1AAJA

Crystal structure analysis of amicyanin and apoamicyanin from paracoccus denitrificans at 2.0 angstroms and 1.8 angstroms resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMICYANIN
publication title Crystal structure analysis of amicyanin and apoamicyanin from Paracoccus denitrificans at 2.0 A and 1.8 A resolution.
pubmed rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 26
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1992-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1aajA00
1HAUA 1OOWA 3OMNB 3EH3B 1E5ZA 1ZIAA 3ZBMA 3QJUB 2FT6A 1SF3A 2FWLB 2IDFA 3FU7A 2BZ7A 3FU7B 1NWPA 1PZBA 1AG0A 5B1JA 3H4FA 3CVDA 2UXGA 2EIMB 1MZYA 1TU2A 4P5SA 4DP7X 1RZQA 4QKTA 5I5JA 3WG7B 2Q5BA 5AZUA 3DTUB 4E9WA 1AAJA 1KDJA 1HFUA 2JXMA 3C75A 4A67A 1MZZA 4DP9X 3H4HA 4GP4B 5I5MA 1PAZA 2H5UA 2DYSB 2JFCA 2N0MA 1ETJA 4HCIA 4Q89A 4W1TA 2XXGA 3WKPA 5B3SB 4BWTA 3PAVA 3IBOA 1TEFA 1ID2A 1X9RA 1QNIA 2FNWA 1NPNA 4PCYA 2CUAA 2OJ1A 3OD3A 4YSEA 4A2FA 1V55B 2JKWA 2YAMA 2GC4C 1J9QA 2IH9A 1RKRA 2AZUA 1L9SA 3NJNA 2I7OA 1KGYE 1NIAA 2CALA 2CAKA 1ASQA 3X1NA 1JZGA 3GYRA 1AQ8A 5FC9A 2TSBA 4KNUA 1J9SA 1M56B 1BAWA 1PNCA 3WNIA 2HX7A 1JZHA 2HRGA 3S8FB 4DPBX 2R7EA 1KCBA 1N70A 2R7EB 2YAQA 4GY4A 1CURA 3FSWA 1SFHA 1FWXA 4YVNA 2BP8A 1A4AA 2BP8B 4M4RB 2XV2A 1I53A 1CC3A 4MFHA 2PLTA 1ZV2A 1L9RA 1FFTB 2YAOA 5F7AA 3S3BB 4DP0X 2IAAC 4YSDA 3RYMA 4BWUA 1HAWA 1JOIA 1JZJA 1EHKB 2BHFA 4YSCA 2IDTA 2DY2A 1GS7A 3FS9A 5B7MA 2QPEB 2FQFA 3GXUB 3ABGA 4BDVA 2ZXWB 3EH4B 2PPEA 4Q8BA 4YVUA 3ZX1A 4A68A 4A2DA 3OM3B 2PPAA 1KCWA 1X9UA 4ENZA 3PCYA 3V9CA 1QHQA 1A4BA 3L45A 1NZRA 2XX0A 1SNRA 2XV3A 4YSQA 3CZUB 2MTAA 1ET8A 2GB2A 2W8CA 4KO9A 4NB7A 3AG3B 2BWIA 3AW5A 4PAZA 2UX7A 3SBPA 2J57A 5PCYA 4HAKA 2VM3A 3NP4A 2J56A 1GSKA 2Q9OA 3EHBB 1ADWA 3N2JA 2IWFA 4ZK8A 1J5CA 2FJSA 4BWWA 1QLEB 1OV8A 2EIKB 1MDAA 2VW7A 1GS8A 3AG1B 3T6XA 1TKWA 2J5WA 1IUZA 1NDTA 3ABKB 4M3HA 1WS8A 3FU8A 3NSFA 1R1CA 2CCWA 1EZLA 3TASA 3TBBA 1AS8A 1E30A 2VSKB 2QDWA 1BQRA 3AZUA 1AG6A 4F2FA 4G7SB 2PCFA 3GDCA 1DZ0A 1OE2A 1E5YA 3QJVB 3T6ZA 2HLEB 2Y1AA 4N8UA 1YLBB 4YL4A 1BXUA 4F7KA 1NICA 1NIEA 2H47C 3NSCA 2PCYA 4HZ1A 1JXGA 1JZFA 3IEAA 4EF3A 1GW0A 2FQEA 1AZRA 2WSDA 2YAFA 3CVCA 4YSAA 5D4JA 3X1EA 4BK5C 5F7BA 4P5RA 3BQVA 3OMIB 3ASNB 1BXAA 3IE9A 1AOZA 1CUOA 3NJKA 1ZIBA 1UATA 2HZHA 1ET7A 5B7FA 4UF7C 4AI7A 3IN0A 2ZWNA 2B08A 4KO5A 1JERA 1TEGA 2YXVA 3SBQA 3NT0A 2BW5A 1OE3A 7PAZA 4NAJA 1AZNA 1PF3A 3FQ2A 4E9YA 1J9TA 4QLWA 4F2EA 1V54B 4GP5B 5B1AB 4JHUA 4A66A 1XB8A 4FAAB 1NIDA 2XU9A 1AS7A 3TU6A 1BQ5A 1ILUA 2AFNA 4BXVA 3NP3A 3FSVA 3QPKA 3NJMA 5I6MA 4KO7A 1IC0A 1M57B 3PPSA 3ZIYA 3MX0B 2J55A 1A8ZA 2EILB 5B1BB 5I5IA 3SBRA 3DIVA 2IWKA 2HXAA 4GXFA 1PMYA 3PAZA 4A2EA 2AANA 2NRDA 4HIPA 3QQXA 5B1JC 1PY0A 4RH4A 2PP9A 2HRHA 1PNDA 2MRYA 3D12B 1AACA 1OCZB 4HCGA 2X88A 1A4CA 3NJIA 2FQGA 3S3CB 5I6OA 4DP2X 1XMEB 1CYWA 2UXFA 4DP6X 3JTBA 1PCSA 1SFDA 2LLNA 2PPCA 4E9XA 2WO3B 3CVBA 3FYIB 3OMAB 3NJGA 4AKPA 3CDZA 7PCYA 3CDZB 1NPJA 4TXVB 4KOBA 1WA1X 3QJQB 5E9NA 4BXSV 2W88A 4DP5X 2BP0B 4WTQA 2OCCB 1WAEA 3ZDWA 1JVOA 3AG4B 3FYEB 3AY2A 2GC7C 1E65A 1ET5A 1L9PA 4GYBA 1AZCA 3X2QB 1NIBA 1SHXA 5EHFA 1NIFA 1IBZA 1IBYA 1OF0A 4AX3A 1M9WA 3FSAA 5LDUA 4G7QB 2X87A 2VW4A 2BWDA 3NSYA 1IKOP 1JZIA 1N68A 2QT6A 2UX6A 2VSMB 3UAAA 2GHZA 2IDSA 1AS6A 2BW4A 5TK2A 3U25A 5B1KA 3T6VA 3S3DB 3TBCA 2GI0A 1WA0X 2P80A 1BYPA 4E9SA 3NSDA 4E9QA 1AZUA 2ZONA 5I6NA 3DKHA 3V9EA 2XYBA 1NINA 1JVLA 1NWOA 4DPAX 3EH5B 4KOCA 1PLCA 4E9VA 5TK4A 2BO0A 2IWEA 2QDVA 3FSZA 9PCYA 4WKXA 4CSPA 2XX1A 2B3IA 2FT8A 3T71A 1AIZA 3NJHA 2VN3A 3S8GB 1ZDQA 3UADA 5IY5B 3PAUA 1BQKA 2EIJB 2GSMB 1T5KA 2YQBA 3NJFA 1BYOA 1J5DA 1KV7A 4HCFA 1MG3C 1PZAA 2AVFA 3TA4D 4DP4X 2DV6A 1W8EA 2VMJA 3NYKA 3QJRB 4KO6A 1SF5A 2HX8A 4UANA 3ERXA 4DPCX 3PLYA 3X1BA 3FPXA 2RACA 2YARA 1SDDA 2CJ3A 1SDDB 4L0PB 5A7EA 3N55A 1OCRB 1JXFA 1W6WA 5I6LA 5D4IA 3WKQA 3JT2A 1OE1A 4HHGA 1F56A 2FTAA 4GP8B 2Y69B 3PXLA 4HALA 2PP8A 1DYZA 1KBWA 2TSAA 1JXDA 1XB3A 2ZOOA 2H3XC 1L9OA 1B3IA 1WS7A 1FA4A 4A2GA 4CSZA 4YSPA 2OV0A 2YAPA 1A65A 2PPFA 4E9RA 1BEXA 3X1FA 3ABMB 1GY2A 1OCCB 2P80D 2BZCA 4K9JA 3FPYA 1E67A 6PAZA 2AZAA 3FQYA 3H56A 2XUWA 1L9TA 3ABLB 3NJJA 3FQ1A 3WIAA 1KBVA 2XWZA 4YSRA 4E9TA 1GYCA 1RZPA 6PCYA 1PLAA 2XV0A 2GIMA 2WO2B 1J9RA 3FU9A 1L9QA 1W6LA 4KNTA 1MG2C 3IN2A 1ILSA 1AR1B 4X4KA 2VM4A 3T6WA 4YSSA 1ASOA 3CG8A 4AZUA 5I26A 2IDQA 3WNJA 8PAZA 3FT0A 3UABA 4FA7B 1NTDA 2FT7A 3KW7A 3QJTB 2I85A 1JZEA 1SJMA 1URIA 1PLBA 5PAZA 1AZBA 1WA2X 4AKQA 2XXFA 2BP0A 3UGEA 3SQRA 2DWTA 3WI9A 1V10A 2QPDB 4HHWA 3UACA 1PZCA 2FQDA 2YAHA 3UAEA 2DWSA 3BVDB 3HB3B 3MBWB 4UAHA 1ZDSA 4W9ZA 2PP7A 4G71B 5D4HA 2XLLA 2XVBA 4BDVB 2A3TA 4A2HA 3AG2B 5B7EA 1SHWA 2VW6A 2GBAA 1RCYA 2E86A 5I6PA 4G72B 5I28A 4DP8X 1VLXA 2YXWA 3QJSB 4YSUA 5ANHA 2IDUA 3OQRA 2EINB 3NJLA 4N4YB 1BXVA 1OCOB 4DP1X 4JHVA 4KNSA 4YSTA 3ASOB 4NERA 1GY1A 1KYAA 2HX9A 5I6KA 2I7SA 3T9WA 2YAEA 2PPDA 4YSOA 1A3ZA 1ZPUA 2CBPA 2DYRB 2UXVA 2IH8A 3EF4A 1GS6X 4JKNA 2UXTA 4G7RB 1CYXA 3G5WA 4G70B 3HEIB 4AKOA 5AFAA 3KW8A 1GR7A 1KDIA 3X1GA 1ASPA 5AKRA 1XB6A 1AANA
