2LE9A 5FUZL 3NVQA 2J3SA 2MNUA 3G6DL 1MI5E 4R7DA 1ERNA 4V2BA 2Q8AL 3RY5A 1QZ1A 3INUL 2NY5C 3UTZB 1BZQK 3RP1A 3W5NA 5HDOA 3S3JA 3MCLH 1CFSA 1U8QA 1CGSH 1N5YL 4KRPB 1UH2A 4L8CA 3K80A 1EEYB 1BOGB 3RWDA 4N5UA 2P5EB 1VACB 3MLSL 3TJEL 2JTDA 3DX9A 1JE6A 2AXJA 3PABA 5GS0L 5TDNA 5BRZE 5C0AD 4F9PA 3UCRA 3G5ZB 1YEFH 4JPIB 4X9BA 2VAAB 1NUDA 2OI9C 4U1MA 4OD2B 1H8NA 3F7YB 5GZND 5GSVB 2B39A 1NLDH 4S1QL 5I8EA 1KCRL 1U91A 4Y8AA 5J11B 4NNYA 3MCKB 1NEUA 1FE8H 2ZSVA 5DD1H 3ZDYF 3RNQA 5C08B 2CQVA 3IJYB 2I27N 3JWDH 4PGBB 5FYLD 32C2A 5BVPL 4GMTL 2VERN 5B38G 3QUML 3B5GA 5AAWA 3CLEH 1UACH 1G9NL 4ELMB 5IB2A 4UTAH 4XP6H 3BXNA 1BJ8A 2J2ZA 4NKDA 3F6LA 5MP6H 3CH8A 5JHDB 4KRNA 5IKCA 5C8JB 3B5HA 3CMOH 5D1ZD 2IF7A 2DQCL 1AIFA 1HHKA 3NCJH 4PRBA 3RVWC 3RWGA 4LARL 5SX4H 4F57L 3HLAA 1OOAA 4RAUA 4K94L 5JIHA 1A7PH 1WZMA 4CVXA 4A2MA 1V7ML 4MXQD 3ARFA 4GBXB 3I3DA 5I1KL 3TH2T 4Q9RL 4GFTB 3UC0H 3VMOA 5J1AB 3NA9L 1GZPB 4M3KB 4QHMB 1CDUA 5TE4L 5I8KL 4GRLB 4QRPA 1WSST 4IMLA 3GBML 1JZ3A 4CUCA 1SHMA 4PJ5B 2ARJA 5DUBA 2NY1D 4KHXL 3Q2CA 4KAQH 4NQEB 2ZJSL 1G0DA 1FDLH 4WV1A 3BISA 3D2UD 5DFVD 5FYJE 5A43C 4JB9L 5ID1A 1X9QA 4PG9B 2R1WB 1ORQA 2R4RL 2CO6B 4M6NL 1IC7H 2BSED 5C0RL 2GTZA 3RGVB 2CH8A 4Y5VA 3W0WB 3OJMB 2Z8RA 3O9WA 3O81A 2XV6B 5BZWA 4EBQH 1P4BL 1YECH 3IF1A 3GMQB 3GSXA 4I0PC 1P4BH 4U49A 5JDSB 4FXKA 3RKDC 1Q94B 1J8HD 3F6IA 4EI5B 1CIUA 1SEQH 2V5YA 4LFHD 3U82B 3BE1H 3I2CH 3T2QA 3KVQA 2EYRB 4Y2OA 3F58L 4KK5C 1D3CA 4X4YA 5C0GB 3SDCA 5BMFL 4WV1B 4UOJA 1UJ3B 1TETL 4KTEH 1K8IB 2GUOA 3MLUL 3GBLA 5C0AB 1OTSD 5JIIA 4KY1H 4JGMA 3TBSB 5IQ7H 1J0YA 4L3EE 3S5LA 1M05B 2Y9RT 4GRWB 1Q72H 2HT3C 3FOMB 4OLYH 2IEPA 4NN5C 3O6FA 4GG8B 4Q6YA 2XTLA 3JTSA 4MMXC 4Q6IA 1KLUA 3QZWA 4KRPD 4PJXA 1WBZA 4C54A 4Q9CA 5EIIA 3PGCB 5HI3C 1MCPH 1J0KA 4LKXB 4PJ9A 3F7VB 1UB6A 3G5YA 4KK9D 3MV7A 4I3RL 1SM3L 2GJJA 4DVBA 1ZLWK 1OAXH 4XZUA 1MI5B 5IMMB 5IESL 5DMIH 2RIKA 4V1DA 1U8PB 4UBDC 1H0DA 5JPNA 2NW2B 5SWZA 3TJEH 1VKXB 1X5JA 3UPRB 2VDPH 3D0VA 1YY9D 3MQIA 3VWKB 2J88L 1BREA 5CZXD 4LLMA 3GKWL 4XMLL 2UUDH 1PEZA 2PXYC 4PJDF 3JWDC 4RISL 4KK9C 2DYPA 1XGQA 3QCVL 1WBXB 1GJIA 1WWBX 1OAKL 5C0RH 4QRRA 3MRGA 3ALXA 1QSEB 4PRHE 3KPSE 1R24B 1E6JL 3NIGE 3RZCA 4JN2A 5DD1L 5CWSB 1NGWB 4OAWB 4OM0H 1NQBA 2Y07L 5E2UL 5C0IB 1T3FB 1WBXA 2OCFD 3V8CA 5KZCB 1K2DA 3CFDB 4JCLA 4WFGE 1N5AB 3JUZA 3IAQA 4UOW1 4JFPB 3DUHA 1WITA 1FNHA 4BSWA 1QSFB 5F96H 2VDLL 5CIPH 1WIUA 2BY2A 4O2EA 2YUVA 4OBSA 4WFED 3V5KA 1RUAH 3BEVA 4YEFA 3THML 3K4DA 3SPVB 3QXVA 1FIGH 3MJ6A 4OGYH 3QPXH 1P4IH 4JM2A 3WS3B 2VZSA 4WU7A 4YNYA 3HRZA 5F3HA 4PJ5E 4N8VG 3O8XD 5C07B 4PV9A 4PRPA 3BAEL 4EN3C 2Z4QA 4PUBH 2KBGA 3T3PE 1SBSL 3LN5A 2YRLA 4NZUL 5TDPB 2QQKL 5BS0A 2EDYA 4TVSa 1GL4B 2IMMA 1MREH 2VDNH 3WJJC 2QSVA 4HH8A 1QSFA 1E28B 2MFNA 3GMLA 4LSRH 3BN9C 4I0PA 5ITFA 1LD9B 4GQPH 4LVOC 2F53D 1BGXL 3WLBB 3VGGA 2CIIA 4OCYH 3VFPB 4R26L 4Q6IB 4KMTH 3JTTA 4ONFL 4TUOA 5JIKA 1C16A 2L7UA 1WFNA 3QFDB 1MF2L 2E7MA 1Y0LA 1ZSDB 5E70A 1UJTA 2WBKA 1RZJH 1CICB 2VXVL 5DC9B 4TUOB 4Z7UF 4W4NA 3WNMA 5IP4A 3L3HB 5C86A 3ABZA 3DLQR 5CKAA 1NL0L 1U8HA 2VLMD 3K2UH 3L5JA 5C2UB 1C8PA 1AGBA 2CRMA 3UP1A 1AHWB 1YMME 5GHWL 1CGSL 2EZ0C 1MI5A 5IMMA 3WL9A 1YMMA 2ZCKL 1T0MA 3W9DB 4LOUD 1PX4A 3MNZA 4YPGB 4EKXA 4OZHA 2DTSA 5L9DL 4XCEA 2B2XH 1PVHA 1D5BA 4LQFH 5H2BB 1XZ0A 4HWZB 3B6SB 3UPCA 2Z35B 4UU9A 5EU4B 1NFDE 3O6FB 1T04A 4GQ9H 1BVKA 5GGVL 2DOCA 3OKOB 1IGCH 1N5AA 5CJQL 3SCMB 2AJYL 5HI5D 2BDNH 3C6LC 1KG0A 5MEPB 1INQB 4MB3A 3S4SG 1QNZH 1RZ7L 2YPKB 3NACH 1EO8H 2J4WL 5DHVA 4JFYA 3D39D 2HRPL 1MQKL 3M17B 4HIEA 2QL1A 2X40A 3EZ8A 4G7YH 2HWZL 4O2CB 2ESVD 4FQJL 4OLVL 3M8OH 2YRZA 2M26A 3NIFF 1YEJH 2Z35A 4YHIA 5IJVA 5AUMA 5DMJB 4JJ5B 4KWUA 4G8EA 2YPVL 4K3EL 4IRSD 1CFTB 3FO0H 5JTWA 4NCC2 2Y5TA 3ARDC 4U1KA 3HC4H 3T2PA 4R4ND 2RQ8A 3OG6B 4LCIH 1FAKT 5MENE 5DVKA 5I0DA 3D25A 1Z3GL 4X6CE 5JPNB 5MENA 5IB1A 1MFEH 5D7IB 4UT7H 5ID0B 4NRXA 1NGZA 2VLJA 5C7XH 5EO0B 5KSBF 1AP2A 3DUSA 5EB9A 1DLFL 4FFYL 1IGYB 4PBWD 2VSDA 1R3LB 2XYCA 2QQLL 2P8MB 1YY8A 4PJCE 4PRIE 5GSRA 1QOKA 2BRQA 5KZCD 4P5TA 2EYTA 3BH8A 1KGCE 1KJ3H 5DA0B 1JP5A 5AZEL 4X80L 4ZOAA 5D93B 8FABA 4IRJD 3ET9F 4KZDH 4LPVA 4MD5B 2O26U 4ZNCD 2IAND 2KUTA 5E1AB 5LAXA 4OBRA 5ANMA 4AIOA 3GMOA 4P5TC 3BO8B 3VFPA 4GAGL 2QADD 3O3UN 5KVDL 2YC1A 3G5VB 1YEFL 1TJIL 3OKNA 1MJ7L 1MLCA 4HH9A 3ARBA 4S2SB 5DDHB 3RDTD 4PJDA 3PNWA 1Q9LB 1VGEL 3X13B 2NXZB 2GAZB 4WI3A 3DXAD 2F53A 2B7DT 1DVFA 3FB5A 5EBWA 4LNRA 4JPWH 1Q9WA 1SY6H 1S7SB 1EFQA 1S9XB 5F9AC 1IM9B 1WZKA 2BVQA 2WW8A 1EGJL 4Y1AB 5C0IA 4GW1A 4JG1L 1P4LA 4GXUN 2V6HA 4Y19B 1XF2A 4LNRB 1G9EA 4LK4A 5HGAA 4EDXA 3N1QC 4MCYB 4WW1B 2BJML 1RAMA 5HD8C 2QTEA 4EXKA 4RA0C 1ZT4A 2NX5B 1LP9A 