4DCQB

Crystal structure of the fab fragment of 3b5h10, an antibody-specific for extended polyglutamine repeats (orthorhombic form)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
218
structure length
218
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTTYGMSWVKQAPGKGFEWMGWINTYSGVPTYVDDFKGRFAFSLETSASTAYLQINNLKNEDTAVYFCARGGNNFLWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3B5H10 FAB Light Chain
publication title Disease-associated polyglutamine stretches in monomeric huntingtin adopt a compact structure.
pubmed doi rcsb
molecule tags Immune system
total genus 42
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2012-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dcqB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dcqB02
1F3DJ 4E41A 5D7JB 5E94A 3V6ZA 1A6ZB 4W70A 1P4IH 4H1LG 4JZOB 4JEGB 4PRIB 3THMH 4U6HA 1BIIB 2AABL 1JYXA 1T0NA 4AMKH 5BO1L 2VDKL 5JLZB 3D0LA 3G5YB 4KKCC 1H8SA 2IALA 3ZKMD 4M6OH 1TJGH 4G8EA 1B2WH 4GLRH 2X4UB 4NQXA 1RUMH 5FHBL 3LMJH 4X7CC 4UAOC 1LQSR 1IEAB 1WAAF 5T3XL 4H0IA 4KJPC 5E8NA 4F15C 1R3JB 4PRHD 1E4XI 4YK4B 3ISWA 3RGHA 1BBDL 3X17A 4DFHA 3O3UN 5FGBC 3MLWH 4RGMC 6FABH 2JJUA 1FBIL 3BGMA 4GMTL 4RNRB 1ED3A 4JY5L 1N8ZA 1OAXL 2D7TH 3LKSA 1U41A 5KVEH 2Q3ZA 4FXGB 2BVOB 1NGQH 3I50L 2CDFB 1H5BA 3DO7A 3TBWB 5D1ZB 1T2QL 2PTUA 1X5LA 4POZD 4W68A 1Q0YL 1GGCH 3F6IA 4XP5L 2DS4A 5I30H 5JA8B 2FECL 3FRUB 1U92A 3UTTE 2Z93B 1NC2D 2IBBA 2NX5E 1FAKT 4P59H 3ROOB 4KQ4H 4HCRH 4MJ6B 3CCHA 1UCTA 1SJHB 4OKVB 3L3IA 2NY7L 3SE4C 1W72B 4KKLC 3CVHH 3IFLL 5J13B 2A6IB 3IFNL 4KKCD 4HGMA 1G7LA 1CFBA 1TDQA 4WI8A 1YEDB 1J8HE 2YZ8A 2ZUQC 2AI0L 1I3RB 3JVGC 3MLRL 3JWDL 3VG9C 4G8GE 3MGOB 3VI4E 5BVPH 3UZEA 4KJPD 1PGRB 2YPLA 3X12A 1NFDE 3EOBA 2BOCA 3W82A 3QEGH 4X0KB 4I0PA 3OGCB 4WFED 4MNGE 4PGCA 4P5MB 1CE6A 3QWOA 3L95A 4MXQC 1T89A 1LEIA 1HINH 4M7LL 3W0WA 3VXUD 2A73B 2XY1A 2WBJB 4NNYA 3UPRA 1FIEA 4WW1B 5FF6B 1JPGA 1YC7A 2I5YH 1ZHNB 4QCIB 5AYUL 5HJ3A 2AEQL 3RJDA 2QQKL 4Z5RA 1DUZA 2CXKA 5EZOH 2H6PA 3GO1L 4ZSOB 3CLEH 4HS6A 1ZA3B 5IHZA 1V7MH 1GGIH 1ADQA 4P57A 1S7WB 4NQDD 2DI9A 2AK4D 2R69L 3WV0A 2VDNH 5MI0C 2CLVB 2FEEL 2DQEL 5C6TH 4KKLD 5FUOL 1KIQB 1SY6L 5HBBA 4HPYL 3RAJH 1J0KA 2R2CA 3WNPA 3RZCC 4GKNB 3L3JA 3LKQB 3P9LA 3BP7A 3L5XL 3PWVB 4EI5A 4HLZH 4F9PA 4XAKD 3ULSA 4GQPH 3VFSA 2JTDA 5GS0C 5F9WB 3UDWC 4QXTA 4OZFA 5E9DA 3TH2T 3IFPA 3LB6C 3LS4H 2ZNXA 5KAQF 3AREA 2C1OB 5DD6B 2KUTA 3FQNB 5SWZD 5TF1H 4V2BA 2FLBT 1YDPA 3QFDA 4JKLA 4IOIA 4JKWA 1O7VA 5IF0A 2ESVB 2YR3A 2BNUA 4Z18A 5HXMA 1IKFL 1MHEB 5IHUH 3V6ZB 5KVDH 4HJJH 4U6HB 5GRYA 1T0NB 4OCMC 4CAGA 1XCTA 4YGAB 1MLBA 4LEXH 4N9GA 4ZYKA 3V4VH 2FECI 3MCKA 3SPVB 3DTXB 1GZPA 4F7PB 3D0LB 1R3IH 4FP8H 4G9FD 1N6QL 2IALB 1P53A 4LSVH 2OP4H 4PRNA 4G8EB 1NGYA 4LU5L 1WT5C 2AJVL 3ULUE 2FB4L 2FD6L 4NQXB 2W92A 5J1SC 4FQPA 3RZCD 4JREC 4JCMA 3GKWH 3CDYA 3PIQA 4YWGL 5E00A 1S9YA 5E8NB 3OL2A 1A4KB 5DURD 4GRWF 5BRZD 1QBLH 2OJEB 2P48B 4JFFD 4X6FA 3LDBB 4Y5XC 3LB6D 3BGMB 2EE6A 4IMLB 3REWA 5FV1L 1JN6B 5C3LD 3DMMA 3U2SA 4OCNC 1H5BB 3I6LE 3VA6A 4JDTL 4XBEH 1MCWM 2R0WH 3EYFB 4J3XA 1KB9J 4TNWF 1CE1H 4FQXA 4XPBL 5JDJA 1U92B 5K9OA 1SM3L 1ODAA 2ZCKH 5LCVL 5HVHC 3QFJA 1CD8A 2IPTH 3WIHL 3ZHLA 3DETC 3ZT5A 2RB8A 2PYFA 3CCHB 2GY5A 4PJAE 4YAQA 5JXEA 3L3IB 2UUDK 4G7YH 1OB1A 2NCMA 5FHAH 5K9QI 2FEEI 1KCLA 1DSFL 4Z8FL 5CZVH 2OR8A 3N85L 4OD3H 4HMDA 1VGEH 4KI5E 4JFQA 4ORGA 1DQDH 1TJIH 1XFPA 3ECBA 3WLBA 3M17A 5KVFH 2ADGA 3RI5F 2VOTA 1JZ3A 1QLEL 2YPLB 3X12B 3S34L 2JJTC 3SCMC 2E6JA 3AB0C 3GEWB 4TUKH 4ONHB 4PGCB 1BWWA 4YHZH 1CE6B 4RISL 1BAFL 1Z3GH 3EFDL 4ZFOA 3ET9F 3RWHA 1JNLL 1LEIB 4MJID 1XGYL 3W0WB 1CL7I 4NNYB 5F9OH 1TQBB 5HJ3B 3A6CL 5GGVY 4Z5RB 3LEVH 1N7MH 4P49A 2H6PB 4HS6B 3F12A 5AEAA 4MAYC 5IHZB 1IM3A 3UC0L 3SN6N 3DETD 1OD7A 3C2AH 4MD0A 4N5EC 1T83A 3DARA 4MZ3A 4LIQH 1K8IA 3MRJA 3S3SA 4XHQA 5F7KC 1HIML 3L3JB 4WI5A 3P9LB 4EI5B 3ZKNC 4JG0H 3WLWC 1UM4L 2R2HA 3VFSB 3HG1A 1QNZH 4JANA 4NKIH 1TVBA 3BGAA 5E9DB 4YQXL 3IFPB 4EBQH 4M4PA 1PQZB 3VGHA 3C5SA 4FZ8H 2Q3AA 2LU3A 3SDAA 1YDPB 4OGAC 5I9QB 2DQIH 3QFDB 2VXSL 4IOIB 1EAPA 3SCMD 5IF0B 2BNUB 3QXVA 1EERB 5E6IC 4JQIL 2X7LB 1IQWH 3SKMA 4LF3B 4QOKD 5JW3H 1N4XH 1XCTB 4NBXB 4DN4L 2IQ9H 2NY5H 3MCKB 4KTDH 3U7WL 3UTSD 2V5RA 3IDMA 4S1RH 5FO9A 3VFOA 1RURH 3TEUA 2XQBH 4ODHH 4MAYD 5F89A 1X5IA 3DX8A 2XQYG 4UUJA 3UTOA 1T03L 4PRNB 4UT9L 5TFSL 3QHTC 1HKFA 1NGYB 3H9HA 3MJ9H 4N5ED 5T5FH 3MMEB 5DD5H 1JFQL 3DIFA 5IJKC 2C1PB 4HF5L 3E6FA 3TO4D 2HT2C 3PIQB 3BPLC 2H26A 3IDYB 5E00B 1HXYA 5D7JC 3MV11 4HKZB 1P84K 1S9YB 3WLWD 4MCZA 1KJ2B 5DWUH 4LKXA 1OT2A 4DUWA 2VZTA 4X6FB 4TSBL 3UX9B 4EKXA 2AJUL 5LJYH 2VDQL 1N59B 4LBEA 4BFBD 1CXFA 4G5ZH 3SDXA 4XMPL 1YECH 3REWB 2VSCA 2HFGH 4LP5A 4OGAD 4NC2B 3TH4T 3DMMB 4KRPB 5E8PA 4HUWB 3U2SB 4PJBA 3OQ3B 1VFBA 4N0UE 1MCLA 1PX3A 4FQ2L 3NZHL 3GRWA 4S11A 4Q9QH 5E8EB 2FBJH 2NY6B 5E6ID 4FQXB 4RRPG 2CMRL 5K9OB 3Q6GH 4NRXA 2YC1B 3MA9H 5HYEA 3QFJB 2J5LB 5ERWA 4WFGE 1NMAL 4AEHH 4YK4C 1CD1A 4KK5D 1FJ1A 3QP3A 4YAQB 1TVHA 3NAAH 2DQHL 1DBBL 3DSFH 1AQDB 1OB1B 4HKXA 4XI5D 1F97A 1FORL 1PFCA 4KROB 4XCNA 1BJ1J 5DZNA 2P44B 4ODTL 