chains in the Genus database with same CATH superfamily
4G3YL 2Q8BH 2P43B 5C6WH 3QEUA 2Q8AH 3IPBA 4PI0A 3QWRA 4FQXC 5CHNA 2NNAB 3FU7B 1LEGB 1JXKA 1PZBA 3VVWA 5D6DA 1JPST 2ZYSA 4KTEH 4PHZA 3QEQE 4I9WD 4FFZA 4Y0GA 3WY2A 5HBBA 4FI7A 4PRBB 3OLGA 4DP7X 1CLZH 1S9VA 4QKTA 2DWXA 1KGCD 4X80H 1CVSC 4KKBD 4NNPL 5LNGA 2K7QA 1A9BB 2VDPL 2RR3A 3GMLB 4Y2OB 3T6QC 1KDJA 1HFUA 3FQ4A 2P5WB 5J3HC 1C9SA 1IFRA 3NK3A 2EIZB 1SLXA 3VWJB 4XC3H 5EUKB 1DBKH 4HUCA 3AU1A 3LXAA 2EYRB 1RSFA 3H42H 4FQIL 3OWRA 2YRLA 2IO5A 4L4JA 3VD9A 4LOEA 4X6CF 4XMKL 2VZUA 1TEFA 4DQAA 1KC5H 1EIBA 4LE8A 3N0PB 3ESUF 5C1MB 5KVFL 1O5DT 4EE2A 3ZR5A 4YSEA 3BKMH 5C0BA 2Y23A 2PTVA 4A2FA 3U6XS 2WIIA 2WIMA 4O2FB 2CALA 2I7OA 4WDIA 2UZYB 3DRQB 2XCMC 3B9VA 4UAOC 3UPRA 1E7UA 4GG6A 1QWNA 3ZKNC 3QDJE 4CN6A 1F45A 2VOTA 3GXIA 4MA7H 1Y1UA 4XNQA 3KLHD 2EIEA 1OALA 5IB3B 2K45A 2QL1A 4XRCB 4NQDB 5TH2B 2OXHA 2O6FA 1I1YA 5GS1B 1FJ1A 4Z7OB 4UM8A 3C12A 5IESH 2NY0C 5CZRA 5ESQB 3RDJA 1CC3A 4R97B 3TH2T 2PLTA 1CLOL 1UZ8A 1CIUA 1KCSH 2JMRA 2QADD 4APQB 1KLUA 1OANA 4MMZA 1EBPA 3VMOA 3CVIL 3WLBA 2Y7LA 4JVPA 4LLWA 3BVUA 5LAXB 3QXDA 2ALAA 1JZJA 2BHFA 1WBYA 2V2WB 4HIQA 4PP2A 3F64A 3L54A 3Q6FA 4CNIA 4M8UA 1A21A 4IBTA 4P0DA 2QFRA 4F7MA 1GGBL 4PJGE 3RQ3A 2XWBB 2YN3A 3C5ZD 2J5LB 3NEXA 2PPAA 4NRXB 5DJDB 3JWDH 5DYOB 4LVHB 1X9UA 4QJ3B 1UD8A 2CDFB 4OIBA 4P2OD 1UC6A 4KK5D 4PJ5B 4IM8A 4AL8L 1X7QB 3CVHH 2A6KB 2WVSA 3T0VA 1DEEA 4K3JL 1DCEA 3F7YB 4WU5B 3TYGH 5KVMC 2XTJB 2A1WL 2V3EA 1Y18B 1YYLH 2DBLL 5C09A 2XIIA 3BVWA 1E4KC 2XNAA 3NIFF 3QXAA 1I9JH 3L3GA 2J56A 1SPDA 4PMFA 4WFGD 3ZZQA 4FNQA 1AR1D 1HYSD 3F58H 1ZAGA 2FJSA 4WJ5A 2NUPB 1DQJA 1DZBA 1T0NA 3GB7B 4JB9L 4LNRB 2R4SL 3V4UH 4M62L 1KIRB 1NGYB 5KYWB 4M8QB 4GIOA 5IEKB 2A6JB 2K4WA 4UT6A 1IVTA 5KN5A 4NHUA 1FG2B 1MN4A 4JFDB 2Y6SC 3DIDA 3EDKA 4Y19A 2QDWA 3CMOL 3C2AL 4PTUB 4OGAC 4NM8L 2PCFA 1KTCA 4LESA 4MS8D 5EUOA 4PWFA 1NCUA 1KJ2H 4B95C 4PJFF 2C26A 5DS2A 4F7PA 2JB5L 5I1JH 2ARWA 4P99A 4G6FD 3O3DB 3ZHKA 2OMXB 4FXKC 1YLBB 3KL3A 1TCRA 2F61A 3IVKA 3QEHA 4YXHL 1MY5A 4U1GC 5C0CA 4NNXB 2PO6B 5GRVL 4ZW8A 1KXQE 2ZUTA 3QK0A 3V6OA 1U92B 4YSAA 1IFHH 3KR3L 4QRRE 2ED8A 1RP8A 2R2CA 5KVEE 1BEYL 5FKAA 1AOZA 1D6VL 4RGNE 5BZDB 4NZ8A 8FABB 3QNYB 5B7FA 5J13C 3IN0A 1G7PB 4EI5A 2P5EE 5JOFA 3QJFB 1JV2B 4J2XA 2GJJA 2B1OA 5IM7B 3BQUB 1YMMB 2YK1H 4DKDC 3EFFA 1I9EA 3N06B 4FCAA 4GG6E 3NRPA 4TUOA 1ZHKA 5B3NA 3MUUA 1CR9H 2JE8A 5D7SH 1FFPB 1U42A 4XCNB 2QQKL 3IJEB 1NCIA 3BPOB 5B8CB 3KXFA 1FGNH 3BAXA 3MLWH 3W38A 3O3UN 4FFYA 3IXAB 5CSZB 2YBRA 4P3DB 2EDHA 3ZIYA 3LKNA 5A2AA 3V0JA 4MB3A 5EULV 2X1XR 4MD4A 2W1NA 5I5IA 5KANG 2ARJQ 3WHE0 3VQMA 3N9GL 1E4HA 1XCTA 1PD1A 3IMUA 1KTDA 1J0YA 1EPFA 1PMYA 3AREB 4DGYL 2IQAA 3GPEA 5EZLA 3BT0A 4QTHB 4YPJA 5GIRA 3VGBA 4EQ2A 1AJ7H 5E8NA 2AJXL 3ZKMD 3EJZC 5F70A 2HLAA 1MJUH 3KH3A 4OZFB 3CLFH 4FFZL 8CGTA 1IBHA 4RNRB 1YY8A 1RZFH 3WFDH 5ECGA 4NIKB 3RBGA 2IMMA 3WUWA 4BFIB 5FCUH 3BZEA 4AEIH 1CDIA 5I8OL 5IQ7H 2F54B 3IETB 3QEGH 1H8LA 3NH7L 2EZ0C 2H2PC 2PWGA 1CFMA 3C6LB 5K9QI 3MXVL 4AE1A 5HHPA 4I9XA 3MREB 3L3IA 5C09E 3VXUA 4J3BA 1UZ6F 4PRIB 1X4XA 3G04B 1P4LB 1RVFL 2MPVA 2CRIA 2AAAA 5I0XA 4KOBA 1GL4B 3QE5A 4IJTA 2F7QA 2Y7NA 2IXQA 4NKOB 1CXEA 2Y36L 1AYOA 1M2VA 3VFVB 3US0A 1CD1B 4YHLL 3T3PE 1XGUA 3SD2A 5FB8A 1HS6A 2KPWA 3MLZL 5D7LB 4FERA 3LHAA 4MAUL 4Y19E 2GSIB 4M5SA 1IX2A 2VW4A 3UG4A 4BH7B 5FK9A 4JO4H 2XT1B 4NNYA 4OLUL 1KPRB 3U83A 4PJBB 1NDMB 2ITEA 2WV3A 4YNYA 1MCDA 3CXFA 1ZHLA 3SDAA 1HHIA 3UX9B 3QDMD 1RAMA 4DGVL 4GSXA 1X5JA 5C0CE 1A0QH 4E9SA 4MCZA 3HG1E 4LASH 4U1LA 4UV4L 4XB8A 5D96B 3EOTL 3MJ9H 1BBJB 3QQDA 1S6NA 2XYBA 3L3OB 4RMQA 1ETB1 3QB7C 1XD0A 3DO7B 4RETB 3H2PA 4XO9A 3CNKA 3PV7A 4DFIA 3NA9H 1MWAB 2E47A 2UY7A 3TEYA 2Y22A 5I1EL 4DCQB 4XE0A 1OGTA 1TVDA 4M5YH 4PJ7A 2I07A 1VESA 4P23C 4RRPG 1YNTB 4WEBH 4ZX5A 1MFEL 5T3XD 2KPNA 4JHAH 4LGSB 2IAMD 3VTMA 3O81A 5F72S 5IY5B 1JPGB 5EEXA 2O72A 4K23H 1T5XB 4GS7B 2Z31C 1MHHA 1RLBA 4N0CC 4XVTL 1QACA 4IDJL 5CILL 3G5VB 3ULVD 1I31A 4MKMA 4HWEH 3HC0B 5E5UB 2X0VA 3KXFE 2WQRA 4X6BB 4PYHA 4DEWA 4UANA 3LHPH 5C0JB 4HH9A 5ABZA 3F8UB 5KJRH 3F7PC 4UU9B 1UADC 4UQ3B 1FLRL 2CJ3A 2WBKA 2Q2EB 4XH2A 4UOJA 4HHGA 1PZUB 4BZ2H 1WHOA 4MD5B 5E9DD 1G9ML 5IFHL 1S7SA 1IO4C 3GMNB 2P48B 4AM0A 3MO1A 4UT6L 4YHKH 2G2RB 3C5ZA 4HSAC 1HXMA 4G1EA 5IMLB 2DTML 3HAEA 4AEHL 4EDWH 5DGQA 3ZDYF 3KYAA 3AACA 1MJJA 4P2OA 1HH9B 5E99H 1SEBA 4JHWH 1ZEAL 1OKEA 3SKUD 4OVVA 4NJAH 3KWVA 4PRNA 1KTKE 1T1XA 3ECVA 4C4UA 2OX5B 3GGWB 2F18A 2XETA 3VXUE 1U91A 2XWZA 1K4DB 1H8NA 3X13A 4QGYA 4XBEL 3VFOB 3B1UA 1P5VA 5C0ND 5DDHB 4UOQA 4WWNA 5JW4N 2Z4QA 4TULH 1GC1L 2PWHA 3RB7A 1YRKA 3OV6A 2DQFA 2VZSA 1KZQA 4LSRL 3QP3A 4X4KA 5AB2A 3OPZL 4DKFL 1MEXL 3ZE0E 2KYIA 1N64H 3LSOA 3WNJA 5FA3A 4R96A 1A4JA 4JFZL 4Y88A 3S2CA 5KSBA 3D9AH 3AUWB 1E28A 3C8KB 3UOAB 3GMPA 4ELDA 1JUFA 1V5JA 3ILPA 5KOVC 5PAZA 1A7QH 3PE9A 4KRPB 3T3ME 2H3KA 3MOBL 2H32H 3ATAA 2H3NA 4CC4A 1CB4A 4QPEA 4G8AC 5DO8A 4GIAA 2YD6A 1QSFB 2GK0B 5GS0L 1FO0H 4NI3A 4Y16D 4XNYL 2F53E 4MYWB 3EAKA 1WE5A 3H7BA 4CA4A 1E5UI 4UINL 1TPXB 2OTWB 1D9KB 5AENA 5GZOD 2PP7A 3DUUA 4BDVB 1TZIA 2A3TA 