5DD3H 3ARVA 3IB4A 2X4SA 4GBXA 4G6FB 3WEXB 3MGTA 4CJ0A 3SQOL 3HI6L 3MV8A 5FYKE 3BGMA 4L8DA 3LV3A 4WUUE 5DURD 3VFUB 2JIXA 4NNXB 4NSKA 2VUYA 4JZJC 2NCMA 1MWAH 1DBML 3JWOL 4HBCL 1KIUA 4YBHA 3UYRH 2AQ1A 5E4EC 1WZLA 1MFCH 4QRSB 1CL7L 4L4TE 3TVMC 3O8XB 2HT4C 4WVRA 3ULUH 4NM8H 4HWBL 4FQ2L 4QWWD 2WBJB 3HZKA 4JCMA 4U1MB 2DAVA 2VUOA 2YK1H 4M9PA 25C8H 1T66D 1WTGT 3ZHKA 1J1OH 2Q8BL 5C09D 3QQ4A 3L5WB 5B3JE 4L8SA 2FIKB 1OHQA 5F9DC 3D39A 4GKOA 2IBBA 1FZMB 3U7WL 3MOBL 3RWHB 1EFXA 3QCTL 5D7JD 4U3XA 4YK4C 5D5MA 3CU7A 4IOIB 3WIIL 2JJSA 4H8WH 2X9XA 4LLDA 4L29B 2DLHA 4LEOA 3MRKB 4LVHC 1LP9F 2J8UF 4Q0XH 1H3PH 3KNBB 4DN4H 1ADQL 4XT1C 2AV7A 4HGWB 5E8NB 3VFOB 5KJRL 2W9EL 4NKDB 3KPLA 1NCUA 4OGAD 2W9DH 2UZIH 2PTUA 3VFMA 1BEYH 5HVWA 2I5YH 3B9KA 1EPFA 4ISVA 5DEGA 1Z9MA 4ZDHA 4NQTA 3H3PL 5EO9A 1CXKA 1RJZA 1GZQA 3K0WA 3SDDC 3QIBA 3E6HA 1I9RH 3IJHA 1FRGL 3LY6A 4LLVA 3ZDZE 5IF0B 2VB5A 5IVZA 3QUXC 4JZOB 1RZFL 4ODUB 2VZTA 3BP5B 1IZJA 2HLFC 3ZE0E 4CADB 1QFWI 1JGUL 2OSLA 4R2GB 4HJGA 1R3IL 4QHKJ 1GGCH 5AWNL 3SE9L 1DN2A 4NCC1 4HUNB 3GMRB 2R1YB 2WMPA 4R3SA 1BIIA 3O3DA 2NY2B 3MLXL 1OCWH 4Z7WF 5DLML 3MXWH 4X6EA 3S37H 3QNZA 3DRTB 3U9PH 4WEUD 1DR9A 3ORJA 1HQRB 5D72H 4PR5A 3KPNA 3SDXA 1JZ2A 4M48L 4JRYE 2FO1A 3RPIA 2D03L 3ZE1F 1VACA 4YX2L 5MHSD 3BKYL 3K2MC 1T20B 1HSBB 3BUYA 2FH6A 3VWKC 1VEOA 1KEMH 1EIBA 4JY6A 4HULB 3CCHB 1JN6B 4Y4FB 4MJ6B 1AQKL 3L3JB 2NY0D 3DURB 3SO3B 3WO3B 1A6AA 2GJ6A 3GO1H 3PHQA 1TCRA 3WNNA 1A7NH 3D0LA 1R5WA 4P2YA 1CGYA 5TQ0H 3IDJB 3L5XH 4X6CF 5DMGC 1LDPL 4YGAB 4M6ML 4W6WB 1QFWL 1MJ8L 1S9VB 3C87A 2AP2A 2CMRL 2HH0L 1VPOL 4PJGE 4JRXD 1XGPB 3VFTB 4D8PB 4ZXBD 5HJ3A 4Y89A 5J89A 1J5OL 3R8QA 2ARJQ 1T5XA 2F58L 3CLEL 4L9LA 5HHVL 3QRFM 3MFGB 1EERB 3QDGD 3BHBB 3MMEB 1NGWA 1QEWA 1TZIA 4JY6B 4JFEA 1CE6B 1CZ8L 2VQUA 4Z7QF 4IRJA 1KTLB 4I48B 4ZFGL 3G9VA 5BZDA 3K4ZA 3EOAA 1YY8B 3AREC 4M1CD 3OXRA 2C26A 5HHQA 3ESUF 2XZCL 3QO1A 4G80B 3T0XA 3ARFB 1L4IA 4MMZC 3HE7C 5E2UH 4OCSH 4Y8DC 3ARFD 4OZFB 5JQHC 4MJIA 3ZTNL 5C09B 5DA4A 5EO1A 3EDDA 4KDWA 1OW0A 4L4VD 5LKNA 4KJYA 2FBOJ 3OKKB 1R0AH 5BCAA 4NKIL 3UPAA 1G6RA 4QHLA 1QLEH 4CGTA 4JFHE 4GLRI 3D2UA 4MD4A 4BQBA 3MUZ1 2DLEA 2GI7A 3ALPA 3EYOB 5E1AA 1J0HA 4PJGB 3S6CA 3E3QE 1MFBH 4HIXL 2IH3A 3MRQB 3QNYB 1T0MB 3S96A 3W9DA 4ZFOB 1ED3A 1NEZA 4G9DB 3OTTA 5HDLA 3W2DH 4MZ3A 3VXRB 5SV3A 3N9GH 4OZGE 1OAYH 5JOFA 2N7AA 4DW2L 3BP7B 3QEGH 2FLBT 4MHHI 4Y4FD 1BP3B 5F6HI 2APTA 1PY4A 5EDXA 3BDYH 4BSVA 3BRFA 3SGJA 4L8SB 5MEPA 1CFQA 4Q74A 4EQ3A 3QUXB 3TT1L 2R69L 1FGNL 4HK0B 3BGFC 1IAOA 3EYSH 5CJ5A 1X6LA 2H2PD 4PJ5A 2F19H 4Y1AD 4FQIH 2AEPH 4KXZH 4P23D 1YY9C 4RAVB 3C5JB 5IG7B 4QXGL 1LE9B 4L9DA 3QH3A 3IU4L 5HDQL 3EYUL 2DS4A 5FM8A 1BEYL 3PP4H 4JFFA 4HPOH 4G8IA 1KN4L 3GMLB 2NY4B 4X6FB 4XC1H 1XGYL 2QR0A 2EDJA 1HHHB 4DGIH 3VXUD 3T1FB 1IT9H 4I5BA 4NDMB 4QTHA 3GRWL 1E6OL 1KV3A 1UWGH 2CDEA 2KL6A 1CS6A 5FGBC 3CDYA 4MAYD 5GJTL 2JB5L 4E41D 5JUEH 3WFHA 1GC1H 4G80A 4JB9H 2APWA 4MXWH 3MRDB 3KDMA 5HSFA 1OF2A 3GIZH 1GPOL 1GIGH 1ZT1A 1W8NA 5JW4Q 4U1GC 5E8PA 1AE6L 4KC3B 5IMLB 5M94B 4IRJB 4HZAA 3QHFL 2WBJC 1J1XH 3S9DB 3O2WL 2BVEA 4KDTA 4YBQC 1CDGA 1NANI 2JCCA 3EOBA 4YHOH 4OLUL 5DHYA 4IOIA 4DN3L 4GUPA 3NA9H 1MHEB 4RRPA 2D9QB 1KIRA 5D7JB 3WSQL 3U6RA 1AQKH 4IRZL 3QQ4B 1OAUL 1RIUL 1FNEB 4QXTB 1DQDH 1D5BB 4YPJA 4XP9L 3Q1SL 4Y2DA 1NCDH 1MEXH 1OD7A 2O5YL 4PRNA 5CP7B 5T1DL 2AJ3A 1HIMH 3D9AL 5T1MB 4EUPA 3QEQD 2C9AA 1S3KL 1ZV5A 4OGAC 4OJFH 1JRHL 4L4TB 1CU4L 3QO1B 5F7UA 4HF5L 4JO2L 1UACL 1EAPA 5DRZB 1PKQB 4PRNB 1JGVH 3W82A 3QQ9D 2OMBA 4HXBH 2ITCA 2NY6D 5C09A 3MLYH 4G8GA 1RUKL 2J5LB 3OAZH 5DURB 1DQML 4FZEH 4CDGC 1XF4A 5K9JL 2OX5A 3G5YB 5IVZB 3P9LA 3REWB 2BSRA 5DRXA 5D1ZC 4FQXA 3JV6B 3KXFA 5E6ID 5EZJA 4PJ7B 1KTLA 2NTSP 5DD6B 4QRRD 1KJVA 2GTWB 1CXHA 4YUEH 1XEDA 3JVGA 3VXRE 5IB3A 3WJLC 4GMSL 1RUPH 4F15B 1FAIL 2RCSH 5DYOA 5F1NB 1RV6X 3MV01 1MJUH 4JFXB 2G2RB 1DSFH 1EBPA 4OZIA 2WUBH 1N5YH 1VHPA 2DD8L 3FT4B 3ZYZA 1FL5A 4M7KL 5DJ6B 4X9HA 2X1XR 3MOBH 3WS6C 2XWBA 1Y6MR 3FQTB 4Y88A 1BJ1J 2G9HA 3O4LB 2GJ6B 1NLBL 4EUPG 1W0VA 4PJ9B 2X4RB 3IFLH 1QKZH 1KB5A 1FQ9C 1JGLH 4N0UE 1C5DA 4O2EB 2N4IA 1IILE 3HS0B 1OP3H 1LE9A 5EUKA 5BW7C 1NFDA 2CRZA 4PJ8B 3RJQB 2DKSA 1Q0YL 4QRSA 2X4OA 3KG5A 4PG2C 4B41A 3P2TA 1F90L 1NH6A 3RFZC 4PJIA 1SVZA 3FQWA 1BZ7A 1DBBL 3D3VA 1FLRH 1FVDA 2H8PA 4DAGL 4X5WA 1MFNA 2AJXH 4XH2B 4FQLH 4YHZL 1F02I 4K3GA 4JZOA 2ICCA 2OK0L 4Y2DC 4PJCA 4WTWA 5I1LA 3FB6B 4OCRH 3BP7A 5DJXA 5GRVK 5FOBB 4JGJA 1S7QA 4JFEB 1SYSB 1S7UB 3OGCA 2FJGB 4XPTL 3FONA 1XT5A 3QIBC 2YMXH 4O4YH 5I1HL 5C9KA 3UAJC 4IMKC 2EXYC 4M43L 2WWMC 4ELMA 4HFUH 1NCAH 4XP1L 4AM0A 3EYQD 3ZYIA 4M8QB 5IHZB 3QDJD 3HB3D 3GSRB 1SYSA 3PQYA 4OFVA 5IVNA 3O9WB 4FQQB 