4DCQB

Crystal structure of the fab fragment of 3b5h10, an antibody-specific for extended polyglutamine repeats (orthorhombic form)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
218
structure length
218
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTTYGMSWVKQAPGKGFEWMGWINTYSGVPTYVDDFKGRFAFSLETSASTAYLQINNLKNEDTAVYFCARGGNNFLWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 3B5H10 FAB Light Chain
publication title Disease-associated polyglutamine stretches in monomeric huntingtin adopt a compact structure.
pubmed doi rcsb
total genus 42
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2012-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dcqB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dcqB02
3CZJA 5H2BA 1V05A 3LAFA 3DSFL 5L9DL 1TETL 1EMTH 2GJ6A 5TDPA 2V2TA 5DMIL 2KPNA 4ZS7H 1PZUB 4D0BA 1SVZA 1M7XA 4UT6H 1P6AB 4XP5L 4LARH 3KXFB 5LAXB 3QDHA 1AXSA 4LKCB 3ILQC 3LMJL 5ERWA 2EDDA 4JO4L 1F42A 5KBNC 1B6DA 2VLME 3P9WB 4B7IA 4GAYA 5I75C 3GJFK 5JPMA 4MB3A 1ZLVK 3EAKA 1RK0B 3TO2A 4JPVL 1EDQA 1TJHL 4AM0B 4H88L 3DO3A 4PV9B 1MRCH 4BQCA 2UWEF 1NC4B 1Y18B 3P4OA 5C0CD 4L4TA 4U1MA 4NJ9H 4R26H 2BXYA 1OLLA 1KG0B 2VLKB 1Q0XL 5CGYD 5DUBB 1IM3A 1G9MC 4OQTH 4M6OH 4ODHH 2C4FT 4J1UA 1A6VH 1T0MB 3T77A 1DDHA 2WBKA 8FABA 1XFPA 3I50H 5ESVA 4Q9RH 2VDOH 1BVKA 4G7VH 4PUBH 5ETUA 5F88B 1UCBH 3VXRE 1U8OB 3RWCA 1M4KA 1HHGB 1DBAL 2VKWA 3NBNA 3FRPA 5IFJB 1VESA 2D9CA 4KHTL 1S7QB 4LEOB 3A67H 2DQHH 3CMOH 3HUJA 1FP5A 1I1YB 1AJ7H 2XZZA 1FAIL 1R5VA 3QI9B 3U30C 1WC7B 3C5ZA 5FAAA 2GJ6D 3CVHB 3L6FB 4EOWL 1VB9A 4X99A 1N8ZA 4MJ4A 2CK0L 2VISA 5F1OB 3VRIB 1BBDL 4ZOEA 2QR0A 5LBSL 4R2GB 3O0RH 3BGFC 3C8KB 5TF1L 1XF4A 3ZE0E 3VGDA 5CSZB 4JZNB 4Y2DC 4ELMA 1FFNA 5DXWA 4UIMB 5BRZB 1ZEAL 1HNFA 4WFGE 5DS8B 3RX5A 3IRPX 4IMLB 4D8PB 4L4TD 4LCYA 5MERA 1JNHB 1BWWA 2FO4A 1QUNA 3DVGB 1ZK9A 3QG6A 4QLRA 4UTBL 1MCHA 4C56A 1A7NL 4NNXB 1S5IH 1V3JA 4ONFH 4LLMA 2R0LH 3D39E 2W92A 1MHEA 2JJSA 1N64H 1PQZB 1ORQA 3MYJA 5JO5A 3T2NL 1QEWA 3BKCH 4JJ5B 5IW3A 4C55A 3B9DA 3EGSB 1A6UH 1A7QH 4QRSA 1CDGA 4RZCB 2Q1EA 1AGEA 3QIUA 3BHBB 5IVXB 4M4RA 5T3ZD 3IDNB 4GQ9L 4NO5A 2EXYD 4ACPA 3C5ZD 3C60B 2PUQT 4PRBA 1IAIM 1DQQB 2QQLL 4CVXB 1A5FH 1R3KB 5DI8B 3EYOB 1JYNA 4RDQF 3QQ3A 1JGEA 3N85L 1UVQB 2ZCKH 4M3KB 3S4SG 5GRUH 3V9FA 3MLWH 4LF3A 2CR6A 3GMLB 2W0KA 1KJ2H 3QPXH 3VD3A 3S97C 3BWAB 4YFEA 4LCCB 4BELD 3BEVA 4NM4L 15C8L 3VXTA 5EN2B 4WI2A 3BH8B 1CLZL 4CNIB 4LQFL 1C1EL 3NFNB 4AIZB 3A0OA 3CFJB 3EYQC 3LD8B 4C56D 1MQ8A 1F11A 1HXMA 5JQ6L 5C2UB 3IVKA 2Z8RA 3UDWC 3FB7A 5C0GA 2VUOA 3VWKD 5C2BH 1YNLH 1G1CA 2DM7A 4FP8H 1FL5A 2R29L 1GGCL 4U4BA 4K94H 1VA9A 6FABL 1BQLH 3C08L 2QQKH 5FUOL 3FQRB 4XMLL 4ZOCA 5ALBL 3QIUD 3JVGA 3T0EE 4JY5H 4TNWF 4Z76B 1QFWI 4Q6IC 4QRPE 2NY5L 2O61A 4U6VH 2ZPKH 4HLZH 3SKMA 1WAAE 3QDGB 2MJWA 3WFZA 1OSPH 1YJDC 4YLQT 4X6BA 1MI5A 4NN7C 1U2CA 3MRIA 1KGCE 1P53A 2OL3H 3N1GC 5CCKL 2E8ZA 4XGZB 4M1DH 4PRIE 1K85A 1T6VN 3QIBA 3P9LB 2UVFA 2A83B 3B5HA 4HS8L 4NQEE 3X12A 2GK0B 5IFAH 2Z31C 2WV3A 5CGTA 4PLJC 2FSEA 5EUKB 1CE1H 1HYSD 4BH7B 3DV6A 5L8LB 4Y5XA 2YN3A 1NAML 4L4JA 3BWUC 3EFFA 5D7JC 4MD0A 4BM7A 4Y2DA 3CCHB 4XP9H 4L4VB 1QA9A 2R8SL 3NA4A 4NUGL 3SKNB 4JFDE 1ZHNA 1U8QB 3RJQB 1W0WA 1DFBH 1T1ZA 5EC2B 1SYVA 1WAAF 4EQ3A 1S7WA 1ACYH 4OF0A 3V4UH 4PGZA 5DJ6A 4HUVA 1MPAL 1NCNA 2CJUL 4FABH 2D31A 5C3TA 3SCMC 3DX9B 3MCKA 2GY5A 1NSNH 5JXAL 1F3JA 3F58H 3HA0A 3N1QC 2XI9A 3LEYL 4OV5A 3HAEG 3BKYH 3HI6H 1OAUL 3EO1B 2C3VA 1JE6A 1YDPA 3SY0B 1C08A 4LVOC 3KYOA 2VDRH 5F1KC 1MI5D 3RWHA 3QNZB 3S6CA 2EDNA 3NIGE 4LCUA 2ITDB 4WFED 4DEPC 1F4WH 2VH5H 4HS6A 1T0PB 5DJDA 4M02A 1OHQA 1DN0A 1VEPA 3HN3A 1HZHL 1Q94B 4KRMB 4LDOB 4PJCB 3UTOA 3VXSA 2Q6WA 4WTXA 4GAGL 4ZAKA 4FQLL 3EJJX 4W6WB 3UTPE 3D0VB 2BC4B 1E4XL 5ID1A 1RFDL 4LFHG 3E6HB 4Y2DD 3DOSA 5T3XH 3BEWB 1LEKB 4DKEL 4PRNA 4TVSa 1JK8A 4K8RH 3R0MA 5D2LB 4YR6B 4W70A 1NL0L 3THML 3HI5L 5FDYA 5LXGH 5F8QC 4OFKA 1HK6A 2Z8VC 3HAEB 4KHXH 3PWPE 4CL7A 1RUAL 1T22B 4IRJA 4PB9H 1YUHB 4JM4L 4WFFE 3FL7A 3GHEL 4OF5A 12E8L 3RKPA 2YSSB 5B8CA 3UDWA 1VFAB 3MBXL 3FFCB 3P77A 1FGNH 4H0HB 4OGAC 4QTIL 1P7KB 1NGQL 3UJIH 5BOPA 5HDOA 2E7CA 2CDGA 3G6JE 5DEGA 5F6IC 1VKXB 2X09A 5HYSG 1KB5H 4TSAL 4F15C 1I7TB 2IC2A 4IRZL 2ID5A 2IANB 3TBSB 5E99L 1G9ML 4Q6IA 1MLBB 4MDIB 3Q5OA 4GW4B 1MCPL 1FYTA 3QAZC 5FUCE 5CZXC 1L9MA 2JCCB 1MWAA 3ZHLA 4AK1A 3NGBC 2P45B 3AMLA 4JPIB 2VABB 4BYHA 3HMWH 5I8CA 2R1WB 3IFOA 1NCCL 4MJID 1MIEH 3VXSD 4OAWA 4JRXE 1DLFL 3HS0B 3EJYC 1U8IB 2UVEA 3BH9B 3P0GB 4X4XA 2E6QA 2Z31A 2J88L 1CT8B 4QGTA 1I7RA 1YPZB 1D5IL 3UAJC 3QXDA 3L3JB 4JO2H 1TZIB 4ZNCD 5KS9B 4D0CA 4X7EC 2OJZL 2H3NB 3G6JF 4FFYL 4KVCH 4XAKE 3ZZ1A 1KJVB 1F00I 2HT2D 2NXYB 3VFSA 3BP4B 3HG1B 5IBLC 4LSDA 1FV1B 2YMXH 3ARFB 2YA2A 4DUWA 5HYSB 1GL4B 2CXKA 4MMZC 5C7XL 1SBSL 1I3GH 3WFEH 1LE5A 1ETZB 4MXQD 4Y4HC 3NTCL 4IRJD 5MENE 3EYQD 2ERJB 4XAWL 3QFJB 5GGRB 3S4SA 1CLOL 4HIJA 5HPOA 1CTNA 4P9HH 5ICXA 2P46B 1MHHA 3VMNA 3EO0B 5KVEL 1A7RH 1P1ZB 4K2UL 5EG6C 4LNRB 4G80B 3NABH 3V6ZB 4ONHB 4YDIL 1BLNA 2V7HB 2Q7YB 3VGFA 2HVJA 3RZCB 5JHLH 4AEFA 1B3JA 5E2UH 1UADC 2VLRD 2FLBT 4ODXA 