4F24A

Crystal structures reveal the multi-ligand binding mechanism of the staphylococcus aureus clfb
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
334
structure length
334
Chain Sequence
AEPVVNAADAKGTNVNDKVTASDFKLEKTAFDPNQSGNTFMAANFKVTGQVKSGDYFTAKLPDSVTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDILTKTYTFVFTDYVNDKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFDNKITYNYSSPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEESSGKVSATDTKLRIFEVNDTSKLSDSYYADPNDSNLKEVTGEFKDKISYKYDNVASINFGDINKTYVVLVEGHYDNTGKNLKTQVIQENIDPATGKDYSIFGWNNENVVRYGGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures Reveal the Multi-Ligand Binding Mechanism of Staphylococcus aureus ClfB
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion
molecule keywords Clumping factor B
total genus 84
structure length 334
sequence length 334
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f24A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f24A02
4LE8A 4F1ZA 4F24A 2Z1PA 3AT0A 4Q6KA 3V10A 1R19A 1R17A 2Y7LA 2RALA 5IHWA 3IS0X 4JDZA 2VR3A 4F27A 2F68X 5CFAA 4F20A 2Y7NA 4JE0A 4LEBA 4MBRA 4FJ6A 4BBWA 4RMBA 4B60A 4LEEA 3IRZA 3IRPX 3IS1X 2Y7MA 3ASWA 4B5ZA 2YLHA 2F6AA 2Y7OA 5CF3A 4JDZB 4MBOA 1N67A 3AU0A
chains in the Genus database with same CATH superfamily
3IJ8A 4Y19D 3GJFK 3K3QA 1HXYA 2NY4B 1T1YB 3QXDB 1OGSA 3EYSH 3F12A 4MMYB 4ZUTA 3FBQA 3RFZC 2ENQA 2NY3C 3PAYA 1U21A 2ZP0T 4B9IA 4J8QA 3QCVH 2I7OA 5I8EB 1JHKL 2DQDH 2BP5M 5C0AA 2VM3A 3U36B 1GZQB 3V6FA 3US1A 5DJ0A 2NY5L 5LQBH 4WV1B 4F9LC 1NDTA 2HFEB 2A74C 1NMBH 3C6LD 2X1WL 3FT4B 1OTTC 1PG7H 4M93B 5DMIL 5C0IB 4DO4A 3HPLB 5BV7H 4U1MA 2LE9A 2VJ0A 1ZLVH 1OZUA 1KEGH 4IOSD 4AGLA 1YSOA 1NGYA 2AEIT 4JGJA 4WWKC 3V7MA 1TQTA 3QIUD 4EEEA 5C1MB 1DR9A 2NQ3A 4G43A 4NZRL 3ZDXE 4EN3C 1TJIH 4HHGA 4DZBB 3D4ZA 3PXJA 4XAKD 3VGBA 1K8DB 2JVUA 4PV1C 4UV4L 4HJ1A 3ZYJA 2P80D 2LFGA 4RGMB 4HD9A 3MV7A 3QC5X 5L9DL 4MNQE 5DF0A 3ARGA 5FOBA 4YE0A 4MKMA 1NFIB 3LS5L 1AC6A 2F53D 1Q9LB 3L4VA 4EDXB 1R46A 4XMZA 3UBHA 25C8L 4E5XG 4EQ2A 3OKDA 1PD0A 3UPRA 1KTBA 2P1YA 3UXFA 4K3HA 1SN2A 1HFUA 1SFDA 2PWEA 4GT0A 3TIDA 5D7HA 5J9PA 2QBWA 5E4IA 1K4DA 4C56D 1R75A 1F90L 3ECQA 3QQDB 4FQLH 2W95A 3WEAA 1F86A 4LHUD 2Q20A 1R3IH 3EGSA 1PMYA 3IFLL 2X4PA 4KITB 5EO9A 4ELDA 2L7QA 4M4RB 5FK9B 1L9NA 1SY6H 3KPLA 1M05B 1A9BA 4M5YL 2J5LC 4HJJL 4XNUL 3Q8AA 1AHMA 1IB5A 1P5VB 4IBQA 4XVSH 5CJOL 5EBLB 2NY1C 4NENA 1GCYA 4MRCA 5LGKA 2BVQB 3LMJL 2NY0C 5FGCE 5FYKU 5B38A 1T20A 3D0VB 4L8SC 1U36A 2Q86A 5IMOA 4JO2H 2K9UA 1KYOJ 2R39A 2CGRL 4DUWA 4WGKA 1MRDL 3S5LG 2HT2D 2Z6FA 4F3FA 4F7KA 2WBKA 3WNKA 1JZDC 4KDWA 1SJMA 2B4CH 3ZZQA 4NO5A 2J1YA 3MJWA 2R7EA 1IM9D 2JLLA 4L3ED 4XVJH 4ENZA 5AB0A 3GF8A 1B0WA 5TQ0H 3NSFA 3MHZA 1J1XH 4HJIA 2AQSA 4OQTL 5HYJB 5GS1C 3CVHL 3MUJA 1SJHB 4B7IA 1TJGL 3POCA 3ZE0F 3RBSA 3RY6C 2GEQA 2H2PC 4XBEL 2OSYA 5T8IA 4G43B 4Z78A 2OW7A 1NAKH 4PJAB 5DJZB 5AZUA 2IH3A 3O6MH 3TO2B 3OR6B 5CAYB 5LDSA 5TDNA 4Z3EA 4R26H 1J0KA 5T1MA 1PY4A 3GKZA 4UAHA 1Y6MR 4ZAKB 1SOQA 3IKCB 4JQIA 1TMQA 1QSEB 5JW5B 3ESOA 3CN4A 5KWYC 4AY0A 1KZQA 3OB8A 2CO1A 4KO5A 5ITBH 1BGXH 4MFHA 3DX3A 4YX2L 1M9SA 1SMAA 3GEWB 2BS8A 4MSWA 4EI0A 4NCDA 1QFUL 2BFVH 1YYCA 3AWEA 3FQRB 3HBQA 1R3HA 2LVEA 3N43B 3QDHA 3CXDH 4WTWA 4R3SA 3W39A 3GTNA 3WHXB 2CCLA 4ERSL 4W4OC 5E5LA 3WEBA 2X87A 3HUJB 1UOVA 4QY8A 4QOKE 1HE8A 3F7PC 3L3JA 1NC4A 2E27H 2IPTL 2JB5H 2VH5H 5EOCL 1Y7VA 4DZ8B 2YXMA 4UILH 4NQSB 5LB1A 4ZRGA 4FHJA 4JREB 5C08E 2IPKB 2YSTA 5IUSA 4XPGL 3IGAB 2V3FA 3D1MC 4Q6KA 4U0QB 1Q9LA 4XCFL 4OFYD 3UP1A 4JG1H 2AAVA 1E4XL 1ID5I 5JIIA 4HOXA 5I5JA 4Y2OA 5BZWA 4HPHA 1ACYH 2CSPA 5CWSB 3EO1A 3AREB 1I8KB 3S3JA 3QJXA 3FT3A 3TBBA 4BXVA 5INCB 4FYRA 4HWEH 3FFCE 3MAWA 1BP3B 2O5XH 4N8VB 5I73B 2VDOB 3ATAA 4FQLL 1FVCB 2X4PB 2PTUA 4ZOEA 2AJSH 3K5RA 4I18C 2X5PA 5DU7A 2QPEB 5IR1A 4LSVL 2D3LA 4AQ1B 5H35B 4Z95H 5I8KL 1B88A 5D7SL 3VMPA 5KSVB 1KCRL 1VZIA 3U9PH 4NJAH 2JF1A 3MFGB 3D0VA 4QT5B 5J6HA 3MRJA 2NNAB 2VMJA 2W07B 3L5XH 3SN6N 4ODHL 5K9QG 3L5IA 2YLKA 4ZAKA 4POYA 4WFED 1INQB 3BP6A 4XN2A 5IJCC 1JCKA 4XN1A 5F72S 3S36L 4FQHB 1E3XA 2VB5A 3MGAA 2CMRL 3G6AB 1GC1H 4UTAA 3VFOA 2CKNA 4FLRA 1JHLL 1A9EA 1F4XH 1AQKL 2BNRA 2Z8WC 5EU3A 4G42B 1PDKA 2HKAA 5JXAH 2FGWL 3FB6B 3G6JA 1HWHB 3QFJA 3MJ7B 1M56B 4XI5D 5BRZB 2JQZA 3QUML 2D7NA 3GSNH 1CD9B 2CNYA 3EDDA 2WQ8A 3CFQA 5ESAA 3P11L 3QA3A 5JTWA 3WFBH 5KSBF 3DKHA 1W72H 2G75A 3O45A 2XFXA 4R4BA 4IKNA 2UVEA 4MNHA 4N2NA 5FB8B 4WO4C 1MELA 5IVXE 4UMGA 1JYVA 1PEWA 3NFPB 1TTGA 2IGFL 4TKWA 3L7EA 1MCNA 1WZKA 1AHKA 3BWSA 4ABVA 4ZO6A 4ZS7L 3V4VB 4NQCE 1YA5A 2JNZA 3WFDL 1K8IA 3F8UB 5D1ZD 5EF1A 2FECL 5CNHA 4HUKB 2OK0H 3CPLB 1RZ7H 3RX9A 2V8LA 1ZGLP 4NN7B 2KL6A 1X5KA 1SN5A 3DBXB 4J6RH 2H6UA 3T4AC 3GMNB 2BIPA 2FX7H 2F53E 3CSYA 3CXDL 3BKMH 5L0QB 5FUCE 2LQRA 5IG7A 5C6TH 1H8NA 3L3JB 1ZGLA 1MF2L 3B2MA 5L9DH 1CXEA 1OT4A 4JHAH 4PJXB 1KTDB 2E27L 2IPTH 2JB5L 3NIFE 4LHUB 4OLYH 3O3AB 2X09A 4I8DA 3LN5A 2SODB 1RVFL 4JY5H 2HWZH 3KPPA 1NGQH 4WVRA 3ECVA 3LZRA 3T65B 3I84A 1H15A 4UOJA 3DUHA 3FUEA 5IIEA 4H0LC 3MRJB 4YSCA 1SVBA 1QVOA 3CZJA 3PHAA 2X4SA 3SE3A 1T80A 2PABA 2WZAA 3ZT7A 