2N7AA 5F1IB 2OCFD 3QIBD 1YA5A 4ZXBD 4ZS7L 4LSDA 5D1ZC 4NSKA 4ORGB 3BISA 4JHZA 1AO7D 1ULVA 4H88H 5TGBA 4XVTH 1IKNA 2YA2A 3WLBB 1NAMA 5D5MB 2AEIT 5I1KL 2NXZB 3O4OB 2WV3A 1AGDA 1U3ZA 4PRID 2DD8H 5KVGH 1JHLL 4JFZH 1S7QA 4H20H 2H2SC 4Z7UF 1F90H 3A6OA 5HDLA 1NCCL 4LASL 1NGZA 5J13C 1QR4A 4LLDB 4B7LA 3PL6D 3QCUL 4FXKA 5D72L 2VB5A 4PRPD 1WBZB 3UTTA 5CINL 5KTEH 1D6VL 3BN3B 2L7UA 1JIBA 1OQOA 5CZKA 1LD9B 4LSPH 4YXLL 3F12B 3MRDB 1HN1A 4PJCB 4JFXA 5I18L 1IM3B 3BP4A 5F7HA 1D5MB 2PYEB 3ME0A 4TTDC 2CK2A 3C09B 2ARWA 3K80A 1D7FA 2BSSA 3TH3T 2HT4C 5HYQA 4MD0B 2EDDA 2V7HA 4K23H 3C5ZA 4OSUH 4W4OC 1K8IB 3BMVA 1A9EB 2D7PA 1J8HA 4PJXF 1DZBA 5CUSL 1UQSA 4CJ0A 4OD1L 5ID0B 3L3OA 5BZDA 2DN7A 2R2HB 2CLRA 2WBJC 3HG1B 3D39E 1DL7H 1UH3A 4JANB 4G8GA 2XG5A 1TVBB 3QQ3A 3VXTA 2WBWB 2ZNWA 1GCFA 4KDTC 3VFNB 4DZBA 2PR4L 1RK0B 1NFDA 5GGTA 3SDAB 2PF6A 3OKOA 4MD5A 2A6KB 2ZCHL 5DUPL 4DVRH 3QI9A 4MNGA 1Y6KR 2VAAA 1YEJH 1RZIA 3C6LA 1AJ7L 3N0PB 4M5ZL 2RGSA 3AS2A 3GIZL 4LRNH 1NH6A 5FDWA 2XA8L 4GAGL 4WW2B 4D9RE 5EO0A 4A6YL 4M3JA 1TJHH 3GBNH 5IFHH 2Q6WA 5J06A 3SKMB 1I9RH 3FAWA 5KVMC 1TCRB 5L2KD 1MFEL 3ARFB 5F9WC 5E2WL 5FO8A 2M8XA 1NMCC 1AE6H 3IDMB 3MOBL 3P30L 3QDMB 3VFOB 5FO9B 1U8HB 1OGAB 5F89B 3DX8B 4UUJB 5EPMA 1MFAH 2AGJH 4TTDD 5JZ7C 1KTLB 1INQA 3H9HB 1FH5L 4LPWA 4J3OC 5TE6L 2VL4A 2HA1A 1JL8A 3DIFB 1S5IL 1ZS8B 3EFFA 1JZ7A 4PRDA 1W72H 2CR6A 1HXYB 3ZMRA 4M6NL 5EC1A 3NACH 1FRGH 1MAKA 4LKXB 3LN4B 1GC1C 2YD4A 5DLMH 3GBMH 4O51A 2H32H 1O0VA 2J4WH 4JZJA 1KACB 2EC8A 4X7SL 5GS2D 4M7KH 3SDXB 3MLSL 2IAND 2B1HH 1FFPA 2DQTH 3BKCL 2R4SH 3DNKA 5E8PB 3SDYH 2CKBL 3OR6A 1ZHBA 4U1IB 2B2XH 3CC5A 5EBLA 1VFBB 3NCYP 3U48A 1JCKA 1FQ9C 4JDVB 3NFSH 3B6SB 4UBDC 4MNHA 3NTCL 2R9HD 1CR9L 3AFLA 1HSAA 1MCFA 3D3VD 2HJLA 2VRAA 3DVGA 1JE6A 1UKQA 5JR1H 2NPLX 3HR6A 1UYWH 5ERWB 1BQLL 1TITA 1CD1B 4U6XB 3N9GH 4KK9C 1FJ1B 5GS2H 4QRPE 5DQDL 3LDBC 1G6RL 2O5YL 2XICA 3QCTH 4BFIA 4LCIH 1WAAE 1EO8L 3OJDA 4CN1A 4YHYB 3WS6C 4XCNB 3SDDB 4UOW1 4GUPB 5JZ7D 5F7EH 4ODBD 3QUZD 1GL4B 3MFFB 3RVUC 4RGNE 1H5BC 5DJXA 4CN6A 3MRIA 2EYSA 2MCG1 3GSNA 2ESVD 3HE7D 5TGBB 1Z9MA 2ADJA 1T1XA 4X6DB 4NO0A 4XAWH 4E41D 4RBPK 1AGDB 1S5HA 3CMGA 3X3GH 2PTVA 3U6RB 3SKJH 4PTUB 1WTLA 4JFHE 1ZMYA 4KUZL 4P46A 4GRLA 1EGJH 3B9VA 4RBPH 1SEQH 4D8PA 1FN4A 4XNYH 2QJDA 5J9PA 4P2RD 2VDMH 3O2WL 1RZGA 1OTUC 1T5XA 3NFNA 3TVMB 5A2LH 3WJLA 4FXKB 3ARYA 3ILQC 3KYKL 3TJHD 2BOBA 3MCLH 2UWEF 4EZMA 3UTTB 3MZTA 3MJ7A 4I48A 3PJSB 4UBDD 4YBQD 2NX5B 1JHKH 5GISH 4KMTL 2VDRH 2X2YA 1XMWA 4KK8D 4JFXB 4NQED 1A6UH 3RWEA 3FO0H 4OTXH 4LAQL 1I1AA 4PJAA 4PJHF 2YKLL 2BSSB 3MXWL 4YBHA 4KK9D 5HYQB 1NCDH 3DUSA 2V7HB 1R3KA 3C5ZB 3HI6L 4L3EE 1J8HB 4EN3A 5F7FA 4LSSH 3HUJF 3V5DB 2APFA 1UQSB 1V7NH 1FCCA 5IOPA 1NMBL 5HPMB 1T89C 2DLHA 2CLRB 1G9MH 3S3PA 3H3KA 3QQ3B 1TQBC 3VXTB 4D3CL 3MPCA 3UTZA 4HS8L 3RIFK 4NJAH 3RHWK 1G0DA 1CDGA 1CLOH 2C3VB 1IL1A 4I3GA 1NFDB 1WZMA 3OKOB 4MD5B 3PGDA 4CVZA 1Z9OA 3QI9B 4MNGB 3QPQC 2J6EL 3FONA 2E7LA 5I1GL 3O3BB 4H0GA 4PBVC 5FDWB 4K7PY 5CEYA 5EO0B 1OTUD 2Q6WB 3EYVA 4LSRH 3KYOA 3ILQD 1MRFH 4EI5C 3MUZ1 1X5HA 2V9RA 3CSPA 3BPCA 3SQOH 2FGZA 1X6NA 1B4JH 5FO8B 1I1RA 4U6VH 2N4IA 3CPLA 5CJXA 5AG9A 1EO5A 1V3LA 1UXWA 4XPAH 5EPMB 3RTQA 2YPLD 4MLIA 4P3DA 3I3BA 3JTTA 1INQB 3EUUA 3CSYA 4XCFH 5I9QC 1KJVA 3GJFH 1E27A 1II4E 3EFFB 4I0PD 4UQ3A 4PRDB 2YUXA 4L29A 4KU1A 1JK8A 4HZAA 3RUGF 3K81A 4G6FD 4L5FH 5EC1B 3W0WD 5E08L 2Z92B 3WD5H 1B0GA 5DFVC 2B1AH 5C08D 4O51B 1YEGL 3LKPA 3D85D 5DEZA 4K3JH 5DQ9A 1RJCA 3VDCA 3OB8A 3TA3B 2ZPKH 1FFPB 3K4AA 5TDPB 2WQRA 5M7QA 3OV6A 1X4YA 3OR6B 2AQ1A 3LIZH 1ZHBB 3QPQD 3CC5B 2OR9L 1V8HA 1JPFA 2VABA 1LILA 3VW3H 5DD0L 4R26H 3L3KA 4I3RL 1YPZB 2ID5A 1P5UA 4MNHB 5HHNA 4JRYE 5GGSA 1HSAB 2HJLB 3DVGB 4XH2B 3IDYC 4JKMA 4EI5D 3T1FA 5F88A 4Q9CA 3BIKA 2XTJE 2VIRA 4MJ4A 5EBGA 1PDKA 4RMRA 4BFIB 4HJGA 3ARED 3OJDB 5I15H 1D9KB 1QTYT 3UJTL 4GRWE 2DTMH 3DMMC 4KRPC 1WBYA 1KIRA 1IGJA 5DJXB 4K8RC 1U8PA 3MRIB 2EYSB 2P7TA 3FO9A 1PG7X 1CGSL 1X5AA 2ADJB 4P99A 1T1XB 4P5TA 3MACH 3BMWA 2NY6C 5CEZL 4FQXC 3SE3C 1JGDB 2BK8A 1MHHA 1NUFA 3TBTB 5DFVD 2L0DA 4YE4H 5JQHC 4FZEL 1UXSB 2J5LC 2W9DH 4P46B 3QIUD 4GRLB 5CJ8A 4OZFH 3HZMB 1FN4B 3SGDH 2BVQA 3QAZB 2VSDA 3UJIH 4DGYL 5ADOL 4KGLA 4N0UA 3S35L 1IC7H 3GZKA 4KROC 2HMID 2BOBB 2UZXB 5FGRA 1J05A 5HGGS 3MV01 2DYPA 1KG0A 4UT7L 3NIDF 1UWXK 1F6AA 2GCYA 3VFTA 5DUBA 3RWEB 1KPUB 2NXZC 3CXHK 3FOMB 3O4OC 4OV6F 5CS7A 1I1AB 3PWNA 1YEEH 4OCRH 3DUSB 5ICZA 2VO5A 4KKNA 1R3KB 2CIKA 4LQ1A 3BZFA 3OAYK 4LPVA 4O58L 2R0LH 1T21A 5CBAA 1A22B 4XC1H 1C5DA 4EN3B 1OAUH 5FKPA 5DK3A 5IOPB 4RA3A 3BZ4A 3DMMD 2XYCA 2FJGA 3OAYH 4K8RD 4ZOBA 5FCUL 3PDOA 1QLRB 5FYLL 2EIZA 5GZND 3DX6A 4HGKC 5DF0A 1J12A 2NY6D 4FQXD 4ZOCA 2L7JA 4O02H 4P9HH 4ZG1A 1ZT4A 1VGKA 2A0LC 4J3TA 3SY0A 3QFJD 4O9HH 5DI8A 4Y16D 5C0RH 4HBQA 5F7LB 3W9DA 3C09C 4FQIH 3VXRA 3VWJB 3L9RA 3WL9A 4S1QL 4TVPD 5JXED 1T83C 5HPOA 2FGWL 1MNUL 4R3SA 2Z8SA 5CEYB 2NTSP 1FAIH 2VLMD 1E28A 1ZLUK 1I1FA 3MNVB 3PABA 2KL6A 5IB5A 1MIMH 2QSVA 1JZ5A 2FHFA 4WHYG 3BPCB 4Z77B 2ATKA 1YNKL 5FUCE 4MGXA 1GGUA 4EXPX 3BH9A 3UYOD 3CPLB 3MLXH 1UXWB 1F02I 5KOVC 2NXZD 3RTQB 3TCLA 4IRSA 3D48R 