1PEWA 1RJCA 2ITCB 3IFNH 5IKCB 1OM3H 3T0EA 3BSZL 5FKAA 4PLJD 2BSSA 2DWDB 1KJMB 2DQDL 3B9VA 1YYLL 2Z8WC 4GKSA 4X9GA 4F7TA 5IWLC 4L4TA 1SYVA 4E41B 3FO0L 4OFYD 2Q76B 5LXGL 3SKJH 4RGNE 5DFVC 4LSPL 4D0CB 1JN6A 4Y4FA 2LFGA 1OAQL 4BH8A 3VRLE 4YHYB 3QFJA 4XNYH 32C2B 3QHFH 4U1SA 3H42L 1P9MC 4HS3A 4P3WA 4LHUG 43C9B 3FQUA 2XI9A 1ZTXH 4BZ1L 2Z93B 3TIEB 15C8H 1RUPL 1KXVC 4ZS6D 4ORGB 3GHEL 2J8UE 3IKKA 4JFFD 1WBZB 2VXUL 3TPUA 4WRLA 5JXAH 4OCMC 1CK0H 3ARGA 4UAOC 1INDL 3B8YA 3MV11 4CN1A 4X9FA 5KSAA 3SBWC 5HHXH 2HT2D 3I9GL 3BQUA 4JKKA 2X1OA 1AI1L 4DK6A 3OF6D 3ARDD 1BZ9B 3U36A 2YUWA 1I1YA 4RWHA 1L7TH 5FCUL 4XGZB 4MXVE 4WI5A 5HYJE 5KG9B 3ZDXE 4QXUL 4M61A 5IW6B 3EUUA 2DQHH 4PGBA 4GSDL 1BZ9A 1XF5A 3CUPA 1OPGL 3QO0B 4D9RD 1NFIA 5DD0L 3LEYL 2V17L 5T3XL 2PKDA 4RMVA 1MCIA 4AEFA 4IDJL 1HIML 3VXUB 4J3WA 4OF3A 5F3BA 1SQ2N 1YEDB 4IOSD 5EUKB 1FNGB 1LO2H 4F7MA 4U6VH 4P9ML 4OCYL 5DJYB 1J0JA 1PD6A 3DXAA 2VAJA 3O3EB 5CUSH 2IFFL 5E6IA 2AV7B 4HGWA 3BPCA 5C0NC 2BNRD 4QNPE 3HLAB 3MRMA 4ODWB 2X4PB 1VFBB 2WUCL 5SWSE 3RI5F 1AJ7H 1EUTA 1ZHNB 4X4YB 4ZO7A 3P0YL 5L7XH 2QADC 3HAEA 3WXWH 3DVNB 2ZUTA 1HHIB 2BXYA 1Z6JT 2R2EB 1OCWL 2BVPB 1U95B 1RPQA 3KLDA 1F6FB 1E0OB 4DCQA 4DZBB 3AROA 4QF1A 1ZVHA 3N50A 5TGBB 3O6KL 3LEYH 3T0EE 4XNZB 1YPZB 4MZ2A 5FYKD 1JGLL 3FT3A 4NT6B 4EIZC 3RWEA 4A6YH 1NC2B 5F21B 5ESQA 4KDVA 3NIDF 4NQED 1I3UA 1LEKB 1RIHH 2FZ3A 1DL7H 1M1SA 4WW2A 3T77B 5C08A 4I18B 2CJUH 1JWUA 2D7MA 2AJZB 1TCRB 4WI2A 4Y1AE 1A3LH 1QLRB 4XNZC 1ZT4B 1ZEAH 4XNXH 2UWEF 4MA3B 5E94B 3SGKA 5HDBF 5L6YL 4I18A 3RX5A 4DTGH 5D2LE 1LDPH 4OAWA 3DMMB 3DPBA 1VFAA 1CLOL 3EGSA 4MQ7B 5JIPA 2VITB 5GJSL 3QUXA 1S7WA 4LKCA 2FJFB 1RUQL 1J0ZA 1CN4A 3JZ7A 1HOCB 3IETA 3QDGB 3RY6A 4YLQT 5KVEH 3OKEB 4AQ1B 2J88H 1FVCB 3HPLA 4G6MH 4JY5L 5KN5A 3SKJL 1S7XB 2ZPKL 4KMTL 4OZIB 1A1MB 4ZXBB 1IM3A 1H0DB 1QLEL 1S5HB 4LPWA 1ONQB 4KDTC 3V0WL 3WFEH 1FJ1A 4MX7B 3BKCL 1MOEA 1HHHA 1JTPA 1UJ3C 4ODUA 4ODVH 3UJJH 1N0XL 4BZ2L 3MLRL 3OR7A 4U1NA 1MCPL 5I9QC 3PXJA 1EUUA 1YZZA 2BMKB 4PS4L 3SGDH 3HAEB 3TFKD 5JXED 3X12A 3RBSA 2IBZY 3QUYC 3OHXA 4PRIB 2X05A 3JWOC 1LWRA 2EEDA 1KB5B 3I6GA 4M62H 3EBAA 1UFUA 3DO3A 1ZA3A 4XI5C 3MRCB 2EH7L 3QUZB 5GS2H 1DQDL 1P1ZA 3GSVA 4X8JA 2W9LA 4OD3L 4JFFB 4MQXD 3MJ8A 4PJAE 1YJDH 2DN7A 4KK8C 4JDVB 1KENL 3I2CL 1UCTA 3MGOA 2A6KA 4MA7H 4UIMA 3TYFA 1RUML 3D1MC 5I76A 2W9DL 3WUZA 4QHNA 1F58H 2DM4A 1CG9A 1YEEL 1QPPA 2V17H 3EOTL 4HD9A 3VXQB 4N0FA 4R2GD 1G6VK 1QG3A 2NMSA 3LH2H 2LTQB 5IM7A 3FZUD 1A6UH 4HKXB 2ADFL 4HV8B 4ZODA 5IROA 5IW6A 1WIOA 2W65A 5A2JH 4BH8B 5J8OA 1A5FL 3C60A 4UT6L 3ILQC 2XXMB 3JWNC 3MJ9A 3MROB 4PRDA 2OI9B 2VLLA 3KGRA 3L6FB 2V2TB 5LCVH 1P69B 1T5XB 4OUUB 1G7LB 4QRTA 3V7AE 2ERJB 1KB5H 1XH3A 2XIDA 5I1JL 4O58H 2R0WL 5L8LB 4WGWB 4PP2B 3DYPA 2AJUH 3V6ZA 3S35X 3FOLA 5GRJL 2JCCE 4FTVB 5DJAB 4DCQB 4WU5B 4JVWA 5IVXA 4FABH 2R0KH 4HJJL 1GHFL 2O5ZL 3BZDA 3MCKA 2ZOKA 4C58B 2E8ZA 1O5DT 3UO1H 4XC3H 4F7PB 3GGWB 4RWYH 3KJ4B 4OF8A 1UENA 3R0NA 4GKZA 1FZJA 5E00A 3KR3H 5M7QA 2W60A 2I9LB 2GUOB 1IGML 4ZG1A 3UEZA 1RIVH 3V4VL 4HC1H 4PS4H 1AHWA 5C2BL 3KPNB 3IXAB 3CJJA 3MV9A 5F1KC 4OCXH 5CSZB 3FB5B 5F7WC 4O02L 1OSZA 1KNOB 4X9IA 3B8SA 3QIWB 4JG0L 4FQ2H 1FN4A 3CDGB 3CDFA 3HE6C 4RFNC 1B2WH 3RUGF 4H1LB 5T1DH 4JHWH 4ACPA 3IFPA 3B3IB 1BBDL 1DBJH 3P73A 5CAYB 3RWEB 3KPOB 1MFCL 1PLGH 3FN0H 3PHQB 1IE5A 3T2NH 4JM2F 5I75B 1EAJA 3PWVA 4W68A 1IAKB 5FECB 3WNPA 1I7TA 3TEUA 1B88A 1BWWA 5GS0H 3KPOA 4LP5A 1KEGH 1NCBL 1I85C 5DRNB 1TJIH 3DX9B 1M71A 5EBMB 1T2QL 5T5FH 1A7OL 4MXQC 3OB0K 4K3DH 5E6IB 2P5EE 3VFWA 3PHSA 3NIFE 3DETC 4P5TB 2VDOH 3T0BA 3B43A 4OLWL 1A1NB 1Q0XL 2W0FA 4LBEA 3G9AB 5CJXC 1AGCB 4G42B 3DROB 4YR6B 3AB0C 4F80A 3KPMB 3TZVA 1MH5B 1ZHNA 2PYFB 3VXME 1ZWIB 3BD5A 2DWEB 4OF6A 1T89C 1JZ4A 4Q9RH 5FO7A 2FEDD 3CFEB 4U33A 3GMPB 1F3DH 1CDHA 5HHQB 1MCJA 3VW3L 4H0HB 4I77H 4U6XA 5D1QB 4FFVC 2F8VA 4XPBL 1FNLA 1OM3L 1INDH 1S78C 1ZA6A 2V2WA 2F58H 4TULL 2DQJL 4DWHA 4ZS7H 3FB7A 4HUXB 1DLHB 3PWJA 3T8XB 1X5IA 3LS5L 1QSFE 3C8HA 4XPHH 4E41A 3BXNB 2BNQE 1ZXQA 2GFBA 4HT1L 4LPYA 1YPZA 2B5IB 3MNWA 3O0RL 3RKDD 3P9MB 4BZYA 1XGPA 3O9WD 3VFTA 4D8PA 1UADC 4OZIE 2EIBA 1EH9A 5FYKL 4AEHL 4BQCA 3QDJB 5F1OB 5IMOB 2E6QA 4G6JH 1LP9E 5E95B 4YHZH 4Y5VC 1HZHL 4HXAH 4NRZB 4U6HB 4U6YA 1QSEE 4PRHB 5JW3L 1KIPB 1PG7X 1KC5H 4J4PC 3E1F1 3SQOH 3VFMB 4NKOB 5LQBH 3MROA 4Y5YC 4RFEB 5CJ8A 5I1EH 1MFDH 2XACC 4JLRB 4LCCC 2OL3L 3S34H 4M1DH 1AKJD 4LKCB 2XWTB 4HUMB 1JHLL 5D2NB 1V3MA 5I73C 4WNQB 2W60B 5CUSL 3QQ3A 1DN0B 1EEZA 1JZ5A 3LKNB 3V6OE 1SMAA 5HI3D 4PJ8D 2DYPB 3X3FH 3IXAA 1JRHH 5JXEA 3O6FD 3OV6A 1ND0B 1NCAL 4XP1H 1MQKH 1A64A 5J6HA 3WFHB 4PUBL 3V2AR 4XCNB 4PJ9D 3MLYL 1QO3B 1A2YA 2ORBL 4IRSB 2Q6WA 2C3GA 