1NMBL 2UZIH 3O3DA 4HUNB 4LLDB 4HIXH 4CBPA 5EIVA 4P3CL 1FYTD 3GMPB 3NN8A 2FJHB 1OP3H 5BV7C 1ZLUH 1J05B 5D2NC 2QEJA 1JL8A 4D9LL 3LB6C 2EEAA 1CL7L 1IZJA 1U36A 1I8KB 5DUMH 4GBXA 5AYUH 3QRFM 4FTVE 1S7SA 2XTJE 3IFPB 5HHQA 1IGFH 1QLRB 2YC1A 4EDXB 2BCKA 3PL6C 2B1HH 2NY3B 1JWSA 2Z31D 2XG4A 4H8WH 4BZ1L 5A16B 2X7LA 1FSKC 2NMSA 1XGPA 3ZKQD 2RFXA 5GGVL 3VCLB 4XXDA 4JN2B 5GGUB 5D96C 1RD6A 1T21B 3BPLB 4XC3H 4DGIH 4ODTL 4G6FD 3VFRA 5D7JD 2DLFL 3IFNH 3V7MA 3VWJB 4Y4KB 3RAJH 1BOYA 4KUZH 2FATL 1S7VB 5FFLA 2JIXB 3QO0B 4PJIE 5C0AB 2CD0A 5DSCB 5F9JA 3CX5K 4K3DH 3TPKA 1GC1H 1OGAE 2DQUL 3WLWC 3L5WB 4OZ4B 1PEWA 4LLQA 3MRLA 3ILPA 3VGGA 1DQML 5BVPH 5E08L 2CMRH 3SCMD 5EU5A 1U8HA 3LS5L 1B90A 3OJ2C 3TJEL 2Q76A 5I1LB 1KFAL 3DUUB 2W38A 5FECB 4JO1H 5CP3H 3PGFL 4NKIL 2CPCA 4MSWB 1A1OB 4F7CB 3EYVA 2D03L 2PW2A 3PV6B 1VSCA 1CS6A 2IH1B 5FYKD 1X6LA 3KPNA 4JGUA 2HKFH 1CBVL 3BE1H 2XN9E 4HKJA 3RWIB 1DBJH 2HFEB 4GBXD 4RCAA 1U8NB 1FE8H 2AJYL 2DM2A 2I9LA 4PJBE 4XCFL 2F15A 4PJIF 4APQB 3MOBL 4M7LT 3QULA 2NY7L 3SO5A 4NN6B 1U8KB 4G8GB 1MJ7L 5F9AC 3TT3H 4ESKA 5SX4I 3TV3L 4TUJA 4F3FB 2L7JA 3ARWA 5H8DA 4W68A 2ADJB 5FHBL 2ZSWB 3TNNA 4JPKH 5KN5A 3O3BA 4XCEB 3QEHB 1BAFL 1UWXK 4FQHA 1F58L 4OLZH 5E8NB 4MA3B 1WF5A 3CFKB 3QDJE 1U0QA 1PW3A 4X6DA 1IGCL 2G2RB 4NT6B 4ZSOB 4GH7B 1R3LA 1XIWC 1F4XH 1H8SA 1FO0A 1CDHA 2YEZA 2H32B 3SBWA 5H37H 5IHBA 2OTWB 4PJBF 5FGBC 3OG4B 3V6OE 5FF6A 2IAMC 4HT1L 1L0XA 4XNUL 1T7ZA 1XZ0B 5FHAH 3MLSL 1K6QL 1T2QH 4YHML 2G5BA 2A6IA 2OR9L 2VZTA 4HIHB 2ENYA 1EFXD 4G6JL 1DANU 1U58A 3QFDA 3QUZA 2FR4A 2O5XL 5DHXB 5D5ME 4D0DA 1Q72H 1FFPA 1NLBH 5CZXD 4QXGL 3SDYL 3O6FB 5JMOC 2B1AL 5DQ9A 5IGXH 3T4YB 2NX5D 3BT2H 5CUSL 3IT8D 1U9KA 5DEFA 1J1XH 3SDXE 3IKKA 4QKXB 1MAML 3EJYD 5CIPA 5DQJB 5FYKL 4O2CA 2DWEB 1P9MC 3KPQB 1K3IA 3SDDB 1UXWB 2DLTA 2BZDA 1UJ3A 1IE5A 5DMKA 4U0RB 4CRPA 2Z92B 1BZ7B 4NGHH 4O9HL 4JKWA 4RX4A 3QNXA 3QG7L 4LSRL 5F96H 1A6WL 2Q87A 3SO3B 4NCC2 5IBLD 1KJ3L 4P5TC 3LN5A 1KSRA 2EDWA 1H3UA 2YS4A 5JHDB 2YPLB 4Y4HD 4KUCF 3BXNB 1A1NA 5D5MF 3MR9A 1P4IH 4JG0L 3LKRA 4LPVA 3VXPB 1C12A 3WDHA 5BVJB 5T1DL 4GLRH 3WUZA 4JGMA 2BSED 4ZFGH 3VFMA 3BP5B 3E1F1 3QHFL 2F5AL 3MRBA 4JG1L 2O93L 2EDXA 3CFDB 2R69L 4HV8B 5F72S 1F3DJ 2OI9C 3DRTA 4DKDC 4NCC1 2DL9A 3IRZA 4S1RL 4HPOL 3JV6B 4OZGE 1Q9KB 5L2JB 3WJJA 4G3YH 1CFVH 3B9KC 4R0LB 1YYMH 2XKSA 32C2A 1BBJB 4LLVA 5LJYH 5IB3A 4X6EB 2XA8L 3EHBC 5HHVH 1HSBA 1ERNA 3E3QC 5HYJA 5E5UB 3QWOA 1FL6A 4TUKL 4NO3A 1JTTA 4Q9QL 3UBXI 3HRZA 1NFDA 4WHDA 3BSZL 3D0LA 3RNKA 1WUNT 1YNKL 4OCNC 5SX5H 1QBBA 3MNWB 4P49A 1MCQA 5EUOE 2DM3A 4ZPVB 1R3JA 4NIKB 1HILA 5DRNB 4RX4D 1Z6JT 2J8UB 4PTUB 1WFUA 3VFPA 4N1EA 1LVEA 4XNYH 3DXAA 4OZGF 1T04A 1YEKH 4D9RE 3BDXA 1U92A 3JV4B 3S96B 1CK0L 5MP6H 4BQ8A 2AABH 4IRSB 3GGWA 3FQWB 4HWZA 1I3UA 1IQWL 3HZVA 1BREA 1XIWA 4IIQA 4JFQB 2WNGA 1BHGA 4NOBA 1A9EB 1B4JH 3KWWB 3CH1A 5CINL 4XCYA 2HJFA 2H26B 4LRIA 1ZHLA 3EOAA 1BQHA 43C9A 2W0FB 3WXWL 3O2VH 2W0PA 2VE6B 1V3MA 5E8EA 2BMKA 2XA3A 4HQQL 5EUOF 4WUUD 1V7ML 3IS1X 3MLZH 5C0RL 3E6FB 3O4LB 4DGVH 3OKMB 4ZD3L 5CEZE 3V52H 5CJ8A 3QBTB 2YKLH 1CR9H 3MA7A 2C7UB 2EIEA 3EOBB 4UT7L 4KMTL 2GT9B 1KCVH 1UEYA 4JM2B 4LAQH 4P2CG 2GKIA 3V5HA 2BY0A 1CXIA 1SYSA 5B3NA 1MHCB 5ANMB 3PNWA 2H9GB 1NJ9A 3UBXB 3MRGA 1JGUH 4NZRH 4EJ1C 4RNRA 4QHNB 2F19H 1JNLL 3O9WA 5IHZB 5DD5L 1W8NA 3WO4B 1DBKL 3KR3H 2M2DA 3G9AB 3RWEB 4P5TA 1WBXB 5F3HB 4FFWC 4WJ5B 5CD3A 2H41A 1XIWD 4G5ZH 3OKNA 4MJ6A 5C0CB 3LZFL 4PRHE 2IAMD 1EPFA 4KAQH 1H15A 2C9AA 4PB0H 5I1JL 4OJFH 1L4IA 3SHSA 3LPWA 3MBEC 2VR9A 1P4BH 3KJ6L 1G0XA 3BPCB 4OLXL 1NBYB 1LO4H 4UT9H 1J7VR 3DROA 1FH5L 4UV4L 1PKQE 2F58H 4KI5C 1LD9B 2FWOA 4L9LB 3Q6GH 3B9KA 3FB5A 4QYOB 3LEXB 4D2NA 1MJJB 2GUOB 4XPBH 3PWJB 4JB9L 3KPRE 1XF5B 5CWSA 1DBML 3MRPB 4JDTH 5INDB 2VDLH 4D9QD 4DKFH 4FFVC 5IM7B 4MS8C 2GJ6B 1ADQA 5J6HA 2VXTL 4PJFB 4YHKH 1CFQA 2WQ8A 3OAYK 2AQ3A 3MV8B 5MEPB 3O2DA 4HLJA 4OCYL 1WSST 2CXGA 5C08E 5J9PA 4X80H 2R9HD 5ERWB 1DE4B 2HA1A 2FH8A 1CLYH 2JB5L 1V3LA 4N8VA 5FDWB 1AGBA 1LO0L 3VGAB 5C09E 2AJZA 4P5TD 1F8TH 1RJYB 2P8MA 1T03H 4NQDE 4NBXB 4K9EH 4L8DA 2CO6B 4YXHL 3TJHC 1UKTA 4OTXL 1QFWH 3GI9L 1DTUA 5DJCB 3SDCC 3QUKA 5BXFA 4FNLH 3VGBA 1BX2A 3C5JA 4K23H 5EZOL 4DVBA 2GYSA 2CUMA 2PTVA 4L9DA 4YAQA 3X14B 1FZJA 3NFPA 1ZANL 4LLUB 5GRJH 1ZA3B 3S34H 1OL0A 3VRJB 1WBYA 1PVHA 3B9KD 4ODWB 2B4CL 4FQXA 1WV7T 1JGLH 1NGWA 5GS2H 3EHBD 4R97C 4MJ2A 3HUJB 3DX7B 3Q48A 5HVGB 4IHOA 3QXAA 3FT4A 3BN3B 1CFTA 5JW4M 1NAMB 5HHXH 4IBLT 4BZ2H 4QF1B 4YBLC 5I76A 4YUEL 2A9ML 1JGVH 1G7QB 1AO7A 1RPQA 4EI5B 3HI1B 1OWRM 2AQ1A 3ZKXC 1DLHA 4U7MA 3RTQC 8CGTA 4PGDA 1BF2A 4Z95H 1AI1H 2VR4A 3WL9A 5JR1L 4OZIB 2APXA 2QR0B 3RA7L 5GZOC 1WWWX 1RUPL 3RWDA 5JIKA 3MNZA 4LSVL 2GW5A 2DKUA 2J5LB 2QSVA 4LPYA 3WNOA 5FB8A 3FT2B 2QKIA 4LCYB 4QTHA 5I19H 2CIKB 1MREH 3V6BR 1KUMA 2VDML 5F89B 3M45A 4Y0GA 5EOQL 1YNTB 4L3EB 1FVEA 1YMHA 4K7PX 5BS0A 3W5MA 3EKCA 3CLEH 3DX6B 3B2VH 1J18A 4WDIB 3VWKB 3EJZC 4LBEB 4YNYA 1AC6A 4KRPB 3KAAA 1YEEL 3WSQH 1JF6A 4PY8J 5IF0B 1H8NA 1DQTA 4FQXD 5FKPB 3TZVC 3F7PC 4B5EA 2HRPL 4AG4L 4ZUSA 2DIJA 1RZ7L 4F57H 1QNZL 1UYWH 3LN4B 4NO5B 2A6JB 1T66C 2LVCA 3GIZH 5CGMA 