1AGDA 2XI9A 2EH7H 1SGKA 3EBAA 3ZW3A 1GHFH 1S7UA 1A7BA 1HWWA 4RFEB 4K3DH 1H3WM 4FQ1H 1IC7H 1O75A 1TQWA 3UAJC 1SY6A 3SBRA 2J71A 3SYQA 3UTPE 3G5YA 1EAQA 4OCXH 5AD0A 3ARXA 2KKQA 4GXFA 1TJIL 1A1OB 3WTWA 3HE7B 3LMJH 1UD8A 5C0BD 4MA3A 5I1JL 2I25N 4MJIE 1MLBB 2HB0A 2YAOA 4HWBL 4P3WA 3CE1A 4R2GB 2E4TA 3KJ6H 2M83A 4MCZB 5FFGA 1RZIB 3ESUF 4FTVA 2VSDA 2ZCHH 3IDUA 5EBWB 1BQ5A 3SYPA 1Z9SB 4L2YA 3LQAH 5A1AA 4OLUH 2AS5M 3N3EA 3EF4A 5ISZB 1S5HA 1OHQA 4UDTB 1FCCA 1JGVH 2VR6A 5GGTL 4Z7AA 3VFOB 5IHUH 5IVXA 3ZE0E 3RWFB 1FPTL 1ZT4B 4AGQA 3WNLA 2O6EA 3TJEL 2VDQL 4KTEH 1CK0L 5I1AB 5J6GB 1SHWA 3QR0A 4JFQB 5DHVA 3QDJB 4Z0XB 3MUGA 4PRHE 5IQLA 4N2LA 1FZKA 2B2XH 3DC0A 4ONFL 2KZBA 3DYOA 3AQYA 4HJJH 3G6JE 3I9GH 4OFPA 4OTXL 4HPYL 3V5KB 3WDIA 1RLWA 4FN0A 1EXUA 3C6EA 1NEZB 1SEBB 4DPCX 1WT5A 2VLRA 4K94H 4P5KA 5EFIB 1JZ4A 3OB0H 4FQCH 1AR1B 4XH2B 3NJLA 2P80A 2WGXA 3OGOE 3ZYZA 5IF0B 3FO9A 2ROXA 1WIPA 5IB2B 5KBKA 5SV4A 1E5UI 2P7TA 2CO4A 1Z32X 3NCFB 4QRRB 5JPNC 1RD6A 2WINB 2FIKA 4XPFH 5C0GB 4JPWH 4BZ2L 2MQ0A 1FFNB 2YMXL 1EA9C 1KLUB 4L5FL 4R7VA 2DJSA 1QBLH 1QUPA 3ARED 3PYCA 1MDTA 2BJMH 1BDYA 4J3VA 5C0NC 4OBSA 2CRIA 5D7IB 3SEPA 4X5XA 2C4FT 4RWHA 2CCWA 2VXSL 3BPOB 3IDJB 1XFPA 4N8UA 3HE7A 1K3ZA 2QVFB 3MBED 5FB8A 1HH6B 2XVGA 2X2JA 2A6IA 3UBFA 3PGCA 1KPRA 1RUQH 3ZGHA 1HNGA 2WBJD 1OGAD 3HRZB 3STLA 4UANA 4AITA 5BV7L 3GUTB 5ADOH 3S2AA 4EXPX 3PPEA 1OP5K 1NAMB 1XH3B 1RUMH 4DVBA 1ZTMA 3BIAX 5DQ9A 1BVNT 1VKXB 3M17B 4FXGA 2XWZA 3LOWA 5J3HD 4O2EA 1QABA 2B8OT 3DBXA 5HVHC 3LZPA 3KYKL 2OSWA 2KZ1B 2OL3L 4MYWB 5E2WL 1NICA 3KEHA 4XE5B 2DQJH 2KZWA 4XBMA 1RZJC 1SVZA 4LGSB 4UIMA 1JZ3A 2N4IA 2OS7A 4UF7C 3UAEA 4IRJA 1PPIA 4UILL 4CMHC 1KTDA 1KBKA 2BY2A 2VDLL 3BSZL 3KDMA 3ESNA 3VA6A 3HIZA 4FXKC 3MCLL 4YDZA 3SO3C 3BPOC 4QRAA 4TRPL 4XPGH 3CBRA 1J9RA 2V17L 4YPGB 3ATDA 2DQIL 5G55A 4HJTA 4U1IB 2B16A 3UBXI 5L7XH 1NBCA 4R4FH 3D69B 1N3NA 1JK9A 2X4SB 4MS8C 2VL5B 2FIRT 1Q1JL 3MC0A 2E9IA 2Y6TE 1A6AA 1IGCH 4B6ZA 7PAZA 1AQKH 1ZS8B 2HVJB 4XNZB 3K1KC 3AS1A 3ULUC 1ZWIA 2DQHL 3EFOB 1H3PL 5IWLA 2DN7A 3GUFA 3KR3H 3O2WL 3GI8L 1E65A 3MNVB 3VNYA 4HDIB 2K3HA 4JRXA 3ZKXB 5C0JB 4P23D 3EXJA 1WH0A 5IW3A 3RL2B 3TWCH 1MHEB 1W72A 4L8SB 2G2PA 2HRPH 4PV9B 5IQ9B 4UV7H 1ACXA 1W0WB 2LHAA 2DS4A 2XN9A 3HNVL 3P9MA 2VR5A 2DKMA 3BAJA 4RFNC 1AO7A 3WEOA 3S4SB 3LIZA 3HPLA 2EXWD 4CN1A 2DYPB 2EQDA 1IARB 4N90D 1ZLUK 3MTRA 4JQIL 1BBJB 2P49B 2OJZH 2RBLA 4G8GE 3WJLC 4JN1L 4DN3L 4YSUA 1LEIB 4AYFA 4HGKC 1RK0A 1DANU 2JELH 3E3QC 3OJ2C 3I3EA 3I2CL 1F18A 5C0CD 1UD5A 2FK9A 4U6VL 1RZ7L 1THAA 1H6UA 3AJ7A 1MOEA 1U92B 2DQMA 3D2TA 1U3HC 1QBML 1KBBA 3HI6L 3IPEA 3MMEB 1DHKA 1ZLWK 3IJHB 5KN5B 3W3BA 1OF2A 3OAZH 4WWNA 3L9BA 5FECB 2FEEI 1Q72H 4GQ9H 3TNNA 2X4UB 4OZHB 4PY7A 4KK6C 5I1HL 3L5WB 3BFQG 3FN3A 3H6JA 3FMGL 4FI8A 4B9GA 3TA3C 5DWUH 4IU2B 4L18A 2DBLL 4AJYV 3O3BA 4OIIL 2ZNXA 5LGYA 3HRPA 3O0RL 3LX9A 2H8PA 3LKSB 1AANA 2X4QA 4N2AA 1W15A 3TLRA 4Y4KD 5K59E 4KDTA 3UGUA 3UAFA 1CFVL 4H1LB 3B6SB 4URKA 2E9GA 5LG6A 4OZFG 1G7IA 1G0YR 1T7VA 3FT3B 1ML0A 1ZPUA 2F19H 4HFWB 2D0GA 3O2DL 3F65A 3E1ZA 4HWBA 5ICYB 3QDJE 4ZPTA 1XF3B 5FF6B 5HP5A 2R0KH 4NZUL 1Y0LB 3K6FA 4K71C 1BG9A 5BS0E 3KYMA 3CUPA 4JO3L 5CLWA 5DI8A 1JL8A 1MFAL 2FHFA 4WTQA 1LEKB 1QR1A 3KG5A 1J8HA 2WXQA 4Z77B 3P9LA 3ARSA 4TNFA 3UZVA 1FVCA 3KLSA 2CHWA 4XMLL 5CGYC 2VDRB 2BIHA 3V4VH 3LZLA 1F11A 4W9LC 3ZRFC 2RALA 3NDZE 4ZFOB 5TK2A 3WEMA 1IMHC 1R47A 3S5LB 2ITCA 1EZLA 4RDQG 4G7YL 2OQJB 4HAFA 1N4XH 2PW1A 3ULSB 1C7TA 3DOSA 3EJRA 4AYEC 2A9NH 1D7BA 2P5EA 4ZDHB 1W0VB 2QKIB 1IVTA 4AGMA 1EFXB 3VXSB 3PWLB 2IBZX 1EH9A 1NUGA 1BX2B 2J25A 1Q9WA 3DGGA 4OH2A 5HYQB 1A0QH 1EIBA 4EUPB 4F9PC 4YEEA 2IDSA 3VWJC 3BVTA 3CVHH 4GSUA 4LEOA 4ONFH 5D4QA 1WBZB 4X4YB 3QZWG 2YRPA 3GGWA 3VDCA 5AW3B 2V5RA 3R18A 4FNSA 1OPOA 4N1CA 1JVOA 1ZDQA 3LEYH 3TWCL 1VERA 3MLVL 2NY7L 4LSRL 3SDYL 5DEFB 4JFDD 3ZO9A 2NSQA 4A1RA 2I9LB 3KDPB 5BV7C 4IS6A 3ARUA 5JOPD 2CHZA 1O5PA 3JWNE 2YPVH 1G7JB 4RRPG 1A1MA 2H32B 3D8MA 1PL3A 1PZDA 2ZSVB 1R17A 4J1UA 2F5BL 3IFPB 1HEZA 2BFVL 5L88L 2K7PA 4L0YA 4QLRA 5E9AA 4BRJA 1X5MA 2ZJSL 3BXNB 4KKZA 2XPGB 1BQUA 4MJ2A 2EH8L 2Z91B 4IBYA 5AAMA 3UIYA 1KPUA 1OM3L 5FAAA 1ZHLA 5C8JB 4X7CC 4ZX6A 4KX9A 4BFKA 2HT4C 3RAJH 2X41A 4FZ8L 4BUQA 2FAUA 2J5LB 4P99A 4N8CH 4OI8A 1DCEA 5I1GH 4DP5X 2WUBL 1ETJA 2W0FB 1L0YA 4OT1H 4QTFA 4TNWK 2CO2A 1MFEL 4NXSA 1MW0A 3FAXA 3VFRA 4ZMQA 4P46C 4QAWA 5CU9A 1RUPH 4K4KA 1K6QH 4PY8J 4QJ4B 5I1DA 3VRIB 4WI0A 5FA4B 5IMMA 2NNXA 1T83C 3FB5A 1TQSA 1S4IA 4O02A 4IKJA 4NPYB 3H3PH 3S5ZA 3GXDA 4QTHB 5CF3A 3H1ZA 2XETA 3UTPD 4J3SA 4CKVX 1J5IA 3TBSA 1AXIB 3IJHA 1OVZA 1RJYA 2X0WA 1T22A 3IDGB 1MF2H 1G7QA 1X7QA 4IRSD 1BQHB 3D09A 5TF1L 3MJ6A 2YPLB 1UD4A 3PFUA 4TTGA 3O4OB 2HWZL 4Z76B 4K23H 5BJTB 5D7SH 5FCUH 1YEDA 4PJ7F 5IB3A 5M94B 2BXZA 1F11B 3CD4A 1AGFA 1F1GA 1FHNA 3EJCA 4UM9A 4U6HA 4E41E 4GRMA 3QZNA 2Q1EA 3CFDB 5EC1A 5I6NA 2X4TB 4J3OD 3U9UA 1BVKB 1PYWB 3HPJB 4MA1C 2R4RH 4WUUD 2W9DL 3SE3C 5T1KB 2C9AA 1N0LA 3DJRA 4K5OA 1Z0NA 1I82A 2JCCB 4B9YA 1CTMA 1T04B 2GHZA 2BVPB 4BQ6A 2MTAA 3EAKA 3Q6GL 4UUJB 4N2MA 4PRPE 4EVNB 3ZKMD 5A2FA 5AUMB 3J07A 2VE6A 5F9WB 3KYKH 2X3CA 3SQRA 4UV7L 1OCOB 3MROB 1FCGA 