5AD0A 4P3DB 3ARVA 3F7PC 1DE4A 3SDAC 5C09E 3JTTB 3CSYB 1KJVB 1KYOK 4XT1C 4FQQA 4N0CD 5FYJU 4X9GA 1I3UA 4UTAH 4UQ3B 5B38A 2V5MA 4TVPH 2Y36L 3F5WA 4Z6AT 1ORSA 4PJDF 2PETA 3D39A 4U6YA 4WW2C 1U8JB 2DQUL 1B0GB 4GKZA 2R4RL 3PP3K 3V6BR 4BZYA 4HT1H 1QFUL 3Q3GB 4LPCA 3IB4A 1RUPL 2EKSA 3ARFC 5DQ9B 5AZ2H 3WNLA 4RQQB 4LHJB 3V7AE 5HHME 1EO7A 3WFBL 2GITB 5ALCH 4PG2A 2QSCL 1MCCA 2VABB 1JPFB 3DGGA 3L3KB 3MGAA 2YK1L 4NCC2 2YD6A 5HHNB 4AIXA 4IEFB 5GGSB 4X9BA 5K9JH 3CU1A 3LZFH 5CGMA 4G7VH 5DJ6A 3T1FB 5F88B 3T1WA 4HEME 3BIKB 3O8XB 2VIRB 3HG1D 2DDQL 4I0KA 2ZKHL 4HJGB 4UILH 3P4OB 2AQ2A 4L1HA 3UCRA 3MLZH 3MREA 1AGBA 4MLSA 3FZUC 2APTA 1ZWIA 4OD2A 4N9OB 3CX5J 1BOYA 2E8YA 1KIRB 1TZIA 1U8PB 4HH8A 5EOCJ 4K7FA 1WITA 1TNNA 2P7TB 3MRBB 1HEZA 2O5XL 4P5TB 1IARB 5T3ZE 1ORQA 2NY4B 4YNYA 3HC4L 3WKML 5TQ0L 4HUMB 1MHHB 2JB5L 4OGXH 2J7LA 3MO1A 4G43A 2F54E 3D1MC 3U4EA 1CFVL 3VGDA 4QRQA 3E3QE 3W39B 3MXVH 1K8DB 2VWEE 1I1YB 1RUKL 3P0VH 4NWTH 3O45B 4S10A 4N0UB 4DW2L 1FFQA 4PGDA 3DO3A 4NKMA 3LQZA 1J05B 4R2GD 5JPNB 3FQWA 4F7EA 1WCQA 2DYPB 1KG0B 3BFOA 3GNML 1F6AB 2GCYB 1IKNC 1UWEL 3MRFA 5E2TL 3VFTB 5HVFB 3H7BA 3B2UC 5DUBB 1RUAL 1C1EL 4G6MH 4C59B 4QRPA 1EFQA 2VZSA 5KJRL 3O0RH 3IDGA 1WAAA 4F7TA 5J6GA 3BZFB 5DMIL 3FQRB 5CBAB 3IDIB 3MNWA 5E1AB 1C5DB 1N6UA 4DGVH 3CZJA 5FKPB 3VI3F 3FZUD 7FABL 1AY1H 1NCUA 2QL1A 1R0AL 1Q8MA 3BZ4B 2HP4A 3H6JA 3QZWA 3TVMC 1BVLB 1FYHB 1B0WA 4HMEA 2FJGB 4Z7UE 5M94B 2E7CA 1S7TA 3PDOB 5C9KA 1RIHH 3CXDH 3QNZA 4NCC1 5L6YL 1CGTA 1K3ZA 1OQXA 1XCQA 1ZSDA 4G8IB 1ZT4B 3ARPA 1P4LA 2EDWA 1XT5A 4NNXA 5DI8B 3SY0B 1U95A 1JRHH 5KSUA 4KZEL 4ZTPL 3UBXG 3G6JF 4ZFGL 3L9RB 3WL9B 5LXGH 1EMTL 3IU4L 3C5ZC 4R3SB 2EYTA 3G08B 4U1KB 5IEHA 3GSQA 3B4NA 1I1FB 1IGYA 3PABB 4PYHA 1DBJL 2G2RA 2ATKB 1RFDL 4WI2A 2JJWA 4PJXE 3BH9B 1KBGL 1P1ZB 5HY9A 2H8PA 4AQOA 5AD0B 3DOSA 5C6WH 3EJJX 1DE4B 3K46A 1YJDC 4H25B 1BVKA 3D9AL 4L3EA 3QI9C 1VERA 4LQFL 2G5BB 4OLXH 3JUZA 5C7XH 1VFAA 4KQ3H 4D9QE 5B38B 3JV6A 3F5WB 1ORSB 5FYKU 4X6EB 2NY0D 2YRLA 3G5ZA 3RL2A 5EBMA 2CDEA 2DKUA 3QQ9C 3TM6A 1K6QH 4NM4L 3ZKQD 4J12A 4ZOEA 3CFJA 2J8UF 4GKZB 1XGQA 4NZUH 3OKNA 2DJ4A 5D1XA 2Q86B 2EKSB 1TETL 3NH7H 1GGBH 1NAMH 4MJ2A 1WK0A 2Y7QA 4NQVA 3VMPA 4I2XE 1EJOL 3B9KA 4LLWA 4F8TA 1TCMA 1IM9D 4Q2ZA 5DC4B 3DGGB 4OF3A 1U2HA 1SY6A 5D7IF 2Q20A 3T77A 4I9WE 2AV7A 4NUGH 5DJ6B 4PB0L 2DWEB 4C4KT 4LPTA 4XCEA 4JHWL 4G8GD 4MSWA 1FDLL 2M1KA 1C5CH 3MREB 5D71H 1AGBB 3TA3C 1N64H 4OD2B 2ZUUA 1KEML 4X80H 4TSCH 1TZIB 3ARDA 3QI9D 3BVNA 1T22A 4HIIA 4K7FB 5EBWA 1FE8L 3V0AC 3C6LD 1H3PL 1X4ZA 3BDYH 3PXJA 5T1MA 4YNYB 3QQ9D 5EOQH 2DQDL 4K94L 4G43B 5B21A 4E5XA 3U4EB 3HFMH 4IHOB 1H3VA 1X9QA 2Z31A 4RWHA 1MAMH 1CLYL 1YNTA 3BKJH 3MTRA 3RWIA 3X3FH 2WW8A 1QLFA 3MUGB 5GGTH 5KANI 1D9KC 5I8KH 1YJDH 4RMQA 4PGDB 3ULUC 2H45A 3V79C 2Y9RT 3LQZB 4CMHB 1U0QA 3FOLB 5FUZH 4JRYA 4Z7WB 3FQWB 1T20A 4HIXH 4F7EB 3RWDA 5JQ6H 5GRJH 1GHFH 1VPOH 4UIKH 1QO3B 1MUJA 1J1PL 1DQMH 3MRFB 3N1QC 3TWCL 1KXVC 1X5JA 3H7BB 2VLRE 4XNXH 5HGBA 3SE8L 3VFGL 4PUBH 5IMLA 2B39A 4F7TB 4N8CL 4OCSL 5GGUA 1YY9D 4DN3H 4EXKA 4P46C 4GRLC 4LDOB 3MNWB 5CD3A 2X4NA 2UZIH 3CMOH 3DXAE 3V6FA 1G84A 3I02A 3QAZC 1BM3H 3M45A 2FCBA 4CJ1A 2DQCL 3VFWA 5E5MA 1MSPA 3INUL 5L88H 1DBKL 1UA6H 1R5IA 4FQCH 4LEOA 1A4JA 3MRMA 2EH7L 2APVA 2YMXL 3QNZB 4U2ZA 2R1WA 5I16A 3IU3B 4ZD3L 1ZSDB 1B0RA 4BSVA 3KVQA 5AUMA 1P4LB 5J11B 3UYRL 4NNXB 5F96L 3RA7H 3WSQL 4CKVX 2UWEE 1XEDA 2CGRL 4P9ML 2GSIB 5KSUB 1I1AC 1P6FA 2ZJSL 5BOZG 1CXEA 3WFDL 4J7RA 5E6ZA 1PG7H 5F6HJ 5IEHB 3GSQB 2YWZA 3KPPA 5EU4A 2IC2A 1JF1B 4EN3C 4PJHE 2Q76A 1R3LB 1A7QH 5HVWA 3KNBA 4KI5C 3TBYA 3HR5A 4AK1A 3HUJE 2V2WA 4O5LH 4NO0D 3MV9E 1TTFA 1KENH 2H8PB 1MCRA 5IQ9A 1HKLL 5DJYA 2Z0BA 2H1PH 3KWWA 2PW1B 3V52L 4LCUB 4JPVL 4L3EB 2FSEA 5FOBA 2PCPB 4P46D 4GRLD 4Q6IA 1VFAB 4XXCA 2E7LC 2GTWA 2R15A 3ZL4L 3PG2A 5CKAA 2H2PD 3VWJC 1OOAA 3G5ZB 3WXVH 3I6LD 5EBMB 5HYJE 2CDEB 5F7NC 4YC2B 3RL1A 2BVPA 2OJZL 4BZ2H 1DLFH 3P73A 3CFJB 3S98A 1CXHA 4N0YH 3OKNB 5D1XB 1UEYA 4OF7A 5GZOD 3GSNH 1BFTA 3HNSH 4HIEA 4LPXA 2HT3C 3PGCA 1CDBA 4JGUA 4YHNB 2Y7QB 4UTBH 5CJXC 5HHQA 1EJ6A 4PJGF 1JGVH 4LLWB 3RTQC 1A0QH 4Q2ZB 2XN9E 4M43H 1FGVL 4V1DE 3A0OA 3KR3H 2EXYD 4X8JA 2WUBL 3T77B 4EN3D 2GIYA 4GG8A 4OF6A 3H3PH 3HC0B 1A5FH 2EC9U 1WFTA 3BT2L 4KI5D 4F9LA 3F58L 3QDAA 1KPRB 1FFNA 1DP0A 2XPGA 4MSWB 3RUGE 3MODH 5C09A 3BKYH 5CFHA 4UT6L 1DQQB 4DGIL 3QG6A 3T2QA 1ZV5A 3BVNB 4X98A 32C2B 5JUEH 3HNVL 4MDJA 2BVTA 2P5ED 4ENEC 1RIUH 4Z7QF 1EHLH 3TNNB 2F5BH 5GRUH 2J1KA 4Y5VB 1UACL 4HWZB 1LEKB 4M8QA 1Y6MR 5TH2A 3U83A 4K3EL 4E5XB 5E6YA 1FLRL 4CBPA 4OLWH 3O8XC 3L7FA 4JDZB 5FGCB 4YDKL 3VXOA 2HT3D 3DURB 3RWIB 1QLFB 3DPBA 1JZ2A 3RTQD 4DCQB 4ACPA 1DLHA 2VDPL 3QO0B 3ETBF 4JRYB 5JDSA 1T20B 2NW3A 1OCWL 3NA9H 3O6FB 2D7QA 1MUJB 2VZ1A 4P5TC 1XGRB 4LNVA 5HGBB 2NY4C 5IMLB 1A7NH 4M3KB 5GJSH 5GGUB 1YEKH 2B7DT 3BW9B 1P84J 2ICWA 2Z4QA 3QYCA 4GRWB 5CD3B 1BHGA 2X4NB 3WMSA 5F3HB 3I02B 1LO3H 1QFWI 1N2RA 3VFWB 3MYZA 2LVEA 3KPMA 4HK3J 5IQ7H 1RIVL 3FT2B 2DI8A 1R5IB 1NCBL 4NZDA 3FB7A 4LEOB 1A4JB 3MRMB 3OG6B 2Y07H 2XRAL 1D3CA 2C4XA 5B4MC 1FNAA 1B0RB 4UU9A 2F54A 5AUMB 1T2JA 3LRHA 5TE7L 4M1GH 