4DCQB

Crystal structure of the fab fragment of 3b5h10, an antibody-specific for extended polyglutamine repeats (orthorhombic form)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
218
structure length
218
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTTYGMSWVKQAPGKGFEWMGWINTYSGVPTYVDDFKGRFAFSLETSASTAYLQINNLKNEDTAVYFCARGGNNFLWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3B5H10 FAB Light Chain
publication title Disease-associated polyglutamine stretches in monomeric huntingtin adopt a compact structure.
pubmed doi rcsb
molecule tags Immune system
total genus 42
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2012-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dcqB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dcqB02
1FDLH 4PRBB 1G7PA 1JGVL 1MY5A 5MENE 5AAWA 1V8HA 3S3JA 5DVLA 3SO5A 4TUKH 2VDNH 2OL3H 2DM4A 4J1UB 5K9OA 4PLKD 4Y4KB 3EYVA 3QDMD 4JZJC 4NO2A 5C6WH 1BHGA 4EUPA 2X1PA 2P5WA 1YEIH 3T3PE 1G6RB 3BH8B 3PE9A 3C60D 2F54E 3MCG1 2OX5A 2QQLL 3QFJB 1YEDB 4OCRH 3KPMB 2ADGA 1QACA 2HG5A 3S4SG 1A9BA 2E7BA 1F58L 1IAKB 5HYJA 3EO9L 1RZGA 4TVPH 2UYLB 1SJXA 2MOVA 3QNZA 4P2QD 3VJ6A 4C4KT 5T3XE 3ULVD 2VZSA 4TNVK 5DI8A 1Z9LA 5HDQH 4NO5B 3L9RA 3QWRA 4OI8A 1J5OH 4HWZB 5C0RL 2ADJA 1L6ZA 2OQJA 1WBXB 1FN4A 1NCWL 5HY9A 4MAYC 5IVZA 4K9EC 5HBBA 4GQ9L 4W81A 5HYSG 4PJ9A 5IHUL 1HXYB 1W72H 4WI4A 3EYSH 1KV3A 3VD4A 2BSSA 4XVJH 4ZPTA 4PJ5A 4KHTH 5BV7C 1FSKC 3TV3L 3LY6A 1U8HA 3QEQE 5FYJH 5HVGB 2DIJA 4WWKD 3CZFA 4PJFB 1HH6A 4UDUA 3KYMB 3QB7C 3QHZL 5IWLC 2XZQH 3TO4B 3UYOD 4FNLH 5D7LB 2IH3A 5ICYA 3IXAB 1GIGH 3R0NA 5DC4B 1XF4A 1V7NL 1YN6A 4LRIC 4R90H 3DECA 3WXVH 3VFWB 4QO1A 1TZGH 4M7LH 4JFQB 2VXTH 3H8NA 1FVEA 4FFYH 4U1SB 4PJ8D 5C09E 4XBEL 5F6HJ 4MMZC 3QJHA 2EH8L 3P3YA 5DMYA 3SPVA 1LILA 4LGPB 4LIQE 4JDZB 2DQFA 5HI4C 3SO3B 2VYRE 3DVNB 4WI3A 3HS0A 4HS6A 1AD0A 3OQ3B 4N8CL 3MLXL 4PR5A 1B2WH 3EYUL 3L3JB 2JCCF 4FRWA 3VW3H 4UAOC 4UBDC 2P8MA 5DD3L 2WBKA 3OKKB 1MFAH 3U0TB 3RTQA 4QHMA 3VXSD 5I1IL 1JGUL 2Z9TA 4B0MM 5JW3L 1F2XK 1MAML 3DRTB 5DRNB 1T7WA 2ZCHH 4P2OB 4YHNB 4M4PA 1A21A 3D1MC 4J3WA 1OLLA 2DYPD 4QF1B 3ZDZF 3MJ9A 1Q9KA 4OBSA 1F11B 4G9DA 2VAAB 4PRAA 4QXUL 4JANB 1A7PL 2E5EA 2YPVH 3OHXB 3CFKB 2XPGB 4Y4FD 1FDLL 1UXSB 2VLLB 3G08A 5D5ME 1PSKH 3I6LE 4S1DD 4LPYA 3FO2A 4Q74A 4JKMA 1ZLUK 3Q6FA 4TUKL 2VDNL 2OL3L 3AS0A 4UUJB 5CSZA 4YDLB 2NY5C 3EIFA 3T09A 4U2YA 3SDDD 4KV5E 5JIPA 1N5AB 3WNMA 4G6FD 2Y36H 1QRNA 4FQHB 2J8UF 4MCYB 1T6VN 5CJQL 4OCRL 5JW4N 4LPXA 2G2RB 1WTLA 3LN4B 4U3XA 2XA8H 5J3HD 1F4YH 4TQEH 4TVPL 1WT5C 2YKLH 3ZDXF 4OLZH 1P84K 4ZNEA 3AAZA 3FB8B 1KB5B 5HDQL 3HAEG 2YR3A 4L8CB 1IAIH 2B2XH 1J5OL 3TF7C 1HCFX 5JR1H 1AFVL 5I18L 2FRGP 2GJ6B 3QI9A 1LEGB 2BMKA 1JFQH 1W72L 1UM5H 3EYSL 3EFDH 5KG9B 2GY7B 3UTTA 4RRPG 5D2LA 2UY7A 1K5NA 1CDGA 3G9AB 2X4TA 4WO4C 1EXUA 3HE6B 1CVRA 4AT6A 1Q9WA 5CP7B 5FYJL 2N1KA 2XRAL 1SQ2N 1VFAB 1Q38A 4RGNC 1ZGLA 3MLZH 2E8ZA 3QDMA 2EKSA 2XZQL 4YHPB 4FNLL 2AERT 2NXYB 1GIGL 5DFTA 5C0BE 3ESVF 4R90L 4DKEH 4K94H 4ETQB 1ZVSA 1A4JB 1AR1C 3WXVL 4CRPA 5ACZB 5JLZB 1TZGL 2ITCA 2OMNA 4YDIH 2VXTL 3LQZB 4KTDL 4FFYL 5HPOA 3WUZA 3GSWA 1E6OL 4LKXB 1PEZA 1ONQB 2Y06H 1KIRB 5L8KB 1JF1A 1TETH 3DMMC 4CVUA 1ZS8B 3FCTA 4JY6B 3VXUE 5T1MB 4LLVB 4MAYD 1PG7L 1NMBL 1ZTXH 4QRTA 4NQSA 5AAMA 2JLLA 4XB8A 2O5XH 5FM5O 1RUQH 2HVKA 4OD1H 1BJ8A 1B2WL 4XWGH 3KAAA 1R5WA 2HJFB 2JKXA 4XI5C 3RUGA 3VW3L 4I3SH 3HPJA 4K7FA 3ROOA 1MFAL 2Q86B 2DQUH 2FIKB 4LF3A 3NCEB 2JJSC 3MA7B 2FO4B 1SVZA 5E6YA 5DJXB 2DJUA 4GXUN 5GGTA 3JXAA 3H9SE 3FZUC 3HZVA 4JFPA 3SDXF 1IGJB 1YN7B 4OBRA 4TRPH 1MQ8A 3HC0A 1EAPB 3RBSA 4X5XA 3RBGA 2GYSA 4JPWH 2BSED 4RMTA 4HIJB 2EZ0C 4CDGC 5FOBA 4JFXB 3MODL 4W6WB 1P9MA 1M1SA 5D6DA 5ADOH 4KZEH 3L5XH 5CHNA 1JK8A 1MLBB 5E9DE 4Z7OF 2YPVL 4XB7A 5FYLH 5HI4D 1HYRC 3MUJA 4PJ8A 4P46C 1MVFA 3EDDA 2P4AB 1HHGB 3VDAA 5JA8B 3TEUA 2YSSA 3WIIH 2HWZL 3MOBL 4E41B 5T3XH 5GS0H 4IMLB 3GMMB 3PWNA 3W9EA 2IAMC 4XPFH 4IIQA 2HJKA 5T5NG 4N0FB 3GSOB 2BC4B 1QRKA 2DM2A 2HTLC 3D25A 4JFYB 5IG7A 5KSUB 4MJIB 2Y36L 1AGEA 4FQ2H 2QHRH 2FL5B 3MRDB 1MHEA 5DSCA 4C57C 4G6MH 1TNMA 2R0ZH 4KDTC 5F1IA 5H37H 1YNKH 3U46B 3VXSA 2XA8L 2FLBT 4LCCA 1A9EA 4TQEL 1I7RA 2H32B 3GRWH 1NBYA 2YKLL 5C8JB 4NIKB 5F70A 4G80B 1ZWIA 1U8KA 1UA6H 4OFDA 3ULSB 3QIBC 4KJWC 1IAIL 2B2XL 5E2JA 1NAMB 2IPKB 4HKXA 4UIMA 1IAOB 5ITFB 2F53D 5KTEH 5BVJB 3MRHB 4HMEA 4Q6YA 1JFQL 1H5BA 2FECI 4AH2B 5JXEC 5DRZB 1UM5L 4G9FB 3EFDL 3LKSB 3EZ8A 1RD6A 4RCAA 2YPKA 4ZAKD 1NC2D 2ZSWA 2XY1A 2OSLA 1KNOA 3G5VA 3PJSB 4ZSOB 3C5ZC 3CPLB 3HUJB 2V5YA 1VSCA 2IF7A 3MLZL 3H42H 4LIQH 4M7LT 2G5BB 5B8CB 2AEIT 5FCSH 1FG2A 3ZE2F 2WK2A 4JHZA 1CFTA 1S9XA 1KJ2A 2Z31D 4PJBA 3A6CH 3O2DH 4DKEL 4K94L 3CCHB 4JFHD 5IQ9A 2VDLL 1NAML 3BN3B 3MV8E 4TSCH 4BKLB 2A73A 4WHCA 4MJ4A 1KTLB 2Y06L 1EAJA 5HYEA 2VDKH 1MQKH 4D3CH 3ZSSA 5HYSA 1P7KA 4QHKI 3N50A 5JZ7C 5D7IF 3WS3B 4XAWH 1ZTXL 3MRCB 4JVUA 2FO1A 1AC6A 2HRPL 1WISA 1RUQL 4MD4A 4OD1L 3LD8C 4JKWA 4TYUA 4M4RA 1U92A 4WO4D 4XWGL 4F8QA 4WVRA 4I3SL 2AP2A 5DDHA 2WWKT 1FL5A 5KVEH 2CDEB 3KR3H 4WEBL 3JTTA 2DQUL 1G7PB 4HHAA 4DKDC 5HDLA 2ERJC 5K9OB 3VGEA 3EYVB 