1AAJA

Crystal structure analysis of amicyanin and apoamicyanin from paracoccus denitrificans at 2.0 angstroms and 1.8 angstroms resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
b'DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMICYANIN
publication title Crystal structure analysis of amicyanin and apoamicyanin from Paracoccus denitrificans at 2.0 A and 1.8 A resolution.
pubmed rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 26
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1992-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1aajA00
1MZZA 1RZQA 3QJTB 3AG2B 5I5JA 1AACA 3UGEA 2GB2A 2DWSA 1RKRA 3TA4D 4Q8BA 1IBZA 2DY2A 2H3XC 2VM4A 1MG3C 3H4HA 3FSVA 2R7EB 4DPAX 4HIPA 4DPCX 1NICA 1GS7A 2FQFA 2PPFA 3ABKB 4N8UA 5PCYA 3T6XA 1HAUA 5I5IA 2J57A 2JXMA 4DP7X 4GY4A 4E9SA 5D4JA 1OCCB 1L9SA 4PAZA 5IY5B 5B1BB 2TSAA 1PZBA 1A4BA 1XB3A 1BXVA 3FU8A 3OD3A 1GR7A 3DTUB 2QPEB 1KDIA 1W6WA 8PAZA 2VMJA 1KBVA 3EF4A 4KO9A 3SBPA 1AS8A 1JZHA 3S8FB 3QJVB 4UAHA 3WG7B 1NTDA 1L9QA 3CVCA 3PCYA 3IEAA 1TKWA 1SF3A 3NP3A 3CVDA 3ZDWA 3SQRA 4QLWA 3IBOA 1VLXA 3TBBA 4BXSV 1AG6A 1TEGA 3HEIB 1NIAA 2DWTA 2I85A 5AZUA 1ASQA 2GSMB 1WS8A 4G7SB 4AZUA 3X1GA 2GI0A 1ASOA 4JHVA 2IDFA 2WO2B 9PCYA 2I7OA 3TASA 5I6OA 2UX6A 1MDAA 2H5UA 2EILB 3S3BB 1RZPA 3X2QB 1BQ5A 3NSYA 4KNTA 5I28A 5B7MA 3FU7B 5I6MA 2HX8A 4GP8B 4GYBA 3ZX1A 3PAUA 4NERA 3WKQA 1ILUA 3QPKA 4AKPA 2HZHA 1GYCA 1JXGA 4N4YB 3N55A 4DP5X 1ET5A 1OE2A 1V10A 4K9JA 1OE1A 1HFUA 2XUWA 1MZYA 4HHWA 4DP2X 1OCRB 1GY2A 4A68A 3NJKA 3ZBMA 4BWWA 1YLBB 2XVBA 5F7AA 1ZPUA 3S3DB 3BVDB 2BO0A 1JVLA 1EHKB 2IDQA 4W9ZA 1AG0A 1AZNA 4GXFA 2DYSB 4HALA 1WA0X 3DKHA 1PZCA 3AG4B 3NJLA 5A7EA 3AZUA 4BWTA 3DIVA 1ASPA 2N0MA 1ZDSA 1ETJA 3FYEB 3N2JA 2BP8B 4WKXA 2W8CA 3CDZB 3NP4A 2JKWA 4GP4B 2FQEA 2VW6A 1B3IA 3T6VA 2BZ7A 3HB3B 4CSPA 4E9XA 1A4CA 4X4KA 2PP8A 2AFNA 4YSAA 1PLCA 1WA2X 2CUAA 4E9VA 3TBCA 1I53A 2Y69B 3H4FA 4TXVB 2PP9A 2UXFA 3NYKA 3V9EA 4BXVA 1WA1X 1X9UA 4BDVA 1JERA 2ZWNA 5B1AB 1CUOA 1ET7A 3MBWB 2TSBA 1XB8A 1A65A 1PNDA 2YAPA 1ZDQA 3AG3B 1BXUA 1TU2A 1CYWA 2PPAA 4YSCA 1AOZA 1JOIA 2IH8A 3WKPA 1OCOB 3GYRA 6PAZA 1SDDB 2IWFA 3UABA 1BQRA 1JZGA 1AS7A 1J9RA 3X1EA 1UATA 2XX1A 1AR1B 2YAQA 3NSFA 3FYIB 3NJIA 1JVOA 2XU9A 1IBYA 3UADA 2MRYA 4AKQA 1OF0A 4M4RB 3CG8A 1M56B 1GSKA 2YAFA 1JZEA 1V55B 4AI7A 4YSSA 3X1FA 2BZCA 2HRHA 3FQ2A 3JT2A 4GP5B 2HX9A 1PLBA 1DZ0A 3FT0A 7PAZA 3EHBB 4YSDA 1GS6X 3QJUB 2BWIA 3C75A 4HAKA 5AFAA 1PNCA 2CCWA 5PAZA 4DP8X 1SHWA 1KYAA 4PCYA 1PMYA 4G71B 2BHFA 4NB7A 4G7QB 2J5WA 1E65A 2FT7A 1NIFA 2NRDA 3PLYA 2E86A 3QJSB 4E9RA 7PCYA 2IWEA 3S3CB 3H56A 4HZ1A 2BP0B 1BAWA 2IDSA 1J5DA 3S8GB 3CVBA 2I7SA 2FWLB 4BWUA 1J5CA 4DP6X 1NINA 3CDZA 3EH4B 4YVUA 2XXGA 1JZIA 4HCIA 4KO7A 4UF7C 1E67A 3AY2A 4Q89A 2UXTA 4A2FA 1GW0A 2B3IA 1SFHA 3D12B 2GIMA 4HCGA 4DP0X 3T71A 