4JCLA 4OLVL 3SE9H 4TSAH 3ZKSD 4RFEA 4MHHG 2CLZA 3NIDE 1ZVHA 3WE6A 4LMQE 4CU8A 5C0IB 4U1MA 5I1DA 5EU4B 1T80A 4MAUL 4LAJH 1A3LH 2FL5A 5JHLH 5JXAL 4CGTA 3H7LA 1EXUA 1LVEA 3KNBB 4H5SA 1JGLH 3TBYB 1PX4A 2QEJA 1FZJA 2BVEA 4M1CC 4UNUA 3HR5B 4F33A 4S1DD 4N0FA 3UMTA 3AM8C 3TN0A 3TPUB 3RVVD 1DEDA 1PLGH 1AR2A 1KELL 5IQ9B 2VQUA 5DJYB 3MRHA 1G9EA 2BRRL 4OF8A 1VEPA 4YXHL 3KWWB 4HJ0D 3FB6B 2FSEB 1BPVA 1AI1L 4U0RB 2ARJQ 4Q6IB 5D2NE 2HWZH 4NHUA 1T1YA 2LTQB 5JPMA 3I3DA 4PRBB 4Z7UA 5FK9B 1F42A 5EOTA 4G80A 3RL1B 5HDQH 2BVPB 3GGWA 1A14L 5B3JF 4LNRA 1NGXA 3P73B 2CK0L 3QPXH 4YUEH 2I60H 1K4CB 3VWKB 3DX9A 4R90H 5DHXB 5B4MD 4HIEB 5GRXG 3S37H 3PGCB 3C60A 4OFVA 1BEYH 3KG5A 1XF4A 4AH2B 4U49A 2BHUA 3JV4A 4WFGD 3BRFA 3WO3B 3B5HA 2KBGA 5IR1A 1ZLWK 2H3NB 2FEDC 4KDVA 4XMKH 5I1AA 2EIDA 5CJ5A 2HKFH 3P0GB 3KXFE 3E0GA 1MI5E 4NQSA 2XZCH 3E1F1 3ZTJG 4EVNB 1S78C 4HXBL 1EFXB 2OI9B 1IBGH 1I85C 1M7IA 4GG8B 2ZSVB 2ZSWA 3V0WL 3I9GL 4QKXB 4DZ8A 2MMXA 4PJXA 4M1CD 2BSRA 4QTIH 4TYUA 1OAZH 1N26A 1XF5A 4XRCA 2X42A 2AK1H 3FRPA 4PJDE 5AZEL 3RIAK 5C09B 3WFEH 4P2QD 1A21A 1YN6A 5GSRB 3QG6B 4L8DB 2BXZA 1OSZA 3MLUH 2IPUG 1F45A 2RFXA 4KKBC 4X98B 4PG2C 2DMCA 4MDJB 3VGGA 3K74B 3VXRD 1YYML 1NL0H 5GGRY 4OM1L 4YHKL 4A6YA 4WFEE 2NNAA 2FX8L 4Z95L 3VFMA 4K3GA 4YDJA 4JPKL 4KJQC 5HHMB 3L7FB 3VXOB 1FNSL 4I2XA 5J1AB 3QEQD 2XZZA 4EEEA 3GUTA 4WCYL 5HI5D 2DQJH 4NKQB 1TZHA 4P2CG 4J6RL 4IRSD 3VG0H 1DLHB 3TJEL 4BQ8A 5I8OH 1VDGA 5IESL 1S7VB 3TFKC 5JDSB 4PJ5E 3C08L 3EKCA 1MCPH 5IB2B 1QRNB 1WZ1L 2NW3B 5C3TA 3ROLA 3T0DA 3OAUH 5HGAA 1NBZA 1D5ZB 1RZFH 1S78D 1HYSD 3CH8A 1NGPL 2AK4E 5DJAB 1AXIB 2FX9H 3ZHDA 3D39D 3EZJB 4ZO6A 1A3RL 1ZA6A 4TULL 1U6AH 1JF5A 5HHPA 1FNLA 4W81A 1S8DA 2Z4QB 1E4XH 4QRUA 4L3CA 1TZGH 3TT1H 2XZQH 1HHJA 3O2DL 3WFCL 1S3KL 2J88L 4UINH 4IBLT 1N2RB 4M61B 3KPMB 1YEIL 4HWNA 5T1LA 5HD8D 3Q5OA 3MRLA 4ONFL 3IDJA 4U1HA 3BEVA 3V5HB 3V9FA 4CMHC 1KN2L 1A6TA 3MV8D 1FYTB 2PO6B 3OGOE 4UU9B 2F54B 3KLAA 3S36L 3HHRB 3GSUB 4PR5A 3EO9H 4CL7A 5LGHL 2ORBH 4HQQL 4P0DA 3S88L 4RFEB 1EBAA 3NN8A 4Y4KA 3KHOA 4KJQD 3MA7A 1OARH 2CLZB 1ACYL 3P9MB 3QXDA 3WE6B 5D93B 3GHBH 4N0RA 5I1DB 2VXUH 1IE5A 2FL5B 3DUUB 5CIPB 1XH3B 1FLTX 2R29L 1L7TH 1OW0C 3TFKD 4H5SB 1WIUA 1QEWB 1FZJB 1MJ7H 4MB3A 2VLJB 1QA9B 4G9FE 4MVBC 4N0FB 5IIEA 4GXVL 5BV7L 3TN0B 2VLRA 2WNGA 1IGFH 2YS4A 3S6CA 3O11B 1SEBA 3FHQA 4FFVC 1NCWH 5J11C 5ICYB 3LV3A 5TE4H 5HHXH 4OLZH 4XWOC 2DQGL 3DXAA 2WMPA 5IJVA 1T1YB 5DJCA 4PGBA 5F7WC 4Z7UB 2F74A 5EOTB 4G80B 2QQLH 3WCYA 3G6DH 4P23B 3M8OL 1NGXB 1FL6B 3G6JE 4HUXA 1KTDB 1SJXA 3I6KA 4IRZH 1KLGB 3RPKA 4PS4L 5I1IL 2VUOA 4G42B 4PP1D 3C60B 4EI6A 1I7ZA 2UWEA 3JV4B 3JWDC 4GG6F 3ABZA 4ZUTB 2J2ZA 5IR1B 1S7XB 4YO0B 5I1AB 4QRPD 4X4ZA 1J0YA 4O00A 5I19L 2E9WA 2PXYA 4POUB 4NQSB 4BJLA 1QP1A 5BO1H 4PJHA 4ZNCD 3FN0H 4AM0A 2JIXA 1XGTA 1MFCL 2ADIA 1M7IB 4RGND 2ZSWB 1J7VR 4YC2C 4DZ8B 1KT2A 4PJXB 3HUJA 1XF5B 4KC3B 5FO7B 1GYAA 3MV9A 5IEKA 1NBYB 5D1XC 2ZP0T 4DKFL 5TQ2L 1VACA 1I8MA 2XWTA 1YN6B 4FFVD 2J8UE 1OSZB 4HFWA 4YIQB 5DUMH 1T04A 4FTVE 3B9KC 1BBDH 4LCYB 4UZGA 3WKNA 5HYJA 1FBIH 2GT9A 4GMTH 1KIPA 4JY5H 1OAXH 1Q0XH 3QHFL 1L7IL 1U2CA 5KSAA 2AJXL 3QWRA 1FHGA 4HIJA 2Q8BL 2IQAB 4OZHF 1KEGL 2NNAB 4LIQE 5HHVL 2P4AB 4EUPA 1GJIA 3VFMB 1DANT 4YDJB 4ZUUA 1T2QH 1G9NC 4S1SL 2O26U 2PKDA 4DK6A 4MJIE 5CJQL 5D7IE 3LN5B 1Q0YH 5IBTL 2VMFA 4I2XB 3GUTB 3S97C 1KCSL 4LSUL 1HCVA 1NSNL 2ZCLL 1TZHB 3PV7A 1KB5L 2XN9A 3PUCA 4V1DA 5E2VL 3FQUA 4XZUA 4KHXL 4JRWA 3RY5A 5EWIL 1U8OA 4AEEA 5DD3L 4DK3A 3ROLB 4IJ3B 4YEEA 1XIWA 1U8MA 5HGAB 1NBZB 2P47B 4XP1L 4ESKA 3I2CL 2NY7H 4WHCA 4OJFL 4PBWD 2VLKE 3IFLH 4PY7A 5ENWA 1OF2A 3IFNH 4LLUA 4Y5VC 1YEFL 3FCTB 4HKJA 5HHPB 3RUGA 4HX1A 4XVJL 4IOSD 1MWAL 1S8DB 1YUHA 2AI0H 4QRUB 1JMXA 4L3CB 3MLRH 1HHJB 3JWDH 4JE4B 5GJTL 4HFUL 1BGXL 1FFOA 5DEGB 5B39A 2AEPL 4L4TE 3B9KD 4KDWA 4BQ6A 2VKXA 4JFYA 3MRLB 4APQB 5FYKL 4U1HB 3BEVB 1J0JA 1L6ZA 1MREL 3B83A 2OZ4A 3T2OA 1H3UA 1A6TB 2CSPA 4Y2DA 3EDKA 3O6FC 3MRCA 4NKDA 4M7LH 4PR5B 1ZT1A 3C8KA 4QRTA 4H1LA 3BHBA 4Y4KB 3NN8B 2P8LB 4ZAKA 4HXAL 5AYUH 2IBZX 4BUHA 3QXDB 4OCLC 2AEQH 5EOCL 1EEYA 2QQKH 1WQVT 2RCSL 4X7DC 3G04A 3GO1H 1P4IL 1SVZA 2BY3A 3MOAL 3UTSE 3ARDD 4LVOB 2YA0A 4WWKA 2R56L 1ND0A 1BREA 3RGVA 35C8L 5IIEB 4NM8L 4AMKL 2VLRB 5FUOH 1SY6H 3QUMA 4HPYH 4WGVB 4OBSA 4HULB 1P6AB 1SEBB 1NFKA 3BRGC 3LV3B 4LDEB 2H9GB 4PJ9B 4M6OL 1RZKC 1LWRA 4L3AA 2Z31D 3ULVF 5IJVB 5DJCB 4TRPL 4PGBB 2F74B 1HI6A 3WNMA 3ULVL 1J1XH 2BY1A 1JZ8A 3C5JB 5EG6C 1B6UA 2AS5M 4HUXB 4OAWA 5K9QG 5DRWA 1XF3B 4XGZA 4HUVA 4AENA 4R8WL 4EI6B 1I7ZB 1X44A 3VA2C 5DC0A 2UWEB 5DJ0A 1IKFH 1YQVH 3VH8B 3O6LL 2XTJD 2CUHA 5DZLA 3K1KC 4HGWA 5E7BA 1FGNH 5DEFB 4XNZB 2AXJA 5E4EB 4WU7A 4ZFFA 5MERA 2PXYB 4JFPA 4U0RC 4Q6IC 4XXCC 4PJHB 2NY1D 3VE0A 3SBWA 2JIXB 1XGTB 3MJ8A 4XX1G 2UVFA 2LTQC 5DQJB 2ADIB 1N6QH 5GRZA 5ISZB 3BDXA 2FBOJ 1A1OA 3HUJB 3WNNA 4LU5H 2AJVH 4P3CL 3OR7A 2R0ZL 1DDHA 2FB4H 2FD6H 3MV9B 2A6JA 5IEKB 4U05A 1UC6A 3SEPA 3VWKC 1VACB 4JPWH 3CVHL 1D5XA 3STLB 4HFWB 1T04B 2YUWA 5D2NA 2DF3A 1AO7E 2VZOA 3P40A 4NKOA 4WFFE 1QZ1A 4PV9A 3L7EB 4JM2F 2M2DA 5HYJB 2GT9B 4GRWH 2VUYA 1VADB 2ILLA 4PJGE 1UB5A 