3GKWH 1A6VL 5ESVB 1G7HB 3ZHKA 1MRCH 2CPCA 4I5BB 3LYRA 3LNIA 4YXKH 5HHNB 4R7LA 1T0MB 1XCTB 4N1EA 2OR9H 3GBML 4JPSA 4YR6B 4N3TA 2VDRL 4PRIE 3UTOA 1NMAL 5IWLC 4A6YL 2Z8RA 5I66B 3F58H 1BBDH 4GRWF 2A9BA 3VRIA 1HILB 3FTYA 4MVBC 4OUUA 4P9HH 1Q9WB 1XVSA 1FHGA 5LWYL 3BESR 1BAGA 3K4AA 2YGQA 1PNDA 5MENE 2ZWZA 5F9OL 5I1LB 3BFOA 2CAKA 3CMOL 3FQRA 3S5YA 2QMKA 3JVFC 3MV8E 3R0NA 3CLFH 1R0AL 1A7RL 4XNXH 3BQUD 4PWKA 1YG9A 2WO4A 3B3IB 4U3CA 4NQDD 5CP7B 5EWIL 3DX0A 3A5VA 2GIXA 1V3LA 3VRJB 4W81A 4PREA 2QADD 5D1ZB 3VXUA 1KWKA 1KJ3H 4MAYB 3WKNA 1UHVA 2IGTA 3KM2A 2RA1A 1BIIA 1KXQE 3SE9L 3IK2A 1TOXA 3I6KA 2OBGA 5E6UB 1FGVH 3RIKA 1TUPA 2G4EA 2WNXA 2F54B 4F7EB 1PIFA 3C60A 1ZVHA 4GSDH 1DVFA 3CFIC 4MXVE 3SDCC 1XF4A 3VI4E 4YDKH 5DD1L 5B39G 4X6EB 3NJJA 4LOFA 1V3JA 2EH7L 1B3IA 4LSUH 2V9QA 1DFXA 1XF2A 3GJEB 4W9DC 3DUSB 4OGXL 1MJ8L 4MA3B 3QARA 2ZCLH 5T1KA 2DRUA 5KUMA 4LBEA 4ZUVA 1FN4B 5DHVH 4M6OL 4MAZA 3V9CA 4EO5A 4AJ0A 1NSNH 3PF2A 4WU5A 1KBGL 4ZOCA 5PAZA 1AACA 1LO3H 3GSQB 2CRZA 1QSFA 3PWPB 3DX8A 1EGJH 4NQTA 3RVXC 1DQVA 3I75B 4UOW1 4UM8B 3ZOAA 1QI4A 5DWUL 3TA3B 4GKNA 2ZXGA 1TFHA 4JDZB 2QMJA 2WQUA 2BNQB 1GYUA 3FNKA 1BVLB 2IQAA 3P69A 4ZPVB 4CN4A 5EEWA 2R29L 1NFDA 4PJCB 2B0SL 4LCCB 4MQTB 4CVZA 4HJGA 1DANT 3FUDA 5H2BB 4R90H 1BVKA 1MW3A 3JTTB 5D5ME 3MLYH 4N0RA 2AABH 4G3YH 2AJXL 4PSRA 4YQXL 2R69H 3O4LB 1IGTB 2FNWA 3QR2A 1MJUH 1OD9A 1QZNA 3MXWH 1MREH 2F8IA 3KL3A 4N6QA 4L8DA 3VWJD 5C0JA 5CCKL 1S7WB 3SCMC 5MERA 3VI4F 1Z1WA 2Q3ZA 1L3NA 2ATAA 3HVNA 4DP6X 1LO0H 2FUQA 4ODUA 4O2CB 4HU8A 3CXHK 3HE6D 3QI9A 3RTQD 3WOVA 4PJIF 1D9KC 1E2ZA 3G3LA 3Q9PA 3RL2A 1JHTB 2ZUWA 4NDMB 3G5WA 3P9MB 1A66A 4AT6B 5D1ZA 1KTRL 4O5LL 3B2VH 4GRMB 3KPRB 1P6AB 4Z23A 5EDXA 3RL1A 1N4XL 3SGJA 2ISDA 4J3TA 4XMTA 3IXAA 2BIOA 2P5PA 4JQXC 5B3JF 3G6AA 4M8RA 5GZOC 3I9AA 5ISZE 3ZLQC 1BOGB 3EO0B 3QDMA 4TVSa 4EJ1C 3QZLA 5AOIA 4Z78B 1FYHB 5MENA 3MLUH 5DO2D 1VSCA 2Y1ZA 2VDML 3F58L 4XNAA 1Q0XH 2BSCA 4JG9A 4K3GA 5I1IL 4LP4A 3SBQA 3BUPA 3UPAA 1U8HA 3T04D 3VXMB 3SPVB 5JQ6L 3WJMA 2CD0A 4G7SB 4OCSH 3QNFA 4D3CH 1N59B 4WFGE 1NFAA 4NUQA 1IBDA 1QSFB 3NCJL 1E7UA 4PBWD 4Z3JA 5DFWH 4PCTA 4QKXB 4S0SD 1MIMH 3QEGL 3U9WA 2Z31D 5A2JH 2FX8H 4O2EB 4YZFF 1FC1A 4CSZA 3QQ9C 2IGFH 4GMSL 1IL1A 1HIMH 1KTCA 5ICZA 4DP2X 5EUKB 3OKLB 4KK6D 5CUSH 3AB0B 4AJWA 2XFGB 2VR7A 5I1LA 4WUUA 3EYQC 1AZCA 2MQ3A 2IPKA 4LO9A 2ZQKA 2XZCH 2YPKB 4HWZB 5DI8B 1T5WA 3QR1A 2WXIA 3L95B 3OSKA 1WAEA 1CICD 1G7PB 3L2LA 4OJCA 3HAEG 1A3RH 5MERB 5C6TL 4X99B 4DOHB 2DLIA 3NABL 4K3EL 2Y4SA 4P46A 3VRJA 1HHGA 3GPEA 2Z92B 5E8EA 3TA3A 4LIQH 2ATKA 1I8KA 2EEBA 3P4MA 4WFFD 4PRNB 5DD0H 1KGWA 1CG9A 1PG7L 3GSVB 3QNZA 3VW3L 5B1BB 2J88L 3FF7A 1W0VA 1TQBB 3UO1L 3FQYA 4NRYB 1F0LA 1S5HB 2EE3A 4P3CH 5DZJA 1EEZB 3BCFA 1CGSL 1DL7H 1JZJA 2NYYD 3MLTB 3U0WL 4ZUVB 3M8OH 1O6SB 5F9WC 3GO1L 1MRFH 1DDTA 1AXSB 1XGUA 3IDMA 5DD3H 3IB4A 3ULUD 2IPUG 4MJIB 4MXWH 35C8H 3MLSL 1GOGA 1MCFA 4X6DA 3WTVA 1A1OA 3IGKA 1RJLA 1OPGH 5FUOH 4NQUA 1JGEA 4KV5F 3X12A 3NJVA 4B9FA 4FG4A 4G2AA 4Q56A 2H1LM 4A7GF 4YXKL 3U0PB 4XZ4A 5T3ZE 3UYPA 3MLPA 3RILA 2P24A 1FLRL 3V5KA 5LKNA 3TBVB 2W9EH 4N0YL 1AE6L 1E3FA 4B5ZA 4I1RA 3D18B 3LHAA 3UBGA 4BWWA 2WN3A 4TVPH 5B1KA 1EXHA 3JSSA 3NG5A 3NIGF 1BCIA 2JB6B 3L3KA 3VCLA 3MPCA 1YN7B 3EFDH 3L6FB 2ZXAA 3F12B 1IL1B 4AG4L 3EJQA 2BVUA 4ZXBB 2P28B 4NN7C 1J87A 5JYMA 3OKLA 1NCWL 3JT0A 4POZC 3RIFF 3D51A 2Z4TA 1ZHLB 4PJFA 4XOBA 3CFBA 5JW4M 2IWKA 4XN8A 1UC6A 3DK2A 3BIBX 4LSVH 5C07A 1WA1X 3NA9L 2F9BT 4HUUB 5BV7B 4TQPA 4WHTA 1OTSD 2X2YA 3SPGA 1AZNA 3B7RL 5T3XH 3GHBL 4ANXA 2EUVA 3KE0A 3BWZA 1E40A 3QNYB 3PWPD 1HS6A 5HD8C 2Y07L 4PJHE 4L37A 4ONOA 1NL0L 4TTDD 3CHQA 5HD8D 2RAMA 4E9XA 4NPYA 4L1SA 1JHLH 1CGYA 1DN0B 1R5IA 3GM8A 4EDWH 3WAJA 1RZJH 3ORJA 2VDLB 2KI6A 4DESA 5DHYA 4DNLA 5SWQA 3CVHA 3BQUA 2H1XA 4MBOA 2Y2TA 4KWUA 4LL9A 1KN2H 4V33A 3QPXL 4JO3H 3I6SA 4AH2B 4EF3A 4LPCA 5F7EH 1H6EA 2F7PA 5JIPA 1S6NA 5GRJH 1I3RA 1HHGB 3IS0X 4KX8A 1VFBA 1UA6L 4Z0BL 3ARGD 5SWSA 1BX2A 1R33A 5JHLH 1ZTXL 1I7ZB 5ILTL 1I8AA 4CVXB 5D2NA 4MB1A 2X9WA 1MIEH 4YN3A 2WVSA 3EGDB 4HAKA 3STLB 1KTKE 5T1LD 1C7SA 1QNIA 3QYCA 3WI9A 2AK4D 3FK3A 4M4RA 5FK9A 3U4EA 1X9QA 4L4VE 3D69A 5EC1B 3CZEA 5DUBB 3WL9B 5D71H 2CHDA 2A9DA 3MLZL 4RRPM 3ULAB 3M6DA 1CDJA 2MOGA 2DZEA 4XP9H 5IBLD 2IANA 4TQEH 2AXFB 1NPNA 5JOFA 3OQ3B 2EDKA 4IU3B 3DOHA 3AG2B 3ECBB 2MCAA 1I9IL 3QSKB 5JDJA 2NXZB 3D85A 4Y8DC 4AC2A 1J1OL 3T8VA 3I50H 1T21A 3C2AH 5F7DA 2BRQA 1P0SE 4H26B 4XNMA 1A4KB 3OX8B 4YSTA 2X05A 3QH3B 1EK3A 3FTWA 4OD2B 1EDHA 1NM9A 3KGRA 4DCQA 1SEQL 3SGEI 4X9IA 3KLHC 3BT2H 2TRHA 2OZ4L 3SD2A 3IEAA 2CR0A 1NH6A 5CSZB 5C3IA 3WMPA 3VG9B 4HVBA 1W8NA 3W9DA 5B1JA 1FAIL 4N0UB 5I1CL 5T3XD 3SKNA 1A9EB 1NIBA 1DJWA 3LKQA 1OGTB 3QI9C 2X89A 4NQVA 4QHNB 2Z65C 1ZANL 3S36X 4WWKD 43C9B 4B9CA 4TXVB 3L3HB 5DWPA 2ED7A 2CUAA 2NZ9C 2ADIA 5CJBA 4DK3A 3DIFB 3RWHA 5EMYA 1Z0MA 1GMIA 5ICUA 1C5DB 1KJ2A 4LCWD 4KRLB 3KWWA 1EJ6A 1VA9A 2WUBH 1OTTD 4D8OA 3A4DA 4M62L 4EUPH 3RY5A 4QRRA 3TV3L 4PREB 3VXUB 1P7HL 3F7YB 1KJVA 4ZUWA 1AAJA 1JNNH 3BPNC 3D3VE 2N01B 3HG1B 3QCUH 3MFFB 5HHPB 4AYMC 3IDNB 1FG9C 4IRJC 3WO3B 5L8KB 5IVNA 3H3PL 4WEUD 4JRWA 5D7IA 2BC4B 4PJ9B 3MRKA 