2AVFA 5I26A 1NPJA 3RYMA 2J55A 1GY1A 1JXDA 1KGYE 3WIAA 3NJJA 4JHUA 1ET8A 2BW4A 1AQ8A 3GXUB 1E5ZA 2VSMB 3OMNB 2X88A 4MFHA 2R7EA 2CJ3A 4E9YA 3FU9A 2Q5BA 1IKOP 4DP1X 2YAOA 1JZJA 2MTAA 5AKRA 4FA7B 2JFCA 2EIMB 2BW5A 4DP9X 4DPBX 2HLEB 2OV0A 1SHXA 2WO3B 2WSDA 1W6LA 1ILSA 4YSUA 4HCFA 2B08A 1E30A 2DV6A 4KO6A 4ENZA 5I6LA 2GHZA 2VSKB 1PY0A 2XYBA 3CZUB 1X9RA 1CC3A 2PLTA 2YAEA 3EH5B 1PZAA 1EZLA 4A2HA 4KOBA 5E9NA 1ID2A 1WS7A 5I6PA 4WTQA 1FWXA 1KDJA 1F56A 3FS9A 5ANHA 3FQ1A 4YSPA 2FQDA 3EH3B 1L9OA 1MG2C 5I6KA 3OM3B 5B1JA 3X1NA 1NDTA 1M57B 4F2FA 1AIZA 1BXAA 3T6ZA 3NJFA 3KW7A 2DYRB 2UX7A 1BYOA 2A3TA 1BEXA 1NWOA 5B7FA 2IWKA 2YARA 3PPSA 2W88A 1E5YA 3QJQB 1HAWA 2VM3A 2Y1AA 4KNUA 1W8EA 2EIKB 3PAVA 3UAEA 4P5RA 1SNRA 2ZOOA 4A67A 1J9TA 4UANA 4CSZA 2IDTA 3ERXA 4DP4X 3WNJA 1KCWA 1R1CA 4KOCA 2YXWA 1JXFA 2P80D 2CAKA 2UXGA 2QT6A 2PCYA 3FU7A 2BP0A 3PXLA 3NJMA 2AANA 1OOWA 3AW5A 3JTBA 5FC9A 3FPXA 2XV0A 1DYZA 5EHFA 1GS8A 1J9QA 2ZONA 5I6NA 1OV8A 2PPEA 3OMIB 1A4AA 1NWPA 2FNWA 4E9QA 2AZUA 1AS6A 1URIA 3TU6A 3IN2A 3NJGA 4JKNA 1NZRA 1WAEA 3FPYA 3L45A 1KV7A 3GDCA 2YQBA 3KW8A 3IN0A 4KO5A 4AX3A 2PP7A 1AZCA 2FQGA 3ABGA 3NT0A 4HHGA 2PPDA 3ABMB 3T6WA 1JZFA 1BQKA 1CYXA 1XMEB 2HX7A 5D4HA 4FAAB 1ZIAA 2FT8A 2X87A 1NPNA 4BDVB 4E9TA 1T5KA 1CURA 4AKOA 4G70B 2XV3A 1SFDA 4YSOA 3PAZA 1BYPA 1FFTB 2BP8A 4G72B 4E9WA 4KNSA 2J56A 4A2GA 1ADWA 3U25A 2FT6A 3ZIYA 3NSDA 6PCYA 1V54B 1FA4A 3FSAA 2HXAA 4G7RB 1KCBA 2IDUA 4YSTA 1NIDA 1OE3A 2EINB 1SF5A 4BK5C 3NJHA 1QLEB 2VW4A 5B7EA 1J9SA 2P80A 2PCFA 2XX0A 4W1TA 2QDWA 3QJRB 3G5WA 1IUZA 3FSWA 4F7KA 1IC0A 2OJ1A 2YXVA 3ASOB 5B1KA 2OCCB 3MX0B 3IE9A 4YVNA 1NIEA 2YAMA 3WI9A 2FJSA 5B3SB 2IH9A 5TK4A 2FTAA 2GC4C 2EIJB 2RACA 1QNIA 2CALA 4M3HA 4F2EA 3UACA 3ABLB 2XWZA 2QPDB 1PCSA 2XLLA 1SJMA 4YSEA 1N68A 4RH4A 3AG1B 3FQYA 1ZIBA 4QKTA 4YL4A 5LDUA 1L9RA 1A8ZA 2XXFA 3FSZA 1OCZB 2GC7C 4P5SA 3UAAA 4YSQA 1N70A 5I5MA 1AAJA 1KBWA 2H47C 2LLNA 4YSRA 4A66A 1SDDA 1A3ZA 3NJNA 4EF3A 1AANA 1AZRA 5D4IA 5TK2A 2GBAA 3OMAB 2YAHA 2HRGA 3SBQA 1NIBA 2IAAC 3ASNB 2CBPA 4NAJA 2ZXWB 5B1JC 3QQXA 2XV2A 3T9WA 3SBRA 1ZV2A 2Q9OA 3NSCA 3OQRA 4A2DA 1TEFA 2VN3A 1AZBA 2PPCA 4ZK8A 1AZUA 1RCYA 4A2EA 1M9WA 1XB6A 1L9TA 2AZAA 3V9CA 2VW7A 5F7BA 1QHQA 2UXVA 4L0PB 3X1BA 1L9PA 3WNIA 1PAZA 1PLAA 2QDVA 3BQVA 2BWDA 1PF3A
chains in the Genus database with same CATH superfamily
1U95A 2Z31A 2ZP9A 4N2AA 1IFHL 2A73A 3L54A 5EOCL 1ED3B 2E7BA 5KG9B 4RDQG 1GXEA 3RWDA 1EO8L 3VFGH 3FCSA 1S7QB 2X4TB 5C1MB 3QUXC 5C08A 5IB5B 1NFDE 1Q1JH 1ZE3H 4QY8B 1RULL 3DX9A 4NRYA 4CVXA 4E42A 2ZKHL 5INCA 3Q8EA 2E7CA 2CNZA 4GRWH 4HIPA 2BIQA 2FIRT 3MLYL 4KMTH 3QK0A 3IMSA 2E27H 3SDYL 3THML 5CF3A 2J8UB 3IMUA 5D96B 5D72H 2WXGA 3RWEB 1RURH 1U4EA 1A4BA 2IF7A 3P4OA 1BFOA 2HMID 3GMLB 3I84A 1XH3B 3IT8D 3CXHJ 5FYKH 3DDFA 5T3ZL 3S34H 1MCJA 3GJFB 5CJOH 5GZND 4ODWA 3BAEL 