3BD3A 4HBCL 2GK0A 4PJBF 3V0VA 4HS3B 2OI9C 4HIJB 3WN5A 1FNHA 1PZ5A 2IMNA 2NW2A 4TNWK 1B4RA 2XKNB 5GGVL 4EUPB 4JDTH 4M7ZB 4ZUUB 1MCNA 4F9LC 1W0WA 4K55A 4O2EA 2H41A 1RQ5A 4Q58C 4XPBH 5A2JH 3NVQA 1SM3H 4OLEA 4PRPE 2XN9B 4Y4FD 3QBTB 4HIHA 4V1DB 4R4ND 5LCVH 3U4AA 4XZUB 1NC2A 3KXFA 1MI5A 2QTEA 5D7LB 3WIHH 4AEIL 1U8OB 3KPRA 4WO4A 1PKQB 1XIWB 3R8QA 2HJFB 5ENWB 1OF2B 1IMHC 2EDFA 2YSSB 3CLEL 5INDA 1XGUA 1V7ML 4PJDA 5SWSD 1MCIA 1DSFH 4HKJB 4OQ1A 4HX1B 3RUGB 4Z8FH 1A7RL 1YUHB 2RIKA 3N85H 3QIWA 4QT5A 1AQKH 4Z7QE 1K4DA 5C6TL 3RI5K 1QG3A 4WUUB 1FO0L 3B43A 1FFOB 3JXAA 1QLEH 5B39B 4OF0A 4GLRI 1VA9A 2XXCB 2HN7B 5C86A 2D9QB 4LLAA 4QGYA 5JMRA 2ADFL 3FHAA 4RISH 1BAFH 2EEBA 1WJ3A 3EFDH 3MRCB 4DTGL 1H15B 1JNLH 4RIRA 5J6HB 3NBNA 1XGYH 1ZT1B 4L4JA 5JW5A 1OM3H 3OKYA 3BHBB 4H1LB 1F3JA 3OKDA 4ZAKB 1CQYA 1GGYA 1A6VH 3A6CH 1EEYB 5CLTA 5F7UA 4XWGH 1XF2A 1ZVSB 5BQ7A 4ZPVA 5L2KE 5IHUL 4PJ5A 4LCCA 4U1NA 1C7TA 5KVDL 5C0JB 1EDQA 5CLWA 3UC0H 1W0VA 4IIQA 1ND0B 5MEQB 1FC1A 3RGVB 2AK4A 2X44D 1R5WA 3QUMB 3GMNA 1L6XA 1S7UA 1HIMH 4PTTA 5LWYL 5DHVA 5JIPA 3QDJE 3CDFA 4MB4A 3E3QC 1Q9WB 1QOKA 4X4YB 4PLKD 4YQXH 3TYGH 1I8LA 1A47A 5D93C 3KPSE 3V4UH 1CZ8L 1OTSD 5KSBF 4OAWB 5DK0A 5DRWB 3EHBC 2IANE 3VJ6B 3A6BL 4AENB 3TT3H 3CUPA 5EORH 5C70A 4HUUA 3TN0C 1WISA 5GGQL 2E9BA 4JQIH 3UJJL 1G6VK 2V2XB 3NCFB 4HGWB 1MCWW 5JORB 4M6ML 4WU7B 2W1NA 4S0TD 5ECJE 4ZFFB 4RMUA 4DN4H 3BIAX 4JFPB 1WC7A 4LPYA 15C8L 4FA8A 3MLPA 5TPWL 3U7WH 3DSNA 4NCDA 1HSBB 1AD0A 2X4OB 3MJ8B 4YHLL 3PP4H 3IRZA 5HGDA 5C1MB 4G9FA 1T03H 4P23C 4YH6A 4UT9H 5TFSH 1C16A 5GS0L 4U1GB 5T3ZD 2A6JB 3U1SL 3VXSD 2VLLA 3OX8A 1JFQH 4I0CC 5ALBL 5I75B 4HF5H 5B3JE 2I27N 3C60C 2CIIA 3S35X 1UFUA 4IRJD 3KJ6L 4XP9L 4JFOA 4NKOB 4E41E 3FJTA 4TSBH 2X4RB 3WHE0 5CZVL 2AJUH 1F4XL 1VGEL 1J86A 1N3NA 2VDQH 1JV5A 3G6JA 2OSLA 1UB5B 4L1DA 4XMPH 3CSBA 3GI9L 3OKMA 4Y8AA 2GK0B 4XHJD 3V0VB 3HZYA 4CADB 1PZ5B 3QG7L 5HYSG 4JZNB 4P2RE 4O2EB 5T3ZH 2VISB 4FQ2H 3NZHH 3LKOA 4PLNC 3I84A 4TUKL 3TN0D 3HC3L 1U3YA 4HIHB 5CILL 2Y5EA 1NC2B 4P4KA 4ZO7A 1ERNA 4LFHG 4NYLA 3EYQC 4G6JH 1NMAH 5ACZA 1M7DA 4LARL 4GFTB 4WO4B 1ETZA 4NQEE 5MEPB 4GJTB 4JG1L 2DQHH 1DBBH 2I9TA 4C56E 5INDB 4OLUL 1FORH 1M71A 3IXAA 4PJDB 4CDGC 4ODTH 3PGFL 4C54A 3WUWB 3QIWB 4ZS7H 5JMOC 1K4DB 3P0YL 5D8JL 2J8UA 3C60D 2XV6B 3CFCH 4FTVA 2AAVA 5I1KH 1AGEA 1JI1A 4FQ1L 2YOCA 4F15B 1JHLH 4MNQD 1RU9H 3FFCE 4AL8L 2YD1A 3VXNA 1JBJA 4IJ3C 2BCKA 1NCCH 4LASH 4RIRB 4MJIA 5JW5B 5D7IA 5D2LF 1G7IA 5FM5M 5D72H 1LP9F 3VXUB 1F3JB 3OKDB 4Q7DA 3IVKA 1PG7W 1T5WA 5CINH 1D6VH 1XF2B 4WTXA 2B5IB 2X1XR 4PJIF 3MC0A 4ZPVB 4YXLH 4OT1H 3SJVA 4LCCB 4U1NB 5I18H 3GMQA 3TO2A 5J57B 4D9QD 3VD9A 4IIQB 3TIEA 4LOUD 4WDIA 2VLKA 1ONQB 3FL7A 2AK4B 5FDYA 4APQC 1PAMA 1FVDA 1J8KA 1R5WB 3GMNB 1I9EA 1S7UB 1XZ0A 3VFPA 2F15A 4PTTB 1MCEA 5DHVB 5CUSH 4OD1H 3X13A 3LEYL 1NGWB 3CX2A 1J88A 2BVUA 2MOVA 3Q48A 1X5KA 3MJ9L 1IGCH 4Y4KC 3GHEL 4F37F 1DQTA 5F6HI 1U8IA 3KLSA 4L4TA 3VG9B 5C08E 4P2YA 4GOSA 2ARJA 2DIAA 2VE6A 5SWZB 2ZCHH 5DUPH 3QNYA 4HC1L 4R9HA 1A7OL 2FX7L 4Y19D 5DK0B 1CFSB 4Z9KB 4LVOC 1JWUA 5CJOL 1AJ7H 4I9WD 4M5ZH 1CGUA 4HUUB 1AXTH 3GIZH 5A40E 4GAGH 4FMFA 1MJ8L 4A6YH 5IW6A 1UB6B 2X9WA 3F7YB 4RRPA 1XR9B 3CFEA 1PY9A 4G6AC 5EU5A 1KULA 4G3YH 1LGVA 5CEXA 1MFEH 3VGAB 5E2WH 1OWWA 4YJZL 3CFKA 3P30H 4RMVA 1PVHA 3MOBH 3T0VA 1AD0B 4MQTB 3UTSA 3IXTA 5HGDB 4G9FB 3WXWL 3FB8A 5KW9L 3EZ8A 1C16B 4DOHE 4DKEL 5T1LD 4AEHL 3FQTB 3EBAA 5MI0B 2VLLB 3OX8B 1S5IH 3CFBA 5B8CA 2R0KL 4OZ4B 4QHKJ 2CIIB 1MHCA 4GRMB 3RZCB 2RJMA 4M6NH 4Q97A 1K85A 3UROR 4XNZC 5DURB 5T1DL 3WNKA 1X5GA 3EGSA 5E4EC 4JFFB 4IOFC 3R0MA 1N3NB 3DVFA 1L4IA 2PXYC 4GG6E 1JV5B 2OSLB 1K5NA 5BS0D 1WZKA 2F58L 3BKCH 5I1JL 4JQVC 1ZE3C 1AGFA 1KLUA 2C3HA 2Q1EA 1BX2A 1RHHA 3G6AA 3SO5A 1JPST 3LKOB 1RJYA 2VLRD 4P48A 3NTCH 1CR9H 5FAAA 5FA4A 3GMOA 4P4KB 4G6AD 5C92A 4XPGL 1NJ9A 3BD4A 1BQLH 1L0XA 4TUJB 5ACZB 4XPHL 3DXAD 4ETQA 3L1OL 5DQDH 5AG8A 1G6RH 2O5YH 3IS1X 3V6OE 2X5PA 1BQUA 2I9TB 4LSPL 3IXAB 5LBSH 1XGPA 3KS0H 1HH9A 4XVSL 5SWQA 4I18A 1IZKA 1IC1A 4M7ZC 5ID1A 4QRSA 1KV3A 3QIBA 1CK0L 4JY4A 3QDGE 1MCOH 4ZUSA 5FECA 5IFAL 5H37G 1AO7A 4OZHE 1AGEB 4GAJL 3PV6A 3MQIA 2N56A 3CVIH 2G5RA 1I8KA 4K7PL 4IOFD 4PJGA 1YEHL 3VXNB 4GW5B 2PXYD 1Q9LA 1XIWC 2BCKB 2RQ8A 3CK0L 3O2WH 4MJIB 4NO2A 1G7IB 2Y25A 5EULV 3IVKB 3KYKH 4E42A 1YEJL 3MYJB 3MV9D 5EUKA 1WWWX 3KHQA 4S2SA 2D0GA 4KMTH 1LK3L 5F44A 2NY2D 5IFHL 4HWBA 3OJMB 4LAQH 1P69B 4ODUA 5IWLA 2GJZB 5E03A 3TIEB 2J3SA 2QSQA 1BFVL 2VLKB 2AERT 2YKLH 5CSZB 1CD0A 1D6EA 1FVDB 3MJ6A 1G7JB 2PTTA 4YFLF 3HI6H 1AE6L 1XZ0B 5FYKE 3VFPB 4CDHA 3W5MA 1GOGA 3B9EA 2V9TA 5KSAD 5C0NC 3QWRD 4J1UA 2I26N 3GMPA 5C0DA 1NMBH 3X13B 2P24B 8CGTA 3HAEG 1NKOA 4ZAKC 1UT9A 4D3CH 1M6OA 1HH6A 1U8IB 1BOGB 1WTGT 4L4TB 3D69A 4HS8H 2WAHA 1MCJA 3TGXA 1IGIL 2AJSL 2R1YA 3LSOA 1G7HA 3RWGA 2F19H 4WNQA 2VE6B 1F4YL 2XN9D 1NLBL 3FT3A 4V1DD 3QNYB 2VITA 2X1OA 5SV3A 2J6EH 1QSEE 1JWUB 1Z9LA 2X4QA 3LD8B 1S7SB 5C2BL 3D2UA 5I1GH 2XI9A 3RGVC 1XIWD 4M7KL 3ARRA 4OGZA 1U36A 2B1HL 3LS5L 4HG4J 3CFEB 3C2SA 4M4RA 4EUPH 5CEXB 2B2XL 5L8JB 5DMYA 5JOEA 2YEZA 5L2KA 2H32A 3CFKB 4MA8L 3NIGF 3UTSB 3BJLA 2BX5A 