4KROD 4OCRL 2DLFH 5EZIH 4RWYL 1FYHB 3C6LB 3VRJB 1ZT7B 3E3QC 1V5JA 4JFPA 4FFZL 2VOTA 4ZMAT 5F89B 4U2YA 5ILTH 4WWKA 3NBNA 1G0YR 4M4RA 4OLUH 3K1KC 4V1DE 1F4WL 1PZ5A 1JF1B 2ZG2A 5IMKA 1HHGA 4KK6D 2UWEE 3QUXD 4HWEH 1CICA 1KCSH 5D4QA 4Y5XA 1DQQA 5TFSL 3SGDI 1HI6A 3HUJF 1XGUB 4IRZH 3IDUA 1WAAA 5J57B 3VW3H 4JHBA 3F12B 4XNMB 1DDHB 4XVUC 2NW3A 1FCGA 1TZHA 3KPPA 2JJWA 3R1GL 4H25B 3VXRD 1OQXA 1UZ6F 3ARRA 3D0VB 5C6TL 4LAQH 3FO1B 3HNTH 2P1YA 3STZB 2FB4L 4DKFH 3WNKA 1LO4L 1AE6H 3UBXG 1UWXH 3D5OF 5K9KB 1JK8B 2QSCH 1QA9B 3BZ4A 4NQEE 1DBJL 3RDTB 3RWCB 1VFMA 3EDKA 3OKMB 4LRIA 1I8KA 3RY4A 1HXMB 1NCBH 3LKQB 1MSPA 3FQNB 2CPCA 1UH3A 1CQKA 3FO1A 3FZUC 3QWQB 1H15B 4CL7A 4TUKH 2EDNA 3A67H 1C5DB 1A1NA 3L9RA 5HGBA 4LSTH 2A9NH 3ULVE 3ZDYE 1DCLA 4YE4L 4MA8L 3U36B 1N3NA 5BS0D 1HHKB 5A3IC 4UI2A 3QWRA 3PWNA 3G04B 1FJ1B 5FB8B 1WICA 1QSFD 3MLUH 2H9GA 4NCDA 5IEHB 3IU4H 5HDQH 3C8DA 4O4YL 3PGFH 5IBUB 3F7RA 1KF9B 1CBVH 3VXTB 4BFIA 3IYLW 5BMFH 2AJYH 5CILH 3ULSA 1R3LA 1K2DB 4FQHA 3KLAA 1KPVB 1OTUD 4G7VH 2YOCA 3AB0B 2IWGA 3RA7H 1C08A 3VFOA 3IDYC 2JCCB 3MBEA 1J1PL 4TVPE 1FO0L 4UV4L 1UH4A 4FABL 1UWGL 1IEBB 4P5KB 4LVNC 4NHCH 3G6JE 3AS0A 1IT9L 5EO9B 4S1RL 1OAYL 5L2KE 1FFNB 5EU5B 5DMYA 5KVEL 3LVEA 2D7TH 2ZUWA 4FMKA 2ZCLL 4KI5D 1DE4A 1JYVA 3E8UL 2PTTB 3HI5H 1RZ8A 2NX5A 4JREC 5C07D 3HC0B 3B3IA 1S7VA 2B1AH 3LDBB 2AJ3B 4C4KT 1JWUB 3LQMA 1PDKA 1J0IA 1DQTA 3HNSL 2LVCA 1XGTB 1MI5D 4R0LA 4FQIL 3FO9B 2NY4D 3OB0H 4AZ8A 2C5DC 2EXYD 5D70L 3WO4C 5BV7H 1XCQA 4RFNB 3V4UH 5CP3A 3HC0A 5F70A 3SGEH 4PR5B 4CU7A 2A83A 2AV1A 4CVWA 1QBAA 1EZVX 1KT2B 2VN7A 3F7YA 5HI4D 5J56B 4YBLB 3RX7A 1RSFA 4PJAB 1LNUA 2P42B 4UT6H 3RAJL 4YHML 4C56D 3UTZA 3MODH 1FG2B 1CLZH 2E6JA 3BUYB 1DL7L 4XCFL 5AZEH 4GRWF 2WINB 3C08H 3GI9L 3F12A 4RA3A 4XNMA 5JHDA 3QAZC 1CLYH 3QG6A 4X4MA 4NFCA 4RFEA 2C3XA 3B83A 3ARXA 4X4ME 4XMPL 2ATPB 3J7HA 3U7YL 4NQDE 4WI7A 1KCUH 4JFEE 3TNNB 4PD4K 4NUGH 4XAKE 2FRGP 1LQSR 5L8JB 2F9BT 1J9CT 1J8HB 5FA4B 2H32B 3IGAB 5L88H 5TE7L 5DS8A 4KUZL 3SBWA 3I02A 1PYWA 5I18L 2VZOA 3VXQA 4YFLF 3EYSL 2MPAL 1B0RA 4M02A 3MNZB 5DVOA 1UB5B 5D1XC 4WHYH 1S7SA 4NKQB 1L7IL 3SE4A 1PY9A 3LMJL 1VADA 1GXEA 4EIGB 1X5YA 4XVJH 4D94A 5CSZA 6CGTA 1AR2A 2NY1B 1UZ6E 4NPYB 2ARWA 4PGEB 4RMWA 1DP0A 4UINL 3O3AA 4NN6B 2XKUA 4MAUH 5FYLE 1PFCA 3IJSB 4FFWD 4P3DA 4JDZA 2Z9TA 4UNVA 5MEOA 2BOCB 3C5SA 5GGTL 4JO1H 5I76B 2Z92B 2W92A 1MFBL 4HIXH 1BX2B 4I2XA 4KMQA 4U6VL 5DLMH 4G7YL 5H8DA 2XWTA 4YXLL 3RVUC 3MO1B 5B3JF 3H9SE 2R1YA 3NABH 1KLGA 4NNPH 3RJDA 3EFFA 4ZFOL 3S36H 3DV6A 4CVXB 7FABH 1IAOB 1CGTA 3BZFA 3QIBD 1REIA 2NW3B 4NZRH 4KRLB 1SJXA 5TDOA 2BCKA 2VRAA 4TVPL 5I8KH 3UJIH 1NC2D 1IKNC 1QTYT 2QEJA 4LCCA 4LRNH 3TLRA 3F58H 4P2RD 1F4AA 1GC1L 5DZLA 4XCCL 2N56A 3PV6B 3QXTA 4GBXC 2VR4A 4PRPB 2LV4A 3QCVH 4OD1H 1IQDB 1TQBC 4A6YL 5KSUA 1RZIB 2UVEA 2JB6A 3DX6B 5GGSB 5JZ7D 3ZSTA 1I1AB 4ODSL 2VLRA 1AC0A 1W2KT 4HIIA 4L4VE 3CSYA 3TCLA 2CJUL 1D9KD 2X9WA 3VE0A 3U4BL 2CUHA 1K4CB 3KYNA 1NCCL 4UB0L 5C3TA 5E7FA 5D5MB 3BIAX 3RWFA 1JCKA 4BH7B 4WDIB 1OP5K 1BWMA 2D31A 2BVYA 3QRGH 4Y4KA 5HHVH 3AU1A 3O2DH 3LN4B 1A6WL 2BSTB 1R3KA 3WNOA 3FQUB 2COQA 2I9LA 1FZKB 5SWSB 2WANA 4WW2C 1L6XA 5IBTH 1NCCH 2F53E 1JZ6A 5JHLH 5AUMB 2IALA 4KTEL 3U6RB 1ZVSB 2UYLA 2X1WL 1BQHG 1ORSB 1MVUA 4LPCA 5BW7A 3GO1L 1YYLH 1CVRA 4JDTL 1KIPA 4O9HH 1BVZA 4QRUA 4M7ZC 1A7RL 5I74B 4YJZL 1TVHB 3M07A 3V5HB 4KZEH 5IGXL 1JI1A 3IFNL 2A0LD 4NZTL 5HHPB 5DF0A 4CMHB 1XGRA 4JRXB 4MNQE 1IEAB 1QSEA 1Y6KR 3BH9A 7CGTA 1KCKA 3WFCL 3IT8D 5E1HB 2JIXD 2IANA 3ZDXF 2C1OA 2ZWLT 3MRBB 1X5KA 1JNJA 4U1LA 2X4UB 4LAQL 3MXWL 5TE4H 3FN9A 4QWWC 4PJXB 1KB9J 4WFHE 1EXUA 2DKMA 1RURH 4NO5B 5IVOA 3RIAK 1S8DB 4O00A 1U93A 3AXLB 4ZUWB 4XAWH 4ZFZB 1T22A 5HHOA 2PYEE 5D7LB 4EQ2A 5I1GH 1EEYA 3NH7H 4W6XB 4XXDB 3P30L 25C8L 2ED7A 3DURA 5DD3L 1JF5A 4K8RL 2Z8VC 2YWZA 2QKIA 2ADJB 1LK3H 4HUWB 3NA4A 2WWMD 4XHJD 1LEGA 2OSLB 5I6XC 4JFXA 2OP4H 2VDKL 3CX5K 1MJ7H 4ODBD 1QQDB 4UIKH 3PUCA 3P0GB 3P77A 4F58H 4I0CC 4HS3B 2FSEB 3FAXA 4CN6A 4PPTA 5KW9H 1Z5LA 2ESVE 1ROWA 1J8HA 1OB1B 5LGKA 2GTZB 3NFSH 4GRLC 3MMEA 2EC9U 4E41E 1RQ5A 3QUMB 1O0VA 1F4HA 1RZKH 3ROLA 3O2VH 3U0PA 3X3GH 3WFBH 1G9NH 5KSBB 4N0YL 2XQYG 4K8RC 3OJVC 2AKRA 3PHOB 1OGTA 2H2SD 3UZQA 3U0TB 3ARGB 1IARB 5EWIL 4LLDB 3MGAA 4PJ5D 5LG1A 2VL4A 3LRHA 1QQDA 5BO1L 4Z7WE 5JMRA 2HRLA 3P4NA 1CXIA 4K23L 4ZS6C 5I16B 3VXNB 1ZGLA 1ORSA 3UTPE 3D39B 4NQUA 3TNMA 3KPLB 4IJ3C 3VFGH 2HT3D 1R6VA 3LD8C 3I6LD 5ANME 2XQBH 1MWAL 4UDTA 5DFTA 1BFVH 2HJKB 3MC0A 5BS0B 3GJEA 1T1YB 1J88A 2Z31B 4M7JH 5ACMA 4LCIL 1KYOJ 4QT5B 4Z7QE 1S9XA 1YN7A 2X4NA 4W4OC 3D69B 4KJWD 4JFQB 4WDIA 5JOPD 5C0GA 1F3DJ 4N0UB 5E9DA 3IS0X 1T03L 3WLWC 2EC8A 3L3HA 3GNML 1BIIB 2GJ6D 