5J57B 2VDMB 3FN0H 5BZWB 2HT3C 3DJSA 1JHTA 1TTBA 3CXHJ 4GUCA 1FL6B 5GS2D 4ANUA 3FBKA 3IK2A 1OF2B 4MXWH 3WIIH 1UXWB 1KELH 3MV8B 1LNUA 4GKSB 5D8JH 5GHWL 1EXUB 4ZDHB 1NOFA 2R2HB 4HH8A 4QTIL 1PFCA 3AROA 2AMGA 3T09A 1E9PA 5FO9B 3T4YA 4N22A 3BN3B 1D2OA 3WTUA 3E6FB 2YD1A 3EH1A 1JYXA 4AH2B 1RURH 3V4PB 4NKDB 3CFCH 3CZFB 4N0UE 2OXGA 1IQDB 2Q76A 5DYFA 2VLRD 4PJIE 4L4VD 4N4YB 1JZ2A 2XZAH 3TZVB 1S7TB 3M88A 4KNSA 3RNQB 4G8GD 4M7ZC 5T1LB 4I2XA 1P4BH 4JJ5B 1U41A 2MQ3A 4OZIE 2R83A 3KPPB 4LRIC 2PXYB 3UBXG 1B0WA 2C9PA 4MRBA 1NGQH 4QRPB 1MVUB 1T6WA 4MZ2A 4YFEA 2BMKA 1QTSA 4I0PD 3BPLC 4WVRA 4LSPH 3QFGA 4NO5B 4BK8A 2B77A 3VX1A 1WZKA 1PD6A 5IHWA 2UZXA 3LRHA 5D1QE 2FZ3A 1AANA 3AWEA 4RGMB 1B0RA 2B1AH 3ZYOA 4Y5XA 2PR9A 3TN0C 2B3RA 5E9AA 3E8UL 5DRWB 5FV2A 1LP9A 2XBTA 3CFEB 1IBBA 1K5NA 2XC8A 1U8NA 2J25A 4LLQA 1TU2A 3TFKD 2CBQA 4ZO9A 4IOFC 1VZIA 4AIZB 4MJJA 4M7KL 3Q0HA 1JGUH 2AXFA 2YPVH 4WFGE 4A67A 1I7ZB 3K6SB 2OMYB 5FHAH 3MZTA 3CC5A 3H2WA 3J8F7 1VCAA 1QA9A 1AXSB 2E6PA 4AJ0A 4E41A 4Q89A 2CSPA 4AGQA 1IC7H 5IP4A 2B9AA 5LN4A 5B3SB 5E08H 4RQQA 4BWTA 1AZZC 2I9TA 2NZ1A 2M26A 5F6IC 4MA8L 2FNWA 3IAGC 3V5DA 1ZLWK 4HIEB 3QZWG 3RKDD 2VR3A 4EPSA 3MV9E 4HWBH 3UTQB 4WFFD 2I9LB 4PGEA 2DMGA 3LKOA 1C5DB 3DGCR 3RVTC 3PFQA 1R3LB 2AJZB 3AMLA 3IMSA 3P0VL 1P5UA 3OKNB 3NJNA 1L9SA 1KGYE 2DQCL 3D3VB 3SPVB 5B39A 5BRZE 1ZK9A 5FC9A 5LJYH 1R9FA 35C8L 3QDMA 5EA0H 4N0YH 2NW2A 1NOAA 4LIQH 1IC5L 2MKWA 3CSYB 4N68A 2MKLC 5CNHA 3ROLB 4WI8A 1CCZA 1JDCA 2CDEA 5EWIH 2VC2B 3QIUC 2YPKA 1V7ML 3BPCA 5EU6B 2WYZA 1A4AA 3B2DC 2WTOA 1EXGA 2HVKA 3W0WD 1CLYL 4JGNA 4DP0X 4M43H 4OT1H 3IDMA 4HS3B 5GSVB 2R1XB 43C9B 1EHKB 1A1NA 3BKCH 4JLRB 3T0EB 3EGSB 3U9PL 1DVQA 4DAGH 3ETBJ 1A22B 2ZXWB 4Q8BA 5ESAB 3RGVB 1W72H 2Z35A 1BD2B 5TPWL 3QJHB 4LMQI 1DQDL 5LGJB 4V1DE 1KCWA 2BFVH 1EUUA 1QEWB 5DUMH 2ZAHA 3WL9A 1N6QH 3P4NA 4DW2L 1SMDA 2OMNA 1A4BA 4AL8C 4KI1A 1HCYA 2QVKA 2BCKB 3ZZLA 2Y2YA 5DMGC 4AVJA 5L7XH 5LUMA 3MYZA 3SDCB 4ANVA 3UTZB 2DQGH 4N25A 1L7TH 3KAAA 2PW1A 2VDKH 5E9DA 5IMMB 5DA4A 1FFQA 2QSCL 3CN1A 3W57A 2IADA 4MZIA 3S35L 5EIIA 4N2BA 3DIFB 2TAAA 2MH4A 4K3DL 4B5ZA 3MLUL 3HNSL 1OV8A 1PKOA 4HCRH 4NO2B 4A7QA 3QUKB 2AKRA 2OI9B 2WUBH 1OAKL 3ABKB 3MR9A 1LP9E 4OM1L 3ZKXB 1DEDA 2HVJB 3HZYB 1YPZE 4GG8A 2WB7A 3WJJA 1AGFA 3U9UB 4YJZL 4S1QL 2EEBA 2QGDA 4F2FA 4X7SL 1R6VA 3KLSA 3MA9H 4M9PA 4F2ME 4L9LC 3HHRB 5F9DC 3ZDXF 3SE8L 4JHBA 4OFYD 5JMOC 4XWGL 1N4XL 4EUPB 3U36A 3KS0H 2L7QA 2X6VA 3ROOB 1BXUA 3SYOA 4G7YH 5DZAA 4W4OA 5GRUH 3M1OA 5MEND 5DHYA 4HZ1A 2XJLA 4E41E 5ETUA 4MMXB 3IEAA 4D9LL 1TYJA 4KK6C 4M7LH 3BKYL 3D7PA 4IMKA 3WDHA 4Z7UF 4U1IB 3I6LD 4YWGH 2Y3NA 1WCBB 3NJKA 1AP2B 4ODXB 4WO4C 1S3KH 3MV7E 4FNRA 4ESKA 2VJXA 2ZP9A 2FJGA 4P06A 4HFWB 4HEME 3QVAA 3UPCA 3K2UH 5D1XE 1AZNA 2X1PA 1OM3H 1TOXA 1D5IL 1WIUA 3L95A 2KS0A 4EMZA 3MZGB 4XO4A 1SDYA 2WN3A 4YC2B 1IL1A 3MROB 4Y16A 1S78C 2Z91A 3NIGE 5D7JD 3TEUA 3B2VH 3UAFA 3CK0L 1FZKA 4KUZH 4YDKL 1AS7A 2NXYD 4NJ9H 3UAJD 5GZOA 1F1DA 4H26A 4ZNEA 3DJRA 2QMKA 1CG9B 1PS3A 3LRSB 3ETBF 3LKRB 1CU4L 1WLHA 3MX0A 3MBEA 1U8QB 2J55A 2YMOA 4DN3H 4GQQA 1LEIA 1T21A 2HMIC 1JK8B 4GLRI 2IWKA 1T7XA 2VDNH 3GMOA 2PYEB 1L0QA 4JR9H 4RAVB 5EU4A 4ZUWB 3VXQB 4ZW3A 1QP1A 5E94A 3CFTA 2K78A 1XGQB 3THMH 5D6DC 5JR1L 2ED9A 4PM1A 1HJCA 1EAOA 2LU5A 3MI6A 4EXKA 2Q3ZA 5C0RH 4YGAB 2MRYA 4Z7NB 2R9HC 1YDPB 4BKLA 1KPVA 1NH6A 1A4CA 4G8GA 3W9EB 3QCVH 1U8HB 1T2JA 3Q6GL 1R3JA 1XMEB 1AE6H 2NZIA 4CADA 2UXFA 2YGQA 2WKOA 5IMKB 1NC2B 4LAQH 3DJTA 3EYOA 3VCLA 1KGWA 1UOLA 2Y7QB 1YHPA 4I0PA 2G2NA 3LOWA 5EO0A 1I8AA 3S3JA 3B2MA 1VFOA 1A2YA 3CCHA 3QUGA 4PJAA 3BWZA 5J1AA 2QPSA 1XH2A 4FQCL 4FI6A 3B3BA 4EOWH 3BH4A 2JKIS 2R8SL 2XWTA 1ZRUA 3ALPA 4NN6C 4X9IA 2BC4B 1OHQA 4PJIF 3PABA 5T1KB 1G5GA 4EZKA 1QLEH 1B4JH 4UB0H 1AZCA 1C16B 2ZOKA 5IG7B 2R1WA 1SY6H 3TT1H 3EDFA 2DJMA 1OL0A 4X99B 1KFGA 1U36A 4ODTH 1N5YH 1JZIA 2QT6A 1QBMH 1RMFL 3MC0A 4P57B 4AUJA 4OU3A 1HSAA 2GHZA 1ZANH 4DEUA 1PG7W 3APNA 3MAWA 4JM2F 3X3FL 1OPGL 2Q6WB 1HTYA 1IVLA 2ITFA 1BYPA 4ZOEA 2MCPH 4MMZC 1LO2L 1F8TH 3EGDA 4RMUA 3NCJH 4L5FH 4LHUB 3VRIB 5A40E 5ADOL 1T20B 5T3XL 1PL3A 2BO0A 3HA0A 1IC4L 4NYLA 3GO1L 3BDYH 1E2VA 4HJUA 1DCLA 2HG5A 3ULVL 3GKWH 3MFGB 5HHXH 3EUUA 1AIZA 1NAKH 1NFAA 3NABL 1EWHA 4F1ZA 1IFGA 1H3PH 3GTNA 1DANU 4CKQA 1KJMB 3HZMA 4Q9RH 4JDEA 4U3HA 3NJFA 4YDMA 2FBOJ 4D9RD 5H94A 3QFDA 4FG6D 4LKXA 4XCFH 2AQSA 2OJEB 5TF0A 4JN1H 1CDCA 4J8RA 3VTAA 2DD8L 3CPUA 4FQHA 3ARUA 5JOEA 5KG9A 2VMCA 4F24A 1NCHA 2K7PA 3W0WA 1ZT7B 1KN4L 1WTLA 5C9JA 5K9KA 4XAKE 1T0MA 1G9MC 2H8PA 3KYNB 2VZ3A 2KLSA 2NXZB 2AMUA 2YUVA 4HALA 3TIEA 3I02A 5I1CH 1SXNA 1Y6NR 1WFNA 4D94A 4R7VA 1U8PA 5DMJB 2FX7H 4P5MB 4JFSA 2ICEA 4FTVB 4L8DB 3DMMC 2EEFA 3Q43A 1F4XL 2WXIA 3K0YA 3PIQA 4X0NA 3U2SA 3FRPB 3JTSB 3U46A 3P9MA 1CICB 2AVGA 2EDDA 3U4KA 2DEXX 4G6MH 1MFCH 3BDXA 3GMMB 3V6OC 43CAB 3KLDA 4JKKA 4Y4HD 5DVLA 1FSKC 3WFEH 4HVBA 1GC1C 1AH1A 5AQ0A 2AJ3A 3RJDA 3MRRB 3WN5A 4YDIH 4JFQB 1B90A 2OR8A 4I77H 1KF9B 2PCPA 4EI5C 3DHMA 3VXRB 2OMUB 3FT1A 4H1LB 2WTRA 4Z3GA 3C5SB 4GFTB 4FA7B 5HGHB 1NTDA 2W9LA 4NT6A 3PGFL 3HS0C 4M6NH 2BXYA 3P0GB 4AT6B 2V9QA 