4NO2B 1KCUH 4MA3A 4EUPB 3SE8H 2FHFA 2P5WB 3OKEA 4XPTH 3RGVC 2E9WA 4J3OC 1AR1D 3AMKA 3BW9A 4JPWL 2D7PA 5EBLA 1T0PB 2ADGB 3UO1H 1N0LA 4DQOH 1CFSA 4NQTA 2HG5B 5AZ2H 1A9BB 4NWTH 5HYJB 3MACH 5ADOL 2LQRA 1FO0A 4KZEL 1RZGB 3IYLW 3VXMD 3QNZB 5FYLL 3VJ6B 2J4WH 5KAQG 3MLPA 5DI8B 4L4VD 3S37H 3S35X 12E8H 1MFEH 3L9RB 3WIIL 2ADJB 4MAYA 4XI5D 2OQJB 5T3XL 2D0GA 1FN4B 2PXYC 5GS0L 3TBWA 4PGBA 3TVMA 4XPFL 3EO0A 5IVZB 1MJUL 4PJ9B 1QFWI 4R4NC 4MZ3A 2MHAA 4FQ2L 1BVLA 4H26A 2QHRL 4YBHA 2DRUA 2BSSB 4HKJA 4G6ML 4PJ5B 3FZUD 4ZPTB 4Z78A 3IDIA 4U1KA 1Q1JL 1U8HB 5HHNA 3GRWL 2EDFA 4QT5A 3CZFB 5GRJH 5IWLA 1F4AA 1HH6B 4UDUB 3QR2A 1CGSH 2EZ0D 4JM4H 3QHFH 1UA6L 2RQ8A 2IWGA 2IH3B 4BJLA 5ICYB 3UEZA 4LVEA 1LHZA 1IJ9A 1XF4B 1YN6B 5KTEL 4I1NB 3RY6C 1A5FH 2LU3A 4TUJA 4BFEA 3A6BL 1FVEB 4ZDHA 5F7UA 5D71H 4S0TD 2HT2C 4QRRD 4APQA 4XBPB 2I5YL 2XYCA 3QJHB 4FQCH 5KSVA 1MRCL 3VE0A 3SPVB 2IAMD 3KXFE 1NC4D 3H9YA 4BA8A 3EZJB 1AY1H 2HTLD 2DQFB 2PTUA 4IRSC 2V5TA 4R7NA 1F2QA 3U4AA 4PY7A 1RK1A 3HS0B 4HS6B 1FH5H 1AD0B 2IBZY 4LIQL 3RWGA 4PR5B 3T2NH 4PJCA 3V6BR 1X4XA 3SCMA 4B7IA 2P8MB 2OYPA 1DANU 4OQTH 2FSEA 3RTQB 2H6PA 4QHMB 3A6CL 3O2DL 4WENB 3MV9D 1I3GL 2NXZC 2VDOH 5F7MC 3TYFA 4TSCL 4JREB 3ALXA 1CT8A 3QIBD 4JCLA 4C56D 2JCCE 2DQDH 2VDKL 3UZEA 1MWAA 4N90E 4YEFA 4D3CL 1NJ9A 5GJSH 1S7WA 1QKZH 5HYFA 1FL3A 4H20H 4MD0A 4XPBL 2EICA 2CQVA 4JKKA 4CADA 2APWA 3ZT6A 4LRNH 1FNEA 1Q9KB 2P8LA 1IC5H 3OR6A 4G9DB 5DVOA 3WEXA 4PRAB 1L0XA 3K46A 1CK0H 3BPLB 3RP1A 4ZD3H 3KR3L 3G08B 3C5ZD 4PB9H 1EO7A 3LS5H 3ZDZE 3FQRA 4ZAKA 3FO2B 1NC2A 2VR4A 3Q6FB 1A7OH 3S9DB 5CSZB 1MRFH 1JN6A 1NMAH 1KCUL 2VXUH 3SE8L 4XPTL 4X0KA 5M94B 2F8XC 4BUGA 1QRNB 1JZ2A 3IETA 5HGBA 2HFTA 3UO1L 2DLFH 4DQOL 5AZ2L 1JIBA 2Z31A 4NWTL 2CKBA 2NW3A 3MACL 1EMTH 5JZ7D 1YPZA 3EDJA 3MJ9L 5EO9A 4PGEA 4NRYA 3AAZB 2J8UE 1H3GA 1JWSA 1MFEL 1INDL 3U30B 3VGAB 1UEYA 3BRGC 1T1XA 1MCOH 2IPUG 3ZDXE 3QI9B 3TM6A 2BMKB 4G5ZH 9CGTA 1MCFA 2XA3A 5DXWA 1IE5A 4WO4A 3UTTB 5D2LB 1K5NB 3HC4H 4I0KA 3SY0A 3AY4C 1KEMH 2X4TB 3ZKQD 1EXUB 4LLAA 1B0RA 4ONFL 3SQBA 4AT6B 1Q9WB 1MJJA 5GRJL 4GAGL 4JQVC 1ZGLB 4JM4L 3QDMB 4OCYH 2EKSB 1MI5D 4ISVA 3O6FC 2ZKHH 1NMCB 4BFBD 1E28B 4J4PC 4K2UH 2QEJA 1ZVSB 2ITCB 1JYXA 3GSWB 2X9XA 1JF1B 4FQCL 3VXMA 3FCTB 3U9PH 3KPQA 1RUPL 1WAAA 2VZ3A 3ROLA 1AY1L 3SKUD 4RGNE 4R4ND 4QRTB 1LP9A 4NQSB 2A9MH 1FH5L 2HVKB 3PIQA 1RIUH 4AIXA 1R5WB 3H3PH 5E99H 2JJSA 3HPJB 4K7FB 4PFEA 1E6JH 1FBIH 2QSCH 5F1NA 3ROOB 1AD9A 3O11A 4OQTL 2F58L 4X7TA 5EOQH 5F71A 4LF3B 3SDCC 4U0QB 3U0PA 3H9ZA 3SE3A 4Z0BH 3BP6A 2Y6SD 1PKQA 2DQDL 4ZG1A 4JFPB 3RWEA 4Y8AA 1F6FB 5GJSL 3H6JA 3TLRA 1QKZL 1J8HD 3HC0B 4H20L 1RV6X 4X5XB 4L4VE 3VD3A 4R3SA 4BH8A 1KN2L 2EO9A 4LRNL 3GSUA 4OLWH 3X17A 5FOBB 2VXSH 1IC5L 2HT2D 4V1DD 4WUUE 3SDXE 2DLTA 5GGUA 3C6SA 4JHAH 5CHNB 1JK8B 2XT1B 2Y5TA 4IRSD 4JQIL 2BVEA 3QUXA 4PJ8B 4WU7A 1IGFH 1T1ZB 4PB9L 3C2AH 3LS5L 5JHDE 4QRRA 1XZ0A 5EO1A 4KJYA 1SM3L 2IAMA 2YSSB 4X9GA 1NC4A 1A7OL 3MRRA 5IHLB 1MRFL 4PJFE 1NMAL 2DKMA 2GSIA 3W9EB 3PWNB 1C7TA 1A3QA 2VXUL 4IIQB 2HJKB 5FKPB 4XP9H 5H2BA 2UZXB 4Z7OE 3D25B 2MFNA 2HKFL 2NXZD 3AXLA 5DGQA 5IG7B 2I60H 1AGEB 1FNAA 4P2RE 2FH8A 1MHEB 1WJ3A 4RFNC 3K4DA 1CD8A 5DSCB 4WI7A 1KB9J 1N7MH 2DLFL 2ZG1A 5EIQA 5F1IB 2PO6C 3DETD 3VXSB 1Q9LA 3MV9A 1EMTL 2J3SA 4LCCB 1A9EB 5IEKA 1I7RB 1NBYB 2CGRH 3N1GC 4N9GA 1ZWIB 1U8KB 1KPUA 1MPAH 3CJJA 5IP4A 1FNSH 3U0WH 3MMEA 5CEXA 1PKOA 2CPCA 4HKXB 4UIMB 1AGDA 3OKOA 3D3VD 4G3YH 5IHBA 4P5KA 4LVOC 1H5BB 1WWBX 1YMMA 1UGNA 1QG3A 4K9EH 1AGCA 2YPKB 1M71A 3HC4L 3R8QA 1KEML 3VMOA 2FEEL 1FP5A 2ZSWB 2OSLB 4ODSH 1KNOB 3G5VB 5BV7H 1ZANH 1KBGH 3FRPG 3OWEA 3DHJA 1RULH 2AVGA 4OCYL 1G9EA 3HRZA 1IILE 1K4DA 2XV6B 1G9NC 4U3HA 2ZKHL 4WFFE 1FG2B 4TULH 2NCMA 3PABB 1CFTB 1S9XB 1KJ2B 1BFTA 1RZKC 4PJBB 4K2UL 4TOYH 4FXGA 5IQ9B 3JWDC 3B9KA 4RA0C 3UDWA 2V2XA 1N8ZA 2A73B 3EJYC 3GIZH 3ILPA 3REVA 3MLVH 4HWBA 2Y72A 2KQNA 3ZE2E 3UPAA 5FO9A 5HYSB 1P7KB 4EBQL 1DANT 3O2VH 1N6QH 4EXKA 1W0VA 5D1ZD 1BP3B 2YOCA 5HGAA 3QH3A 2A9ML 2VLRD 5TH2A 3RPKA 1YECH 1BFVH 4MD4B 1RIUL 4U7MA 1U92B 2EDRA 3H3PL 5EOTA 5D7IE 5DDHB 3GUTA 1E6JL 1FBIL 1FL5B 3TIEA 1U36A 4FZEH 5EOQL 1NGXA 5C86A 4JB9H 4YH6A 4HHAB 5I8OH 4Z0BL 4M3JA 1KJ2L 3CGTA 3O6FD 3VXPA 3HMWH 1H9VA 4MA3B 2C26A 3OKEB 3MRFA 3HI5H 3IDNA 4AK1A 3BW9B 1A02N 4HZLA 4WW2F 5EBLB 2VXSL 1CFSB 2GJ6E 4R7DA 4UB0H 1FO0B 4CMMA 3ARGD 4JHAL 5BOZG 4DZ8A 2EDLA 3F6LA 3W11C 5SWSE 1IGFL 5E2VH 3C2AL 2DLEA 3HZYA 5GGSA 4Q9BA 4MAYB 3LOWA 1MCIA 3TBWB 4PGBB 3TVMB 2NY5H 3EO0B 2PW2A 4XP9L 3PWPD 3SDCD 2I60L 2MHAB 4H25A 2AXGA 1BVLB 4H26B 3GMOA 4HKJB 3SGEH 3TO2A 4Z78B 1KSRA 3IDIB 4WGWB 4X7SH 4U1KB 5I1HL 1F8TH 3MROA 4BK5A 4ONOA 5HHNB 3WD5H 4QT5B 2Z91A 4PJDA 2CGRL 2IPTH 3CK0H 3LMJH 1MPAL 3U0WL 1FNSL 3RUGF 5AYUH 3MJ6A 1I8MB 5D7KD 1HQ4A 1FIEA 5JPMA 1KXTB 1WIUA 4YK4B 3RY5A 4G3YL 5DS8A 3D39A 3CX2A 1TJGH 5I0ZA 4TUJB 3N1MC 4V1DA 4K9EL 4ZDHB 5IBUB 4XAKD 4HIEA 1FORL 1I1CA 4APQB 3DI3B 4DGVH 3MRQA 1FE8H 5KSVB 4IRSA 1GGCH 4JFFD 3OG4B 3VE0B 1HDMA 5DHVH 5BV7L 1ZANL 1KBGL 4R7NB 4PY7B 1RK1B 1RZ7H 3MUY1 2AXFA 3AS3A 2VR5A 1J9CT 32C2A 2EO1A 5DURD 3OJMB 3RWGB 1XF2A 2OXGA 1H3XA 4PJCB 3FB5A 1CS6A 