4F24A

Crystal structures reveal the multi-ligand binding mechanism of the staphylococcus aureus clfb
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
334
structure length
334
Chain Sequence
AEPVVNAADAKGTNVNDKVTASDFKLEKTAFDPNQSGNTFMAANFKVTGQVKSGDYFTAKLPDSVTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDILTKTYTFVFTDYVNDKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFDNKITYNYSSPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEESSGKVSATDTKLRIFEVNDTSKLSDSYYADPNDSNLKEVTGEFKDKISYKYDNVASINFGDINKTYVVLVEGHYDNTGKNLKTQVIQENIDPATGKDYSIFGWNNENVVRYGGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clumping factor B
publication title Crystal Structures Reveal the Multi-Ligand Binding Mechanism of Staphylococcus aureus ClfB
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion
total genus 84
structure length 334
sequence length 334
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f24A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f24A02
3IS0X 4BBWA 1R19A 5IHWA 2Y7LA 2F68X 2YLHA 2VR3A 3AU0A 4LEBA 1N67A 4JE0A 4LEEA 2Y7NA 2RALA 3AT0A 2Y7OA 4MBRA 4RMBA 1R17A 4JDZA 2F6AA 5CF3A 3IRZA 3V10A 4LE8A 4F20A 4F24A 2Z1PA 4B5ZA 4F27A 5CFAA 3ASWA 4MBOA 4B60A 4F1ZA 4Q6KA 4JDZB 3IS1X 2Y7MA 3IRPX 4FJ6A
chains in the Genus database with same CATH superfamily
3N3EA 3ARED 3MRQB 3OJ2C 4TL4A 4IGBC 4IHBA 5E1QA 5T5NF 3S37L 4HJ0C 4EN3C 4WWKC 3EAKA 3WUZA 2CK2A 5EZIH 4NZJA 1OGAD 2D4DA 3FCBA 4K3JL 4G5ZL 1D5IL 4DTGL 4FNSA 1QRND 5C08D 3HI1A 1KDIA 2WNWA 2SODB 1KB5H 1FFTB 1S6NA 3OKMA 4HGKC 1AFVH 2PO6D 2EDRA 4IBVA 1BIHA 2IALB 3VYNA 3DJZA 1K8DB 5D7IA 2IFFH 1T66D 1QHQA 1J8RA 1IBZA 2PABA 4FG0A 3GK8L 4NOBA 1IE4A 2DTSA 2F7PA 4GI8A 4N5EC 4ZUVA 4AKQA 3QDMD 4ILDA 3WKPA 1CLYL 3O6KH 3NCJH 3RX8A 4ALAH 1T1WA 3OMAB 4JKLA 2P44B 4HDIB 1DJWA 4OGXL 3UGEA 3FOLA 3IDMB 3OHXA 1H8OA 2Y1AA 4AL8L 4IDJH 3SCMA 4P57A 5DHDA 5ID0A 1E2ZA 3SGDH 3WIHL 3TOPA 2HH0L 3CDZB 3D4ZA 3JT2A 3NCYP 4I89A 4NQCA 2FBJH 4A7SA 3ULUF 1JGEB 1Q0XL 2R1XA 3C5JB 1BZ8A 4KRPC 3L1EA 3WSQL 2HLAB 2NY6B 4JM2F 4UOQA 4WJ5A 2YA1A 3LNHA 4IRSB 3SGKC 4QHKI 3EFOB 1KPRA 4TQIA 2WXLA 4Y19B 1XF3A 2P5EA 2P8MB 1BBDH 4HIXL 5DEFB 4D94A 1F86A 3ARFD 5TD4A 1BQLL 2FHCA 2L4OA 3ARGD 1E5UI 4I1RA 1NGXA 4ZTEA 4URKA 2WW8A 1F3RB 2MNWA 2A0LC 4WKZB 1NBQA 4B60A 1BWMA 5E5LA 5CKGA 2Y23A 5I24A 3O4LE 4J1UA 4UBDC 3QUYB 2H3NA 5AL0A 4A2MA 2L7JA 4EZJA 5D6CB 4LL1A 5A16B 2DIAA 1IC4L 3DJRA 1QSFB 2J12B 1LYQA 4K23L 3I6LD 2GFBB 3E2HC 2ITEA 3VI3B 4JPWL 4NRZA 1RLWA 4A2HA 4IBZA 4O2FA 5EF1A 2E6QA 2FAUA 5IVXB 1NEZB 3T5WA 3D7PA 4P5MB 1GZQB 2CXKA 2WTOA 2J8UF 1YMMB 3X1BA 3FOMA 1NUDA 2DEXX 4ZZKA 2QADB 2DQFB 2LTQC 3BHBA 2BRQA 5KYYA 5IHBA 3LN9A 1NICA 5I66A 4TUOA 3VUAA 4KJQD 3WJMA 3A22A 4NJAH 1NCBL 1TQCB 1CGSL 4WNJA 1MELA 1KGYE 1MIEH 5C0AD 4KH9A 4NQDA 5E00B 1O7DE 2OMBA 3B9AA 4H0IA 1QLFB 4CVXB 4PJ7E 2Z0UA 1I3UA 3ARQA 4PG2A 1RURH 2AABH 2NYYC 3QDGE 3HZKA 1E67A 3MODL 2GEEA 4NN5C 3V7AG 3GKZA 4WCYH 3KH3A 2FO4A 4N9OB 4RGMB 2PCPA 2Q86B 4DGVL 7CGTA 1SVCP 3WNOA 4LHQB 4QTHB 1K9TA 5D2NB 3MGTB 2X1XR 4UILH 5DZLA 4UYQA 5E8EA 2HT3D 3MNZA 4BV1A 3OXSB 1QYGL 2WVVB 4BFJA 4KK6C 3RRQA 4CC1A 1UM5H 4MJ6B 2GJRA 2L7UA 4J3OF 2ZD0A 2ZUYA 5CZKA 2OXGA 5AYTA 1G6RA 4IOSA 3FQUA 1E3FA 4O58H 1OPGL 1CJYA 4O4YH 3BUYB 4HUWA 4W9JC 3R7QA 1RFDL 3X3FL 3UZEC 5CNHA 1O0VA 1L7TL 1KBKA 3GO1L 4GKSB 4XMKH 4NYLA 3K2KA 3U4AA 3WUWB 2P80D 1YJDL 4RVBA 2HJFB 1MHEA 3BWSA 1J1OL 1ED3B 2EE9A 4YVNA 5DRZA 3H7BB 4JQVC 5FC9A 5D7KE 5C09D 1MVUA 2WM0A 2D0GA 3CFKB 5EUKA 1HZHL 2QGCA 1SBSL 3OPZL 2Z35A 5INCA 3FCSA 4OJAA 4WW2A 4XPTH 3C8KA 4O2CA 4ZTPH 4LIQL 3HG3A 4A7GA 2Q8AL 4UQ3A 4L8DA 1C12A 4ZOCA 1GAFH 4X4XA 1JXDA 1OSPL 3DXAA 5F7MC 3A6BL 1UD8A 3FRUA 2VXTH 4FZ8L 4WWPA 2G3ZA 1QSZA 1NMAH 3NZSA 1WBYA 1AQDA 2VMFA 5DLMH 2Y1YA 4YC2B 1H5BC 4U0QB 4I0CC 2QV4A 4JDZA 1AGEB 3FT4B 4LK4A 3FQNA 2OYLA 3RKPA 2BOBA 5I18L 3GUFA 2GITA 5E9AA 1PLAA 4P49A 3LS4H 3ES6B 1ACYH 4I48B 3L3OB 4JM2B 4MJIA 5GRZA 4WQOA 3TVMB 3V4PL 5ICZA 3MO1A 1JPTL 5AWNL 2PTVA 4OLZL 3FB5B 5DQJA 5AOIA 4EJ1C 5CLWA 4F2FA 5D5MF 2EYRB 1V7ML 1RI8A 4FNTA 4QYOB 2ZAIA 2CO3A 4LVOC 4BKSC 5HHXH 1MJ8L 1JDAA 1RH8A 5KAQF 1JNLH 2ZCKL 3ETBF 5LGJA 1ECZA 1JXFA 5B3SB 5FK9B 3VFVB 5HVHC 4KV5F 3UTQB 4MVBD 2YD4A 3LSOB 4JY6B 3SDAA 1Q9OB 3B2UC 1RHFA 4XXCA 2APVA 2YS4A 3EJUA 4OKDA 5IJBC 2CHNA 3MV9E 5D2NE 1YYLL 5ESVA 1XCTB 1E5CA 2IOMA 1QKZH 3MLZL 3V4PA 3DGDA 2AHIA 5CJXC 3NSYA 3PP4L 2J43A 1J7VR 5DFAA 3BIKB 1MF2L 5KVDH 3RNKB 1OTUC 4D0CA 4FCHA 5BVPH 1U92B 1CT8A 2E7LC 5DJ6A 2TRYA 3TCTA 1DVXA 3GXDA 5E7BA 4JREC 5IQLA 1CYXA 1K4CA 3T0EC 2X88A 3R7RA 2KHAA 1J18A 5AOZA 1DLHB 2X9ZA 3TIDA 3MROA 1WGOA 4NBZB 4UQIM 4S1DC 1E9OA 3ETTA 4OCMC 4UM8A 3DNKA 1WQVT 3BN3B 4PU2A 1UWXH 3TBBA 4GG8A 1INQB 4AEHL 5I15L 2BVQA 4KDTA 5IFHH 2VAJA 3IVKB 4PCKA 5I5MA 4A39A 1I7ZB 1ZT4A 3MPCA 2E6JA 2NXYC 4U1MB 3VG0L 4EAEA 3VRIB 3V6OA 2ZG3A 2F68X 2OP4H 1Z66A 4N4YB 2W91A 2XG5B 2ZKWA 4GB9A 2PYEA 3T0BA 3RP1A 2OM5A 1GJUA 4DN4H 3HPJA 4GW5B 3D48R 4YUEL 1OKEA 1Z9PA 2CRMA 1T20A 4CU8A 3MDJA 3GNMH 3L5IA 3ZDYB 4XPBH 1SPDA 3ULVF 2V17H 5D7LE 4RGOL 4KY1H 1M53A 1I31A 5CBAB 2QSTA 3A4EA 3EDFA 2JFCA 3ULUE 5JUEL 