2NY6B 5DUPH 3SODB 4AKQA 1FUNA 2ESVD 1MDTA 3BRDA 4OFYA 4YAQB 3LN5B 5CAYB 4KKLC 2YAHA 4Y9FA 3QZMA 2ITDA 4IBSA 1N59A 5MENA 3HB3B 3RUGA 2ZYHA 4FL4C 4XPAH 3T8XB 3H9SE 4N24A 3HRPA 2YR3A 4M93B 2V8MA 1UACH 3LZFL 4NNPH 2OBGA 1YPZF 4WGWB 5LCVA 4K3EL 5JXAL 1L7IH 2E5EA 4UCFA 3MDJA 5GGRA 5C6PB 5AVUB 1QSEE 5I76A 25C8H 4BK5A 3DO4A 3WNOA 1OGAD 3MOQA 4WFHD 3MRQB 1TZOA 3L3JB 5D7EA 3LKQA 5D7JA 5FECA 3WUZA 5KVFH 1N0LA 2EINB 2AJSL 5BZZA 1KEMH 5EU3A 2FK9A 1OCOB 2V5TA 3UAJA 2Y1YA 1QTYT 1JIBA 4ELME 3FFCD 4KVPA 5H37A 5IQLA 4YBQD 1L3NA 2WNKA 5FFOA 1P84J 1G84A 4C58B 1SQ2N 4F15C 3HUJF 2ADIB 5EB9A 5AOZA 4B7LA 2I7SA 2GY5A 3TEWA 4NFBA 2JK5A 3RY5A 4MBOA 4R9HA 5I17B 1ECYA 3FONB 4EQ3A 3DX6B 4W81A 3TBWA 4Z77B 4QO1B 3VU2A 4HUXA 1AIFA 1EBAA 1UUSA 3D33A 3G5WA 3PNWB 3PYCA 3UFIA 4WAFA 1CTOA 5JNYB 2DLEA 2XA8H 1AKPA 4MMYA 3NCFB 4NPYB 2E3VA 5A2CA 4KKBC 2GTWA 1F6AB 1TVHB 4BRJA 5L8JB 3IMBA 4HX1B 2LTQC 4PWIA 3KWWB 1PZ3A 3L5WA 5DU7A 2C1OA 1PX3A 3K2MC 2AV7A 4B53A 4UIKL 3KVDD 1XGPA 4PJCB 2DEYX 3SCMB 5D9SA 1Z5LA 3DTUB 4YK4B 3L3DB 2JXMA 3OHXB 4LBAA 2DI8A 5IJDC 2Z4TA 2EH8L 4F8OA 1MREL 3QXTA 3VGGA 4AL8H 3LZOA 5EO9B 3ZT5A 4CMMA 4PJXB 5IOKA 1BJ1J 2CM6A 2X4QB 4JREC 4K3JH 3IU3A 5I8EA 5JLZB 2A0LD 4MX7A 4N8VA 2W0LA 3JXAA 1IZKA 1GZHA 4YE4H 1ID2A 2GTQA 1QR1B 3HRZB 4P9HC 1VGEL 3SBWA 4MJ5A 4DK6A 4QF1A 5T5NF 4H5SA 3O8XD 3G6AB 5IHBA 1BMGA 5I6XB 3KLHC 2QQNL 3JV5A 3QISA 4JNXA 3DV6B 1SM3H 4FJZA 5LGHL 2HAZA 2R4SH 4P04A 2WSKA 5D2LA 4JKPH 2GSGB 1BX2B 3O0LA 1J9SA 1ORSA 2R2BB 1M56B 3K4AA 5IJVA 3MGTA 5INCA 2WCPA 3ZT6A 1BDYA 2QADC 2WVTA 3RUGE 4XP5H 2YGPA 5I74B 3IFOB 2DMCA 1OAXL 2RALA 3C2AH 2X2IA 2V9TA 3CMOH 4HWZB 3D87B 4YDVA 4YR6B 4BHUA 5D5ME 5BQDA 1A6AA 1U95A 3PQYB 2CNYA 2XV2A 1H19A 4L2LA 1ZLEA 3D1MC 3L2MA 4O02B 1L9RA 1FFTB 1UT2A 4QGTA 3C5ZC 1K6QH 4LP5A 4YXHH 2MIZA 4WI0A 3UBXI 1OAQH 3Q2LA 2DQIH 3DOSA 2AJYL 1KB9K 2WYTA 2HTLD 4KJYB 4P2OC 3L4ZA 5TE6L 3QUZB 4PJEE 7FABH 4KK5C 1DQKA 3MJ7A 1HX0A 3ES6B 3GBNL 5J11C 1TVBA 1AQKL 4GXVH 4H2CA 1LJMA 4PG9A 1E5BA 3QS3A 1GCFA 3MFFA 2I27N 3HCVB 4QXGL 3VXME 2C8NA 3K6DA 1UXLA 4Q7DA 4TNEA 1W9XA 3J27A 1HIML 4X5XB 1CD8A 4Y4FB 5CINH 5MERA 4M5ZH 3DURA 5EBLB 4J6IA 1HKLH 1SNRA 4GT7A 4Z76B 2XV3A 3R0NA 4GAYA 5A7BA 2MTAA 1AR1C 1HYSC 1BVLA 3D85B 4X83A 5LQBL 1J0ZA 4LEBA 4R4BB 1VFMA 2UX7A 1JL8A 5DEFA 2YA2A 2O6EA 4KDVA 4ZS6D 4Q9QL 1MUJB 3FAXA 4FEMA 2JQMA 2HT2D 5FGSA 2CRZA 4WU7A 1YUKB 3MJGX 3VG0H 5AW7B 4ZODA 2IWFA 4XN9A 5LAPA 2UZPA 2WXRA 3F00A 2QV2A 4MS8C 4HZAA 4CC4C 5I1LA 2J5WA 5C7ZA 4IIQB 1ADQA 1QKZH 1KEGH 1Q0YH 1FFRA 3QCUH 3VUAA 4HMCA 1RUKL 1TF4A 3ULSA 1SGKA 1AS8A 5ACMA 2AJXH 2ENSA 2D9QB 3EGXB 3B6SB 2DDQL 5D2NE 1MXGA 5IB5B 1ZLVH 4Y9GA 1XR8B 2CIIB 4UTBA 1FAKT 4Z3EA 5BS0B 1T1ZB 1G6RA 3T6ZA 3B3IA 3QBTB 4ZQTA 3ZSSA 2VKWA 4JFWA 1PDKA 3FL7A 2H47C 1F3RB 3IDIB 3HMXH 1MHEA 4DESA 1L0XA 1GW0A 3RZCB 3BH8A 3MXVH 4W93A 1S7RB 3P30L 1XF5A 4OAWA 4LP4A 5IR1A 3SY6A 4ODBD 1M71B 3IE9A 3I3DA 3WJMB 1WIPA 4H8VA 3UC2A 5A16B 1NANH 1RUQH 5JO5A 5KVEH 4BZYA 3NZSA 4FQLH 3UZVA 3NT0A 5JW4M 2E8ZA 2GYSA 4MA1B 4F27A 1ES0B 5DEGB 4ZW5A 5HPMA 1B9KA 5EU5A 1YEFL 3K2KA 2F9BT 4LHJB 4JHUA 2BOBB 4JFOB 1NA8A 3SEPA 1AOHA 2DKUA 3W1ZA 1QFWM 3LKPA 4W9CC 5F9JB 1FZOB 3L17A 3REWB 2JCWA 4AGPA 4FNUA 1IGJB 3ZKMC 1M57B 1OTUD 1R5IB 4XB7A 4AG4H 1AQMA 4PB9L 1SHSA 1BZOA 5F8RC 1KTLA 5LBVA 3EOTH 2A77H 4HPYH 2OCJA 4Y5XC 2C3VA 4DO6A 3GTVA 5AW0B 1DJYA 5DVPA 3CHRA 3NRQA 5I30H 1HZLA 4G6JH 1S7VA 1UD6A 2Z9TA 1JHLL 2NNFA 3L4WA 1AY1L 1UHVA 2X4OB 2WYIA 3V6BR 3FFCA 5D7IE 4AXWB 1JV5A 4P2QB 4Z7IA 5LXGL 2XWJB 5EC2B 1SOXA 2YGVA 4YE0A 4BD4A 3A6OA 4OBSA 3GSOA 5CILH 1N10A 4HS8L 4FQ2L 2PPCA 4UZSA 1KIPB 2ID5A 3T04D 3EDEA 2ALWA 2OR9H 3GHEH 3OMAB 1XF3A 3IJ7A 2JKNA 4PRAB 3X12B 2ZX9A 4HBCH 1D7CA 4L4TD 4QYOA 1ED3A 5FUCC 3OAZH 5DK2A 2X1WL 2D7OA 3D51A 3IJHB 3MRJA 3FHAA 3CDCA 1P5UC 5IHHA 1QPKA 1BFVH 2BVPB 5EOCH 1V8HA 5A2IH 2A83A 1G9MH 2NY3B 2B0SL 4U6XB 1SHXA 1XF1A 4ZPVB 3TBVA 1O6TA 1VGKB 3IJSB 4HG4J 1O7SA 3AXHA 1VFAA 4GRWH 3WY1A 3QIWB 1JZ6A 2D9CA 3EJRA 2DQDH 3DTDA 5HDQH 3MQIA 4JW3A 4A6YL 5IQMA 1HDMB 1XX9C 3SGKA 3V4LA 1RJYB 1AQHA 3T6VA 2K3HA 4UTAA 3VNYA 1H6UA 5DI8A 4PVBA 5C0EA 2VIRA 2ED6A 5ICXB 5C0FA 5AL8A 4BFKA 3VFSB 3O3BB 4KQ4H 1JF6A 1M42A 4ZNCD 5JHLA 4E9LA 3BZ4B 4HC1L 5DK0A 1DL7H 4RFNC 5A2LH 1VFUA 3EH5B 3KLAB 3VXSE 4N3UA 1HEJC 5AZ2L 4WGVB 5DWUL 2GTZB 3ULVC 4NQEE 1GC1H 1G43A 3O8XA 4X5WA 3LXCA 2ATKB 3MJWA 1KZYA 3QA3B 5E2WL 1LO3H 1MEXH 4AV0A 4XMPH 3L1EA 1MSPA 3NCMA 4RAUA 1CN4A 1AGEB 1I82A 4JFZH 5DXWA 5F7EL 1I8MB 3SJVB 1WFIA 5E24E 3NYKA 1HK6A 5I0VA 4OFIA 1SF5A 5HHVH 4X8XA 1QFOA 4IRJD 4DPCX 1BW8A 1JD9A 5C0DA 3TVMD 5BVPH 5FGRA 2DEWX 4MDRA 3MRGA 4AJVA 3JWNE 3VGEA 3BLBA 3CE1A 3KPSB 3VGAB 4XOAA 4FFYH 2VUOA 4TS6A 4KNQA 3L4CA 3Q8FA 4D7BA 4OFDA 1THCA 5KYNA 2LFEA 4HXBH 4P59H 4UINH 1LO5B 2G3XA 4FP8L 3EHBD 1U2HA 2TSAA 1AD9A 5GJTL 3UXFA 4BFFA 1RP9A 3WJJC 4MAYB 2KLRA 1LE5B 1UYWH 3BW9A 2I5YH 3HI6L 2NYYD 3V0WL 4D0BA 5ID0B 2QSTA 4XZ4A 2K3TA 4OLWL 2P80D 5D5MF 3U1SH 5C0NC 2X4TA 3QUMB 4UTBL 4M4PA 5K9JL 3FPYA 4AYEC 4X5RA 3NIFB 4QTIH 4LCCB 3VFMA 3IWVA 4M03A 1EHNA 3WHXB 5I66A 1G6RL 3VFGL 