2GUOA 4TULL 3WNOA 4KY1H 2X1QA 1GAFH 1BAFH 1J8HE 4KRPC 2FSEB 2H6PB 4TOYL 1NANI 3TYFB 3HC3H 1X5FA 1CT8B 3GIZL 5FV1L 4RBPK 3K8LA 3SGKC 1MWAB 3GBLA 1J88A 1G9MH 3C8DA 5E2WH 1S9KC 1NJ9B 4JAMA 4MZ2A 2K7PA 1S7WB 1FL3B 1N6QL 4MD0B 4F7CA 1WFTA 4CADB 4K8RH 1FNEB 3OJDA 4E41E 2P8LB 1YECL 1BFVL 2VSDA 3OR6B 2CRIA 3WEXB 4XP5H 1A6WH 3E6FA 1JP5A 1JNJA 1WC7A 3CFIC 4FZEL 3LDBB 3VFOA 5I8CA 3FQRB 4JB9L 4KVCL 4ZAKB 5I8OL 1NC2B 3WUWA 5DZOA 3GMLA 3UC0H 2A2QT 5CEYA 3HMWL 5DO2C 5FV2A 5J12C 1JN6B 1NCTA 5B3NA 4MLSA 2GAZA 3QXUA 3HI5L 3VXTA 3D0LA 4X0KB 5J9PA 3IETB 4HH9A 5IB4A 4P9MH 1ACYH 5HGBB 4N9OB 1FLRL 2BFVH 2Z31B 1QHOA 3CDFA 2CKBB 5JW4R 4UB0L 2NW3B 3EDFA 1R3LA 2ZPKH 1YPZB 1FC1A 4O2CA 3VMPA 5EO9B 4PGEB 2UUDK 4NRYB 5E2VL 4PBWD 1JWSB 2APBA 4HS3A 4NC2B 4HUXA 4LSVL 1ZLUH 4PJBF 2QJDA 2AW2A 4ZSOE 1T1XB 3CDGA 4QRPD 5D1ZA 1AIFA 4MJ5A 3RHWK 2NY5L 3V6FA 1FZKA 2VLRA 5HI3C 3FN3A 4S1QH 3WHE0 5EZJA 4WO4B 4NHUA 3QXTA 3DUSA 5D2NC 3SY0B 1A6PA 2CRMA 4R97C 4X7SL 1B0RB 1D6VH 4HBCH 3RWCA 1F8TL 2HH0H 5J0BA 1MJJB 4ZO8A 3WD5L 3L3HA 3CK0L 3DV4A 3LMJL 4NCDA 3E3QC 1IEHA 2CKBL 1F4WH 1EEYA 1U8QA 4ISVB 2B4CC 5C08A 3T2OA 2IGFH 1HKLH 3W11D 2XTJC 1HEZA 4NQED 3SGDH 1K4CA 5EC1A 3ARGA 4DGVL 1JZ4A 2R0WH 3VXMB 1GGCL 3KPQB 3SDYH 4PJAA 1T21A 3ROLB 5C3TA 1LP9B 3EW3B 3B5TA 2XXCB 2P5WE 3PIQB 1J11A 3MUHL 5CILH 1X5IA 4JN2A 5DQJA 2XACC 4RIRA 5DFVC 1QR1A 3VFNA 3NCJL 2VR9A 5LVEA 1BAFL 4ONGH 2P24A 5F1NB 3WO4C 1AD9B 3O11B 4X7TB 4PYHA 4RDQG 3U0PB 1DJSA 5CLTA 3PWJA 3HC3L 5TDNA 3BP6B 1PKQB 3RU8H 25C8H 2MJWA 3BKYH 5FDWB 1OVZA 4OM1H 4R3SB 4UV7L 4BH8B 2HFFA 3GSUB 2CO7B 5BZDA 3HHRB 4NN6C 5KS9A 4LPTA 4XP5L 5GGUB 3THMH 1A6WL 3C6SB 4GOSA 4MD5B 2HKHH 2Y5TB 4XP4H 1DL7H 1U2HA 4PJ5E 3QUXB 4WU7B 4QRRB 3VGDA 1XZ0B 3D69A 5IF0A 5EO1B 3FMGH 4KJYB 3RQ3A 1A7RH 2DICA 1CLOH 2IAMB 3UC0L 5CGYD 1NC4B 3MRRB 2GSIB 2YBRA 3NPSB 4KRPD 5H2BB 3E6HA 2GHWB 3AXLB 3QNYA 4GAJL 4IJ3B 4P9ML 1PGRB 5DEGA 3BI9X 1Q9LB 3HFMH 3MV9B 3RZWA 2XN9D 3F8UB 4IDLA 5IEKB 3DVFA 5E4EC 5GPRA 1M7XA 4C56B 4N9GB 1KPUB 4HKZA 4JO1H 3MMEB 5CEXB 3GKZA 3FQUA 1MCKA 4JFFE 4XXCC 2GK2A 1AGDB 3OKOB 4G8EA 1UWXK 2FR4A 2MWCA 3RVXC 1YMMB 1A14L 1D5ZA 3FAWA 4J3VA 3DIFA 3MGTA 5GS2D 1M71B 4L1DA 3RHWF 5DO2D 3QCTH 1D6VL 1XAUA 1V7MH 3RIAF 2HH0L 1K9TA 4HFUH 3X13B 3T0EA 5HJ3A 1DCLA 1MAJA 1F4WL 4CUCA 4GMTH 3HRZB 1CU4H 1K4DB 4MXVF 1RHFA 2OJEB 4QKXB 2E3VA 1FVDA 1X6LA 2IGFL 3TFKC 4FXGB 1HKLL 4CJ1A 4DKFH 5CD3A 3B9KB 3EYOA 1Z0MA 2V2XB 1N8ZB 2Q3ZA 4WI9A 5JW5A 1EVUA 5EBGA 3ILPB 5JO5A 2VQ1A 1KENL 3REVB 1XR9A 1PZUB 4LQFL 5FO9B 2R0WL 1P53A 4LU5H 3CDYA 3P30H 3SDYL 8CGTA 5HI3D 5D6CA 1W0VB 3JV5A 3LCYA 3Q1SL 3I6KA 3LQMA 3QDGA 5HGAB 3GM0A 3QH3B 1J0HA 5TH2B 4KGJA 4QRPA 3C09C 5CP3A 1YPZF 5ALBL 1H3TA 4NRZA 5IESL 3WFZA 5EOTB 2O5ZH 2V2WA 3P4LA 3TIEB 2I9LA 3GUTB 4ONGL 3VFMA 2W91A 3RGHA 2CDGA 2ERJB 4U1IA 1NGXB 4LCWA 3W9DA 5IHZA 3O8XC 2LU7A 4F33A 1HYSC 3VXPB 3L3GA 4AEEA 3RU8L 2YHGA 3FRUA 1J1PL 2AEWA 3QWQB 3MRFB 3IDNB 3BKYL 2XTJD 4HZLB 4HGWA 4M7ZB 5L2KD 4R7DB 4JY4A 1MHCA 5E6IA 1V05A 3BT2H 2DM3A 3THML 4CMMB 1DP0A 2HKHL 4NQEA 4J3XA 4XP4L 1Z3GH 4HC1H 4DZ8B 1UJ3C 3PG2A 3FMGL 3HZYB 1A7RL 1DUZA 2Z35A 5GGSB 5CEZE 4F7TA 4FXKA 5DFVD 1Y6MR 3BKJL 4O51A 4RQQA 1T6WA 2PW2B 1ZE3C 4P23D 5T1KA 1MOEA 4H25B 3NCMA 2AXGB 4MVBC 5T5NF 3W81A 3G6DH 3GMOB 3TO2B 5SWZD 2HT4C 1XMWA 4KUZH 1T83A 2IALA 3MROB 3CFDA 5I76A 1X4ZA 2WP3T 1F02I 2Z91B 4PJDB 5J89A 1XCTA 5F9WB 1A3RH 2LV4A 4JO1L 3ETBF 4IBLT 2C4XA 1KYOK 1I8LC 4L8SC 4ZUVA 1HQ4B 3P4MA 1A1OA 5JPMB 3D39B 2ESVD 3LH2H 4RISH 3WJJC 4V1DB 4WEMB 3RUGE 3ZYZA 3GBMH 4HIEB 4XVUD 5D7JD 3MRQB 1SEBA 1JL8A 1BZQK 3QCTL 3MREA 4IRSB 1Y6NR 2Q8BH 1HDMB 5F1SA 3CXHK 2C3XA 1V7ML 2K1MA 4HFUL 1X5JA 3MBEC 2AXFB 1NCDL 3T4AA 4X6DF 32C2B 3GSQA 4QOKA 2X44D 1MHHA 1XF2B 4LSDA 4GMTL 1FQ9C 1CU4L 2O5YL 4PJEA 2GUOB 4YHKH 3BX7C 2NXZB 4B5EA 3UTZA 2X5PA 3DUHA 4DKFL 2MCPL 3GI8H 1KJMA 3OAYH 2R4SH 4R4BA 4I77H 2XN9A 1KFAH 5A2KH 4RNRA 4ELMA 3P30L 4PV9A 4JAMB 4LDOB 1CFNA 4NUJA 3MSPA 3RVXD 4F7CB 4MXQC 1FFRA 2EDHA 2J5LB 5IJKA 3OJDB 2A1WH 5ISZE 4KZDH 3V52H 1WZMA 4PRDA 1CZ8L 3ZHKA 4DFIA 4MAUH 5HHMD 1I7UA 4Y16A 1M6OB 4D9QE 5CGMA 3E6FB 1WC7B 4I0CC 3IU3A 4HZAA 3VFOB 5I8CB 2AJXH 3B5GA 2UZYB 1YYMH 1UH2A 5C0GA 3WUWB 3GMLB 2Z93A 1A6ZA 2LTQC 5CEYB 3WJLC 5GJTH 3MRJA 2EYRA 5J13C 2GAZB 1BJ1H 3VXTB 3D0LB 4IMKC 4DAGH 2FATH 4FS0A 5J9PB 1KELH 4HUKB 5IB4B 2WINA 1CGTA 1N0XL 5DHXB 4X4XA 3P77A 4OJFH 3BT2L 2DL9A 1R3LB 5CJXA 1CGYA 4O2CB 1Z3GL 4HC1L 1SBSH 4AEFA 5F96H 4R2GC 1MUJA 2YA2A 1UVQA 2RGSA 5TDPA 4HS3B 5IFJA 5KAQF 2IPUK 3MQIA 4HUXB 1QBMH 2KH2B 3RVUC 3LS4H 3NCBB 3CDGB 1H3UA 5D1ZB 1AIFB 4MJ5B 3L7FA 4ODXA 5F9DC 1FZKB 2VLRB 4WI6A 2FGZA 4NZUH 1HHKA 4C58B 5EZJB 3O8XD 4RGMC 3G6DL 3F7VA 4NHUB 4PJBE 5EB9A 3G04A 2D3VA 3RWCB 4DN4H 4XMPH 4G6JH 4KUZL 5DUBA 4MJ6A 4RMWA 2EC9U 2ZP0T 2RBLA 3HG1A 3GSRA 3D85D 2GJZA 3L3HB 3DV4B 3PP4L 2FX7H 3O6FB 4CN1A 1A3RL 1S3KH 1EEYB 1U8QB 2PR4L 4JGJA 3N9GH 5C08B 3P40A 1HSAA 4F7MA 1QBLL 4U1LA 1DZBA 1A3LL 5FA4A 2Y07H 1HEZB 5CBAA 4H0GA 1DQLL 1K4CB 5CJBA 5D2NE 2HRLA 4A6YA 4OF3A 3GBML 5EC1B 3ARGB 5SX5K 3AU1A 1C8PA 4TVSa 2Q8BL 4PJAB 1T21B 3KPOA 1FIGH 3IDJA 4MVBD 4Z7UF 