3IXTB 1VFUA 1QVOA 2BC4A 3FB8B 1U8KA 5J4MA 1JUFB 3V2AR 3ULVE 5BJTA 4I77H 4KVNL 3HE6A 3OZ9L 3WIIH 3CFBB 4FQHA 3QDJA 2ATPA 1J5OL 4Y2DD 3TO4B 1MHCB 4UIMA 1CICA 5E08H 4G9DB 4C58B 4DQOH 3EDEA 1YEGH 4ZAKD 4U7SA 3KPSA 3VFRA 4RGOL 1J1OL 2ZUTA 4EIGB 4LLVA 1CGXA 1K5NB 3HLAB 2NLJA 3GDBA 4XMLL 3SBWC 3H0TA 1UZ8A 2IANA 2APBA 1ACZA 1YY8A 4RDQG 1I7TA 1BX2B 2OR9H 1RHHB 1P2CA 5DD0H 1KNOA 1HDMA 4WWKD 2EDNA 3ZKMC 4U1GC 2OZ4H 1SEQL 3E6HB 1FL5B 4OI8A 5I75C 5CEZD 5EIQA 3UP1A 2D03L 3P4NA 1NJ9B 5GXBB 1B6DA 1F3RB 5D6CA 2DOCA 4ETQB 5MP6L 1GPOL 4ZOAA 2P49B 2BXYA 3EW3B 2YD3A 1IAIM 4NRYB 2FR4A 1NUDA 5EZJA 4L8SA 1XGPB 3V5KB 4ODXA 3WN5C 1GC1L 4EDXA 1ZOXA 1HH9B 4OTXL 5SWQB 3QUZA 3X11A 3PHOA 5ID1B 4QRSB 3QIBB 3Q5YA 4JY4B 4ZXBB 1UJTA 5FECB 1CGSH 4POZC 2K7QA 3ARGA 4FN0A 1AO7B 4PJBE 5CEZH 1Z6JT 3HE7A 1BIHA 2X1QA 3BPLB 3PV6B 1UWGL 3MLYL 4UNVA 4FZEH 4HKBA 1FL3A 4PJGB 1RAMA 1S7RA 1JGUL 1Q9LB 4WO4C 5LAXA 4F7CA 4DGYH 5ADOH 2HLAB 1CLOL 1Q1JL 3RU8L 4MA3A 3Q1SL 4QHLA 3S35H 4P2RA 2Z9TA 3RIFF 4NO2B 2A1WL 5FEBA 4J3VA 4GAYA 1MJUL 3PL6B 3DVNA 4DVBA 4PRPB 3BGFB 3KDMA 5EUKB 3QIWC 4KGJA 4S2SB 5JIKA 2NZIA 4UT7H 2CH8A 4NNPH 4Z7NF 3MRPA 1SBBA 2ZUSA 2R1XA 5FFLA 1BQHG 2IWGA 4NQEA 2UY6A 4ODUB 3PWJB 2QKIA 2DWDA 4P4RA 1B4JL 1D6EB 2PTTB 5GHWL 4C56A 3AS0A 4O58H 5L7XH 5F1KC 1P9MA 4J1UB 1JJUA 5C0DB 3OG4B 2AV1A 4YX2L 3E8UL 4LCWE 3NIFF 1CIUA 4J3WA 5FCUH 1B9ZA 4DAGL 2HKHL 1M6OB 4YXKL 2GEEA 3D69B 2HVKA 2KKQA 2R1YB 4MQ7A 2B5IC 1MPAL 4KHTL 5SX5H 3RWGB 1CIDA 3FFCA 3FT3B 1KC5L 3K2MC 4LCCC 5I8CA 5IT2L 2VITB 3KXFD 3WD5L 1MI5D 2NTFB 2FWOA 1SMAA 2PW2A 4OZGF 2X4QB 3KPRD 4IIQC 3D2UB 5IB1A 4WO4D 3GJFA 5HSFA 4S1QH 4XCYA 1CDHA 5BVJA 1MNUH 4K71B 5HHOE 2QHRL 1YYLH 2ITDA 3LAFA 3LIZL 1T0MA 3GM0A 2YEZB 3QIWD 3ESVF 5L2KB 2H32B 5BOPA 1I8LC 4X6CB 3IKCA 3SOBL 2WIIB 1AKJA 1QVOB 2OQJA 2BC4B 5M95B 1U8KB 1LO2H 3R1GL 5TDNA 1I75A 4LGRB 4NN5B 5BJTB 4OV5A 2G9HA 5E24E 3HE6B 3SGKA 3ZYIA 2Y36H 4FQHB 2ATPB 5A16A 1I4FA 1QSVA 2VR9A 1TPXC 4UIMB 4OFIA 1CICB 5KSBE 1P7KA 1T4KA 4ZS6D 5H94A 1ADQL 4O2FB 5ESQA 2P8MA 2EZ0D 5B38G 3KPSB 2R4RH 5C08A 3VFRB 5ESVA 3K3QA 3UTPE 1QFUH 4WENB 5F8QC 1RUPH 3VGAC 4BELD 3D85A 1J0HA 2NLJB 3MACL 5DDHA 2VJXA 4IS6A 4BYHA 4F2MB 1UZ8B 1KTKE 1UH2A 2BJML 2D4FA 2IANB 4PJ5D 4QXGL 3WFBH 4XVUC 5T1KA 1I7TB 2QSCH 1P2CB 4CRPA 4BQCA 1KNOB 1HDMB 4QHUA 1QR1A 3TESA 5EC2A 1CLZL 5EZIH 2YK1H 3BH8A 5ESAA 4NFCA 5IV2A 3UJIL 4ZO8A 1E4WL 1KJ3L 3P4NB 3D3VB 3BE1L 4FRWA 5FKAA 2WINA 5D6CB 1N0LA 4QTHA 2ZG2A 5CMAA 2EO9A 3BPNC 1X5XA 3B9AA 3IAPA 2DDQH 2GAZB 2ZKHH 1NMCB 5GSVA 1HCFX 1QBML 4ZPTA 5ABDE 1JVKA 5EZJB 1FV1B 4L8SB 4ODXB 2AKRB 5JIIA 3QUZB 5HDOA 4OCRL 3KPQA 3PHOB 1MQKL 3X11B 2B8OT 4ALAL 3NPZB 2NQCA 1CL7L 2RR3A 1DBAL 4Q9BA 2O5XH 3HE7B 4UQ2A 4E41B 5DHVH 5E94B 3HC4H 5BW7A 2D0FA 5TQ0H 6CGTA 2AJYL 2JB5H 2YUVA 4HKBB 4P4KC 3QJFA 1FL3B 3OJ2C 5MHSE 1WIPA 4GG6A 2WBKA 1CFVH 2NYYC 3DLQR 1S7RB 3QIUA 4PP2A 3AY4A 4X9FA 3HI5L 2OX5A 1RUKH 4FOMA 3OPZL 1MELA 4MA3B 4QHLB 3WS3A 4XVUD 1I1CA 4BZ1L 4DW2H 4P2RB 2IF7A 4WUKL 2LU7A 3HMXA 5ELIA 1KJ2L 4GAYB 5DMJB 4CU6A 3DVNB 1A1MA 4KAQL 1T2XA 2GSGA 2JF1A 5C0RL 5HGHA 3KDMB 4PRAA 3WO4B 2BHYA 4NDMA 3GNMH 3MRPB 5E2TH 1UWEH 2R1XB 5HI3C 4DEPB 3AMLA 3HZKA 1RUAH 4NQEB 3RX7A 3ZHKA 1C1EH 4JO4H 4K8RL 5KJRH 3V6OA 2QKIB 2DWDB 1CGYA 4P4RB 2AJ3A 3TLRA 4C56B 5DMIH 2DMKA 4GKOA 2GUOA 1ED3B 1N8ZB 1P7QD 3LKSB 4KFZC 1KCUL 5DR5L 7FABH 1R0AH 3T2PA 2ERJB 3QDGA 3ES6A 4JO3L 5DVLA 3DO7B 1F2QA 2P42B 4OZHA 1C5BL 4UTAL 2HVKB 5L6YH 3L6FA 4MQ7B 3MBXL 4JQXA 1T1ZA 4OGYL 4Q74A 4KTEL 5D2LE 3G9VA 3FFCB 1LP9E 1KB5A 4P4KD 5DMKA 2FWOB 2NYYD 2PW2B 5FB8A 1H3XA 3RKPA 5IUSA 4MQXC 4OIIL 4Y16A 4ZTPH 4ZFGH 5IB1B 4PJIE 3GJFB 1HE7A 5D5MF 4XCYB 1EMTH 2YN3A 3IU4H 2VDLL 2OMNA 2E7HA 2VH5L 3HB3C 3NCEB 2XZAL 2QSTA 2ITDB 1G7LB 3ALWA 1DBJH 5EZLA 1T0MB 3SGDI 1U58A 1NC4D 1RFDH 3C9NA 3LHPL 2NY5C 2YXMA 3ZDZF 2ICCA 4FTVD 1AKJB 1KBGH 2OQJB 3LRSA 4U31A 5HI3D 4NO3A 2LAAA 1NBQA 2IAMD 4MX7A 1JZ4A 2JB6A 5KANG 4N8VA 5TDNB 3D9AH 4UOJA 4OV5B 1LO4L 3EOBB 2BOCB 3LD8C 4I0PB 4PJCF 1NANH 3CLFH 1I4FB 4NQCE 4N1CA 1P7KB 5GRVK 1T4KB 3QT2A 2P5EE 3QWOB 3L95B 4G6FB 5H94B 3T0AA 4NM4H 5ESQB 4TPRH 3KLHC 2P8MB 3UPRB 5C08B 4YR6A 3RNQA 5ESVB 2MCPH 4OQTA 4X6BA 1JPGB 4QEGA 3B2VL 3D85B 1BD2E 3I75A 1DUZB 1PYWA 5DDHB 4IS6B 2R8SL 3SJVD 1QSEA 3U30B 4F7MA 1EJOH 4GO6B 4OB5L 5T1KB 2ZG3A 4P57B 5IG7A 4MQXD 1TTGA 4PIRF 1TVDA 2VLKD 4QHUB 1QR1B 5EC2B 5DJDA 4BM7A 3MXVL 3BH8B 5ESAB 1BBJA 3HB3D 3P0VL 5B8CC 1PBYA 5T33L 3TO4C 5H8DA 5FIEA 3U0WL 3BP7B 2X4PA 2WINB 1OP3K 2APWA 4M48L 3ULSB 4QTHB 5CMAB 3RVWC 1ZVYA 1CXLA 4JJ5A 3LOWA 4WW2F 4QXTB 4OZFB 5GSVB 3NOIA 4J8RA 4L4TD 2QHLA 4JFDE 1CGWA 4ZPTB 3AREB 1OP3H 3E2HB 3S36X 1BVZA 5D1QA 4WFHE 3KPQB 3O0RL 1I3GH 4J4PA 5F7YC 1AP2A 3T2NH 1FE8H 1H3PH 2V7NA 2Y6SC 2ZUYA 3AROA 3RBGA 4ELME 1CFTA 5DD1L 4E0RA 4GMSL 3P77A 4UQ2B 1SBSH 1Z0NA 2DQDH 4GBXA 1SQ2N 3BAEL 3S8WA 3KLHD 3QJFB 4P2OA 3DUHA 4GG6B 3T0BA 3DYMA 3O4LD 1MLBB 1Y6NR 3GI8L 3QIUB 4N9GB 4PP2B 4ZYKB 4JY6A 1NAKL 5IP4A 4GSDH 2B20A 1CLYH 2D0HA 3OHXA 4KK5C 3UBXA 1HQ4A 3VD3A 1LE5A 2W60A 4MYWB 1GZPB 4QYOA 3WS3B 2EEDA 2ZUXA 2X4SA 43C9A 1FZMA 4XI5C 4JN2A 1A1MB 3VGFA 