4F24A

Crystal structures reveal the multi-ligand binding mechanism of the staphylococcus aureus clfb
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
334
structure length
334
Chain Sequence
AEPVVNAADAKGTNVNDKVTASDFKLEKTAFDPNQSGNTFMAANFKVTGQVKSGDYFTAKLPDSVTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDILTKTYTFVFTDYVNDKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFDNKITYNYSSPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEESSGKVSATDTKLRIFEVNDTSKLSDSYYADPNDSNLKEVTGEFKDKISYKYDNVASINFGDINKTYVVLVEGHYDNTGKNLKTQVIQENIDPATGKDYSIFGWNNENVVRYGGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Clumping factor B
publication title Crystal Structures Reveal the Multi-Ligand Binding Mechanism of Staphylococcus aureus ClfB
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 84
structure length 334
sequence length 334
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f24A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f24A02
5CF3A 2Y7OA 4JE0A 5CFAA 4BBWA 4F1ZA 1R19A 4B5ZA 3AU0A 2Y7NA 2F6AA 2Z1PA 4RMBA 5IHWA 3AT0A 2YLHA 1N67A 4MBRA 2VR3A 4LEBA 4F27A 4JDZA 4F24A 3V10A 4FJ6A 4JDZB 3IRPX 2F68X 3ASWA 4LE8A 4Q6KA 2Y7MA 2Y7LA 4F20A 3IS1X 3IS0X 4LEEA 4B60A 4MBOA 2RALA 1R17A 3IRZA
chains in the Genus database with same CATH superfamily
3GZOA 1RFDH 5EBWA 4ZSOE 1ZGLB 4G7YL 1CQKA 3JWNC 4F5CE 5H4YA 2B59A 2H1PH 3EOAB 3QVAA 2Q87A 1QLEB 2BSRA 4LSUH 1ITBB 3ILDA 1ES0B 3ARPA 2IGFL 5HDBE 1MQ8A 4XMKL 3I6GB 3H3PH 4AVHA 3TIDA 2J1XA 1SM3H 4P5TB 1CLVA 4LIQL 3DBSA 4YC2B 2WUCL 1PCSA 3QIWC 2HJFB 3L48A 4M1CC 4X9HA 1GOFA 3S37H 1P9MC 4NZTH 3DUUB 1M56B 5F7BA 4Y4KD 3CD4A 4BBWA 2ALWA 3JWDL 4RNRA 4WO0A 3K91A 3BRGC 4BHUI 3LKQB 3PGFL 4JG1H 2O6DA 4C56B 2A6JB 3GK8H 5E08L 5JIKA 2EDKA 3V79C 3T0VA 4LP4A 3UXFA 43CAB 2VN3A 5TH2A 1H3VA 1QLFB 4S2SB 4Z7NE 1MW2A 1QPXA 4O4YL 1KYUA 3GSNB 3LEVH 3REWA 2EDEA 5HYQB 2CJTA 3SPVB 5DCCA 4JFEA 1D6EB 2OMXB 4NI3A 6CGTA 4OCWH 1IGIL 1XR8B 1CF1A 5E6UB 4EOWH 3OKEA 4GOSA 2VO8A 4IRJD 2XYCA 3FN3A 2F54A 4M8QA 3N55A 4B27A 3NK4A 1LO0L 3WDIA 3S3PA 3MRJB 2I7OA 5ID0A 2X6CA 3KPSB 2AI0L 5F1IA 4A39A 4CMMB 2JNZA 1ZTXE 1I3GH 1UURA 2BXYA 3LRMA 1YPZE 1EIBA 4K8RD 4ZUTA 3MUHL 1YMHA 3GBNL 1SPDA 3ECQA 3KW8A 3ULUC 4KK6C 2YEQA 2F0CA 2OL3H 3MNVA 1LTXA 4QUOA 5DD0L 2JJUA 3VRJB 4QOKB 4D9RE 5AW6B 5CR8A 1V27A 3K2IA 4MTMA 4R8WH 2XPGB 1HHJB 5IM7A 1IAOB 4NIKB 4JANB 1I7TA 1NL0L 3FFCA 2ZSWB 2E7BA 1FCGA 2IDUA 5H94A 2WUBH 5IMMB 4FLRA 4QCIA 2OSYA 4XMVA 2M8XA 4R4FL 5I1GH 4FHBD 1OD9A 4L5FH 3GMOA 5DMYA 3CU1A 1TXKA 1F42A 2DOCA 2HT3C 4YQXH 5IVZA 1QSZA 4QRQA 3O6KL 1R17A 1UTDA 1JGEA 3HI6L 3UC2A 4FNQA 3PE9A 2XLLA 3D87B 3WNPA 1PY0A 5E4IA 5GRUL 2CAKA 3EF7A 4XMLL 2A9CA 4IRSB 1Q0XH 4POZD 3L3OA 1MJUH 3VU2A 5D70H 5EU5A 4J3OF 1BAFH 3II1A 4P4KB 5IBTH 1UM5H 4P99A 4Y5XB 2H9GA 3U30C 1C8PA 3TZVA 2XICA 3ARED 3EJPA 2CHWA 1S5IH 1GC1C 2RD0A 4IK7A 3LNGA 2WN3A 3V6OC 4F20A 2WC7A 5D8JH 4JHUA 4F7TB 3CGTA 1MFVA 2H4EA 4FCHA 5IROA 2X6AA 2V8LA 2LHAA 4HUCA 4UIMA 2WD0A 2DBLL 2EO9A 5ACMA 3KZ8A 4TSAL 3TNNA 1G9HA 3GEWB 2FSDA 4WKXA 2ZKXA 4X6DB 1IM3D 3MX0A 3S96A 3MOBH 4X7SL 3VWJD 1DL7H 1EBAA 3D05A 1O7VA 2C9QA 5G4NA 3T8MA 4BCZA 2Y1YA 1A8JH 3SGKA 2CLVB 2DWTA 1UWFA 2VJ8A 1RCYA 4Y4FB 3G5XA 3I2CH 1FFPB 3CN0A 4Z7VA 2HCZX 5I23A 9PCYA 4M62L 2BIMA 4AQEA 3GWJA 3PNRB 5GGUA 3V4VA 4AM0A 5BOZG 4WSGA 2OJZL 3DSFL 3FQ4A 3SDCD 2X4PB 2DWDB 5BNXD 1MHEB 1II4E 4X6CA 3ABGA 4G7YH 3SDDA 1YUHB 4E5XG 4JFDE 4FLOA 1U58B 2ZF8A 3NBNA 2O1AA 4UINL 2HN7B 2BJML 5D2LF 1CD1B 4JR9L 3BAXA 4QGYA 1E5CA 4QRRA 2IGFH 4N2EA 2VE6B 3MMEA 3SBPA 3MFFA 4WO4A 4Y2OB 4NT6B 2WAHA 4TULL 2ZQKA 4YSRA 3RX7A 1J18A 4LIQH 4H8WC 4NKIL 3ARDC 4TN9A 2E86A 2ITEA 4NQSA 4H44C 2WUCH 4JFUA 5I6OA 4RMQA 4TQHA 5GHWL 5J6SA 3ZL1A 1JYNA 1KPUA 2AZUA 4GY4A 3X3GH 5CCKL 3A5VA 32C2A 3OKDA 5GS0L 3IJ9A 3JWDH 3F64A 3FQRA 4IKJA 2XQYA 3C09C 5FF6A 1J0KA 3CPLA 1G4RA 4RRPG 4ZMYA 3PGFH 5KYYB 1OW0A 3ISRA 4X9GA 3ZDYF 1X5JA 3EHBC 3OG4B 4I1PA 3AAZB 5CEZE 5E9DA 5C0BB 1DJHA 4O4YH 5GRYA 3OSKA 5A2KH 1X9RA 3HG1A 2EICA 3FK3A 4LEXL 3OX8A 3IB4A 4FNUA 1IGIH 5DT1L 2F53D 4MAYD 4BFRA 1UKSA 4XZUA 4BGDA 5F0PB 4KJYB 4UU9B 2FQDA 4RMBA 1LO0H 3TU6A 4XO5A 1NDMB 3RWGA 4HS8L 5MENB 1JV2A 5I76A 2B59B 1KIUA 2AI0H 3ZKQD 2BSDA 4MLIA 4ISVA 4FQ2L 2GEEA 2PWGA 4AYID 3GBNH 3DX4A 4IK6A 5JW5B 2XKSA 3CN3A 4LLYB 3ZR6A 2J1ZA 3CVDA 3TBVA 1MCPL 5DD0H 2GIXA 2DMGA 2VLRB 5E8NA 2UXGA 3OC5A 4I2XB 1MQKL 2GJZA 3ARBD 4N90D 4XOCA 3QDGA 4P2QB 2HLFD 4R97C 1JFHA 4HETA 4FABL 2QDVA 1LWRA 1CYWA 1NL0H 4FQLL 3KYNB 1M3IA 2YFOA 3OR6B 4NBZB 5K9QI 1MJJA 4R4FH 4KRPC 5KN5B 4OZFA 4IBVA 1G7HB 4JFFB 4FFWD 2YO3A 3MBEC 5GSRB 5MEPA 4ZFOB 4IM8A 2CG9X 2A6IA 2OMVB 3O6KH 5B38G 5ID1B 4PG9A 3RVVD 4MNQA 5TK2A 4M00A 4H1LG 3ZLQC 3TPUA 2RMNA 5GRUH 4XMLH 5DRWA 5DS1A 3WNJA 3TEYA 2PP8A 5C92A 1U8CB 2GJJA 4JPKL 1E6OL 2F54B 4ZZFA 3QWOA 2ISDA 3K46A 4YSUA 1AO7D 4PGDA 3UYPB 1AHMA 3EJZD 3RDTC 3I6LE 1HH6B 4XAKD 3MNWB 1F41A 3QC5X 5EUOB 3WKML 4E9LA 4JQXC 1HSAA 4QIRA 4AIOA 4JKMA 4CADB 2DI7A 5BS0B 2QADB 1O0VA 4XXCC 3TXAA 2MWCA 1O7DE 4TSAH 1LEIA 5DC9B 2HLEB 2EDYA 4F3FA 3EAKA 2NY0D 4GG6F 2JI2A 1OLLA 4X7SH 1BEYL 5D1XE 4UT7L 2VMJA 