4AEIL 3S8FB 2D7TL 2VITA 2PO6A 2B16A 3TYFB 1TLMA 1HOEA 3G5ZB 5I16B 4GXVL 4LSVL 2J44A 3STZB 5JYLA 1U8PA 3ARDB 3WJJA 1A0QL 1OAZH 4LIQE 4IIQB 5T3XH 3LPGA 4QXTB 3DIFB 1AG6A 4BEIA 4MXVE 1AGBA 4O58L 1EEQA 1LO3H 4WVRA 3ZZLA 3IS1X 2CBTA 4JAMA 1DANU 4PGDB 3APNA 2VLME 3MRJA 3WXWH 2IBBA 5FGRA 1HHHB 4LLQA 4C47A 1QWHA 3CXHK 5AYUH 2OSLA 3VXTB 2EILB 5LWYL 1T4KA 3IU4L 4K7FA 1DBJH 3DHPA 2X10A 3KPQB 3VFTA 2VN5A 1BQ5A 3GT6A 3P2TA 2FEJA 2F68X 4JO8A 3JWDL 5TE6L 1BPLB 5IVXA 5HHVL 4ZQKB 1O7DE 5SWZE 1FE8L 2AV1A 1TIUA 3JWNH 2OTPA 5DJ0B 1RH8A 3QFGA 3SYPA 1C5DA 2Y5TA 4TNWK 4XOCA 3NABH 1J10A 3QZOA 4XVJL 4IS6A 2L8AA 1AJ7H 5HVWA 1GYCA 1EMTL 4OZGB 1IGCH 2V17L 2XSKA 4F7PB 1KTRL 1ID5I 5KSAC 3T0EE 5EF3A 2GVYA 1QSEB 4A38A 4JANB 1HFUA 3NOIA 1A5FH 3FU6A 2FX9L 2G30A 3M17A 1VKXB 3MCLL 5GZNA 3FT1A 4NPJA 3QRGH 4P9HH 3S36L 4KH2A 3ZLQC 4QNPF 1IL1B 1G7LA 4GO8A 2HVKA 3S3PA 4UUJB 3P77A 1MDTA 3GMPA 4U1NB 3EIFA 3PWPD 3NZHL 4GSDL 3S7GA 4GMSL 3BPCB 3FB6B 3EFDH 2JNZA 3PPEA 1JWMB 1WBZA 5C0CE 1X4YA 3ECBA 1OAXL 3GJFH 5IW6A 3CSPA 4JPKH 5GJTH 1CK0L 2HFTA 3L3HB 3ZYOA 4AMKL 4XVUD 3IMTA 4R5TA 1RZIA 2BMKB 4LHJB 4AENB 4JKPL 4CSPA 1NUDA 1N0LB 2IAMA 4RBPH 1IT9H 4HEMA 5I9QC 5BZDA 3L3GB 2EKJA 2YR3A 3VQMA 1U3JA 4TVPH 1K4CB 1SN0A 2YQ3A 3BXNB 1PLCA 3L13A 3OKEB 3AQYA 1MW3A 4LKXB 5C0GA 5ICZB 1ZA3A 3LZFL 2BX5A 1JGUL 2VCOA 5DRNB 2F19L 3TN0C 4X5WA 1UCTA 3SYCA 4XI5D 1MCPH 4TXVB 3LKNB 3GMOB 4PWJA 4O5LH 1BBDL 4BXVA 4Y1AA 3TJPA 1DVFB 1YA5A 4GKSB 5AW7B 3UBXG 4JG0H 3HNTH 4GKNB 2WTOA 2R1XB 3UAFA 2CPUA 3WFCH 1T6BX 2FD6H 4GRWF 4MD5B 1TVHB 1BF5A 5EZPA 3OB8A 2HUHA 3KPLA 4K9EH 2Q10A 5EOQL 3EJSA 1HVXA 4FXKB 3HG4A 1ND0A 3H0TA 1YN7B 1YVLA 1A9EA 3PWPA 3RBGA 4NFDA 4NN5C 3SGJA 5FLVA 2Y1ZA 4AL8H 5I1DA 3RPIA 3NA9H 1V7NL 4YHKL 1AYRA 3LQAL 1LE9A 1HHIB 4B9ZA 1C16B 4OV6F 1JZGA 3JQOB 3V52H 2XBDA 2O5YH 1D3CA 2WV3A 3ULUL 4OZ4A 3EOAB 3FYIB 5C7XL 2FSEB 1NDMB 1ROWA 3TO2B 1C1EL 3QH3B 1MI5D 2H8PB 3FQWA 4JFXA 4AV4A 3VXRA 4N9GB 3AS3A 3A47A 3B7TA 3WFBL 3QG6B 5IGXL 1DJWA 1EFXB 3QRFM 4Q6KA 4YHIB 1J8SA 2YPVA 1IARB 3DSNB 1RK0B 3ULUD 4L8BB 2YD5A 3K5SA 4YK4B 4ABVA 2JI3A 4FQ2L 1F6AB 2XKUA 4URKA 5DQDL 1YN6B 5CBEA 3ESPA 2Q3AA 2WINB 3HJEA 3QQ9C 4KTDH 1W9XA 1NC4D 3ZQXA 5GXBB 1I7RB 1FGVH 2B8OT 3CLEL 4NZRH 2HWZH 4WFFE 5HPMB 3O3EB 5GS2H 5E6SB 5CIPB 4K7PY 1OT2A 5SWSE 2J8HA 1GGUA 1WE5A 5IOKA 3DO7B 2C9QA 1NFIA 2EXWC 5HI4C 1B0GB 2EDLA 2KQNA 1Z9NA 5F0MB 3IETB 3KGTA 3OSKA 2W0FB 1T1ZB 4HCIA 2DLGA 1E67A 4X80L 1XGTA 1BZ9A 2VDRL 3WIHL 1QLEL 2B3IA 3G5VB 1A4JA 2EEAA 5ICUA 4NIKB 3WMSA 1JGDB 4EI5D 4PG9A 4HUVB 1BW8A 4F7TB 2BDNL 4Z7VF 1NCGA 1H6FA 5FUCC 1CXHA 1P4BL 4KI5F 2R83A 2K8QA 2G9KA 4NQCE 2VE6A 3L6FA 1KTKE 4MA8H 1LWHA 3D4GA 5C9JB 2WZ5A 3BEWB 4NX0A 2VRKA 4O00A 1T22B 2OYPA 1SN5A 3QUXD 3ZUCA 4DVRH 5ILTH 4IEFA 2J43A 2XA8L 3CFIC 2HLEB 4HCFA 3MRDA 2W9DH 4OJDH 2DV6A 5LBSH 4E5XB 4W6YB 