3U7YH 1JZHA 3IT8D 2PNDA 2C3WA 4IQHA 4KKBC 3WY3A 4GUPA 3CPLA 2YHGA 2R2BB 3ML9A 3PXHA 5EU5B 2HMID 3T3PF 1SZNA 3EOYG 1YO4A 5J89A 2VWEE 3MQIA 2YD9A 1LE5B 3F5WA 4OTXH 2YJLA 4W9HC 4N1HB 4NC1C 4PJIE 4U31A 3QJHA 5KOVC 3BMVA 1XSKA 5DHEA 4FI7A 2DBLH 1BZQK 4ZS7H 4EAEA 3QJQB 1PZCA 4UUJA 2XZZA 3R4DA 1E43A 1X7TA 1QHPA 1F4WH 1B4RA 4ICWA 3LPOA 1T2QL 2AQRA 2WKOA 4CN6A 1AFVH 3DOSB 4DAGH 1PLAA 5HVFB 3O9WB 4RISL 3UJJL 3U25A 2QR0B 3EJUA 4G8IA 3T4YA 1FVDB 3MBWB 4XCCH 3RNQB 2R1WA 2IMMA 4NWUL 2DWTA 2WZ0A 2Y72A 3N50A 4ZPTB 5E8OA 2WVTA 1FIEA 2YSSA 4U6XA 5C2UB 1RMFH 2RR3A 3AZUA 3DTUB 5DC2A 1D9KD 2E6JA 1T89A 3DJZA 3KL5A 3JWOH 2MPAH 3U0TB 3LKQB 4AH2A 1O7DC 3V7AE 3FPYA 4O2CA 4AW4A 1INQA 3O8XD 2JKWA 4RZCB 2VL5A 5AVRB 2O5ZH 5GSRA 1AKPA 5KANG 2B9BA 1U3HA 3DVNB 4ZMWA 4RAUB 4XO9A 4V1DB 3UERA 2NY6D 5CCJA 5IROD 3M1OA 4JHWL 2DH3A 5C0BB 1VZHA 3B34A 3TGXA 1BECA 2P8PB 3DMMA 1O7DE 2I9LA 3D12B 1QFWL 3HAEA 3ISWA 5GQBA 4JL1A 1TVHB 4UQDA 1IAOB 3FRPA 4ADGA 2GSMB 4ANUA 4UZGA 1URLA 2EP6A 1N0XL 1IFHH 2XY2A 1DSFH 2XFXB 1ID2A 1UJ3C 1FAIH 3WTSA 4PJ9A 3P73B 2O6DA 1UUNA 4KVNL 5CIPB 2XV3A 3L7EB 4JFFB 3VYPA 3WO4B 3MXVL 1SXSA 1KWGA 1I1AA 4HPOL 2A0LD 3BUYB 5GJSL 3WTYA 3S2CA 2APSA 2VLKE 5IW1A 3EJJX 3PWUA 2NY3B 1JDCA 5C8JA 4NPKA 1U8HB 3VXMA 2Z8SA 4U0RC 1K5WA 5BW7A 2DQFB 5BOZG 4R0LB 1NINA 1TITA 3UPRB 4Z8FH 3O41A 3I9GL 1FLRH 2VDKL 2BIQA 2J8UF 4BFNA 3U46B 4DPRA 1D7CA 1OB0A 3U1SL 1EBPA 3WS3B 5C0RL 2A9CA 5K39A 2ZG1A 1FFPA 3GHEL 3QQDA 2DI7A 5CMAA 2VDPL 1CT8A 1TTFA 2VDQH 4KTEL 5CSZA 3RGVD 5SWSD 5IOKA 4L4TA 3REVA 1PIGA 3TU6A 1WFOA 2ZCLL 1VZGA 4AQ1C 4QAMB 2ZZUT 1D3CA 1PLGH 4BUGA 3T4YB 3DYPA 1O5DT 2FIKB 2X0UA 5CEZE 1M4KA 4G7QB 4ZS6D 1E4HA 1EO5A 2BVTA 1X7QB 4M1CD 1RV6X 1ORSB 4L9DA 1A7NL 1EX0A 3RLSA 2CJ3A 3WELA 3TN0C 5KYYB 3QUKB 2KHAA 2MKLC 2CO3A 3UPCA 2R7EB 3GHBH 1LK3H 3H0TA 3RWGA 1RL1A 3L2MA 3OKEA 3QP3A 1Z9MA 2OJZL 3QXUA 4DN3H 3GSWA 5T1JA 4APXB 4M7KH 3CFEB 1NL0H 2A9AA 4BRVA 2H45A 3O11A 3VB9A 1N10A 4M7LL 2VXQH 2FR4B 1JTTA 1XH3A 3MXWL 4M8UA 5E2UH 1Z5LB 3PJNA 1WICA 4P4RB 3FTGB 4X0KA 3RGVA 3S3SA 2IALA 1U3JA 3PAUA 3B9AA 2VWEC 1G7MB 3DURA 3W9EB 3WE6B 4OZGA 4V2CB 4QGTA 4HOMA 2A6JB 2ZUUA 1I3VA 3MRHB 4JFHD 4G6KL 5C70A 1S7VA 4BFIA 3X12B 1VIWA 1OW0C 2IXQA 4I0PD 1GOFA 1A22B 5H4YA 1J10A 1TKWA 2F0CA 5LAPA 1VGEL 5DHVB 1OP3K 1WA2X 3GM0A 5KTEL 2C3XA 1E27B 1M05A 1PAZA 3O3DA 3DDFA 5EU4A 3TBYB 1SMDA 1EEYA 5DJ8A 1PVHA 4N2FA 1PZ2A 5D8JH 3RURA 4LLUB 4OZGE 2O61B 1HILA 2K7QA 4OUUB 4Z7WE 3R1GH 3AUWB 5DO8A 5F96H 1AGCA 2NY5C 3F83A 2F7OA 3HG1D 4M29A 4KKCD 3HN3A 4WUUE 5SX4H 4I0CC 4KKLD 3TH2T 1RZKC 1CDUA 4ETYA 4MDIA 4GS7B 1KJ2H 1JMZA 1L7IH 3GNMH 4P5KB 4GQPH 3FTVA 4RMBA 4XP1L 3AG3B 4PGDA 4TULL 2CZNA 1QSFE 2QKIC 4XAKE 4YAQB 3DA0A 5I0WA 2F6AA 3HI1A 2X1XR 2VLKA 1O6TA 1KNOA 1J5OL 1G9NH 4PGCB 5DHDA 1IM3B 3WCYA 2N7AA 3S36H 1T0PB 5H37A 3RFZA 2N59A 4RAVB 3H9HA 3BVNB 2YK1H 2WSDA 2WWKO 4NFBA 5BOJA 2Z7WA 3KVPA 4N86A 2IBZY 1WGOA 5IQ7H 4FQ2L 1HYRC 4KTYA 2JSFA 1IIIA 2OPCA 1E4XI 3G5XA 1AP2B 2PO6D 1QBLL 3HN8A 4NAMA 3PNWA 3QIBC 1KEMH 4MAYC 1PG7W 5FUZH 2EDQA 1D5RA 2NUTB 4X0KB 5IW1B 3DO3A 3N41F 4PUBL 1XGQB 3UACA 4FKHA 2VXSH 2VO8A 4QYOA 3L9RA 2DD8H 5F1IA 1NTDA 4WY7H 1U8IA 3AABA 4W9ZA 4ZMAT 2LAGB 3GUTA 4GKNB 4LEXL 2X6CA 3MLTA 1KTLA 1R6VA 3CDZB 1MRDH 3NJKA 5EN2B 1E7VA 3LNDA 1NIEA 1QBMH 3GSWB 4FNRA 3CU7A 3D07A 1T0OA 3TN0D 4NO2A 4MJIA 1MLCB 1RULL 2XBDA 2WY3B 1A4JA 1FNHA 1RZ8B 3N2JA 1I1YB 1YNKL 3L7FB 4HBCL 1ZOXA 4W9CC 4XHJC 3QYNA 3QZBA 3MLXL 2A2QT 2W80C 2WLYA 3CN2A 4WHCA 5IJVA 4FQJH 4LRIC 5JUEH 3ZE0B 2AXFA 2WXNA 3SYAA 2A3TA 4M1DH 1MJ8H 4TSCH 3TESA 1BEXA 4N2BA 4M7ZC 4RRPA 3APDA 1DQLL 4NIKB 1I3GH 1USZA 3MJ9L 4MD5A 5E2UL 4OFQA 4OQTA 4TL5A 2C3GA 1WJ3A 2CR3A 2BVYA 2OMTA 1N3NB 3K80A 3LH2H 3QIUB 2ZP8A 4PJ5B 2DY2A 2Y7SA 5DLMH 5TGBB 2CIKA 4F27A 5B39B 4PJEE 3MRNA 2HKHH 4TVPE 5JO5B 4L4JA 4QHUA 1PCSA 5E24E 2X28A 1SXAA 3QNXB 1QSED 3KNBB 3TBCA 4UT7L 4Z7VA 5E4AA 4G6KH 4AQEA 1VESA 4XE0A 2CKBH 3CDYA 4F8QA 5K69A 2TSBA 4GYBA 3D0LB 3N0AA 1E9QB 2H5UA 5KVDH 2APTA 4YWGL 5E51A 1P2CA 2BM3A 4Q6IA 1OZTG 1JUFB 4HIEA 4X4ME 3ILQD 2Z1KA 4PAZA 4PJ7E 4OF7A 2NRDA 4UINH 2GY5A 3N91A 5GISH 1MCQA 3KJ4C 4PJXA 3TVMD 4RCAA 1EUTA 2GTWB 3T1FA 1BBJA 1SDAB 6TAAA 3V4UH 1QRNE 3NA9H 1P7KA 5E5UB 2ZX8A 1KELL 3Q0HA 4WAFA 5FDWB 1P53A 1CVRA 3QIUC 4RIRB 4EE2A 4EI6A 4Q9QH 1KJ2L 4NOBA 4DFIA 1FYTA 4NO0A 3KPMB 3MOBL 4WNQA 4PPTA 3BZFA 2P46B 2XQYA 1E28B 4BSWB 1HHIB 3OMNB 3MOAL 2VXVL 3K71B 1GZPA 3NCMA 3ZMEA 5I1KH 5SWQB 2HRGA 1OCWH 5BRZA 3C5XA 2CGRH 3Q6FA 2DV6A 1FL6B 2Q76A 4WW2B 1FRGH 4XTRC 4ATWA 5D1ZI 1SOKA 2Q3AA 3L5WA 4LLUA 3SPIA 1I3RB 3NPSC 5SWSB 2WP3O 3ESPA 3F62A 3ZE1B 4HIHA 4CMHB 1NLDH 2FO4A 2Z64C 3FFDB 5D70L 4K8RC 5L88H 4NQCB 1TJXA 4WTXA 2CRMA 1YYLH 1ORQA 4HIJA 2YIHA 4GUPB 3N1FC 1B9ZA 4RGNC 1WITA 1YEHL 4Z95L 1A1NB 5I8KH 4BK8A 1TZAA 5D9SA 1C5BH 1O9ZA 5EA0H 1AZZC 5JIMA 3FSWA 3L1GA 1U3HD 5E8PA 2XKNA 3QZPA 1QQDA 4PRAB 4G6JH 1AMXA 5D1QE 4F37K 2VDOL 2DWDB 1CFVH 2ZKXA 5E1IA 2VQ4A 3KYMB 2YD6A 2FX8L 5IQNA 2YN5A 3AY2A 4JPKL 4MKTA 1WE5A 1BMGA 4JR9H 4NUJB 3TO4A 3L9EA 3HG5A 1UKQA 1FIGL 1KDJA 3Q01A 3EGSB 3QDJA 4PW4A 1NGWA 1R24A 4LB8A 2PPCA 2LT9A 3EJTA 4X6CF 5DQJB 2GFBA 3B37A 