5B38A 4I2XE 4YHZH 3DVGA 2HT4D 5F7KC 4JN2B 3LV3A 4P23A 1KTDA 5DQJB 3M17A 3MV7D 4RIRB 1QR1B 4YHKL 3VFNB 4NOFA 2NY7H 1JPGA 2P24B 3RWIA 2XTJE 1GOHA 1JBJA 1RZKH 5L2KE 4UINH 1GGIH 3PWJB 1Z2KA 5TDNB 2R4SL 4QXGH 4ZOBA 2XI9A 2EIEA 4I77L 5JOFA 3ESUF 1KFAL 3W82A 5LBSH 2G75A 2FH6A 2QQKH 2WSKA 2PUQT 4BH7A 3BPOC 3QIUA 2HFFB 3S34L 2A1WL 3BYYA 5BZDB 3V5DA 4N0UA 3V52L 4X7EC 4MAUL 4OZGF 2IQAA 5KS9B 3QHTC 2ESVA 4KI5F 1WV7T 5FO7A 5TE7H 4UDTA 2NTSP 2GTZA 1BQUA 4KK8C 4WV1A 4CAGA 2YPLD 3MBED 1JRHH 2AJXL 5D7JA 5E5RB 4OFYA 4CU6A 1NDGA 3D69B 5IF0B 4XMLH 1YYML 4Z7NF 2EKJA 3ARWA 5JDJA 5GJTL 2EECA 1SY6A 5SX4I 4KTYA 2YBRB 1QSFD 2F15A 1F13A 4XBGA 4JVWA 4ZTOL 5CEZH 2X40A 3E6HB 3PNWA 2FATL 3QNYB 3UX9B 4XTRD 2R0LL 2EDQA 4V2CB 1T20A 1FNLA 1FYTE 1S5IH 5DEGB 2F8VA 4OJFL 4PTTA 1C5CH 1OT1A 3KPNA 3VXNA 1X7QA 3L5JA 4MXQD 1SBSL 2AJVH 5F96L 4XXCA 4HKZB 3ZHDA 3D5OF 5C0FA 3FQUB 1QBML 5EU4A 4MB4A 3QCUH 4XP1H 4DJMA 4G8EB 7FABL 2FR4B 1YEGH 3IDXH 4EN3C 4HK0A 4NZUL 4LPCA 1UKQA 2VQTA 4PJCE 1D5ZB 4CMHC 1HIMH 3DIFB 3MGTB 3MOAL 4WI2A 5DJ0A 4WHYH 3GSVA 3SOBH 5HHOA 4EI5C 3B9AA 4DN4L 1CXKA 5IQ7H 3V4VH 1S8DA 4BQ8A 1NFDA 5HJ3B 5TFSL 4QGTA 2PYED 2FX7L 1VPOL 4WI5A 1S3KL 3N9GL 5GQBA 2IBBA 4P3CH 3QXDA 1FVDB 2JJWA 2DI7A 2O61A 4LSTH 5CJ8A 5CD3B 3EYOB 3FAXA 4R2GD 4U1JA 4P57A 5JW5B 2IG2H 5H35A 5JO5B 2VQ1B 4NQCA 1PG7X 1XR9B 2E6PA 3RVUD 5LWYH 4MXVE 3LKOA 1GYAA 2BNRD 1A47A 3UZQA 3BZFA 5C0DA 5D6CB 1U8NA 3I6KB 4EI6A 1FIGL 3QDGB 4GSDH 3F6IA 2OTPA 2Z8SA 3TNNA 1VENA 4YHZL 4QRPB 1OM3H 4UQ2A 1CE6A 1ADQH 2V5RA 3OGCA 4NRZB 3O4LE 3WNKA 4X7CC 7CGTA 2V2WB 2I9LB 2NY7L 3VFMB 4JRXD 3NZ8A 2CDGB 4U1IB 1FJ1A 4LCWB 1T1YA 3W9DB 5IHZB 1RZKL 3ZTJG 4UINL 2FGWL 4F33B 5AD0B 1YPZE 3U83A 3L3GB 1I3RA 3EOYG 5BRZA 1AKJA 3D85A 2DI8A 3FRUB 5LBSL 2QQKL 1JMXA 2L7UA 3SDAA 4E5XA 4UTBH 2WQ8A 3GBNH 4HGWB 4LOUC 4O4YH 1T5XA 4NFDA 3D6GA 2X4RB 2YRZA 1MHCB 4JY4B 4HS8L 5E6IB 5CGTA 3SJVA 2B8OT 3LPFA 4M5ZH 5TE7L 1OHQA 4NQEB 1DQMH 3B2UC 1JRHL 4XMLL 3LSOA 4ZPVA 4N8VG 1DUZB 2Z35B 4F7TB 3QG7H 4FXKB 4PJIA 1I8KA 3G6AA 2CH8A 4O51B 4RQQB 3DX9A 3ARDD 5GS2H 2DLGA 5T1KB 5CEZL 3QXAA 3OKNA 2VDRH 5EUOF 3PDDA 4O58H 3Q5TA 4LNVA 1U3HC 3M07A 3ZE0F 4EDWH 3N85L 2W9EH 5K9QG 2VLJD 3HNSH 3MV7A 3TC9A 1U3JA 1B0WA 4JO4H 4EEEA 5FHBH 4ZFOL 1C5CL 2IALB 3D2UA 5I76B 1DEDA 1XCTB 4X9BA 2AJVL 3LEXA 4RAUA 2ZWLT 1WAAE 4H1LG 5F3BA 3MNZA 4XGZA 3SBWA 4DOHB 1FAIH 1TJHL 4ZUVB 1LP9E 2A6KA 3QCUL 3P4MB 3ULUE 1A1OB 2EC9T 4KRNA 3AVEA 4KK8D 3FHAA 4PG2C 5D4QA 1A6UH 1BBJA 4QRQA 5EOCH 1HIML 3NH7L 3SOBL 1SEBB 4PREA 2M26A 3MREB 3NA9H 3PHOA 4OZFH 3K74B 3H3KA 5IQ7L 3MBEA 1BX2A 4U1NA 4GW5A 1EFXD 3T4AB 1YNLH 5IFAH 3LKQA 1CF8H 4QOKB 1MHHB 4E9LA 5ESVA 3FB7A 4NFCA 4PJEB 4Y1AE 4P3CL 3UTZB 4LLUA 2PTTA 4LSTL 4X6DE 1KJMB 3KWWA 4K7PX 1NPUA 1TQBC 2H3NA 3LIZH 2IG2L 4R4BB 4GRMA 5LWYL 2XN9B 3WYRA 4F80A 2L0DA 3BGFC 4RNRB 3U6RA 4ELMB 4PV9B 3TYGH 1CFNB 4NUJB 3WCYA 4EN3D 1GH7A 5J6GA 4ELKA 4GSDL 2FHBA 3KPSE 4PRDB 1OM3L 4YX2L 1FGNH 2NYYC 4EI5D 4MQTB 1I7UB 4Y16B 4JRYE 1ADQL 5CZXC 3WNPA 4QYOA 2YD4A 2J8OA 2CMRH 3IU3B 5HGDA 3MRMA 1DUYA 3VXRE 2XXMB 1DN2A 5FECA 4AENA 5J12B 4DGYH 3U36A 2Z93B 1A6ZB 1R5VB 4NPYB 4RBPH 4DK3A 3MRJB 4WW1A 1F42A 3QUKA 5F3HA 3RDTC 4IMKA 1EGJA 2FHCA 2EYRB 2AJSH 5FM4A 2PYEA 2CXGA 5MHSD 3H0TA 1RUMH 1FRGH 4Z76A 1N2RA 4O4YL 2C7UA 2WINB 5I1KH 1UG9A 1A7QH 5F6IC 4NWUH 1UENA 4X4XB 3P77B 1WZKA 1YMME 3OF6D 5I17A 1J7VR 4M5ZL 1EIBA 1DQML 2E27H 1MUJB 2WIMA 1UVQB 2GTWA 3QUMA 2VUYA 1FCGA 2AKRA 5TDPB 5IFJB 2VLMD 4R8WH 5GSVA 3QG7L 4XC3H 4PB0L 5EU7E 1I75A 2LFGA 3L7FB 4ODXB 1EJOH 4JFZL 2GSGB 3DARA 1W2KT 1HHKB 2VDRL 3GEWB 3ISWA 4O58L 1JZ6A 3QUYA 4EDWL 5IKCA 2W9EL 3F7VB 3C5SA 3ARXA 3WFCH 5F97E 1BD2D 3G04B 4JRXA 5E95B 5DUBB 4MJ6B 2Y4SA 3B9EA 2E9JA 1ZHLA 3HG1B 3GSRB 3HAEH 3GSNA 2GJZB 3KLAA 1PX4A 1MFNA 4LOUD 4ONHA 3ZLQC 2UUDH 1MFDH 5BQ7A 4WTZG 1HSAB 4F7MB 3WBDA 1WBYA 3NFNA 4LAQH 1CI5A 4U1LB 2DS4A 2YMXH 2YRLA 1TVBA 2DQHH 3RNQA 5FA4B 1A6UL 5C0JA 1R5IA 5CBAB 2Z8RA 5D1QA 5EOCL 2QSVA 3KPPA 4A6YB 3VDBA 4LSUH 2NX5D 4OF6A 3GFUA 3AU1B 3NA9L 4I9WD 3MJ8A 1BWMA 3KPOB 5I9QC 2R2BA 1KEGH 3B4NA 1U3HD 3IDJB 1CR9H 2NY0C 5B38B 1DBMH 2AJUH 3KYNA 3QDJE 3RVTC 5IFAL 1CF8L 3MGOB 3DVGB 4K3JH 3ARDA 2NW2B 1XIWC 4GKSA 4GRLA 3WO4B 3LV3B 4P23B 1KTDB 1TPXB 3M17B 4LHUA 3UTSA 4LNRA 1JGEA 1JPGB 1GC1C 2JTDA 3RWIB 1AJ7H 4Z7UE 4Z0XA 3DXAD 4XMKH 1U58A 4NQDD 3BO8A 3LIZL 5JOFB 1BGXH 4XC1L 1CLYH 4PJXF 2G75B 3TYGL 1AE6L 1CICC 4NNYA 4P4KC 4XZUA 1KCRH 1L6XA 1G1CA 4G8GD 3FOLA 4BH7B 2VABA 4KK9C 3QIUB 4EKXA 3OSKA 4WFGE 3V5DB 4N0UB 4ORZC 4D9RE 1ZGLM 2IQAB 2EEBA 2ESVB 1P7QA 1EA9C 5FO7B 4UDTB 2GTZB 2XKSA 4WV1B 5D7JB 2C4FU 1NDGB 3IAGC 2AJYH 4OZGE 4KI5E 4XBGB 2FWOA 1ZEAL 2AJSL 1A6TA 4S10A 5TQ0H 1HNFA 3MLRH 1MREH 3KJ6H 3PNWB 2CDFA 1RUML 4FFZH 1T20B 4HK3N 3AB0C 5I1KL 4FMFA 1A7QL 4NWUL 1U2CA 3D39E 4K23H 5E4EB 5M7QA 2R2HA 4PTTB 3GJFK 3KPNB 5C07D 1MAKA 3VXNB 4F15C 1X7QB 2B1AH 4EQ3A 2E27L 1AQKL 4NO3A 2FD6H 4ODVH 2VL5A 4OLXL 4PJHA 3AGVA 2AJZA 2HLFC 2NYYD 5C0FB 5J57B 2UWEA 4Z9KB 1N6UA 5EU4B 1K6QH 4EN3A 4XC3L 1ZHKA 5CZXD 2XG5A 3PQYA 4XNXH 1EJOL 1U8LA 3VWJC 1QPPA 5DQ9A 1MFCH 3N06B 5C0NC 1C12A 3EBAA 3DX7A 