1JRHL 3BZDA 2V5SA 5HGHB 4TOYH 4NDMB 5D96C 3QIBC 4JJHA 4ZXBC 2O5ZL 1J1PH 1ZTXL 3TWCH 3HZKB 3SE8H 1N5YL 3QDHA 2N1KA 3IDNA 3RVWD 4N8CH 4OCSH 3EIFA 4D0BA 3GRWL 5CCKL 3OBAA 1KXTB 2WZPD 1WWCA 2GI7A 2GUOB 4JM2A 2ZOKA 1RMFH 3RY6A 4AG4H 1RZ7L 2DQCH 1A6WL 2Y4SA 3FN9A 4MA7H 1WCBA 2Q8AL 2QADC 4LGSB 5LQBL 3INUH 4TNVF 4KK6C 4YDVA 3ES6B 1DBKH 3PL6C 4R4BA 4OZHB 2EH7H 2Y6SD 4HHAA 2YMXH 2Z35A 2W65A 3BGFC 4G6KL 3L6FB 4ZD3H 2JELL 1T1ZB 1DQJA 5ADPL 1F11A 1INEL 3T4YA 5F71A 1IILE 5K9KA 3UYRH 3WSQH 5F96H 5DMKB 1K6QL 2GJ6A 1G0YR 4P9MH 5IWLC 2BNQD 4Y16B 2ZJSH 1UVQA 4X6DF 2IGFL 2XWBA 3WFDH 4PB9H 4N8PA 2PYFB 5CGYD 2A9NL 1D5BA 3I85A 5C0FA 1GGBL 1AD9A 1MLCA 4HUKB 5EZLB 4BSWA 4XNUL 1U58B 5EUOF 5DJZA 4HV8A 5CP3H 3C9NB 2OYPA 3I6GA 4JFQB 5I1LA 1FO0A 3LRSB 4WFFD 3ECBB 4NO3B 3M17B 3NABL 2ADGB 2JB6B 4N8VB 3V52H 1WIOA 4OCWL 3UPCA 4P2QE 1K2DA 3ZL4H 4C4KO 3ILPA 4LCWA 3HKFA 3RWFA 4ZFOB 3RWHB 4K71C 5DRZA 2EE9A 2OJZH 2QADD 3VXRE 4KK6D 2XKSA 4X80L 4YR6B 4X6BB 4HZLA 2HFTA 5F9JA 4PJEF 3SE4A 3SKUD 3I75B 1PYWB 4EQ2A 4X7FC 4F7MB 1IRAY 1HHHA 4F80A 2E3VA 4OCYL 3QEQE 3HFML 3WNOA 1IM9A 4UDUA 1FGVH 4NN5C 2LVCA 1MAML 3NIGE 5HHOA 3P3YA 2M26A 4M1DL 2G75A 3HE6C 2JLLA 4DUVA 1BBJB 3X3FL 3MRJB 1I9JL 2A9ML 2WUBH 2MPAL 1JRHI 5D4QA 1CICC 2X4PB 1EZVY 2E6PA 4MDIA 1NEZG 4WGWB 2DL2A 1WSST 2HG5A 4JJ5B 2MHAA 4BH7A 5HYIA 3C5SB 4UT6H 5H35A 3V8CA 4X99A 4HWBH 4DGIH 4XNXL 5D1QB 3BP5A 3LH2L 1MFBH 2VDOL 3CZFA 5EB9A 2EYRA 4NPYA 3HNVH 3R06A 1EAPB 3RVXD 3D2UD 4MMXC 2V7NB 3IYLW 3H9ZA 5KSBA 1TENA 1CFTB 1HWGB 4E0RB 1RHFA 3G9AB 3CFIC 3MRRA 5TDOA 4PJFF 1F8TL 1BM3L 2R9HC 2ZOLA 4GBXB 3IJHA 1JGEA 4K3EH 3MV8E 1FLRH 1CWVA 1DN0A 4FQCL 3IJYA 4JY6B 1DN2A 4H8WC 3EJZC 1AXSA 3HRPA 3OHXB 3UBXB 4YDKH 4I5BA 1HQ4B 3BN9C 1FZOA 2W60B 4QYOB 4NJ9H 4PJ7F 4F8QA 1Q72L 43C9B 1FZMB 2VDPH 4L8SC 1RV6X 3UDWA 2FO4A 1RJZA 3KYMA 3QUZC 4R2GB 1OCWH 2A2QT 3HE6D 2RHEA 1RPQA 3QDJD 3E6FB 3HE7C 1MCQA 1CICD 1OLLA 4CVXA 2H26B 1YPZF 4KXZH 3K8LA 4MCZB 1KFAL 4X9IA 4Y5YA 3IDNB 1ZAGA 2ICWJ 4KJYA 3RVTC 3KPSD 1U8LA 5IMKA 3DWTA 1KCRH 4I8DA 4MS8C 4LBEB 3W2DL 2ZOKB 4JFEE 1CXIA 4NGHL 5E5UB 1RIVH 4L9DA 3Q2CA 1NCBH 4PJBB 4R4BB 1QFHA 4HHAB 3TJHC 1G9MC 2XRAH 2W65B 4FHBD 3RNKA 3U9PH 3WO4C 3MUHL 4X4XA 4YBQC 5E1HB 1DQJB 2X10A 2WP3T 4XNMA 4CU7A 3BYTA 4HWEL 3T4YB 5TE7H 3ULUL 5K9KB 4GW1A 4NRXB 4DEPC 1DLFL 3F8UB 4KK8C 3MUY1 4M7JL 1UVQB 1UCBL 1QD0A 2XWBB 3EJZD 1DEEA 4BFGA 4QWWC 5T3XE 4Z7NE 3QQ4A 1D5BB 3BN9D 1K9TA 1TVHB 4U1JA 1UADC 1V5JA 1NCTA 4MAUH 4UTBL 4HKXB 1P9MC 1ZHKA 5IFJA 4BSWB 4ZNEE 2Y06L 5DJZB 2ERJC 5E8OA 1AFVL 3STZA 2GW5A 4KUCF 3FQXA 4D0DA 3I6GB 4NSKB 5I1LB 3ARGD 1FO0B 4FMKA 1Q9OA 1KELH 1NAMB 3MUJA 3NIFE 2BRRH 4YXHH 1A5FL 1JP5A 1AI1H 3RVTD 4H8WH 4JM4L 1S7QB 1K2DB 2FATH 4MS8D 4LCWB 1FIGL 2NY0B 3WFZA 5DRZB 4KVCL 1NGZB 1A14H 4OZGE 2HRPH 4Z78A 2CK0H 4HZLB 2OBGA 3ZYZA 1SYVA 5D2LA 2X70A 4FQLL 1LP9A 2EDHA 4JRXE 5GRUL 1KLFA 4PJIA 3BP4B 4NT6A 4XBPA 2P1YA 1IM9B 4FG6D 4QWWD 3FO2A 4LVEA 4NFDA 4C56D 1ZHLA 3SGKC 4I0PC 4QHKI 4MA1B 3BYYA 4HXBH 3UYPA 3V0WH 1EV2E 3DROA 4Z7VF 3I9GH 4HAFA 3L3OB 2JJTA 4LPUA 2XWJA 5BZDB 2IPKA 1F5WA 4LK4A 4G8GB 5AZEH 4BH7B 5ILTL 2GYSA 3A67L 4N90D 4DZBB 3IJSA 4JR9L 3FFCD 3VGBA 2WWKO 3BP5B 3U30C 3CZFB 5E95B 1A7NL 2EYRB 3WIFA 4HC1A 4NPYB 2F53E 4NQCA 3R06B 4NHCL 2VAAB 5MENE 4H0HB 1RZIB 1DUYA 4PGZA 5GIRA 2P5EA 3C6LB 4U3XA 1CQKA 3MRRB 5TDOB 1OP5H 4OM1H 5A3ID 4YHKH 3W9EA 2ZOLB 4D9LL 5C0BD 2IFFL 2FX8H 4Z95H 1JWSA 12E8L 1IC4L 3IJYB 1BD2A 2DIBA 3SHSA 1P7HL 4F9PC 2Z8VC 4JPKH 3JV0A 4I5BB 1FNSH 4KTYA 3OTTA 2AXFA 1FZOB 4YHPA 3GJFK 1AKJD 5DJ2A 3BSZL 4F57H 1G7QA 3O3DA 1JPSL 1N6VA 4RDQF 3AREC 4J6RH 1X7QA 3E2HC 4NP4H 3TJEH 3KPOA 2WUCL 5IESH 4TSAL 3C08H 2FO4B 1RJZB 3KYMB 1WZ1H 4XX1E 1OGTA 3R4DA 2O61A 5DRNA 5EO9A 1NGPH 4B0MM 4CVXB 1A3LL 5BW7C 1A3RH 1ZKAA 4Y5YB 5TJWK 2VN4A 4KJYB 3V7MA 4JFDA 1G0XA 2FH6A 1U8LB 5IMKB 3ARUA 3QIUC 4JZJB 4Y4HD 3AY4C 3WFCH 2DJUA 3O2DH 4X5WA 7CGTA 1S3KH 2J88H 5CHNA 2LFGA 3SDCA 4ODWA 1DBML 2DJSA 1YEIH 2A83A 5T1KD 4ELMA 2LU4A 4JO2L 4LRIA 4ONFH 1U9KA 5EBLB 2HMIC 2YRZA 1VESA 5L9DL 3RNKB 1KN2H 2ED9A 1VHPA 1UM5L 4XNMB 2K9UA 1OWRM 1PD6A 2DKMA 3S36H 5HDQL 4GW1B 4QHMA 5DGQA 4ELKA 4P9HC 5LGHH 1F2XK 2KQMA 1IVLA 5IHBA 4HQQH 3S88H 3FT4A 4YUEL 3V6OC 1ACYH 5IJKA 3QQ4B 1EH9A 4J3SA 4PV8A 2VKWA 3S37L 2V2TA 5INCA 1GAFL 3EO1A 4U1JB 3KS0J 1R5VA 1ZHKB 2JKXA 2OXHA 4FQJL 2R29H 5IFJB 3QJHA 2ZZUT 1NDMA 3FQXB 3OAZH 4D0DB 4GXVH 5BV7H 2WLYA 3RWJA 4M62H 4KH2A 2AQ3A 2GJJA 3GSNB 1A8JH 1Q9OB 5GZNC 5LGJA 5JLZA 4NO0B 4JQXC 3AVEA 1S5HB 3JWNC 2X05A 2EECA 1W0YT 3EJYD 3BUYA 4QTIL 2DQGH 4L4VD 4Y16C 2W0LA 3MRQA 4NO5A 4D8PB 2LQRA 1YNLH 4K3DH 4JGMA 3VD5A 3WFEL 5JXEC 5K59E 5J9PB 3RIAF 1DTUA 3M8OH 1KCVL 1RZGB 5I1CL 4N5UA 1T5XB 3NFNB 1BP3B 3RZWA 1FFRA 4GAFB 5D5ME 4CUCA 2KZ1B 2EDTA 4PS4H 5I1IH 1EZVX 1P4BL 1LP9B 1DVFA 3MJ7B 4I48B 2JCCF 4RNRA 1MHPH 1EVUA 2CJUL 4FXGA 2X89A 4PJIB 1MY7A 4PJAB 2MWCA 3TBWA 5D1ZA 4HW6A 3FO2B 5KZCB 5I19H 3BXNA 3FN3A 3ZDZE 1ZHLB 1A9BA 4N0CC 1EEUA 3VH8G 4PY8J 5C0EA 1MFCH 3DROB 4FFYH 3O2VL 4JKPL 3HMXH 1HNFA 3DJ9A 2XWJB 3QDGD 3VCLA 2YPVL 4PJCE 2PYEE 1I9IL 1T66C 4WHYH 4MJ6A 1IAIH 5SWSE 4DKFH 3UTZB 