2EECA 1CLCA 4PJ9C 1CQYA 4OF3A 3O8XC 4C59B 3C6SA 3L9RB 4LU5H 4ENEC 3DECA 1AO7D 1LP9E 3BPNB 2J12B 3QQ3B 5FYJD 4N0YL 2ICCA 4AENA 3BZDA 4N9GB 5E1HB 4XNZC 2CDEA 2WBJA 1GZPA 3RIAK 1W72H 4N0CC 2AXHA 3ZYIA 1UZ8A 1JMZA 2FHBA 2ADFH 3AB0C 5E5MB 3ECBA 1TCRB 5I75B 2CDFA 1IL1B 4AEEA 4L4TE 2DOCA 2VIRB 3MCLL 4FFWD 2IPUG 4NZJA 3HNSH 3RL2B 2OP4L 4NC0B 3U9PH 4C54A 1KLFA 1R3IL 1B0WA 1AIFA 3BX7C 4H25A 4JDZA 1EEQA 3BUYA 1TIUA 5BS0D 1JPSL 4FQQA 2G9HA 3MODL 4NDMB 5C0GB 1G7LA 3OR7A 3P4MB 3HZYB 2IFGA 2ICEA 5F7YC 3ARXA 1LP9F 3BO8A 2G75B 3KYMA 4IOFC 4G9DA 4FMFA 3BKJL 4KK8C 4AMKL 5GIRA 2GIYA 3FO2B 3RPKA 5DURB 4H1LG 4KI5D 5T3ZE 5SWSB 2UYLB 3MLXL 3HNVL 3GKWL 3HFMH 4BSJA 4YHPA 3MLVH 5FO8A 5DRXA 4RAVB 1D9KA 1QRNA 4FFVD 5I74C 4PGEB 5DK0A 1EZVX 2OR8A 3U30B 2V2XB 2JK5B 1KEML 4LRNH 2AKRB 4MS8D 3UPRA 4OFYA 4P46C 1PLGL 3W0WA 1YECH 1PSKL 4HKBA 4ZO8A 3X12B 2WBJD 1S78D 4U6XA 3TC9A 4F33B 5D7KD 3RTQA 2EC9T 3P73A 4EQ2A 4A6YH 4ELME 5I0ZA 5B21A 4E41E 3DV6B 5TFSL 4ODUB 5MEOB 1X6NA 2Y36H 4PP2B 3BGFB 3BISA 1HINH 1M7DA 1BQSA 3BD3A 4Y2DB 4ODVH 5ISZA 3I6LE 2NZ9C 1OB1A 1K2DA 3MV01 5E9DA 2XY1A 4Q74A 4H1LB 3KPLA 3U0WL 1UA6L 5DYOA 3UO1L 1JJUA 1OD7A 4C56E 1EJOL 1N4XH 1QVOB 2HT4C 4XMPH 3S37X 3V5DB 3DNKA 5ALCH 3TJHD 3PQYA 3HHRB 3SDCD 5GRZA 1E0OB 4HUVB 4XXCC 3HE7C 3GNMH 4HH9A 4BJLA 2D31B 3GMNB 2NW3B 2P5EA 3EBAA 3MCKB 4O5LH 3RRQA 1G7HB 4LK4A 4M8QA 4OD1H 3LKNA 4PJHA 4M9PA 3SE8H 5GRYA 1RULL 3ME0A 2B2XL 5BZWA 4ELMF 5EU4B 2QHRL 1MCJA 4NRXB 3HPJB 3U1SL 2ED7A 5IB2A 1NFIB 1D9KD 4XMKL 3KYOB 1QRND 4OFDA 4P99A 4MD5B 4YBQC 5EFIA 4PJ9A 5KSVA 1LWRA 2I24N 4U1IA 4UDUA 1HSAB 4GXVL 2AJXL 5DT1H 2P8LA 1CFNA 5DJDB 3U36B 2Q8BH 4NNPH 1DN0B 1KEGH 4MQXD 3OAZH 5E6IA 4WU5B 4MJIB 3G08A 3RTQD 3BVNA 4RQQA 3S88H 4OLWL 2APFA 2ZZUT 1RAMA 1QFWM 3VXUA 2CKBH 4KKAC 3D9AH 4R4FH 4AZ8A 5M94B 3UYRH 3UJJL 1CFBA 5A2KH 4ZFOA 5ISZD 1A8JH 5E9DD 3TIEA 1T4KA 4PRNB 3TBVA 1GPOL 1UEMA 3A6OA 4G9FB 4UILH 3WLBA 3DI3B 4P2QB 5EOCH 3W82A 4NWUL 4QY8A 5FM5M 1H8OA 2BNRA 2BVOA 3MRJB 4EDWL 4J3WA 4JFHD 5GJTH 1VCAA 5IJKA 2E7HA 5FUZH 4LGRB 3EJZD 3LQZA 3QCUH 1HQ4B 4F9LC 4QRUA 4PRPA 5HHOA 3TZVD 2MQ0A 3PDOB 4NCDA 4MAUH 2AK4D 3ZKMD 2N7AA 5SX4H 3D6GA 2XNAA 3GDBA 1ZSDA 5IHUH 2VLRB 4XPFH 3FAWA 4NO0D 1MI5E 3QH3B 3BZEB 3VI4E 3F5WA 5DWUH 4PJ8C 3E0GA 4PJ9D 3DGGB 1U93A 1UGNA 1EEYB 3KPMA 1U3HC 4HWBH 4NN7B 1NDMB 4ENED 4I18C 2QSQA 4HUUB 5E2TL 4MX7B 5E6ID 5JW3L 1RIHH 4P46A 4XRCB 3GB7A 2VLKE 3EIFA 3VXUD 4WGWB 4MB5A 5J11C 4QOKA 1T2XA 2Z31B 3GBNH 5T5FH 4TTDC 2I60L 4N0CD 4K3EH 4XNQB 1ZTXH 3IXAA 5L7XH 4WCYL 5ADPL 3GMQB 3U6RA 2IPTH 4G6FB 4KV5E 5D7JB 1GAFH 3FO0L 1QBLH 2P24B 3ZDYE 5JW4Q 1U41A 4IDJL 4F7PA 4MLIA 1LE5B 1V8HA 3MOAL 1HH9A 2BNRD 3OB0K 3VI4F 2DTMH 3MJGX 4HUWA 4XX1G 1U8PB 3I75B 2AERT 2YPKA 3G6AA 4Z18A 3L3GB 1XH3A 5T33H 3HR6A 3SE9H 1NCWL 3G6DL 4HW6A 3I6GB 1UG9A 3HE7A 1YN6B 3L3HA 5C86A 3SCMB 4KK8D 4PRPD 3PDGA 4PG2A 1M6OB 3MV7B 5GXBB 3D25B 1CXKA 2DQIL 5A3IC 2VWEC 5IJVB 3STZB 1IAIL 3QZWG 1BGXL 2Y06H 4KV5F 4PJAB 2FIKA 4LVOB 5GGTL 3ZDYF 4EXPX 1FNGA 3GBLA 2I25N 4CVUA 4YQXH 3VXSE 4TVPH 4XVSL 1UM5H 4PBXA 4P46D 1RZ8A 5HHQB 4DEPB 3U7AA 1MFBL 1RIVL 3OJVC 1JYXA 1GJIA 1D5ZB 4GKSB 2BVPA 4QOKD 4LASL 3MACL 1EERB 1C5CL 1XGPB 2MMXA 3DVIA 4OCRL 2RFXB 4JZJA 3BPOC 4LGPB 3ULUC 4XXDB 4JQVC 2VDKL 4L5FL 4G8FB 2DWDB 2P1YA 2NZ9D 4OZHB 3MROB 2BOBB 3DX8A 4R90H 2HT4D 5F7EL 1G84A 4J8RA 4MA8L 5IB4A 3MYZA 4XPTH 3QZWB 2AEWA 3BYYA 2DD8L 5DDHA 3VMPA 3HE7D 4R7DA 2PO6B 3B6SB 3RL1B 1JHLL 3H2WA 3WIHA 1CIDA 1QBMH 1NAKL 4XBEL 5JDSB 1R0AL 5F7WC 5F6IB 3VXNA 5KTEH 1FYTE 3JUZA 4JO3L 4F15B 4HHAB 4WHYG 3KPNB 2PNDA 2IPUK 4TRPH 4ZUUA 4OGXL 1I3RA 3ZTJG 1EFXB 3TPUA 4BSWA 3QAZB 2MPAH 4YBQD 4NBZB 2ZKHH 1N6UA 1HHJB 4MAYC 3RFZC 3HB3D 4KDTC 3NGBB 4MHHG 1LILA 5IVXF 5BO1H 4Q9BA 2IPKA 5LGHL 1YEFH 2NX5B 2V2WB 4PGJA 1DSFL 1SEQL 4EUPH 1G6RA 3FMGH 1RUMH 4OB5L 1R24B 2YD8A 3L3IA 5EIIB 4KKAD 5CZVH 3UXFA 4NKDA 2ZOLA 5TQ0H 1IBGL 1MNUH 1KN4L 1QFUL 1BVZA 1TZGL 4FA8A 3FRUA 5KW9H 4GKNB 2EO9A 2BSRA 4X5WA 4RBPK 3QEQB 5F9WC 1ZXQA 2E9JA 3GSUB 4PJ7B 4TN9A 5DJ8A 1G1YA 4X6DB 2R2HA 5FOJA 5IV2A 4MXWH 3NAAH 1T1YB 3Q6FB 4ETYA 3MRQB 4Y4HB 1FO0B 1DVFC 3JWOC 2YZ8A 4WUKL 1N5AA 4DUVA 1EMTL 4ZS7L 5E94A 4UT6L 4WW2F 5DD6A 3LHPH 3FQXA 1KELL 3C2SA 4LARL 3OKKB 1TCMA 3O11A 5F3BA 3IU3A 3ARVA 5DVNA 5TE4H 1U58B 3KYNA 1JUFA 3ROLA 3L95A 3KPOA 4YK4C 4D0DB 4PJ8D 5HXMA 4HMCA 1MRCL 5D2NB 5C0FB 3UTTA 2R2EA 1DL7H 4NJ9L 4OIIH 3U2SA 4R26L 3STBA 5IMOB 1GYAA 4K7PH 1EXUB 2E8YA 2AV1A 4NOFA 3PL6B 1FZKB 4OQTL 4M6OL 3BP7B 4ODHL 4TTDD 4UQ3B 2VZ3A 1A6VL 1FSKB 1RJZB 1LK3H 3I50L 4JDVA 2GITA 1QFHA 4DN3H 4Q9RL 3L7FB 2VDOL 4JLRB 2X9WA 4G7VL 4GS7C 4PUBL 5D96B 1Y6MR 1UCBL 2D7MA 4PLKC 1T1WB 3QNXB 1KV3A 3G5VB 1P7HL 5BW7A 4HUXB 1IFHH 1F97A 3MRHA 3UPCA 3A67L 4PREB 2DQHL 3CMOL 5T3ZH 3VFOB 1AJ7L 5C0JA 1IKNC 2VTFA 3B2UC 3PABA 5IMKA 1C12B 5C0BB 2FBOJ 1FLTX 2BHZA 2JTDA 5AEAA 4U1HA 1BD2B 3SQOH 5BJTA 5EC1A 4PRDB 3MRFA 2XV6B 5TDNA 5CP7A 2DQFB 4DCQA 3WE6A 4F2MB 4Z5RA 4XP4H 3T2QA 4ELKB 3O0RL 1RSFA 4OLVH 4CN6A 5A3ID 1N59B 4WUUB 1U8MA 2SEBA 4FFZH 4LLVB 1V5JA 2FD6H 2A6DA 3OKDA 5K9OB 1X5LA 3G5YA 3UTTD 1HSBB 3C6LA 4TULH 5D2LE 2GAZA 