4W4OC 4S11A 2CKBA 4OCYH 3BKJL 1GGCH 2UVFA 1BGXH 1IQWL 1MCLA 1VPOL 5IQNA 4ZFQA 4HISA 4PJEF 2EDNA 1MCWW 1OT2A 5KOMC 3SYPA 3KYMB 4IMKC 2CPCA 1NBQA 1VCBC 1E9OA 3TBSB 4JFFD 5H8DA 5CCGE 2DLGA 1DVXA 3F2LA 4JE0A 3KWTA 5IB2A 3GIVB 1U8MA 2QBWA 1T2QL 5EZJB 4G9FD 4BCXA 4GAAA 1FE8H 2XI9A 3WCYA 5JORB 5AVVB 4PJFB 2OZNA 3AT8A 1Z3GL 3P2DA 4HIXH 4LARH 3F05A 3BSGA 1I3GH 4Y16C 3L4TA 1PVHA 3UP6A 3SE3A 5D93C 1RK7A 5GZOC 3L2LA 5IW3A 4WNQB 5DQJB 2N3JA 1J5HA 1VACA 1MRCL 2X7LA 1I9RL 4E68A 3V10A 3LNIA 1THAA 3DV4B 3IDYB 1FNGB 1ZLUH 3Q2VA 4JY6A 2ENPA 3VXOA 1P1ZA 1X4YA 1G7HA 3OC8A 4DUVA 4NHCL 3D39D 5HVFB 1NMCC 3J7HA 1OO2A 4YIQA 1U3YA 4NWUH 1J1XL 2ERJC 1MAKA 2R4RH 4U1MB 1JNLL 4G72B 1I1FA 5DRXA 3TH4T 4PLNC 5B38G 2Q7AA 4M9OA 1U3ZA 1AGCB 2FL5B 3B8YA 3BUYA 4PWHA 3NCCB 4Y1TA 3V5KA 4ODWA 4JMNA 3OQRA 2BOCB 4P9HH 2J20A 4I0PC 1HL9A 4NX0A 3VXPA 2XQYK 4Z3TA 3HLAB 2VQUA 1F0LA 5DFAA 3BIAX 2ZXBA 5KJ4A 3LXBA 3VDAA 3UJIH 3GUTA 3SDXE 3BSHA 3O2VL 2F2HA 3BP6B 3IXTA 1VENA 2ZXAA 2BIMA 1CXHA 4IK6A 2NQDA 5FKPA 4E0RB 1MAMH 2JKSA 4QRUB 4U1JA 3K6FA 3Q5OA 4Z7WA 1CLYH 1H15B 3FHEA 3FUDA 4PJ5D 5F7KC 1NM9A 1ZSDA 3TFKC 3FQWB 1HAUA 3VI3A 1ZA3B 2OYMA 1XSKA 3ZL4L 2QQQA 3BHBB 4G8IB 4Y5YA 1SF3A 2EYTA 2C9UA 2Y7OA 5JW3H 2XTJD 4XNUL 3HAEH 4U6YB 4GAFB 1UCTA 1O7DC 2WINB 3ILQD 3HI1A 4HGWB 3GNML 3I6GA 3Q01A 1F2XK 4L2YA 5TDNA 5EOTB 1ZLVK 4BINA 1WJ3A 2GT9A 4AC2A 1R5VB 3KJ6L 5I2IA 2O61B 4UM9A 5DS1A 5JHAA 5JHLL 6CGTA 1DQDH 4RMSA 4HKBA 4ZFFB 2X44D 4WW1A 2J4WL 3MLVH 3C75A 3U0TB 2VKXA 4M6MH 3RKDC 1IAKA 1PAZA 4TUJB 4L4TA 3TO2B 1NDGB 1RK0B 4F58L 4ADGA 1U33A 2YOAA 5KYUB 4PJDA 4TLSA 5HHMB 2XXGA 2P8LB 2GEQA 1A3RH 5D7IF 1WWCA 4HSCX 3C5XA 3DARA 1KIUA 2F0CA 5DZNA 1SZNA 4P9MH 5IGXL 2WLJA 2OMVA 5I71C 1IT9H 3HN8A 5TJWK 2ZSWA 4YX2H 2PN5A 4QYAA 1XH0A 3FUFA 4JFEB 1HINL 3MRBB 1V55B 3P4MB 4JZJB 4CDHA 1SVBA 3ZTNL 5ALBH 1B4RA 1IGYB 1ASQA 1YC8A 1JZGA 4XP1H 2VLKE 1KTRL 4BSVA 1DN0A 5EEUA 5JHDB 4KTDH 4NDMB 2V7NA 4OM1H 1J8HD 2HX7A 2FAUA 3VX0A 4CGUB 1NGPH 3RFRA 2R56H 5IEHA 3D25A 1EANA 5DVMA 4CN1A 1CURA 1TTRA 4N20A 4PYGA 3SE8H 3ZMEA 1R47A 1EFXB 5FM5O 5CEYA 3DXAD 4L3CA 4WKZB 2AGJH 4MSWB 1TCMA 3LZLA 4HF5L 2YEQA 2ICEC 5H35B 3BEWB 3OG4B 2VLLA 4YDZA 1KYDA 4IS6B 3UJJL 5I15L 3NFPA 1HWWA 5EEVA 5HGDB 4YSCA 1MHPL 1M6OB 3Q3GB 3FS9A 3NA4A 3VSTA 5E4OA 3BGMA 3MV11 1JYVA 2QPEB 2P9RA 1N5AA 1PIGA 3EYUH 4HUKB 1F3JB 2EKSB 5CZVH 3S36H 2B4CL 2CKBL 1HE7A 3DJZA 4MNGB 2PABA 3HHSB 4PFEA 2HKFL 4M1GL 1UOVA 2Z0UA 2QVFB 3P0YL 4X8JA 4IRJA 5IJBC 3T4AB 3TVMA 4LSVH 3ULUD 3GSRB 4APXB 3WN5C 3FO9B 2XFXA 2DF3A 4HV8B 3GZQA 5F9WB 4QXWA 1H6FA 1SJVA 1FGVH 5KSUB 4HIJB 3CK0H 3BRFA 4L3EB 1ZVYA 3TTSA 1U6AH 3ZDYB 1RZ7H 2A9NL 4BQ8A 2BSBA 1G1CA 3P02A 1ZMYA 4N0FA 3OAZK 4PRPE 5J06A 3HW7A 4PY8I 1KUMA 4OLXL 4PB0H 4LFHD 4Z8FH 2C9VA 5EIIG 1H6TA 2D0FA 5SWSB 4O02L 3UEQA 1NEZB 2BSDA 4LRNL 3TBYB 5CR1A 3BXNA 3QGVA 1K8DB 2EDXA 3SE9H 1BECA 3GSVA 3SGDH 3PWVB 3ZPDA 3ZO9A 1VB9A 4JRYE 4M48H 4U6VH 4WSGA 5A6LA 4JKWA 1CFSB 2SODB 3HFMH 3VFTB 2R2EA 1E5CA 2X1QA 1FG9C 1E5YA 3WV0A 3F3HA 3QHZL 4PPTA 3CXDL 6TAAA 3MNVB 2P49B 2QPFA 3LPWA 1A7BA 5C70A 3FB7A 4JFFA 2ARJB 3I75A 2Q1EA 3PXHA 1J88A 32C2B 4GW5A 4CL7A 1JXGA 1CFTB 1TZAA 3QQ9D 4EF3A 4NCC1 5D7LD 2XN9D 4X98B 4E5XB 5INDB 4G9FA 5GRJL 3A0OA 1A6ZB 5GGVY 4L29B 3RL1B 2Q20A 4BK5C 3KPTA 3P1VA 3FHQA 3QZPA 5F88A 4V11A 3IDNA 4BJLA 5C0IB 5CR8A 1A9BA 5BZXA 5LGYA 5ES4B 1BM7A 5ISZD 3ALXA 5D7JC 1AXIB 2EIZA 4QY8A 3T1FA 2R8SH 4PGBA 3TV3L 2NXYC 5EUKA 3UAJC 3VWJA 3HE7B 2EYRA 5AZEL 3JBG7 2IPUG 3CHSA 5I73C 4HZLB 5E8OA 5BUPA 3JZYA 3LDBB 4WV1A 4XBGB 5AB9A 2A9AA 3PS6A 2QSQA 2C4FU 5F0JB 2BNRB 2FGWL 2PTTB 3BGFC 1B0GB 3SZKC 1Q0XL 1OSZB 3CFMA 3NP3A 5IFAH 5L2KB 2YOCA 1IC0A 3OSVA 3RIFF 1DBJH 3SDDB 5I1GH 2J1WA 1K2DA 4PBXA 5EPMA 1A8ZA 3VQLA 4POZD 4ZMYA 2OMTB 4QCIB 4N2NA 2PTUA 1LO2H 2HXAA 3NGBC 5D1ZD 5F96H 4R83A 1E6JL 1ICTA 3GHBH 2JELH 1FAIH 5I23A 1F18A 2DJ4A 2CPUA 1OK0A 4QRSA 3GIZL 4H25B 3SE6A 3POCA 4XRCA 1A6WH 2NY1D 5IROD 2J88H 3VG9C 4NUGH 2V2XB 1IE5A 4RH4A 3KVQA 3GO1H 2FNBA 1DUZB 2BVUA 2O5YH 2P5EB 3D12B 1T1WB 1JF1B 1VJSA 1QUPA 1B2WL 1BJ8A 3MYJB 1AGDB 2A74B 2BSSA 4ONFL 3RWGB 4O9HL 5LAXA 3NEEA 3WAKA 4YFDB 4IMLB 3MRNB 5HHOD 4Y1AE 2VDOL 4FNSA 2CCVA 3MLXH 3OLDA 5MEOA 2JCCE 3LIZA 1DJZA 3WD5L 5L0QB 3KGTA 3APMA 1KXTA 3FYIB 3WLWD 2VDLB 5DJDA 3HBQA 3GJFB 1S9YB 5DYOA 2Z7YA 3I2CL 3CDZB 4C56E 2CDFA 4BXSV 3SBWC 3G5YB 2AXGA 3QPQD 2YS4A 4WTQA 4PJ5A 2GY7B 3GDBA 1SYSB 3HPLA 1KSRA 3LS5L 3N43F 3OJVC 2A6KA 3OWEA 1QWUA 3AG4B 4JEGB 3ZDWA 3CFJB 2GC7C 3BAJA 3HTLX 3R4RA 1ZVNA 1M1XB 5I0YA 3HNVH 3SDXF 1HKFA 4ZBJA 1T03L 4XNZC 5K69A 1U2CA 1P7BA 5D70H 2CO7B 3H85A 4MJID 1QUNA 1NLDH 2AEOA 1GAFH 4L48A 3KGUA 4FZ8H 2UZIH 1QHPA 3FW6A 3UAAA 4K71B 3IFPA 3TX4A 3GB7A 4LNRA 5KUMA 2WD0A 3NFSL 3D69B 1HVXA 3MGOB 5KYWA 5A2KH 4MCYA 5IEKA 3PJNA 1ZLUK 4HKJB 3BP4B 4PD4K 3TWYA 4GI6A 4M3JA 3EBGA 3A24A 4LCVA 1CFQA 4DPAX 2AK1H 4Y9BA 1DSYA 2XV6B 5EZOH 1OVZA 3DK2A 1F58H 3HZKA 4LAJH 1CLCA 2EDBA 2ZAIA 2P5WE 2QDVA 4FG6C 3O3DA 3S9DB 3DSNA 5CZXD 3WMQA 4PV9B 4U0RC 4BQBA 3QO1B 3T71A 4A7TA 4N86A 1ZDQA 5JDSB 1XXDC 3C9NA 5MHSD 2Z3FA 3ARFB 4N1HB 1U92A 