4JFSA 1G1KA 1NBZA 3BAXA 1GL4B 4IBLT 5JORB 4JFTA 2ZAIA 4ZXBD 1DQQB 4XCNB 1DVXA 5HDBB 4G7VL 4XPAH 2AK4E 1N6VA 1GJIA 2HXAA 1AG0A 1RHHA 3MREB 1FUNA 4RFOH 2BO0A 3DPBB 2WXLA 3PWLA 3MA9H 4AKQA 4QXUH 1J9CT 5CEYB 4Y5VA 4MJJA 5FDWA 4UQ3A 5TDPB 5EEXA 1JNJA 2FD6L 4KK5D 4ZAKD 4HYTB 5DJ6A 2XWEA 5IHLB 3WHE1 1GGIL 3DGGB 1F3RB 1FQ9C 3D18A 3WFDH 1QW9A 3AGWA 3W5NA 5IFHL 2XN2A 3TT3L 1R3HB 1ILUA 4KRMB 2HZHA 2IQ9H 5JHDD 1T3FA 5I2IA 2YFOA 2HJLB 3GC3A 2P5EE 3QJVB 4WSKA 5F8QC 1N0LB 4XB7A 1TETL 5E6ID 1Y07A 1N9PA 2OTWB 1HC1A 4TF4A 4PHZA 2VRAA 4XOAA 4M5YH 4YSQA 3GMOA 2F54D 3DV4A 5J5EA 4YJZL 2AHIA 3LVEA 2YKLL 5I28A 2UVFA 3RL1B 2QLVB 2WYZA 5ELIA 5AG9A 5GGSA 1JYNA 1OTUC 4E9SA 4ODTL 4JFDA 1CPUA 4KMLB 5F6HJ 3Q5TA 2WAQA 1HHIA 4P2OD 2QPSA 1YEFH 1K72A 1TCRA 4Y9BA 2FCBA 1HCFX 2FH6A 4C56E 1DSFL 3PDOA 2RFXB 4JKMA 4I0KA 5J57B 3VX1A 3QQ4B 4Y4HC 1RSYA 1QPKA 2BHFA 3FQUB 5EOQH 5I5IA 3HC4H 4WHYH 4L4TD 2IH9A 2JWYA 3VD7A 1KPVA 1HHHA 3UO8B 4FKEA 4IHBA 3V52L 1DE4A 3GS0A 5DJDB 4HS3A 4OCXL 1GJWA 4LOEA 4Y8AA 2W81C 3IMSA 2X4NB 1GKEA 2YRBA 3IGAA 4TMPA 1YYLL 1KC5L 2J8UB 4O02B 3GSXA 3QUKA 1PZAA 5EBGA 4RLDA 1RP9A 4DH2A 4PG2C 4DVRL 4JZOA 2OTUA 2GTQA 3BPLB 2J44A 4JO1H 1GY1A 5FM4A 5HHMB 3SCMD 5E94A 4HJ0D 1PZ5B 5FHBH 4R4NC 1MFDH 5EDSA 2YUXA 3LKNB 5KJ4A 3ULVC 1JG9A 2FJUB 3LTVA 4E9VA 1QFUH 2VQTA 3E8UL 4LSPH 4HS8H 1AOZA 3CK0L 3AUVA 1MHEA 1W72B 1Z5LA 2OP4L 1M7DA 4EDWL 5PCYA 2H6PA 3H9SA 4Q2ZA 5LGJB 1I8LC 1QZ1A 1XXFC 3WNMA 3DSNB 1WFIA 2DQ6A 3OD3A 5B4MC 1KN2L 1QTYT 1QTPA 4GQRA 2EUWA 2WLLB 2NR6A 2Q8AL 3VXTB 3AXLA 4RMRA 3Q13A 2K1MA 2QZ5A 4BK5A 4NSKB 3V4PA 1PX8A 3GD1C 4CDGC 4DF9A 3NAAL 4ZSOE 3DI3B 2NYZA 1IEBB 2B14A 3KYNB 4J3WA 2YOAA 1MCWM 2RIKA 1RURL 5INCA 4OD2A 4QGYA 4YWGH 3UDWA 3L4ZA 1GR7A 4N2IA 3S35L 1ANUA 4C47A 4GEJA 1ONQB 4OIFA 3V6OC 2FQGA 4FFYH 4GKLA 1HX0A 3KW8A 4APQA 2F74B 4N8VG 4UNIA 2WXOA 4I88A 5JUEL 3K81A 1KIPB 2B15A 1ZLDA 1BW8A 4XCNA 1KGCD 1W80A 2HJFB 2ZPKH 4HOWA 4CGTA 1TZHA 4MWFB 1U3YA 3U2SA 4MB3A 1IGIL 1S7WA 4U05A 1WUZA 1YJDL 4P2QB 3RVVD 3FHEA 4QTIH 3WFEH 2EVJA 1MCRA 1MCOL 4P04A 1FV1B 1NCCH 5L4IA 5AZEH 2PYEB 5MI0C 4H5SA 1AGEA 32C2B 1U8QB 2O5YH 2BZCA 3OG6B 2ZAHA 4D9RD 3B8YA 1D5XB 4EIZC 4A6YH 2YGNA 3HG1A 4ZFOL 1HSBB 3DX1A 4ZMVA 2OKMA 4U6YA 5C0DB 3VI3F 5T3ZH 1QR1B 2LVCA 4LFHG 2ZOLB 5D7LA 3OKOA 3TT1H 3HR5A 1SN0A 3QUMH 1F8TL 3WKYA 3BJLA 4QRSA 3ILQC 4UOZA 3OKEB 4AQAA 5KBDA 3D39D 3G7TA 4NS0A 3QEQE 1Z3RA 2ADIB 2EDBA 4QRRD 1SVCP 3S97C 4RGND 5DZOA 4TM9A 5FOBB 4JG0H 4QRPA 1RZIA 3LKPA 4TN9A 4OF8A 1XF5B 2IADB 1YMHB 2GUOB 4NGHH 2CDFA 5AW8B 3DUSA 5GGRA 1GYVA 1QATA 2BFGA 2NPLX 3B1UA 5FOJA 2F54E 4N0YH 4PJDF 5FV1L 3V4PB 4Z7OE 3GSOB 1KJVB 5I18L 4MNGB 5FW6A 5FECA 1MWOA 3NJXA 5CKAA 3GI9H 1FN4A 4Z7UF 1DQIA 2ZF9A 4F15C 4RGMC 5AFAA 4M7JH 4CU6A 5T1KD 4PJGA 1T7XA 1M7DB 1FZKB 2R1WB 3Q5YA 2Q5BA 4MD4A 4JFOB 5B38B 5D70H 5KZCB 3LDBB 1B90A 4HS3B 2Y1YA 3VE0B 1TKWB 1YEGH 3D2UD 2QGCA 3IDYB 4NENB 3C60D 2VISA 3VWKC 1CBVL 2QEJA 2GBVA 3L16A 1DVTA 4PJCF 2ICES 3L4CA 1CF1A 2DM2A 3QHFL 3LEXA 5DSCB 5G2NA 5I6XC 2NW3A 2MSPA 2OTUB 3JXAA 3K5SA 3V0EA 2YQGA 3QISA 5B3NA 1BGXL 3FCSB 1TZGL 3D0LA 1URIA 3X3FH 1IGTA 5HYJD 5F3BA 5I1EL 4LPVA 2WJ7A 3ASOB 3G6DL 2ZUSA 1U8OB 1U8QA 5B4MD 1GW6A 2L3BA 3MRRB 1KPUB 3BRDA 5CLXA 4PEEA 3WV0A 2IIJA 1Y18A 1O7VA 4Y7MA 2DLGA 1IC7L 1YMMA 3L4XA 2EO1A 3T0AA 3S34H 5BVPL 4P23A 5I16B 4AXWA 1L9RA 1A8JH 4DK6A 4ZZFA 2PCPA 4U2ZA 1RMFL 4ZO7A 3GMLA 2BXYA 1OSZB 2HJFA 4G6FB 1L9TA 3FXIC 2A9MH 3IXAB 4G71B 4UDUA 4LQ1A 3JWNH 3ZSSA 4P3DB 4FGMA 3R4RA 1VPOH 3T2NH 1CE6B 1LP9F 5HYSB 1NGQL 2OM5A 3BAYA 3LZFL 3NFSL 3LKOB 3FT9A 2JE8A 2CBQA 3STZB 3U46A 4YHZH 2VAAA 1CDYA 4KHXH 3LVTA 3WNNA 1B2WH 1NKRA 1TVHA 2DF3A 3CVBA 4KVCL 4ZW6A 4CC4C 2YK1L 1UA7A 4R4FL 4BZYA 3UC0H 3J7HA 3EHBD 4IRJD 2XKSA 3KJ4B 4OLXL 3LKRB 5DUMH 5K59F 4M61A 5F1IB 4L4TB 2D2OA 5KS9F 5FM8A 1U0QA 4PRIA 1A3ZA 3P73A 4I77H 3WSQH 1PD1A 2WNKA 5J13C 2W60A 2K70A 3MZGB 4LARL 3OPZH 1S46A 2MRYA 3PWUB 1H0DA 2AK4B 5F6HI 5LNDA 4FQXD 3LD8C 3OZ9L 4MAYD 3ESMA 1FBIL 2XQYK 1EAPB 2QHRL 1YY9D 2ZICA 1MCSA 4ELME 5DD6A 5E9DA 5IEKA 4WHYG 4APXA 5KJ7E 4Y2NA 3LDBC 4LSSH 5CN2A 5JPMB 5JORA 2YMXH 1DN0A 1OM9A 3EIFA 1A47A 5FW8A 3RWDA 2GFBB 1HDMB 5EZOL 1JF1A 1K4CB 3VXRD 4LCVA 3P30L 3VM7A 5H35A 2D73A 4AJVA 3ZMRA 3OKYA 2K9FB 3ZDXF 4FXTA 1XGRA 2YEZA 4PG2A 4PIRF 1Q0YL 1UADC 4GS7C 4U1IA 4QHPA 4D8PB 3SDDB 1WCBB 2NY4D 2YGVA 4Y5YA 3GBDA 2CK0H 3IJEA 4M62H 2PYFA 4ODXB 3MV11 1U4EA 2V7HA 5HI3D 3RNKB 2E7BA 4R96B 3T6QC 1D6EA 4KZDL 4J3UA 2VKXA 1AIFA 2NY5H 1Z9OA 2EEXA 5J1AA 2H2SD 4JQVA 5F9JA 4JX0A 1DBJL 2CJSA 4UB0H 2EXSA 2DMGA 4ZS6C 3VGDA 4JHUA 2PCFA 3VXNB 4X6FB 1S7QB 2QPUA 2WB1A 3ABZA 3N06B 4UNTA 5DK0B 1SJXA 4N4YB 2EH8H 3S37X 1T3FB 5K1JA 3RA7H 5I2IB 1VB9A 3R8QA 4BIKA 3MJGX 43CAA 4TQEL 3NZSA 3PWVB 3MOQA 2MH4A 2Y2WA 3FFOA 3WFEL 2W60B 4C83B 2A83B 1A6WL 4HJSA 4JGNA 2VAJA 2VUKA 4HWUA 3AWGA 3UDWC 5ADPH 3H2WA 3ARFA 3BVVA 1MFCH 4J4PC 4KMQA 1L9MA 2JIXD 3BW9B 3PJSA 5DC0A 1X5LA 5I1KL 1RPQA 5DQDH 1IGYA 1BYPA 1FFRA 3HOGA 3QUZC 1EJOL 5I8OH 4HFWA 2XY1A 5I71C 4Y1AA 4NZTL 1MI5B 1FRGL 1MHCA 2N3JA 4PY7B 4P2YA 4PP2A 4TTDC 1EEUA 7PCYA 4RDBA 3ABKB 4OCMC 3SDCD 3GXMA 4FADA 1V10A 5I16A 3ABMB 