1CL7I 3M45A 4RGMB 2F5AH 3ZMRA 3S88L 3FHQA 5DJDB 1MY7A 1P4IL 4OTXL 1T7VA 1AXTL 3TO4C 1EDQA 1IC7L 4D0CA 4DFHA 5I1DA 3MGTB 1XGQB 1BIHA 3TO2A 3U4EB 3TH3T 4ZXBA 2OTWA 3BPLC 4PJHB 1HYSC 4PJ8C 5F96L 4JHZA 5FXCH 5CD3B 1MPAL 1HHJA 3TT3L 4NHUA 3MUHL 3P11H 3V6BR 2V9RA 3V6FA 1ZHLA 4HV8A 4HKXA 3N1MC 2DQEH 2Z92A 2MCPL 2H1PL 1IGJB 1T2QH 2CK0L 4Y19D 3CH1B 4F37K 2HA1A 4RQQB 3MJ9H 3O3AB 4BSJA 1IC4L 4AEEA 1T83A 5GGVH 3U46A 3HMWL 4JPKH 1U8QB 5FDWA 2A74A 3OAUH 4HWZA 2BSRB 4JFZH 1BX2A 1NMAL 4ORZC 3HC4L 4QTHB 2EDBA 1WBYB 4AL8L 4YC2C 5CEZH 3QULB 5E2VH 4OSUH 1MJUL 1NAMH 2NY6B 1Q38A 4OIAA 3ZL4L 1SY6A 1HSAA 1QACA 3D39E 3AXLA 4ZUWA 3CVIH 1U36A 2Y4SA 5J6GB 1VCAA 3QUKA 4HG4J 4I4WB 3LAFA 3RQ3A 4HIIB 2W59A 3SDXE 1ACYH 2EDLA 2DYPD 4U1JB 3KXFD 4OCXL 3W5MA 1KTKE 4I0KA 3H9YA 2IANB 4ETQA 2ZCKH 3VD4A 2F8OA 1DQMH 2AXFB 5CEYA 4YEEA 2IPUK 2P4AB 2VYRE 2YC1B 4WY7L 5BZWB 2EO9A 2VABA 5HYFA 4TRPH 5GGQL 4LSVL 1SVCP 2ESVB 1GZQB 1V7NL 5ALCL 2FECI 4F58L 3RU8L 1FZKA 3P0VL 3WBDA 4XWGH 4YXKH 2LAAA 1QHOA 2DL9A 1NSNH 3DSFL 3HCVB 3QI9A 2DI9A 4JFED 2Q3ZA 2NYYC 2DTMH 4J3XA 3A6CH 2CO7B 1YMHA 4NQCD 3P4LA 1QSED 1AXTH 2QSTA 2Z31A 4XCYB 5E6IC 1YNTB 1YMMD 4IHOB 4DZ8A 2HFGH 3WKML 2CLZB 2VO5A 3RTQD 3V6OA 1S7VB 2OR7A 4WWID 1OT2A 4EUPH 3SDXB 3IDIA 4TSAL 5I15H 3VXNA 3GJFH 3WS3A 1JTOA 5I1AB 1F45A 5EBWB 3VWKA 3FFDB 1P2CB 2A6JA 2HTKC 3MFFA 4IMLB 4TNVK 5C6WH 2YA2A 4DKEH 4PJXE 3CIQA 1RJLA 2H1PH 4UDTB 4XZUB 3OWEA 2GY5A 4R90H 1NBVL 1G9ML 1AO7D 4LSQL 4LLVB 3ZTJG 3QIWC 4G9FE 4PRHA 4YXLH 4MA1C 2D7QA 4P23B 5FDWB 5IGXH 1MCCA 1CWVA 1A7RH 4R26H 3LEXA 4JN1H 1BGXH 1FBIL 3RTQC 4OZ4A 4BA8A 5CCKH 4TOYH 5MEOB 1H8OA 2VISA 4WWKC 3SDDA 3VRLF 3MUY1 1CDBA 5HVFB 5DVLA 3UXFA 1QRND 4JM4L 3PP4L 1I9JH 4XXCA 4X7SH 2F53B 1D6VL 4MCYA 4WW1A 1HINL 3T65B 3U0WL 4ODTH 1MRCL 1MCFA 5E6ZA 4S10A 3C6LD 4U0RC 2QR0B 4PGCA 4Y1AA 3KDMB 5D7SL 4XPAH 1EHAA 2ICWA 3C08L 4Z7UA 5TE7H 4AH2A 1BOGA 3RWDB 3V95A 2IQ9L 3L3JA 2BVTA 4PJ8A 2X9YA 4XBEH 4U1GB 3RAJH 1DBAH 4OLXH 5ICXA 2FNBA 1DUYA 4KHTL 1FZMA 3OXSA 4I9WE 3Q5YA 3VXOB 4AH2B 1Q9KB 1OP3K 3NH7L 3GK8H 5CZXC 5EBLB 1QUNA 3I84A 2DQIL 1QP1A 1BF8A 2R39A 1M7DB 4MAYA 1MREL 2E9IA 3CFCL 4O51A 3RVTC 5LWYH 2EYRA 1BQHA 2ZNXA 1KTRL 4U1LB 3NFSL 1RJYB 2ED8A 4H1LG 3MRNB 4ISVB 5C9JB 4MDJA 2CUMA 3NACL 1PSKH 1QNZL 4NO3B 4NNPL 2EE3A 4X6DF 1TVBB 4JN2B 3TESA 4JN1L 3QIWA 3FL7A 1BQLH 2EDQA 2VXSH 5JR1H 4L29A 3ROOB 1JF1A 5IMKB 1A4JB 2UZYB 4OF0A 4KK8D 1R3HA 4YIQA 4IMKA 4XPAL 4LCWA 3S7GA 1ADQA 1BM3L 2Y1VA 1BLNB 5JQ6H 4MAUL 2APBA 1WCBA 3LKSB 4Z7UE 3RU8H 5HGBB 4HPYH 5DTFB 4F3FB 5D7IE 3MRQA 2IH3B 2ICEB 7FABL 5I9QB 1N8ZB 1RJLB 4D9QE 4Y19A 5GHWH 5BVJB 4G5ZL 4RGNC 3HUJE 1FL6A 5CJOL 1Z9SA 4FXGB 3T04D 5CKGA 3L3KA 2NY0B 3JV4B 1AD0B 2A0LC 4PV8B 1N2RB 2OXHA 4X5XB 5F71A 1GRWA 1QBBA 3FJTA 2IBZX 4M6AA 1A7NL 3PWPE 4C83B 4P5TD 4YR6A 2I07A 3VFRB 3MUJA 5KANI 1A4JA 3RL1B 2BSSB 3WFCH 4APQD 2XTJD 5L0QB 1MJ8H 4PLKC 4KUCF 4F9PC 3U7YH 2AKRB 2GJZA 5T3XE 2Y6SD 1CE1H 1T22B 4H5SA 4HK3J 5HHOB 2CXKA 1OSPH 2WBWB 5EZOH 5D1ZA 4XNQB 3ZLQC 4Y7MA 3U4AA 5I17B 2ADGA 5DVNA 4E5XA 4N1EA 4X98A 1V8HA 4HUXA 2V2XB 3CPLB 2IH1A 2R56L 2YSSA 2JIXB 2VDNL 2Q86B 1LO5A 4L3ED 5J6GA 1NFDF 2QLVB 3FCTB 2X10A 4NDMA 3PE9A 1TZIB 4R4FL 1C12A 3X14A 3P9MA 5IBTL 4IDJH 4FZ8L 4QRPD 4MNQB 5EC1A 4RMTA 3D0LB 1BZ7B 3W0WD 3GSOB 2WAHA 3QJHB 1TITA 5D7IA 1MPAH 3G6JF 5I71C 2ZCHH 4KRMB 1F00I 1I9RL 4KROC 3GM0A 1UXSA 2Z4QB 4R4NC 2W0FB 4LBEB 3TBVA 1XF1A 3QUKB 3ZKQD 4IIQC 3B9AA 3PXHA 3LKQA 1NCTA 2W07A 4XPFL 3KNBA 4DVRH 2W9EH 4NP4H 3DMMD 4LU5L 5C71A 5IB3B 4Y4KC 3VWJB 5IQ9B 3S88H 3QQ3B 1NBVH 5KS9A 4LVNB 1I7TB 2E7CA 1BM3H 4M03A 3MLVH 5HXMA 5HGDB 3BIKA 4GBXD 3UROR 3S36X 3MACL 1RMFL 4PP1D 3WNLA 5ADOH 2XOTA 3GHEH 1I4FA 1U8LB 4OKVB 1UM4H 3UJIL 1VDGA 4KVNH 1XF4B 2X2YA 4M1GL 5DHYB 2OBGA 1NKRA 4K9EL 2WBJD 3GMNA 2EXWD 5DHVB 2OL3A 4KUZH 5KS9F 1F4YH 5K93A 4WY7H 2NLJB 3MA9H 2PW1A 3C09C 3O3DB 1NC2A 4JRWA 3W9EB 5KSBA 2R1WA 4JY5H 1IGIH 1WGOA 1YNKL 1OAQH 3RGVD 3ULUL 2AVGA 4NO2A 1DBAL 2FJHA 1KC5L 1S7RB 4P2RB 3H0TB 4MD0B 3BP5A 5INCA 5E24E 3PDOA 3UYRL 4OTXH 4G8GB 2WP3O 3GI9H 4NBYB 2EXWC 5MI0B 1MCWM 3DYMA 1IKFL 3EYOA 4XWGL 2AI0H 2BNRE 4KVCH 3BEVB 2X89A 3MFFB 4LOUC 1D5MA 4YHYC 1AY1H 2BVPA 3CSPA 5KAQG 4M43H 3V7AG 4FXLA 3QXDB 4HFUL 2ENSA 1LO4H 2YMXL 3LQAL 1NGXB 3ULUD 4FQCH 4DKAA 2AI0L 1D5MB 4M7LT 1G7PA 5BXFA 2QHLA 4K2UH 3OB8A 4BM7A 1N8ZA 1QYGL 4K7FB 2G2RA 4GW1B 4DGVH 1CF8H 4NPYA 4F9LC 4L9LB 1YEKH 1HXYA 2PW2A 3E8UH 1KJVB 2MKWA 3QNZB 4GT7A 3RWIB 2D7TL 1PW3A 4B7LA 1A6TA 1TFHA 4DFIA 4X4ZA 4ZUSB 1C5BL 2YKLL 1F4WH 3FB6A 4P3CL 5IBUG 3LRGA 5F7DB 4V1DB 3CSYB 5FHBH 3FRPA 4DGVL 5IMLA 4FFZH 5TE6H 4Z8FH 4OQTL 3BH9B 3LPWA 1KG0B 5ACZB 3QFDA 4EEEA 4R6UA 1X7QB 