5DMGC 3U79A 1S7SA 3L5WA 4ELMF 5DJ0B 3GSVB 5HHOB 3RDTD 5HPMA 4KC3B 1UWGH 2COQA 2B7DT 4YAQA 5L0QC 3FJTA 3O3UN 1S8DB 1IAMA 5FAAA 1NFDB 1N3NA 3MXVH 2E7HA 4HUUA 1MFDL 2XQBL 3MRPA 3S36X 1T89A 1F6LL 4GG8A 4HIXH 4QHLA 3QXDB 2Y9RT 4LAQL 4X9IA 3BZEA 2YMXL 1UWXH 4PRNA 5INCA 2O61B 4N8VA 1X5ZA 2DQHL 2H26A 4U1JB 2CLRA 3S3PA 4P57B 5K9QI 5MP6L 1Q9OA 2EDOA 5H35B 4NQCB 3OF6A 4KXZI 4LSUL 3H7BA 3LKOB 5F7HA 2EDXA 1T7XA 1B6UA 2EE3A 4ODUA 3V6ZA 1Z9OA 4DFHA 3BZFB 1HK6A 1NGZA 5C0DB 3GI9H 4HCRH 1KEGL 1U8NB 3O9WC 4X4ME 4EI6B 5I15H 5AEAA 1CR9L 3CH1A 1DBML 2AJUL 3TNNB 4K55A 3UAJD 4UQ2B 4K3JL 1CE6B 1H8OA 5KZCD 3OGCB 3WKNA 4YZFF 1TXKA 2NY3C 4YXHH 3NZ8B 2VZOA 2YC1A 1AJ7L 1FJ1B 1T1YB 4JO2H 2V9RA 1WCQA 1BD2A 4XMKL 4RDQF 4LSRH 1DLFH 1I3RB 4M61A 1J0KA 1BVZA 1BGXL 5BRZB 1AKJB 3D85B 2DJ4A 3S5LA 5I8EA 3ZKMC 3E2HC 1HXMA 3SDAB 4E5XB 1KCRL 4PJ7A 4X5LA 1JE6A 1RUAH 4L4JA 1BF2A 4JPVH 3L6FA 1T5XB 1UXWA 1CGVA 2NR6D 2CK0H 3E0GA 4M62L 5E24E 1F97A 3SJVB 3B9VA 4GBXC 1T1WA 4S1SH 4RWHA 4U7KA 4K3DH 3S96A 2ZUYA 4PRPD 3TBSA 2NY0D 3NABH 3RVTD 4LARH 3LSOB 5T1LD 4ZPVB 4CL7A 4PJIB 3VFSA 1I8KB 4WFHD 3G6AB 5EWIH 4CKVX 3SE9L 1MF2H 3DX9B 5TQ0L 3QXAB 3OKNB 1NSNL 3MLRL 1EJ6A 3KJ6L 5E2UH 5C08E 3QBTB 5D7SL 4FFZL 3V6OA 4KMTH 2E7LA 3MV7B 4G7VH 3TPKA 3EFFA 4WEUD 1I9IL 3GM8A 3O3AA 4K23L 3D2UB 1CICD 1C7SA 4P4KD 5I1AA 3ARVA 5EUOE 2B1AL 4WTXA 4TVPD 1DLHA 3ZE0E 4KK9D 3LEXB 2FD6L 4ODVL 4RAUB 4L8SB 3FN9A 1AQDA 5F3BB 3MNZB 1VHPA 1K6QL 2A6KB 4G8GA 4O00A 3O4OC 4XNXL 5IJVA 3TIDA 1EERB 1D9KC 3PUCA 2EE2A 1ZKAA 1VEPA 1BBJB 4KKLC 4QRQB 3U48A 2OI9C 4PREB 1UWGL 3PHOB 1OGAD 3MBEB 1BX2B 2R1WA 3HRPA 4U1NB 4GW5B 5I1DA 3TT3H 1B88A 1MCLA 5TE4L 2AK4D 3MXVL 4NN7B 4OD3H 4JGUA 1RJZA 3U4BH 5ESVB 3FB7B 15C8H 4U6VH 1KXVC 5J1SC 4X9HA 5FO8A 3T8XA 5EIVA 4HIXL 2K7QA 3IT8D 3F12A 2WUCH 4IS6A 4LLUB 2P5ED 2PTTB 1GZQA 1I1AA 5FCUH 2AAVA 3KWWB 3BDYL 1VB9A 2H3NB 2HLFD 1XGRA 4OFIA 3KPRD 4GRMB 4UU9A 2FBOJ 1WIPA 5C07A 1ZLWK 3U6RB 1KACB 2L7JA 4P9HH 2VUOA 3VWJD 1L0YA 3GI9L 4HCRL 5J6GB 1QFWM 4ELKB 5I15L 5C0ND 4KFZC 5DMGD 2C5DC 3PGCA 2D9QB 3EJJX 3ILQC 3KPLA 3MJGX 2WIIA 5EU6A 4N5UA 3VDCA 1JYWA 1WK0A 4POZC 4QYOB 4U6YA 1EVTC 3BDBA 3MRMB 3ARFC 1DUYB 2DL2A 2LTQB 4JO2L 3SKMA 4NJ9H 4U6XA 4AENB 1UH4A 5DVKA 3RDTA 5FECB 4AEHH 5F8QC 3U36B 43CAA 4I3RH 1YEKL 1AXSA 4WW1B 5F3HB 3QUKB 4LSRL 5DK3A 3U2SA 3PWVA 3Q3GA 2V9QA 4MA7H 5E94A 2PYEB 3BN9C 5E1AA 5BO1H 5KSBA 1QSED 1RURH 3JSSA 2D0FA 3DYPA 2VDPH 3H0TB 4PLOB 4JFDD 3TWCH 1RUAL 1F00I 4Z76B 1N2RB 2C4FT 2C7UB 3GDBA 1GGBL 2QQNH 1D7FA 1KC5H 2CK0L 5FGBA 4X6CA 2R2CA 3R0MA 5BOPA 1NFDF 2ED8A 1WBZA 3WO3B 5I17B 1YEJH 5DC0A 4S1SL 2YXMA 4OGAC 4K3DL 4P2YA 4Y2DC 3O9WD 3NIGF 3V0VA 1CG9A 3MO1A 3NABL 1TVDA 1T04A 3QUMB 2GTWB 2Q76A 2AKRB 4LARL 2XWBA 3VD5A 4NQVA 4WFEE 5GSVB 1X5GA 4LCUA 3T0EE 5EWIL 1JF5A 1MF2L 3VGFA 5CJ5A 4NHCH 5E2UL 3QUYB 2IADA 5IKCB 4KMTL 5DHYA 3C5SB 4G7VL 4JG1H 4JRXB 3A67H 1JHTA 5HHQA 1KB9K 2JIXD 1ZHLB 4NC0B 4L3EE 3GSNB 3KLAB 1BPVA 2WWMC 4DGIH 4MMXC 4ONHB 5BQ7B 2BNQE 5EA0H 1CDJA 2VO5A 3O3DB 3PV7A 3QDGE 4GBXD 1WBYB 3NFNB 5DK0A 3DX8A 5IMLA 3OAUH 3IXTA 1TVBB 3RNQB 5KVGH 1B4RA 1CL7I 2KL6A 4LLQA 1R5IB 4IRZH 5D1QB 3KPPB 3VWKA 2BOBA 2X4SA 3KYKH 3ET9F 4LCIH 4S2SA 1ITCA 1D5MA 3MJ8B 1HINH 2FEDD 1ACZA 3HKFA 2R2BB 3TT3L 1NQBA 3B6SA 3P9MA 5T1LA 2YEZA 2B5IB 3GNMH 4MJ2A 3KYNB 3QUZC 3NGBC 4OD3L 2OL3A 2XY2A 2VZUA 3U4BL 3ARDB 4GKSB 3G6JF 15C8L 4LHUB 3UTSB 5F88A 3GSNL 4U6VL 5JOPE 4M1DH 4LNRB 1YJDH 1JGEB 4J3UA 1CD9B 2WUCL 1OAXL 2EEAA 3MC0A 4Z0XB 3LPWA 2OR7A 5FCUL 1U58B 2EYTA 3BO8B 1E0OB 3OMZA 4FG6C 5IUSA 1CICA 5SX5H 2D03H 3BPOB 4NNYB 3PDGA 4XZUB 2VAAA 3FOLB 4MB3A 3VMNA 2AABH 2VABB 2CDEA 4KKLD 2PKDA 4LGSB 3VFUA 2X4OA 3WDHA 3GHEL 4PJXE 1QFPA 4P5TC 1P7QB 1HKFA 3BGAA 4AM0A 4U1HA 1WSST 1W72A 3W0WA 4ZXBC 3BDXA 4FTVE 5TE6H 5GZOC 3EKCA 4NRXA 1OGAA 2ZOLA 3MXWH 1YA5A 4C54A 2E9IA 4XX1G 4YC2B 2FWOB 5MEND 1A6TB 1RURL 1QHPA 2VDPL 2CDFB 1JPTL 3TWCL 5DD6A 2VNCA 2QQNL 1KC5L 5EU3A 3NCCB 2R2HB 4EVNA 2F54D 4X5WA 1YEJL 5DF0A 4G8FA 4NO3B 1B4JH 1OP9A 3KPRA 2YD8A 4M9OA 2VL5B 2WQRA 4PJHB 2AJZB 3C6LC 1IFHH 3GZKA 3ILQD 3HI6L 2UWEB 4JKLA 4K71B 4EN3B 3VWJA 4NBYB 1ZHKB 3MBXH 4M6NH 3PQYB 5T3XD 4QOKE 1U8LB 2CXKA 4Y5VA 4CMHB 3ARFD 5DQ9B 1C12B 2YD3A 3HE6A 3DX7B 4PJEE 4ZOCA 4HG4J 1S7SB 3L5WB 1WF5A 5D96B 5HPMB 4YAQB 1BIHA 3A67L 3MZGB 2X4QA 4DZBA 1OAZH 2VERN 4YXKH 4MNQA 4Z8FL 1J8KA 4M93B 2Y1VA 3QPQD 4YHPA 3DVIA 1N3NB 3RWDA 3DTXA 4Q0XH 4HUUB 5I71C 3N1FC 4ELME 3JV4A 5EA0L 3MRPB 1X5LA 3QEQD 4YUEL 2CR6A 5DWUL 3QO1A 5E2TH 4GG8B 5I1GH 3P9LA 4QHLB 1A7BA 3BZEB 4JFDA 2XKUA 4OGAD 4PRNB 5INCB 5IVXA 2R9HC 4Y2DD 5TF1H 1IZJA 5D1XC 3PHSA 5KVGL 2H26B 1VEOA 2CLRB 1ZS8A 4KROB 1Q9OB 4IRZL 2VLKA 4Y2OA 3CU7A 3BKMH 3KVQA 5DJCA 3KYKL 3H7BB 4HMCA 1X5YA 1SJHA 3O9WA 3AM8C 4ODUB 3OZ9H 1NGZB 1AO7A 4L9LA 5CIPH 2BVQA 2XNAA 5C09D 3GNML 4LASH 3CH1B 4QHUA 3WSQL 3WDIA 1D6EA 5D8JH 2AI0H 3RL2A 1NH6A 2FO4A 4O02H 3D9AH 1RJLA 4M1DL 4KJQC 4RMSA 2YC1B 4GRWB 3PXHA 2WWMD 1Y18A 3K7UA 5E56A 1BD2B 4DEPC 4OGXH 4M61B 2JIXA 2P42B 4YZFE 3S5LB 3U7WH 2D03L 1I1RA 5I8EB 1MCHA 1HXMB 1CGWA 5I6XC 4PJ7B 5LGKA 2AABL 2ZCKH 4XWOC 5AG8A 3PWUA 1UXWB 4OLYH 3VA6A 