5KVMC 4G6AD 4G6MH 1CD0A 4UT9H 4HZAA 4OJDH 4X5QA 3P9LB 5IGXL 4LASL 3M1BA 2WLKA 1PU0A 2NUPA 4JJ5B 1MJ7L 2FQEA 3HNVH 4XHQA 5EO1B 5AW6B 4HJEA 2HG0A 2A6DB 4LNRB 1M7XA 4PWIA 1XTMA 1P84J 4JKPH 3L3HA 2IBGA 1E0OB 4TNVK 1ZLSL 1N70A 2NY6B 4JKKA 3Q2NA 3REVB 3VI3E 1A7PH 5IIEB 3OSVA 1INEH 2N1TE 4OM0L 3QJZA 3Q2WA 5F88B 2IV8A 3SDAA 3W0WD 4NC2B 1QYGL 5D96B 1A2YB 2JELL 3MMEA 2ZWYA 1YQVH 3MRIA 1UWEL 2ERJC 3UTSB 3O8XC 3FU8A 1WBXB 5JOEA 1B4LA 3WKMH 5I74C 4H0HB 2WYHA 4PJ6A 4RNRB 3FBKA 1G9MC 4OI9A 1ZXKA 2H26B 3ZQWA 4IRSC 4NUPA 4U1SB 2CO6A 4WKZA 4PTUA 4OZHE 2QQQA 5G4MA 1UVQB 2WUCH 1UM6L 5EBLA 1LO2H 1CLYH 1PAMA 2LGNA 4OJAA 1X4ZA 5SX4I 2QSCH 2R2BA 4MAUH 5EU5A 5FKAB 3PFQA 4YZWA 1XGRB 5AOZA 1YEEH 3OL2A 2DQDL 4RWYH 5KYUA 4PTTB 4BHUA 4NKOA 3Q1EA 2A99A 2EILB 4U2YA 3QXAA 2WXJA 1TZGH 1FNSL 3QJHB 2MJWA 1G5GA 1K4DB 5AL0A 3HHSB 1QLEH 3BLKA 4IBTA 4OZFB 4OR1A 3QZOA 4JRYD 3CLEL 1BFOB 3FKUS 4DP0X 5A7BA 4TVUA 4PJDE 1KEGL 1NCDL 4MBRA 2YD3A 4APQB 2JMRA 2QVKA 4PJ8D 4DPAX 4PJCE 4Y9CA 1BYNA 3FO0H 3EJZD 2XQ0A 1R3JA 1P4IH 1EJ8A 1SQ2N 1OSPH 4LLVA 3FCGA 1AS8A 3KYOB 4ZFOA 2APFA 4PV8A 1TJMA 1USQA 4P57B 4HH9A 5EUOA 1P1ZA 2WZ6A 4H8PA 3OAYK 1VPOL 4GLRI 3WN5B 2E9JA 4WIQA 4GSXA 2C3VB 1KN4H 3QULB 4JFFD 2P26A 3CCHB 3RFRA 3BKCL 5AVSB 2CLZB 5CINL 3H7BB 2XBZA 4XRCA 2CBPA 5I1EH 4Q9RL 3KPSA 4JRXD 4TL4A 1AJ7L 4ONHB 3TEWA 1GIGH 4BJLA 2FL5A 4B9PA 1TVBB 1T5KA 4QHNA 5D6DA 1CFQB 3HG2A 1GZQA 4YDIL 1TQCB 5C2BH 5I30L 3K6DA 4Z7UB 2FWOA 2YUVA 1BQHA 2DMBA 2GK0B 1LP9B 3H9ZA 2VLKB 2H47C 1M1XA 5CFAA 1A21A 1HH6A 1Y1UA 3ZE2E 4G6ML 4UT9L 5IVZB 1BZDA 1CG9B 3BN9C 2E9BA 1U93B 1E9OA 2EECA 3FTSA 2HT4D 2XTJD 2WXFA 2EVHA 1J0HA 3LEVH 4L1HA 3MFFA 5HHPA 3T1WA 4IIQB 3CX2A 5HXMA 1MCIA 3BW9A 4H88H 4KRPD 5HBBA 4F2MA 2YARA 1CL7H 1JN6B 4NZFA 1I3UA 1E4KC 3MRDB 4GQZA 3BXNA 1KB3A 5FO9A 5SWSE 4JFXB 1SF5A 3AFLA 2UZYB 3M17A 4FXGB 4WDIA 1RU9H 3CXFA 1SLVA 3LQZB 3RIAF 4OZIE 1NCWH 3FB8B 3WEXA 3CC5A 1F1AA 1L9SA 2VE6B 3ZR6A 3C60C 2BHZA 1ZLWH 4ZFGL 4GAAA 1G94A 2WSKA 1P5UA 5IMLA 1FWXA 2ZOKA 3QZMA 4GAJH 4X6CE 2CM6A 4FMFA 2ESVA 3CH1A 3RAJL 1RUKL 1SUJA 1SY6L 4R9HA 2GTZA 3SE8H 1PCXA 4BELD 1GXEA 1IFRA 3TBVA 2YXVA 4PRDA 4WK4B 3IPBA 3O9WA 2ADFL 2FO1A 3ELQA 4HH9B 4NIYE 4CW1B 1VLXA 1DBAL 3JWDL 4CU8A 4JHZA 5EEYA 3FUHA 1F4YL 4W93A 2ZWLT 3VSVA 3BP7B 1QA9B 3EW3B 3LPPA 1CWVA 3SE9H 4ZW3A 5L4FA 1JGUH 4KZDH 1N7MH 3V5HA 1QG3A 3DNKA 4LHUG 4M8QB 3MO1B 1IIKA 2WTPA 2FB4L 3ARZA 4KOBA 4UB0L 3OXRB 5I76B 2Q10A 3QIUA 1MJJB 1G6RA 3DX7B 2A4ZA 2JCCF 3HTLX 2I32A 1FV1A 1IC4H 3FMGH 1BVZA 2ZWNA 2QV2A 3E1F1 3NRQA 4LMQE 2ZPKL 3JT2A 2G2NA 3IBOA 5CGYD 2QV4A 2IPUK 4ZFZB 1QSEE 3QNYA 5TH2A 3WTTA 4WFFE 3I6KB 1U33A 3ILPB 2A6JA 3IGUA 4FI6A 3RUGB 2EDTA 4E9YA 3HI5H 3ZDYB 2UXVA 2YJQA 4FJYA 4JFDB 5ALCH 1I9RH 1KGCE 1EJOH 4J6IA 4QXTB 2AQ1A 1D9KA 5EO0B 4BKLA 5GGUB 2GTWA 1WFNA 3C9NB 3BUYA 3PP3K 4KZEL 2NCEA 2Q2EB 2FL5B 4XP9L 3RI5K 2ATPA 3VFTA 4ZW5A 3ZZLA 2JIXA 5D1ZC 5I6OA 5HDLA 1ERNA 3ARDB 2OTWA 4Y4KC 4LSDA 2ZKHH 2LAAA 2AJVH 3QDGB 1NEZG 2FZ3A 4LVNB 3SKMB 3X3GL 1BZOA 5L2KD 1HXYB 4PB9L 1KPVB 4MLSA 1HKLL 4QF1B 1BIIB 3KCPA 3TO4C 1E4JA 2R1YA 3C6LB 4S1SL 4GKSB 4KK8D 2ZWSA 4K23L 1XCTA 2DJ4A 3ULVH 2A1WH 4MA7L 5E2TL 8CGTA 2J8UA 4OM0H 1CMOA 2Z3FA 3PU7A 5LBSL 2CR6A 2GB2A 3WL9A 5C0RH 4GG6B 3ENEA 1AGDB 3X17A 5J06A 5J1SC 3A21A 3B2UC 4CVWA 5B8CA 4P0DA 5IM7B 4UQIM 2APBA 4H88L 4HT1L 4IEFA 4W70A 3TYFB 4FLOA 2FSEA 5BMFH 3RX5A 4P3CL 2UV3A 3E2HC 3IKKA 1CFQA 4YHNB 1EDQA 3FQUA 3FPXA 4WWKB 3ZKND 3WDHA 4J27A 4YHYC 1QSVA 1DJIA 1M6UA 3M45A 2WZPA 5T5NG 1LO2L 4XX1E 4ZQKB 5JNYA 5CWSA 3IETB 4GMTL 1RHFA 5EN3A 4J3OH 4YSEA 1HZHH 1JF5A 3EGXB 2ZKWA 4XNYL 1MAMH 4KNTA 2BCKA 2XWBA 1UKTA 4IMKC 2ZG2A 3PDGA 5D7JD 3P2DA 1U58B 3NJIA 4NP4L 4ZJ9A 5C86A 1S9WB 3D5OF 3GJEA 4JRYA 1A14L 1X44A 1QA9A 3FT2B 5A16B 5CBEA 2WAHA 5KSVA 5IVXB 3IVKB 8FABB 6FABL 3GS4A 4JFXA 3BUDA 4NWTL 3KZ8A 5C0FB 2F5AH 3GXTA 5GS0D 4DGYH 3VXNA 2VJXA 1G9NC 3FH7A 3LPFA 1BIHA 2VW6A 4Y2DD 3DX7A 3Q2VA 2CLVB 3GGWB 3ECUA 3CAFA 4KQ4L 4L4VA 5D4IA 3EADA 3QWQB 1EANA 5CZXC 2VAAB 1BFVL 1G84A 5GZND 1JWSB 4U3XA 3TIEA 1XB3A 4ZUWB 2I60L 3QQ9D 5JDSB 1IM9B 1HJBC 4M56A 4PRID 1SM3H 4BK4A 3B9KD 2PYED 1S3RA 4S1RL 2HJLA 3KPSE 3LV3A 4GXVL 1VGEH 2KBGA 4BDVB 5IB2A 5HHXH 1XZ0A 2WLJA 5BVJA 3NJMA 3BEVA 4KHXL 1SXBA 4GRWH 4NLHA 2NX5A 1MZZA 5E9DE 1FVEB 4M3HA 2ARWA 3MUGB 3VFTB 2NY0B 2I5YL 1QP1A 4A68A 2OV0A 4EPSA 3NJGA 2X2IA 4QLWA 2VLJA 2WXHA 4WU7A 1NCJA 3QI9B 3V0VA 4NZ8A 2ZOLA 4QXGL 2YQBA 5C7XH 4G7VH 5FWQA 1KYDA 3SDAD 3KBHE 1YECH 2RCSL 3KPRA 3WIHL 3WNOA 3L48A 5H4ZA 1IT9H 4HETA 5D1XA 3UIZA 4KK9D 2W38A 3WD5H 1L9QA 3CSYB 4L2LA 1ED3B 4LNRA 2ICWB 2ZYSA 1GPOH 3AS3A 3FQXB 4YDLC 1AGEB 3VTTA 5IJKC 4OLEA 4NI3A 3SJVD 5INDB 1YHPA 1MCDA 3TBTA 5TF0A 4NRYA 1AP2A 4JN2B 5D6DC 1T4WA 3B83A 4EZKA 3MNMA 3ZGIA 1D7FA 4KAQH 4EN3A 2BNRE 1ACZA 4FG2A 2AABL 4G3YL 1U8PA 4U3SA 1IGCL 5C09D 2XTSA 4MXQD 3RWJA 3FU3A 4ZMTA 3OZKA 2VNCA 3OMAB 4WW2A 4OV5A 1AXSA 1QI5A 5DURB 4Y0GA 4QOKB 4P46B 1L3WA 4HUVB 1E8YA 1UD2A 2PYFB 3TWYA 1LTXA 2EICA 2KMWA 4MHHG 4OZIB 3F7YA 4K9EH 4KJYB 4Z76A 4NN6C 3IPFA 2HLFD 3ETSA 3BYTA 1HL5A 4NO2B 4Z8FL 5CP3H 5ESQA 3C2AL 4NBZB 5EF0A 4GAYA 4WWPA 4GUOA 1WDAA 1EO8H 3KPNB 