3WKNA 5C0NC 3QUXB 3H7LA 4PJ8C 5DVOA 1FH2A 3KGUA 1CDUA 2WUBL 1TNNA 4ISVB 1QUNB 3B3BA 3ZKNC 3LPWA 2ARWA 3ARDD 3II1A 2EEXA 5HYJB 3VWKA 1G9ML 4PY8J 1T7YA 2VNCA 3EUDA 1ZS2A 3X11A 1GRWA 1CE1L 4FQQB 4MNGB 4O00A 5F96H 5C3TA 2V4LA 4DP1X 3CC1A 5EZIL 4ANVA 3X12B 3FU3A 3QPQC 4AC2A 4HEMA 1RERA 2IDQA 4K9EC 4Q6KA 5AKVA 4PJXF 1HH6B 2GJ6B 2OPCA 1MCKA 4F8LA 2XA8H 5MENB 1EX0A 2XXGA 4Y4FB 1BJ1J 1KB5L 2JKXA 3R0NA 4WI5A 1XH2A 1JPFA 1BIIA 3DRTB 4OZFA 2ZKXA 5LNDA 3LQMA 5B8CC 2LE9A 4IHOB 4NZUL 3US1A 1QNZH 3UZQA 1OV8A 4OGAD 1INDH 2WQAA 3O6KL 4HFUH 2F8IA 4ALAL 1FE8L 1NDGB 3UTSA 3U6XS 5G5DA 1FJ1B 5FA3A 4X5QA 1MFEH 1M2VA 3EDDA 4JB9H 3ZYIA 2UWEB 2J8UE 2VDPB 4PJBA 1KB5A 1E7VA 1UD6A 2V7NB 1FPTL 1ZVSA 4YHML 3QRFM 4H2CA 2LOEA 3AREA 3GMRA 1P84K 3WIFA 2VDLB 1MEXL 1YY9C 3OMZA 1IM3A 2FBJL 4YLBA 3SODB 3U79A 1ZLWH 2E8ZA 3LPFA 4ZAKB 3IBEA 4GPVA 1QRNA 4CSSA 2VDMH 2RHEA 2C9AA 1IJNA 4LCIH 4UTBH 5E6SB 1ZLSL 3GPEA 3QQ3A 3BAEH 5E1IA 2PO6A 1DUYA 4Z7QF 4YAQB 1JE6A 2I7SA 3P3UA 1PG7X 3VE0A 1CZ8H 3MTXA 3U83A 2WB7A 1BBDL 2B9BA 3MLUH 1OSZB 5IK3A 2YO3A 5BZDB 4U33A 4YSDA 4LSDA 4JAMA 4ELMA 3QG6B 3BVNB 4XVJH 4C59B 2FIRT 1BXAA 3QDMA 1ASPA 4U7SA 2EZ0D 1LP9A 3L5HA 1ORSA 4N28A 1VERA 4J3VA 1IRAY 1OALA 3TEWA 1DE4B 3C8HA 4RH4A 2AQPA 4B3VA 2VR8A 5EIVA 4NQSB 2GJPA 3TC9A 2IIJA 3JTTB 4MAYD 2PMZA 2XZAH 2QKIA 5L4MA 3N44F 1NZRA 4XWGH 1F6AA 4WU7A 5HYJE 2H47C 2HRPH 2IDSA 4G80B 4YE4H 3MX0B 4MNGE 4DAGL 3HZYA 3T8XA 3EFDH 2ZXQA 5JLZB 2MFNA 1QO3A 3SOTA 2OV0A 5CGTA 5DK0B 4WU5B 4N2FA 5F9WB 2CNZA 2ZT9C 3ARFA 4PP1C 2YQGA 1NEUA 4XPFH 2BK8A 2ZP8A 3ARGA 4MDRA 4WI2A 4IJ3C 2W80C 1MIEL 2XWZA 3CLWA 4XCCL 4OCYH 2IMNA 3L3DB 4MSWB 4XVTH 4HD5A 1A9EA 4LSSH 1OF0A 3S4SA 4MCMA 5IOPA 1INEL 4JRLA 2L8AA 4ZX6A 1D9KB 2IWGA 1IGYB 3I3EA 1RURL 2DYPD 3SCMC 5ADOH 5AZ2H 3G6AB 3WG7B 2IBBA 3S2CA 4PPTA 4ZDHA 2W95A 5IUSA 3I6SA 4N2LA 3BZFA 5BXFB 4AI7A 4R97C 5CXPA 1UFGA 5HPMB 3D0LB 4HFWA 1JYXA 5H94B 3GIZH 3O6FB 3HG0A 4ICWA 1N2RB 1XSIA 5TE6L 4RMQA 3CFUA 3BUBA 4DQAA 3VRJA 4JVPA 1UM5L 1QTPA 3LV3A 1QSED 1AYRA 5D5ME 4Q74A 3HA0A 3Q6FA 4GOSA 1M05A 2FYVA 4O58L 4XCEB 5KYXB 3TT3L 5C0AA 3LH9A 4IU2B 5FWQA 1G7IA 2TRHA 3AB0C 2C7UB 3LRSB 4W9HC 2Y6SD 3UZVB 1N4XL 1QR1A 3LMJH 2FEEL 4U3SB 4KV5E 2FATH 2X6AA 3ZYJA 1WCQA 5DO8A 2VLKD 3T2QA 5D70H 4N9GB 4FN0A 4QRRB 4NO0D 3FSWA 2HP4A 4OCSL 2A6IA 43CAA 4DEPB 2FLMA 4ZTOH 4KJYA 2QQKL 2M83A 4Q6IB 4U1IB 4Q9QH 1MWAL 4ZTPL 4R96A 2OMYA 1AR1B 1OCWH 2XIIA 4HBQA 4P4KB 3AQZA 1WGVA 3DHUA 4YHYB 4FP8H 2CBTA 1AGCA 2VDQB 1X7TA 2VLLB 2VXTL 2WINB 3V10A 3KXFE 2HTKC 1NMAL 2Y07H 1LHZA 4IRJB 1OAXL 3C75A 2XKUA 1E9PB 4NKOA 2B59B 5BW7A 4NQVB 5GGRB 5L6YL 5K9KB 3QNZA 5HI4D 4HUNB 4IOFD 3ARPA 1KYOK 3PXLA 4XX1G 1CXFA 5K39B 5D96C 3LS4L 2P80A 5T1MA 4KI5F 5E7FA 5EU6E 1KG0A 2H32B 5I82A 4PG2C 1OLLA 3FUKA 4PW9A 3OQ3B 2Y7NA 3EOAB 4XGZA 1E9QB 5C09A 2XNAA 1Z9SA 2WAHA 43C9B 4GRLB 1T83A 2F8OA 4AGLA 4D7BA 3ZYZA 4BSVB 4N24A 1IBYA 2HUEA 3DX2A 2A2QT 1W91A 1PS3A 4UYPA 2JIXD 1X9RA 3D3VE 2FEEI 4JPVH 2FX7H 2JCCA 2XQYA 5IESH 1C9SA 1L9NA 4YBQC 1RZGB 3ULVE 2DMHA 3U36B 4B3EA 1NKOA 1GVIA 1R1CA 3BH9A 1SJEB 5GPRA 4P3DA 1UEYA 2EDJA 3DX4A 1HSBA 3MMEB 3X1EA 3N44B 3VFRB 5KVDL 3U30C 1U95A 2WLLA 3NAAH 3PFUA 5IKCB 1XF4B 1HNYA 2IDCA 3VJ6B 4L0PB 3DROA 1IAIH 1T04A 1IQWL 3HR5A 3SJVD 5AVVB 5HI5C 5DJAB 4R7VA 1JZ5A 2VZSA 3ECBB 3QARA 2ZWSA 3M7OA 3SOBL 5CJBA 3T0XA 5IGXH 2K45A 3VQLA 1VRSA 3S48A 3IMTA 2GJZB 4BM7A 3PS6A 1HQRB 3ZPDA 1CIUA 2IGFL 4HZLA 3H9SD 1QR4A 1SVBA 3CH8A 3GSRB 2F1EA 2TSAA 5L4IA 5MI0C 2DD8H 4OFVA 4XVSH 2JSFA 2IWEA 4WW2C 3MV11 3AU1B 3CFBA 1OARL 3QHZH 5GRVL 3VA6A 3TPUA 3O0RL 4QRRE 3RWGA 3E8VA 4ELKA 3ROLB 3HB3B 4Y9EA 5AB0A 2XV2A 2OP4L 1JPGA 4GG6F 2D4FA 3L9BA 5F1IB 2ATKA 3O3DB 3KPTA 2Y4SA 4DN4L 2HFFA 3ZT5A 1B0WA 1SHWA 4BH8B 4YXHH 5IP4A 1AC6A 5C70A 4BZ2L 2VM9A 4PBWD 3P4MA 3D85B 1FNLA 3PGDB 1RJLB 1YMHB 3QORB 1X7SA 2QEJA 2QFRA 4LHUD 1FORL 4QLRA 1KULA 1NFIB 4FXKA 2GCYA 2R0WH 2UY7B 4XMLH 1BYOA 2BSCA 5DD0L 5IR1A 1ZLVK 1ZLUH 1S5IH 2CZNA 4JG0H 5DEZA 2Y9RT 1P4LA 3FU5A 1TQUA 4OAWB 4PBXA 4Z7QE 2OA9A 1NOFA 3TCXA 4GT7A 3R0MA 2IPKA 2E27H 2Y7MA 5EF0A 4TKWA 1Q9LA 2BP8A 2EABA 5F96L 4JRYB 1J88A 4HWNA 1JOIA 2JXMA 3NCXA 3OLEA 3GB7B 2QDVA 1LEGB 4EI6B 1DTUA 1GSKA 4FQIL 4W4OA 2XA8L 4UAHA 4IBUA 2X1QA 2DQIH 1I7RA 2GIMA 4JFYA 4YX2H 4PRHD 5KYNA 5A1AA 3ESMA 2BIHA 4JDTH 4G72B 4JFHE 5DEGB 3V5DA 3QH3B 1MDAA 3F5WA 1QNZL 1NKRA 1AHMA 4WK2B 1INDL 2EXYD 2IXQA 1NBZA 1NM4A 2EO9A 2XKNB 3BT2H 4RDQG 4ZJ9A 4TXVB 3RIAK 5D1QC 2CD0A 4HOMA 2BM3A 3QI9D 4ZO8A 1TYJA 3O41A 4JB9L 5HHOB 1QHPA 4KDTC 3EYOA 3ARDA 4QOKE 2WLNA 3OZ9H 3BWUC 3DHMA 5ABZA 4NERA 4OD2B 1J9TA 3BAJA 1J9SA 3RWCB 3GBNL 4TNVK 5HTSA 1PJWA 3MBXH 3Q3GA 3V6OC 1FZOA 3BO8B 1CQKA 4OIIL 3L13A 2A6JA 2R1WB 5LBVA 2VDML 5KSUB 5LCVH 2IVFC 2DQJH 4ENED 4PJHA 4OF5A 3BAEL 1ITBB 3F7RA 1VENA 2BVTA 5GGTL 3HE7B 1MCDA 5BQ7B 2YAHA 1U93A 3BP4A 3ZE2F 1WLHA 2W9DL 1A5FH 4XVJL 4DFIA 2YSTA 3EOBA 2I9TA 1NGZA 2R4SH 1SDDA 3O45A 5FYKU 4HS3A 1NOAA 4PLOB 4XMPL 5TTRA 3ZT7A 1B3IA 4F27A 1LNUB 3QT2A 4PB9H 1J0KA 3EO1B 5GS2D 3I6KB 5B4MD 3GYRA 3TV3H 3MLXH 3NYKA 2D03H 2AI0H 1X9UA 2O61B 4XXDA 4UTBA 5ITFA 3ZUCA 4F8TA 3VWKC 4J4PD 2XZAL 3HFMH 4UV4L 3IFNL 