3MOAL 3TBVA 1NANH 1WGOA 4ZTEA 4NUJB 1YPZA 4G43A 4G6MH 3EH5B 4HUUB 4YGVA 3ZHDA 1UD8A 3MFFB 3NIFE 1SXBA 4YWGL 2ADGA 3DOSB 4D8OA 3Q2WA 1YAZA 3NQKA 5B3JE 4NHUB 4JVUA 2NY0B 1ACYH 2JKIS 2MQGA 4P07A 1MHHB 5BXFA 4M7KL 5CIPH 4LVHC 1FO0B 5IM7B 4FNUA 3X1NA 1Z6JT 3D05A 3RA7H 2UWEB 1DN0A 4Q74A 3L2NA 2AKRA 1NWOA 5DJXA 4EI5A 2EDTA 1EDYA 1HINL 1A1OA 5I1KH 3OXSA 4LCCB 1ZT7A 3QJQB 3U2JA 1HAWA 2Z92A 2Y1AA 3E2HC 4B41A 4MBOA 2ZG1A 5KUMA 4BFOA 1GPOL 3ARRA 3T77B 1FG2A 2R1YA 4P2RD 4WKZA 1NGQH 1WEJH 3WTTA 3NTCH 1TVBA 3CHXA 2H3NB 4RISH 1BJMA 4X6FA 2YXWA 4Q9QL 4ZZFA 5DD3L 2BOBB 1MSPA 3QUXA 1S8DA 5AG9A 3D50A 2F53A 3W82A 3ZL1A 1KJMB 3DMMB 3TBTA 3WNNA 5E6IC 4TUOA 4QTFA 4N68A 5FO8A 2AANA 3KYMA 4LMQI 1DJXA 4D9QD 1BM7A 5HY9B 4NWUL 2YSSB 5IBTL 1MJUL 5TDNB 5I6NA 4PJFF 4BUQA 1A4AA 1J0ZA 2VT0A 1WWBX 3CZGA 3SGDH 1UD2A 4H88L 1QFWI 4Y19E 5KSAD 5JXAH 2F2HA 3CFEA 3FUEA 1KGUA 3AGVA 2FQGA 2XWDA 1KCKA 1BMGA 4MNHB 5D70H 5GISL 4NPYB 4NQVA 1NAKH 1CYXA 1CLCA 2DQGL 2E6JA 1ZLVH 3HS8A 3G5YB 4PRNA 3CN1A 5IEKA 5C2UB 4JFOA 2EKSA 5EC1A 4BBWA 4HZLB 5DK2B 1SPDA 3AUWB 4ISVB 5ITBL 1A7BA 4OFYD 1T0NB 2HVBA 2BOCB 3O0RL 4UDUB 3Q06A 4L8DB 2N1KA 3S9DB 4HWBH 2RFXA 2WWOA 4S11A 3OC5A 1IEAB 4H25A 5DURD 1ZANL 5D1ZB 2NNCA 2X4NA 3P3RA 4Z3JA 1FO0H 4JFDA 2BVQB 4HETA 3CIQA 3ESVF 5LXGH 4YEFA 4OI9A 1RZFL 4RX4D 4ERSH 3LDBC 2ZXQA 3DK2A 4Q58C 1XZWA 5D7JB 3R7RA 5E8EB 5MI0C 4LSPH 4F7KA 2BSDA 3FT3A 2NLJA 1JGLH 2HH0L 2VABA 1XBRA 1GGCH 3T2OA 2NMSA 1AKJB 1I82A 4ZO7A 5G4NA 4ZW6A 1CFNA 2A6JA 2OCCB 5IJKC 1JPSL 3TN0D 1Q0YL 5JMRA 3OWEA 5BRZD 2F74B 1UVQA 4FFYA 1L5GB 1QRNB 3ZU8A 4AZ8A 4G7VH 5JDJA 2OL3L 4GFXA 4N2CA 1N8ZB 5JUEL 1QUNB 4DCQA 1JN6A 1FV1A 1MCOL 1Q94A 2XN0A 3PQYD 3ILDA 5FW7A 2P5EA 3CFJA 3LEXB 3FUHA 5ID1B 4WEBH 3GLZA 2KERA 5HHOB 1ZTXH 3RUGA 2Z64C 2H47C 5BNXD 1KJ3L 2BIPA 4UMGA 4GMTL 4AGMA 4OFYA 1DQVA 5B38B 3BAIA 3HFFA 3GSUB 2GTWB 2Z4QA 5SWQB 1YYLL 3EOBB 2EDWA 3UG5A 1WIUA 1AQKL 5DMKA 3CHPA 2CRIA 2FLBT 5FOBA 1AFVL 3VXUA 1FBIH 3TO4C 3P9WB 4V2BA 2TAAA 3W0WB 1MFUA 5FCUL 5TH2A 1JHLH 1MXGA 3MV9D 2YQGA 3VGAC 4RX4A 3VI3F 2Y5QA 4JFFA 1OB1B 5DWUL 4XWOC 4Y9GA 4IGBA 4BCZA 2PYFA 4NSKB 2CD0A 3GO1H 2EDMA 4QHMA 1A3QA 1MFCL 3QUHA 3EJRA 4L29A 3TOPA 3WTYA 1QA9B 2YWYA 5EUOF 4MA7H 5BZXA 1RZQA 4TUJB 4MX7A 4H8QA 4YE4H 2NSXA 4XNMB 4S1DC 3P0VL 1F97A 3QQ9D 5LN4A 1BVLA 4I2XE 2IQAA 4YDZA 4L9DA 4X7FC 5DLML 4GUPA 5E8NA 3GBEA 1E2ZA 5HHME 4BV1A 2A83A 4DKEL 4LCWE 4M93B 3CFMA 3VWJB 2HFEB 4ONGL 4X8JA 4WI4A 4QOKE 2EXWD 2VQTA 5HI4D 1BBJB 1GHFH 1D5ZA 2ZUXA 1OGSA 4QWWC 1U58A 4UQ3A 2IO5A 1GR7A 1NEZB 2ZOKA 1U8HB 5IJDC 1W6WA 5KJRH 2F54E 3C8HA 2WUBL 1RJZA 1P7KB 2ATKB 2R0LH 4YHYC 4R3SA 4OLXL 4YLBA 1CIDA 1JPGA 2J6EA 3MX0A 1QFPA 1TENA 2OR8A 1J0KA 3RU8L 4O9HH 5KSBB 4TTGA 1ZA6B 4QJ3B 2X7LA 4WCYH 3I3DA 4MZ2A 4BINA 1FIGH 4Q6IB 2V5RA 1A1MB 5GJSL 3RHWK 3WBDA 1EO5A 1IJ9A 1X6NA 5I66B 