2FECI 4OJFL 2DQEH 3SGKC 2BC4A 4ADJA 2XG5A 3QXWA 5C6PB 3GHEH 2GKIA 2X4TA 3T0XA 3RWEA 3A6BH 4BFFA 3WNIA 3ARBD 4URTB 4X6DE 2QLYA 4PN6A 2QSTA 4JLRA 1U8CB 3OG4B 3C6SA 4YXHL 3GRWA 2Y07H 1ZA3B 2UYLA 3EJPA 2H3XC 4PBXA 3RVTC 2CIKB 3I2CH 5B39A 1J0IA 2WO3B 4MJ6A 4U33A 3T6XA 3U48A 4OFIA 1DJYA 1GS7A 2OMTB 3GEFA 3UABA 1CK0H 4ERSH 3ZBMA 4P2RD 3JWNC 2X44D 3I6GB 2COVD 1TTRA 4GAJL 1GKOA 4H0IA 3VXRA 1ZT4A 6PAZA 3MV9B 1ECZA 5ACZA 1T03H 2MCG1 1I85C 4ELMA 3RRQA 1RZGA 3LZOA 5GRVK 3HLKA 3FT1A 5K9JL 3NZHL 3LRGA 3V6OE 4ZODA 4X9FA 3WFHB 3SJVE 4OV6F 1GMEA 3FTUA 4OUOA 2UZIL 3DXAE 3TEZA 3GLDA 2RTTA 4AX3A 1QBBA 2RHEA 4H44C 4HIEB 4YXLH 1JZ6A 3OJMB 1R3LA 1CXHA 2FD6H 5EU6E 2YUZA 1IAKB 2Y36L 1EAOA 4M7LH 4P2RA 3OWEA 3Q48A 1TDQA 3CZUB 4OLZL 4OM1L 4YPJA 2PF6A 1ZPLA 4NBXB 3T3PB 4V1DA 2CXGA 1QRNA 3L3IA 5DJXB 4Y9EA 5ESAB 4N2DA 4Z5RB 5AVUB 1KGXA 4NNXB 3QXTA 2R2EB 3HUJE 5FUOL 5B1JC 3V0FA 4PCKA 1T66C 1W91A 4PD4J 1OLLA 4R7XA 3TNMA 4LOUC 1A3RL 1WO2A 1YY8A 1JWSA 5IY5B 1DLFL 1QWUA 3BI9X 5T5FL 1OAKL 1LQSR 4UU9B 5D1XB 4ZOAA 5C09A 4OF5A 1HSBA 2G60L 3X1FA 3B7TA 1OP9A 4G9FE 1BQRA 1RJZB 1V7MH 5DD0L 2EXWC 1H6TA 3IU3A 4PY8I 5K1NA 1RUAH 2YC1B 4OCLC 4RA0C 2G9KA 4UOW0 3HR5B 2EYRA 3NCYP 4PJ8C 1UZ8A 2NY1B 5DHYB 2F1BA 3UJJH 4LF3A 2Z0BA 3BCDA 2MTPA 1EZVX 1GYCA 1KCSH 1A5FL 5D7JB 3MGOA 4HXAH 4UTBH 2R0ZL 1EFQA 4S2SB 4XT1C 3ZKNC 3QEQD 2FWLB 4GW5B 4NUMA 4X8CA 2YKLH 5DZPA 2FYVA 2FJHB 3N1QC 4GMTH 4AYID 4QOKA 4AYBA 4BH8A 5KYNA 1ZJBA 1ZGLB 3CC5B 3HBZA 2P5ED 3GSQA 2QQNH 2Z31A 3KJ6L 5FYLD 2FYYB 4F91B 2EIZB 5HGBA 4LSQH 1EHKB 4HJGB 3BGAA 3ARWA 1K5NA 5C71A 3C5ZA 1E27A 2EDEA 3SQOH 1BFTA 3NQKA 3MRGB 4LKCB 4YSRA 3KPOA 1WS8A 2WK2A 3IE4A 5AZ2L 1KIUA 3G5VB 2IANB 4JJHA 5F3FA 3MCKA 1AGCB 4BBWA 5BQ7A 4JO1L 5IEKB 3ETBF 1L5GA 1AQMA 2OW6A 3U83A 4TNGA 1C08B 2FJGA 3VGFA 5IOPB 1G6RB 1CIDA 4QRUB 1YMMD 4MZIA 1PKQE 3O2VH 5GZNA 4LT7A 1VCAA 1MWAB 2DM4A 5DR5H 3BUTA 2CU9A 1JF1B 4FAAB 2UWEA 1P5UC 2A4CA 4IMKA 2PP8A 5CIPH 4PJ5D 3DDGA 1JXDA 3LNGA 3C8KA 1A6ZA 1I7TA 1H9DA 3S4SG 4N8PA 2JJTC 4AYDC 1OWRM 2Q6WA 4FNTA 2X38A 3VXRE 3WFHA 4A7GA 1CGXA 3JV4B 5IEHB 3ZKMC 2GVYA 3NZHH 4HIIB 1F2XK 2H32A 1T1WB 1JGIA 2IGLA 4NEHB 3II2A 4XO5A 1V54B 3FTGA 4YFLI 3RGVB 3AITA 1QNZH 3GMOB 4YXLL 1U8CA 4N0UE 2UZXB 2OL3B 2DQGH 2XG4A 3BD5A 1J05A 3V95A 3QUZD 1ZKAA 2Z91A 1SBSH 3FF8A 5GGUA 5IQMA 4KROB 2X42A 1ETB1 2C9PA 3RDTD 6CGTA 2D3NA 3DUUB 2F74A 3FU5A 1E30A 4U1KB 2ARJA 3UJIL 1CE6A 4DTGL 4KMTL 2J57A 3DHMA 3O6KL 4GQ9L 2G0KA 4H26A 5TE6H 3IFNH 5KYXA 1U8LB 4LNVA 5HHOD 4DCQB 1YY8B 3O3DB 3DIVA 3QHFH 3FN0L 1KB5L 2ITEA 4PJ9C 4AL8L 3GJFA 5AYTA 3CN3A 2DQCL 1P4LA 3S35H 2ZCHL 3OAUH 1I1AC 4A2EA 1D5BB 1I9EA 1WAPA 5DK3A 3S35X 3ZVVA 4JANB 1Q4NX 2NY0D 1TIUA 3FH5A 4GINA 4IEFB 2YGPA 4XPHH 3VB8A 3BHBB 5GGTH 3G04A 1IGMH 1JDAA 2ESVB 3BISA 3CH1B 2H2SC 4L29A 4WWID 3ROLA 1XAKA 3AAZB 4HWZA 1OT2A 3H2PA 2AVGA 3ALPA 5IMOB 5DJ0B 2M2DA 2R4SL 4WUUB 4FCHA 3A6CL 4PVMA 1INDL 4WV1A 3DIFA 3UAAA 4LAQL 3HMXA 3QIBB 3CDGA 4L3EA 1FNEB 3CFKB 5EU7C 3HZVA 3VXQB 5JW3H 2WM0A 4G11A 2R2EA 4XO4A 3THML 4H0GA 5SV3A 3PWPE 1FZOA 3WUZA 3QNXA 4GBXD 1F8TH 4UV4H 4OLVH 3T3ME 3GLAA 5E6IB 5IJKA 4FOMA 3HG3A 1TJHH 3WUWA 3ZT6A 1UTDA 3W82A 1F6LL 2D2CC 2PP9A 3HAEB 2MCPL 4FQCL 5DC4B 4DPBX 1Q8MA 5LGJA 3D2UB 5CBAA 2UX7A 3MV7B 3DHUA 4H20L 2EDOA 1NPUA 4X0NA 3JYCA 2FATH 3JZ7A 1FFQA 1DUZB 2PPDA 3JVGA 5B8CC 3ARBB 3K4DA 3O4LE 2VDRH 4M5SA 5TDNB 4MLIA 1NLDL 4X6DB 4YGVA 1GVIA 2YPLA 4QRUA 1XCQA 1XR9A 2WV3A 3C5SA 2DH2A 1KV7A 4F7CB 3T2OA 1WBYA 3ZYIA 3ZY7A 1XH2A 2CDGA 3NSYA 1T03L 4UNVA 2VUOA 2HH0H 3LCYA 4OZGF 4Q89A 4D7PA 4Z7WF 2HLFC 1H3TA 1QLRB 2P47B 2XZQL 3QG7H 3WFBL 4DSYA 1SQMA 2XA3A 5BO1L 5KYUB 3NAAH 1ETA1 1K5NB 5AW2B 2HLEB 3X11A 5IW6A 4F58H 2GUYA 4LU5L 3RGVC 1V7NL 2XKUA 5JDSA 3RHWF 5K9OA 3ZTEA 5B21A 2QFRA 2FZ3B 1FGVL 1NANH 4NP9A 3ULVF 2AV1A 1BZ9B 1J1PL 2A7BA 1NJ9A 5JHDB 1UQSA 1XB8A 3GMMB 4ONHA 1QR4A 4JPIA 5AAPA 3FOMB 1CDCA 1NCDH 3ROLB 5EEUA 5I1HH 3VH8G 2A5UA 1P4UA 3K8MA 4KKPA 3E8VA 5HGHA 3FU7A 4K5LA 3B3BA 1HWGB 1WEJH 3GIVA 1HEZB 5FCUL 4A67A 1E9QA 1G43A 1MCJA 4YIQA 2IO5A 4BV1A 4WI9A 1GTNA 3EZ8A 4IJ3C 4R84A 4Y1AB 1A4AA 2AGJH 1LNUA 1CDGA 3S96B 4DOHE 1HZKA 1CGWA 3C09C 2DKUA 1OOWA 2EDYA 1FNFA 2CJTA 1P7QA 1QFWH 3KPQB 4A38A 3OR7B 1MY7A 2EKSB 1T1XB 4FNLL 5DJZA 1F4WL 5HI5C 3LKOA 1HQ4B 2DTSA 3HUJF 5B7MA 3JQOB 4F2MB 3PLYA 3KEDA 25C8H 2NDGA 5BVPH 2O30A 4ZFQA 4NZRH 4KH9A 4WCYH 1QSEA 3K72B 2IADA 4N9GA 1MFAH 3KR3L 1KCUH 4PWEA 2ADJA 3FJTA 5ITFA 3RX8A 3PWPA 4V2BA 1OY3B 1E28A 1XMWA 2P8LB 1ZHKB 4BSWA 1NGPL 3CVCA 1B2YA 1U91B 5HY9B 1H6FA 3US9A 2EEFA 4LSQL 4CRPA 3FAWA 1CICA 1A2YA 4KKRA 2G30A 1S9XB 2YD5A 4DERA 3TBSB 2GTZB 2VSCA 4IW4C 4NJ9L 5E6IA 3FB7B 4GAGH 3ZUCA 4XNUH 4F93B 2CCVA 1IU1A 3DRTA 3V79C 3U4BL 2ZUXA 3QUYA 3NCCB 5D2NB 2E7HA 3WIFA 4PWHA 1V7ML 2WVVB 4DZ8A 1A6PA 4XI5C 4KDVA 4MD4B 4R83A 5KUKA 2YFNA 2KZKA 4KY1L 3K4ZA 4CVUA 2H41A 5I0YA 4L1BA 1E8ZA 3IJYB 5J11B 3P02A 5CHNB 2ITFA 4PG9A 2VISB 4W6XB 5BQDA 4I77L 3U2IA 1T1ZA 2IDCA 4PGZA 1IKFH 1DBBL 1XB6A 4XC3L 3LEXB 5DSCA 3VE0A 1AKJA 2BIIA 3WGVB 1IM9A 2H1PL 3SO5A 1NJ9B 5JHDA 2NW2B 4LFHD 2WC7A 3TJEH 1WPCA 3PHQB 2CKBA 4TNVF 2Y7NA 3MRBB 2Y5QA 3KM1A 1FGNL 4ENED 