2EC9T 4RGMC 3DV6B 3FT2A 2E27H 1RURL 3L7FB 5T1KD 1F4XL 3VD7A 2Y72A 5EU6E 1N64L 4X98B 3O8XC 4ALAL 4ODHL 1J05B 2R15A 3H9SB 5TFSH 2F54A 4YC2B 1HQ4B 4WFHD 4F33A 3ZZ1A 5L2KA 3S35H 2PTVA 4K9EH 2RCSL 3UYOD 4QTIL 2WLZA 3LZFH 2AABH 3MRMB 4JPVH 4ZFZA 1N4XL 5DUML 1OQOA 3HI5L 4PJFB 4WFGD 1U58A 3RY6C 5CSBA 5EA0H 4D9LH 3CXHK 4Z7VE 1I7RA 1XF3A 3T2NL 1NKOA 3RWHA 2NNAB 4JM2C 4KK6C 1NGQH 4EOWL 4FZEL 3KPPB 3ARBC 2DDQH 5D6DC 4W70A 5H94B 4RGOH 1OLZA 3QO0A 2GCYB 3L3OB 1D5XB 1WTLA 4P2OB 3TZVC 3IDXH 5MENB 3T4YA 3OHXB 2YSSB 2B5IC 3TA3B 3MLZL 3GMOB 5JOFB 1P6AB 5IIEB 2O5XH 1J8HE 4JO4H 1FYTD 3ULUC 5DMKA 5F7LB 3LQAH 2VDKH 5DRXB 2FR4A 1KACB 1CI5A 3FT3B 4NT6A 1BQUA 2FHFA 3HG1E 3JWDL 3Q6FA 4AIZB 5IEKA 3HG1D 3BQUB 4NQDB 1MLCB 4HH9B 3DUUA 4POZD 1NAML 3BJLA 3TCXA 1VFAB 4I0PD 4B5EA 3GIVB 1F6AB 1JWSB 1ETZA 3RIFF 5T5NF 2IGFL 2DQFA 1I7UA 3CZJA 1AD0A 4MJIE 2ZUQB 4HKZA 2H9GB 5TPWH 2QQKH 3C5JA 1XF2B 1F4YL 3AAZA 2R8SH 1FVDB 1D5ZA 1KJ2H 1F3JB 2P49B 3Q6GH 5T1LB 1MCNA 4GS7B 2GW5A 2I26N 1FVEB 1ZOXA 4MXWL 4F7CB 3T2OA 1ZLUH 1JL8A 3L7EB 4UT9L 4LGPB 3L5IA 3UDWC 2EH8L 1EK3A 1QR1B 2FWOB 4GG8A 2HAZA 1BD2E 4LCUB 2VLKB 3BT2L 2VDLH 5ELIA 4POYA 3PHOA 5HYJD 1QEWB 3TM6A 2XWBB 4MNGB 2ZUUA 3VI4F 4EDWH 2GEEA 3PL6A 4M7ZB 2PUQT 3GHBH 4G3YL 2DLIA 1T6VN 1KJMA 1SMOA 4WTZG 3ES6B 1UXWB 2VKXA 4EI6A 3O6FC 3H8NA 2AS5M 3V4PH 5I74C 5FYLH 3ARDB 5LAXB 5TGBA 5J3HD 1JUFA 1A6WH 3VGHA 4TVPH 1BD2B 2J1KA 4R7NA 2VISB 5EZIL 2IAMD 2DQIH 2F19L 2E9JA 5I18H 4MVBC 3ARED 4M1CC 4FG6D 3D3VB 4FZ8H 4GOSA 1IAMA 3DRQA 1I4FB 4G5ZH 4B0MM 4PTTB 3V0VB 2HYMA 4MAYC 2CDGA 4DW2H 4D0DB 2IBGA 4X6EB 2B0SL 3FB8A 5LWYL 5IIEA 1ZS8B 1RVFH 2VXQH 5DJXB 2A74B 2AEQH 4OD2A 2Y06H 5FEBA 2X41A 4KKLD 5EORL 1OP9A 4ORGA 1EEQA 5IESH 5TH2A 1A02N 4D0BA 3UJJL 2EIZA 3IVKA 5IFHH 4OLZH 1CICC 5B8CC 2AJZA 4KROB 5ISZB 4HKJA 3IJSA 4BELD 4QHUA 3RWGB 5TF1H 2XZAH 4Z0XB 3OXSB 3ZE0F 5JW4R 4AEIL 1WT5C 1T04B 1UGNA 4X7SL 5DT1H 3LIZL 3W81A 2YN3A 2HFTA 1N6UA 4H25A 5FO9B 1IKNA 1ND0A 3SQBA 3QQNA 3G08A 2FX8H 3HAEH 4PLJC 5IB4B 5I1IL 4NQVA 1TQBB 1MRFL 1NBYA 2P8LB 2FH8A 5L2KD 5D7KD 1OD9A 1JPGA 1HH6B 1AKJB 3VXSA 3V8OA 3C60D 4MCZA 3LKRB 3H9SA 3WFDL 4PJ7A 3V5DA 3OPZH 3O11A 3RHWK 2P8MA 3VXRA 3IDNA 3OKLB 3QISA 3MNVA 4G6KL 4F2MB 3MRRA 1OGAB 3VFSA 3TWCL 1A6ZB 4JQIL 4N5ED 3D85A 2DJUA 3K46A 3FRUB 3MUGA 3PL6C 2DRUA 2H26A 2BVUA 1J10A 1JTTA 5B3NA 3PWNB 1XR9A 4LIQE 4GRLA 2AGJH 1A6TB 2X4PA 4MA3A 5C0BB 4NOFA 2C3VB 2YD3A 4MLSA 3L7EA 4Q2ZB 2X42A 2D31B 4FHBD 2IPTH 2JK5A 1UVQB 2KQMA 3L5WA 1S3KH 1JNHA 3MLWL 1W72B 3O6LL 1ITBB 2I24N 3D9AH 4LSDA 2CLVA 3JBG7 3UDWA 5ID0A 3DV4B 4R4FH 4M6MH 5GGUB 3T4AB 1QFWH 1T7ZA 4PJDB 5J7CC 5D1XB 5DHVH 3MV8D 5JO5A 3C2AL 1HE7A 4RMUA 1JGEB 2FATL 2JK5B 3WL9B 4XAKD 5GGSA 4JO1L 3BI9X 5C0BE 1A9BB 1LMKA 3BN9D 4N5EC 5D8JL 4LARH 4F57H 2D2OA 5EOCH 1DN0A 1HCVA 3KYNB 3B2VL 2VDPL 5DEGB 1TJGH 5H35B 2GT9A 3REVB 4NZTH 1SJEB 5E8PB 2YN5A 2NY3C 3HE7D 2H45A 4MHHG 2XICA 1MRDL 4AM0B 3VG9B 3CVHH 5CILL 1RK0A 2X4SB 4N0CD 1HINH 4P4KA 5HYEA 4JFYB 2R0ZL 4EI5D 1A0QH 2FDBP 1YEGL 1FLTX 1OARL 4XTRC 1U58B 2ZG1A 1R3IH 4TSBH 3T4YB 4TSAH 1AI1H 1JGUH 5DDHA 4NGHL 3I9GH 2W0PA 3SJVD 4BQ8A 4HSQA 2GFBB 1ODAA 4FMFA 1FN4B 4OZFG 3BPNB 4M5ZH 1ACYL 2Y7QB 1N59B 1VGKA 2VTFA 3D2UB 1IBGL 2NW2A 5SWZB 1VKXA 3ILQD 4QY8B 2EDHA 5F7NC 4HUUB 4XVTL 3QDMA 1OTUC 1S7TA 4Y4HB 1X5HA 1EJOL 2HVKA 1OWWA 1FG9C 2CK0H 5KJRH 4KKLC 1V7NH 2IAMA 3PGFL 2PXYD 5ALCH 3V0AC 3G5VA 1CD8A 2GTWA 4UTBH 5AZ2L 1EXUB 3CSBA 3UTSB 4OD1L 5IBLD 1WFOA 2LU4A 3ARDA 4HLJA 4TPRL 1LEIA 4M61B 3QEGL 3RNKB 4KPHL 3HTLX 4MGXA 5TJWK 4Z78B 4PYGA 3SO3C 1IEHA 4Z18A 1ZVYA 4CNIB 2GSGA 4KGLA 2DQGH 3LH2L 4MNGE 1II4E 1HNFA 4JFOA 4K94C 3QEUA 4GAYB 3P0YH 1KULA 1CE6A 2XA8H 1K3ZA 3O4OC 1TIUA 1TVHA 3V5HA 1JYWA 1P4LB 3B9KC 4XVJL 2ZSWA 4RSVA 1ULVA 3QHZH 3BIBX 4ZFFA 5ERWB 3ZKXC 2IG2H 4WV1C 3NPSB 1X4ZA 2VQTA 3SCMA 5J12C 1WLHA 1E4JA 4UTAL 2GQHA 2PYEA 4Q7DA 3RUGB 2XKNA 4F7TB 2C3WA 3EHBD 4KJPD 1Z5LB 5GJSH 5C92A 3IJYA 1JPTL 2BNRA 5F7HA 1IZKA 5IJKA 4FRWA 5AYQA 4GG6B 5DK0B 3RDTC 3ZTNH 3GJFK 2XKNB 4F37F 5C3LD 4P5MA 1T4KB 4GRMA 4LLQA 4LVEA 2BNQA 1UZ8B 4NFBA 1YN7B 3C6SA 1PJ9A 2YD2A 1WZ1L 2ZUQC 1CDIA 4J12A 4X6CA 4ZD3L 1T3FA 1U8IA 3FONB 5CCKL 1KYOK 3HHRB 4JFDD 4G8EB 3QUZD 3DV4A 3QIUC 3OX8A 3D85D 2ATKB 5C0CA 4HEPG 1BBJB 3QWRD 3T3MF 3C8KB 2H32H 1WT5A 1A7BA 1QFOA 1GYAA 4NWUL 5JXEC 3CAFA 4P2RA 5J1SC 3VFSB 3H0TA 1MJJB 4BQ6A 5DJCA 4GW5B 3DECA 1Z0NA 5I8CA 2CRIA 1GAFL 2F5AL 4HWBA 4YK4B 1XAUA 2D7OA 2R4SH 1LVEA 4XVSH 5IMOA 4WEMB 1U8OB 4Y16B 5CMAB 4G6AC 5TDOB 1CG9B 5TQ0L 4EVNA 3SKMA 1I3RA 1ZEAL 1HHIA 2HJLB 2KDGA 2X1QA 5SX5K 2YD5A 2ORBH 2VDML 1R3JA 4X6DA 3QDGE 2W65B 4FS0A 4KTDL 1UXSB 5IEHA 5IG7A 1HH6A 3WLWD 3VFGL 4U05A 4LU5H 