1MAJA 1UENA 3FFOA 1TEGA 1NOLA 2YEZA 1YEHH 3OSVA 2DLFH 3VRIA 4JJHA 3KJ4C 1IM9B 1EAJA 3GWJA 4EMZA 5DWPA 1RZKL 3RURA 3SB3A 1QI5A 2UZPA 1SRDA 2H0FA 2X89D 2Z3FA 5I6OA 2XRAH 3S3BB 3UMTA 3S5LB 3FO1A 4KY1H 3O6LH 3F7YA 4X9FA 5EZJB 1T20B 2RQEA 2XPGA 3H9SA 1AXSA 1HIMH 5B7MA 5IOPB 5BUAA 1YEGH 2WHVA 1KN4H 3B9DA 3BH8B 1QNZL 1XF4A 2CHZA 2FBJL 3N9GH 4MZ3A 4TMPA 1UWEH 5KANG 5ISZB 3VSUA 3ZX1A 4PTTA 1WC7B 3AWFA 4N3TA 1ILUA 4WJ5B 4HW6A 5B39B 4WI0B 5KYWA 4KUZH 3O3DA 4FQXB 1XR9B 1ETZB 5JNYB 2ZNWA 4J3OH 4JFEE 1T80A 1K85A 4AYDC 1OPGL 3MUY1 2AEPL 2NY2B 4F1SA 5AZEH 1S9YA 4RFNC 2NOYA 3RTQC 1XF2B 4HF5H 1NEPA 4YDKL 1JVLA 3TNMB 1AZNA 4GXFA 4XR8C 2VXQL 2FRGP 4PB0L 5C07E 1W91A 3T3MF 4X4ME 4OD3H 3V0GA 4QAWA 1IC5L 3QE5A 1DZBA 2UVEA 3FFCB 4MDRA 1FYTD 1R4XA 4NKOB 5K9JL 4OCXH 1F3DH 4F9LC 2C3GA 2WLJA 4OKVB 4AW7A 3RVTC 3MO1A 2EDDA 2JQMA 3JV6B 1ONQB 5E6ID 5HDOA 4KKCC 4RAHA 2MEJB 3SPVB 1G1OA 2BZ7A 1HQ4B 4B50A 3MRMB 2X89A 2NNXA 4C56E 1C5BL 2JKXA 3MXWH 4EKJA 4ELMA 2ICWJ 4O2FB 2CM6A 3TBSA 1QBLL 1VEPA 3VFUA 4F3FB 5DHMC 4C55A 3P4NB 3LZOA 4YUEL 2O6PA 3K8MA 4WRLA 2EXSA 4L3ED 3A4FA 4HBCL 2RIKA 2CKBA 2DLHA 3DUUB 4Z3IA 1IFGA 4IDLA 2VH5H 4MJJA 3RNKA 4BZ2L 1UQSA 1M3IA 2WXIA 1WA1X 3EYFB 1UD4A 5C0JB 1UM5H 1Z5YD 4JBSA 4BCXA 2TSBA 4HKZB 4PJ7A 3ZKMC 3RDTB 5C0DA 1EHLL 2CHNA 2QSVA 4X42A 4CBPA 3W81A 5I15H 5ESAA 1CT8A 2G3MA 3OKDB 2FHBA 2QHLA 1E8WA 1PG7X 2V7NA 4FP8H 3F04A 5CJBA 3FO9B 3M1CA 3N6YA 4NNPL 4ZXBA 4A1RA 3BLPX 1AGFB 4X0KA 4HU2A 2DQIL 1UXSA 4XH2B 4HUWA 4OD1L 1OCOB 4N2BA 4GAFB 1FYTA 5IT2L 4XOBA 3IJHA 2XPYA 3TZVA 3EGSB 4YLCA 2YAQA 2CDEB 2XU9A 3QS2A 3TTYA 5LQBL 4LP8A 3CG8A 2V2XA 4X7CC 3VTTA 5JR1L 1TT6A 1J05A 4GIPD 4PJIA 1C9SA 4MMXC 3QIBC 5L4IA 4JMNA 2R39A 3F85A 2NNAA 4ZYKA 1Y6MR 3AS0A 5HJ3B 3C75A 3DPDA 4CAGA 5C6WH 1E9OB 2CCWA 4YAQB 3GMMA 1Q72L 3FTYA 4LCUA 1M71A 3QORC 4L3EA 4LO9A 4P2QA 2J88L 4HMDA 5EULV 5EU6A 4G71B 2VLKD 3C5SB 4U6XA 3QQ3A 3NZUA 3IAQA 1EUTA 2PTVA 2K3TA 1U3HB 1NIFA 3QJSB 35C8L 2VZVA 1IE4A 2XJKA 3S3CB 3F83A 3CK0L 5TGBA 1Z3GH 3T65B 5KS9F 4PGCB 2OMXB 2XXMB 4OCMC 2D31B 3UDWC 4JJ5B 4LBEB 4LLDA 3OR7B 1YEEL 5DJ2A 3EOTL 1IEBB 3MRKB 1KJVA 2WK2A 1S7RB 3O8XC 3TO4D 4R0LA 1GAFL 4ZFOB 5LUMA 4J3OF 3DGDA 3BAWA 4KPHL 3QDJB 3D34A 4N2KA 2MSPA 3ZO0A 2ZQKA 4Z7UA 5ABDE 2KMWA 2UZXB 3NEEA 5MENA 4XWOD 4PWHA 2DI9A 1AGDB 4MMZB 7FABL 4FTVB 3NIGF 2JLLA 3DETC 4JHWL 2FWOA 2MHAA 5E70A 3ULVH 1IEHA 3FN0H 4MJ2A 2AJUL 4HD5A 4I9WD 4S1DD 3MBWA 5DMIH 2QSQA 2YRZA 4GUCA 2A77L 4ZMOA 5DFAA 2PW2A 3KMDA 2Y9RT 5A2BA 4ODTH 1OEZW 4OCLC 4AVHA 3TYGH 3FRPA 3F65A 4JDTL 3HR5A 1NLDL 4LHQB 1W0YT 4S2SA 1MWAA 3K2UH 2DEXX 4WWKC 3KXFD 5IW1B 2GEQA 4GEIA 5I6XB 3REVB 1XQ4A 2Y06L 1LGVA 4G9FB 4KITB 1MRCH 4R84A 5CCKH 2NT0A 1GC1H 4LSDA 5DTFB 1IAKA 3SKNB 1KT2A 1AC0A 1R5WA 3IGKA 2CDFB 5EC2B 4N0YH 2EDYA 3U30C 4QWWD 3O0LA 2GQHA 2R29L 2QFRA 2RH0A 3QA3B 4RMRA 