4UILH 3SPIA 4JO1L 2ATPB 1J8HA 1LXMA 2ADGB 3C09B 3ILEA 3X11A 2CHDA 1YEHL 3ISRA 3HIZA 1WBXA 2VMJA 2TRYA 3QNYA 4IKNA 5F7MC 4TVPD 1G7PA 1GH7A 3BSZH 5ACZB 1JV2A 5AVQB 3MLRH 2YARA 2VRQA 3DXAA 5IM7A 3U4BH 4L18A 2EAEA 1OCRB 3NAAH 5KBKA 3OKDB 3H8NA 3PHQB 2VDQH 3V7AG 4F5CA 4GMTL 3H9YA 1CGXA 4XCNA 4NQDE 4OF5A 1I7UA 1IAOB 5ERWB 3LZFH 3Q1SL 4Z7OE 5B8CA 5ABAA 3HZVB 4YHNB 5T1LD 4CSZA 2OV0A 1FCCA 3MBXH 2ENYA 3ZJAA 4KKAD 4E9RA 2HRPL 2NYZA 4UT9L 4Y4HC 1BZ8A 4QRPD 3VFPA 2OW6A 2O5XH 3L13A 4OD2B 1EDYA 4UT7H 5CCKL 3NIDB 2OL3A 4XPBL 4P5TB 1A5FL 3ARYA 2W95A 2BSTA 2G0KA 2YC1B 3GMQA 3OF6D 1KB3A 4OV5B 1MCHA 1P4IL 3WXWL 4EN3B 1RZPA 4D3CH 4OZFA 1QFUH 4WHYH 4B27A 3WOVA 6PCYA 1BF8A 1SXBA 2CLVB 2VB5A 4I0CC 3U2JA 2OCFD 4XN4A 2VXTH 1L9QA 1W6LA 4JCMA 4XP4H 4BFIA 1JVKA 5AG8A 1TQTA 4Z5RB 2G2PA 5EUOF 1HZHL 3K72B 2IH3A 4LDOB 3ORJA 1T7VA 2NLJB 4AZUA 1C08B 4OGYH 4Z6AT 3MOAL 4X7FC 4KC3B 5KTEL 1URZA 4ZMAT 1R0AL 1XZWA 3QPXH 2XIDA 3MREA 3ZDXB 2QJDA 1KENL 2FT7A 3FJTA 5DC4B 5DF0A 1RULL 5ITBH 4JDZB 1MIEH 3U0WH 2DW5A 1JPTL 2DL9A 2PYFA 3SKNB 4X4ME 3QZLA 1SRDA 4NKOA 3V0VB 1R3KA 3S5LB 2W65A 2VQTA 1NJ9B 3FQNA 4U7KA 4RISL 3RTQB 1J87A 4Z7UB 2GITB 3OB8A 4RBPH 1MCSA 1CD1A 3LRMA 1SUHA 3UYRL 3QFJB 2ORBH 1HCVA 1ZDSA 4JFDE 5D7LA 4KI5E 2XN9A 1IEAB 2X05A 3VM7A 1INQA 1I8IA 3O6KL 1MCOL 3II3A 4PW4A 5D4HA 4UIKH 1B6DA 4Y7OC 2GVYA 5HYFA 1OP4A 5BJTA 4NI6A 1BP3B 2YJLA 3ZY7A 1SXAA 4PJBA 1NDMA 4MLSA 1KBBA 4XPHL 3MU3A 1CL7H 4I5BB 4NRYB 4JZOB 4WUUB 3NBNA 3CZKA 3HC4L 4GAJL 2WMPB 4HETA 1SN0A 3T2QA 1ZHNA 1H8OA 4YBQC 2FRGP 2YXWA 1YUHB 2D03H 2Z92B 3EIFA 3JWOL 3MCKA 4K2UL 4XOBA 1B2YA 3MJ8B 1FIGL 1NUDA 4XN8A 2IDUA 2JWYA 4M5TA 4FA8A 4IKLA 3IB4A 5IFJA 2R23B 1QLRA 3LIZL 1CIDA 1KYAA 1CDYA 2X0UA 1YNTA 5FLVA 1YMME 5DHMC 2KZWA 1UQSA 3T0DA 1T5XA 3HC3H 4HQQL 1T22A 4JJOA 1GS6X 3LMJH 5D1ZA 1EO8L 3RGVD 3U79A 1YEKL 2FYYA 1TTFA 4EIUA 4J6RL 4CMHB 1PY4A 1INDL 2VXSL 3D4ZA 2GI7A 3HC0A 3PWNB 4WFED 4CW1A 3KJ4B 5IROA 4J27A 3FH5A 1GGTA 1KB5B 2CJUH 2QQLL 4ALAH 3X1GA 4HOMA 3JV6B 3FRUB 1Y0LB 4YBHA 2AJYH 2O6PA 1NAMH 3SGKC 1BSIA 1AG0A 3L9EA 3GBML 1Z9SA 5I24A 4PRDB 4TNWK 4KFZC 1ZK5A 1KJ2B 1Q94B 5EV7A 4DUXA 3FB8B 5CUSL 1AQKH 1FYTD 1RZQA 1OAUH 3EYVA 3QUXB 2A0LC 4PJIB 1Q9OA 4PMEA 4TM9A 2LAAA 2UWEF 3MCYA 1SUJA 5GGTH 3CTTA 3QDHA 4KUCF 2G3ZA 2CHWA 4ZMLA 4GP4B 2C9RA 3EO9L 2J43A 4W9IC 2F54E 1EHXA 3O8XC 1TENA 2DRUA 3WNNA 3VGDA 1J5OL 5FUZL 4IU2A 1X9RA 5TDPB 1QNIA 4Q9QH 5LXVA 2FEEL 1K4DA 1MH5A 1PPIA 4PRIE 5FIEA 1YN6A 1TFPA 5IWLA 4OF3A 1HWHB 2ISDA 4M56A 4Z3FA 5BRQA 4MJIA 1DBMH 2YMXL 3L7FB 2JCCF 1JWSB 2V2TA 4JRWA 1BZ9B 5CEZE 3UTSD 2WXFA 5DFWH 3CZGA 2AXWA 3QSKB 1IB5A 5FEBA 4PJ7F 5D7LE 4LVEA 4CKVX 1HNYA 2OULB 1EERB 5FDWA 1WZ1L 1Z5HA 1EEUA 4WW2A 3C8KA 2HFFB 2R7EB 4GQ9L 4H8WC 3D8MA 1EAQA 4WWKD 5FYLD 5HDRA 4DGUA 5LG6A 1FPTH 3RGHA 4M4RB 4PJBE 4DKEH 3RBSA 2YAOA 1AFVL 3MRPB 4JGJA 1EH9A 2Y5TA 1XTLA 5F7AA 3S3BB 2EVFA 3VFUA 1AQDB 4H8QA 1I1AD 5LCVH 1T0PB 1WO2A 2WKLA 5F7DB 2GK0A 2XWDA 1MJ7H 3R8QA 5DJCB 5KSVB 2MOGA 2BP3A 1TQWA 4X5QA 2ZUXA 3ULUL 4BDVA 2IGLA 2OL3L 2W07B 4GRMA 2F5BH 2ZTBA 4H4NA 5CU9A 3S5ZA 3RWCB 1IEBA 1UM5L 4S1SL 1AYRA 4ZS6C 1E4WH 1TJGL 4GKSA 3HE6D 2N59A 4ZDHA 6FABL 2HT2C 5ITFB 1TZGH 4ZMWA 2XVGA 4IOIA 2P7TB 2GHWB 4P2RB 4ZUTB 4KO9A 3SO3C 4NB7A 2C3HA 4HEPA 5H37H 2ZYIA 3E6FA 1JZ5A 1GGIH 1MIML 4TPRH 4XPGH 3V4PA 4NKDA 1EEYB 5FYKE 1K3IA 3SGDI 1Z5YD 1I7RA 3AQZA 4OM0H 4WHTB 4R3SB 2HWZL 2BNQE 3MODH 1HQ4B 1S7TA 2RA1A 4QXTB 1N9PA 2WXMA 3RNQA 3UL4A 5T1LA 3ZTEA 1V3JA 3SE3C 3K2IA 1CO1A 3BFWA 1PQZB 2MWCA 1P9MA 2P8MA 2PXYA 2QEJA 3AG1B 3OQ3B 4I3SH 1Q38A 1TKWA 3B8SA 1G4RA 1NDTA 1T04A 1MVUA 4QRPA 5DD0H 4C55A 3SOTA 5FV1L 3VE0B 2O30A 1I8UA 1F86A 1TQVA 4K0OA 4L1BA 1IGFH 2IANB 3N5AA 2D7MA 3BVXA 3OF6A 3V4VA 1WITA 4KROB 2DOCA 3ARGD 3TT3H 1JHLH 3P77A 5KSBF 4LHUG 3MVSA 1Q90A 3WY4A 2VYRE 1DJIA 3WEBA 3G08B 3VI4A 4FADA 2LGNA 4Z7OF 4PHXA 1JK9B 2YAFA 4EVNA 3GSNB 1CFBA 2R1YB 3CFEA 4G8FA 5IB1B 2CG9X 3SPHA 1INEH 4FGMA 3OMIB 3ASNB 1MF2L 4IJ3C 1FNLA 3AQDA 3IT8D 4AIZA 1MVFA 4GKNA 4WHDA 3BO8A 4JFXB 2HZHA 4KGLA 2B08A 4QHLA 3CUPA 4YZFE 3I9GL 2NX5D 4UNTA 2CKNA 2BCMA 4GI9A 4NQSA 1HCFX 2XG5B 1OTUC 2ZD0A 2WZ6A 2BHZA 2CZNA 3TCXA 3IJ9A 4HIEA 2CK0H 3PV6A 4Q2ZB 4XBPB 2F58L 2CRYA 2XU9A 5GZND 3DBXB 3TU6A 2I9LA 1SLVA 4K7FA 4S1RL 3B9KD 4FN0A 4ZXBB 3DRTB 2HFGH 4Q0XL 4Z0BH 4W6YB 3NCXA 3FQRB 1K3ZA 3OKNA 5E8PB 3EG9B 1UVQA 2ZUYA 3D3VA 4RWHA 2ZCKL 3H0TA 2NW3A 1TUPA 1F4WH 1QSFE 4BSWB 2ZJSL 3TYFA 1LO4L 1Z7JA 3CSYA 4UZGA 4XT1C 4Y5YC 3ROLA 2CR0A 1IAIH 4DVRH 1GHFH 1FBIL 3DA0A 3KYOB 4NQCD 3FRPG 2VAAB 4AQEB 5EU6A 5AZ2H 3NG5A 2W81C 1PY0A 3HUJB 3OZLA 4KI5F 1OARH 5TQ2L 4ZZKA 1F97A 1ITBB 4GO8A 2BIHA 1AACA 4KJPD 3MV8E 3PP4H 3RPKA 3F62A 2FQGA 4FQPA 5GSVA 3INUL 5E2WH 3ZTJH 3BH9A 4ODSL 1F13A 1HOEA 4ABQA 3EGSA 4O51A 3T0EA 1DQML 2F5AL 2WGNB 2WC7A 2LE9A 4HDIB 1ZV5A 2WZ0A 4KWUA 3U0PA 1WIOA 2VABA 3RGVA 3CVBA 4U05A 3QUYD 1PCXA 3KBEA 5LGJA 3F6IA 4H1LG 4LDEB 2KHAA 4KY1H 1LDPL 2BP0B 3GUFA 2NZ9D 4HW6A 3PGCB 2R29A 2EO1A 3I84A 5HYJD 2FLRT 4TV3A 1RZGB 1YNKL 4NP4L 1UXSA 3EYSH 3BLPX 2JKJA 4JCLA 5IMMA 2ETWA 4IRZA 2D7PA 2IPTL 1J05A 1M9WA 