4K3EH 1T1WB 1DVFC 1TJIH 4OZIA 3S96B 2E7MA 3TBSB 4GG6F 5BMFH 4I5BA 2V17L 2DQEH 3P0YL 3FOMA 4UT6H 3RZCC 5TE6L 2WBJC 3T04D 4KUCF 5ILTH 3HG1E 3MXWL 3VFSB 1A6VH 4MJIA 3I6LD 5JQHC 4JM2A 5I1JH 5GHWH 2IANE 4UV4H 1LO4H 1RJYA 4FG6D 3UROR 3EFFB 1EO8H 4I18C 3UZVB 3O3AB 4DKAA 1F3JA 4LSQH 5I1AB 3GMRA 4HIHA 1DLHB 1B4JL 5EPMA 2XKNA 5DZLA 4ZUWA 4Z5RA 1B0GA 1AQDB 4U4BA 2I27N 1IFHL 5ITFA 3B8SA 3K1KC 4P5TD 4YJZL 3ALPA 4OZHA 4G8GB 3MBXL 1FAKT 2V5SA 4M6NL 3T4YB 2HN7B 5IJVB 3TIDB 1NUNB 4NQUA 1OAUH 3CVHH 1G1YA 1ZOXA 1OOAA 1OPGH 4U0RB 4UNTA 1XEDA 3S35H 4GKZA 4Z7WA 2R1WB 4YXKL 2XTLA 5I1DB 2CRYA 3DHMA 4LLWA 4DN3H 2EYSA 4FP8H 4Q0XL 1T0MA 1H3PH 1RJZB 5AG9A 3K3QA 3S98A 5FO8B 4Y19E 5E2TL 3T8XB 5I1GL 3F12B 2YXFA 1K8IA 4IS6B 5J11B 4XT1C 3I50H 5TF1L 1GZQB 2NTFA 1I1AB 3LRGA 4AY0A 1JHKH 3C6LD 1XGRB 1GXEA 2F54A 3CLFH 1N5YH 3BKML 4UU9B 5C07B 5C0BD 5I1LA 1XT5A 4JEGB 4XHJC 3TA3C 3D0VA 3JV0A 1KIUA 1C5BH 3OZ9L 2G9HA 3NA4A 1KCLA 3WL9A 1MIMH 5CFHA 3WS6C 1A0QH 4LASL 5EBWA 1CFBA 3PGCB 4KK6C 5D8JL 3KPLB 1OAKL 4KKBC 3VXUD 2WIIB 2AI0L 3OB0H 5EU6B 4O02L 3D9AL 1U42A 4U6YB 1XGQA 1GC1H 4R9HA 4U6XB 3SKMB 1CTOA 2X05A 3RDTB 2AEQH 43CAB 1LDPH 3U4EA 4OGXL 1AXSB 3U2SB 3PWVB 3Q3GB 2BOCA 3V8CA 5E94B 3U7WL 3TPUA 5E1AB 3GRWA 5KSBB 2R9HD 5JPNA 4KKAC 2VKXA 5D1XD 1ES0A 3H9SD 1ZSDA 3QEQA 4UMGA 2ZCKL 2R4RL 2IH1A 4OLYL 2VITA 4X6CB 3DSNA 4Y2DA 1WBZB 3C8HA 5BS0E 4K3EL 1ED3A 2Z0BA 3V0VB 1G84A 1CG9B 5C0AE 3MO1B 1T04B 2Q76B 2XWBB 3EAKA 3GKWH 4JKPH 3GB7A 4NQVB 1UQSA 1PFCA 1NFDE 5MI0B 4LCUB 3P11L 5E9DD 1A6VL 1MCPL 4JY5H 5DUPH 4KJQD 4JFEA 3NIGE 2OLDA 5I1JL 5GHWL 2IADB 4AMKH 1AP2A 2LVCA 5KZCB 5DHYB 1LO4L 2B0SH 1MJ7H 1T2JA 5GSRA 4PBXA 1EO8L 1JHTB 3L1OH 5HHQB 4HJGA 4WI8A 6FABL 3WIHH 3O2DA 4HXBL 4NQCE 4N0YH 2R23A 4OT1H 5GZNC 4XWOD 3P4NA 2BZDA 1UZ6F 3VRLF 1W0WA 4KUCD 5KSAA 1JTPA 1DVFD 4HX1A 5DK0B 3DX8B 5IMLB 4U1GB 3IXTB 4XBPA 1OAUL 1XCQB 2ICES 5AWNH 4LLQB 3CVHL 5IW6A 1XGPA 5E7BA 3RZCD 4OCSL 2WBJD 1OPGL 3VWKB 2BOBB 5E5UB 3AS2A 1UACH 2X4SB 3GK8H 5EO0A 4S2SB 1D5MB 4PJ7F 3S35L 1QA9A 5BVPH 3P9MB 3B6SB 5T1LB 2AEPH 2V6HA 4DN3L 1LGVA 4FP8L 5IB2A 2YEZB 2AXHA 3HMXH 2YZ1A 1MCNA 5BRZE 1H3PL 2APFA 4QRUA 2OL3B 2EE9A 2XWTA 3QJFA 1EHLH 3VI4F 1L9MA 5F88B 4WCYH 2DKSA 3I50L 3PL6C 3STLA 3BWAA 1CGUA 2EYTB 5IB1A 3SJVE 1JHKL 3CLFL 3G6JE 1CICB 4P5MA 2NY1C 4Y5XC 3ARBC 1C5BL 3MV8D 3ZE1F 1W8OA 5CCKH 5L8JB 4QXWA 4NOBA 2DN7A 1OTUC 3TZVA 1OB1A 4EOWL 1R3HA 4P5TA 4XPHH 5FIEA 3VFUB 2X4OB 4JDTH 4Y4HC 5HSFA 1CXHA 2RR3A 1AHWC 2Q6WA 1ND0A 3IS1X 5ETUA 4AM0B 1S7RA 4U1HB 1W72B 5IVNA 3W0WB 4GLRH 1GC1L 5IBUG 3T2QA 1YEIL 5BW7A 4NRXB 1OGAB 2ZOLB 1LDPL 5C0CA 2LU4A 4ESKA 4HMDA 1KPVA 1KCSH 2DQJH 3AB0B 2RCSH 5CINH 1HILA 5DD6B 4C83A 3ZL4H 1UADC 4X4YA 1WIOA 1TZIA 5I8KH 3QA3A 1N4XH 4Z7VA 5EU3B 1AGFA 3I3BA 4XHJD 4EVNB 4X5WB 3TA3D 1VACA 5F8RC 4G8FB 5FYKE 5ICZA 1I3VA 3MRNA 4N0CC 4YHOH 4JZOB 3L3OA 3KPRB 5C0BA 4YHYC 3HE7A 1J1OH 3RX7A 3GKWL 4JKPL 1LK3H 4KKBD 1DN0A 2GCYA 4TNVF 4XVTH 3VWJB 4JY5L 2UV3A 5DUPL 5F93C 4Y5VB 4XVJL 4W4OA 3F62A 4KHTL 4XCCH 4S1RH 2OZ4H 3HNTH 4TTDC 4ZODA 4AMKL 5GS1A 2YD6A 2B0SL 1MJ7L 1J05A 2X4QB 4DZBB 4KK5C 2OR8A 3GJFH 3L1OL 4OQTA 5EFIA 4MNQB 2EDWA 2VKWA 4KKAD 3WIHL 3RWDB 3BEVA 3NVQA 3DTXB 5IB3A 4OT1L 3DGGA 4D94A 3C60A 1E28A 3JV4B 2JJTA 2R69H 2DWDA 1R3JA 3RKDC 4M7LL 5D1XA 3QO1B 1DSFH 3P9LB 3E1F1 4JFDB 5ACLA 3H9SA 5IVXB 2HFGH 1G9MC 3QAZB 4G6AC 1KOAA 1JZ3A 5DD1H 2GEEA 4Q6IA 3S3SA 4P2QA 3UJJH 4M43H 2VLKB 4K8RC 3QQNA 2GQHA 5DJCB 3ZKXC 1FFOA 3VG9B 3GK8L 1SJHB 2RB8A 3O9WB 4OCNC 4OF5A 4OCWH 5BVPL 1AO7B 4L9LB 1NGWA 2BSTA 2BHYA 1ZT1A 2BVQB 2AEPL 1PLGH 2H2PC 2R2EA 2XNAB 5CKAA 4FABH 3HMXL 4QHUB 3WHE1 3DLQR 1ZHNA 1ULVA 1D6EB 4KRMB 3KXFD 1BQHA 3RL2B 1EHLL 3F7RA 3F65A 4YFLI 1RJLB 4WCYL 3QT2A 4B7LA 1Y18B 4ZOEA 1A4KA 4WWKA 2ZCHL 5SX4H 3CH8A 2NQCA 5CD5C 5C7XH 2JIXB 3TO4C 4YHMH 3UCRA 2VZTA 5CCKL 2WV3A 1U95A 4OKVA 4PJFF 5E7FA 3FL7A 4N90D 1SJVA 1H8SA 3PWUB 4XPHL 4KGLA 2Y23A 1MCWM 3QQ3A 4JDTL 1ITBB 3FFCE 3LKRA 1ZHBA 1T1ZA 1PSKL 2IC2A 4OZIB 5F44A 2JF1A 4FQXC 3RZCA 3V5HA 1T2XA 2WBJA 3MLYH 2ID5A 4WWID 1NCBH 4I5BB 1KLFA 4UBDD 3ZT7A 3FOMB 4W6YB 3SO3C 5FKPA 4AG4H 2EDKA 4HAFA 1EBAA 3SN6N 3CFJA 3MRIA 4JM2B 4GG6E 2RCSL 5CINL 1J0IA 2EIDA 4I18A 3JVGC 3ZL4L 1CDHA 1RJYB 1F4YL 5I8KL 3O6KH 4OLZL 4LKCA 1A7NH 1F3JB 1U3YA 3ARBD 1PJ9A 3GMRB 4HIHB 1OTUD 2J8HA 5EPMB 1WWCA 2PW1B 2XKNB 2OBGA 3TNMA 4ZUWB 1J1OL 5JR1L 1JPFA 1B0GB 4Z5RB 1LK3L 2DYPA 4Y4HD 3O4OB 4XVTL 4LAJH 5B39A 3F7QA 4OZHB 3BAEH 2OR9H 3Q5OA 2V5MA 2I25N 4ZFZA 5JNYA 3P9WB 3EDEA 3QCVH 2OI9B 4S1RL 2MNUA 4XCCL 4YGVA 3UTSE 4Y4FA 3HNTL 3A0OA 5C6TH 2ZG3A 1FNGA 5ABDE 3VXQA 3UMTA 3JZ7A 3KG5A 4GKZB 2BERA 4Z7WB 3SDDA 1RIHH 1S7QA 1B9ZA 4LLWB 4AIOA 2EYSB 4F2MA 3IKKA 3KLHC 1T0MB 1QNZH 3PABA 4PRIE 3MLWH 5FF6A 2R69L 3DBXA 1DSFL 5DJAA 3NOIA 4YDIL 1K8IB 2HFGL 3MRBA 4N0CD 2NTFB 1TETL 4HLJA 4M43L 2F54B 3TA3A 5I1LB 3CFCH 3UJTH 4P0DA 1DR9A 3D0VB 1H15A 2O5XL 3HTLX 4OCWL 4NQXA 4QRSA 2G9HB 3WL9B 4PRHE 4F3FA 3KNBA 1PLGL 5IV2A 4HGMA 1E27A 4AQ1B 2WANA 4FABL 5EBWB 4TTDD 4HGKC 5E8DH 4L4TE 2A6JA 1IGTA 1HHIA 4LK4A 4RGND 3JBG7 4KK5D 4POYA 4JZJA 2ZUQC 4MQSB 1XGQB 1PDKA 5EH1A 2R1XA 