3H4FA 3MQIA 3OKKB 4ZPTB 2DJMA 1MNUL 4LRIA 1KXHA 4ZW6A 2LQRA 1HX0A 4LNVA 5GS2H 3LH2H 3WDIA 4KMTH 4EDXA 1GS6X 4YSEA 4YE4L 4Y5VA 3TNMB 3UJJH 5AG8A 3H54A 4JRYE 4ONGH 1YHPA 3BGFB 2R2BA 3EFDL 4D3CH 3FUFA 3MI6A 1EO5A 4D9LL 2XPZA 3FUIA 3O3UN 2J5WA 4F1ZA 3LXCA 1XR9A 4HPYL 5C9JA 3BRGC 2I60H 2VRKA 4CJ0A 1OGPA 1X5XA 4XPFL 3REWA 4FZEH 2CQVA 3NACH 4LP4A 4AUYA 1J9CT 1QNIA 2A83A 5PAZA 2FECL 4TNWF 3S3PA 4OCYL 4F7MB 5E8OB 4XVTL 1T1XB 2VM3A 3MJ6A 4LSSL 2EDOA 2QMKA 4GG6B 5F21B 3G08A 1NCUA 2VDNB 4G42B 5FW6A 4ZXBC 3QPXL 1MJJA 2BS9A 1HSAA 1RULH 2H9GB 5DQDL 5AZ2L 1RK0A 2ICCA 1UXMA 3TNNA 3CFQA 2EDEA 3AREC 5B3NA 4NNXA 3UROR 1NCCH 3WEXB 4S1SL 5FKPA 5GJTH 3ULAB 4DETA 1F42A 4U6TA 2AW2A 1TFHA 3GIZL 3FB6B 4QRPD 3GJFB 2UYLA 5KBMA 1TYEB 3QAQA 4R26H 3TBTB 1ZHKB 1COBA 4YL4A 4ZPVA 5IHZB 4DVRL 4BQ8A 1JZIA 3EYSL 3K74B 3PAUA 2OSXA 2RD0A 3CVBA 4KI5E 5GGSB 3HE6B 5TK2A 2XOTA 1MW0A 4XI5C 4OZGF 5HD8C 3FTZA 1F18A 4QCIA 5KW9H 2HJKA 4P2OA 1BPVA 4WW1B 4Y2OA 3D0VB 2AEOA 5FUCC 4PRPB 4Q9BA 4HJUA 4Y4HD 3UX9B 4L37B 3Q5YA 4LQ1A 2EDWA 2V5TA 3FT3B 1W0YT 2OR9L 2UZXA 4G9FB 1D6EA 5KYWB 2Q9OA 2DYPA 4KO5A 3FQ4A 2FATL 2XA3A 4NT6B 1BV8A 2YGQA 4G8FB 5KSBB 2QKIC 3IFLH 1XGZA 3GHEH 1JYNA 1LE9B 1GOHA 1JGUH 1ZHLA 1UXWB 3MFGB 4ZTOL 1UUSA 3IXAB 5ESQB 1XZ0B 3QB7C 4HKXA 4M5ZH 2WOBA 3IRCA 3L7EA 4PY7A 4BINA 4Q9QL 4FFWD 1R24A 3FN0H 1G7HA 1OCWL 5EHFA 3EO9L 3BAXA 3FYEB 4Z5RB 4OZHF 4OZIA 1MHHB 4FP8L 4PJIA 4Z7NF 2ITDA 3A21A 3LN4A 1HWHB 2AEWA 2Y07L 3ARFC 1A3RL 1QSEA 3BPLB 2Z7ZA 3NK4A 3THMH 4TSBH 2VMCA 3SE6A 1FRGH 2Z6FA 2QPSA 3ZTNH 5ENWA 2ZYHA 1X9LA 3DARA 3FSAA 3FNKA 4BGLA 3DUUA 1PZAA 2EE3A 5T3XE 3GSNH 3DVGB 1MUJB 3QWOA 1U8NA 5JA9A 4GG6E 3QFDA 3DX9A 2VLKA 3G5XB 4NFBA 2OJZH 3NN8A 1G7PB 4E9RA 3P4NB 4NO0A 3ZE2B 2XHNA 1JVKA 1IGTB 1JV2B 1YQ2A 4JGUA 5HYFA 1AQMA 4JPVL 3C6LD 2R29L 4FXGA 5IESL 2YARA 1GSMA 4IRZL 1K85A 1NDMA 4BKLB 1XV8A 3H2PA 1AO7B 2KLSA 3BJLA 3NPZB 3Q0HA 3FRPA 3RVUC 1KTKE 2YC1B 3KPSE 3CXDH 4KJQC 5IEHB 3UDWC 3TZVB 3QHTC 4NC1E 4A68A 1U21A 5J1AA 2KZWA 1RJZB 4I1PA 3JWNE 5AFAA 2O5XH 1ES0A 1JD9A 1ONQB 1IAIL 3FFDA 3A0OA 1SFHA 1IBFA 2QSCH 3AUWB 3M88A 3G5ZA 4QTIH 4D0DA 1ZEAH 4LDOB 5HHVL 1WZKA 2X6CA 1KENH 2CR6A 1CFSA 4HJIA 5J11C 1UA7A 5IGXL 1RUPL 4M6ML 3GMNA 1HZLA 3TH4T 4G9FE 2D3LA 1Y6MR 5EO9A 4OU3A 1ZGLA 4HK3J 4I5BB 4RSVA 3QYMA 3N50A 2JIXA 4F2ME 2ARJA 4NUGL 5SWZB 2NCEA 3BPNB 3DBXB 1JBJA 1PLCA 4NPYB 2LFEA 4GNKB 4JE4B 4AVKA 4P06A 2G2PA 5AUMA 2IBZX 3TPKA 3NFPA 3M1BA 2CK0H 2WLKA 1N68A 3A24A 1GR7A 3AVEA 2CO2A 2R0ZH 2BNRD 5BW7C 3DV6B 1T0MA 5T5FH 5AOMA 2BVOB 4NJ9H 3ZR5A 2PPAA 1DYZA 2QQQA 3AXIA 5H35B 1UVQB 3P4OB 1ND0A 2OI9B 4WV1A 3SJVA 1C16B 3CK0H 5GGVL 3IF1B 2R0WL 4XMLL 3FH8A 4O5LL 4WO4A 1S5IL 4JG0L 2WZ0A 1CFQB 1KPUA 1L9TA 2XZZA 1JZ8A 3SDYH 1QD0A 2B5IB 3AWGA 3HPLA 4HGWA 1ML0A 4OZGB 2H3KA 4XNMA 1QAWA 4EI5B 1J8HE 1IAII 4I13B 1JVLA 5B1CA 2AVGA 4J3SA 3ZE2E 4R2GC 1CDYA 2DL2A 1KNOA 1BF8A 1A4JB 1AGBA 3AITA 3UTPE 1LK2A 1T5XA 5D1ZD 3LKQA 1NBVH 5TDPA 1A9VA 1KIRB 3OAZH 2XUWA 2ZX5A 4ZMYA 1S7SB 2YSSB 2DQIL 1K2DA 3BIAX 3S3SA 3L54A 2EADA 3QIUD 4YX2L 1RJYB 2WLJA 3LKNA 5CGBA 3FT0A 4JDTL 1EMTL 4U6HB 3QDAA 3D39E 3MRIA 3RFZB 1GGBL 4G8IB 3WS3A 5CM1A 3HHRB 3MCKB 4LHUA 2V5YA 3BLKA 3B1UA 3VVVA 5D7JC 2AXFA 2LW3A 3NJFA 5EOTB 3O2DH 4RGNC 1N5AB 4E41E 3TJHD 2J21A 5I5IA 1B9ZA 2YPLB 4ZNEA 5CKAA 2XTJC 3V4VH 2ZCLL 3ZDZB 2BHYA 5I9QB 1UZ8A 3CBRA 4H8UA 3WNJA 3RWFB 1EAOA 3DX6A 1LO4H 1JWMB 3EW3B 1I8IB 4KFZC 3E3QE 3NTCL 4ZQKB 5F7YC 1YZZA 4G6AD 5CD5D 3MNMA 1TTRA 3IDJA 1SJXA 5CEZD 5ITBH 4KWUA 5AW4B 4PRHA 3T4AA 3HNSL 2BXZA 3IWUA 3V8CA 1ZHNA 2OJ1A 2WQVA 2YEVB 5DD5H 4BE6A 2R4SL 3K46A 3N1PC 4KZEH 4YSUA 1DN2A 1Y0LA 5AW6B 3KLAA 2DI9A 2ZWNA 3PDDA 4QJ3B 2BVPA 4PB9L 5AB2A 5JIMA 3TV3L 3AUVA 5CEZH 3QI9A 4AYSA 3IDUA 3QK0A 3MLXL 4FL4C 2D03L 2AI0L 3ILPA 4Z78B 5LCVA 3C2AH 4L23A 5FYJE 1VCAA 4F57H 4FQLH 4JO2H 1GPOH 3MXWL 3CN4A 1P4IL 1DP0A 2C1PB 3KPRB 1W0WB 2EYTA 5HI3D 5JPNB 1JNJA 2COQA 1N0LB 1OZTG 5EUOA 1XGPB 4OZGE 1AE6H 2E9IA 2KUTA 1AS7A 3L1OL 3P02A 3BKYH 4J3UA 1NFDA 3LH2L 4CVZA 4KMTL 4NP4L 4X7DC 5F3HB 4EQ3A 1KXTB 3FQRA 1ZANH 3IEAA 2F53D 4JG5A 4GXVH 4K7PL 4W4OC 4D3CL 2QVKA 1EO8H 1CFVH 1Q0YL 1T1YB 2D3JA 1XEUA 3AT8A 4JFEB 1WFMA 3SKMB 3WHXB 3ZY7A 3S9DB 5D72L 2JELH 4YO0A 4IU3B 2I9LA 4PHZA 3BH4A 2I60L 3QJZA 2N56A 3HN5A 3QC6X 4FZEL 4H0HB 2NZIA 3NACL 3ZTDC 2EUXA 4KVCL 5GZOC 1IC0A 3ZL2A 5E1AB 3W5MA 4G8GA 4NWTH 4KZCA 3IJ8A 3W9EB 2BCKA 4NNPH 3VFMB 3OGCA 1Z32X 4N85A 3C5ZC 4I85A 4GW4A 4Y9CA 4RETB 4MYPA 4OZHE 5TPWH 2ICEB 4I2XA 1SF3A 4J4PA 5AZEH 2Y7QA 2YBGA 1CPUA 3D18B 4UIMA 5DURD 4KK8C 4XMZA 2WAQA 3BN9D 1V3KA 3ZBMA 1NCCL 3MJ7A 5ABDE 1Q90A 5FGCB 5GJTL 5ALCH 3L08A 3IJSA 1AIFA 4YHOH 3ZHDA 5EN2A 4PJEF 3K2MC 2K3HA 4R26L 1BG9A 2DQTH 4LAQH 4I77L 3Q1SH 1CICB 4AYEC 5HYSA 3HKFA 3EOYG 4JQXA 3S8WA 3EG9A 1S7WA 3E8UH 2DKSA 1VEPA 3QHFL 4JZOB 3J07A 3MRFB 4OGAC 1GXEA 3ZHNA 3RX5A 4OV5A 2KZKA 3CVIH 1MW3A 2XZQH 4N0UE 2B7DT 2CAKA 4FYSA 5JNYA 5GRXG 5EZLA 4FQCH 2EO7A 4N5UA 4XO3A 2EO1A 4RNRA 2MQ0A 4UT7H 4CVWA 3UPRA 1A25A 4F3FA 1OK8A 2K7QA 3IFLL 3UG3A 3B9KD 4LRIC 3MV7B 2ZX9A 1WF5A 3FO1A 4MJJA 1TMQA 2E74C 3K4ZA 3WCYA 4QRQA 3KPRE 3VH8A 3IFPB 4M5ZL 4JDVA 4QRPA 1E8ZA 