2APTA 1T0OA 1ADQH 5F7UA 2ZX5A 3CFNA 1YYML 4G7VH 5FF6B 1MFAH 3VXNB 1FYTA 1EGJL 1QR4A 3ARQA 2UX6A 2FLMA 4QD2E 2IGFL 1JWUB 4MB4A 3DI3B 4FQXB 1NFDA 4NO2A 3DGDA 4RBPK 1HHGA 4GKOA 1EZVX 4J8QA 4TL4A 1S5IH 3VXRD 5D6CB 5ILTH 3ZYIA 1FDLL 3RWEB 1I3UA 3STBA 3U6XA 4F80A 4U3SA 2ZONA 1JRHL 2HVJA 3HZYA 2LT9A 2CJTA 1P6WA 2JJVA 3U9UA 1LD9A 2E6QA 5KBLA 1YMHA 3L3KA 1R19A 4X8GA 4JPKH 4MQSB 3K74B 3P3YA 5AWNL 3COOA 2WLMA 1YEIH 2DIEA 5AW6B 1L0PA 5C86A 3FUHA 4EUPA 5MEQA 4UQDA 3U7WH 2VDLL 3ROOA 5E00B 1IM9B 4CSSA 5KZCD 2R0WL 1SLUA 4IRJC 1JPFA 3KBHE 3DX7B 3TVMC 3AABA 4TVPL 3UTSA 4MDIB 1WZMA 5I9QB 1G0XA 1BYOA 4ZX4A 1IM3B 2DQTL 3MCLL 1MG3C 4OLEA 5G4OA 1WCBA 4ZOBA 5DHVB 1AP2A 1BF2A 1SEQL 5DS8B 4KO6A 3TA4D 4WWKA 4I4WA 2O5ZL 2Q0ZX 5BV7L 4LSUH 3L5XL 3CSPA 1UEYA 3EHBC 5FO7B 3CZJA 3FPXA 3ULVF 2DH2A 5CCHE 4UAOB 3D3VE 5I19L 3RFZB 4YEEA 3JT2A 4FQQB 1HL8A 2NYYC 1I1AA 5ESVB 3IS0X 2X4PA 3EO0B 2G9KA 3JWNH 3BP7B 2MCMA 2EUVA 5JIQA 3I74A 1DYZA 2DWEB 2NY0B 2EE0A 4I0KA 3CH1A 2E4FA 1E6OL 5EU6E 3QYMA 15C8L 4QOKB 1CG9A 4PY7A 3ZKQD 4EEEA 3LRSA 3UG5A 4ZYKB 1ZOXA 1M6UA 3V4VL 5ANMA 1IE4A 5AYUH 5C2UB 5EN3A 3HE6A 1GZQB 1JNLH 3ECBA 3PPEA 4ZUWA 5IVZB 4NZRL 3T0EE 3JUZA 3NJJA 4RLDA 4FMFA 4GIPD 1R3HB 1XGQA 2FDBP 3BEVA 1ZTMA 4J1UB 4ODUA 5J3HD 1OSPH 1PKQA 1S7WB 4JFUA 3BAEL 1GYCA 1BD2E 2E9IA 4PRHD 1F3DJ 2AEPL 1JHKL 2N01B 2NDGA 2EADA 2VH5H 5TDOA 3UGUA 3UC0H 4X50A 3W9EA 5T1DH 1X6LA 5JDJA 5IMKA 3VWJC 4J3OH 2G75B 1NC2A 4KH9A 3LV3A 3GSQA 4MJ4A 3QDGD 1CD9B 4P2CG 5JHMA 2Y7QA 2E0PA 3EJCA 5E8EB 1EO5A 4WV1C 2FB4L 1TO5A 1KY7A 1BAGA 2Z7WA 1FVDA 2XXFA 5I1AB 1ZKAA 2ZXGA 1A4KB 4PS8A 3ARGA 3FN3A 1EAPB 2ZG3A 2QPDB 2Q8BL 3K91A 1CL7I 2KMWA 3MV01 3QNXB 3LKSA 1UH2A 4XNUH 4X2UA 4UTAH 1C16A 4XN1A 3GNMH 2ZQKA 1ZS8B 1JYNA 2YPLB 3DX9B 4LNVA 5C07D 4DZBA 5BMFH 3KJ6H 1DHKA 2ZWLT 1CLZL 3B2PA 2VR9A 2YFNA 4X80L 1MCEA 4DZ8B 3SB3A 1NBZA 2Z34A 1GRWA 2VLME 4MJ6B 1SHWA 1XR9A 3BZ5A 4U1GB 1X5YA 3O41B 4UQEA 3L2NA 2JJTA 4XC3L 5I1HH 1DBKL 4F58H 2HN7B 3WEAA 2NX5A 3H42L 2OLDA 1X5ZA 2OTUB 4IGBB 4AJWA 1W72B 1DFBH 3KGRA 4NRZA 1Q9LB 2OSWA 3L16A 3PQYD 4YSUA 1T20A 2X4UB 1NCCH 3PFUA 5ANHA 2APFA 3UBXB 5AUMA 5J13B 4J39A 1Q72H 5GZNA 3RWDB 3BKML 3B9KA 4JE4B 1U8CB 5DHDA 4YLBA 2JB6B 5DC2A 3ASOB 2ZXQA 2QVIA 3FTGB 3K6IA 1JXJA 4HK0A 5DJ6A 5T1JA 3QRFM 1KJMA 4YZFF 1L5GB 2J6EH 3JV4A 4JPVH 4MA7L 4H0LC 5CBEA 1I4FB 3FTUA 3H9SB 1UB5B 4K7PH 2XTJC 3E2HC 2WKOF 4NQCA 4H8WH 3ILQC 2ZWKA 3V0EA 4Y4FD 1FI8C 5AFAA 3SYCA 5IESL 3KW8A 4LLYB 5C0AD 5BRPA 2GUYA 4JAMB 4OR1A 1NCWH 5HDOA 1ZT7A 1KCSL 4X6EB 3VJ6B 3DLQR 3PJSB 1TJXA 3EZ8A 2IDFA 3SKOA 2ZUWA 5CSBA 3KG5A 5T3ZD 3DVFA 1UJ3A 2PYEE 3JVGA 5IJKC 4I3GA 1UURA 2VR8A 1UB6A 1N2RA 3NUKA 4FMKA 4OQ1A 4TN9A 2HPOA 1DE4B 3UTTD 5I5JA 4P5MA 1ZT4B 3JWDL 3RHWK 3ZXAC 4ACPA 5HGBA 3I9IA 4E9WA 4ZPTA 2KL6A 4OLYH 4GQPH 4Z7NE 4QHKJ 5GRWA 1T6VN 5I5MA 3FT4B 4P8QA 2HJLB 3KPOA 5TGBB 3QZWB 2GW5A 5HJ3B 3CVHL 3FOLA 4UQBA 3DYMA 4JGMA 5DRZB 4NBXB 1I7TB 1N3NB 3TYGL 4F93B 1YYLL 1MLBA 3IBOA 3F12A 2CLZB 1BJMA 1X5XA 4AQOA 2OJ1A 1MCJA 4L8SA 3MRDB 2WLZA 5BS0D 5L9DL 3F58L 3MRRA 3TEXA 2WQ8A 4B0MB 3KLQA 4JFQA 1ZJAA 1TLKA 3AS0A 3V4UL 3RZCD 3VXRA 1TYEB 2A6DA 2Z1KA 1XEUA 1BAWA 4RMWA 5CWSB 5DJ2A 5HGHA 3P73A 3RX7A 2Y4SA 1BYNA 1J9CT 3WNKA 3RVVD 3IDJB 2V4LA 1W91A 3FTYA 2BP8B 5CU5A 4LLDA 3QHZH 2WVVB 5I1JL 1M2OA 5D7KE 4YAQA 3SDYH 2VDNB 4S10A 1OW0C 3W39B 3BYYA 2EVJA 5C0GB 4LCYA 2EUWA 1LE9B 4W6XB 5JA8B 4JFHD 4QRTB 2IDTA 2F68X 4HHAB 4AQAB 3ULUC 1IFHL 5HVHC 3I6KB 1T66C 3OKEA 1L9MA 1CF8H 3MRCA 4RZCA 5JIKA 4HKXB 4HA1A 3NACL 5KVDE 3PCYA 3S88H 2H2PD 4K15A 3BWUC 3KWUA 3MMEA 3VACA 1XF4B 2Z31B 4X6FB 3TJEH 4HYTB 3AG3B 2CO4A 1XGYL 5GISL 3BISA 4MA3A 4FA6A 5FYJE 1HNGA 4N8PA 2XQ0A 3SBPA 4NC2B 3N50A 4N85A 4XNMA 1CR9L 5D7SL 3QXWA 1BQHA 1JPEA 4I1NB 5F3HA 4J3TA 5T1MA 2Q9OA 4XCYB 1H9VA 1E27A 1FGNL 3FT2B 2XKSA 5GRYA 2AS5M 3MLWL 1ZWIB 3LIUA 1QLEB 4P2QD 4OCLC 2EIKB 1O9WA 4YXLH 4S2SB 1I3RB 5IREA 1KXHA 2KERA 4OKDA 1F1GA 1B4TA 3SKMA 3NDZE 1SYVA 4Z77A 4MNQD 4Z3JA 1UZGA 1QFWL 3QYCA 3KPRB 1AJ7L 3QQ9C 2X5PA 4M7JH 1MJUL 2Q7YA 3W11D 4CVXB 3CLFL 2IBZX 3KPMB 4FTVE 3KPNB 1RZFL 4XOCA 3WFDL 2VLJD 3RB5A 1J10A 2HLEB 2DM4A 3ISWA 1B2WH 2NY2D 4AEIL 2G5BA 1F6AA 1ML0A 5IQ7L 3QEGL 4HX1A 1AO7B 1QQDA 2AXHA 2NY3D 4N90E 1AZRA 1QI3A 1P69B 3MGAA 3QH3A 1NGWB 2G3NA 2VDOH 3NPZB 4AYBA 3EDJA 3CFKB 5F9OL 5AEAA 3QDGA 1HXYB 3OZ9H 1MJ8H 1RD6A 3V2AR 2FEDD 1OZTG 4P23D 1UATA 1CE6B 2WLIA 1RZIA 5EO1A 4L37A 2VXVH 3MUGA 1GPOH 4X4YB 2AK4D 4MZRA 3LNEA 5BOZG 4BHUI 3FQ2A 3VXRE 4FLRA 2KKQA 2X4QA 1MCRA 2NR6D 3UGXA 4GRLD 5G4NA 3T08A 2KUTA 2IPKB 1HILB 2X12A 2X41A 3GSUB 2H26B 2CE6A 4LLUA 1QATA 1HEZA 1XB8A 4QT5A 1QR1A 3BDBA 5IVXB 1NBVH 3QO0B 5EZIH 2VRKA 3LH9A 5D1ZC 5C07A 4AVHA 4JO4L 3G6AA 1C8QA 1S9KC 3QQ4A 3QPKA 4XODA 1P7KB 1MPAH 2WXOA 3UTPE 1GMEA 1M7DB 2NY1C 3DV6A 3ETSA 5IROC 1E8YA 2FR4B 3B7YA 5DT1H 1D5ZB 2W0KA 3FF8A 1A0QL 3ZQXA 3BAWA 2EQDA 4LASL 4ZSOB 1RHHA 3MJ9L 3OJDB 1F2QA 1LO0H 1Q9WB 1UA6H 1YEDA 2BY0A 2CO2A 3IFOA 4A2EA 4ATTA 2YPVA 4HWZA 4YR6A 3STLB 4HAGA 3VD3A 1BVKB 3PQYA 4AYFB 3GXNA 1QZNA 5FWRA 2WWNA 3NA9L 3D18B 3KPSD 3WLWC 3IAPA 4M5YL 4YHML 