4XXDA 2YAHA 3L1FA 5EU6B 1EAJA 3S3BB 4HWEL 1ZGLP 3U9UA 3VYPA 4GG8B 1FH2A 4ELDA 1R4XA 2O6CA 1KV7A 2VITB 4WJ5A 2NNFA 4M62H 3GS7A 1AYRA 3DX9A 3WEXA 4DPBX 3VMPA 2PO6D 5D7IE 1SF5A 4YXHL 2OJZH 3DSFH 1U93B 3KWWA 1D5MB 2C1OB 5IQ9A 4KI5C 3QFJA 1JZIA 2F18A 1YDPA 5F9WB 3TO4C 5I0VA 1AR1C 3WNIA 3VQ1C 2BVPA 2OA9A 2MTAA 3V6FA 2BHFA 3C5ZB 4QHLA 4UINH 2GTZA 1FHGA 2WINB 1WRFA 3ISYA 4IBQA 4JEGB 4JR9H 2F1EA 1F0LA 1XD0A 4K9JA 3NABL 1GYVA 5E5LA 1NAMA 4QJ5B 1TZ8A 4TULH 5EO9B 5CBEB 3GZQA 4NKIH 4QLWA 5IW1B 3C8DA 4FD0A 3BO8B 5GHWH 2D7MA 5EO0B 4Y4HA 5CCKH 5GZNC 4ORGA 3PL6D 3L5WB 2HTLC 4Z7NB 5CO1A 4K3HA 3F05A 4HCFA 1BVZA 4Y7OC 1JMZA 2YLKA 4FERA 3BAKA 4GKOA 2E9IA 3PWPE 4XI5C 3HUJA 5CJ5A 1N8ZA 4JFHE 4Y1AA 3DGDA 4HSCX 4LLUA 4CBPA 3L3JA 4U6HA 5JO5A 3D18A 4BFKA 4CVXB 2B8OT 4ZUSB 4ZS6C 3IS1X 4YSDA 3ILEA 1SMOA 2ENSA 3LN9A 4LEXH 1SHMA 1L3WA 3VSQA 5GGUB 3QDJA 3SKOB 1IZKA 2QVTA 1EZVY 4GLRI 2OTPA 2UXFA 1YPZB 2FLMA 5I6PA 4Y9FA 4G8FA 4KROC 3JT0A 4HS8H 1J10A 3IK2A 5CCHE 3UTPD 2E6QA 4CDGC 1AZBA 4ENZA 3AWEA 3MMEB 1DDHA 1KENL 4FQ2H 2QSTA 3KWXA 1S7SB 1ADQA 1T20B 4W6YB 1R3JA 2NW2A 3HLAB 4NRYA 1O9ZA 2V5SA 1MCPH 3ZKND 3TO2A 4HBCL 1MQKH 3B1TA 6TAAA 1D5XA 4J8RA 4A55A 1Z9SB 4FABH 3GSXA 5A40E 4FQLH 3FQRB 5CN3A 3NJHA 4GEJA 1XT5A 4DPRA 1E6JL 2AP2A 2NSMA 3S0PA 1KTBA 4ATTA 5KSBE 1CFQB 5AAWA 3BUTA 3KL3A 2CR0A 3THML 4NSKA 1QI5A 1S6NA 1WYJA 1OCZB 3EH3B 1FYTB 3FQXA 2R2EB 1NJ9A 2E9JA 4BSWA 3FCBA 3DSNB 2FWUA 1CE6B 2K70A 3VXQA 5ICZA 5DZNA 3EJSA 2NY3C 4EIBA 1QSEE 3MU3A 5HGBA 2PNDA 3DX8B 4XO9A 4JPKH 2JCCA 2VXUL 4M7ZC 4JFXA 4HA1A 3HAEA 1X9QA 3HTLX 1E4XL 2XWJA 1NIEA 4XAWL 4N2NA 2OJEB 3UAFA 5DHMC 3VI3E 4PRDA 3WKMH 3N42B 2RIKA 2J2ZA 3CVCA 4ZYKB 3W9DB 2ED7A 3D85A 4N8PA 4HPHA 2YKKA 3L81A 1CDGA 1Q94A 4HUMB 6FABL 4LBEB 3TN0D 2H8PA 1NMCC 2RFXA 1Y18A 1BEYH 4AGNA 4UT7H 1ZXQA 3WL9A 5KBPA 4AUJA 2GIYA 4HWEH 5JW4M 1Z66A 3GXNA 1E43A 2E8ZA 4QHNB 1RZIB 3G5VB 3D2UA 4MJ4A 3CMOH 3BP4A 1KXQA 2N1TE 4JFDB 2FGZA 4L0PB 4XPAL 3ILPB 3W39A 3SDAC 4YXHH 1VB9A 1PDKA 2YXWA 1OF0A 4QO1A 2CO7B 2HP4A 4XZ4A 2A7BA 4PRPD 1D5IL 2NYYD 2MCPL 1BZ8A 5CLWA 4PG9B 3Q48A 4I0PA 4FMKA 5AW3B 3B9KA 2CA3A 2G4GA 3BZ4A 3ORJA 1AP2B 4TTGA 1OGPA 3O2VL 3QHZH 1CURA 4D8PB 3VFWB 2GPZA 1JF5A 3L4TA 2D9CA 3NABH 4LLWB 5EU7E 1AG6A 4AK2A 5CZVL 1BJ8A 3NSXA 5TE7L 4Q8BA 1NSNL 1OOWA 4ZQKA 4UM9D 2VQ1A 4HLEA 1I8KA 4FC3E 3TVMB 3PUUA 2I9LA 2VDPB 4PJAF 1OIOA 5IJBC 1RJLB 1BFVL 2OMZA 2YEVB 5IVOA 5MERA 3LRKA 1NMBL 4QJ4B 1E27B 5TGBB 1OK0A 3OB0K 1IEAA 4K15A 5EV7A 4YLBA 3X13A 5DJDB 1KB3A 1ZA3B 4DJMA 1ZIAA 2C3VA 5FA3A 1DO6A 4L8DB 1JHTA 4DK6A 2OCCB 1MREL 4DUXA 4WNQB 3QUZC 1I8IB 2V2TA 4TVSa 1R0AL 4JZNA 3NEEA 4Z23A 3TWYA 4J3OG 2F7OA 4EXPX 3RHWF 1FNHA 3DX9B 1X5IA 4HFWB 2YA0A 3KWWB 1N5AB 3OG6B 1B6UA 4NENA 5I5RA 5AYTA 2I25N 5SX5K 1BVKA 4Z7UE 5HJGA 3GBEA 4PWFA 4AY0A 1AZNA 1MLBB 4O2CA 2Y7QB 1YEGL 2QFRA 4NB7A 1BPVA 5GIRA 4RWHA 3RZCC 2UV3A 3BE1L 4YO0B 5DVKA 5C0AA 1W9XA 2EYRA 5HPMA 2O26U 2ZAGA 1KENH 5CZKA 4B95C 2WO3B 2KH2B 5DJYB 1QG3A 3GBDA 1TU2A 3BVNA 2CLZA 2AK1L 5F7AA 1S9WB 3NIDB 4HBCH 4I1NB 4IOSD 4Y4HB 4GT0A 1E2WA 2C4FT 1QQDA 3WMPA 3OWEA 3GLEA 2Z91A 3L7FB 3VX0A 2GEQA 3OQRA 1Z7JA 5FECA 1E6JH 3O8XB 3VSVA 5KAQF 2QEJA 3THMH 1R3LB 3NESA 3IMTA 4WI6A 1F58L 4Y1AB 2R83A 2VLJD 3MGTA 5FO9A 3L3JB 2R0KL 1A47A 2QGEA 5G4OA 5DEJA 5H2BA 1L6PA 4P46D 2G0LA 3ABLB 3DXAE 4B9FA 5KYNA 4L8BA 2ITDB 1LNUB 3JTSA 4P06A 4NO5B 1TQCC 2N01B 3HN8A 5FDWB 3MTXA 5T5FA 5KW9L 4MASA 2VXUH 1H3XA 1HJCA 4PVLA 1TPXC 1BM3L 2YSTA 3HEIB 7CGTA 3KXFA 3EXJA 1IB5A 4QRPE 4I0CC 1E4XH 4PJIF 2E7HA 3LH8A 5K39B 2MNUA 3KPNA 3N1GC 5ESVA 3X17A 4D8OA 2EYTA 5JQHC 3UP1A 2IADA 4ZW8A 4IBLT 3SJVE 5E1AB 2QV4A 4LL4A 4JN2B 4TLUA 4FI8A 5IMLB 3S3SA 5D1XB 4DZBB 1R3JB 1U36A 4FEMA 4GQPH 2W65B 4OF7A 1XGQA 4BFJA 4AQOA 3M6DA 4XNXL 3PWVA 4EEEA 5KG9B 4L8SC 1KIPB 3ESNA 4OGZA 2XQYK 3KPQB 4YXLL 3ECBA 4D9LL 4PTUB 5EDXA 4FG6C 2DH2A 4N24A 3CC1A 3C6LA 5K5YA 3FQUB 1R3IL 1UB6B 5D7IB 1IVTA 4H2AA 3Q5TA 1AZZC 4LLDB 4XO4A 2NCMA 4LDEB 3VRLF 1NGZB 4PHZA 1QR4A 5CWSB 2IIJA 5C97A 3KCPB 2IBZY 1BLIA 1OANA 3OXRB 3BDYL 4XPAH 1CDHA 2DM2A 1ZT7A 1NEZG 1M1SA 4HX1A 1OGAA 3IDJB 3RTQB 4L1TA 1P6AB 2JB6A 4HXAL 1D5IH 2QFPA 4NZ8A 2HLAB 2MCPH 3VXQB 3VRIB 4OM1H 3ZDZE 4WEBL 3Q43A 1D7CA 4J2XA 2EDHA 5TQ2L 3O2VH 5D7JA 2G5UA 2J8HA 2LAAA 3SD2A 4DKEL 4CVUA 1TZHB 3D6GA 3QUKA 2JCCB 2XTLA 3GO1L 4IKNA 1GY2A 4E9SA 4PY8J 3VCLB 1Z9MA 5GS2D 2EIZB 3K0YA 2Q3XA 5CZVH 5ES4B 5TE7H 3PJSA 3ARVA 4P2OB 1PJ9A 1RV6X 1KB5L 2P4AB 4WFED 2BSEA 5HVGB 4Q9RH 3JUZA 4HS3A 2WBJD 3AM8C 1TTUA 1BFVH 1P4BH 2HT4D 3A6OA 3PWPB 4HHWA 4KFZC 2EECA 1NMBH 4AH2A 3MLUL 3T2LA 1I7ZB 1S7VB 4E9VA 4PGEA 5EU4A 4PH8A 5EEZA 1HXKA 2EDTA 2H8PB 1T1WA 2CK2A 2IOMA 3N85L 4J3OD 3VB8A 4DESA 2ENJA 4GKSA 4TVPD 4B97A 4DGYL 4JK0D 5HVWA 4NAQA 1MREH 1PZAA 4W4OA 1IRAY 3WEOA 5DD6A 2X42A 1SY6A 4LCCC 5KOMC 1L0XA 2XA3A 2ZUQC 4JFYB 2NOYA 3WNMA 1R0AH 3NDYE 2X2UA 1MCWW 2VSCA 4APQB 4F58L 1MWAA 1MSPA 4WWPA 4ZW3A 4NKOA 1HNGA 3RIAF 3GZPA 4HIEB 3T0ED 4LF3A 1YYCA 3TBTB 4KZCA 1JXKA 4PS3A 4G8GD 1IFRA 5JPMC 1YZZA 5EZLB 3LDBB 1MCKA 5MI0C 1YEGH 3VE0B 2VL5B 3LKNB 2DRUA 4UTAA 1JJUA 3ETBJ 4H13C 4EI6A 3BE1H 1DVYA 4N8VG 1CYGA 3OB0H 4BE5A 