1MCOH 3OJMB 1FL6B 1RHHB 5F7UA 4OV6F 5GGRY 4MAYA 4KDTA 5IB1A 2D7PA 1RVFH 3S36X 3ULSB 3W39B 1S5IL 2PYEA 1UH3A 2R0LL 4GMTH 4S10A 1N64L 3ULUD 3MRDA 3R06B 1R3JB 3FFCE 3VXQA 5E8OA 3MSPA 4O00A 4CADA 1P2CB 3D3VD 5DJ0A 4P23C 5JW5A 3BKCL 3SDAC 2B5IC 1T7VA 4Y19D 3VFPB 1TZHA 1A6UL 1A7QL 4IMKC 2FYYB 4RGOH 4XB8A 4YGVB 5TH2A 5FA4B 1SVCP 3WIFB 4LHQB 2IANE 4X8JB 2FDBP 5IFHH 4HEME 4X4YA 3JBG7 3QISA 1AR1D 2CLZA 5ELIA 4U1SA 5DK3A 3FQTB 3OPZH 3PGDB 3ULVE 2EIZB 5D2LF 1A5FL 1I7ZB 3TBWA 3ET9F 3OX8B 3CH1B 3MJ9A 4Z7VA 1ZHLB 3EOAB 1BQHB 2BNQB 1XR9A 2IAMB 2ZCKL 3MUGB 5E0QA 5GRUL 5E95B 1FRGH 3K3QA 1KJ2L 3QPXL 3QEGH 2PYFA 1C5DA 1YPZE 3CSYA 1A4KA 1GOGA 1KCRH 2VL5B 2CGRH 2DYPA 5I6XB 5HGBA 2WIIA 3A6BH 4FZ8H 2HJLA 3U7WH 5IHLB 1QSED 3PJSB 1JZ6A 3S37H 5C0DA 1RZGB 4FRWA 3OSKA 4KTEH 1IEAA 4MAYD 4ZYKB 4CJ0A 1XGUB 4JREC 1J5OH 1H3VA 3H9SA 1E28A 1JTOA 2PYED 3QFJE 1G9EA 1TJIH 4XI5D 5C2BL 3PWUB 1YNLL 3ULVF 2JCCF 1TPXC 2VRAA 3T1FB 4FP8L 4OLEA 5I73B 2JJTA 4K94L 1GHFH 3VXMA 3WS3A 1A3QA 1HQRA 2Y5EA 4RWYH 1ZLWH 3BD4A 1BQLL 4RFNC 4MWFA 4U2ZA 2MQCA 2QQKL 5GISH 4Q0XH 1ES0A 3CFEA 2BSTB 5B38G 4JY5L 2XRAH 4MNGB 1S8DA 5I1IH 2ATKB 1YPZF 4P5TB 4U6VL 2ZPKL 5EO1B 4DGYH 3SGKA 4GXUM 3LV3A 4OSUH 4PP1C 1OSPL 5ICZA 3CLFH 2AS5M 1X5YA 4MJ6B 3BAEH 2OL3L 4M1DL 1NGZA 1H15B 2VZSA 4JFOA 3IYLW 1INQA 5IFAL 5I15H 4URTB 1IKFH 5C07B 2OI9B 1CE1L 5IK3B 3BIBX 1HDMA 1EBAA 3EYUH 5TGBB 1JYVA 5HYJE 3FB5B 4XP9L 5SWZA 4HK0A 4IS6B 1NFDE 2VSCA 5B38B 1XCQA 2Z93A 2VQ1A 3H9SD 1FNLA 4HZAA 1DFBL 5C0AE 4OFIA 2DLHA 4X9FA 2QBWA 1ACYL 3V4UL 1FJ1A 2NLJB 3PE9A 2GTZB 4OD2A 3RKDC 2LABA 1TTGA 3CUPA 1CFQB 4FABL 3AMKA 2EIBA 5C3LD 3EYSH 3C5SA 1PG7X 2EH8H 1NSNL 2AAVA 3DXAE 3F58L 4X0KB 4KRLB 4PLKD 2XXMB 4PR5B 3QDMA 4P23A 3SDAA 5E6YA 4Z0XB 1JRHI 3JZ7A 3VE0A 5E56A 5DMGC 3BKYL 3HI6L 4IMKA 1NGYA 4G7YH 2E6JA 2ZNXA 3UX9B 3GIVA 1S9WA 5LCVH 3CMGA 3QEUA 2D7TH 2VDRL 1ZT4B 2ZSVB 2DQEH 4HKXB 3B2UD 1FCCA 3WKMH 4MCZB 2QHLA 1NFDF 1F4WL 2VH5L 4P5MB 3JWNC 3PG2A 3OB8A 4OCXH 1L9NA 3IJYA 1QHOA 1BX2B 4NN5B 1A2YA 4AQ1B 3AAZB 5KG9A 1BECA 3T0EC 4QHMA 3GBMH 3PWNB 1KENH 4PJEB 4JFPA 5HTSA 1BPVA 3DSNA 4O58H 5T3XL 2FNBA 1RJLA 3NPSB 4L8BA 3UTSA 2R2BB 4GG8B 2IH3B 4K8RL 1JF1B 4Y16C 2IMMA 3TA3C 2DTSA 5F1SA 3CAFA 5LXGL 2X4SA 4NO2A 4D9QE 3F7VA 4KHXL 4IHOB 3QXAB 3FT4B 5K9QG 3MLTB 9CGTA 2OTUA 5JPNA 4PB9L 4F7EA 4JZOA 2XWBA 1T7WA 5GZND 1FGNL 4UNUA 3M1BB 4WY7H 3UJIL 2F54B 2KZWA 2MHAA 3QDMD 4P23D 4XH2B 3SDAD 4YE4H 4XZUB 3TEUA 1KB5L 3MNVB 4IOSD 4LVHB 3VD5A 1BIIB 2F74A 4QCIA 5EU3B 3MQIA 4ZXBC 1FIGH 1TQCC 5IEKA 4JY4B 1MWAH 5A2JH 4PJGE 1YJDH 5FK9A 1RMFH 3QUMA 1FVEB 1XF2A 5IBUG 1OTTC 3DI2B 3HMWL 3RVTC 3T3PE 3G5ZB 1D5BA 5KSBB 2RCSH 1R5IB 4FXGA 3S5LG 1I9IH 3MBEB 4UAOC 4JO2L 4DJMA 4Z7UA 4XBGA 4KVCL 2A74B 1J8KA 5MEQA 2YMXL 2HLAB 3WFEL 1I3GL 3VG9C 4L29B 5EA0H 2GSIB 4Z7NE 5J13C 4TUOA 2YPLE 4M5ZH 4P9HL 4GRLB 4PJGF 4BSVA 4LMQE 2PTTB 4GSDH 4TPRH 4ONOA 4KJYA 1A7RL 2CDEB 1SMOA 5IBUB 1JTPA 5FO7A 3NABL 3FCTA 1N0XH 2HKHH 1OP5K 5AZ2H 3X17A 4WFGD 2YWYA 3AM8C 5JHLL 3IGAA 5E2UL 4K3JH 3S5LB 1TVHA 2UZIL 4M48H 5GS1C 1JZ2A 2R1XA 4HIXL 1N6VA 5GHWL 4JHBA 3S7GA 5I1GH 1Z5LB 1KLUA 3DETC 1MAJA 1OAZH 2YD5A 1UENA 2EKSA 5DUML 5AYUL 3D39D 2AXFB 5EZJB 3BW9B 1QLFA 4Z7NF 1I1FB 1CD1B 1IGFL 3SDCB 2B1HL 5IVOA 3PXHA 4H8WL 3ARGC 3WDJA 1UWXH 1GOFA 5GIRB 3T0EA 2VLJB 4XC3L 1VGEH 4DGIL 5I66A 2LU3A 5K9KA 2BRRH 3IFNL 1ZT1B 2E7MA 5FUCC 1SMAA 2F53A 4GW1B 2PCPA 3RAJL 4KUZL 4XVUD 2YXMA 2A77H 2NNAA 1MCNA 3ZO0A 4CGTA 5J6GA 4YHPB 4Y16A 4R97B 3TA3A 5FO8B 2NY2D 4PRIA 4K3DL 2ZOKA 3INUH 2XPGB 1AO7E 1GC1L 4QRQA 4ZTPH 1MFNA 4XPAH 2HG5A 5EU6A 5KANI 3HRPA 3T4AB 5BVPL 5TJWK 2CMRL 4YBLB 4U6XB 2H2SC 3PWLB 1Q9WA 3ZKXB 1YEDA 2XY2A 3OHXA 4LHUD 4JO1L 5K93A 4OZFG 1XCTB 2VDNH 3BGMB 1XMWA 4LKXB 1PZ5B 2D0GA 5DMGD 1W8OA 3M17A 3K46A 1K2DB 1WZKA 4JFDA 2HKFL 5JA8B 4WI7A 3BE1L 3DO7B 1DBJL 5AG9A 1DEDA 1FE8L 5BS0E 4YHNA 3O81A 5KVGH 1AQDA 3BN9C 3J7HA 4HD9A 3MV9B 3RIAF 5DJAB 5DC0A 1Y6KR 1BJ1H 2H8PB 4NQUA 4Y5YA 1S5HB 1KIRB 3TT3L 1MFEH 3T0ED 4LSTH 2JB6A 4QRPD 3LKNB 3MRCA 1ODAA 3QUXA 4JPKL 1CN4A 2F53D 1QQDA 3AREA 3TZVB 4OZFB 2DQJH 4OLZL 2QJDA 5E00B 2AK4B 1S7XB 4Y16D 3TA3D 1L6XA 4N5ED 1KGCD 3GRWA 5IB2B 1BIHA 2XTJC 4NO0B 4PRID 4ZPTB 3L3DB 4I0KA 3MRRB 4NQED 2CQVA 4PJ9B 1F4XL 4LIQH 3BQUC 4U1IB 1NUGA 2OK0H 1FO0H 3O8XB 3T0XA 4LCWA 1KLGB 4CU6A 4H26A 4MCYB 3H7BA 1RZKH 5FHAL 3VXUB 5DJZA 4RFEA 5I8EB 1T2QL 5JW4R 3ROOB 5D9SA 3AM8A 3TVMB 4JFDD 1JZ7A 3AB0B 3GSVB 3TBVB 5EOCJ 4ZXBD 5GS1A 1DUYA 2NYYC 1X9QA 1Q72L 1NLBL 2XWTB 3D69B 3K4AA 4WENB 5BV7H 1LO5A 5I1DA 2B0SH 2VL4A 4YFLI 3REWA 1HI6B 5IGXL 1QSFB 3EDJA 2BNRB 1CVSC 1RZJC 2WIMA 1OTTD 3BT2L 1M05B 1X7QB 5FYJU 5D1ZC 2YZ1A 1J1XL 5ICYB 3AY4A 5DHYB 5CIPH 3G6JA 4E9LA 4BUGA 3MO1A 3QUXD 3QR2A 1N26A 3MGTA 3IDIB 4PJFE 5HI5C 5IP4A 4QEGA 3L5JA 2EEDA 3ARED 1NUNB 3FT3A 2WINA 4NGHL 3W9DB 4N68A 2WUBH 2Z8SA 4HPYH 5F96L 3R1GH 1QO3A 2VN7A 3TBYB 3RVWC 1I8MB 2FEEL 5F6HI 3W0WE 4M7ZC 3U0PB 1XR8B 2X4OB 4IOIA 1P4IL 3KPMB 4JRXA 5I74B 1I3VA 3PGCA 2VKXA 3ZSSA 5D7LB 3K2MC 4NUJB 3UTPD 4ZFGL 1FDLH 3L1OL 4L3AA 4P9ML 4POZD 5J57B 2GSGA 4RAUB 2DQCL 3GSRA 1YN7B 3AS2A 1RU9H 5DC9B 4AH2A 