1Y7VA 2AHIA 4RRPM 4K9EC 4ABVA 4WEBL 3WS3A 4L8CA 4IQHA 4JHAL 4Q97A 1S5HA 5DQ9A 2B39A 3QPQC 4K23L 3WIHA 2H0EA 1PZ2A 4FLHA 2CR3A 4E9XA 4F8NA 4HWEL 2FUQA 2J8OA 2AQNA 3HCVA 1I1CA 2FO8A 4ZAKD 4M7ZB 2BZDA 4MXVF 5E1AB 5C08D 3LHPL 4OLZH 4R8WL 2X3CA 4XNAA 2W88A 4X5XA 5IWLC 4Y4FA 1IJNA 2OCCB 2IQ9H 4TQEH 3W37A 5SWZD 3BPLB 4B7IA 4XXWA 1U8IB 4BZ2L 4F92B 2UYLB 3SQBA 3X2QB 2HJKB 2BXZA 3HFFA 1MUJA 3TXAA 4KHXH 4Y8DC 1AKJB 4YHKL 4WW2C 3FUNA 4MLIA 4ANXA 3A6CL 5CGMA 3UTTA 4EDWL 3TN0B 3S3DB 5D7IB 5E99L 1DTUA 4RMBA 1QMUA 1WA0X 4JHWL 4CBPA 3GD1C 1MI5B 1JDDA 4G8EA 4NJAL 1XDTT 4E9QA 4XPBH 5CZXC 4F37F 4F7CA 5I5RA 1A7PH 5D2LF 3FB6B 2VDPB 1IGIH 4U1NB 3CX5K 4PJCE 1TPXC 5IT2H 1FZJB 1XR8A 2UY6A 4N2DA 4TULL 5BS0A 4KTGA 1T1ZA 1XT5A 4WKXA 4RDBA 2FT8A 3IDIA 2HH0H 4PJXE 3EF7A 3HLKA 3N1MC 3RZCA 4Z7NF 5KTEH 2ZKMX 3MOAH 3WFBH 5JOPD 1N64L 5F6IB 1BOGA 2FE0A 5FXCH 4D9QD 3LRKA 4M61B 1KENH 1Q4NX 4BM7A 2IFGA 3D9AL 4ETYA 1H3XA 2VISA 3TA3D 3TPUA 3WJMA 1H5BA 3WKNA 1W8EA 4G43A 3PWLB 1X44A 2BINA 4L1TA 5A16A 1KY6A 3E8VA 3VYOA 3K3QA 1WDAA 1XIWD 4KZEH 2AV1B 2DAVA 3IPFA 3QWNA 5CP7B 4RISH 4P3CH 1ES0A 1OE1A 1LLAA 1UT9A 1FO0L 4K07A 4KKAC 1P9MC 1M4KA 3UZQB 5HY9B 1OEZW 1UM6H 1B3JA 1G7LB 4IKIA 3VXSB 5FO8B 3FN0L 3A23A 5F9JA 1FZOA 1LDSA 5E6RB 3CDGA 3REWA 3WKMH 2YAPA 4NQEB 1FFNA 2OM5A 3GBEA 4LKCA 2JJSC 5DCCA 4MXWL 3WIIL 3X1FA 1KELL 4GAJH 1A7NH 5D8JL 1ECZA 1R5WB 1WUNT 1E67A 3O9WD 4RGMC 5GGSA 4Y4KD 2R15A 1L9TA 4EIZC 3WGVB 2BVQB 2MOQA 1X4ZA 3VSUA 2YD3A 5JIPA 2WUCH 5FCSH 5IQOA 2YD5A 1OLZA 1JGDB 3CFCL 4XX1G 2HJFB 5IQ9B 4HUMB 2DB8A 1CQKA 1HSBB 1MG2C 1KCLA 2X4OA 3EBIA 1RZKL 1P4BL 4TKWA 4P2QA 2GJ6B 3QIBD 4I87A 5E2TH 5EC2A 2V5MA 1ZT1B 1NGQL 4IHOA 2Q3AA 1ONQB 4HMEA 3BUTA 5D71H 3FH8A 4LSPL 1A1OA 1KIPA 4PG2A 4YQXH 4MNQA 1QRNB 4LDLB 1CF1A 1SLWA 4FLSA 1PIFA 3U4EB 4LFHG 4KH2A 1TTAA 1PAMA 5CIPB 2EDQA 1WFMA 1FORH 5BVJB 5KS9A 1U2YA 3O0RH 1BREA 2VLJA 2XZQH 3H3BC 1UJTA 2B1AL 1HHJB 5IV2A 4WWPA 4NQXB 1QVOB 1TIUA 4BFOA 5FFLA 4KAQH 4W9ZA 4HJTA 4G71B 5E6YA 3HJ0A 2LVCA 5F1OB 5C2BL 2ADFL 5DFTA 3OGCA 2G4EA 3O4LB 4NXSA 2C4XA 1JGUL 2KZKA 3AG2B 3D52A 5KBDA 2YPVL 4ZQKA 1HDMA 4JPWH 2AEIT 5DMKB 5FHAL 4X6CA 1ND0A 3B7RL 2VITB 4CVWA 1D5BB 1W0WB 3L8QA 2AK4A 2XRAL 3QEQD 4I48B 1IC7L 4HT1H 5E08L 1FVEB 3ZQ9A 3Q1EA 4WO4B 4GRLA 3M6DA 1L0YA 4XWOD 4WTWA 4OLVH 4AK2A 4HWBL 1HEHC 2F74A 3DVNB 2GTZA 4XI5C 5F71A 1BXVA 5L2JA 2FIRT 3RGVC 2YMXH 3NFNB 2BVTA 4JVUA 2PCXA 1U58B 3ARVA 1RV6X 3K71B 2ATKA 2P52A 3QA3A 2MHAB 5CN2A 1ZVSA 3FQUB 1SY6A 3WE6B 5EA0L 4N0YL 4JQXA 4R26L 4Z7VF 4XP9H 5K9QG 2PF6A 3RPBA 4Z9KB 3EF4A 5IHZB 1K5WA 4JKNA 2BX5A 4NBYB 4Y2DD 3SY0B 4B0MM 2BPBA 4MTMA 3GXMA 4GQ9H 5EWIL 2BHUA 4YHIB 4EXPX 4Z78A 3DOIA 2XKNB 3T6XA 2W80C 5ELIA 3WNLA 1NL0L 4KDTA 3VWKB 3N1PC 3RIAF 1AFVH 2Z6FA 1AD0B 4NBZB 1TNNA 1ZIAA 3C5JA 3KPSA 4G6KH 4LL1A 5IMOA 5CHNB 3QDJD 4AMWA 4MJHA 4Z3HA 1A14L 2EACA 5AOKA 2VXQH 4DAGL 4ZMVA 3SZ6A 1QO3A 3N1FC 3JWDC 1W72L 5KEZA 2JNZA 4LOFA 1E8WA 2Q5BA 3N43B 2NQCA 2BFVL 5FFGA 5J1TC 2AQ2A 1AAJA 1S8DB 5DUML 4ZAKA 5C08A 5ID1A 1N6QL 4OZFH 1BXXA 1YAZA 3LB6D 2BERA 2XVKA 2BVOB 3AU1B 4LCCA 2Z1PA 4XMZA 3SDXB 5HYSG 4GI8A 2MQCA 3KPLA 4W1TA 5L7XL 2JTYA 3KYKH 4N2FA 3SGJC 5SWZA 3ELAT 4PJ9D 1FN4A 4OBRA 1L7TL 3SQOH 1G7MA 2IV9A 2VDKL 1HI6A 3PWUA 3ZLQC 1IILE 5K1NA 1TJHL 4ZX6A 1DBAH 2RAMA 1WC7B 2FHBA 1EEQA 5E2UH 1I8LC 4BEIA 3GSXA 4NN6B 2HWZH 4LLMA 2EE6A 5C0BB 4NOBA 4WWKC 2WIIB 3HR5A 3X1NA 5IW6B 2Y6TE 4Y5VB 2WUBL 3DC0A 4WDIB 4XE5B 5EZJA 3UPRB 4AY0A 2HCZX 1JZHA 1NUNB 5CEZH 3DTXB 2VWEE 3EADA 5EH1A 4PJFA 1I1AC 2P28B 3ZUCA 1WICA 2Y72A 1MFDH 1MVYA 2YFOA 3FSWA 3FF7A 2OXHB 3L4XA 3MA9L 1I1YB 1FJ1B 4UM8B 3KNBB 4MKTA 4QHNB 3A4FA 3MRHA 3HE7D 2W94A 1UZ8B 2OK0H 1N0XH 3PGDA 1KLUB 4G7YL 4H0HB 5GRUL 1UOWA 3WLBB 4LLWB 1RJZB 3QXDB 4KKCD 5C3TA 2Y07L 2Q87A 1WBYB 4PP2B 3HE6C 3Q6FB 4M7LL 4CNIB 5KYXB 5K9OA 3V8OA 2E9WA 4UOW1 5IB4A 1TQBC 1OM9A 1U3HD 4YWGL 4AJYV 5BPPA 3WENA 4BIKA 5L4MA 1S3KL 3TA3A 4EAEA 3KHOA 1QI5A 1V3MA 4ES8A 1T1YB 2BY3A 1JI1A 3V9CA 1QNZH 1XIWA 4HLZH 4GINA 2V7HB 3DBSA 3I9GH 3VNZA 1UWYA 3K2UL 2AQ1A 4ZW6A 5GSRA 3F84A 2L7EA 3FCGA 2D7TL 4TSAH 1WZAA 1OM3L 3CFBA 1CJYA 1DEEB 1WV7T 4QRRD 1LK2A 1LM8V 1AGCA 2GIYA 2FL5A 3BJLA 3B2VL 4RGND 3C60D 2XNAB 2APBA 3O6FB 4U1KA 2CBMA 2F58H 3PG2A 5FA4A 4KUZL 2OYKA 3SJVE 3BFOA 1DJXA 2BOCA 3L3GB 3L4VA 1GSKA 4NJ9L 4BZ1H 2P5ED 3CFDA 2VQ1B 3DOHA 1T0NB 3IJYA 2VW7A 2ZCKH 5GS3A 4DN3L 5KBNC 3ARGC 1A64A 5E70A 3UYPA 2H6PB 1MCNA 1LO4H 3O9WA 3IGFA 4JR9L 5CEXB 4PJ8D 3PWPB 4GRWB 4Y4KA 4JPIA 5KN5B 1Q9KB 2WGXA 4FNTA 3THML 2L04A 2OJZL 3GEFA 1NPUA 4E0RA 1AG6A 3GJEA 4C4BA 3QWOA 3DMMB 1LWHA 5EUOB 1BQLH 5TQ2H 1H15A 4DN4H 3QS2A 2H0FA 5C0RL 3FQWA 4HPHA 4F7PB 2DLFH 5GJSH 3QQNA 3RWJA 1NICA 1XCXA 1JBJA 3OL2A 3QCVL 2OMWB 3QEHB 3NIFE 4K9EH 1UA3A 1AE6L 2JJTC 2FQEA 4LAQL 2WINA 1CE1H 4NENA 1ZCRA 2L8AA 2FSEA 3LS4H 1R5VA 4P5RA 1FSKB 5CN1A 5E4EC 2DQHH 4OCNC 4GMSH 3OR7B 3B43A 2HYMA 5KAQG 2QLYA 5I8KH 2NOYA 1KACB 3U0TA 1ID5I 4S1DD 1KIQA 4YHZH 4EOWL 2DQ6A 3NTCH 5GZNC 3TNNA 4PS4L 3TO2A 1NFKA 3B9KC 4U0QB 4DIXA 3AU0A 4QLWA 1B4JL 2ZWYA 3EFFB 4OCSH 1VSCA 2Z64C 5C09D 1V54B 3HS0B