3QXUA 3BYTA 1LO0H 1UWXK 1CLZL 2XVGA 3L4UA 5CILL 1U8JA 1UUNA 4G43A 5F8RC 3ZRSA 3GTVA 3JTBA 2IQAA 1WA0X 1TOXA 3CVCA 4PRDB 4RWYH 1IEBA 4HYTB 3LEXA 1V54B 1FI8C 2GTWA 1KUMA 2ZXAA 3MLRL 4A2LA 3T2NH 5J56B 1MJUH 3WE1A 4HUXA 4TSBL 4G7YH 4Z7UA 1SM3H 3U4KA 3D69A 4LHUG 1TITA 2EZ0C 1FRGL 1JTTA 3KH4A 3WFEH 1FZMB 3VYOA 2V3DA 4Y4HA 1UASA 2AF2A 1IB5A 5TDOB 1DQLH 2HJLB 4R7NA 1BMWA 3N91A 2Y72A 1FZKA 2X6BA 4I9XA 3VFSA 2VB5A 5KVFH 5EG6C 3P0YL 5GS1C 2DEYX 2TSBA 2AKRA 2OJZL 5T3ZD 3HS0B 5L8KB 2AV1B 3ZSSA 5IQOA 1YSOA 1K3ZA 3N1MC 1RY7B 3CDFA 2Y5TA 1S9KC 4JO8A 4IEFB 2DTMH 1N5YH 3SPVB 5H8DA 4H8WH 5FGCE 4AGNA 3IKCB 1KGCE 2R2HA 1IGCL 4E9QA 4EUPH 1N6QL 5T3ZH 3KJ4C 5AAMA 1O9VA 2P5WD 5D8JL 3GSNA 1SLVA 1DQML 1UH4A 1VGKB 2IALA 2WWMD 4LDLB 3EJTA 1MJ7L 2CGYA 3CXDL 1YPZF 4P2OC 1E4XH 1U8CB 5CU5A 4WUKH 1JK9A 4YIQA 1KJVA 1EDQA 4AQ8C 1R9FA 4H4NA 3CFDB 2O5XL 1U4FA 2QSCL 4Z77A 1SN2A 3OKYA 3MGOA 3KM2A 4MXWH 4NQEE 2WZPD 2EKSA 4PEEA 1AD0B 2QKSA 1E4JA 3PABA 1E5ZA 1PFCA 5CEYA 4PGEA 4LLVB 1HHGA 5DWUH 4LF3A 4ODSH 3TGXA 3UYPB 3BSHA 3CDZA 4FFTA 5EBMA 3S5LB 3O9WD 3EHBC 3C6LA 3PYCA 2OTPA 4KKLD 5AW9B 1K6QH 3MV7E 5C7XH 4G1MB 1GC1H 4K3EH 2NYKA 3C5JA 4YHKL 1NCTA 3RUGA 2FBOJ 2Q20A 1TT6A 2CK0L 5J13C 4BQBA 5FB8B 2HX8A 1AXTL 3LZFH 5LNEA 1U91A 3S36X 4UAOC 3H42H 2J2ZB 1A1OA 3D2UB 2P8MA 5HGAA 3AXLA 5T5FL 4NJ9L 4W4NA 2PTUA 4CMHC 4ABUA 3VFNB 3GXNA 3KBPA 2EJ1A 1BZEA 1JNHA 4APQC 4K7PY 2I07B 4LLYB 1PTZA 1FNEA 2R0KL 4DJMA 3CK0L 5K59F 3LH8A 2VAAB 1ZCRA 1FVDA 1G6VK 2J88H 3ROOB 5GS0C 1D9KD 2WYTA 3IFOA 4PV8B 4A37A 1EEZB 4F7EA 3OR6B 2MCPH 4AEIL 5FV2A 1WIOA 2W0LA 1FNSH 5D6CA 5ISZD 1VFBA 4PJGA 1P5VB 3BFOA 1FCGA 1LTXA 1JZ4A 5CCKH 1M6OB 3PHOB 3QO0B 4GEJA 4MMXC 5T5FA 4EF3A 4FXGC 4K3DH 4ADIA 3VI3A 3B6SA 3KL0A 5EULV 4OLXH 1M7UA 4K2UH 2FHBA 4CAGA 3KLHC 1J5OL 3VI4A 1NEZA 1GZQA 1B4JH 2HG5A 4BFBD 2ADJA 3TN0D 3QVAA 4P46B 4R6UA 2I85A 3LCYA 5DMJB 2LAGB 4EPSA 5JOPD 5FCUH 4GI6A 2MNJB 2BNRA 5JXED 5EBLB 5JQ6H 1SQMA 2FJHA 2Q87A 2P42B 3CSYA 1NAKH 3L5XL 4XPGH 1FGNH 3ZL4H 1BQKA 3HRPA 4M1DH 4TLSA 4B9CA 3O2DL 3QEUB 4CVXA 5I75B 5EA0H 4DZ8B 2QVIA 2HFEB 4DKTA 1CFMA 2KBGA 4R4BB 2VZ1A 3TL5A 2CMRH 1DDHB 2R4RH 3V4VL 3JBG7 2ZAGA 2XZCL 1RUQH 2BP3A 2PCXA 3VH8G 1ZPLA 1PDKA 2ZOKA 3MC0A 5EF3A 1LO4L 2AJUH 3FHEA 3WKML 2BSDA 3LAFA 5FHBH 4AE0A 4K94H 3IDNB 4ZS6D 3T0VA 2IAMD 4N2AA 1HL9A 1VACB 2FVNA 2XJLA 2IPUK 4P4KD 2DI8A 3Q8EA 2ZF9A 3CU1A 1S5HB 3O2DA 2Q8BH 4AJVA 5J6GB 4GSRA 1JK8A 3FCTB 2DH2A 5DR5L 3QIUA 3RWJA 1IAMA 4HA1A 4HMDA 1M2OA 4PJ5D 3EF7A 3CFEA 3E6FB 4JFSA 3V4VA 2D2CC 4EBQL 1HCFX 1J0IA 4LEBA 3BUYA 4XNUL 1DQDL 4DGYH 4FTVB 4KZEL 4HUUB 1L4IA 1NCDL 3P9MA 4WO4C 2H2PC 4EE2A 4PJEE 4JFUA 1ED3A 3C2AL 3W2DH 1WFUA 3H7BA 4KBPA 2OQJB 3BD4A 3RGVB 4JO2L 1GPOL 1KBVA 5FR3A 1I8MB 3KCPA 4H1LH 3ZE1F 5D1ZI 4L9LC 4EO5A 4XP9H 1OP5H 5AW3B 2CRZA 3RPIB 2JK5B 1X5IA 3BH8A 4OI7A 1FN4B 1HCVA 4JR9L 3U4BL 4GO8A 7TAAA 5EZJB 1BLNB 2H32H 2DJ4A 2ICWB 1ZANL 3AG4B 2Z7YA 4XE0A 4X42A 2EVIA 1KB3A 1DVFB 2BSBA 1EO8L 4HKJB 5HJ3B 4FFVD 4M4PA 1OM9A 3ASNB 2CA3A 2OMZB 2JELL 3K6OA 4OD3H 1YUHB 1BOGA 2EIJB 3HG2A 3EBAA 1PZBA 3NEXA 3F12B 1XEDA 3JXAA 4WWKB 4WRLA 4MZRA 4XZ4A 3VFOA 5L2KE 1U8HA 3TA3B 4HZAA 1BF2A 4RIRA 4XRCA 4WFGD 3ZT6A 1EFXD 1M3JA 4M8RA 3X1NA 4NNPL 3V52H 3T6ZA 3GI8H 3TVMA 4FXTA 4RQQA 2KQMA 2LT9A 4PD4K 5AW2B 5GJSL 5F1NB 5TPWL 5CUSL 4F8PA 5IJKA 1MRCL 3LX9A 5AZEL 3B9VA 1JG9A 4QYOA 5F9DC 2Q1EA 5F70A 5HHPA 3LQZB 3OX8B 5HSFA 2Y22A 4RAVB 1YG9A 4X6BB 2X4UA 3FSZA 5IBUB 1FYTB 2DQEH 4XXWC 4ETQB 1J9QA 2AEQH 4YHOL 1XMEB 3VFVA 1A6ZB 4IBWA 1M7IB 4PGDB 1THAA 1NPJA 3FH7A 3LSOA 4FI7A 5EC1B 4LAQL 2CA4A 1LE5A 4OY9A 4PJ9C 2ZOLA 3Q1SL 4D7PA 4JRXD 3AG3B 1XCTA 4FOMA 3BDYH 3DUHA 5E8DL 3BDXA 1XXFC 4YFLI 4HVBA 2VRQA 3B5GA 2X9XA 4XNBA 3AM8A 3RNKA 2WNKA 5L2JB 1M71B 1HINL 1MLCB 4U31A 3QEQD 4XT1C 5JDSA 3D85D 3CVIL 1ZTXL 2XDHA 3QI9C 3KPQA 3UPAA 2BZCA 1DBAH 3WBDA 1QBLH 4RESB 1ZVNA 3UBXB 3HCVA 4PW4A 1SY6H 3UAJC 4F37F 4NHCH 3TURA 4BZ1L 5SX5K 4MAUH 4QF1B 4R5XA 1KCUH 5BNXD 1HCYA 3IVKA 4FFZH 2WLIB 4MNQD 1I1AB 1CF8H 2R1YA 3GMOA 3T4YA 3BOVA 2E56A 1YPZE 4HIHB 4K8RD 3WN5C 2AJVL 4Y16C 3WNPA 4L4VB 4J28A 4HIEA 1SRDA 3ARBB 2NY1C 5EOQH 5LBGA 4NO2A 3OBAA 4HIIA 1A3ZA 5DD3L 4RCAA 1BMGA 2XG5A 1LXMA 5IBLC 2WHVA 3BZ5A 1ZLEA 4YVUA 2JKWA 2DLIA 5E2WH 1WDAA 2K1MA 2NNFA 4RZKA 1MJUL 4GW5A 1QWUA 5LAXB 5E6UB 1J5IA 2JLLA 1ZHBA 5H37H 1QBML 3SQBB 3FFCD 2WXMA 2G0LA 1I85C 2VDOB 4LSPL 2NSQA 4B9JA 2ADIA 5B4MC 3OC5A 4OVVA 2JB5L 3SDXF 4OFKA 3MLSH 2VE6A 5IMLA 3W9DB 2PTTA 2EEDA 5KVFL 4M56A 1I4FA 1RZIB 2VABA 1NPUA 3TYGH 3WO4B 4M62H 1NUNB 3B9KA 3MLWL 3SDCD 4RBPH 4WFHD 2A9CA 2D7TH 2HVJA 3GSOB 2CKBB 4FQQA 2NDFA 2DTML 5K1NA 1Z0MA 4FQHB 3ARYA 1UD3A 3X12A 1ET8A 2HKFH 4A6YH 6FABL 3NJHA 3MHZA 4WGWB 4X6CA 2EP6A 1MW2A 4GH7B 3SQOH 5T3ZL 5K59E 2QPFA 4JQXC 3OTTA 3Q8FA 4AIXA 1NGYB 3APFA 5BUAA 2XWJB 1G1CA 2DKUA 4X6EA 2GBAA 5JQHC 5KSAB 3UTTD 2GK0B 2QVTA 3NABH 3KCWA 3U0WL 3HMWL 3IDIB 1ZWIB 2B4CL 5KBDA 1BAFL 4X9FA 2OTUB 2R7EB 5AB1A 4LPTA 3AS2A 4JKWA 4WTXA 1EAQA 1NDGA 4L8SB 1O9ZA 3MU3A 3QRBA 4KXBA 3KPOB 2AJ3A 3L1FA 2IJ0C 2NY3D 4EUPA 3BQUC 1DSFH 1IGIH 1OTSD 1UADC 2DB8A 2UWEA 2Z91A 3CC5B 2LU5A 3LIUA 4KX9A 3RG1C 3IMBA 