3U4EB 4Z77A 4TRPL 5L6YH 1IM9D 4DWHA 2W07A 5GGRY 4Y88A 5E70A 5T33H 4BYHA 2BOCB 1ZLWH 4YHML 3TPUB 2NY2B 1CLZH 5JPNB 4G6AD 2NXYC 1KTKE 3DMMD 4M6MH 1ES0B 1ZSDB 3QEQB 3L5XL 3BEWA 4K8RD 2IH1B 2VITB 4DVRH 4Y2DB 5ANMA 1AI1H 3V8OA 1ED3B 1PD6A 1I85C 2H2PD 3MLYL 4NO0D 1SHMA 4WUUD 1T4KA 1NCBL 3GB7B 1M7IA 1UQSB 4AG4L 3RIFK 1PYWA 5JHDD 4JFEB 2Z4QA 3WKMH 3K2UH 5FM8A 2R0ZL 3D18A 1DEEA 1YNKL 1S9WA 1AP2B 4FQ1H 3DSFH 1HOCA 4MX7A 3BRFA 4NKQB 5CD5D 3IU4H 1JTOA 3KJ4B 2V2TA 3NTCH 5GSRB 3O6KL 1A7NL 3TO4D 4CVWA 4LQ1A 4HJGB 4IOFC 5F21B 4P2RD 4QEGA 1I8MA 4LRIA 2R23B 1U8PA 3P4NB 4P3DA 4JPIA 3BE1H 4D2NA 1W0WB 5KSAB 3MRGA 3VRIA 4P46D 4HX1B 3G9VA 3BAEL 4FQXD 2OR9L 1A8JH 3ELAT 3QCVL 4C59B 1N6VA 43C9A 5IW6B 1W8NA 1XGPB 3T08A 1UZ6E 3VRLE 4GT7A 5C6TL 3L3DA 1TCMA 5EO0B 4DW2H 3BHBA 3STBA 1QA9B 3H42L 1RIHL 3QULA 4OLVH 5IB2B 4MCZA 2PYFA 1F4XH 5HVFB 4BSWA 1F3DJ 4OKDA 4QRUB 3MLWL 2XWTB 3QJFB 2YUZA 4QTIH 2CJUH 3EYFA 4OZIF 4PJ7E 5B22A 3GMQA 2QL1A 4KJWD 1TZHA 1CWVA 1T7YA 3STLB 3BWAB 4R4FH 3IFNH 1MQKL 5IB1B 4WFFD 4OTXH 3VI4E 4XAWL 4P5MB 1KIPA 2APVA 3ARBA 3CFCL 4JM2F 1CDUA 5JXED 3UJTL 2BX5A 4NDMA 4MA1C 4QLRA 3L3IA 3H2WA 1TITA 4FOMA 1EO5A 4PY8J 2F53A 3TZVB 3U7YH 1OB1B 3SE4C 2BVPA 5IROC 1R3HB 4P5TB 1AHWA 1U41A 3ARQA 1QPXA 5KVEL 2J8UA 3SGEI 2J6EH 2FIRT 2Q6WB 2GITA 1ND0B 3ZE1E 5ETUB 1S7RB 3KLHD 3DOSA 2VTFA 4BSVA 2N56A 5C0CB 4I4WA 5L6YL 1IT9H 1E4WH 1UJTA 1S9YA 5T33L 1KPVB 1ZLSH 4OF0A 4D0CA 1CE1H 4YWGH 3MNVA 1WT5A 4M6ML 1HILB 1VFMA 4C83B 4X4YB 2VWEE 3WDJA 4YE4H 1TZIB 3QA3B 1NEUA 5I30H 3CAFA 3HUJF 2HTKC 4Z7VB 1AGFB 4DVRL 4MYWB 2J4WL 3MZTA 2BY0A 1AI1L 1VACB 1H3VA 3S37L 12E8L 4X4ZA 5ICZB 3MRNB 3L3OB 2GJ6D 5C0BB 3TJHC 1QFUH 2BVTA 3HE7B 3K81A 4HXAH 3OR7A 1WLHA 3K0WA 1DN0B 2A6DA 2GCYB 5DMKA 5DHVA 5SWSD 3VFVA 5TJWK 5BJTA 3WKML 2YS4A 3K2UL 4ZFFA 1I3UA 5EZIH 3RIFF 1P5UA 4FQ1L 1QSVA 5GS1B 3DSFL 3RGVD 2JJUA 3IU4L 2DMKA 3NTCL 1J05B 4MNGE 1ZA6A 2WUBH 4NZTH 1MY7A 4CW1A 1CGSL 3L5HA 2Q87A 3QHFL 5EFIB 3B8YA 3JTSA 2YWZA 3BEVB 5IB3B 3DGGB 1IM9A 3C60B 3WUWG 5ICXA 3BE1L 4XPAH 5J6HA 2DWDB 1A5FL 1D5BA 1NLBH 1R3JB 5D1XB 1A6AA 3DMMA 3ZT5A 3H9SB 4M9PA 5D71L 4PYGA 5DMIH 1QR4A 4HJJH 4J7RA 4Q6IB 2PXYD 4P2QB 4WTWA 5EC2A 5EU6E 5M95B 2W65B 4L4VA 1FFOB 4ALAH 1KTRL 4DW2L 5A2JH 3U1SH 2HP4A 4NO0A 4WUUA 1NGWB 2BSTB 3SDXA 4OLVL 1ZT1B 2R2EB 4PP2A 3T2NL 3UTPE 5HDOA 2MQ3A 1F4XL 1FFPA 5FUCE 3QFJE 1ZHNB 4PJ9C 2E9BA 2WBWB 1HN1A 1BQHB 4QTIL 1F3RB 2CJUL 5JHDA 2VDOL 4Q58C 3L5IA 4NSKA 4WRLA 4NJAH 1A4KB 3IFNL 4WWKB 4P4RA 5CLWA 4OTXL 2D9CA 4HIIA 3DRQA 5FDWA 2DQTH 4P2RA 4LMQI 5I6XB 1V5JA 4K07A 3PP3K 1X9QA 2DBLH 3QO0A 4F9LC 2WW8A 4HT1H 1U95B 3U7YL 3V2AR 4OKVB 1CK0L 4P46A 4MD5A 4ZD3L 3RVWC 3QQ3B 3X3FH 3LKRB 4FQXA 4XNQA 1CQYA 1ZHBB 3CUPA 2J6EL 2BXYA 3IDMA 3F5WA 1AC0A 3ZTJH 4E41D 5DRXA 3RZCB 3V5HB 2WBJB 5LGJA 3PGDA 5FGRA 4RMVA 1T7ZA 4N0RA 4GAFB 4M7KH 1IT9L 1E4WL 5D7LE 4NM4H 3QEUA 4KDTA 2YD2A 3CFJB 4JQXC 3MRIB 3JVGA 3K1DA 1CE1L 4WJ5A 4YWGL 5L9DH 3LZFH 1RZIA 4I18B 3RTQC 3IFPA 3NMEA 4YE4L 5I75C 5I30L 2UZIH 3SGDI 2O26U 4LKCB 4JREC 3QIBA 3WFDH 4C56A 4NN5B 3F7YB 3RX5A 3T1FA 4I0PC 1NGPH 3TNMB 1QFUL 4Z18A 5JXEA 1JPFB 1NAKH 1MCOL 2DYPB 2ZSVA 3OXRA 5B39B 4G5ZL 4L3CA 1FL6A 3G5ZA 4ZFZB 4XVSH 5JNYB 1DQQA 2V9TA 3CSGA 2WM0A 1OP3K 4BM7A 4YGVB 5EZIL 4Y4FB 3C5ZA 5IMMA 1FNGB 5JXAH 3X13A 3VXQB 1YY9C 2WUBL 4NZTL 3SDDB 1S7QB 3EJZC 3LEVH 4MNHA 1X5KA 4XCFH 4H1LH 4F2MB 2BCKA 5D7IA 4G6FB 2BRQA 2OJEA 1TMCB 4HKBA 4MB5A 2HTKD 5FF6B 3KHQA 3DBXB 4I3GA 1NLBL 4V2BA 1P2CA 2QV2A 5DJAB 2LVEA 3TCXA 3MRBB 3P0VH 5DMIL 3O2WH 3TJHD 1LO0H 2D7OA 4XCNA 3U9PL 1WZ1H 1IMHC 3TA3B 4FQPA 2BNUA 1QD0A 3ORJA 3SQOH 4ALAL 3W0WE 2L4OA 5IFHH 2GI7A 1H15B 5ALCH 3U1SL 3VGAC 4NQXB 4QRSB 4F3FB 2E7CA 3KNBB 3BISA 5IV2B 3IDUA 4Z7VF 1E27B 1ZV5A 4DCQA 1RHHA 5E99L 1Y6KR 5FYJE 2QSCL 5SWSA 3CU1A 2A6JB 1IGTB 1HHIB 4Q9RH 1B3JA 2XZAH 4JZJB 1R24A 5L7XH 1H3WM 5SV3A 5MEQA 4WW2C 3HLAA 3FONA 1JUFA 2P5WD 3ZKSD 3RGVA 4NJAL 2DTSA 4J4PD 5ID0A 2EDBA 5EZLA 2R1XB 5C9JA 4Z77B 4PLKC 1MI5A 2DQTL 5D2LF 4TUOA 5INDA 4OLWL 4XRCA 1V3KA 1NMCC 2B1HH 4IEFB 2DBLL 1A22B 5KBNC 4A2LA 3BEWB 1YNTA 5EZOH 3X3FL 5ANMB 3QWRD 1C08B 3WLWC 2PXYA 3UBXA 1GRWA 1T4KB 2KBGA 4POUB 1M7IB 1HHJA 4MNQE 5IB5A 1PYWB 4M7KL 3O3BA 4NM4L 4OF7A 5HHPA 4PJ5D 5BV7B 2BY3A 3STZA 1FYHB 3QWOA 1FSKB 2FBJH 2Z4QB 4NNXA 1UC6A 3D18B 1N7ML 1DEEB 1JGVH 1G7MA 3ULVF 3BJLA 2VMFA 1S9WB 4PV8A 5L9DL 3LZFL 1HOCB 4MX7B 5A1AA 4YDKH 2V2TB 2UZIL 1DBKH 1D3CA 4LEXH 3WFDL 3QDHA 1RSFA 4KPHH 2MMXA 1LEIA 1A2YA 1EEUA 3OL2A 2DIBA 1JWUA 3RY6A 3KGRA 4KVNH 1J8HA 1U8PB 4P3DB 4JPIB 5TQ2H 2ILLA 1AO7E 3V5KB 3MRGB 3VRIB 1OCWH 2EC8A 5D6DC 3HZMA 4YO0A 4XVSL 4YFLF 4LP5A 43C9B 1OTTC 3Q2CA 3DUUA 1FCCA 1YEFH 1EHNA 2NZIA 4ODSL 3RWHA 1WGOA 4PJ8C 2XG4A 3L3DB 1I7ZA 4Y0GA 4OGYH 4PD4J 1TCRA 5JXAL 1BLNA 1RULL 3BHBB 1AGBA 1GCFA 4UAOB 4GQ9H 3QULB 5IHUH 3TH4T 3LEVL 3ZMRA 3L95A 2PO6D 4XCFL 4MCZB 2PYFB 3RTQD 4BSWB 3NCFB 3EYFB 1G6RH 1JV5A 4WHYG 1KCVH 3M1BA 3GMQB 1TZHB 3P0VL 4I0PD 1NLDH 3MLVL 1R6VA 4LCCC 3O2WL 1T5WA 2UY6A 3QZWA 1WZ1L 4OZIE 3O2VL 1KIPB 3ARBB 3DJ9A 4PG9B 3OKDA 3SQOL 3I75A 4OIAA 5H8DA 3TN0C 4NDMB 1NBVH 1V7NH 2D7NA 5ALCL 3SE4A 