4JFFB 2ILLA 4U7SA 4LL9A 1OCWH 1PAMA 5E9DE 4PJFF 4G3YL 1OW0C 1CFVL 2OR7A 4BKLA 5HY9A 3RUGA 1YYML 2CIIA 4C4KO 5J12B 4N8CH 2HFGH 1LE9A 4MDJA 3PQYE 3KNBB 3DETD 3NH7H 4WFFD 4ZMAT 3IJHB 5HHVL 3IXTB 1T20A 1HH9B 1U6AH 3V6OC 1EHLH 2X4PA 4QNPF 1OF2B 3T1WA 2P5EE 4MQSB 4N90D 1UCTA 3GMRB 4PJHE 1Q0YH 3IDXH 2R0WH 1WFOA 1MCKA 2LTQC 3L3HB 5T1KD 3F65A 2ZG3A 4WTZA 3GKZA 5C6PB 1XF3A 4QWWC 2H45A 3OKEB 1AKJD 1A0QH 4WU7A 4XCNB 4HS3A 3TIDA 3I6KA 3U4AA 1A1MB 1F6AA 4I3SH 3WKNA 4XNYL 2M8XA 1YEKL 3RWGA 4YPGA 3NIFE 4FTVA 5MP6L 3CPLA 2AABL 4JRXD 5IW1A 2HJKA 4N0UB 3MGAA 4V1DB 5HGAB 1A9BA 4HJGB 5KSUB 4I8DA 4BA8A 2Z9TA 3IDJB 1B4JL 3IU4H 3VDBA 4NC1E 1OSZA 2H2SD 1ZT7B 5GQBA 3O2VL 5EZLB 4RMSA 4XAKD 4D3CH 4PJXB 4PJHF 1TDQA 3WN5C 3TH3T 2C1PB 5EBWA 1Q9OA 4PJDB 3K4ZA 1OP9A 3MLZL 4DGVL 3CVIH 1S7RA 1KIQB 4ETQA 3V52L 2YKLL 2W9EH 4FQJH 3DMMB 5DVKA 1CR9L 4X6CB 3UYPA 4J8RB 3W5NA 1GGUA 3BN9D 1TVBB 2Q20A 2DF3A 5A40E 1KCVL 3QWRD 4U1LA 3TBTA 3NIFF 4LAQL 4Y8DC 1MEXH 3FOLA 1T1XB 3FB6A 1KB9J 2HTKC 1OM3H 4OGYH 4UZGA 4X98B 5D1ZA 4R7DB 3QNYA 4PRPE 3WS6C 4P4RB 4I9WE 5HHOE 5IEHB 1PG7H 2ITCB 3SEPA 2VXQH 1JGUL 5AAMA 2BSSB 4NZRL 4U1JB 2MNUA 2VXSH 2F19L 3VXNB 2R23A 5L2KB 3QJFB 4JFYA 3KR3L 5BQ7B 4FTVD 2B39A 2AK1H 2DQGH 2XTJD 4FQ1H 4NQCA 4PJBA 2IG2H 3Q5TA 2NY1B 4PJ8B 5H94B 3LCYA 3BQUD 4G5ZL 4NZTH 1MFCH 1ND0A 1P7QB 5DJ2A 1U3HB 4QOKE 3F7RA 1R3HB 4I18B 4Y4FA 2RQ8A 5D6CB 2VDPH 5I71C 5K59F 5AUMA 4KAQL 2W60A 1HH6B 3IFLH 3F12A 4XB7A 4PB0L 4O2EB 2MKWA 2PW1B 4OJFL 4UU9B 1IQDB 3L3IB 4Q2ZA 2FX9H 4RGNE 3D18B 1P4BL 4MNQA 1LO4L 4UT9L 2DMBA 5JA9A 2BSRB 5CMAB 2F58L 5EIQA 4KKCD 4MMXC 3Q6GL 4MQ7B 3VXOB 2NYYD 5E7FA 5DJXA 4UI2A 4NKOB 5IV2B 1QKZH 1QHPA 3W2DH 3HC3H 4ZNEA 2APVA 4MVBD 3SGJA 1G7IA 4JDTL 3V6OA 2VDLL 4J2XA 1KJ2B 5GGVY 4DKFL 5I9QC 5D1ZD 1DJSA 4HLZG 4OF8A 4GKZA 2M26A 3LKPA 1WZMA 4EXKA 1ADQH 4YHKL 3UJTH 3FQXB 3H42H 3O2DH 5HI5D 3MGOA 3V7AE 1AGCB 3ARRA 4X80L 4HDIA 2EYRA 4O4YH 2X4UA 3PP3K 4R4NC 4O51B 1CLYL 2GFBA 3MZTA 5HYIA 5DD0H 2H1PH 2J8HA 2QV2A 5F1NA 4NQCD 1IT9H 1JUFB 1F8TL 5EO0B 2DJSA 3RVWD 3R8QA 1T03L 2R2EB 1UC6A 3W81A 4PY7A 4K9EL 2FGZA 4JKLA 4AL8H 4WTWA 2D7NA 3ZKNC 4XWGH 4P2RB 1QFWL 5ITFA 1NUDA 3PWVA 2YD7A 5CJOH 25C8H 5DMIH 2VN4A 3L7EB 2Z4QA 3KYAA 4U1NB 4FNLL 5TQ2H 5ILTH 4K23L 2ADGA 4MNQD 4Y1AE 1MUJB 3RBSA 4H5SB 2XFXA 1A21A 5GRJL 3WN5A 2WWKT 3S34L 3D3VB 3GSNA 3SKOB 2OL3B 3I02B 5FA3A 3OGCB 4Y19B 4I48B 4EVNA 5L8JB 1JGLL 1UKSA 4EN3C 1QSVA 4JFEA 1NGXB 1T0NA 5HGDA 1OAXH 2VLLA 1QG3A 4W81A 2CK2A 4OUUA 1TLKA 1FNEA 3RGVB 5HHXL 4NM8H 4BZ2L 1KNOA 5BJTB 1JMXA 1M71B 1JGVL 4EI6B 2KQNA 4OZGA 2X4NB 5FYJH 1IC4H 4Z95L 1AI1L 4YDKH 5HVFB 4GRMA 4QWWD 4AEIH 3Q1SH 3K74B 1VFMA 4ZFZA 4B0MM 2HN7B 5SWQA 5IB5A 1UQSA 2AGJH 2FL5A 1FNFA 3O2WH 1T5XA 3RY6A 1NCBH 5D1QC 1EIBA 1FG2B 2XKNA 2A0LC 4RMQA 3BDYH 5I19L 1G0DA 3HZMA 4G8IA 1MREL 4KPHL 1I8IB 2DJ4A 4N0FA 1QSEB 3CDYA 4GMSH 1JRHH 4RRPA 1S9VA 3T0AA 4MAYB 4HX1A 2WAHA 5IB1B 4RMWA 4X7TA 1BOGA 2X89A 3BJLA 4G42B 3CLEL 4JKPH 1BBDH 2E9WA 3B2VL 5EZIH 3VFUB 4NKMA 1SY6A 5ID0A 3WSQL 3BRFA 4HIIA 2ESVE 5E8PB 1VDGA 5CHNA 5E4EC 1VPOH 5D1XA 4NQXB 4PS4H 4F7TB 5JORA 1K4DB 3FFDB 4F57L 1CG9A 1UYWL 3WUWA 1ZWIB 5MI0C 4M61A 4UV7H 3V0VB 3GIZL 4HXAH 4JQXA 1HHHA 2HVKB 4HC1A 5I17A 3GFUA 4U1SB 2HTKD 1DVFB 4LU5L 3D2UA 3TO4B 1A14H 3QCTH 4S1DC 5T1MB 3QO1B 4F8TA 1MRFH 2GI7A 3U46A 4I4WB 3TCXA 4ONGH 1W72L 5ADOH 1I9EA 2APWA 2D0FA 3V4PH 4UOJA 5GSRB 1ZVYA 2ADFL 5TE6L 2EYSA 4OCWH 3QIWA 2YRLA 4YK4B 1U8LA 4GG6E 3HNSL 3U9PL 2P5WB 2DAVA 4L8SC 3IDGB 3N06B 1CD0A 4LLYB 2ZG2A 1CGSH 2FCBA 3V8OA 1SJEA 2QQLH 3GSQA 3ISWA 3KLHC 5IR1B 1IC7H 1FAKT 1NCDH 2DMCA 1AY1H 2LU7A 3IDMA 5C0ND 2OZ4A 4S1SH 1NEZA 4PGCA 2EO1A 1G7PB 1ZHKA 3LPGA 4D9RD 4ZODA 1S9XB 4GS7B 4ZOBA 3IDYC 3MV7E 1I1AA 3MREA 5J1AA 3MRKB 5KVDH 2B7DT 2BOCA 3HFML 4YWGH 2A38A 3HCVB 5GSVA 5BMFL 2P47B 1ORSB 4YDJA 1IGTA 3MLVL 2HT3C 3QA3B 3FO1B 4MGXA 1N2RA 2NTFB 4IDLA 5I1AA 5F8RC 3D2UD 2FJFB 4HFWB 5I1KH 4GG6F 4LRNL 4LSSH 3SJVE 1YECL 1U8JB 1FORH 5C9KA 2OSLA 1PDKA 3WYRA 2H6PA 4YHIA 4A6YL 3IKCA 5C6TH 1U42A 4R4ND 1KC5H 5CEZD 2UWEB 5ALBH 4OIBA 1JHTA 2Y36L 5HSFA 4IM8A 5DK2B 2IADA 3KPRA 1FVDB 3QIWD 4OBSA 3TN0A 2OJEB 1HINL 2R0ZH 4ODVL 3KPTA 1FL3B 5JZ7C 2JJVA 1HNGA 2FZ3B 3ZMRA 1N4XL 4XMPL 2VQ1B 5ALCL 2PYEE 1LGVA 2VZOA 1FLRH 43CAB 4GJTB 2YBRA 1MVFA 1FN4B 2G60H 1KTLA 3GNML 3R4DA 4RIRB 2JE8A 1AP2A 2A2QT 2ICWA 3X11A 4O5LL 2C26A 1YEJH 1EAPA 4OD1L 1D6EA 1CICA 3C8DA 1IGJA 5C09A 1E27A 3SE8L 2AJ3B 3AROA 2OQJA 1LMKA 1GGTA 4G8EA 3SDAB 3VFWA 5IIEB 5F1IA 2B5IB 4Y5VA 4HUMB 2KKQA 5GS0C 5J3HC 2ADIA 3MRMB 3KHQA 3DRQA 5J1SC 3VFNB 3ZHKA 3JTSB 3CFBB 4Z7VE 4M3JA 2D7QA 2X05A 5JOFA 2VDQH 1HKFA 4OD3H 2Q8BL 4NNPL 1KEGL 3AS3A 1IGYB 3HE6A 4MB4A 4DZBA 1QR4A 4FQIH 3S88L 2C4FU 3VXRB 4QT5B 1CGTA 1VGKB 2CKBL 3D9AL 4QHMB 3OJDA 1W0VA 4R4FL 1FBIH 4OBRA 4JFPB 3UYRL 3KPRD 3TN0D 4RDQG 3S8WA 4DFHA 1XGRB 1K8IB 1CGWA 5JIIA 4CVZA 2VXUH 5FGCB 3RGHA 4C57C 2A0LD 1AGFA 4UILL 3QEQE 3H9SE 5DJYA 2NY6D 3UP1A 5CBAA 3KLDA 5EOCL 1WFTA 3OR6A 1SM3H 4KROD 3VFVA 4L8SA 2P4AB 3GJFA 4PJ5B 3DIFB 2NQCA 3OKLB 7FABH 1SEBA 5FYLD 1S7UA 4JREB 1AXTH 3IS0X 5C08D 1SJHB 1IM9A 3VXME 3QWQB 