1KEGL 1NFDF 1Z9NA 1E28A 1PIGA 4UI2A 3STZB 2M1KA 4U1NA 1WWAX 2L7QA 3K6NA 2JTYA 3WLBB 4MJJA 3VFVB 2IAMA 4NO2B 2BM3A 5FFGA 1S7TB 2E7CA 1DVFB 1G7PA 2AK1H 3FQ1A 4UTCA 1MZYA 5KSBB 2DJUA 4AGPA 4LHJB 4AMWA 1R24A 3GGWB 2JXMB 2EKJA 2OMZB 1TSHA 2R1YB 1IJ9A 5F1KC 3ARFB 1NC2D 2Z8RA 4Z5RA 3MKKA 2AXWA 5SX5H 1FJ1B 3T08A 3QZBA 1YYML 1F58H 1RURL 4FKKA 3FB7A 1JHTB 3JVGA 3L6FB 4KV5E 1QSEB 2R0KH 2ZZUT 1DCLA 3G6JE 1WTLA 2V2TB 1ILSA 5C6PB 1N4XL 2GTQA 4LVNB 4WGKA 1BECA 5F21B 3KBHE 3B7RL 4XMWA 5GZOA 1GL4B 1A2YA 2E0PA 1XCTB 3FU6A 2P48B 3SKMB 3CZJA 1T6VN 1S7XA 4EN2A 4GXVL 3P11L 1BM3H 5AZUA 3VI3B 3QI9B 2OMUB 1OWWA 5I17A 2W9EL 3VXPB 2BNQD 2CPUA 2LE9A 3RGVD 1JPFA 2VDLL 3UIYA 1HDMA 4GUCA 3REVA 4M5SA 5E4OA 4PJ8A 4X7EC 1I8UA 1C7TA 2D7QA 4N2IA 4JM2C 3NJKA 1YG9A 1DN2A 1U3HA 4GW4A 4PSRA 2NY6B 4XVTL 3FULA 3M1OA 3UMNA 2FHFA 1IILE 2Z4TA 1T04A 1WP6A 4HKZA 4UDUA 4BWUA 3PREA 4JNXA 1QBMH 5I1LB 4XNXH 1UJ3B 2K3HA 2XWBA 2CLZB 5I9QB 4I3RL 2A9DA 2BRRL 3B8YA 1I1RA 1QTSA 2X3BA 3V4VH 3STLB 4YXLH 3J8F7 4D9LH 5AOIA 1ASPA 2KZKA 3R4DA 3QIWD 3FO0L 4MQXC 1R3IH 3DOSA 4AQ1A 2BIIA 1B0GB 5FECB 4K23L 3NCYP 1CTOA 3EH1A 2V9RA 4B9CA 1L9RA 4NO3B 5DJ6B 3BDYH 3JV6B 3F01A 5HHOA 3EFFB 5CEXB 5DYOA 4XX1G 2I60L 2NXZC 1R5VA 2VDKB 3C8HA 1NAML 2IQ9L 2Y1ZA 1YY9C 1P1ZA 1BOYA 4HXAH 2CUIA 4FFZA 4HGWB 1KFGA 2GT9A 1BX2B 4U1LA 4WEBH 1JWUB 5TQ2H 4P3WA 4DKEH 2ZKYA 1F2QA 4G6AD 5DS8B 4KUZL 2WKLA 3BFOA 5KBNC 3GO1H 2CDEB 3ZX1A 3CFMA 2G5BA 1MLCA 4WI8A 3IAPA 3DUHA 1HEZA 2APBA 4KVPA 2EZ0D 3LNFA 3T4YB 4WWKA 1KB5H 4PJFA 1KCBA 5FYJL 4ZAKC 2GC7C 4ETYA 3BVUA 2WGXA 5F7NC 3EYQC 4I4WA 2Z1KA 3QUMA 1KCWA 4FHKA 4LP8A 4KXDA 2C7UA 2R27A 3K72A 1ZRUA 1J0IA 3MLUH 5TDPB 3GTNA 2N1KA 3C6EA 3QORA 5GISL 1GCFA 1O5DT 4M1GH 3N85H 1I1CA 1HXMB 3B2PA 5K9KB 1CB4A 1OAKH 1J0YA 4DGYH 3BKCL 5ERWA 4FX5A 4BYHA 4FF9A 2BWIA 3ZMEA 3H4FA 3TH3T 4Z7UB 1NIAA 1TF4A 4F58H 5JXEC 2F8VA 1UZ6F 4HH8A 4YFLF 3P1VA 3KS0J 1ZT7B 2FNWA 3EO1B 1ADQL 4ODXA 5CU9A 3OGCB 3N3EA 1U8KA 3CFDB 3CHRA 5SX4H 1U3YA 3QQ3A 4MCZA 4UZSA 4LHQB 3VXME 2J4WL 3QZWA 4GIOA 3RX5A 4A2GA 5J6GB 3RUGF 3RFZB 4PS7A 1EAOA 1FFNA 4MBRA 1EGJA 4LKCA 5DK0A 1X7QB 2DYPD 3C9NA 3EFOB 1KEGH 2A74A 2XTJC 4YHYB 1ZVYA 2HKAA 2ORBL 2PYED 4UOW0 3BGAA 5IZ7A 5JORB 1ACCA 1B0WA 3BP7B 3BZFB 1RUAH 4MCNA 3WKYA 5MEOA 4XPFL 2QZQA 4L4VE 3VX1A 4H8QA 4R96B 4OZFH 1XXDC 4EN3A 5F3BB 2BY0A 1YC7A 4S1DC 3KNBA 2J8UA 5EZIL 4MJID 3R7QA 2D31B 4XNMB 3OJVC 2EH8L 3L4WA 1GMEA 3LIZA 3NRQA 5IESL 4QF1B 1OE3A 4N5UA 4PGEB 5EU4B 3P0GB 3G9VA 5GGTA 5L2KD 1IT9L 1T1WB 2BVUA 1RERA 4IHBA 3KR3L 4GKSB 1UB5B 1YYMH 2K1MA 3DXAB 3RWIB 4NQXB 1RURH 4FA7B 3K2UL 3UGXA 5EC2A 3IDNA 2FYVA 3HPLB 3N43F 3ECUA 1BFTA 2R59A 1N4XH 3O2WL 1PZSA 1U41A 3O4LA 4N86A 1U9KA 2P8MA 1BQKA 4QRPB 3F7YA 3NFPA 5JW4N 1FH5L 3TT3L 2YD7A 4PV1C 1GGYA 4DCQB 1QZ1A 4JPIA 2P7TB 5DHYB 5B4MC 4GXVH 3NIGE 3P11H 5E6IA 3KWUA 2W9EH 1PSKL 3CDZA 3FUMA 4HC1A 3SJVB 2QL1A 4KKZA 5EIIA 2YAMA 2WLYA 1SXZA 2VDLH 1BDYA 5GGSB 5C9JB 2GJ6D 3H7BA 3NPSC 3Q01A 3Q8AA 1WV7T 3FYIB 4R90L 1E28B 1KXVA 2QKIA 5J1AA 1IEHA 4XVTH 1NH6A 5K59F 4A2LA 4A63A 3NEOA 5JYLA 5B39A 4Z7QF 4I5BA 2IMMA 3QDMD 2MSPA 5I8EA 2F8OA 2CR3A 2GY5A 4XWGL 4L05A 3EUUA 2WIIA 4I3RH 4H0GA 4YHIA 3JWNE 4TLTA 3DV6B 2BRRH 5HGDB 4P5MB 1W80A 4YGVB 2UWEE 5FHAL 1OM3L 2O6FA 5EBLB 4AWJC 5KUKA 5D7SL 4XP5L 1GS6X 3VTAA 2XWDA 3FO0H 2FEJA 4LLVB 4Z5RB 2RQ8A 4OFPA 3UO1L 1QOKA 2ZOLB 2SEBB 5T1LA 2MCMA 5L2JB 4IGBC 1MFUA 4K23H 4Z3FA 4XRCB 1M9WA 1WZAA 4X0NA 1I4FA 3ZDZB 4HJGA 1WSST 4KPHL 4DQAA 3P9MA 3C60A 2I60H 2R1WA 5BRQA 1NAMH 3CX5J 1A6TA 2IQ9H 2AK4E 1JUFA 4FFYA 4KRNA 2J1KA 3G04B 3MV9A 3Q9QA 2VC2B 3ZRFC 1XGRA 1RK0B 3MLXL 4Z3EA 4HIIB 5B7MA 3R8QA 1XF2A 3WIIL 4KUZH 4EVNB 4N0UA 1U33A 4PJ9C 1NGPL 1A3LL 3O41B 5I17B 3WUZA 4RFNC 1CO1A 4FZEL 2IBGA 3MRLA 4BFFA 1JPGB 3WHE0 4LBAA 2GBUA 5FYJH 3REVB 4ZMPA 2DTSA 3VGGA 1TLKA 3GSRA 4C47A 4WUUD 4W9GC 4YBLB 1BIHA 4WRLA 2EC9U 5KAQG 1JV5B 1S78C 1R3KB 4JO5A 3ILQC 3SE3C 3LRHA 3ZU8A 1AC6A 1KN4L 3E9TA 4PP1C 1GZPA 2VMFA 4M03A 5GISH 4J39A 1DSYA 1T5XA 4OJCA 1AR2A 3MV8A 4HS6B 3GMLA 4D9QD 3OMIB 2R29A 2AMGA 3BKCH 5HJDA 5HHNA 2YA1A 1TVHA 1IC5L 1X9LA 4LCUA 4I9XA 4L3EE 3MRBB 4OCSL 3ULUE 1NCNA 3CFIC 4ZFGL 4ONGL 1DJWA 4FHJA 1E4KA 1J9TA 2XU9A 4LCYB 3FB5A 1UT9A 1BYOA 5DO2D 1ADQH 4ACTA 4CUCA 2Y5TA 2Z35A 2NY5L 3VWKD 1WHOA 1J9SA 1JGLH 4D0CA 1LEKA 2ADIB 3GJFA 3CTTA 5DZLA 3HMWL 4RVBA 4NQEA 3SSGA 2AJZB 4FAAB 2ORBH 1AZUA 1OB1A 1SLWA 1WWCA 2X6VA 4HKBB 4PYGA 4XPFH 3WXVL 1YJDC 5D5ME 2BP8A 5CM1A 1XB6A 2DLFL 5I1CL 1IKNC 1S9VA 2DS4A 3WNLA 5EZIH 5EEWA 1KTLB 4Q2ZA 1BA9A 3EJQA 2EH8H 4WW2F 3U82B 5IESH 3EO9L 3B9EA 5EEVA 3WEBA 1VCBC 3VVWA 1U8IB 3G6JB 2BCKA 1IT9H 3CX5K 1JSYA 3N0AA 1TOXA 5T5FL 1QFWM 3OLEA 1G7JA 3K2UH 3HAEH 2XV3A 1OEZW 2IQAA 5HY9A 3D5OF 3V6OE 1WO2A 3V6ZB 4IOIB 2IANE 1QLRB 8FABB 3O2WH 4K5MA 4MQSB 5JIMA 4B41A 4Z7VF 1XCQA 3ZW3A 2MPVA 4LRIA 1JZ8A 1FH5H 4HJ0C 3TT3H 3V6BR 3BGFC 1IQDA 3RWJA 3ZQWA 1A1MB 5D1ZB 3GM0A 1G5AA 4JQIA 3T2QA 1JZDC 4RZKA 3BVWA 5AYQA 2UY6A 3NH7L 5IHZA 4X6CF 5KBDA 2BHUA 1Q9LA 4G9FA 2NTFB 4E68A 1T1YB 4DP8X 5C2UB 5CGYC 5HHPA 3ML9A 3A22A 4R90H 4TV3A 3UC0L 4DO5A 4HK0A 3VFSB 4Q89A 4NO0A 1S7UA 4PR5A 3MODL 3S37X 4TOYL 