2MQCA 2V7NA 5DWUL 5I76B 1DBML 1MSPA 2QVFB 4ODSL 1NMBL 2GAZB 1GZHA 5E6IC 1MI5E 1BOYA 1K6QL 4FD0A 4MQXD 4QRBA 5LGYA 3VNYA 4V1DD 5I1GH 5L7XH 3AXHA 4OZ4A 4PLKC 4ONFH 2B8OT 1JZ2A 1PG7W 2FX8H 3QAZC 2CHDA 4IK6A 5I74C 1JD7A 4DVBB 1A6VH 2P5WA 4YHLH 2A4CA 3LZFL 2X1PA 3OKDB 4YAQA 2R2EB 4DO5A 3DBSA 1YNKH 3H42L 5FKAB 1SXZA 1WHOA 2R39A 2JI2A 3QE5A 1CYGA 3UTZB 1XF2A 1UWFA 3QG6A 1A4AA 1T2QH 1NCGA 2WXNA 2K3TA 1DLFL 5IWLA 1VADB 1VA9A 1UG9A 4OFQA 1X4YA 2WZPA 5K69A 4LLDA 5I1CH 4PFEA 1HI6B 3ZX1A 2VLRD 2Y2YA 2ADFH 3DPBA 4NQSA 5F2FA 3M46A 5I73C 1HQ4A 2E9WA 2Q7AA 2XPGB 4CVUA 2BO0A 1BAGA 2W0KA 3O9WA 1WT5C 2IDFA 5TQ0H 3TBVA 4AQEA 4FFWC 5AD0A 2A9AA 5DRNB 1TLMA 2C3WA 4K2UL 4KTEH 4X9IA 2COVD 1B4JL 4GRMB 5AAMC 3OSVA 1CDBA 2J1XA 2VITB 4EDWH 1ODAA 1G9NH 4AIZB 3V8OA 5DK0A 4AG4L 3VXSE 3TO4D 1KT2B 1QLRA 2Q7NA 2ZXDA 5A6MA 3L7FB 3ZE1E 4PI2A 4YGVA 2DWXA 1NAKL 5I8EA 3HIZA 1UT9A 5IW6A 1RIHH 1JNNH 3QFGA 3ZE0F 5HVHB 4ES8A 2OXHB 3ZL4L 4M1DL 2NNAA 5IM7A 4I87A 4MD0A 4CBZA 1UURA 5EA0L 1D9KA 1NIDA 2C3VA 4LSVL 1K8IA 3B2PA 3SN6N 3GJEB 2P52A 5LJYH 1KXVA 1R3JB 2R4RL 4JFQB 4DPRA 1UOKA 1A65A 4AEFA 3G6AA 5ISZA 2Z92A 4L3CA 1RUQL 5K9OA 3LZLA 1MFUA 1F3DH 2BIMA 1FHNA 5TK4A 5BXFA 1SNRA 3HC0B 4K3HA 2VN3A 3D0LA 4FJ6A 5FHBL 5H94A 4QWWD 3O6FA 4IJTA 5KJ4A 4UTAH 1GOFA 2ENJA 4XN7A 5C07D 2NY6C 3TN0A 4NUQA 4IRSC 4GQRA 1KJ2B 1QZNA 4XBMA 1NA8A 3CCHA 4YHZH 5D7IF 4L3EB 3N43B 3LXAA 4S0TD 5JXEA 3CIQA 3PHSA 2YEZB 1W9XA 4XCEA 5FF6A 2HUHA 2DIEA 3MRGA 2ZWYA 1UA6H 2ENYA 3L9EA 1CI3M 1CR9H 5HYIA 4TQ8A 3S36L 1KLGB 1BSIA 4UQBA 2CUIA 4MA8L 1MCQA 5I1JH 5C0BD 2GIYA 1E42A 3QUYC 4U3SA 2G0KA 1U8QB 2E7CA 3AWFA 3EBHA 1FA4A 3TEXA 5I0XA 4NUMA 5C1MB 3I02B 5F9JA 3O2WH 4XP9L 1SN5A 3NQKA 4TVPL 1SJHB 2M26A 1W72B 3CSTA 3ZKMC 2CHZA 1BDYA 3MUY1 4OCXH 2AQQA 4JJ5B 4U1IA 2IAMA 2EDNA 2BSRA 4PRNB 4Q97A 3VXUD 5ETUA 3TS8A 4P4KA 2P24B 4UUJB 2VLJB 3HAEG 1B9KA 2BP5M 2DWDA 4I9WD 4KVNH 3N42F 4J3TA 4XCFH 4CNIA 1F4XH 2QADC 1OB1A 2YUVA 3UGXA 4G71B 3WYRA 5JR1H 3B7SA 1E5BA 2PW1B 3MRMB 3EYQC 4JZNA 4LKCA 1D3CA 3MJGX 4YSTA 5F7AA 4MQSB 4U6VH 4WLCA 3F6JA 3JT0A 1E9PA 1XL6A 2B59A 2YPKB 4H1LA 1TQCC 3TZVD 3BUQA 1DN0A 4GXUN 3CLFH 4B53A 1PCXA 5DT1H 5K9KA 5C8JB 2KC0A 1T22A 1XT5A 4Z0BH 4DCQB 4UINL 4LE8A 3RVVD 4NBYB 4PV1C 1KBGL 5KVEH 5J3HD 3NSCA 4XOEA 4EUPG 3V52L 2H32A 1OTTD 1GCYA 3EOAA 1W8EA 3N85H 1IGFL 1CXKA 1Z7JA 2F08A 5ALBH 2ZYSA 4EEEA 3IGLA 2DJSA 4M43L 1DFBH 3U9PH 2A7BA 2Z93A 3EDEA 4RGMC 1OAZH 4L1TA 4JHAH 4M48H 2K7PA 4WY7H 1A1NA 1R34A 4WI6A 1OAUL 3MBEB 5DFVD 4N86A 4LOEA 4ZFFA 2GBTA 4LMQE 4BCYA 2BCMA 4HF5H 4LARH 3GWJA 4U3HA 2DV6A 3BXNB 3VFUA 3SDXE 3R06B 2ZG1A 1JPSH 2PWEA 4X9HA 1IMHC 1O7VA 3BDYL 4NCC2 4GBXD 5TDNA 3RY4A 3T1FB 2XFXB 4HJGA 1GHFH 3U7AA 1OAKL 1NGWB 3VFRA 4EIUA 1GMEA 1Q8MA 2ESVE 2Q76B 2PNDA 1TFPA 5F0PB 3DMMD 1KCSH 3MBWA 4IMKA 4L4TE 1EDYA 5J57B 2ZYIA 2O93L 1EFXA 4LBEB 3HMXH 4N8CH 4LCCA 4X6DB 1DBAL 2XVBA 2RQ8A 3FTYA 3IAPA 3MNVA 4K5LA 4OM1H 3ECBA 4KKAC 3W0WE 3GS0A 1SY6L 2EH8H 3QWRD 2O5ZH 4NHCL 1KLFB 1PYWB 4MAUL 3B9EA 1HQRA 1KCUL 4FFZL 5KUMA 4ZX5A 3U48A 2BNQE 4KX7A 4FTDA 3QDJD 32C2B 2VXSH 3K1KC 5E51A 5D71H 1BZQK 3BAWA 4BA8A 1BEXA 4LT7A 5FYLE 2B14A 3D25A 1L7IH 5EOQL 5IB4B 3DX7A 4JMNA 3VXRE 5FHAH 3WFHB 4JRXA 4DZBA 3V2AR 4M1GH 4DK6A 3MV8D 1DQJB 2QHRH 2VLJE 4BFNA 5I0VA 4W9ZA 1SY6A 3NJMA 4YC2C 3RHWK 4K8RL 2IQ9H 2AK1H 5FUOH 1DQIA 3MRRA 1IKNA 4KPHH 2XVKA 3QEQA 1MCEA 4JGMA 1IAIM 3D85A 3PGDA 4FFZA 4JKPH 4TF4A 3PPSA 1RJLA 1H3PH 1YMHA 3TH3T 4Y1AD 4HBCH 1YO4A 5E9DE 3L3OC 1RUMH 3MLSL 3OKMB 4BH7A 3TVMC 4FAAB 2QSQA 3P30L 4Z7OB 2JI1A 1A7NH 2J8OA 3RX7A 2AZAA 5IJKC 5D7IB 4XN4A 5SWQA 3TYGL 5GIRB 5AALA 4PCTA 1RZPA 3US0A 4J8RB 4UZUA 1HOCA 4RFEA 3FSVA 4MNQA 4KVPA 3BD5A 4CUCA 4TSCH 4WW2F 1MCJA 1L9QA 2PCYA 3QCVH 1T1WB 4AQAA 2W9LA 5H37A 2FWSA 2GUOA 2HKFL 4A6YL 1S3RA 3KLSA 3FOLB 3VGAB 3OHXB 2DIJA 2NW3B 3EDJA 1JCVA 2YHGA 4Q0XH 3BISA 4X4MA 5ID0B 1S7UA 2V9UA 5CD3A 1D5RA 1PW3A 2WXIA 2UVEA 1GTFA 4NQCB 2ROXA 3VW3L 2R9HC 4KROD 4HX1A 1XCWA 3HBZA 3MLVH 2HLFC 1KJ3H 3S3JA 4R97B 5DEGA 3FFCA 3QH3A 4DPCX 3OAZK 3PNWB 1F6FB 2R1XB 2ZKHH 4RAUA 2C26A 2HT4D 5E8NA 4WJ5B 5DHYA 2Q3XA 4JFDE 1GGIL 1WK0A 3D5OF 4A6YA 5F6IB 1IAKA 3RQ3A 4ZMLA 2P5EB 3LZQA 1IGIL 3Q13A 2F18A 3BN9C 1OOAA 4B50A 3NCFB 4NQXB 2NQDA 1NGXB 1HESA 3RWCA 1EJ6A 3CDCA 1CDCA 1URLA 4BFOA 4RISH 1G1OA 3ZE0E 4FRWA 4XAKE 4J1UB 5D4JA 1P1ZA 3BIBX 2H3NB 2ZZUT 1YEJH 4L8BA 3S6CA 3WJLC 3AS3A 1N7ML 1KLUA 4YHLL 3H85A 1SEQH 2MOVA 2K9UA 3HE7A 4H1LG 1ZIAA 3TWCH 4HSAC 3MKKA 5BMFH 4NRZB 1OT2A 4MMZA 4JFWA 4DW2L 4O2FB 1L0XA 5CGMA 1FBIH 3MVSA 1KC5H 2J6EH 4HG4J 5FFLA 4IKNA 1E5YA 5H4YA 3LS5H 2AV7A 3EJRA 3DIDA 1UJ3A 3FOMB 4Z7VA 1LNUA 5E4EB 3EO1A 3POCA 3QXVA 3FUMA 4U1SA 4JK0D 1N8ZA 3U1QA 3J8F7 4PREA 4K71C 5KYYB 4PI0A 1MZYA 5I66B 4U3XA 4TUOB 4YFDB 2HKHL 2VZVA 2MOQA 3D4GA 5D7IE 1VGEL 3RWHA 2NY4B 4ZPTA 4P3CL 2QMJA 1X9QA 5J6HB 4V1DA 4PUBL 5D96B 4MYWB 4B9YA 3EFFA 4P8QA 5GRUH 1SN0A 2DKMA 4QNPF 3UH8A 5J1TC 5HXMA 3GM0A 3HZKB 2LLGA 1WUNT 1F00I 4X4YB 2AITA 1C8PA 3UYRL 1VLXA 3B7TA 2FO4B 2PCPB 5MP6L 1FSKB 2E9JA 2H1LM 4DQOL 3CX5K 4LEOA 4XH2A 5F9AC 1OAYH 1JNNL 4NQCE 3REVA 4U1LB 3PFQA 4G1EA 4F7MA 1T1XA 3I6GA 3MNZB 1NLDH 2ZQKA 