5GJTL 4U3XA 3O3AB 2XWBB 5FUZL 1DUZA 3Q2CA 3V0WH 1H0DB 5E2VH 3HLAA 3QCUL 5FM8A 2J8OA 1TPXB 4CW1B 1CICD 5C09D 5H37G 2RJMA 2MHAB 2Y7QB 1LO2H 4RFNB 2VOTA 3AXLA 5B39B 3AGVA 3LSOA 3C09C 1VFBB 1BM3H 4MAUL 2DIBA 2X4RA 4NQDD 3OXRB 3ZT5A 2Y4SA 3QUYA 4KKBC 5IHUL 2XOTA 4XPFL 4WO4B 2X4QB 3HI5H 4QRRB 4MZ3A 4HWEH 4WWID 5DWUL 4NNYA 2GCYA 5IW6A 1RZIA 4HWBL 5EB9A 2BVQB 3D39B 3RDTA 3WFHA 3K8LA 1E4KC 4S1DD 1RIHL 2MTPA 2OX5A 3LQMA 4HKZA 1AHWA 1VACB 3D87B 4GLRI 1RUKH 4OIAA 5LG1A 4GQPH 5FCUH 5T5FL 3GBNL 4R7NA 5I16B 5L0QB 4XNMA 2YA0A 4JHAH 4K3EL 3KPPA 5DLML 5SWZE 5CBEA 1KB5A 1ZS8B 1ZTXL 5L7XL 3NCCB 1QYGH 2R1YA 4H0IA 3V4VH 5FM4A 4UQ2A 3F6IA 4OKVA 1K8DA 1GAFL 1QBLL 2OXGA 5ESAB 3Q3GA 2YN5A 2XICA 2LV4A 3CXHJ 3I3BA 3V5KA 5CFHA 1LP9A 1IM9D 4QXTB 4NPYB 3KLHD 4J4PA 2DTML 1HYSC 4NHUA 4P3DB 4F7MB 3SE9L 5T33L 5JTWA 4NSKB 1C16A 2EDOA 3X13A 3MMEB 5C0BE 3WIIH 1CDYA 4KJYB 1GGYA 3AS1A 3RNQA 3STLA 1PG7W 5CS7A 3QDME 3O45B 3U0TA 5HHME 4LHUB 2EDRA 2Q8AH 1PX3A 3G5XA 3KLAB 4UNTA 3IJSB 3IGAB 2OMBA 2K1MA 3QUYD 1KT2A 2X2YA 2AQ2A 1EO5A 1X4ZA 5CLTA 2ED9A 2NR6C 1E6JH 2RR3A 1HCFX 1KPRB 4YIQB 1UB6B 1ZHBA 2Y06L 1WFNA 2HT3D 4X9HA 4KK9D 1K4CA 2EDJA 3DBXB 3P9MA 4JHWH 2BY2A 4P2OA 2EDHA 4YQXL 5L6YH 4TVPL 1UM5L 3DGCR 3C2AH 3PHQA 3JVGC 5EBMB 1FZOA 3ARZA 3VRLE 3CDGB 2W9DH 3M8OH 2VB5A 3FONB 4HZLA 2I9TB 3UTSE 3GMMA 3N1FC 3FOMA 3PV7A 5HJ3A 4QRPB 3G04A 2P43B 4KQ4H 5K9KB 5DRWB 1KIPB 4O02H 1BMGA 2KZ1B 2YD1A 5C8JB 3QIBC 5IMMA 4PG9A 1EVUA 5C0EA 5JZ7D 5J6GB 1U91B 4R90L 1JWMB 4GAJH 1L0YA 5HHPA 4M62H 1CWVA 4ZUVB 4NQEB 3DVNB 2BNUB 4WI6A 4Y5XC 5D72H 1NUFA 1J86A 2VO5A 3NOIA 3FQNA 4E41A 3WIHH 3TYFB 3OHXB 1BFSA 1QBML 2BNQE 5F7LB 4L8CB 1A4JB 3VRLF 3U4EA 1LEGB 1L7TH 1YMMA 5KTEL 2R4SH 5GS0D 4OCMC 1M1SA 3IF1B 5J3HD 4M03A 4JFDB 4TRPL 1U95B 4ZUWA 3GSOA 1BFOA 4ZXBB 4WNQA 4P2OD 2MPAL 1TQCB 2RBLA 4PTTA 4QXUH 4MLSA 2ZKHL 1BJ1J 1MFDH 3OXSA 3TF7C 1Z9LA 4I0PC 5BO1L 3BP6B 3F7QA 1YEFL 2EXWC 5AWNH 2IBBA 1XGTA 1KJMA 4UDTA 3ARUA 2IBZX 1E4KA 1T83A 4BH8A 3FMGL 1RUML 1G6RH 3QJHA 1G7MB 3FTGB 1MOEA 1B0GA 5CZVL 4Z7UE 5TQ0L 1MNUL 3O3EB 1MLCA 4R2GC 4U1GC 5C9JB 5KW9L 5EO9B 3CC5A 1KXVC 4X5XA 5IWLC 4HFUH 5T1LA 1YA5A 3ZTNH 5LGJB 1M7IA 1DN2A 5D8JH 4MXWL 3NAAL 4DW2H 3VG9B 4ZDHB 4MNGE 3S35X 4FQ2H 4ZAKC 2OTPA 1ZLUK 2XWJA 3QRGH 4Z78B 5J13B 5AYQA 4WHTA 2Q3ZA 1MVUA 1TNNA 4E41D 1X44A 3F8UB 4Q9CA 4P0DA 3MRNB 3LHPL 1H3PL 1CQKA 3H7BB 2HT2C 4R4BB 4E42A 4OM0H 3I6LD 5JNYB 4KU1A 1YMMD 4U33A 2X9XA 4MXQC 3L3OA 3TFKC 5D6DC 4IRJC 2OBGA 4Z7UF 5C07E 1LO3H 5I8OH 2CLRA 3DV4B 4KKBD 1I7UB 5TE4L 1AD0A 5B8CC 3MLYH 3EOTH 2DLGA 3PWPB 3ZT7A 1TFHA 2J1KA 5ENWB 3UTQB 1HEZA 1ZKAA 2EE9A 2Z35A 3BESR 1ZVSB 1DL7L 1T3FB 2V17H 3U4BH 4OIIL 5L88H 5CD5C 3SE4A 1J8HE 4K7PL 1DEEA 4DKAA 3CZFA 4KK5C 4ORGB 5D70H 4TSCH 3KXFA 5LAXA 2O5ZH 1I1CA 1EA9C 4LKCA 3ARGB 4LSUL 5T1KB 3BMWA 5DVLA 3RWJB 1LK3L 2F53E 4DN3L 1O7VA 3H9YA 3ZHDA 3ULUH 3DURB 3AVEA 4LCCC 1LNUB 5T1LD 1AKJB 4WEBH 1RK0A 4BQBA 1AE6L 2HWZH 4AM0A 1IFHL 4PV9A 1NC4A 1Y18A 5EU6E 4WW2C 2V9QA 3UTZB 1OWWA 4C83B 2NXZD 3V6FB 5T3ZL 3LD8C 4M93C 3LDBC 2OYPA 2IBGA 3CGTA 1KTRL 1KG0A 2VLKA 4U3HA 4G43B 5DUBA 3SQOL 3CDCA 3F7YB 2CH8A 4ZO7A 1GZQB 1T0MA 3BMVA 5F7KC 4OM1H 4J3XA 4DN4H 4XP4L 5DTFB 3C9NB 5F88A 1U8OA 3RX8A 5E7BA 3BI9X 1HHGA 4OLVL 4PPTA 4HGWB 3ARDB 3KPSB 1T89A 2NR6D 5H35B 5IFJA 5DFWH 4FFZL 5MENB 4XP1H 1TMCB 2FD6L 1S7QA 5HPMB 4LEOA 1MHPH 1FQ9C 4TULL 2EDBA 1I1YA 1MCOL 3I2CH 3QI9A 4X9IA 1WC7A 4RGMB 3CVHA 4I0PA 3ZDXE 1P84J 3L6FA 1RVFL 2NY4C 3VFTA 3KXFD 3VRIA 5JLZB 3BKMH 4GMTL 1I75A 3EYFB 1S9YB 1C5BH 1LHZA 3D85B 4GBXC 3C8KA 3HNTH 1ZA6B 2ARJB 3H3KA 4M6AA 5CSZA 4JZNA 3TIDB 4DOHB 5T5NG 2X1OA 3HMXH 3QIBD 1JIBA 2XG5A 4UIMA 5IWLA 4RGOL 2WQRA 3LRSB 4NBYB 1NC4D 1T7YA 4QXWA 4IMLA 4D8PA 4DK6A 4YPGB 4LCWE 2N56A 2UZYB 4PJEF 3CPLB 3RY4A 3MJ7B 1JNHA 2GTWB 5IFHL 1XGQB 1UB5B 5DVOA 2PR4H 1J11A 3DVGA 4Z77B 1O7SA 2VLKD 1QP1A 3BQUB 5B4MC 3OPZL 1JNJA 3JWOH 1XF1A 1B9ZA 4NNXA 5TPWH 3MJ9H 5IMLB 1WBZB 3U82B 3ZDXF 3LKQA 4MYWB 4NWTH 5KSBE 1PQZA 2ZWLT 1NGPH 1FRGL 4JJ5A 1D5XB 3QEGL 5CKAA 3EGSA 3RPIA 5D6DA 3I84A 2EYTB 1FFOA 3NZ8B 4RZCA 4PJIB 1KCRL 3BHBA 5IVXA 5GGSA 2JJWA 1NDGB 2CGRL 3IDNA 4HIEB 4DTGH 4Y89A 3A6BL 4FZ8L 3U7WL 1OGTB 1OGAB 3QI9D 3S37L 2AXGA 4R8WH 3C60A 3QQ4B 4XP6H 3LIZH 2YPVH 3NFSH 4KTEL 4N90E 4I0PD 1DQQA 1HOCB 4CVXA 2EXWD 1J5OL 2F9BT 1H5BC 3EYOA 4P57B 4YFDB 1LK2B 3DUSB 3VH8G 2VAJA 1TJIL 5C70A 1DBBH 5F93C 1UVQA 5FOBB 1V3KA 4LPTA 3ESVF 1HHIB 4M1CD 1QPXA 4DZ8B 1GHFL 3GMLA 2IQAB 4R2GD 4RWYL 5D4QA 4JRYB 5KSBF 5GISL 3FN3A 3TYGH 2R23B 4Q0XL 4LCCA 1F4YH 3K1KC 4V2BA 2XN9B 3QXWA 3RI5K 2XRAL 1KTKE 5CJXA 1DR9A 5EN2A 2V9TA 5I1IL 1YQVH 2ZUYA 3BH8A 4KXZI 5IOPB 5F7DA 4CNIA 4DGYL 3ELAT 4ZAKD 4OSUL 1UACH 3NFNA 1JVKA 4WW2A 3U9UB 3CLFL 3S98A 2LU4A 3WHXA 3BAEL 1Q38A 1R5WB 5AUMB 4GRWE 4S11A 4M5YH 3U7YH 4YDVB 1FGVH 5I15L 2X42A 3PHOA 4KTDH 3VH8B 1G6VK 1N7MH 5SX5K 3RUGE 1IKFL 1JNLH 2P49B 4R3SB 3TFKD 3FQRA 2B20A 2YD3A 3EYUL 3B8YA 3QDJB 1ZGLA 3SBWC 2QLVB 3L3KB 1ED3B 1KCSH 4Z76A 3NMEA 3MLRH 2V7NA 3VG0H 1MQKH 2Y6SC 3DYPA 3ULVC 3QDGA 1RZKC 4R96B 1QFPA 1JZ5A 1W72B 5CD5D 4KZEH 3JWDC 4XGZA 1UJTA 4KK5D 3P9LA 