3LB6D 2OLDA 4XWGH 4M8UA 5DURB 2YXVA 4MJ6B 1OM3H 5FHAH 5IIEA 4FXKA 5D7SH 1YNTA 4GP5B 4JAMB 4XP5H 5D2NC 3ZGIA 4JCWA 1B6DA 3VG9C 1OWRM 3L5HA 3BSZA 4NQDD 3UO1H 1S5HA 1LQSR 1VESA 1A1OA 2V7NA 2Z6FA 1GYWA 1YN7B 3WGVB 2AJVL 1JZHA 2HUEA 3IEAA 4MB4A 4NWUL 5IMKB 5BUGA 1ET5A 4X7CC 2X7LB 5HGHB 4KPHH 3ZL2A 4CVZA 3IDNB 3FSVA 2JQZA 4KUCF 3SGDH 2P8LB 3QJTB 4PJ5A 5C70A 2C3GA 3S48A 2HAZA 1ZHBB 3F7YB 3MLXH 4G2AA 5IBLD 2IPKA 1KCRL 1BMZA 4J4PA 2F19L 3GIVA 4JPIB 3WIIH 2HG5B 4C4KO 5I0WA 1NGPH 4G6FB 1A3LH 3RNQB 4R0LB 4ZXBB 4FZEH 1TQBB 1BBDL 2XXFA 3MV7A 3T0DA 1XCWA 5DVNA 3BP5A 1AGFB 3V4PA 4Y19A 3GFUA 3N40P 3OKNA 4JVUA 3KVPA 4MD0B 2DM7A 3KS0H 3L3GB 4YFEA 2BIPA 1SOQA 1FNSL 2PLTA 1JVKA 1GPOL 1HHKA 1SY6L 3EH5B 3NACH 4WHYH 5BV7L 1KN4H 2X0WA 4NWTL 4AYSA 2ADJA 4UUJB 1MWAL 2WIIB 2J7LA 4M6ML 1QR1A 4QRSA 2MCAA 1HXYB 1UA6L 3DTUB 3UBHA 2P8PB 3OMNB 2K6WA 2TSBA 1IC5H 2NY1D 4K5NA 5FUCC 3IXAA 1ND0B 5LCVA 2XWRA 3W81A 3FU0A 4OCSH 3GUTB 1UOWA 4UTAL 4N5EC 5J4MA 1C16B 1FNEB 2LFEA 2FEDC 1FIGL 3PJLA 4ONGH 4ZFGH 3VXMB 4JRXB 5JMRA 3VXRE 3VFRB 1C12B 1EH9A 3AQZA 1PLGL 3D09A 3C60B 2G9KA 2R1WB 4DGUA 3H8NA 2ED8A 5KVEE 1D9KB 5FDYA 2BSTA 3QIBA 3RWHA 5IT2L 5FFOA 4ZUWB 1AD9A 1GXEA 1BQLL 2DQ6A 5FA4A 3TA3C 2VDNB 3BFQG 3NRPA 4IBSA 4L4VB 3V0VA 5E9NA 4U3XA 2NR6A 3CFTA 2A0LD 2AABL 2GK0B 4C4KT 2EXTA 4KJWD 3H0TA 4LOFA 5C7XL 1CXIA 1JD9A 1RZ7L 4M7LL 3VI4A 1YEJL 1I53A 3WXVH 4ADJA 4JFQA 2HT2C 2JJSC 1K2DB 2K4WA 3KPMB 5GS0D 2DLFH 3L4CA 4MMXA 4YPGB 5I1CH 4XGZA 3LAFA 4FFTA 1SZNA 4QJ3B 5E03A 1RSYA 4G59C 5ETUA 3EO9H 2RHEA 5H8DA 1U8LB 4N9GB 4LDCA 1AKJA 2WV3A 3WHXB 5T5FH 2DL2A 5F7HA 4O51B 5FM5O 5E1HB 5F89A 5H37H 2EE3A 4N0FB 5I30L 1X6NA 1RZJL 3NIGB 1YHPA 4FKEA 3GI8L 1BQHG 1I8MB 1HCFX 3K1DA 4P3CL 4Z77B 1AHWA 4MA1C 1H9VA 2A73B 2P46B 3EG9A 5HI4C 5SWZA 3HE7B 4CNIB 2IC2A 4HOMA 4HALA 2F2HA 3SKUD 1HQ4B 1OQXA 1ZK5A 1UH4A 3D25A 3LQZA 1QPKA 2Y5TB 1XIWD 3NH7H 4K5LA 4PLNC 5ITBH 4MWFB 5EU3B 2OXGA 3HE6C 1TZOA 1PNDA 2N4IA 1PQZA 2DQDL 3MVSA 3UC0H 1Q0EA 1XF1A 1D7DA 2WY3B 2XZAL 2CBTA 3B2MA 4KQ3L 4D2NA 2CM5A 2W92A 2PTUA 1KGWA 2UWEB 3M1BB 2NUPA 1WCBA 1OB1B 4KI5E 5E2JA 1N5YL 5D1QA 5D72L 4EI5A 4QHMB 5BOJA 4PRIA 3MODH 5C71A 4TOYH 5TK4A 3TOPA 2DWEB 4X5WB 1U8MA 1WFIA 1ZT1B 3H9SE 4KQ0A 1Z0NA 4OSUL 3K6SA 4MHHG 4OR1A 1VJSA 1NC4B 1TR7A 4WLCA 2EDWA 3T71A 2IPUK 3F58L 3DX3A 4DEUA 5EFIB 5E9AA 4A7SA 2AK4B 3B2UC 5D7LB 2AJVH 2BP0B 4MRCA 5C07A 4J3TA 2CCLA 1DJYA 1UACL 4MD5B 4NWUH 3D1MC 2CLRB 2EEDA 2YQGA 3HUJF 4Q4EA 1ZV2A 5AZEL 3G5YA 4OUUB 2EUVA 3DRTB 3KW7A 3KLDA 3HCVB 4W9HC 4XHQA 5KJ4A 2F8XC 5JZ7D 4XN9A 1TNNA 3NG5A 4JRYE 2GUOB 5DEZA 5IEKB 1KCRH 1KIRB 1L7IL 1N67A 1BBDH 2UY6B 2WWOA 4FQXA 2ZCKL 4OD2A 3EYVA 3QEUB 3ZHNA 3BFWA 3CFJB 3VH8B 2H32A 3KVDD 4WTXA 2ARJA 1I1AA 3VFUA 2VL4A 2D3LA 1FNSH 2YK1L 3GSWA 3VRIA 5IB1A 4NO0B 2ITCA 1SY6H 3DIDA 2OCJA 4PR5B 2CO1A 3B43A 2OW7A 5CP7B 4RAVA 4NWTH 4WGVB 4XMZA 2X38A 1KTDA 3X12B 1MWAH 1CXHA 4L3EB 4M6MH 4O02B 1EAPB 3QDAA 4PBWD 2AEQL 1JTPA 5I71C 4P23A 4LHUA 1JZ2A 4JFPB 4LEBA 3KPTA 1Z9LA 3CWGA 4FJ6A 2CDFB 4NNPL 3NCMA 4UTAH 2WIMA 3BH9B 4LQFL 4KJQD 1FIGH 5DVOA 3CHPA 4QRFA 2YD1A 4U6XB 5TE4L 3X3FL 3PABA 3PWUA 4K2UL 4U49A 5FX3A 2L4OA 1PLGH 5IOPB 3NP3A 5I26A 2BIQA 1B4TA 1EX0A 3MYJB 1NGXB 1OZTG 5FYKE 4X6FA 5AB1A 5IT2H 3FZUD 1T89C 3PP3K 1BQLH 1D5BA 1QYGL 4KO5A 3FQTA 3PAYA 3DPBA 4GMSL 4NFCA 5D5MB 4D0DA 2AABH 4FI7A 4PWGA 5C7XH 3LIZL 1RZ7H 3VFGL 4M7LH 1DVXA 1YEJH 2OMYA 2AQQA 4RMWA 5JQ6L 3P30L 3RBSA 5GGTL 4Y16A 1DBAL 3KWVA 3MRDB 3OTTA 3QUYA 5A7BA 3KPRD 4PS8A 4YSTA 2NZ9C 1EPFA 4OFYA 4PJHA 3U30B 3U36A 1I9IL 4NM8L 5ICUA 1H5BC 2BC4A 4FTDA 1HHKB 2GKIA 3FTGA 2BVQB 1J86A 4JUTA 2BSSA 2HMIC 2NY4D 3A0OA 1P2CA 1AACA 2GSIA 3QPXL 4O2FA 4PB9L 5IB5B 5IFJB 5C0JB 1V7NL 1IM9B 3MBWB 4N2CA 3TJEL 1R5IA 2PYFB 3PGDB 4KY2A 5I30H 4W4NA 5LBSA 4BSJA 1RZJH 4DZ8A 4ELKA 5CP3A 5SWSD 3GI8H 1QLEL 2WYIA 4HKXA 2JE8A 4P3CH 2VDOL 4OI8A 2UUDH 3SCMD 5E95B 3FT2A 3IBOA 3MRFB 4LCIL 4J3XA 1HL8A 4LOUD 5IHHA 5BQ7B 3ZHFA 1YMMD 4LKXA 4OTXL 2Z31C 1F8TL 4G7SB 3SGJC 4L2LA 3UBFA 1LQBC 1DQML 1XEDA 3OZLA 3ZE0F 4X80L 4KHXL 4GRLD 3VNYA 2DQDH 1QSFD 5E1QA 4N2FA 1FN4B 2XZAH 4KQ3H 1GJIA 5T33L 1XTMA 5FM8A 5T1MA 3RIKA 3MA7A 3L5JA 1N5YH 3JWDC 1OB0A 5D72H 4PG2C 4CW1B 2APTA 1OAUL 4KMTL 2XA8L 5B1JA 3BVDB 4XVUC 4Y4KA 1NTDA 3ARDB 2YARA 4OSUH 5IB3A 5CF3A 2YRZA 1X44A 3G5ZA 2DIBA 3FJTA 4PRBB 3F58H 5IW6A 1CDBA 1M71B 5KVFE 2LQRA 5F96L 2O4EA 4P5KA 1TJGL 2WWMD 3BDBA 3C09B 3BVTA 4H40A 4AEFA 1QSVA 1WAAE 3H2WA 4G9DA 4LPUA 3MXWL 5AZEH 4KJPC 1HI6B 4HUUA 3EOBB 3EHBB 5F8QC 4C57C 3UAJD 5KYUB 3BKML 5HYFA 2WZPD 3FKUS 5AW8B 4N3UA 1JF1B 3R4RA 4IRJA 3LVEA 4WFGD 1E9PB 5BVPL 1TQSA 5BZWA 3QHFL 3QUMH 3MZGB 3P9LB 3U7AA 3TURA 4CN6A 3P73A 2BNUA 3GJFK 1L7IH 2IAAC 1EANA 2ZCKH 1DUZA 4HWZA 4JZOB 4U1SA 4XCYA 3N9GL 3T0AA 1PQZB 4MCMA 3H3KA 5DFVC 2R29L 5G5DA 1F3RB 1K3IA 2YK1H 2VSDA 5C3LD 4G43B 5I1IL 4JMXA 1OTTC 3UCQA 3SQBB 3WUWG 1U8MB 3L13A 3OGOE 3ZSSA 2DBJA 1YEHL 4ANVA 1N7ML 2AEQH 3E6FA 3L1OL 3W9EB 1XF5A 3VXRB 5IV2B 4UIKL 4ZPVA 3S35H 4NCDA 5I1DA 3T65B 3IJYB 2GFBA 4R97B 4NNPH 4LU5L 2VRKA 1JGDB 4LQFH 5C86A 4UF7C 5FW8A 3UG3A 5TE4H 3X3FH 4UMSA 1EGJH 4K2UH 3FHQA 5ILTL 4ODTL 4OIIL 