4HC1A 3L3IB 5IROA 3ZZ1A 3D3VA 4KWUA 2P49B 1UM6H 2F53B 2ED7A 4MJIE 4HSQA 1M6OA 2BVPB 2A38A 1JI1A 1GSMA 1AHWB 1H5BC 2EH7H 2ADIA 2J8UB 1YY9D 2GITB 2XZAL 3N1QC 1P4IH 5L7XL 3EJZD 5DEZA 4NKDA 2D7MA 3F58H 4BSVB 4M48H 1INQA 4I4WB 5C0IA 2VAJA 5AYQA 1S9YB 1L4IA 3EJYD 4LHQB 4D0CB 1OF2A 2B1HL 3MNVB 3CFEA 1ZGLP 4NGHH 4GUPA 4M5YH 1P5VA 4G9FE 3SKJH 4NKOA 3VU2A 1S7TA 4YHYB 5I19H 2VDMH 1DTUA 1OL0A 1MH5A 3KPTA 3HUJE 3OR7B 3QQ9C 2A6DB 5DMKB 1A64A 3MCLH 5DHVB 3AY4A 1A7PH 2FJHA 1MCEA 2M1KA 4PIRF 1CL7H 3VFVB 5BJTB 1Z6JT 4YPJA 1CDCA 1H8NA 1VA9A 4ZFFB 3LQAC 2UVEA 5CEZD 1OY3B 2OTUA 3MFGB 1KJ3H 4RGNB 4JQVA 5DJYB 4X6FA 4YDKL 2WLZA 3V79C 1DBKL 1ZA6B 2IPTL 4CW1B 3AS1A 4LEXL 3O6FA 4FHBD 4KPHL 4J4PA 5AYUL 3JTSB 4RGOH 1YQ2A 3K8MA 1IM9B 4KVNL 5CJQH 5ICXB 4J2XA 1VADA 5TQ2L 5J6HB 5FYLE 1D5BB 1TJGL 3BQUC 4BK4A 1OCWL 3T0VA 1A6AB 3DMMB 3U9UB 3WLWD 1BOYA 3ZTNH 3MV01 5CUSH 3IGAA 1FE8L 1KIQA 3ZKXB 1S7VA 5EC2B 3W2DH 1YEFL 3V95A 4L4VB 1E4XH 4OGYL 1SBBA 1RZ7L 1NBQA 1AFVH 3MPCA 1A1MA 5I18H 4NO0B 4WUUB 4ZQKB 3SDXB 1Q8MA 4PP2B 3TVMC 1FFPB 2Y7QA 2ICEA 3PWPA 4KY1L 3SDCA 4CNIA 1GAFL 5T1DH 3T3MF 3ZKNC 2DBJA 5JHDB 1G6RL 5A43C 2YD1A 1KCVL 5HGHA 5HYJE 2X10A 2XRAH 4NSKB 4OZFG 2CLVA 5FYJU 3TCLA 1NLDL 1G9ML 4P4RB 5E2WL 4HIIB 3DRQB 1CXIA 4P2RB 4ZO7A 4F9LA 3FFDA 4K8RL 2Z8WC 1KB5H 1NBVL 4J12A 1U8IA 3QO0B 4P48A 1UM6L 4YK4C 1OTTD 4KTDH 1E6OH 4PLNC 4P46B 2A0LC 2EH7L 1PQZA 4JFEE 5T3ZE 4FQXB 4XNQB 3KLSA 3CUPB 1U91A 3IDMB 4APQC 3F5WB 1P4IL 1PG7H 4JFFA 5DRXB 1NMBH 5ISZD 2VJXA 5LGJB 3PGDB 1BVKA 4K7PY 4HPYH 4DUVA 4PP1C 3F58L 3Q5YA 1CVSC 4D9QD 4M48L 3K8KA 4JQXA 4F58H 5JQ6H 3QEUB 1WEJH 2AQ2A 2PO6A 3KS0H 2VN4A 1U8MA 3FTGB 1ACYL 3SCMC 2BFVL 4WJ5B 5B38G 2X4NA 2QSTA 2KZWA 1RZIB 4NGHL 3IFPB 4M5YL 1N26A 2ZPKL 4Y89A 3MTRA 4G6KH 3SKJL 4KH2A 3EDKA 3QIBB 3TN0D 1LMKA 2D0HA 4GO6B 4I0PA 4PJCF 4PJGA 2X4UA 2WMPA 4XX1E 4LDLB 3T1FB 3LKNA 1EEQA 1RJCA 5I19L 4W4NA 2VDML 1Z5LA 4KHXH 3MODH 2ZSVB 3OXRB 1ZT4A 4OCMC 4S1QL 5C2BH 4L3CB 3MCLL 1K2DA 1FL6B 3G5ZB 3JV6A 3K4AA 1CL7L 1DQQB 2NMSA 2W92A 4NBZB 4NC1E 4HBCL 1UT9A 3C5ZB 1KJ3L 3LDBC 5IMMB 2HWZH 3MOBH 5HVHC 3J8F7 4ZAKC 1TIUA 1IGCH 3GIVA 4JJHA 4MNHB 4Y8DC 2ZJSH 4RGOL 2BCKB 2DWEA 2MQCA 5D7IB 3DYOA 1U9KA 4HKBB 2HAZA 3BD4A 3TH3T 5C6PB 1BEYH 1P2CB 1EZVY 1J10A 2Z31C 3ZTNL 5CUSL 3MLTA 4XCNB 1RVFH 1JRHI 3W2DL 1WQVT 3QEGH 3QQ9D 2BNUB 1E4XL 1ETZA 3LD8B 3WNLA 3ALWA 5CSGA 5CILL 4F7EA 5C0CE 2X4PA 5EN2A 4DCQB 1RHHB 1QRNE 3HA0A 4HD9A 5SWSB 2Q7YA 2ZUQB 1TVHA 5T1DL 4WW2A 4TSAH 1RY7B 3RPIA 1R24B 5MEQB 1R3KA 5AD0A 3HLAB 3FONB 1JUFB 1FZJA 3RGVB 4Z7VE 5IM7A 5J1TC 1BM3H 1OSZA 5E08H 4ZNEE 25C8L 5ID0B 5EZLB 1CXFA 5C9JB 4UILH 2H32H 1MI5B 1G7JA 2Q8AH 4ZFOA 1S78C 4TUOB 5INDB 3BQUD 4OM1L 2R29H 4XRCB 1KB5L 2CK2A 5DJ8A 2X4RA 2VDLH 1NAMH 2RIKA 4PGJA 1GPOH 1NDMA 1YNTB 1HH9A 3FN0H 3UTTE 5D2LE 1DL7L 2QKIA 4K7PH 5E8OA 4LSPH 3QXVA 2PXYB 1CLOL 3UBXB 1MLCA 3B3IA 3TVMD 3IAQA 2HRPH 6CGTA 1LO5A 4HPYL 3HZKA 2EEDA 3VH8G 3QDME 3OPZH 3ZKND 1HHJB 3ULUC 5IB5B 1QQDA 4F58L 5JQ6L 3O3BB 5HHPB 5KN5A 4XCEA 1WEJL 3O0RH 3STZB 3T0WA 3QWOB 2DM7A 4NNXB 2PF6A 4WEBH 4U7SA 5CZVH 1WAAF 2G5RA 1G7MB 4PV8B 4BQ6A 3HFML 1LP9F 2ICWJ 3V4PH 3ULUF 1PVHA 3HCVA 3E8UH 3SE3C 4G6KL 1WUNT 1X5HA 1GGUA 3EOTH 4P2QE 3MCKA 1LEIB 4M1CC 1HHHA 1A2YB 1JWUB 3ULVE 1FYTD 1NFIA 1J87A 1J8HB 3OKLA 5DJDA 3O45A 4KHXL 2A0LD 2BY1A 4KRLB 4LSSH 5C2BL 4APQD 3AROA 1GOGA 2Q3AA 2ORBH 2D7QA 3HZMB 4OLUH 4YO0B 4ODWA 5DK2A 4KQ3H 4PP1D 3DUUB 3RWHB 1C5DA 2A83A 3BXNA 3QUXC 1I7ZB 4G43A 1ADQA 1TCRB 1BLNB 5GGQH 5ISZA 4HG4K 4HFWA 1IGCL 4CN4A 1AGBB 4S11A 5J56B 3MUGA 4RSVA 1MJUH 4O5LH 1HWGB 4RA3A 3SCMD 1JI2A 4IRJC 3L95B 2ZJSL 3BJ91 3NPSC 1OAQH 1IEBA 4QGYA 4EUPH 3REWA 1JV5B 4QY8A 4IJ3C 4URTB 1Q1JH 3SGKA 1BEYL 3M1BB 2BHZA 3QEHA 2FCBA 3QPXH 2BVUA 1T5WB 5GXBB 4LU5L 3QZWB 1RVFL 3TN0A 1LE9A 3QEGL 4NYLB 4MA1B 3SKOA 3OKDB 3HB3C 5D93C 3I75B 5GRXG 3N0PB 3AMLA 4GMSH 3D3VB 5I0DA 3NCYS 3A6BH 3G5XA 5TDOA 4IHOA 2O5ZL 2C1OA 1OQXA 2I5YH 5CWSA 5HYIA 2ADIB 1MRCH 3QQ4A 4TSAL 2OMBA 3VXSE 5CJOH 5FFLA 4LCYA 5T3ZH 1R5VA 5FA3A 4NPYA 1JGDA 3S4SA 3DWTA 4NKDB 1EX0A 1BM3L 2ZG2A 4QWWC 5E08L 1CXLA 2IMNA 1IC1A 3O4LD 4L29A 5EU7C 4UILL 3TFKD 1INQB 5C0IB 1TFHA 2Q8AL 1JGLH 2R29L 4QTHA 4JHBA 1OF2B 4YXLH 2GW5A 1I3GH 2FNBA 4AYFA 3TBYA 3CFEB 1J0JA 2QR0A 1I9JH 3BZDA 4GUPB 1GPOL 1WFUA 3B9KC 3BYTA 3UDWC 3FN0L 1C1EH 4NKOB 2DD8H 4D0DA 4K7PL 4LSPL 4EIZC 1S7TB 1F4HA 1O5DT 4XPBH 2BHUA 5IBLC 3T0BA 4X98A 3VGGA 4LFHG 3PWLA 4YHIA 4HLZG 1MH5B 1RQ5A 1KG0A 3OPZL 4YHLH 2GSGA 4OZFA 5EIIA 5D2NA 2FJHB 5KVMC 3O0RL 2W9LA 1TTGA 1HYSD 5D70H 5CZVL 3QRFM 2X1OA 4WUKH 2XIDA 2OTUB 3ARYA 4DVBA 1MJ8H 3V4PL 4X6FB 3E8UL 2X89D 4WHTA 2H1PH 3WXWH 1S78D 4I2XA 4X6EA 4ZS7H 1UB5A 3EOTL 3OAZK 3RX8A 1RMFH 5ESQA 1G0XA 5GRUH 3BQUA 1VADB 2NY6C 2PTVA 5L2KA 4M7ZC 3LH2L 4LSSL 1QBAA 2W0FA 4RISL 3NFPA 3PHQA 5DLMH 3G5YA 3MJ9H 2ORBL 4OLUL 3IGAB 1EUTA 1PG7W 4P9HC 4YIQA 1KIQB 1G0YR 1S7VB 4KQ3L 4RX4D 1INDH 3ULUD 1NGQH 4OI7A 5GGQL 4AL8H 1A1MB 4U49A 1G7LA 5HY9B 3MGOA 4GAYA 2YUXA 4O5LL 5E4IA 3NFSH 2NW2A 4UZGA 2Y7QB 1UH3A 1OAQL 2ICEB 3ZDYF 3PWPB 3SDCB 4CNIB 2I26N 4ONFH 4EDXA 4GH7B 5SWZA 3S6CA 3GI8L 4ZTPH 5HGHB