2A83A 2GK0A 3QUZC 5FO9B 1MELA 3I3DA 1EUUA 4X6FB 1X5ZA 5F7HA 5C0IB 3EYSL 2EH8L 4HXBH 4GRWF 5EUKA 1J9CT 4BH7A 3WEXB 5A2IH 4LAJH 1YEIH 2P7TB 1A6TB 4I5BA 5D5MB 1GH7A 1EVTC 3RUGF 4OCSH 2AV7B 1L6ZA 1RI8A 1CVRA 5F1NB 2NXYC 3CCHA 3P30H 2X70B 4L4VA 4NQSA 1AH1A 4TQEH 4G7YL 3FN9A 5LCVL 4I13B 4PBVC 1G7JB 1U8QA 2ATPA 2D7TL 1UJ3C 2DQEL 5EC2A 3SDXB 3WKML 1HIMH 1HHKB 3JUYA 3NCMA 4Z7WB 4OCXL 3MV9E 3PUCA 3U79A 4GUPB 1JPST 1UM6H 3DX9A 4LVNC 3W9EB 4G6AC 2AI0H 1NMAH 3GBML 1OTSC 4NFBA 1KENL 5DGQA 3WN5B 2NW2B 5KVFH 1PYWB 3N50A 4I2XB 4O58L 1B0RB 1IGMH 4JFXB 3EO1A 1Z3GH 4NZUH 3SY0A 2AJVH 4R6UA 1IEBB 1NC2B 1VERA 5HYFA 4HCRA 1EEZB 3QNZA 4A6YB 2E9IA 1IRAY 3VI3E 2J3SA 2ITDA 4NYLB 2NY4D 1CE6B 5J7CC 1H5BA 3WJJC 1KNOB 3T0VA 5IROA 4KVNH 2GEEA 1Q94A 4PJCA 3Q0HA 4CMHC 1JWUB 4WW1B 1BVLB 5AD0B 4WY7L 2BC4A 2Q7NA 4Q58C 3E6HA 4NQCE 1JP5A 1UQSB 3VWJC 2ED8A 3PHSA 3BEWA 4OT1H 3V2AR 4Y4KC 1A6ZB 1K5NB 1LEKA 5CJQH 3NZHH 5D2LA 4MD4B 2UY6A 4YR6A 4YO0B 4FG6C 4QHLB 3HAEA 4N0FB 3BRDA 4O2FB 1MWAL 5B4MD 1T22A 3BZ4B 1YJDL 2YK1H 3CSGA 2A6KB 1RMFL 1YUHA 2DQTH 3QUMH 1QSFE 2X4TB 5EUOB 2YSSA 1BOGB 1KPUB 3VI3F 5I71B 1OQOA 1VFAA 2RCSL 2DLIA 3FFCA 4KGLA 4MNQE 1N6QH 4A2LA 1P7KA 2AJUH 1A3LH 1I9IL 2E3VA 2RGSA 2UUDH 5ID0B 1VKXA 3FO9A 1MJUH 4IIQC 4WRLA 1I7TA 4ZNEE 1WWBX 2IANA 3TBSA 5EPMB 4LRIC 2J6EH 4PYGA 1FFRA 5JOPD 1MLBA 4MDIA 4GW4A 1BEYH 3GM8A 3LY6A 3QDAA 4M61B 2JCCA 4LPWA 4ZUTA 5I30H 5EA0L 2CKBB 4JPIA 2VABA 4M5ZL 4NN6C 2R1WA 3D2UB 1N3NB 1MCIA 1D5MB 4JANB 1U8IA 2FJGB 2YXFA 3CFCH 3BH9A 4GSDL 4TPRL 1JV5B 4JPWH 2DKSA 1YPZA 1N0XL 2HKHL 1EHNA 5AZ2L 3L3JA 1TZIA 4NQVB 4K3JL 3KDMA 1OAYH 4M48L 3AU1B 1KJVA 1MRDH 5EDXA 1N5YH 3BP4A 3T0BA 3HG1A 1FV1A 5IQ9B 3ARFA 2CO7B 5HYSA 5I1GL 3QCVH 5E24E 1ETZA 3RJDA 2EKJA 1HWGB 1OAZL 1RURH 2P8PA 3QFJA 1S7TB 5GGRA 1OARH 2ICWI 5EBGA 1SJEB 3H0TB 2R9HC 5HDLA 3JSSA 1UWEL 5ABDE 1Q1JH 3O9WC 5MHSE 3FFCD 3CSBA 5KSAB 3EO0A 3VU2A 1P1ZA 3EZ8A 1Q9LB 4LNRA 4G80A 3V6ZA 4ONHA 1UFUA 2Q7YA 4Y2OA 3RZCA 5C92A 1I1RA 3MCG1 1VGEL 2IAND 4HJ0C 4JFEE 5F70A 4JAMB 5DHVA 4IJ3C 4LLDA 4LFHD 1LEIB 2BOCB 4K7FB 3OKYA 1JGDB 3GMPA 2FJHA 4OCLC 2A77L 2Y6SD 1J05A 3ULVD 4EN3B 3S35H 4PRHB 1WCBB 1I8KA 3QT2A 2C1OB 3INUL 3TH4T 5CEXB 5IKCB 4LGSB 3ZYJA 4GOSA 3IFPA 2CLVB 4ZTPL 4XPAL 1QLRA 4EDXA 1J87A 3PIQA 4P5KB 3U48A 3QUZD 1RIUH 3HR5B 3SDDC 5A16A 4MNHB 2XT1B 4YXLH 1PKQB 3O6KH 4YHIB 1WLHA 3VCLA 4JN2A 1F4AA 5GGUA 5BZDB 5EU7E 2IALB 1T21A 4GW5B 2VDNL 4CMMB 4PJXE 4CDHA 3T0WA 4UIKH 2GHWB 2NXYD 4K07A 3VWJA 3ARFD 5D7IE 4Y4KA 4NZDA 1JZ8A 4ZQKB 2HYMA 2JIXA 3B3IA 1EGJA 3QO0A 3QFJD 5D1QB 5C0AA 2ZP0T 3QHTC 5DSCA 3IETB 4RMUA 2HFTA 5KVGL 4J3SA 1JZ3A 4KJWC 1ZMYA 2YBRB 3L5WA 4OZ4A 3SGEI 5C08B 5D71H 3DTXA 4PV8B 5I1LA 1JPFB 4G6AD 2ICWB 5FECA 1ONQB 1MFEL 4LSTL 4XVJH 1OTSD 4AIXA 4MSWA 1A1OA 4M7LH 1IGJB 4F7CA 3PV6A 4DUXA 3P4NB 2IH1A 4G8EB 1X5GA 3VFWB 5A2LH 4AT6B 4JFZH 1IAKB 1X5HA 1H9VA 5E4EB 2DQJL 3UBXG 1RK1B 4NQDB 4PJXF 3N0PB 1UWGH 1X4XA 3RWIA 2X1PA 2HFEA 3GRWH 5D7IF 1U8NA 2BDNH 2Q86A 2WZPD 4LIQL 2OK0L 1FO0L 4APQA 4PGBB 2NY3D 4NRYB 1U8KA 4G8GA 2W65B 4FQXC 1YYLH 4X6CF 4YX2H 4S1QH 1JYWA 2YUWA 4F3FA 4R9HA 5HYJD 1RZKL 3HTLX 3VJ6B 2ADJA 2Z91B 2ZSWA 2H2PC 1AD9B 4U1KB 4EUPG 2GJJA 3VWJD 2W9LA 2X10A 4XCEA 4Y4KD 3QEHA 2OS7A 5E8NA 3GSXB 4FG6D 5FKAB 3VW3H 4U3CA 5C0AD 4N8PA 1AGFB 1IEHA 2G2RA 4IRSC 5AZEH 5BV7L 4NT6A 5EBLA 4U6HB 2B0SL 2X9YA 4L8SB 4YEEA 3T2OA 2BX5A 4L3CA 1D6VH 4KZDH 1CFSB 2H32A 1VADA 1IM9B 1WTLA 2OTWA 3SQBA 1YY8B 3LKOA 3DXAD 3NCYS 2DBJA 1XZ0A 5KOMC 1IAOA 4L1DA 5TDOB 1UXSB 3IDYB 4HIHA 1AC0A 2VITB 2WUBL 4HPYL 3R1GL 3K1DA 4EUPB 4PJGA 5E2JA 1NBZB 2GCYB 3T4YA 4APQD 3ES6B 4F8QA 1FNHA 1DQJB 3LQAH 2Y25A 3JTTB 3RWFB 4E5XB 1FDLL 5DQJA 3BD5A 2DWEA 4P2RE 3KPQA 1EFQA 2L4OA 4LLWB 3TGXA 3SDDA 1UXWA 1WVZA 3BGAA 1RU9L 2ZUQC 4ZFFB 1BJ8A 4I77H 4GRWH 3ZL4H 3MXVH 1OCWL 1BZ7A 2R1YB 2WK2A 3LKSB 5ESQB 5H2BB 1F90H 3L5HA 4N8CL 2HFGL 5TDPB 2V2TB 4D0BB 5JHDA 3NH7L 4HUKB 2YPLA 4Q7DA 4X4MA 1KCUH 5E4IA 5FYLE 2WBJC 1S78C 3BXNA 1U6AL 4Q6YA 1AXSB 1MCRA 1EHLL 3VXPA 2I5YH 3FRPG 2JJUA 2RAMA 3O9WD 1MF2H 5BVJA 1T6WA 3BP5A 4GAYB 5JPMB 3DUHA 1Q0YL 3IDXL 1NQBA 2R0WL 3TO2B 3CFDA 2LE9A 4HV8A 2XZAH 3U0TB 2X1QA 3JV6A 3P4OB 4HJ0D 4L4TB 4U1MB 1A0QL 1Q9KA 4HMEA 4Z0BH 5GJSH 5L2JA 2A1WH 4XPHH 3FKUS 3NCEB 4NP4H 1BFVH 4I3SL 1RJCA 1LDSA 4YXKH 4X6EA 5JDJA 1IM3B 2MOVA 1UKQA 4J1UB 3FB8A 3P9MB 3T77B 1DDHB 8FABB 5ESVB 1BVKB 5ETUB 5F6HJ 5A2FA 3PHQB 3IU4L 3RWCB 2LAAA 3SDDD 1OLZA 3MNWA 1NBQA 1KACB 2EDQA 3T8XA 1WZ1H 2C5DC 4ZPVA 4D3CL 2FECI 4KWUA 5DRNA 3GMMB 2J8UA 3SGDI 1D9KC 3QSKB 4WI4A 3VGAC 5TF0A 4PTUA 1R5VB 3G04B 4OI9A 3C5ZB 1KPVA 2ZG1A 3E8UH 4OFVA 2BJMH 3CVIL 4Y8AA 5JHDD 2YPLD 2L0DA 2OXHA 5FGRA 3JV4A 3S96A 4X99B 1N8ZB 2W9EL 2VISB 4FQJL 4GFTB 2WM0A 4MQXC 4IRSA 4YHLH 2FB4H 2ZNWA 2ENSA 4JFQA 4KJWD 5IG7A 1MEXL 3KWWA 3V95A 1RZJH 1OM3L 5DQDH 4OGYL 1XF4B 2H26A 4J23A 4UNVA 1MY5A 3BIKA 4ELMB 1FFNB 2W0FA 1BZ9A 2EE6A 3PP3H 4E41B 2BY3A 1PG7L 5T3XE 2VE6A 2VXQL 3OWEA 2EC9U 2LQRA 4RA3A 5MERB 2FO4B 2VXSL 3QG6B 3E6FA 3O4LA 4TSBH 3OKMA 4C56B 4KTYA 1JFQH 4CJ1A 2AK1L 2DQGL 4FQ1L 2FX7H 2IG2L 4LLMB 1CGUA 1UH4A 2GT9A 1MHEB 5F71A 3LRGA 