1T2QL 3RJDA 4S11A 1MI5E 1SLXA 1TYEB 2H6PB 4KRPB 1L9QA 1DFBL 4HK3N 3ULVC 1DANU 4ODVL 1YN6B 3MBEB 3EYFA 5EBGA 1RZGB 3SD5A 2FL5B 3RY6A 3B9VA 3GSQA 1EO8L 1QYGH 1U91A 1CDJA 4LSPL 4GUOA 3S5LB 2EILB 4BKTC 4FADA 1ASOA 3F3HA 3BWZA 3FB6A 3LIZH 2IGTA 3VFGH 3AREA 1ZHKA 1W15A 4BQ8A 5JQ6H 1LWJA 3P30H 3V0FA 5D9SA 1OSZA 2GG1A 5GGTH 3NIFB 1X5AA 1DBAH 1YVLA 2WXJA 2GJPA 3FAWA 3QEQE 4KKNA 5D6CA 1IIKA 1L9MA 1IKOP 1KUMA 1W0VB 1I9IH 4NM8H 3MNDA 3RDTB 1CG9A 5FYJU 3CFEA 2WXMA 4TVUA 5HP5A 2OM5A 3GMNB 4GAGL 3APFA 4HUVB 1PW3A 3QPXH 4PB9H 2GITA 4HWBA 5F88A 3A67L 4KNTA 3VO0A 1V7NH 4ZW7A 3M17B 5ALCL 3TJEH 1DEDA 2WLHA 4IDLA 4JQIL 2DQCL 5D7KD 3MACL 3E9UA 2NPLX 2J3SA 3PP3H 1K4DA 2X4QB 4ERSL 3IYLW 4WFFD 2FO4B 4KDVA 4D7BA 1OTSC 2VDOH 3MJ7B 3IMVA 5DQJA 4XNZC 3SDCA 2NRDA 3OLIA 1YEDB 2EVFA 4Y9EA 3ZE1F 1WIPA 4H88L 3C75A 3T3PF 1B4LA 1EUUA 2XV6B 3HB3D 1BP3B 4OTXH 1KCKA 4P2CG 4X80H 4KHXH 5IB4A 3FRUB 4KMLB 5T1JA 1AR1B 1N6QH 3CSYB 4GW1A 1MF2L 4RMSA 2PW2B 2F5BL 3H9SB 2FEEL 2XOTA 1E9OA 5EN3A 4GXFA 1TFHA 3BSZL 3ZO9A 4PY8I 2OMWB 1AQDB 4UNUA 1XF3A 1OAUH 1RJCA 2XA8H 4X6BA 1OP3K 3RTLA 4MCYA 3ZYJA 1NBQA 1TKWB 1FV1A 4PJEE 3HNVL 4BRJA 3LHAA 3QUGA 4GRWF 4AIEA 5AOMA 3FTGB 4Z78B 1X3DA 4XCNA 1UWGL 3BDXA 4EZJA 3KYOB 3P3RA 4PS4L 2BCMA 3PHQA 4XODA 5F96H 3T1FA 2VW7A 4ZMZA 5J57B 4ES9A 1TJGH 3LMJL 2YAOA 3NTCL 3LNDA 2XFGB 5DQDL 3SYOA 2BO0A 2X89D 3MXWH 2ZKWA 4JRYB 4JY6B 5SV4A 2AEWA 4KO7A 2CKBL 3GPEA 3TEXA 3CXFA 1B9ZA 3BKMH 2YBGA 1UYWL 3SE4C 3ZDXF 4RH4A 2B9BA 2W81C 3UBXG 4F8LA 4IU3B 3E1F1 2F53A 4MAYA 5JIHA 5BVPH 3O81A 5JDSA 2DI9A 4NNYB 3R8BB 3QHFH 5HYJE 1QP1A 3IXTB 1OY3B 2XC8A 4BH7A 4PJ7E 5F7YC 4JGNA 1XGPA 5C0DA 3AZUA 3WMQA 1P84K 3N9GH 3B7SA 3KPPB 3OHXC 3SDXE 5BRZD 3HKFA 3QXVA 3UTSE 1FC2D 2R29H 4OZIE 4KROB 2WZ5A 3EDJA 5T1MB 2VTFA 4JJHA 4HUNB 2LABA 4GMTL 4J23A 4PJXE 5LCVL 1UCTA 5JNYB 3P3TA 4NZRL 3ROLA 3WJJC 4AGMA 5I1IH 1JHKL 1CC3A 1TJXA 5JHBA 3ARBA 5CLXA 3RP1A 1AGCA 3AS3A 1YEHH 3IJ7A 3TBSB 2A6KA 1N7MH 4ZFOL 1SJHA 1HHHA 3NJIA 3L1OH 3CU7A 5CZXD 1G1YA 4UIKH 4EIUA 4IBTA 3FXIC 3NA9L 4LU5H 3WU1A 3GJFH 2QPFA 2B20A 2C9RA 1EFQA 1RJZA 3CDGA 5DGRA 4ODTH 4OIIH 3SO3C 3ZDWA 5ILTH 3HZKA 4HUUB 3WEAA 1UVQA 3DO3A 5C08D 1DFBH 3AQYA 2X09A 4ODVH 4PMFA 3VGDA 3ENEA 5IHBA 2UYLA 5DJ8B 3TFKC 3ZE2E 4R2GD 3DURB 5CS7A 4BH8B 4PWJA 4EQ3A 1E8XA 3AW5A 1UADC 3VXNA 4FZ8L 1VDGA 3KL0A 2Y22A 2IFGA 4LSPH 3ZMRA 1U3ZA 4HH9B 1ODAA 4I0KA 2YOAA 5IJVB 4YDVB 2C8NA 2NY3B 3BMWA 4OV6F 4DUWA 5J11C 1AO7A 5EEYA 5IREA 3ARGD 2V6HA 2VDQB 3DJTA 4M7ZB 1HK6A 1G0XA 2WBXA 3H3BC 5T1KD 1HESA 2EABA 1R6VA 5DUBA 2ZE0A 3FO1B 4WVRA 4KUCD 2NCEA 1Q4NX 2CA4A 2DLEA 1BF8A 2NQ3A 4O5LL 3R7RA 3RWCA 3HNSL 2A6DB 1RY7B 4QXGL 4RETB 2DQUL 1HL5A 4GAGH 4IOFC 4OZHE 4YE0A 2IF7A 3BT2L 1E4HA 2NXYD 3CH1A 3FQWB 4QXUL 3A67H 5DRZB 2P5ED 1DJGA 4EXKA 4X5XA 5JYMA 4G8EA 5ALCH 2EXSA 2XWXA 3AXHA 3E6FB 2DQCH 4JQIH 3V7MA 3MACH 2ZUWA 5C09E 1NMCB 2WAQA 5I1DB 4Z9KB 4ERSH 4E5XA 1CMOA 2CBOA 2NLJB 4KK9D 1Z5HA 4LSRL 3V4UL 1IAKB 2PO6A 5FAAA 1D3CA 2AV1A 2H0FA 3QUXC 3AQXA 2CRZA 3DMMC 5KSAD 3E7JA 1F97A 1MCFA 3KPLB 4KZEL 4H88H 1IC1A 2ZTBA 2NQDA 3DX7B 4HCRA 3G5WA 3V5DA 3IJHB 2Y2TA 3DYOA 3SDAB 4Z0XB 3KLAA 3WYRA 3ETSA 1H3UA 3G3LA 3U0TB 2L04A 3W0WE 3NVQA 4X4KA 2I5YL 2ZUVA 5JHDE 4U1IB 1MF2H 1SBSH 5AW5B 1D2OA 2F5BH 3ARWA 1P5UC 1YC8A 3BSZH 4Z76A 1L5GB 1GGCL 3F5WB 4ATWA 2ZWNA 3UG5A 2R4SL 3D34A 3GSUB 1WC7A 4AQAB 4KVNL 1FL6B 4PJFF 2EDNA 3SBRA 3VFPA 4B9YA 2BNRD 3CFKB 1Q0YL 1IQWL 1M3JA 2BMKA 3BXNB 3HNVH 3PL6A 5FO7A 3S6CA 2JB5H 4TQIA 3WY4A 1JPSL 1UWGH 4Y5XC 4PS4H 1C1EL 3Q1EA 3O6FD 3SGDI 2CRMA 2JKJA 5GS1A 4MZIA 4BA0A 1PZ5B 5DJCA 5HYSB 5B3JE 3LMJH 3NTCH 1FIEA 4MJ2A 1GVIA 2IO5A 2OXHA 1NZRA 5DQDH 3D39E 3CSBA 4BXSV 4MJ5B 2CKBH 4BFIB 2QR0A 4TM9A 1KJ3L 3C6SB 4MRBA 5DO8A 1A4JA 5E8PA 2ZJSL 1MPAH 4Q4IA 4HV8B 3V4PH 3QUZB 2WOBA 2DQJL 5IKCB 4U3SB 4P07A 3SDCB 3NCCB 2VDRL 1OP3H 3EBHA 2VIRB 4RGMC 2Y3AA 3HFFA 1OL0A 2AF2A 4PTTA 5L4MA 2W0FA 3CVHB 3QH3A 1DUYB 2ERJC 3LKOA 4JM4L 3V10A 1BVNT 5BVJB 3I6KA 4MMZA 5F0MB 5ISZE 2HFEA 1XGTA 5HVHC 4WW1B 2NY7L 4YSCA 4GMTH 2JKIS 3RZCB 1NUNB 5LCVH 4NZRH 3T6ZA 2BZCA 3SY0A 1JHKH 1BZ7B 2FIRT 1U95B 1F4AA 4DPAX 1OGTB 1HE7A 4N6RA 1RHFA 2P5PA 2PCPB 4HEMA 1W6WA 2XTJE 5B38A 1P7HL 2Z8VC 4HDIB 3MNMA 2J55A 3Q6FB 3NA9H 1MI5B 3O3EB 5EORL 4BCYA 3PHQB 2WXPA 4GSUA 2OW6A 4XN1A 2CD0A 3QG6A 5B8CA 4JKWA 5KSUA 3N1PC 2OBGA 5BCAA 1E5YA 4KXZI 1I7RA 5IQLA 2K6ZA 2CM6A 3KYMA 3KE0A 5GJTL 4PCTA 4F57L 3TJHD 4FQHA 4PUBL 2D7OA 2FYYA 4FZ8H 5JDSB 1VSCA 2Y7NA 3OL2A 2JELL 4JM0A 1RUMH 3QEQB 5IB2A 3U46B 1RP8A 4MA3B 3MROA 1TQCB 2YC1B 2ZX6A 2ZX5A 2XG4A 1TPXB 3WTTA 2X4NA 4FLQA 3B2XA 2BX5A 1C08A 2HJKB 5DS2A 5JXAL 4QHKJ 2J5WA 3WTXA 3BN3B 4O5LH 5I5IA 1KLGB 3HMXA 4YWGL 3HNSH 5C7ZA 4QXGH 3RWEB 2DQUH 4RIRA 3TN0A 3MOAL 2YA2A 4PI0A 3BT2H 1Z3GL 1WLHA 4QXUH 5AW2B 2E7DA 2DJMA 1ZEAL 2A6KB 1HHHB 2WJ7A 5F7FA 1JZ3A 3ZL4L 3UPCA 3VFTA 3ERXA 4RZCA 3ZVVA 1IGJA 4GJTB 3WKQA 2XJLA 3UTTD 2F7PA 3R06A 3DTXA 3GYRA 4LSRH 1JXDA 3V4UH 4KNQA 1JNHA 4L37A 1TTFA 5GGQL 2AQSA 3KBEA 2HX7A 1HEHC 3UZEA 5CD3A 4UOZA 1EJOL 5LDSA 4A37A 4PRPA 3IF1A 3VQ2C 4IJTA 1YNKL 3U2JA 3NSDA 1J0HA 3T77B 2I5YH 4YUEL 2IH1A 3LZPA 3U1SL 4MGXA 3MRKB 