4YO0B 4CGUB 5BJTB 3H3KA 4QRPB 4X6CF 1HL4A 3FQ1A 4PJAA 3UIYA 4ZX6A 1QD0A 3N85H 4DZ8A 1GKOA 1U8JA 2UX7A 2YRBA 2BJMH 5HBBA 4XP5H 1BEXA 4H8VA 4JLRA 4TL5A 3TEZA 2YA2A 1DQLL 4EQ3A 3L5WA 1HZKA 5AW8B 1T3FA 4Z78A 1C08A 2B9BA 5FS5A 4YR6B 3M8OH 3KM1A 5IHUL 1FFRA 2W9EL 4L5FL 1MEXH 3CN2A 3WNJA 4ABQA 3BWZA 2B1HL 5J6GA 3IGAB 3H6AA 1E90A 1ZE3C 1SLVA 3ARWA 4WHYG 4CJ1A 1JXFA 4G1MA 2CR3A 2EH7L 2R27A 5GZOC 5IQ7L 3D39D 3ZRCC 2VL4A 1P4LA 2Y3NA 5IQMA 1XR8B 1IFRA 5L88L 5GPRA 1OOWA 3AW5A 5D1XA 3KXFA 5D71H 5FC9A 2ADJA 2HG5A 1I8IA 1EEYB 3S96A 1TTAA 1PZDA 5EO0A 5FB8A 4FXTA 2ENYA 3ME0A 4H0IA 3SODB 2X9WA 3G3LA 4JKNA 5D5ME 4AE0A 1WAEA 4WGVB 1KGCD 1AGEA 2WXRA 4AX3A 1X3DA 2W07A 3ARTA 3G04A 3KWWB 4U1MA 1N2RB 4WV1C 1XXDC 1F4XH 1ZVYA 3CBKB 3KM2A 3SYAA 4RMVA 4YDMA 1BQKA 2HX7A 3RTQD 4Q97A 1GYVA 4G8GD 2WN2A 1A6VH 3HS0B 4YGAB 3RX9A 3GJFK 4E9TA 1RIUL 2ZCLL 4L37A 4MHHG 1JTTA 1TTFA 4YX2H 3E7JA 4FFZH 4ODXB 3BGFB 3T8XB 4E9WA 1RVFH 3KS0H 4KX9A 4CDHA 2QGDA 2CK2A 2P1YA 5C08E 3QWNA 2VLJD 3D8MA 4LB8A 5EF1A 3RVTD 1FYHB 4FJ6A 2H1LM 5SV4A 3GNMH 5JHLL 3V0EA 3TTSA 4KKAC 2VZTA 2EP6A 1KIPA 4KKCD 4N2MA 4ZO8A 4KH9A 1UZ6F 1KPVA 3MV01 4GNKB 4UT7H 5TE4L 3NCJL 4F7MA 3MV8D 3GLDA 1R6VA 2QDWA 5LG1A 4J1UA 4AG4H 1J5IA 3D39A 4RWYH 1CDHA 3JWNC 5HDRA 3MA9H 3ULVF 1CE6A 2GHWB 3VXPA 1H3VA 2X6VA 2YAMA 1NBYB 2ARJB 2D7PA 2IH9A 5ETUB 3WNOA 5DJDA 2H32A 2EXYC 5F3HB 4R2GB 1I1YB 3L5IA 1T21B 3HZMB 2XLLA 5CSZA 5F0PB 3ZKMD 4P9HC 4WNQB 1FFNA 5D96C 5EBGA 3DGCR 4PJBF 3W39A 4PBXA 3K8KA 5I8OH 4B9PA 3EXLA 4J3SA 3D18B 5F71A 4OSUH 4G8GA 1IX2A 4KNQA 3MOBL 2FUTA 4LHUB 4F33A 4FQ1H 3KPRE 1DE4A 4PS8A 2YD0A 3U7AA 1EXUA 3ZTCC 1TQUA 1U30A 3S48A 2QKIB 4KZDH 5D7IB 3P54A 4MCNA 3L5JA 4F9LA 3ARDC 3EGDB 2JB6A 2A9MH 2X1QA 3GK8H 4GAJL 3B8YA 5D2NE 3W1ZA 4IIQC 3W2DH 1IGYB 1D5MA 4KBPA 4L05A 3LB6C 5KAQF 4Q9RH 5DHYB 3OJDA 2ZCKH 4XGZB 3W9DB 2LABA 2NY7H 1V7MH 3QIBD 3MV8A 5FIEA 3BDBA 2V3FA 4NBYB 3ZQ9A 1QR1B 2YKLH 2ITFA 3WS6C 5KVEH 1RHHA 2HKFL 3FCUB 4BZ1A 1MIML 1XIWB 2O6FA 3ET9F 2WD0A 3ALWA 2IGFL 3QORD 5HYJB 5ESVA 3WHXA 4GW1A 1JZ2A 3HOGA 5IVZB 1HWWA 2ATPA 3CFTA 3AU1A 3FSVA 4PRBA 1QBML 3WTUA 1JHKH 4H1LA 2YJQA 2JCCF 4K9EC 4OLEA 4PGZA 1UM6L 1RP8A 4CU6A 5B4MC 5I5IA 5ABAA 2DQTL 4UT9A 4GAYB 1OCCB 4AL8C 3BKMH 1E40A 2K4AA 5DJZA 1F1AA 4HCRH 1KJ2A 2WCPA 1CFTB 2YMXL 1RUKH 4BA0A 1XB3A 4QRSA 1TQCB 3O8XD 5C3TA 3SPCA 3EO0B 2Y6TE 1OGTA 4XPFL 3ZE1F 4JKKA 2G60L 1X5IA 3CJJA 3Q8AA 1NAMA 4WUUB 4NWTL 3Q2LA 4P4RB 4Z8FH 1WZ1H 2X9XA 1S5HB 1QVOA 3GINA 3DETD 3PUCA 1KG0A 2YS4A 3EAKA 3QEUA 5TE7H 4A7TA 5DVMA 3RQ3A 3ESUF 2WZPD 3HBZA 4MMXA 2VGLM 1B9KA 3QIBA 1JGEA 4R5VA 2EVHA 2XIBA 5HDQH 1OAYL 2DWTA 4LKCA 5CXPA 4IKLA 2VRAA 5ICXA 3T8VA 4AK1A 2XZZA 1SHMA 1DR9A 1GYUA 4XO4A 3GI8H 5G55A 4G7SB 1JDCA 3M6DA 3VFSA 1BDYA 4AZUA 5IMOB 1E8XA 3WTWA 3GIVA 1PKQB 4WWKD 5CZXC 5E2WH 4GI9A 1OALA 3LNDA 1KTDA 2WO2B 