3P1VA 2VSMB 4H8WC 2PWDA 5T1DH 5DMGC 1N64H 3VO0A 4CSTA 5JW5A 2VLRA 3KEHA 2YXWA 1KY7A 2WO2B 4YDLB 2V8LA 3Q2VA 2A6DB 2VO5A 1WA2X 5MEPA 3WMSA 3FW6A 1OW0C 1OD9A 4WFEE 1HNFA 2X87A 5LN8A 1M4KA 3BJ91 1BJ8A 5I1KL 4NYLB 1LL1A 2P5PA 4UTAL 1MHEB 1L5GA 1X4XA 5D6DA 5DRZB 3TBTA 3WNKA 3AJ7A 3WTXA 5DGQA 2EIZA 1FH5H 2WWMC 3VAEA 2DZEA 2WJ7A 3T3MF 5JW4N 1MVUB 2WD0A 4YHZL 3TO4A 3OV6A 1WAAF 2P26A 5EUKB 3NDYE 4U4BA 2WLYA 1D7BA 2Z35B 4WGKA 2JKTM 5B1JA 3FCSB 4HWZA 5C2UB 1Z3RA 5IMMB 3C8KB 1A21A 3D0VA 4O2CB 5IWLC 4UQ3B 1CR9L 3SHSA 2VDKB 1C12B 4IIQA 4O02L 4HHGA 4X4XB 2WBJD 3FT3A 1GC1C 3DXAB 5KYWA 1Z3GL 1AJ7L 4UTAA 4UQDA 5LAPA 4UF7C 3S5ZA 1WBYB 5T1KD 1J12A 3FUJA 2GEQA 4G8FA 5KSBA 5DZAA 3JWDH 4JDZB 4LCUA 4XP4H 1BW8A 1DVYA 3UERA 1LE9A 3FQNB 4OFDA 4AV5A 4KKLC 1A6UH 4N2MA 3GGWA 1M42A 1UXWA 2CPUA 3CFJA 3WFDH 3IXAA 1PZ5A 1T4KA 3Q06A 4MJIB 5GS3A 4NQDE 4N0CD 2W9EL 5DQJB 1WBXB 4Z5RA 3EH3B 4KVNL 5K93A 1MHHA 1H8NA 5IQ9B 3ECWA 3A47A 1U2HA 1MFNA 5F9WC 2VW4A 5GSVA 2F5BL 4GRWH 1V10A 1PU0A 1QSVA 2GQHA 4U6VL 15C8H 5DUPH 2G3MA 4ELMF 4QXGH 5LGJB 3QZNA 3UJIH 2W1NA 3LY6A 1I9EA 3CLFL 4R0LA 1LP9F 1HHHA 5DT1L 4WIQA 2FB4L 4DGIH 4HIPA 3SDAB 1BZ9A 3IJ9A 4MJ5A 4QRFA 3BZDA 4PVLA 1D9KC 5C0BA 4KZ0A 2GK2A 1XGUA 3V4PB 1MUJA 1E6JH 2DM4A 4KJWC 1OGSA 4O9HH 2F0CA 3TCLA 5F7KC 1MCRA 3OLDA 3RDTD 3PPEA 1G7PA 3U46A 3P4NA 5T33H 3U9PL 1ETA1 1CLOH 4X8JA 1EGJH 4OW6A 5IOKA 1CT8B 1OAZL 4AH2A 1IL1A 2PP8A 4WY7L 1K4CB 2APSA 2FDBP 3NSDA 3O6FC 4G59C 4YSPA 2OCFD 4ZOEA 5LBSL 4QGYA 3U4EA 3FU6A 2CGRL 3K71A 3MROB 3VXUA 3WL9A 3WY1A 1E9OB 2B1HH 1UM4H 4G6MH 4HF5L 4UM8B 4BKLA 5KANI 3MCG1 2CBOA 4HEPA 5IF0A 1AO7A 4GG8B 3HN8A 1YEGL 2BVQB 2PF6A 3BMVA 3SE3A 2IGLA 4HUVB 2FJGA 1XH3B 1GHFL 2KPWA 2YC1A 3CZGA 3TZVA 5MEQA 2Y3AA 4R7LA 5ACZA 1NC4D 4ADJA 3BEWA 1UOWA 1RJZA 4NSKA 2I69A 5D7KD 1Z9LA 1KCSL 3O8XD 3T3PF 4K94C 3V5KA 4N8CL 4GKNA 4OLVH 5LDUA 2XQ0A 2PYEB 1FDLL 5KVGH 2JMRA 2NXZD 5K1JA 3HPJB 1W80A 3DXAE 3APCA 2DBLL 1B6DA 1T20B 3RVTD 3WS6A 2HT2D 1BXUA 2P28B 4FEMA 4DEPC 3O3AA 4KKBC 5IJDC 1BM7A 3JV0A 2VXSL 2UZIH 4Q6IC 3DBXA 1YEHH 5D71L 1AR1C 2WY3B 1DEEB 2VIRA 4P4KC 3PQYE 1L7IL 4YHYC 4B5ZA 1NC2B 3HMXA 4A66A 2DY2A 4GBXA 1R5IB 4IRJC 4M1GL 3DJTA 3T0AA 2QHRL 5E1HB 1XAUA 1GW6A 3SE4C 3X11B 3DV6A 2IQ9L 4X5WA 2AK1L 5FUOL 4BFGA 1F3DJ 5GRJH 3DMMA 4JKPL 1U9KA 3TBWB 3P4OA 4BDVB 3U1SH 1C16A 4UNVA 5KZCD 1K72A 1JGDA 3MACH 2HPTA 4AYFA 1JPFB 1A7NL 1QW8A 3T3MB 4OZFB 3BQVA 3GIVB 4M6NL 5GHWH 1M3IA 1MQKH 4PLNC 4U2YA 2QVMA 5FOJA 1KMGA 3MV9D 4FERA 4FQPA 4N2OA 5D2LB 2GT9A 3QDJA 1T21A 5FDWB 3UZQB 4PJAA 4TSCL 4DUVA 5J9PA 1NBCA 2VRAA 4OLYL 4P23B 2CJTA 4FULA 5I0DA 1HKLH 1PNDA 1RCYA 3Q6GL 5BRZB 2FEDC 4MS8D 5FA3B 3CQQA 3IE4A 1M2VB 4UZGA 4HK0A 4DKDC 3BGMB 2FQEA 4PJBB 5AYUH 1KB5B 5D1QE 4C55A 1IE5A 3MV8A 3FK3A 4FABH 1XWVA 3I2CL 1FC2D 3GMRB 5B1KA 4F33B 1IFHH 3WIFB 3TESA 4HWBH 2ZP9A 3OPUA 2EUWA 3MLVL 1OGAB 4U6HA 1IC5H 3RTLA 1QRNB 5C08B 3CFTA 5CGYD 1A14H 4OJYA 4Y1AA 1GS8A 1XGYH 2GSMB 4LCCC 4GMTL 3QQ3B 3V6OE 1U6AH 2PO6B 4PJFF 5AKSA 1I9IH 4XP5H 5FX3A 4FHBD 4QNPE 2YPLA 3K80A 4YBHA 3MRLA 2BZ7A 4JAMB 3QDMB 4YDIH 4GXUM 1LP9B 2P45B 1ORSB 3D87B 1DSWA 5IVNA 3HB3C 3B2MA 1B3JA 1I8IA 1QOKA 2HVKB 4PQXA 5B38A 4UM9D 4RISL 4AENA 1DVUA 3BUDA 2UV3A 5BS0D 1YYCA 4XODA 4P9MH 5ADPL 4JN1L 1YEJL 4LPXA 3R1GH 3T65B 4PGBB 2X2UA 5KBLA 1SEQL 1RHHA 1OOWA 5KANG 3SBRA 2Y7SA 1P4UA 3DV4A 4J6RH 4WU7B 3RB5A 3TWCL 2FWUA 1T80A 1OE1A 4W81A 2ZOOA 1KC5L 2J6EL 4LCYB 4KKCD 3HZYB 3LS5L 3RY6A 3T8XB 2ETWA 4GUCA 4R4FH 2A73A 1X5LA 4JL2A 1QO3B 3EH1A 4ZW7A 5F0MB 3V9FA 5JO5A 2RIKA 2OMUB 1YLBB 2PXYD 3BMWA 3OAUL 5JOEA 3W37A 3AGVA 1VPOL 4LCVA 2QTVA 2DQUL 3NIFF 3ARGB 3T3ME 1W0WA 2ZNWA 4YE0A 5JPNA 2G75A 1E8YA 1RJCA 1RZQA 5BO1H 4HU8A 3TJPA 1WAAE 2RMNA 3TEZA 1XGPA 3M45A 1A9EB 3S4SB 5IOPB 3T3PB 2ZJSH 3W1ZA 2YD9A 2H0JA 5F3HA 4F7CA 4NLAA 4HEPG 2J6EA 1KV3A 3BCDA 5GRUL 4X9YA 2XXFA 2L3BA 4H20L 1OP5K 3KPPB 3UTSE 3ZTJG 2APTA 3KJ6H 3FB7A 3WHXA 1PZUB 1A7QH 4IU3A 4ZDHB 4ESKA 1BZOA 3BZFB 3NCMA 5EU3A 2X7LB 4C56B 4ZI8A 4HFWB 2GYSA 2F2HA 5B1BB 2DM2A 3QXDA 5E1AA 3IBOA 3VRJB 3L6FA 5DLLA 3V79C 1GS7A 4IBSA 5J12B 1JXKA 1A47A 4HMCA 4NUPA 5T1DL 3I75B 3D30A 4I88A 2P9RA 3Q6FB 4LLAA 3GSVA 1DHKA 1QEWB 4J5VA 1X7QA 5C0AB 1JFHA 3U9WA 2SEBA 1BVNP 4K15A 4WFFE 2KI6A 4NEHB 4ELME 3EH4B 3VMPA 1PX3A 5FUCE 1LP9E 1QR1B 3DIFA 3ZDXF 3LKOB 2AXJA 3OWRA 4UQCA 5BV7H 2LR4A 2EEAA 4U7MA 2XVLA 3HE7C 1S46A 1CICA 3GMLA 1AOZA 1CG9B 4H2AA 2A6IB 4Q7DA 5BO0D 4KJYB 3K0WA 1AG0A 3KR3H 2OMYB 3DLQR 4JY4A 4H25A 1KN2H 5ESAA 1H3VA 5F7EL 5IB1B 1BFVH 4J3OD 4MHHI 5HDLA 3HC4L 4ZFZA 4DHLA 4Y9FA 1HYRC 1T0OA 3TLRA 2B1OA 4NM4H 3SYQA 3GMPB 2NY3C 3NA9L 4MDIA 4IKJA 2X4PB 5F9OL 3AGWA 5DTFA 1WEJH 8FABB 3BWZA 4NKOB 1HNGA 4XMWA 1OZUA 4OUUA 3VU2A 5IROC 1BM3H 1LO2L 3DETC 3QNZB 1IT9L 2CCLA 1A6UL 4J3OH 5DHXB 1TZIB 2VDOH 4Z7WA 1G9EA 3QISA 2ZWZA 1ZV2A 3EJPA 2DYSB 4AGPA 1KG0B 3D08A 1UGKA 5DU7A 4M6OH 5EU5A 4PJHF 1XCXA 4N0FB 3T3PE 4ZNCD 4MX7A 1C1EH 1UEMA 4XGZB 4APXA 4XNXL 5FOBA 2XNAB 5C09B 5FO8A 2C8NA 1MCHA 4HCIA 3GF8A 2G2RA 2R56L 3Q5TA 1KV7A 4KUZH 1TNMA 2I27N 1ZRUA 1OAQH 4LSTH 3TASA 5DUPL 3GS7A 5KSAD 2EVHA 5A3ID 3UJIL 2JCCB 2QPUA 3A4AA 3KBFA 4FYTA 5DJ2A 