1P4LB 4A6YB 1O6SA 4PJEB 4F2MA 4FTVE 1GGCH 1U3JA 3IFPA 4UM9A 3C8KB 2R4SH 4PJDA 4KVNH 2Z7YA 2HVKB 5BPPA 1Q0YH 1IQWH 1JN6A 1FUNA 2YD5A 5GGRY 3E8VA 1A4CA 2V3FA 2GTWA 4LARL 4HWNA 2M26A 5FKAA 3VFNB 1RK1A 1JPSH 2VLLA 1C1EH 4GW5B 3HC4L 3STBA 3WFZA 3ZXAC 1WBYB 5AAPA 4XB8A 1MAML 2P5WD 3L1EA 3E2HC 4KBPA 5CLZA 5MEQB 2CO6A 2V3EA 3CQQA 5CN2A 4DVBA 1KJ3H 5HYJB 2ZJSH 1Y7VA 3DROB 3S36L 4PJ7B 5KVDL 2JJVA 3NCJL 1GGUA 4LCCB 2DQJH 4WK4B 3EO0A 1HX0A 2ZUQB 3BWSA 4K8RL 5H37G 3X14B 2H32H 5ABZA 1FZJB 3FW6A 5EN2A 3QEGL 3SDXB 2VDRH 2FEDD 1NICA 3UTSB 4OZIB 3T6QC 1JZGA 3P2DA 5GSVA 4YMPA 1RPQA 4PJXB 2QTEA 5JPMB 3MGOB 1WA2X 5MI0B 2ZUXA 4G80A 2NY7H 4B0MB 4NZUL 3TF4A 5FV1L 3T09A 3VAEA 4RFOL 3MTRA 2E8YA 4MAUL 4IOSA 5CIPB 1F1AA 5T3XE 5AD0A 1PY9A 1S7RB 1HHIB 2CJSA 1KXTA 3L3OC 5FW6A 3UABA 2XACC 4F37K 1NGWA 4UT9L 4UOQA 1AZRA 4QT5B 2NW3A 5EO1A 4FN0A 3CN4A 3ZIMA 5DMKB 3FU7B 3TZVC 2GAZA 2LAGB 2VLJA 1ZLSL 3IRPX 3ZE2B 5D4JA 3ZTJH 3D4CA 1HWWA 4P46A 3ARQA 1U0QA 5E8PB 5IROC 3G6DH 4FJZA 3NGBC 2FECL 2X70A 2EYSB 4QWWD 3P77A 2EDRA 5GJTH 4F57H 2VOTA 4I9WD 1J9RA 3AJ7A 4HKJA 4J6IA 2G3ZA 4U0RC 3O3DB 3OKOB 2JELH 1PAZA 1BZOA 3QXWA 5I73C 5D6DA 1DJZA 1RUQL 3SGKC 1X5LA 3VM5A 4HWBL 5LXGL 2DIAA 4MVBC 1P6WA 4OZHB 2XV0A 1JMXA 4GQQA 3D08A 4HOWA 2R1XB 2YJLA 4X5PA 4N4YB 5JXAH 1SOKA 3HC0A 3MRRA 2KMWA 5LBSH 2XBTA 4JM2B 3L9RB 5F0LB 4YWGH 1NANI 3RAJL 5CP3H 3DUSA 2EXWC 5C09B 4B60A 1SQ2N 3SDDC 4H8HA 1Z3GH 1QEWB 2G75A 3FSAA 5EPMB 2X3AA 4N6RB 1ZEAH 4KTEH 2ATAA 5LVEA 1YNTF 3D12B 1PKQA 4WO4C 2GSMB 2WTOA 3RU8L 3ZL4H 4ZNEA 2W60B 1AYOA 5ITFB 2F61A 2Y2YA 5E8EB 4H1LB 1T0MB 4N0CD 4S1QL 4PRHE 3E6HA 5GGQH 2MTPA 4XMPL 1LEGB 2WCPA 3W0WB 2NSQA 5DK3A 3BZEA 1EJOH 1DR9A 3EYUH 5JHDB 5AVSB 3D0LA 4F7CA 5T3ZE 1S3KH 5LXVA 3B3IB 4KVCL 5D2NE 2BPBA 1YNKH 4X9BA 5FM5M 1WFOA 1DTUA 2XN1A 2NXZB 1OW0C 2HFFB 2EXYD 2Y1AA 4FQHB 4NN5C 4RDBA 3AC0A 3AABA 4YUEH 3U1SH 4DP0X 3GHEL 5F1SA 4NUJA 5KVGE 2OK0L 2EDXA 2IWKA 4GSDH 2IMNA 3WJLA 1HHGA 3IETA 4DH2A 3AFLA 3N06B 1HNYA 3BH8A 1V54B 4MA8L 2WBJA 3TT1L 1T4KA 1LK3L 1WQVT 1T1ZB 2PXYD 2HYMA 3DJZA 4EDXA 3LQMA 2XWTB 1VKXB 1JAEA 1NIFA 5HDRA 4CC4A 3HNTL 1X7SA 4ZAKB 1XF4B 2A9BA 3FH5A 4LARH 1ZD6A 4HUWA 4PY7B 3NYKA 3RKDD 1OD7A 1YEIL 1QFOA 3HC4H 4ONOA 4H8VA 4YIQA 2X9ZA 1DBKL 3NUKA 2OQJB 3FQNB 2B14A 4N22A 1JWMA 4W93A 5EG6C 4GKLA 2RACA 4X9FA 5GRWA 4LLMA 5FO2A 3IU3A 3N6YA 3WTWA 4JPWL 3DDFA 2CUHA 5EB9A 3QIUD 3K0WA 1OP4A 3P4OB 4QY8A 3PV6A 2MHAB 5I0ZA 3S36H 3MJGX 3B2DC 5KVDH 3NCJH 2X2YA 3T0EA 4K8RH 2WXKA 4R83A 4G8GA 1J8RA 3QEGH 4PRPB 5ISZB 4PJGE 1E3ZA 4WI2A 1WZLA 5FUCE 2BVOA 2WVSA 2NDGA 4Y9GA 3FB8B 1F90L 1QW8A 1G0DA 2ZWYA 5LJYH 4QRUB 1KNOB 1AGEB 3A4DA 4XBPA 1FYHB 2P42B 3HG5A 5E1IA 1RHHB 1G6RA 1CDCA 3KLQA 4UQDA 5IJDC 5D1ZI 4NZUH 1KPRB 4MNGE 2JLPA 4RFOH 3G08B 2X4OA 2XTJB 3GTVA 4MAUH 3S5ZA 4YNYA 5EUOF 5K1JA 2WXNA 1ET7A 3OMZA 3W1ZA 4HCIA 3RVTD 1NC2A 2AJ3B 3F12A 1NKRA 5D2LA 4ODUB 5FO8B 5IGXL 3AU0A 2EUXA 1A0QL 1W8EA 3ARTA 3PQYE 2VLLB 1CT8A 2NT0A 2BY1A 3I6SA 3TTSA 5CJOL 1M7DA 2AANA 2I07B 4WI0B 2XWCA 3IDMA 3MAWA 4UBDC 1ZLSH 1AOHA 1NPJA 4LVOC 2AQRA 4WSKA 2GHZA 4PLOB 3U4KA 1FNGB 3HZMB 4FGMA 4JKLA 2WCGA 3BZ5A 3CBRA 1JXGA 1WCQA 1Q1PA 1CFTA 2X9XA 1TIUA 5ICXA 2MKLC 5IVXE 3CE1A 2AKRA 3EO0B 3FONB 4PIBA 4EZMA 4WK2B 1A9BA 4ABUA 3F84A 3HS0A 4UZUA 4HOZA 2BNQA 5HDBF 4AIZA 2DM4A 3O45A 3RGVA 5KSVA 2PW1A 1G7LA 1RUQH 3BW9A 4AUUA 5KZCB 4ZMOA 3PU7A 1LJMA 3BD5A 4HWBH 1NFIB 2HVJB 3ZN6A 5LXGH 1A4KB 2OFQA 3MJ8B 5DTFA 3PYCA 1KSRA 3MUGA 4GKNB 5DZOA 4YHML 5HD8C 2Q6WA 4S1SL 4AEIL 2JSFA 4WJG3 3N41B 3NPSB 2YWZA 4HJ1A 2IPUG 3FQYA 2ZYIA 3EJUA 1UWXK 5IFAL 4HJEA 1FZMA 3BYYA 4G42A 4MS8C 4IS6A 4P4RB 5KUMA 4MNHA 3RAJH 3VB9A 1F4WL 3F85A 1OV8A 1B3IA 3O9WD 1KY7A 3BJ91 2KLTA 2NX5E 1YQ2A 3SEPA 4KHTL 3N0PB 4BJLA 4OFKA 2JQAA 3RU8H 4I77L 5J3HC 5DI8B 2OSLB 5IK3B 1H6UA 1HVXA 3OJDB 4NZFA 4ZFFB 2GAZB 1AH1A 1SJXA 2Q10A 2EEFA 3O3AB 1ZK9A 2H3NB 1ONQB 2OV0A 4AYMC 4S1QH 4Y4HC 4IGBB 4PJBA 4XMPH 4ZDHA 2QSCL 3BEWB 1I85A 2YPLE 1H3WM 3QZWG 1VZGA 3FTSA 4RA0C 3SBQA 2XG5A 4KVCH 3O11A 4DTGL 4KKAD 5GRXG 4GPVA 3CZFA 5E0FA 2OMBA 3DETC 3QJHA 4FTVB 3QSKB 4ZUUB 4WU7B 4YHKL 1KTCA 1QRND 5D4QA 3JWOC 3HS9A 4LPTA 2VDMB 3US9A 1Z6JT 2XT1B 4ELMA 3GHEH 5J1SC 1RLBA 3G6AB 5L88L 2OK0H 4HEPA 3CLEL 2XQ0A 1S8DA 4LEOA 3KWTA 4XC1L 2A1WL 3ZRCC 4DNLA 3VMNA 3WS3B 1U8NB 4PJ9B 1GR7A 4MA8H 4RFNB 4LSQL 5E8DL 3TT1H 3OXSB 1LK3H 5KEZA 1WBZB 1UH3A 4ZPTA 1FLTX 3HC0B 4X0KA 3HNTH 3IDGA 4P5RA 2OTUA 2CRIA 1QO3A 2YUVA 1E65A 4UDTA 4RAHA 2FNBA 4Y2DD 1YEIH 5I28A 1BD2E 3EH2A 4X42A 2BY3A 3RZWA 3MRCB 2Q9OA 3CX2A 1DBKH 3WAJA 4AMKL 1JIBA 3OQ3B 1KG0B 2DKUA 1FSKC 2W91A 1KGUA 1YAIA 2PN5A 5DWUL 5CCJA 4IIQA 4JPWH 3LQAL 3DK2A 4N68A 2Y7SA 1G1KA 2IDCA 4G8IA 3B34A 2FUQA 1SHXA 4OLWL 3WIHA 3BQUD 3DVNA 5E2UL 4J5VA 4X99B 2Z34A 4GG6A 3QQ4B 4L5FE 5DRNA 1UM4L 3MPCA 3QJFA 4PGCA 4LESA 3GXDA 1HTYA 4G70B 1F90H 1H3TA 2IWFA 1BIIB 3TCTA 5AAWC 1GRWA 2DYPA 2OR7A 4NQCE 3ULVD 2DQHL 3B83A 2PYEA 3B9AA 4M56A 2EEXA 5AVXB 1H8LA 2MFNA 1X9UA 2VLKE 3W2DL 4N20A 4P04A 3QISA 5AVZB 5DC2A 1KJ2B 3MLTA 3N42F 5CN1A 2F08A 4YL4A 4MJIA 4PJHF 3CK0L 2HSIA 4XVJL 3F8UB 3U6RB 1OPGL 5D55A 2YGNA 1OTUD 2DQTL 1F5WA 5IGXH 1HKFA 