2X28A 2EAEA 3P3TA 4BFJA 3KBHE 9PCYA 4FQJL 4KWUA 5TDOB 2H5UA 3KYKL 1S9VB 4XNXL 3PWNB 5GSRB 3X2QB 5HYIA 2IALA 4HSAC 4WI6A 2P9RA 2Q2EB 1ODAA 5AB2A 3A21A 1DVFC 1RUAH 2VMDA 4DZBB 2I60H 2ZUYA 5AVVB 4NXSA 3UDWA 2WY3B 1LO5A 3EZ8A 5E0QA 3IWVA 3UBXI 4JM0A 1T7XA 1JXGA 3QS3A 4N4YB 2P8MB 1GGBL 1JDDA 1P4IH 4R7DB 3X11A 2DD8H 3O8XA 1OE1A 2DLEA 2DJ4A 1G6RA 4M8UA 4FXKC 4HHWA 1UKSA 1LEIA 3EYOB 5T1DH 3KEHA 1XAUA 3UPCA 3HA0A 2CO1A 4OLYH 1PIGA 3Q9QA 4G9DA 4N2IA 1DEEA 1MVUB 5JW5A 4FKKA 5DMJB 5FWRA 2VR7A 5DLLA 1Z0NA 5FYJL 4AVKA 4JO4H 3N1GC 3LNFA 5FW6A 5K1JA 2VN4A 1FCCA 2JK5B 4YDJB 5FKPA 4JZNB 3EFFB 1BVZA 3A67H 5E1GA 3AJ7A 4H26A 1PD0A 2VDKB 5A2AA 1A6TA 2B3RA 3O2VL 1A6UH 1JCVA 4QYOA 3NK3A 4UYQA 5FYKL 1J0YA 4M5ZH 5GRJH 3S34L 1SDAB 5GZOD 4HH9B 4ZS7H 2R1WB 3LX9A 1RXLA 4G8FA 4ZDHA 1QHOA 3FB7A 4FLSA 5E4EB 5FYJD 4DQOH 1WFJA 5ECGA 1I9IH 2C1PA 2HJFA 2X1XR 3U4KA 3WDHA 1U91A 5CU9A 3IDGB 4YK4C 3C08L 2AJ3B 1QKZH 1RUQL 1Z3RA 3D0LB 2Y0SA 5GRVL 5H35A 1WA2X 2R4RH 1Y07A 5FYKD 5ICYA 3VFOB 4O02B 3H4FA 3MROB 1LO3L 4ZOAA 3TBYB 3L1EA 1IZJA 5BOPA 4AMXA 5J12B 3QYNA 1A7RH 4QUOA 3PGCA 5CD3B 4QT5A 1LDPH 3LZPA 5B1AB 1MI5E 2D0FA 3AABA 2L7QA 4X4ZA 4GS7B 5T3XD 4YBQC 1DBJL 2YRLA 1SN2A 1BVNT 4LNVA 4MQXC 5AOLA 2X9ZA 1NUNB 2E6QA 4KTEL 2BY1A 4A7UA 5KUKA 4L9LB 4U6HA 4HBQA 3RWFA 3ULUE 3TCTA 4XCYB 2HTLC 2X53A 4TNVF 4JHAL 5KBNC 4KKAD 2R51A 3QFDA 4JRXD 2PUQT 3VFRA 1D6EB 1F2XK 5DRZA 4EIUA 2Y7NA 3FB8A 3QG7H 1VZHA 5IQ9A 4Z7QE 4WW2F 2XG4A 3WKML 3MNWB 5FLUA 5A6LA 5FGSA 1UD3A 1YPZE 5AL8A 3D0VA 4PVMA 4IMLB 5I18H 4PVLA 1FFPB 1CPUA 4BE6A 3QGVA 2K0RA 4JFSA 5I71B 4LEOB 3MSPA 3BUIA 4KDTC 1YNLL 1T1XB 2OAAA 2W65A 4AYSA 2G75B 2HX9A 3NCYS 4N22A 2EXYD 2YC1B 4YSDA 5DK0A 4UQEA 5GJTL 1NDGB 3TT3L 3UBGA 1OXYA 3HG1B 4NENB 4WV1A 2VAJA 4MCYA 4XNDA 3OG6B 2ZF8A 5E9AA 4DGVL 4F7CB 1WBXA 1GZQA 1KYOJ 4UQIM 2ZXEB 4JQIH 1D5RA 2A6DB 4OLZL 2EDJA 3NESA 5DUPL 3E8UH 1OANA 3AY4A 4TN9A 3A6CL 5F1SA 1JYNA 1I8AA 5C6TH 5CJ8A 3L9EA 4O02H 4EKXA 1G7PB 5KVDH 3LNEA 1JMXA 1R3LA 2NY0C 2VL5A 4K5NA 1C12B 1FPTH 1SEBB 4ODUB 4HUNB 5EBWB 4F5CE 1MCPL 3AT9A 3ARDD 4LQFL 2DL9A 3LPFA 4O5LL 5C6PB 3LZNA 3S2AA 3SE8L 2UUDH 3D12B 3LB6D 4LCCC 5JMOC 5EORL 4HJIA 2DWDB 2C3VB 1NPJA 1JF1B 1I8UA 4N87A 4L8SB 2FD6L 3CHSA 5I1LB 3VGGA 1HTYA 4PRAB 3HW7A 1KYOK 2WC7A 1NPUA 1ED3A 5KG9A 4K9EL 3MLVL 1YMMB 3B83A 3UZEA 3MVSA 4G80B 6TAAA 4NJ9H 3O11B 2HPOA 4PRPB 2Q8AL 1LO4H 2X4TA 3MUHL 1DUZB 3IGUA 3OKOB 3DMMC 2Y23A 4HIXL 4W4OC 3MRLB 4KHXL 1JZ5A 2C5DC 1N4XL 3KPPA 3C5ZB 3F7VB 3HG0A 3DYPA 2QVKA 2MTAA 3QEGL 4QLRA 3DURB 4UM8A 3V52L 4ZTPH 4UOJA 3OLDA 2BSCA 3B7UX 3KE0A 4QRQB 5C0CB 5IR1B 1ROCA 2WO3B 5B4MD 5INDA 2NTFA 3RWEA 2BNRE 4I88A 2YD3A 1P1VA 1QW8A 1QSED 1BG9A 2PLTA 3K4AA 1MAKA 4HX1A 5KBPA 4P2RE 2P28B 5IJBC 4JFWA 1PVHA 3JV4A 2I9TA 3LHPH 3SCMA 3IDIB 3TYFA 3H42L 3WSQH 1JD7A 1UA6H 3TVMB 2FNBA 4MMYB 2D73A 