1NIFA 3H3KA 3TBSB 4UNTA 2QELA 3C5XA 2WBJA 1W6LA 3CXHJ 1F97A 4K73A 4BXSV 3BH9B 1E6JL 4P3DB 1HSBB 4ERSH 4O9HL 5HVGB 4YDVA 1G9NC 1U95B 2FSDA 1OF2A 2WLLB 5T33L 2AQ3A 4M6AA 1B0GA 1EGJL 1OP9A 3IDYB 1DO5A 1ECYA 2AV1A 5B38G 4AMWA 3DROB 3QR0A 3HR5B 5FV1L 4IEFA 5D6DC 2E5EA 5KVMC 4G2AA 3B7UX 4G6ML 1UM4L 2XACC 3UL4A 5DUMH 4RBPK 4NC1C 3HE6C 1YYMH 3F7LA 2DWEB 4YSOA 2EDFA 4HZLB 4PJ7A 2C7FA 2CGZA 3U7WH 3OJMB 3P40A 4A38A 4PRBA 3CHPA 1MCIA 1RZFH 1A4CA 2C9VA 3CFBB 3G6JB 1WAPA 4P5RA 5E70A 3RWGB 3TPUB 2EVGA 1EGJA 3TEYA 3DYOA 5K1VA 2VJXA 1BXXA 3RTQD 1JPGB 1LDSA 4GEIA 3BLPX 3V0FA 1OAJA 2ZYRA 4P2QD 1C5BH 2QQNL 2ATKB 5CHNA 1RMFH 3B9DA 3NSJA 3WTWA 4DP8X 3NZ8A 2HFFB 4U49A 2X4QB 3RDTA 1JS4A 2LAAA 4KUCD 2X05A 2BRRH 1U42A 3D9AH 1UM6L 4M9OA 3B5TA 1RP9A 3P4MB 2FLRT 2NLJA 4MLSA 4QWWC 3S5LA 2G3NA 3RBSA 3F7QA 2WYIA 1YEHL 4NN6B 4FXKB 1OY3B 4GKOA 2ZX8A 5C0DA 2JJVA 5HGBA 2OL3H 1EBPA 5IR1B 3GM8A 2X89A 1P4LB 5F89A 4R7XA 4FI8A 5FB8A 3EGXA 3BPLC 4PJFE 4N2DA 3KYAA 2YMXL 3CU7A 5EU6D 2IPKB 2HN7B 5C09E 1Q9LB 2BP8B 1PZDA 3LQAC 1NC4A 4M03A 3EJCA 2JXMB 1PD0A 4KO9A 5KTEH 4F92B 3O8XA 2DLFL 5LUMA 4LLYA 4KXZH 2XN1A 4ORGB 1F4WH 2ZF8A 2YGVA 2JCCE 3U1SL 1JSYA 3D3VD 2H1PH 3HBPA 3MACL 3MRCB 3N40P 3QJHA 4YBLC 3RGBA 4A7QA 3ROOA 1Z9MA 2B08A 3O4OB 5JW4M 4JY5L 4MHHG 1EEZA 5IB3A 4JFYB 5GHWL 5AW5B 1MQKL 5LB1A 4OJFH 3GSUA 5DVMA 1XAKA 3ULVD 3T2OA 4M1CC 3U0PA 2BHFA 4BQ9A 1IVLA 2EDBA 2Z9TA 1P5VA 1O9WA 3F5WB 3P9LB 3QUZD 4Y2DB 2IXQB 3C60D 3INOA 4LVHB 4BK5A 1HKLL 3L2NA 1YCSA 3Q2CA 4M5SA 4OZIF 3O41B 2CXGA 3GHBH 3QQ4A 4PJIF 1C8QA 3L81A 3ULVH 3ARDB 3SE3C 4P46A 3RWDA 5AAWC 3ZZSA 2QJDA 4K7FA 2BSED 1D5XA 3LIZH 2DAVA 3TZVC 2CLRA 1M1XB 1WUZA 2XTJE 3CZNA 3ZIMA 4HWBL 5GXBB 4KQ4L 3Q3GB 2H8PA 2Y7LA 1FZOB 1IC5L 3NIFE 1WWAX 3R4DA 2AEPH 3RVVC 3VXMD 2A6JB 3QUKA 5KVDE 1XGYL 3L45A 3ATEA 3LNGA 2XQBL 4P5TD 5E4IA 2YLKA 4GLRH 1OTTC 3QEUA 3WI9A 3ARWA 2A6KA 4XN9A 4DZ8A 4XP5L 5M94B 3O0LA 3EOTL 3AY4A 5LDSA 1YRKA 1DDHA 1FO0H 2H6PA 1U93B 1SF5A 3MV9A 3WS6C 3RAJH 3EOBB 1U3JA 1SDDB 3O45B 4YDIL 2Y06H 2VUYA 4HS3B 4XMUA 2ZOTA 4HWBA 3VXTB 2DF3A 2AQ2A 4XCNA 3GLEA 3IDNA 3FO2B 1GYCA 2VDMB 2YEQA 2X1WL 1RSYA 3QIBD 1VACA 4JE0A 4XXDB 2YAFA 4P9ML 5ITFB 3FZUD 1R17A 2VZOA 5D55A 5J6GA 3FCTA 2VZTA 4HLJA 3X13A 2X0UA 2WXHA 3DC0A 3KGSA 1MW1A 1U8OA 4FG2A 3DOSB 3D05A 3NZHL 4J6RL 4R5VA 1ZVYA 3GMMA 2JKNA 3S35H 4AXWB 1OL0A 4EDXB 5DS8B 2ATAA 4RA3A 2OS7A 4Y5VB 2OI9C 2MTAA 1LJMA 2WC7A 4HLEA 3QWNA 3MNDA 1EDHA 4AGOA 3H2WA 2HFGL 2HX7A 3ABKB 3ZDXE 1BAWA 1XR9B 3ULUL 2B5IC 3QYNA 5F93C 5C9JB 4OGZA 2NUPA 3REWB 3D33A 3NJNA 5LGHH 4EI5C 3MLYL 2EXWC 4DN3L 1HAWA 4DF9A 3RPIA 2JK5A 1KXQE 4WTZA 4UM9A 4WEUD 4N0RA 5EZJA 3RX9A 2NR6C 2XTSA 4P2RE 5BS0A 1HEJC 4JFHD 5B7EA 2B1AH 1WISA 1MJJB 1JZGA 1W8OA 1HSAB 4MAYB 3KJ6L 3TNNB 5L4JA 5DMKA 3VSUA 3ZYOA 1A7QL 3HS8A 4NNXB 5E8PA 4U1JA 4ZMQA 1AHKA 3FONA 4UDTA 5FKPB 3S0PA 3NCBB 2D8KA 3ZHLA 3RFZC 3SDDD 4S11A 4BUQA 3MCYA 1XH0A 4ONOA 3NH7H 4I18A 2UYLB 1BBJA 1D5BB 2PLTA 4H8VA 4ZOBA 4ZPVB 3JV6A 2PXYA 3F7PC 3QGVA 3NIGB 1OT1A 2C34A 3B8SA 5DO2D 4PJHE 4JCLA 4LXFA 4YOKA 5I9QC 4CADA 3GUTA 3EH2A 4QCIB 4OBSA 4QAMB 2Z8RA 4Y2OB 1KGWA 1CGYA 1S9WA 5I5RA 5I6MA 1U8PA 4QO1A 4PGJA 5AENA 4RMSA 2HSIA 4WI7A 5JYMA 1D6EB 4N2BA 4MKTA 2DLHA 1V5JA 4MB5A 2N4IA 4MZ2A 1UD4A 2ADGA 2DYPB 5EOCJ 3N41F 4M7KL 1HE8A 2FH6A 4XZUA 3UBGA 4LO9A 2VSKB 1HVXA 4JNXA 2O6DA 2W59A 3ALXA 4Z23A 4XNZB 2CJSA 3I9PA 1ZHLB 4OSUH 2DW5A 1YY8A 1A0QL 2J8UA 4JEGB 2VN6A 3AT9A 4HKXB 3W39A 4PY7B 4OI8A 2BDNH 1EJOH 3KR3L 1N3NA 3TU6A 3RY6C 3F6LA 3EGDA 1KN2L 3BVDB 4UMGA 4Y4KD 4K55A 4OBRA 4OZIB 4PJIB 5IY5B 1MAMH 2GC4C 3OB0H 3ESVF 5TE4H 2ITDB 3X14A 3CH1A 2EC9T 5JHAA 1MIMH 4UT6H 3LN4B 1UOVA 3P77B 2DQCH 1QSEB 4M7JH 3VG9B 2BOCA 1R46A 2VDRH 5JPNC 4GAJH 3L9YA 2YD7A 4G6KH 4PW3A 5ENWB 3L3HA 5JMRA 3SBPA 3OZKA 4Q56A 3FPXA 4HXBH 4QXTA 2UZPA 1FLRH 1L6PA 3L3KA 1JGVH 4L4VA 3ARBA 4M6OL 1EWHA 3QWOB 1J05A 1Q72L 5KG9A 4KU1A 5C3IA 1C1EL 3QFDB 3DX9B 4Y5YB 4WI0A 1ORQA 2VLKB 3NN8B 4NO0B 4PTUB 4ZMXA 3FMGH 4RRPA 4HKZA 3BE1H 1OAQL 4LSTL 3S37H 4KX8A 2N7AA 4ZUSB 3N0PB 3SD2A 1SMAA 4K3JH 3QCTL 4G5ZH 1D5IH 4DTGH 3F62A 2OBGA 1BQRA 1V3MA 4WEMB 1W8NA 4XWOD 1E65A 1NCOA 3FRPB 3B8YA 2ICEC 1WCBA 4ERSL 1ZPUA 1XD1A 1GW0A 3ZMNA 2XI9A 4RX4D 5J1AB 2P48B 3GK8H 5EUOF 4MASA 4QXUL 3N5AA 3JV4A 1N6VA 3GSOA 3RWIA 1NFDF 3FFDB 2AGJL 1GIGL 3TA4D 2ICWJ 3J27A 4ZW5A 5IVZA 3G5ZB 2DPKA 1E2WA 2J8HA 1RZ8A 4FQHA 3WDJA 1CFSB 3IGKA 3EH5B 3RKDD 2VDLL 4OV6F 3GMNB 2F54D 2XC8A 4H8QA 4Q2ZB 1CICC 5EO9B 4BWUA 1IVTA 1ZGLB 2O30A 2VUOA 3WUWG 5JHBA 3U7WL 3WIHH 3ML8A 5KSAA 5FIEA 2ARJB 4C8XA 1RZFL 3ISYA 2RACA 3DGGA 2Y24A 4IBQA 4J2QA 3IDIA 2C9RA 1Q0XH 1NL0H 1DCEA 3CFCH 1QFWL 1LEIA 2R7EA 3AG1B 1GZPB 3BSZL 3NFPB 4YXLL 1ETB1 1IGML 1KN4L 2X3CA 1JWSA 5ID1A 3KPOA 3SKOA 3T6XA 3Q8BA 4OZIE 4PJIE 2A9BA 4HIXH 1T0MB 1G7LA 1BQLH 4XHJC 1QSEE 1P5UA 4WTZG 1YNTA 1TPXB 1ND0B 4PRAA 4S0HA 2CLVA 4WV1B 3SJVB 4P9HL 3VB8A 2OL3L 4MZIA 1WRFA 3UOAB 4ACPA 1KPUB 2PCFA 2G30A 3VSQA 4HGWB 4XNMB 5DSCA 1U2CA 2R2EA 3H9SB 5CMAA 5T3XD 3DVFA 1FAKT 3P73B 1TO4A 2VLKE 4K23H 3ULSB 1T7XA 3JWDC 3CXHK 1XGRA 1ZV5A 4AJ0A 1AHWA 4GMSL 1AGBB 3RTQA 3NEEA 1LK2B 1AKPA 3FBQA 4HH8A 4DFHA 