1CR9L 4PYHA 1A0QH 5L2KA 2JJTA 1KT2A 5CJOH 1R3HB 3PDOA 3QP3A 3K71A 2ESVD 5C0CE 3U7YL 1N2RA 1BQ5A 2GSGA 3SBWA 1NBYB 2E47A 4V1DD 5I6NA 1DVSA 4L4TD 4LLMB 2QVMA 4NKQB 4NYLA 1HYSC 2JIXB 4OFVA 6PAZA 3ZIYA 1EA9C 4LL1A 3GMPB 4QY8B 3B6SA 1AGDB 1T21B 3GSOA 3WY3A 3CH8A 3LD8C 4TPRL 5C0EA 4Z3HA 4GYBA 5CU5A 4NKMB 4F2FA 2R7EA 1H15A 4UOJA 3BGFB 3MOQA 3INOA 4J1UB 3FU3A 2GJ6A 5LBGA 1EEZA 1G9NL 1FZOA 3MLPA 4X4XA 2FJSA 1QNIA 4JJOA 4JZJA 1A7RL 3GXFA 1DN0A 4YHMH 3P0VL 4PHXA 4S1SH 4AEIH 1KXHA 1U8HA 1ZOXA 2QVIA 3QDMA 4L1BA 4NN7C 5FK9B 5IFAH 3O6LL 1M05B 3Q8EA 4XBMA 3NDZE 5ANMA 2X4OB 2C3XA 5E5MA 4I0PC 1F4WH 1LVEA 3ZYOA 3B9KC 3QZLA 2BOBB 2YRPA 4LIQE 2CQVA 4YDIL 3LH9A 1GZQB 2V5RA 3EJJX 3T8XB 1CFSA 3KPOA 3HC3H 2VUOA 1I1FB 4KHTH 4OD1L 1JNNL 1HSBB 1OK8A 1PPIA 4HCRH 5D2LB 4I77H 3DVFA 2BFVL 3EJYD 4NUPA 1BXUA 3RPIB 2WBWB 4Y0GA 5D2NB 3T3MF 5E6YA 1M7DB 3VG9B 4L3CB 3H9HA 1KJVA 4NQTA 1T7WA 3RNKA 1NLDL 2A77L 4MMYA 3D3VE 2QSCH 3EW3B 3BN9D 4DTGH 3EJRA 1M7IA 3GRWA 5LO7A 4YHKH 3BJLA 4TLSA 2PCFA 3OKMB 1H3PL 5L88H 4X9YA 3ZDYB 3CLEH 3NZ8A 5D4HA 4P2RE 2XN9E 4GBXD 3TV8A 4ODWB 2PW1B 4XC1H 1DQIA 4F15C 1JGIA 2A1WH 3T6VA 2AC0A 3KHOA 1DQVA 1CZ8L 3OR7B 4WUUA 5HHXL 1M1XB 4KKCD 4LSQH 5E8DH 3FUJA 2WCSA 3V5KA 5AVVB 5I2IA 1U3NA 4E9QA 3B7TA 5KJRL 4WDIB 5I1AB 3WFBH 3CFNA 2FJHA 4MNHB 2NY2C 3F6IA 5TDOB 4R3SA 4LFHG 1QWUA 3TCLA 1S9YA 2OAAA 1GYAA 4Q6IA 1DVUA 5A2CA 2BFGA 1NEZB 2Z4QA 2ZWSA 4AMKH 1G7QA 5DWUH 3E1ZA 1PLAA 1ZV9A 3GS0A 2FX8H 2X4TA 4AJVA 3IDYC 4HFUL 1MHCA 4OLWH 1DJSA 4P5TD 2AJUL 5FEBA 5E2UH 3HA0A 1U4FA 1Z9OA 2WB1A 4DK5A 3APMA 4KC3B 2KPWA 4FG0A 3FDWA 1XL4A 4U6YB 5DK2A 3TS8A 1FG2A 3ME0B 3VWKA 2PCYA 3SGEH 1UM4H 4XNQB 2X4UA 5FYLD 4DFIA 1BVLA 2HTKD 4MNGB 1PZ3A 4ICWA 3BAIA 1O9VA 5JLZA 1FO0A 3T04D 2DQHH 4L0YA 3MLYL 2F7IA 1JZ7A 1GOGA 3VJ6A 2XIBA 3DWTA 2V2XA 3TA3B 4C56D 3II3A 4OKVA 5HDQL 3FOLB 1E2ZA 3W2DH 3ULVE 4EO5A 2WYHA 3B2VL 3PQYB 4XBGB 1NQBA 1BW8A 2R4RH 4ZPTB 3VXUE 4PJCA 5BZDB 3N1MC 3CK0H 4X50A 4XVJH 5I66B 2AXFA 4TUOA 1UA3A 4N2MA 1AXTL 1OPGH 3ULSA 4MXQD 2DQTH 3AADB 1CR9H 2Y06L 1KWKA 4UNIA 3JV4B 4IJ3C 4K94L 1WZKA 2VISB 3U7YH 2OYKA 3IFNL 5IVXB 2VWEC 3IFOB 3KPSD 3B5GA 4NLHA 4PJAA 2WLNA 1W91A 2FHCA 3DIVA 4LGPB 2WTRB 2I9TA 5CJ8A 4N8VB 5B1KA 4G1EA 3Q6GL 4TPRH 2E27L 1OP5K 5I16A 5EF3A 3NA4A 5E8OA 3AU1A 3MRNB 3C6LC 2DZEA 4MA1B 3V4LA 4QOKD 1T0NA 1CGWA 1N3NB 3VYOA 1LO5A 1Z32X 3GMMA 3Q06A 3RL2B 4PRAB 1G9NH 1DLHB 3A23A 5C0FA 1FVCA 3FOMB 2KLSA 1NIBA 3HE6B 1A7RH 2Z0UA 3P0VH 1FORL 2KPNA 3LIUA 1BFOB 1FVDA 3AS1A 4OCXL 2NX5B 5FOBA 1OHQA 3O6LH 4R5XA 3WIFB 1PTZA 2C5DC 4O9HL 4KTYA 3US0A 5LWYL 1T5WA 3QJSB 3MRPB 4QAMB 3RFZC 5D7JC 5IJCC 5EBMB 4JBSA 2VZOA 4OD1H 3RWDA 4NQDA 1JNNH 4LASH 2XZZA 4MB3A 3TYFA 3QO1B 3U4EB 4N2LA 4ZOCA 2YPLB 3CNKA 4IRSD 3CLWA 1D7FA 2XIIA 4P4KD 3T5WA 2GSGB 1NLDH 2A77H 2QQLL 1FNAA 2GBVA 5EULV 2G30A 4QGTA 4A68A 4F7MB 4OUOA 2YRBA 4QHUA 4AYFB 2LU7A 1KDIA 3TGXA 2P24A 4XN4A 4GS7C 3GSOB 1CN4A 4I1RA 5B1AB 4AEHL 1H3PH 5IHUL 1G94A 2PR4L 2EDMA 3QQXA 4GO8A 4W4OC 3RB7A 1URZA 2EDLA 3KYAA 1JZJA 2NZIA 3IDIA 1TT6A 5T8IA 1Q9OA 1VA9A 1HKLL 3QYCA 1SLVA 2IXQA 4TVPL 1A3QA 4NQVB 1CZ8H 4G3YL 4RBPK 5E70A 5HHXH 4LZKA 4U33A 2N0KA 1BYNA 4LFHD 4A2MA 1JCKA 1BD2B 2WQXA 1UGNA 2OL3B 4Y4FD 1EVTC 4QRTA 1U8HB 5KJRH 3ULAB 1QFWL 1AC0A 2JTDA 2PKDA 2ZOKA 2YPVA 2XBZA 1IL1A 3I3BA 3NJLA 4TUJA 1F3DJ 3UZQA 2O5ZH 1CCZA 1TQWA 3CC5B 3S35X 4PJIA 3A6BL 3MRHB 3BWAA 4XNBA 1H8SA 1SXNA 4OVUA 3TBYA 4EMZA 2R2HA 2KC0A 3EIFA 4L48A 1PX8A 3H1ZA 2X0UA 5DLLA 1T3FA 5AVUB 2IAMC 4FYTA 5I71B 1NAKL 4HFUH 2GK2A 3JTTA 3QFDA 1KJVB 2AJUH 3RNKB 5HSFA 5KYWA 1G6RL 3EDEA 4UT6A 1LLAA 4NQCB 1NFDE 3TESA 2Q76B 3IRZA 5SWQB 1U8PA 2I69A 5D7HA 1E30A 2BP3A 2CHZA 2VLKB 4Z7AA 5F1NA 1KTRL 4HZLB 3C87A 3MLYH 3VI3F 1LMKA 3DYMA 2WM0A 3JVGC 2WLLA 1E42A 3ARZA 2JK5B 5HDQH 4WEUD 4KKQA 3FO2A 4XC3L 5C0BD 2ZUYA 5DMGC 4Q6KA 3L2LA 4XH2B 1KTKE 3B2VH 4NDMA 3X1NA 5GZOC 5A2LH 2EAEA 1USZA 5IFHL 3WTSA 2KS0A 2ZXQA 4KKBC 5C0CB 1VGKB 1AXTH 4NRZA 3TFBA 2Y06H 3T6WA 1RZJC 2K8MA 3NK3A 1H5BB 1IBGL 5HHME 4K94H 5F71A 1B0RA 4PJ8C 3WFHB 1G7MB 1ZVSA 1F6AB 4R7NB 2GBTA 1SUJA 3IFNH 1PG7H 1U3HC 4XT1C 1ASQA 5MEND 2G9HB 4EI0A 2DF3A 3SIKA 1CD8A 2GCYA 4UNVA 2NT1A 3HR5A 2EEAA 4QNPF 5INDA 5HI3C 3Q6GH 2E27H 5C0RL 4J6RL 1ORQA 2FZ3B 2X4SB 4NP9A 2WLIB 4QTHA 2XXMB 4H5SB 1KJMB 4DP1X 3FS9A 2WNWA 3S88L 4ZW6A 1XIWA 2BOCA 2E6PA 1Q9KA 2VLRD 3FCTA 4J8QA 4AQ1C 1NCJA 2EUWA 3GDCA 2QDWA 3GLZA 4P2QD 5IF0B 3M45A 4R7VA 1BG1A 2YBRB 3IT8D 2DWXA 2L7UA 2RTTA 2Z31B 3NFSL 1V7ML 2H26A 1FORH 4OCXH 1SYVA 4OLEA 2XVBA 3N5AA 3MLVL 1EV2E 3BP6B 4JFFD 4MB1A 4O9HH 3LKPB 5AKSA 1TTCA 1G9EA 2JF1A 1GKOA 4LLQA 1IGYB 5LWYH 4LHUG 1K6QL 3QW9A 2VRQA 2X6UA 5FV2A 3PHSA 5AFAA 2AXFB 1M2VB 2H41A 4DP9X 3ZZSA 1LE5A 1DEEB 2BERA 1BLNA 2Z92A 3D3VB 3K8MA 4X7TB 1OP5H 1FF5A 4URTB 1IGTA 3DBXA 2DIJA 4WWKC 3UFIA 2CU9A 4U1MA 1A6AB 3TJPA 4E9YA 4ZFQA 4KAQL 1N9PA 4PB0L 4F7KA 4ZFZA 2QQLH 5GS2H 3L3IB 4X6EB 3E0GA 3MRMA 3L5IA 3QQNA 2DN7A 2D4FA 5EA0L 4Z7UF 3OKKB 1TYRA 3QBTB 4P2RB 2XN9B 1OAJA 3LEXA 3QORC 4EBQH 4MBOA 2G60L 4QLRA 3ZTJG 5BS0D 2QADD 1N18A 5BXFA 1RJYA 3CZSA 3OPUA 2WMPB 4FFVC 2B77A 3B7YA 4PV8B 1PYWA 5IHUH 3RVUD 3VG0L 2B0SL 4AEHH 