4LSPH 5B4MC 1MVFA 1HDMA 2OM5A 1FAIH 4IM8A 4PJFE 3SGKC 1OWRM 3K8KA 3I75B 5EIVA 2Q20A 1Q1JL 3JV0A 4GRLD 5BRZD 5DD5L 5CJXA 2VR5A 3TO4D 3BPCB 5FHBL 1F13A 4OI9A 2NNAA 1WWCA 1MHCB 4ZO8A 4I4WA 1NCNA 1DBKL 3LHPL 5GS3A 5KTEL 5A16B 1YEIH 1BMGA 2P24A 2A6IB 2ZOKB 5HPMB 3C5ZD 4XAWL 3IS1X 1JNNL 4RRPG 4JZNA 5CWSA 1D9KC 4OGZA 5HHMD 3GBNL 2AJVL 5JHDD 1IAIL 1J05A 2W0LA 5C70A 4EN3A 5KN5B 3LQZA 4Z5RA 3CVHA 3GJFB 4WHDA 2OP4L 4BUHA 4HT1H 4LPUA 1MVUB 3WUWA 5E8EB 2MQCA 3STLB 1WWWX 1MHPL 1JGEA 1NCDL 3TVMD 5C08D 1AGDA 1XGRB 4JRXA 4YE4H 3TN0A 3NZHL 3BZEB 4HQQH 4NQXA 1HZHH 4HXAL 5E5MA 4BFGA 4L9LC 4Q9QL 3IDJA 5D1QC 5T5FL 4F3FA 2FX9H 2NX5D 1QLFB 5C07A 2GJ6E 3ARWA 1QRNE 1U2CA 2A83B 2AV1B 3QIUB 1IGYA 2Z31C 2RR3A 2VL5B 3OKDA 4RZCA 2J4WH 3AGVA 4YO0A 43C9A 1E6OH 3ARQA 3SJVA 1V3KA 3AC0A 3RZCB 5CHNA 2GSIA 3VFVA 2WUBL 5JMOC 2BNRB 5FF6B 4IJ3B 3UTOA 4MJ2A 3MRPA 1QBMH 4YHLL 3BP4B 4LHUB 4F15C 5ISZE 5DJ2A 1KIQA 3RL2A 3D87B 2AK4D 2NXZD 3OQ3B 3OXRB 1G9MC 3C2SA 1X4YA 5E2TH 5GRJH 3GIVA 4XWOD 5DZNA 5CP3H 3FOLB 3T0EB 1BJMA 2KQNA 4J6RL 4R7DB 1I9IL 5C2BH 4RBPK 3H9ZA 2VDOL 1U3JA 2APFA 3D3VE 2H8PB 4XP4H 2DQFB 5IHUH 2Q87A 4OUUA 1AR1D 1A9EA 2OTUA 5T3ZH 1FFPB 4NRZA 1BQHB 5DUPH 1J11A 4RAHA 3LN5B 1S7QB 5I6XB 1VFUA 5ICYA 2JKXA 4BZ1H 2PO6A 3MLRH 4LGSB 1RZJL 3BGMB 3FQNA 4YDLB 5FB8A 1G6RH 4BFEA 1FORL 4ESKA 1I9EA 4JG1H 2ARJB 4JY4A 1YEHH 5IVXF 4P4KD 3EGSB 3NTCH 5FGCE 3CFKA 1BVLA 1RUMH 1UM5L 4L3CA 1BVKB 1LDSA 5DJYA 1U8JB 2XZQL 1INEH 2OQJA 2CDFB 2VLKE 3CFBA 3CFJB 3RPKA 3TJHD 3VGAB 1YJDL 1DQLH 4IEFB 5IT2L 5GGRY 2FSEA 3VWJA 3DO7A 5E03A 2P47B 1A6VL 1QBLH 4JFHD 1EV2E 5D7SH 1NMBH 1VFBA 2QHRL 5D96B 1XCQB 4AEHH 4IIQB 1CIDA 1U8KB 5IOPB 3TBTA 4HHAB 5CBAA 4Y2DD 1I8IB 4L8CB 1CGUA 1A22B 1ONQA 1J1XL 1SBSH 4NO5A 5D2LA 4OIIL 2UZXB 2ERJC 1UG9A 3PWVB 4FOMA 5IW3A 3OSKA 4Z77B 1Q9LA 1TCMA 3EW3B 3BVNA 3O6ML 1JHKH 1HWHB 1E4XH 2DI8A 5D7LA 3QRGL 2MPAH 1E4WL 4C56E 5FA3B 5F1SA 1EVUA 5C0CD 1QSVA 1NDGB 4Y5XB 5HHOE 4Z9KB 3UZEA 1HWGB 4W4OA 4OQTA 5F97E 3R8BB 3EDFA 5ABDE 5GS0C 3BFOA 3BWAA 1EZVY 2H2PC 3NCMA 4JZJA 2R0LL 4UQ3A 3F7VA 2NY7H 1GGBH 4R96B 4KQ3H 4KK5D 4P5MB 2OXGA 2NY5L 1SEBB 2EEBA 2XA3A 4TSBL 4OM0L 2HFFA 1I3VA 4IRSA 2FEEL 5AD0A 2XT1B 5E99L 1R5IB 4DK3A 3SCMD 2IAMC 1TNMA 3FQRB 1WAAF 4R96A 3H3KA 4Z95H 4HWUA 4M93B 2A9ML 4HS8H 5EU3A 4J1UA 2XN9E 3LOWA 3JUYA 4RGNB 5CGYC 1DSFL 3GSQA 1I1AC 4GUPB 4PY8J 3W11C 3ROOA 2O5YH 5AG9A 3GDBA 4ODXA 1FO0A 4N0CC 5KBNC 3W2DL 1BAFH 3QEUB 4G8FA 1UKSA 3TGXA 3EYUH 1FNEA 1FORH 2VWEC 1A6ZA 4NKOA 2LTQC 4M5ZL 1NGPH 4L1DA 3UBXA 1VERA 4Z7OE 5CEXA 4ZFFB 3WD5H 3LB6D 1PLGL 4AENB 1CLZL 3AMLA 1FFNA 2VNCA 1PAMA 3VXSE 4HBQA 2OR8A 2JJTC 1BBDH 3WXVL 4KFZC 1MCWW 1B2WL 3HZYA 1DANU 1IFHH 1R24A 1I1FA 5FYJH 2BERA 3VRIA 2IQ9H 3QR2A 3MBEB 5CBAB 4MA8H 3M1BB 1TETH 4CVZB 5C9JA 3MRKA 4XBGA 4XC3L 3HZVA 1SBBA 1WBYA 4GXUM 4N8VA 5JPMA 4XVTH 1LO3L 3QWOB 3KYMB 1WCQA 3BE1L 4HCRH 3V0WH 5FYJL 1ZS8A 5BS0E 1FC2D 5GRUH 5H2BA 3P9LB 3QFJE 5CSGA 2WIIA 5EOTB 1A3QA 3HI1B 2ZOLA 2BCKB 3VG0L 4FFWC 3GRWH 5F1IA 1YYMH 1A8JH 2FBJL 3O4LE 2P24B 3IKCA 3BT2H 3NPZB 3EFFB 4PJGF 3L5HA 4EXPX 5LBSH 1P7QB 5ALBH 4L4TD 4OFPA 4PJEE 1F5WA 3MODL 2R0ZH 1U8JA 4YDIH 4R4BA 4HJJH 4E0RA 5TQ2L 3F7QA 4TVPD 2XY1A 3KWWA 2VDRL 1J1OL 1CR9L 1U3ZA 4OV5B 4OCSL 4JVPA 1CR9H 4RCAA 4HZLA 1GPOH 1MCLA 5BJTB 3CDGA 3RVXC 2HJFB 3LRSA 5GPRA 4N8CL 3LCYA 4OLXL 1A0QL 4LCUA 4Z7NF 4WUUA 3TPUB 2AK4A 1K5NA 2HJLA 1B9ZA 2BY1A 4L4JA 1V7MH 1T1XB 1A6VH 1HOCA 1QBLL 4G9FB 1XR8A 4U6HA 2X4NB 4M7LL 4U6YB 3V52H 1LE5B 2D4DA 3GSNH 1DQLL 2EDTA 4JKPL 3C6LA 3VRJA 5ENWB 3AM8A 4MA1B 1UT9A 1A1MA 4HWBH 1TTFA 2B4CL 3WO4B 5GIRA 4YO0B 3KHOA 4PV9B 1PKQE 2IPTL 2UVFA 4NKIH 3OKOA 3X3FL 3QUMH 5CGMA 1E4WH 3MV7E 4CMMB 1ZGLM 5CZVH 5B8CB 1D5ZB 3UPRA 4QXUH 2VIRA 4ODXB 2AGJL 5IW1B 2EZ0D 2JJSC 3MRIA 3PIQB 4NSKB 1N6QH 5GGUA 3T4AA 2HFFB 4N9OB 1A2YB 5L88L 3WXWL 3U0TA 3V5KB 1EGJH 1INEL 4OIIH 4PJXF 4ZQKA 5T3XH 2FYYA 4G6ML 4WWKD 5INCB 3KJ6L 4FP8L 2MHAB 4WO4C 3RGHA 1UWEH 3VXPA 5BQ7B 3HZVB 1JGDB 5EU3B 4HWEL 4LCWB 5E2TL 1H8SA 3NAAH 1CICD 5DR5L 1O7SA 5ILTL 1RK1B 4YDLC 3VDBA 2XRAH 4JO3H 1IGFL 4JKMA 4C55A 2WSKA 3SE8H 4IOFC 5LQBL 2YD8A 4UQ3B 3KLAB 4MQSB 1DE4B 1GVIA 4S0TD 2N1KA 3B2UD 4LCWE 1IAKA 4DKFL 1G7HA 3H42H 1OY3B 1AGEB 1N64H 2A1WH 3WJJA 1T5WA 5KSAD 4P5KA 1CGXA 2MJWA 1AH1A 1GH7A 3LSOB 4MCZB 2X4TB 3R1GH 3SE8L 4PGDA 4KV5F 3Q5OA 4APQC 4EZMA 4KI5F 1HSAB 5T3ZL 1IM9A 3FFCB 3MRCA 1S5IL 1A3RH 3KPMA 4P2OC 3TZVB 3B2UC 2C4FU 2YK1L 4MNHB 1KLUB 3QZWB 2X6MA 1MELA 3ELAT 3WUWG 4LSVH 4UILH 4RIRA 2A77L 3MJ8B 3QWOA 3VI3E 5HVHC 3ZT6A 4JPIA 1NLBH 4OT1L 4WUKH 4Z0XA 4L4VB 5LGHL 4ZUUB 1G7QB 5DEFA 1OL0A 4YQXH 1CD1B 5C0AA 5F8QC 4CADA 5GRWA 3MCG1 4PJ7F 5ETUA 1F2XK 3QA3A 