1ZA6A 1TYRA 4NRYA 1T5XB 3C8DA 4P2QA 4WF7A 3LKQB 5TDPB 2X2IA 2E0PA 3WN6A 4ZQTA 2FR4A 4QRAA 1RVFL 2PWHA 4LEEA 5T3XH 2OL3A 3UABA 4JS7A 3CPUA 1OT4A 3U6XA 4L48A 1L6XA 3LKNB 2GHWB 3HS0C 5DZ9A 4DNLA 4MJ2A 1NCBH 1QFWI 1CGSH 3WS3B 3APDA 1CYWA 4FG6D 2WSDA 4LHUB 3KPSD 4C47A 4GKLA 3A4DA 4N0CC 5IZ7A 1I8KA 4BEIA 5D7EA 4JLRA 1SFDA 1UD5A 2HZHA 2RFXB 4DP9X 3BPCA 4M7LT 5AEAA 4N90D 3ULVL 4HPOL 3NDZE 2VITA 1T89C 1HHJA 1UZ8B 5EU6A 4OVUA 5AVQB 1VCBC 2D3NA 4AIZA 2NPLX 1AC0A 3LIZL 4MCYB 3DX6B 4Z7UF 1L9MA 1LDPL 3UP1A 1NAMH 2AEPL 1Z2KA 3OM3B 2IEPA 3D3VA 1QYGH 3IDJB 1BQHG 2CO4A 5D9SA 3QJVB 1CU4H 3ZR6A 1QLEH 1ZXQA 4PRHB 3GJEA 2VN4A 3T4AB 1R3JA 4JPSA 3VRLF 1OPGH 1ZHNB 5AKRA 3X3FH 1RFDH 1FLTX 3RAJL 3LIZA 4ZFQA 4CN4A 3K8KA 3C60A 1HL8A 3ILQC 1Y0LB 1L7TH 4JUTA 1HHIA 3GO1H 3KLAB 4AYGA 4XPHL 4F20A 2BP0A 2WQWA 3QI9B 4JUSA 3AQDA 1YJDH 2Q5BA 1J1OH 1KCKA 3K3QA 3PWJA 3SJVE 3V6ZA 2YA0A 4PLJD 3MLTB 4RRPG 2O4EA 1KEML 3MZGB 1WIPA 3WJJA 2EYTB 1F0LA 3KYKL 3ME0A 5EO0B 4R3SA 1SBSH 1FO0A 1USQA 3OPZH 4PJXA 2YEZA 5I1EH 5A2BA 4J3OG 2WLZA 1NFDB 4CVZB 3CNKA 2JJWA 3S35L 3VXMA 1CE6A 2ZKMX 4EIBA 3FQRB 4LIQH 1F56A 1J8HD 2YXVA 5LQBH 4P5TA 4OCNC 2P7TA 1D7DA 1KLGA 2EIBA 3OKNA 4F15C 1OSPH 2NXZC 4A2FA 2YD5A 4QHPA 1IBDA 5E99H 4NI6A 4YO0B 2QQLL 2WUCH 3UTPD 2I9LB 4WWNA 4X9GA 4YPJA 5DJDA 5K5YA 1MFBH 2AJZA 3JZYA 3MJWA 5I18H 4FFYH 1SJHA 3ZLQC 4GLRI 4JHVA 4BK5C 4FKHA 3H9HB 2BCKB 2YWYA 5HDBB 4WK0B 4HWEH 3ABMB 1WC7A 3OGCB 3RUGF 5E08H 1MCOL 3QIBA 1JPTH 3GSXA 3D39D 4GW4B 4PRNA 4OLZH 3SYOA 3QA3A 4QYAA 4UUJA 2EILB 2WK2A 2KZBA 1AOHA 2NX5D 1A8JH 1JPST 1V7MH 4I2XB 4P46C 3HI5H 4UIMB 3VXPA 4CC4C 5HYQB 3F84A 1MJ8H 4ZNEE 4R8WH 3MRMA 4E41D 1AGFB 1I9RH 3TBYB 2ID5A 3MJ7B 5HVFB 2Q2EB 3MUHL 4L0YA 3BZEA 3KVQA 1F11A 2ZCKH 5CLZA 1ADQL 1ZJAA 2YUWA 1AIFB 3U6RA 2JE8A 1UT1A 5EN2B 4FQ1H 3N9GH 1WFJA 5EPMA 4O51A 3NCWA 2EDXA 1VFAB 3IS0X 5I6LA 5I6OA 1A8ZA 5HYSB 3AY4C 3MLZH 1S7WB 3PP4H 2KERA 4PV9A 3AROA 4PN6A 3SKJL 4NUJA 4XN1A 2X10A 5JHDE 2D0HA 3M86A 4PCYA 3PLYA 4OV5B 4MS8C 3VI3F 3DURA 5AQ0A 4X99A 4QHNB 5IVXF 3DKHA 5KAQG 5JNYB 1A02N 2X42A 4KQ3L 1CLVA 4P99A 5EZLB 5B21A 3R06A 2QZ5A 1BPLB 3UPRB 2YAEA 4AEHH 1TU2B 1FZJA 3V6BR 2QPDB 3S3BB 4F3FB 3CN3A 3T1FA 2W81C 3FO1B 3UIYA 3DDFA 3ZOAA 3EADA 4DWHA 4QRQB 5FYJD 4YR6A 3VH8B 1ODUA 1CXHA 4JDVB 4QRPB 2HTLC 3VG0H 5EUOE 4JGJA 1JRHH 4G43B 1NFDE 1AZNA 1P84J 3HW7A 4AQ1B 3QXAA 4HJTA 5HHMD 4Y8AA 1MAML 2EYSA 4X6DA 4R84A 5TE4L 3IU3A 5F7DA 1IEBB 1MIML 3LEXB 2GTWB 4UT6L 4XVUD 2DQCL 3AMKA 3UPCA 4HWUA 3UAEA 4OFPA 3RGVC 1G1KA 5FYJH 2YRBA 1VKXB 4HUXB 4HT1L 2VDRL 4YUEH 3TX4A 1KLFA 2FYYB 3Q9PA 4Z0XA 1HYSC 1CUOA 4G6KL 4Y4HB 1TUPA 5I6XB 2PKDA 2BVEA 2EICA 1EAPA 4HXBL 4Z76B 4RGOH 1JJUA 2WBWB 4P23D 1JGVL 4A63A 4R7NB 4G8GE 3UC2A 3VFSB 1NDTA 5F1OB 1DVFC 3TYFB 2IANB 1H8LA 4QJ4B 2WUBH 5HDBE 3FAWA 1ESOA 2AKRB 2AEIT 5B39A 4UT6A 1G9MH 3FMGL 3LXUX 4I2XE 4H13C 1CE1H 4WJKB 3P0GB 2Y5TB 3MCLL 2E76C 4PRIE 3TA3C 2X70A 3KHQA 4Y4KA 2Z4QB 1SUHA 4KK5D 1SOSA 1T2JA 3ZKXC 2MHAA 2R2HB 3PWPE 3K5RA 3AY2A 5KOMC 1FG9C 4MXQD 4FNRA 4GQQA 5D1XD 4TQEH 3GSNB 3T0WA 5I26A 1BYPA 2XV0A 3D07A 3P3SA 1EXHA 1FFOA 2YD8A 5GIRA 5AVSB 1JK9B 4J8RA 3IN0A 4YIQB 1KJVB 1XDTT 4NZUH 4ZS7H 3I85A 4L18A 5EB9A 4XX5A 4Z77B 4N8VG 1FE8H 3EJZD 3MGOB 2EKSB 1P7BA 3R18A 1ZD6A 4HU2A 4C54A 3PABB 2ODIA 1CL7H 2GIXA 5LXVA 4QHLB 5CEYB 2NW3A 2APFA 4PGEB 3S34H 3IE9A 1HHGB 1FPTH 4YHMH 4LF3B 1ZIBA 5KYUA 5EBMB 3QZPA 3V9EA 1MEXH 3C6LB 3U25A 1AGDA 1PJ9A 3PNWA 1NL0L 3RUGB 3CFCL 5I1DA 1RZJH 1YUKB 1ZLSH 3P3TA 1S78C 4HC1H 1HXKA 1CN4A 4UQEA 5INDA 1S9YA 4J8QA 1U91B 2LVCA 1IGJA 1A1OB 3QJQB 3LJ3A 5HGAB 3AXLB 3F85A 3UCQA 4X7FC 5HHQA 2BC4A 1OANA 1ET5A 2CNYA 4ANUA 1I1AC 4F58H 4NQXA 5C0CE 1JNHB 2CDGA 2IGTA 3LD8C 3HZMA 3WIHA 4Z7UE 4C4KO 1FNEB 3TWYA 2WXQA 1WPCA 3ARBC 3NJKA 1JZ7A 5IFJA 1FVDB 3FT9A 5DEJA 4HKBA 5E24E 2F54A 3IFOB 2A38A 2W94A 4F7EB 3L3IA 2HVBA 4LOUC 5ACMA 1NWOA 4TL5A 1JAEA 1VFBB 1RKRA 4PJGB 1UKSA 2NOYA 3NRPA 3SB3A 4YQXL 3VRLE 3B6SB 4C56D 1G43A 3JYCA 4J23A 2Z31D 5FFOA 3VI4B 2OMNA 4DAGH 1ZE3H 2HG5B 2ZAHA 2ADJB 2FSEA 4MDJA 3UAFA 2CO6A 1AQ8A 5F3FA 5T3XL 3KL5A 3DX0A 4AGMA 2BNRB 3U2SB 2YOCA 2AJSH 3MYJA 2YK1H 3WO4C 2CIKA 1KGCD 4KRMB 2FJHB 3MRKA 4BUGA 3CSYB 1M1SA 4XCCH 2VH5H 1XHHA 2K4AA 1V3JA 1MVFA 4B41A 2BIIA 2G9KA 3NCYS 2NQCA 1INEH 1JHLH 4POZC 3BVWA 5J6HA 3LDBB 2E7BA 1UKTA 1GYWA 3SKNA 1KYOJ 3P4LA 3W57A 4ZSOA 1YN7A 4X4YA 1I7TA 4ONHB 4NQED 3JVGA 4H8HA 5KSAC 1PDKB 5E6RB 2ZOKB 5IHLB 4RMUA 3UEZA 3IS1X 3QZMA 5JQIB 3G04A 3B2VL 3ZDYF 1NAML 2WLHA 4A7VA 4XP1L 3PWVA 5TE6H 4U1LA 5D1ZB 1XZWA 4OI9A 3WMPA 1KPVA 4L8SC 2C3GA 3HFFA 3V5HB 3RJDA 4HLZG 1JK8B 3RILA 3RUGE 1U3HD 3COOA 3QIUB 3RWJB 1CU4L 1F13A 1QLEL 3QFJD 2A6DA 3CFEB 3V4VB 4QHKJ 5DHVH 5FLUA 1U8MB 4UWQB 2LU4A 3TFKC 4Y19E 3TT3H 1QX1A 1NQBA 2BX5A 2KS0A 4JVWA 4M7LL 5DC4B 4CJ1A 2PR4L 3KPSA 5CZXC 2AZUA 3JUYA 3U2IA 5JMOC 3P9MB 4IK7A 4NENB 3MUUA 1NAMA 1N4XH 5FO9A 4W9KC 1AQHA 2JNZA 2WO3B 1EEUA 5HHNB 1T3FA 5B39G 2OK0L 5A7EA 3KCPB 3BW9B 3UAAA 4FQXD 1B0IA 1NM9A 2CIIA 1G7JA 4IYKA 1LK3H 3PP3K 4OCSH 1BXVA 5I1EL 3BH8B 5D4HA 5L0QB 2QQKH 5IMMA 2YKKA 4HSCX 3A4FA 1QSFE 1MWAH 4W6XB 3POHA 5DJZB 1TEFA 5LQBL 3VTTA 1TTAA 3VI3