3MYZA 3C5ZC 3TASA 1HESA 1JTPA 1I75A 3FQWA 2FWSA 4NNPL 1PZ3A 1KNOB 2WBJC 5H2BA 5IR1B 1WZ1H 2G3NA 4N0UA 4Z7VF 2PYEE 2WIMA 1WGVA 2BP8A 2F58H 3V5HB 2RACA 3HMXL 4XWGL 1NIAA 2F1EA 4LL1A 1CFBA 4GRLB 3EYUH 3HNTL 3SKUD 4LHUA 4HULB 3NK4A 3ARYA 4J39A 4P57A 5EZOH 5HPMA 5CCHE 1BWMA 3B2UD 1IAIH 4L3CA 3WIAA 1S78D 1W6LA 5I0DA 4FQHA 3GTVA 4UMSA 5HDRA 1P7QD 2X40A 1CR9H 2ZOUA 1E2WA 2HFEA 3FT4A 1JNHA 2GCYB 2QPDB 3V0WL 1S9KC 1XR8B 3OLDA 2XQBH 1ES0A 1P9MC 1NCTA 2DMCA 2R1YB 2ICWI 2VL4A 1IILE 4KXCA 2M26A 3TH3T 1YPZF 2L7JA 2XYBA 1CYGA 1BD2E 1BG1A 4X98B 1YAIA 1A6WH 4ZOBA 4RVBA 3QRGL 4B3EA 1FNGA 1UENA 4UT7H 4YQXH 4FDWA 1TENA 1A64A 4PRIB 3G5XB 4Z0XA 1NCUA 2XWRA 1F97A 2NZ1A 4HUXB 3B56A 4NO0D 5TPWL 1MI5A 1U30A 2VH5L 3GS7A 3Q06A 1LE5A 3RPKA 2PUQT 1A02N 4ZQTA 4PGBB 4PLNC 5I15L 1PZSA 3B5GA 4NQEB 4K9JA 4TQHA 2AQTA 4OCWH 2PXYB 5BRZE 3OKDB 3HI1B 2RQ8A 3Q2CA 4I4WA 3MRNB 1WD8A 2W92A 1TJHL 3ROOA 3T0BA 1MFCL 2HT2C 3N1PC 1T5XA 3OZ9H 3EJYC 4NI6A 4E42B 3D05A 4HLZG 1NM4A 1RUAL 4YDJA 4ZMYA 4LK4A 3MRGA 4M3KB 4KJQC 4G1EB 1WAAF 1BQHG 4NFDA 3RY6A 3C8HA 3REWB 2WVVA 3VGEA 3DX8B 4NPJA 1MG2C 2UWEE 5LCVL 4MGXA 2L4OA 5IJVB 5JPMA 2J7LA 2K4WA 5D2LE 2GC7C 4HQQL 2IOIA 2KQMA 4JM2A 3RNQA 1C16A 1IQDA 2ALWA 3MX0B 1AHWB 2J2ZA 3PNWB 4IM8A 12E8L 4R4ND 5D72L 1UA3A 3GWJA 1M2VB 4BFEA 5HYSG 4LASH 2Z0UA 1M7IA 4KI5F 3KXFA 3IRZA 3UAJD 1WG3A 3UADA 3VFUA 5CZVL 4DKAA 1TJGH 5FO7A 3R1GL 4LAQH 4FTVE 2Z92A 5E6YA 5E8EB 4RGNB 1ACCA 4R96A 1N8OE 2VCOA 3MBEB 2OSLB 1HINL 1YNTF 2HRPL 4Q74A 1YEKL 2YAMA 3HRZA 2PXYD 3U1SH 3W2DL 4C4UA 3RX7A 2PWDA 2JKLA 3ZL4L 5L6YH 3DPDA 4GH7B 3D30A 3GSRB 3GTTA 4PJHF 2XVBA 3EH1A 2QFPA 1EQWA 2D0FA 3FT2A 3FO1B 4H25B 3VWJA 4E9QA 2TAAA 4CUCA 5LWYH 4LPTA 3NRFA 4XC1L 2BIMA 1WISA 4P5TC 3F04A 1VGKB 3ARBC 4IHOB 3N43F 4F7MB 4JKWA 3V4PL 1KENH 3A23A 5IB4B 4PJFB 2FH8A 1HCVA 3KPSD 1NFDE 5F1KC 5JIHA 3BZEB 1IEHA 3PHQA 1SJVA 1VFUA 2FLMA 5LVEA 1YJDC 3MTXA 2JQMA 2I9TB 1MZYA 2A83A 4BQCA 1FYTB 4G6FD 5E2VH 2XBTA 1BOGA 3EO0A 5I6PA 3DUUA 2C9QA 3BZ5A 4BYHA 3C6LC 1S5IL 1BM7A 3L8QA 2WJ5A 5FO8A 1DEEB 1COBA 3B9KC 2XQBL 4XP5L 5JLZA 4WY7L 3GBNL 4F58L 4YOKA 4BQBA 2JI2A 4G8EA 4M5ZH 1BREA 1WYJA 1RXLA 3QEGH 5E9DD 3B43A 4M9OA 1OQXA 2EJ1A 4AKOA 4KGJA 3VSQA 1CC3A 2W59A 5JHMA 3P2TA 5E5MB 4Z3FA 3W38A 1CGSH 1DL7L 1SDYA 5HSFA 4P2QA 5KANI 3L17A 5IKCB 3A47A 5DA4A 3VGHA 1AMYA 5GISL 1KCUL 1JZIA 4G9FD 4FF9A 2ZX5A 1A1NA 3NCXA 4X6DF 2IBBA 4FQIH 3U82B 4FS0A 4FQ1L 5LXGH 4OCYH 2QVIA 5MP6L 1A6AB 3SGDH 5HJ3B 3FU9A 4K8RH 2X4OA 1PW3A 1J0YA 4DJMA 3HZVB 4X8JB 5F88A 2B59B 1T5XB 1G0DA 3D6GA 4ABUA 1T83A 1HQRB 4YFDB 1I7UA 4XPHL 1L6ZA 4YDJB 1FL6A 1B2WL 3C8DA 4G1EA 2CUIA 4JZNB 2XG5B 4PS8A 5ERWA 2J88H 5DHMC 3DHJA 1CL7I 3HC3H 3PUUA 2J6WA 3H56A 4U1NB 1D5ZB 1MJUL 5A43C 4P23B 1GGYA 1UURA 3COOA 4AVHA 2GHWB 1FL5B 4YGVB 5G4NA 4HGWB 3GZOA 3GRGA 1AR1C 2JCCE 1UGKA 5CEZD 3O2VL 3ECBA 5AYUH 5IMKB 3MREA 1CICC 3M86A 3WAKA 2VIRA 3X3GH 2ICEA 2HPOA 5AG8A 4GO8A 1P7BA 5CJ5A 1GGCH 2DWXA 2AQQA 3MVSA 4XNDA 4X7TA 2V2WA 1YPZA 4NJ9H 1DVYA 3FFCD 3QEHB 1YMME 3KWVA 3GJFH 3LSOB 1NQBA 1CL7L 1F6AA 1OHZA 4K8RD 4EIBA 1UT2A 4CVZB 1N6QH 1IUZA 3PAVA 2E8ZA 3RVVC 4Q4EA 5BZXA 2P5WA 1A25A 3W9DB 3ULUL 3QWRD 2HLAB 4JLRB 4LESA 4YDVB 1KB5B 3OLEA 1I9JL 3UTSE 4IK6A 1TXKA 1OIOA 1LEKA 5CP3A 3KYOA 5FLUA 5J3HC 2ZYIA 2EC8A 1N2RB 4UZSA 4XBEH 5KSAD 1PLBA 3CK0H 2PN5A 1RCYA 4PUBH 5GGSB 4U1MB 1UA6H 2R69A 1KFAH 4GOSA 3ISRA 2Y25A 5CD3B 5ANHA 3ZIYA 5IK3A 1UWYA 1N7ML 4JFED 1LMIA 4CSSA 4KJWD 3BP4B 5DCCA 3L4YA 3CLWA 4GRLD 3VDAA 1NGYB 2D7TL 3N42F 1XMEB 1T1XA 2H3KA 3GXUB 5HYQA 4EIGB 3EF7A 3T0EC 4Y2DB 1MI5E 4JPKH 2LV4A 3WYRA 5HHQB 3QQ3A 4B9ZA 4U1NA 2OI9C 1KTJA 4GO9A 4Q2ZB 3UTSD 2CLRB 2E47A 3S5LA 1RK0B 5DC9B 1S7SB 5F0LB 1ED3A 3D39A 1T20B 3RUGF 4P2QE 1EMTL 2P5EB 4ZDHA 3QAZC 3EYOA 2VW7A 3TBTB 4HZLA 3DTDA 2VZVA 1Q9KB 4F3FB 5LG1A 4F2EA 5CJXA 5L2KB 3FB7A 2DB8A 1KG0A 4UAOC 4NLAA 2RD0A 1OSYA 2VMDA 4WFHD 5J1AB 3TP4A 5CLYA 1DO6A 3VXMD 1G6RL 2YQ3A 4KJQD 2A1WL 4MA7H 1QUNA 3GDCA 5ALBH 5JZ7C 3QUYB 4RX4D 2VYRE 4RFNB 4ZMOA 4X6FA 3TCXA 4TUJA 2XPGA 1OP5H 4L8BB 4WENB 1LM8V 2BSRA 1WT5C 3LXAA 4IMLA 3PWNB 2WIIB 5IB5A 3TYFA 1C08A 2FJGB 5BRQA 5TGBA 3SB3A 3V55A 4UTBL 4M02A 4BH8B 4ZFFB 5HDWA 1G7IB 1UCBL 4YC2C 3S9DB 3ZX1A 2QGEA 4KVNH 5GS2D 2ENSA 2XZAL 3KYNA 3TJHD 5BZDB 3BEWB 1NFKA 1J8HE 3W2DH 1ZD6A 2R23B 5IBUG 3WIHH 2B59A 4LLWA 3Q44A 4L9LB 4PLKD 3PWJA 4NM4H 4JM0A 3QIBD 4A7TA 4MSWB 4L8CA 3WN6A 4LOVA 5IEHA 3OC5A 4IKLA 3VWKA 1NIDA 2EC9T 2XV0A 5ID1B 1KIUB 4U6XB 4IGBC 4I3SL 2L7EA 4HHWA 5CBEB 2H1PH 3IVKA 4MQXC 2OP4H 1A8ZA 4EN3D 5T1MB 1MNUL 3OV6A 5I1CH 3H2QA 5C0FA 2OXGA 4PJAA 4L5FH 1JTOA 1I8IB 3TO2A 1HK6A 1MWAA 5E8NA 4EI6B 3LRMA 1WF5A 3CV5A 1VHPA 4OCRL 3MV8A 1CZ8H 1U41A 3D39B 3ALWA 4U6HB 5M7QA 3DXAD 3C9NA 2OCJA 4G9FB 5I0XA 5FYLL 1EO8L 3ZO0A 1OWWA 1B6DA 2F58L 43C9A 1V27A 2NR6D 5CMAB 2AJZB 2J6EH 4FMKA 2FRGP 3D34A 4P5TA 3VM5A 1T2QH 4FJ6A 1SM3L 3VXPB 3WO4C 1LE9B 1SXCA 1D5BA 3L3IB 5DJXA 2FO4B 4UQ2A 4KPHH 2PR9A 4PR5B 1VAHA 4NWUH 1ZTXE 5EIVA 3AT9A 3MODL 4WCYL 3QPXH 4ENEC 4XPAL 4H13C 4UU9A 4JW3A 3ZDZB 1XGTA 2OTPA 2OL3H 5E2WH 4DQAA 2IOOA 1DJXA 4MX7B 4HX1B 5KVFL 3LKPB 4GKZA 4D9QD 4DHLA 4FNQA 1W9XA 3H6AA </