1ORQB 2CKNA 2HP4A 2XZCH 1MFCL 3MYJB 4JM2A 1JPGA 2P5WE 4NZTL 5JO5B 2FHCA 1NFKA 1QEWB 4JE4B 1MCSA 3MXWH 4LSPH 3VD7A 1XGTB 1KJMB 2VDPL 5EORH 4UDTB 3T3ME 1MHCA 4QRSB 5ANMA 3IFLL 3ZKMC 1AGEB 3QIUB 2CSPA 1D3CA 2H9GA 2V5MA 3VA2C 2H2PD 2FX9L 4QHNA 2YHGA 4DVRH 1XT5A 4I3RH 3LS4H 4CN1A 4PRBB 4U6YA 4FMKA 2J5LC 4LEXH 5IQ7H 4OLYH 3RWEA 1JPTH 4IRSD 5E6IC 4WJ5A 1JGEB 3S3PA 1QKZL 3W2DL 3HC3L 5IESH 1H3TA 4LF3B 4NC1C 1QOKA 4RSVA 3QYCA 2BFVH 1A7OH 3PP4H 1J88A 4CU7A 1PKOA 2ZUUA 1ADQL 3UJTL 3BEVB 2CRIA 4K3GA 3H42L 3T3MF 3O2DL 3VXTB 4E42B 1NBYA 4O4YL 1PBYA 3H9ZA 1I85C 3PF2A 3EFDH 1LD9A 4L9LA 1F11B 2CLRB 1HXMB 2H1PL 1CXFA 5DD0L 5IJKC 4QYOA 1IT9L 3LEXA 3OZ9H 4Y88A 3IVKB 4W4OC 2GUOA 3FB7B 1XF5A 3MPCA 1FL5B 3MRPA 5INDA 4AL8L 1F02I 1KF9B 4XWGL 5IM7A 1WWCA 2BXZA 1DEEB 1N0LA 3BPNC 3CZFB 4Z7OF 3RY5A 2A73A 25C8L 5CJOL 4KXZH 4PJFA 3MV8A 5MEPA 1MCBA 4AIOA 1KELH 5TQ2L 1QD0A 5ILTL 5J56B 2O61B 3SKMB 2GK2A 1DE4A 1KB9K 5FDWA 4X6BB 4NHCH 1MI5B 2VSDA 3GSNH 3MRIB 4G6KH 3QIBB 3LN9A 1RJYA 5JUEH 1OAXL 3ZLQC 2DRUA 2FSEB 2CUIA 1LDPH 4OI7A 1J1OH 5DJCA 4YDLC 4Y5XB 1OAQH 4NM8L 4RGNC 3EFFB 4MD0B 1IC5H 1TJGH 2EZ0C 1YMME 1YEHH 1FC2D 3X14A 1QA9B 4YDKL 1IC4L 3GJEA 5FYJL 3O41A 4LLUA 4AEIL 1ZHNB 4YEFA 1ZA3A 3Q1SL 1X3DA 4M4PA 3VRJA 1W0WB 4AYFA 1T1ZB 1SYVB 4ODWA 2AGJL 1S7WB 4LOUD 2KUTA 3FHAA 3O2WL 5DJ6B 3C87A 1NCBL 2ZCHH 3BDYL 3DX7A 5FGCE 4PG2C 4GMSL 5JOEA 2JLLA 1JRHL 1F3JB 1NAMA 2KL6A 2FHFA 4I0PB 4PJ5E 1I9RH 3MV8D 4QF1A 4OV5B 3VFTB 1GXEA 5LQBH 1G7QA 1T2JA 4EI5A 5HI3C 3HI1A 4JKPL 4RFOH 3SE3A 4DK3A 1G9NH 2C3VB 5EZIL 1T5WA 1F4HA 1YDPB 1C08B 4PD4J 4OZIA 1HYRC 1SY6H 1JNNH 3RWHB 4U1GB 3N9GH 4LCUB 1EHAA 4OFYD 3TWCH 3W0WD 3HB3C 1VPOL 4HS6B 4PS4L 5IT2H 3FT2A 3CH8A 2CIKA 3VXSB 4WVRA 3QB7C 4UV7L 4JZJC 4HXAL 2Q6WB 4QRRE 5F89A 4ZAKB 4HC1H 5AG8A 4KQ3H 1YNTA 4L3EA 5ID1B 3B9EA 1IGIH 2IJ0C 5M7QA 2ZCLH 1A14L 2QSCH 3QCTL 3ALXA 2IBZY 35C8H 4HK3J 3DX6A 4WDIA 1IAMA 4Y7MA 3VWKA 1JK8B 1MRFL 1A3RH 3LKQB 4LBEA 3WD5H 4NRZA 4ODSH 4ONGL 5ADOL 3PQYD 5IF0A 5FKPA 3V4PL 1I85A 3RPIB 3WCYA 4IRJB 3D1MC 5CEZH 1FFOB 5GGSB 4OCWL 5DVMA 3ZE0F 3ARBC 4F58H 1JCKA 5B8CB 2P5ED 4W4OA 1KN2H 3LN4A 2A6JA 3P77B 1TITA 2AXGB 3KHOA 4UUJA 4ISVA 1CGSL 3A6CH 2CDGB 3L9RA 5DEGB 3KXFE 2HMIC 4EI5D 1IC7L 1NCDL 1AY1L 3TT1H 1Y0LA 4N9GA 4ALAH 5JW4N 3OBAA 4Q6IB 4S1SL 2EH7H 2OZ4H 1FYTB 4X7SH 1FCGA 1AGDA 1MWAB 4UTAH 4DQOH 4U05A 4UBDC 5E5MA 1TCRA 1IL1A 5I8CB 3IFOB 5KVDL 2VIRA 4PRAA 4YWGL 4OAWB 2YD4A 4K55A 3RL2A 1YEGH 3DYOA 5F7DB 4X4XB 4WW2B 4L3ED 1I7RB 3FHQA 4M93B 3LDBB 3QXDB 3WHXB 5I1KL 4N1HB 3K80A 4LSSL 4NDMA 5EWIH 4D0CB 3P4MA 3HZYA 4KRPD 1FIEA 1CDCA 1FORL 2R0KH 3VFSB 2G75A 3GI8H 3PHOB 3QQ9C 3DYMA 1INEH 1A6PA 3FO2A 2V5YA 5C6TL 1KC5L 4HMDA 3CU7A 4J12A 4LVEA 4XC1H 5SV4A 3S4SB 1ZGLB 4HIJB 5SWSA 2UYLA 2R0ZL 2V7NB 3MUY1 5ICXB 1JHKH 2AEIT 3IB4A 1MHHB 4WHCA 5ITBH 2YD9A 4RAVA 3RZWA 3GMOA 3MUJA 4I9WD 3CK0H 5HHOD 4PGEA 5JQHC 4MXVE 2V2XA 2JK5A 1BLNB 1FLRL 4FXKA 2WMPA 2AKRA 2HVJB 2G60L 5FYLH 2NY4B 4ODXB 5E1AA 3O3DB 3TLRA 5LWYH 1FG9C 3UCRA 4J3TA 3NN8B 4F33A 3ILQD 4LP4A 1YEJL 4NC2B 1NCAH 1X5IA 4ODUA 5BRZE 5E8DH 5MEOA 4PP2A 3MA9H 1ZOXA 4GBXB 4I5BB 1S7SB 2YC1B 4NQSB 2BCKB 4H1LA 5LVEA 1EV2E 1EX0A 1J0ZA 2IQ9H 1JWSB 2QADC 3ZDZE 1QVOA 2X7LB 2ATPB 2ZUSA 3TNMA 3V5DA 2IMNA 2VZUA 2VDQL 4RGND 3VFRB 4OD3L 4MXVF 4MA1C 2EZ0D 4Y1AA 2R56H 5BW7C 3GMNA 2NW3A 3OAUH 1G7HA 4FQIL 4Z7QE 3RI5F 5DURD 5GRVL 5IVXE 3K8KA 1FBIL 4N9OB 5SWSD 2FIRT 3EZJB 3QXUA 5F9JB 1AR1C 5F7NC 1ZLWK 5EU4A 4ZFOL 2CRMA 4NRXA 5A1AA 2VXUL 3HPJA 4LLQB 3MRLB 3ILPB 1A7BA 4M43H 3ARBA 1NFIA 5J0BA 2HLFC 5EU5B 1U8HB 3O6MH 3L5IA 5A43C 2Q76B 1SM3L 1FNSH 4MD5A 4X9BA 3I9GH 3GJFH 3ZDZF 1HSAA 1ZLVH 7FABL 1AXTL 3EYVB 2PW2B 3U36A 1H5BB 3ARSA 4XVTH 4GT7A 5HI3D 3V0WL 4WU5A 4MJIA 5E2VL 4LDEB 1E6OH 3VMOA 4FZEH 2F5BH 5HDQH 2QQNH 3C6LC 4HKJB 1LO2L 3SGEH 4NJAH 1QACA 1AQKH 2I9LB 4Z7QF 4D94A 1BM3L 5FM5O 4JRWA 3QULB 4G9FA 1UM4H 2MCPH 4P2QA 2Y07H 4XI5C 4HWEL 2YRPA 3EDKA 5I1HH 4TUJB 3MRJA 3TNNB 3ARYA 5KN5B 1MIMH 2PO6C 4Y1AD 3NIGF 5FIEA 3O3BB 1OT1A 1A7PH 4FQHB 1HQ4A 1RUKL 2ESVA 5FCUL 2VMFA 1JF5A 1XAUA 4QHKI 4JHAL 2WLZA 4CAGA 1R3LB 3FO9B 3EW3B 1QYGL 3V4VL 3PDOA 3QDGE 2YEZB 2VLRA 3ARBD 4LSQH 3QH3A 2ARWA 5FF6B 3BZEA 3RX7A 3DPBA 1OTUC 4ZUTB 3DGGA 1EEYA 1NDMA 5J4MA 2HMID 2G5BB 4HUUA 1NCTA 1L7IH 4MX7A 5D93C 2A6IB 4XRCA 5CSGA 2JF1A 3WIIL 2YR3A 3QFDB 3QUZB 2FR4B 1AFVH 3H3PH 1EHXA 5BV7B 1FFPB 3P0YH 1WITA 2AEQH 3BZFA 4XNQA 3VFGH 5DQ9B 4L4VE 1NLDH 1B4RA 2Q8AL 2V9RA 4UBDD 3GMQA 3KDMB 3SOBH 4G9FD 5D7JA 4GG6A 2P24A 5DEFB 4P2QD 1E6JL 5CIPB 5GS0H 4O2CB 3KPSE 2JJTC 4EZMA 2P8PB 4JHWL 1UJ3B 3LVEA 5DMKB 1U8PA 5L6YL 3I75A 2VJXA 4J7RA 3C2AL 3L3GA 1DZBA 4HF5H 3I6GA 5F9DC 1X5KA 1YN6A 2ESVD 1CIUA 4M7KH 3SCMA 2W9DL 3QQ9D 3M8OL 3LN5B 4LVNB 3SGKC 1M6OA 3MV7A 3D25A 2IWGA 4YJZL 1A1NB 3MR9B 4K71C 5HGGS 3LKRB 5JOPE 4KQ4L 5DHVB 4O02L 1X5FA 5GHWH 5IJVA 3STZA 3VFMB 4DOHE 1F2QA 4XCCH 3MRBB 4PJAA 4M6MH 4GAJL 5I8KH 3SJVA 5CSBA 3DRTB 4M62L 4PJCE 5HBBA 4JR9H 3ALPA 4NFCA 3BRGC 1D5ZA 1RY7B 4GKSA 5D72L 3PIQB 2HTLC 32C2B 4PLJD 2ORBH 3WIHL 5IB3B 4CMHB 2MFNA 2N1KA 1CGVA 3JV0A 3MJ8A 5HYJB 3QWOB 5K9JH 4G8FA 1BQHG