1SJHA 4RMSA 5TQ2H 4PBXA 4QGTA 1IL1B 2EXWC 4P2QA 5CP7A 3PGDB 4CVZB 1YEDA 2DL9A 3ZLQC 4KPHL 1C7SA 3FONB 2P5EB 4YFEA 3MV7E 1BJ8A 1I3RA 2XZQL 5DT1L 3QHFH 2YN5A 1L7IH 2A77H 3O81A 5BMFL 2AJXH 2J8HA 4U4BA 3G5VA 3T0ED 1ZEAL 2Q8BH 3EYVB 3WHE1 5HHVH 1JWSB 3KYOB 3D6GA 2OR7A 2G60L 2WQ8A 4S1SH 5CJQH 5IBTH 3OGCA 3G5XA 1KCSH 4LSUH 1NSNH 3QRGL 3QEQA 2EE3A 2ZCLH 5DJ2B 1G7QB 2B4CC 4Y1AD 1KB5H 5CSBA 5E2VH 2V5YA 4QY8A 1EHNA 2A73A 2WBJA 5D1QC 4KHXH 5EWIH 4WW1A 5FYKD 5DD3H 1OGTB 1OARL 1ZHNA 2AW2A 1E27B 4Q6YA 4KDTA 5DRNB 3I2CH 4OJFH 5EO9B 4L29B 5J8OA 1JK8B 2DLFL 3GSRA 3UAJD 3H9SE 1YEFH 3QDME 4HAGA 2CO6B 1L7TL 2QQNL 2OL3A 4GBXC 1OGAE 4OZIF 1S7WA 4XVJH 1OVZA 4P2OC 1MWAH 3Q0HA 1T66D 3GSXA 2CLVA 3LKPB 3EYOA 4X5WB 4UV7L 2Z8WC 3K1DA 3OB0K 5GJTH 4HFUH 1BGXH 2EXWD 4KMLB 1FNGA 1QSED 4ODWB 2AEPH 2A83B 3DRQA 5E2UL 5FYKH 1RZJL 3OB0H 1MREH 4R2GC 2FIKA 5E99H 3PE9A 4W6XB 5CZXC 1A2YA 3MV8A 2C1OA 1BFOA 3FQNA 4DWHA 4WTZG 4ELKB 3EDJA 4OLYL 3RRQA 3KPNA 4PPTA 3FT4B 4XP6L 4HXAH 4OQTH 1CS6A 5EOCH 2V2TB 3EO1B 1CBVL 4JM2C 4QXWA 3ULVD 2FDBP 1MHEA 1E4KA 4X7EC 1R5VB 3BX7C 5KG9A 3RY6C 3MOAH 4MMZC 3QJHB 3U4BL 5D1QD 4WI4A 1WBYB 1IGJB 2R56H 2C4FT 1NDMB 4J4PD 4B7IA 35C8H 4NM8H 3RWJB 3ZTNL 1JYVA 3EDFA 3SPVA 3FO9B 3FN0L 3QSKB 5LGJB 3DTXA 1L9MA 2MKWA 4F7PA 1XR8A 2FHCA 2P43B 1M05A 3VXSE 4Z7WF 1Q9KA 2VYRE 4GBXD 1MAJA 1MIEL 4ERSL 4P2OD 3VGEA 3BUYB 4Q9RL 2I24N 5EO1A 3MRQB 4NO5B 4JFEA 3QXTA 5DHYA 4FNLL 4TRPH 5DFWH 4R7DA 2BVQB 3ULVH 2B4CH 3TNMA 5E70A 5DUML 4KKAC 4X6DE 1A4KA 2R2BA 2HRLA 2OJEA 1MJJA 4NN6B 2OM5A 3HI1A 4R8WH 1IT9L 3TV3H 1DVFB 2OK0H 4ZTOL 1DQLL 5CZXD 3SQBA 3QQNA 1Q0XL 4IMLA 4NZTH 3WS6A 3T3PF 4C83A 3O6LH 4NZRL 3AGVA 1HXMA 5EUOE 1JN6A 2JE8A 3PWNB 4EIZC 4OIBA 2EC9T 1BF8A 1MEXL 3EYFA 3BXNB 1MF2L 1TTUA 5ICZB 1A9BB 2CIKB 1T21B 4JM2D 5C0EB 4X83A 1RZ8A 4ZNEA 1OAYL 5I17A 2NY0C 3LPFA 3VCLB 4K7PX 4P3CH 4ZQKA 2R0ZH 4ISVA 1AGCA 1CTNA 2EDQA 2EIZB 3DX6B 3NMEA 3KPTA 3B5GA 2XOTA 1JNHA 1FNFA 3B8YA 3GB7A 4P2QB 4Y2OA 5CP7B 1JNNL 4KZDL 1VGKB 2GJ6D 3BD5A 3GJEA 4PJEE 3ZYJA 5ETUA 1NQBA 1NUNB 2V9QA 3W9DB 2F8XC 4CVUA 1IC5L 1PEZA 3VXRB 1MVUA 4OZGA 3V4PL 1X4XA 1ROWA 1LMKA 4MNQE 4WRLA 1GZQA 4M00A 2ENYA 3G5VB 4HBCH 4MA1C 2Y1VA 4X8XA 3UO1H 4M9PA 1F00I 1E28B 4KKAD 5GGVH 4AQ1B 5IB5B 1QUNA 3BP6A 4FFWC 4JRXA 4OFYA 3ALXA 2JJVA 1MY5A 3G5XB 1U42A 1F58H 4ONHA 5ITBL 3QEQB 3HMWH 4FABH 2KZWA 4XXDA 5ANME 5KN5A 3FO1A 3IDXH 3IRPX 4QY8B 4UV4L 3TCLB 4IRSB 1WFNA 1TXKA 5FV2A 5CBEA 3DGCR 3DECA 4AEIH 4FQQB 5CKGA 1H8NA 4R4FL 3LPWA 4LCWD 3C6LC 3AUVA 4PLJC 1MH5A 3GSRB 3OSKA 2CRMA 2WWMC 4JAMA 3D39B 4U6YB 5DMGC 2X40A 4LL9A 2OL3B 1AC6A 1A7RH 5A2FA 3GSXB 4YZFF 1CDCA 1MQ8A 3DI3B 4HD9A 1YMMD 3EYOB 4PJFE 2CXGA 1FO0H 2EKJA 1FNGB 2F53A 4YDLB 3PWPE 5MENA 5LGKA 3WUWG 3DRQB 3R0NA 4OI7A 1G9NL 4ZO9A 4WEBL 2HAZA 2UVEA 4EDWL 5HHOD 1JI2A 4WTWA 3PQYD 2FIKB 2VXTL 4O4YH 4OIAA 1RSFA 2ADFH 2QV2A 4PJ7E 4JO1L 4Y19E 1A2YB 1PQZA 2E7MA 4PD4J 4DTGH 2BZDA 3MV8B 1BFOB 1J1XL 4NWUL 4IDJH 4EOWL 3KPNB 2DLGA 4FFWD 3S5LG 3JTSA 4Y5YC 1RJLA 1GIGL 1DCLA 4XCCL 4WHTA 1V3JA 4K9EL 1GOHA 1FVEA 1QRKA 1YY9C 2W9EL 3BQUA 2AP2A 4JZJC 5IMOA 1CT8A 1YQVL 1YPZE 4MXQD 2X7LA 3H8NA 5KG9B 2EDKA 4HLZG 1FGNL 3DYOA 1ZWIB 4LF3A 4L9LA 5SX4H 1ZGLM 5HI4C 2C9AA 1CU4L 1A64A 1LK2A 1EEZA 2R23A 1TNMA 4PLJD 1OPGL 4YHML 1HEZB 1XR8B 2WWMD 5LWYH 1ORQB 1M05B 5DMGD 1Q9KB 3QCVL 3MX0A 3UTPD 2QLVB 3MO1B 3MSPA 4XBGA 5JHDE 5EO1B 1KSRA 4JFEB 3MMEA 4QRQB 5DHYB 3VXQA 3H42L 2C1PA 3TP4A 3NCJL 4R7DB 4JPWL 3S4SG 3TNMB 4I3SL 4HKZA 1CZ8H 2VC2H 1KJ2A 5GS0D 2R2BB 3TC9A 4NKMB 2ED8A 5BS0E 1MJJB 1T7YA 3HI1B 1EUTA 3A6BH 2IG2H 1U93A 4Q0XH 3B3IA 1N59A 4B53A 4Z7OF 5GGQH 4M6AA 3MNZA 4C83B 4ODSH 3UJJH 3L5JA 1HXMB 4M6MH 5JA9A 2D9CA 4HUWA 4QRPB 3CDGA 1NFIA 3IDGB 3NGBB 5J6GB 15C8H 3BDBA 2BP3A 5TPWH 5E8EA 3U36A 3NFPA 1RZ8B 3SE3A 4YHLH 2H2PC 5I17B 4RGNB 2YC1A 1WV7T 3IAGC 1RZKL 5GS0H 3QZWB 5HI4D 5E8DL 4ZQKB 3WJLC 4DKDC 4ISVB 1AGCB 3GSOA 1LO0L 4ZFZA 3U1SH 1S7TB 4RFOL 4KRLB 5ALBH 1KN4L 2C3WA 3SGEI 5GZOC 4OM0L 1CF8L 1JNHB 1XCQB 1AQDA 5MHSD 1MRDL 3GB7B 2X9XA 3KJ6H 5JIHA 4YHOL 4XP9H 4Z0XA 1J10A 2VZ3A 4XB7A 1OAKL 3GJEB 1U95B 5F1IA 5ETUB 3TPKA 3WIHA 2BDNL 1AQKL 1F4XH 2UUDH 3BWAA 1MVUB 4OZGB 2JK5A 2EYTB 2EXYC 4CN4A 3GI9H 1GZQB 1SMOA 2DB8A 5D5MA 3QG7H 1IGYB 3MLVH 2IEPA 2E5EA 3ZE2F 3IAQA 3BP6B 1BJMA 2G2RB 4JRXB 2ENSA 2B0SL 3HC3H 3GMRA 4Z7VE 4XXDB 1U8NA 2BMKA 5HY9B 2NXYB 4LKCA 5KN5B 3FO1B 5CILH 4LLDA 4ZMAT 4Y4FA 4U3CA 1OM3L 4WY7L 1QFWL 3K8KA 2C4FU 5CBEB 1BVKB 4LARH 1S9XA 2EDEA 1WBZA 2APXA 2GFBA 4LHUD 2XA3A 1A6VL 3JV6B 4XWGL 1LEGA 4JG1H 4U3HA 1MH5B 1LD9A 3RL2B 4OLUH 3MRDA 4JAMB 4PJCA 3WEXA 1D5MA 2PYEA 3PGFH 4KV5F 2F9BT 1A1NA 1JPTL 5SWSA 1BF2A 2HH0L 1XGQB 1T7VA 2QBWA 3GK8L 3P0YH 5D8JH 1A9EA 4RWYL 2F53B 4NQVB 3U0TA 2VQTA 5MENB 1H3WM 5ID0A 4FQ1H 3B9KB 3QA3A 3MV7A 4LSTL 5D6DA 4AL8H 5KZCD 3EO0A 3TYGL 2AXGA 1KPVA 3VFNA 1ITCA 3V4UL 1RK0A 3N1FC 2MQ0A 3P2TA 2AV7B 4NIKB 2A6KA 3GMMA 3JTSB 1RJLB 3IDUA 4XCEB 4WHTB 2NY3B 5E5RB 3TT3L 1IGTA 1FVEB 1HOCA 4R0LA 3BQUB 3WUZA 5EORL 5IMOB 5EU7E 4WV1A 1CT8B 5LG1A 4WW2A 2LE9A 4Z0BL 3SDCC 1MCHA 1LHZA 4L9LB 3ARDB 4NQCD 1TCRA 4LHUG 4LRIC 1T22B 4HIIB 1EUUA