1N6QL 4K2UL 1G7MB 4JZJB 3OL2A 3PP3K 1U3HB 2FX9L 2OLDA 3T65A 5GZOD 3BUTA 1HQ4A 3D48R 1QBML 3ETBF 1FL5B 2VKWA 1ZLSL 1AO7A 1MAJA 3V4PL 2AJXL 5DVMA 5FOJA 1FFPA 1VPOH 3DVFA 4ZAKA 2XNAA 2P44B 4V2CB 3ULUF 2ICWB 4Z7UB 4PJHE 3FAWA 3M1BA 3GMQA 2B4CH 3GSXB 4XPTH 4K55A 5E2WL 5CEZL 1DQQB 2ADIA 3STZA 1QFWM 1C16B 4PLOB 1OSZB 5F9OH 2L7JA 5CD3A 1FVCA 3HPLB 4ENED 2HLAB 5C6PB 1HNGA 5I17A 1FNSH 1JGDA 5D71L 1ZVSA 3BX7C 3DVIA 2CKNA 3HFMH 4NZJA 3IKCB 5DGRA 3L3KB 5BO1H 3ZSSA 1XZ0B 4ELKA 4ELMF 1MIEL 1QKZL 3T0DA 2BY3A 4PJ9C 3ARUA 4YHIB 4JKWA 5IJVB 2D3VA 2VR9A 3NN8B 4QHMA 3U1SL 1JNHB 4NNYB 1IAIH 4QHLB 3L95B 3UO1L 4NKMB 2OMNA 4C57C 4YDJB 5J6HB 1IGTA 5DUPL 4UT9H 3QDAA 4GH7B 2RB8A 3VXMA 1NDMA 2LAGB 3E6FA 1IBGH 3QDMD 5I0ZA 1RU9L 2JLLA 3KR3L 2B2XL 1F6AA 2UY6A 1B0WA 3VFNA 4LCCB 2F74B 2VIRB 1BECA 3FN0L 4L8DB 3Q5TA 5GZNC 4PGJA 3WSQH 4GMSH 1INQA 1XR8B 2Q76A 2NY2D 4NZDA 2JJUA 5KSBE 1OARH 4HXBL 4BFIB 2FO4A 4OLEA 3HPJA 5HJ3B 1QYGH 1BHGA 4IS6B 1CXEA 3KYKH 4K3HA 2VLRD 3GSNA 4PJCB 2X09A 3RNQB 2YUXA 3SDDD 4S0SD 2H3NB 3TJHC 3Q6FB 4Z7VF 5FGBA 4QHKI 4ONFH 1GSMA 1PZUB 2KPNA 4XHJC 5DWUL 1X5GA 1OP5H 4NQSB 2JELH 2GITB 4P59H 3MV9D 3K8LA 1CXFA 3V7MA 3QXAA 5EU7C 1YYML 3OKMA 5DC0A 5ETUB 3GSVB 4NQCE 5EBLA 3PABB 5K9QI 4UINH 4P57B 4NC0B 4ZPVA 4WO4B 4U1JA 3R0MA 3KJ6H 4FP8H 4LASL 1Y18A 4QY8A 2C3HA 3TO4A 2BNQD 3L9RB 1LO5B 4URTB 4O02H 3T09A 1OAUH 1RIUH 4ODHH 5E56A 5FGCB 2DQDH 3FOMA 4TTGA 1PQZA 3VMPA 1WFTA 4KJQD 4WO4A 1M7IB 5FYKH 5JZ7C 3GBNH 4RX4D 1I7ZB 4JPVL 3MOQA 4XPGL 4LIQH 4UQ2A 4Y16A 2FCBA 1QR4A 1ES0A 3IGAA 5HTSA 1WV7T 4PJGA 2IG2L 3MACH 9CGTA 1H3WM 1T21B 2NY7L 3BD3A 2FX7L 3KPRB 2CKBB 1E4KA 2OS7A 4UUJA 5CLTA 3I6LE 2VDRH 1YC8A 2BDNL 3LKPB 2XZCH 4FQXD 5ID1B 1UKTA 4EJ1C 3IETB 1ES0B 2A6DB 3SCMC 5F8RC 4YFEA 4MA7L 4KKAC 4M7LH 4L3EA 5E6YA 3I6KB 4YQXL 3ARBD 4QXGH 3TVMA 1GGIL 1IC5L 1IGIL 3L3IA 3VG9C 3TN0D 5C0EA 2MOVA 4G6FD 3ILPA 2NY3B 3FFDA 5IB5A 4DEPC 1FGNH 1IAIM 4DVBB 4L8BA 4FQCL 4TUJA 5DRZA 2FGZA 1T03H 4OCLC 2NX5E 4KH2A 2CR6A 2HN7B 4Q2ZA 4MJ6A 2P5WE 3OKKA 3SO5A 2V7HB 3QUYD 4CKVX 1AR1C 1EHXA 2E7HA 3AFLA 3DWTA 3SGJC 4Y19E 5EUOB 3SDAD 3NOIA 3DI3B 5INDA 1ZHKA 3GSUA 5BRZA 1IM9D 3MZTA 1DVFC 4XNXL 4HS6A 3GSRA 3PQYB 4M7KH 1YDPA 2V7HA 3MV9B 5IT2H 1GGTA 2I60H 3DXAB 4OCWH 1LILA 5HY9B 2E7BA 1YC7A 3LIZH 4P9HL 5K9OA 1C7SA 1C1EL 4DJMA 3NABL 2H41A 3AS1A 3HA0A 1XR9B 3UTTD 2X4QA 2Q3AA 3OAZK 3WDJA 4NC2B 5CD5C 5DR5H 3OR6B 3PWLA 2YD9A 3V6OC 4J23A 3MYJB 2VLRB 1BFOB 1QVOB 4HDIB 1XIWD 2ZCHL 2DQTL 1N3NB 4TQEH 4M5YL 5HPMA 2AEQL 1XMWA 4NJ9L 1MCOH 1RIVL 3RNKA 1YNKH 5E4IA 5IV2B 3HUJA 3PF2A 3VXSB 1H5BC 5L0QC 4PRAA 2HMID 5JORB 1X3DA 1F42A 1L0XA 3GI8L 1CT8A 1XH3B 5CZVL 1F8TH 3PP3H 4X6FA 2VH5H 3E6FB 2NXYD 1CU4H 3DTXB 1P53A 2A9NL 4BKLA 5EZOL 3TBYB 1LK3L 2O93L 2FYYB 3THMH 4MQXC 4N68A 3BIKB 1NUNB 2PN5A 4GLRH 4EDWL 1I85A 5E5RB 1H15A 4LQFL 1MEXL 4XCEB 1W0WB 1T6WA 3BKMH 3LB6C 3QFJD 5E5MB 2YPVH 5HI4C 5JW4N 2EDOA 4S2SA 2VLJB 3WIHL 1UWXK 4H1LH 1C12B 4NO0B 5GS1A 5T33L 1XF5B 4ZUVA 2DQHL 4P9MH 4GAJH 2F54B 1DVFB 3X12B 2CKBA 3KPRA 4UUJB 1CZ8H 1FIGL 2BNUA 5D6CA 3B9KD 2VMFA 5ANMB 3ZKSD 1G7HB 5ALBL 5EU6A 1A6UL 1EO8L 1MCSA 3MSPA 2H3NA 4GG6F 2EDKA 3P3YA 3V4UL 2HFGL 4Z7WB 1FYTE 4JFDE 4QRQB 3VDCA 3DX7B 5DD6A 3OX8B 3KYOB 1KNOA 3RGVA 1HHJB 4ZAKD 5E9DB 3WIFB 2CIIB 4LQ1A 3MRBA 2F5BL 2A38A 4OLZL 2FL5A 5EN2B 3SE3A 5I8EB 4YBQD 5FKPB 4MSWB 5J1TC 4P23C 1U3HD 1A14L 5HHXL 2DBJA 4NKMA 2FBJH 4YDKH 1F3JA 1CVSC 2GJZB 3MLXH 5DRWB 2VJXA 3MLTB 3N1PC 4N9GA 1FIEA 5I1LB 3KHQA 1H3XA 3HMXL 3WE6B 5IROC 2VL5A 3OKDB 4M48H 3LN4A 4HPYL 4YNYB 3HRZB 1Q9WB 1UZ8A 4J1UB 4J7RA 2VXVH 1BOYA 1AP2B 3DUSB 5IK3A 4U1IA 3TT1H 4R2GC 3K1DA 4X6BA 5CJOH 3BWUC 1YJDC 5D96C 2J8HA 1U2HA 4NBZB 5F72S 4YZFF 4EI5C 1MFDL 3CPLA 1I7UB 2PYEB 3RUGA 1ZKAA 2OR9L 5KSUB 4YX2H 4A2LA 3MPCA 1NCWH 2C3VA 2HLAA 1FYTA 3UTQB 3B4NA 5TF0A 3WE6A 4YIQB 1S7UA 1YQ2A 5LVEA 1OAZL 4Y5YA 3QUYA 3LV3B 3MJ9L 3HZYB 5JNYA 4OUOA 1Y0LB 4DTGL 3IXTA 3UTQA 5IJKC 1S7RA 1URLA 3LS5H 5DD0H 3QZWG 5DO2D 3EYVA 2J6EL 4S1SL 3M17A 4HIEB 3LEVL 5I66B 4YDJA 5ICXB 2Y36H 3QCTH 4GG6E 1GGIH 5KS9B 5FYJU 1I1CA 5TE6L 1DBBH 5TF1L 4K7PL 4HMEA 1U8MA 4PJIB 4ZO9A 2HT2C 3GB7A 3H3BC 2DQCH 3G08B 3VCLB 3IAGC 3MRHA 1XIWA 1ZK9A 2QKIB 2Y06L 1MRCH 3ZYOA 3B6SA 5C0BA 2JE8A 2EICA 2PO6C 5FUOH 2D4FA 1A1OB 3GBMH 4X7EC 3U9UB 12E8L 4X4XA 3MBXH 4JM2B 5CINL 3D18A 1OTSC 1M71B 4J3SA 1JFQH 1QFPA 2WP3T 3PDDA 2BOBA 4F2MA 2IGFH 2XNAB 1T5WB 2BVOA 4WEBH 3VD9A 1FP5A 1P7HL 1EO7A 5L7XL 4N8VB 4G43B 4E5XB 3CXDL 4O2CA 1KEML 4P49A 1M6OB 1KJ2A 4XX1E 3DOSA 1NGQL 1YUHA 5LXGH 3UTSE 1KCRH 1J87A 3CU1A 2XRAL 4CN4A 3IFPB 5GS1C 3FCTA 5CLWA 2E7LA 4HJ0D 3TA3C 4ZYKB 4GMTH 1UEYA 4KRPC 1EAPB 1P7QA 4RMRA 3CLFH 4U4BA 1JBJA