4E41E 2PR4H 2YPKB 2WOYA 1LWHA 1JYWA 3BWUF 3K80A 4AVJA 1I8LA 5KS9A 2VR7A 1F4HA 1HKLH 1WFUA 4J3OH 5A2IH 1FLRL 3HOGA 2Q2EB 5EU6D 4TVPH 4G3YH 2VLMD 5I15L 4BQCA 4FQQB 1A3ZA 4LPXA 1MFEL 3IFLL 4X4MA 2NUTA 4OGAD 1C5CL 3GINA 4TMPA 5FOBB 1QFWH 1PFCA 3ATEA 2X1QA 4W9FC 3VYNA 4RAUB 3VDAA 4KDTA 3WIHL 4Y7MA 2ADGA 2V8MA 3LKRB 3ZZLA 4FNPA 1CD0A 2ZUTA 1FL5A 2A74C 3ZYZA 1AD0B 3C5ZD 3TYFB 4M43L 4EKJA 2QHLA 2YJQA 4IEFB 5DA4A 3S3DB 3QRFM 1T22B 1NAKH 3POCA 1K5NA 4F2EA 1PX4A 5LLIC 1AQ8A 4Y5YA 2IFFL 2AQ3A 2PTTA 2DQFB 1ZS8A 2EE0A 3SOBL 1JRHL 2DL9A 4EN3C 1G6RH 2LW3A 1QACA 3MGAA 3QQDA 4HP5A 4RBPH 3NFNB 4W9DC 1WBXA 4WV1A 3CFBA 3DO7A 4TTDC 4M48L 2Y25A 4JLRA 2C1PA 5ABDE 3FTYA 1U2HA 4E0RB 4LCWA 3GI9L 4XWOC 4R7XA 2Y4SA 4TQEL 1J8HE 1P69B 1QD0A 2FGWL 1I9EA 4R5TA 4GRMA 2H2PC 3VXUB 1NGQL 1NFAA 2ICES 2YR3A 1YO4A 3KPRA 4XC3H 1ACZA 1K8IA 1C5DA 1S4IA 3QEHB 4WI3A 5IFHH 1KIQA 4Y5VA 1BSIA 4DN3L 3LZLA 3LZNA 4OLVL 5E6IC 4MVBD 4QHKI 4OU3A 1CXLA 2NQCA 4NRXA 1ZGLM 3BHBB 4NJAL 5F9JB 1IFGA 2M83A 1IBGH 2I27N 3FRPB 2IH3A 1AIFA 5EOTA 4U4IA 3B56A 1L9NA 1WPCA 4F7PA 3W5MA 1KXVC 2QKIC 1KYOJ 5GPRA 3WFDL 4LNRA 1A7OL 3P4NB 5SWSA 4ZMWA 3FFDB 5JMOC 4GI9A 5ICYA 3PS6A 4UQ3A 5GGRA 3SCMA 2R23B 4D9RD 5AB2A 2I32A 2VQUA 2Y7LA 4NHUA 5DSCA 4APXB 5C0RH 4J6RH 4Q9BA 3CAFA 1IMHC 3JYBA 3S88H 3K4DA 1YMMA 1A65A 3MRQB 5K59E 2HKHL 2OMTA 3CCHA 4BDVB 4F33A 4XNZB 2WVVB 1BZDA 1ZV5A 4OJEH 4ZMLA 4BD4A 4Z7OE 4GRLA 1QSFA 3WGUB 3U25A 5IBUG 1TTBA 2XWZA 5FM4A 5IWLA 3MLWL 3AS2A 5DUPL 3OF6D 5A3IC 1V7MH 3C60C 3IGAA 3VD1A 2AQ1A 3MLVH 4NNXA 1N59B 1SEBB 2AGJL 3C5JB 2FB4L 1FGVL 1FYTD 5F70A 3QWRD 4MAZA 1K6QH 2KL6A 3TH2T 1CGYA 2K7QA 5GS3A 1G7IB 1NINA 1TVBA 2A3TA 2K45A 3L3HA 1U8JB 4WHTB 3RUGA 2IDQA 2FD6L 1WUNT 9CGTA 1IE5A 1LE9A 1WG3A 3D52A 4P3DB 4R7DA 3GRWL 3D0VB 4G6ML 2VAAB 1RUPL 4KAQH 4JFEE 4NS0A 4OGXL 1VEPA 4PV9B 4NP4L 4PB0H 3F62A 3WN5A 3LXUX 3UAJA 2AERT 4Z1PA 1U92A 1HOCA 2WZPA 5CJXA 5EA0H 2F54E 5T1DL 4A7GF 1F3DH 4R4ND 1Y0LB 4XB3A 1GJUA 2G60H 3ML8A 1PS3A 1R34A 2XPZA 4OJAA 1W8OA 2ZXAA 5AZ2L 4X7FC 5C0GA 1JG9A 3HR6A 2H1XA 3VG0H 4KZ0A 2B0SH 3SKJL 4ETQA 3VFOA 4U3CA 4X98A 1SNRA 1MVUB 1FLRH 1GOHA 1FZKA 1RSFA 3JVFC 3T4AA 5KJ7E 2ZXDA 5I15H 3GMRA 1E4KC 4W9EC 1F3JB 3AMLA 5AOJA 1MFEH 1JP5A 4R4BA 3AB0C 3DGGB 3MRIA 3U0PB 4L9LA 1ETZA 3OHXB 1C5CH 1RULL 1NBVL 2B7DT 2VLME 3FFCE 4JFDD 2YUXA 1VFAB 3WIHH 2ZXBA 3IBEA 1T2JA 1I31A 3V5HA 1H8NA 4QXTA 4YAQA 1JZ4A 1DQKA 2O5XL 3L4XA 4K71C 4M43H 1T83A 1NFDB 5I82A 3G6JF 4JDEB 2C9SA 4BK8A 5I8CA 2LVEA 2UZYB 1WD8A 3GBML 3VA2C 1DLFL 2YEZA 2IFFH 1FO0L 3S3JA 1PEWA 2F68X 2VM3A 4GFTB 1DQJA 1DVTA 1JRHH 2CGYA 2ZXGA 4NKDA 3RVXC 3A3YB 3I74A 1FVEA 3QPQD 1QNZL 1A6ZA 3KYKL 3TVMD 2AQNA 4M48H 3SO3B 4YHOL 2BHYA 4EJ1C 1P4UA 5F6IC 3NJMA 5LAXB 4TYUA 5CEZD 4OT1L 2HJLB 2XZCL 4OGYL 4QXVA 4RGNC 3GI9H 4TQEH 2PUQT 5DUJA 2FGWH 4HIQA 5IMOA 1NGQH 3M1CA 4QPEA 1ZWIA 2ZIDA 3LS5L 3EBGA 4E9TA 5GRZA 1CI3M 1XH1A 5J11B 1UD6A 3RHWK 2JKLA 2XWEA 4LRIC 3NRFA 5TPWL 3H55A 4JREC 5HHMB 2R8SL 4KK8C 4DN3H 5JUEL 4I87A 4OLVH 5HGAA 2FUTA 4HIHB 4NJAH 2WW8A 1T1XA 4LP5A 1SN0A 1TENA 3KDMA 3PGCB 2XDHA 1JVLA 4Z7VE 3DX6A 3C5SB 1BZQK 1LP9A 1FL5B 1MG3C 3ROOA 2V3DA 3L95A 3WFDH 2NNAB 4O58L 1ZA6A 4LNVA 2D7NA 4X6CE 2OZ4A 5FR3A 2PTTB 2ZXEB 1ORSA 1UXMA 1DQQB 4M7LT 3FCSA 1EZVX 5DQ9A 4FXKC 3ZMNA 3BRDA 2BINA 1E40A 4QRRE 2HKHH 4E9WA 1IZJA 3E38A 3QUXB 5LNEA 5A16A 1D5ZA 3DMMB 4RSYA 4Y4HD 1BVNP 1BZ9A 1D2PA 4LCVA 1NCTA 4KDWA 1XR9B 5H35A 1H6FA 2AXJA 4LCWB 2G2RA 4LRNL 3MLWH 3O8XD 5DUPH 3BAJA 2FJGB 5K9OB 4MZ2A 4X4YB 3QFGA 4BKLB 1ED3A 3CZEA 1NDGA 4AK1A 3LRGA 2AGJH 2FB4H 1FGVH 4Y1AD 4AT6B 1R46A 4FRWA 5EOCJ 1C5DB 1P5UB 3OVUB 3KJ6L 2ICEA 3BPCA 4MQTB 4J4PC 1IBZA 1QUNA 3NP4A 3TL5A 5E9DE 5ADPL 1FYTE 2FD6H 3PDGA 2EIEA 1BQHB 3GRWH 2MRYA 3HZYA 3I6LD 1BAWA 3PWJA 2FBJL 4G6MH 1OE1A 1J11A 1TCMA 2YLHA 3K4AA 1RUPH 4GB9A 3HG1E 4OGXH 2X89A 4NP4H 2FJFB 3QA3A 1CICA 4YDJA 2AQ2A 3QXAA 5TFSL 3ELQA 1K8DB 1HILA 1EEQA 3U9PL 2G2PA 1CFMA 4YZFF 1L0QA 4E41B 1KBVA 5T1DH 4E42B 2B15A 1CFNA 3FSZA 4N1EA 3ES6A 4OIFA 4WW2A 5AZ2H 5D1XD 1QKZL 5C6WH 4YDZA 2QTVA 2IGLA 2B3IA 4WIQA 4WTZG 3EGSA 1GYUA 1V55B 2ENQA 3SKJH 2W80C 1MRFL 2YPVL 3HZVB 2DYSB 2OMNA 4G8AC 2HH0L 5BRZA 1F11B 3WUWA 3D30A 5IY5B 4RGMB 4PLKC 2G2NA 3WD5H 4OAWB 4OQTL 1D7BA 1LK2A 2ZT9C 2ERJB 2WK2A 1HH9A 2QHRH 4G7RB 5GGVY 2EUZA 3QDGE 1X5GA 4AC2A 1GTNA 1RU9L 1RULH 1NBVH 1XEUA 5C0IB 5HVHB 5FYKL 2VRAA 3QIBC 2BS71 2HRLA 3BUYA 3FFOA 5DJZA 3RTQD 3VD5A 4U1JA 4UT6L 1KLUA 2NR6C 1XV8A 3ZKMC 1AXSA 3CQPA 2O5XH 4TL5A 2TAAA 5HJ3B 5C0ND 3GHBL 3RVWC 1CDIA 2MH4A 5EZJB 4C83A 2ZXCA 4ONHB 4XMKH 3WELA 4ALAL 3GBMH 4EQ2A 2N59A 1DLFH 2W9LA 1FO0H 4MNQE 5CSZB 4UQ2A 3ZJAA 5DFAA 5DHXB 2AAAA 4P2OD 3L2MA 4MMXC 5EF1A 5C08A 1B4JL 1A9EB 3QNZB 1QNZH 2QGDA 3QNYB 3KYKH 1J8HB 5FGRA 4EUPA 4GUPA 3UTQA 3FT3B 1TO4A 1BVOA 3V8OA 4L8CA 4YHOH 4DO4A 1IGML 1R5WB 3PWPD 4L0ZA 4JFHD 4OT1H 2XZCH 4OGYH 4ZD3L 3PAVA 5AG9A 3L08A 1P7QD 1U8OA 3ARGA 1KB5A 3BGMA 1CL7I 1CTNA 5DJXA 2XY1A 3VXSB 3OSVA 5E08H 3L3DA 3LS5H 5T1KA 4RFEA 5EIQA 2BOLA 3N43B 4W6WB 2WGNB 2O61B 5TPWH 1AHWC 3RIAK 4HBQA 1OZUA 4H25B 3TIEB 4EF3A 4APQD 2WXOA 5C9KA 5JUEH 1FL3B 3JYCA 4ZW5A 1MVFA 4BSVB 1IIIA