5I16A 3STZA 3MUGB 3JYCA 3ARDA 4IU2B 4PJDE 3VRLE 3ATFA 3MLUH 3E80A 4IIQA 4QXTA 3NJFA 4WTZA 1LK2A 2W60A 1JE6A 3FUJA 3OV6A 3X3FL 3UZQA 5D1ZC 4WO4A 2BIHA 2IWKA 2AJXL 3NJXA 2YA0A 1E5YA 3CFBA 3RZCB 2APTA 4PWEA 1HE8A 3WS6A 2WZ0A 1E9PA 1CXIA 2IG2L 3DO3A 4LBAA 4W9GC 2D3JA 4CSZA 3GC3A 2A4EA 5D7JC 4X5XA 4FQIL 4LSTH 5CZXD 4X4YB 1KCWA 1TSRA 1ES0B 3RI5F 2W91A 5DHVB 2KH2B 1ZLWH 5GS2D 3B6SB 1WFIA 1TZGH 3EYVB 1T5XB 1O5DT 4ZQKA 2FEEL 2QQNH 4OLUL 5FV1L 3UTQB 4CU8A 3SYQA 4Z7WB 4KAQL 2XWBA 4ODHL 3WELA 4ZUVB 5IROC 2H2PC 1DVFD 1OP5H 4F7PA 5DUBB 3ROLB 3VI4A 1D9KB 1QSEA 3ZHFA 2ZUQB 4JANA 4UDTB 1H0DB 3R0MA 1R3JB 2QVIA 1VKXA 5I8KH 4LVEA 4B96A 5CR8A 2J72A 1IL1A 4P3CL 4DVRL 1TO4A 1JK9B 1HHGB 4JY6B 4EN3A 1JWMA 4PWKA 4F37F 2BM3A 25C8L 3CTTA 5LBSL 1WJ3A 2H0EA 3F3HA 3JUZA 4OF7A 1CB4A 2VMCA 3L3HA 4PJFA 3FKUS 5BRZE 5DUJA 4PS4L 4G7YH 4FZ8H 15C8H 1N18A 3RY6C 1UUSA 3WJMB 3NA4A 3IRPX 4OT1H 3ZN6A 4AENA 4KZEH 5IQLA 1N0LA 1KUMA 3T2PA 3ZE0F 4F8PA 4GUQA 4XC1H 3HZKB 5EUKB 5IWLC 3PQYE 3K80A 4BK5C 1EFXD 3BXNA 2CGRH 2WJ5A 2FE0A 3OKEA 2XX0A 2BS71 3ARBA 4ELKA 1NBQA 1NFDF 3E9TA 5F1OB 5I1KL 3GMOA 1MQKH 3O3BB 4MCZA 2CLRB 4PFEA 1BVKA 3BSZL 4X7DC 5F0LB 4KQ0A 1MNUL 3HC3H 1JZDC 4F7EB 3FRPG 4GKNA 3SQOH 1TZHA 1DDTA 2R1XA 3P2DA 4UTAH 5IQOA 5LJYH 1F18A 1QNIA 4WEUD 4RAUB 4KROB 1B2WH 4M93C 3VWJC 4RISL 2OZNA 4MDJA 2QHRH 3MV9E 4NRXB 1I8KB 4YBQD 5E6UB 1YN7A 1DSYA 2IPTL 4MQXD 4UZGA 3B7SA 4A6YL 2VLRB 3ECQA 1A6AB 4MBRA 3BPNB 4GT7A 5J6HA 4EDXB 3GXNA 1QSVA 1KFGA 1HHIA 4ETQB 1VZIA 2LLNA 3LY6A 1MFNA 2HTLD 1C16A 4JZJB 2B1AL 3PG2A 1KN2L 4LOVA 4KMLB 3EOAA 2FSEA 4ANXA 1NDMA 3TO2A 3QH3A 4AUUA 2H8PA 4B95C 3BHBB 4MXVF 3GB7B 4Q6IC 5B1JC 4QTIH 2XV2A 4N9GA 3N06B 3NSCA 2WKOF 1TJHH 4LDEB 4XN4A 1QG3A 2R2BB 4PJHB 3OB0K 3QG6A 3HFMH 2DIBA 1KMGA 5EZLB 2UXVA 3DSNA 4H5SB 1XF3B 3R1GH 4L8BA 4V1DB 5IHZB 3A24A 2QZQA 1YN6A 4YIQB 2WINA 1M6UA 2KQMA 2FZ3B 5I5JA 1I7RA 1AACA 4X6BB 2GB2A 2A6IB 1EDQA 1O9ZA 2J12B 5FUZL 4APQB 5CIPA 5A6IA 3B1UA 2DY2A 5KVGE 5LXGL 2P45B 5FUCE 1K6QH 3DO7A 3FU3A 2A9BA 3VI3A 5KANI 5BCAA 1J48A 5FWQA 1DEDA 4P59L 2NY0D 4FQXC 4KJQC 4GG6E 1QPKA 1T1ZA 2OI9B 3CX5J 4PGEB 3Q8BA 4JO1L 2G2RA 5HHOA 2A9NH 4LLWB 4N0FB 1W0WA 1UFGA 1NCTA 5DZNA 2NY2C 1CLZL 1JGDA 3D07A 4JE4B 4LVOB 4HUVA 1Q0EA 4F7TA 3MMEB 2PTUA 3UP1A 4E2OA 3DJ9A 5CZVL 4HJ1A 3O4OB 3M45A 4B3VA 3VD9A 3MXVL 4N6QA 1VFAB 1Q0XL 2YD9A 3IAPA 3PP3H 2Q86B 5HDLA 4U0QB 3BZEB 1I85A 5D9SA 2DTML 1OQXA 3FN9A 3NP3A 4JQVC 4WEBL 3BEWA 5CKAA 5JDSA 2BRRL 3F5WB 3KPNB 1DLHB 1S9WB 1XEUA 2A5UA 2WYHA 3VNZA 4KDTA 3UERA 3DMMD 2COQA 1NIAA 4OZIB 3CX5K 4CDGC 2QEJA 2AJYL 2QBWA 4LLVB 3T3PB 1WS8A 4M62L 1N9PA 2A9AA 1JYWA 2H1PH 2HVJB 5HXMA 5E94B 4PREB 4NUJA 2WVVB 4HUUA 2MOQA 1S7TB 2JKSA 1KLGB 4NKQB 1S5IL 4DAGL 4KXAA 2DQUH 3U9PH 3CFDB 1TPXB 3BPLB 1UJ3B 2OR9L 4HWBA 4CC4C 5F1KC 3L17A 1FYTE 3T0DA 3UJIL 3SPIA 5C0RH 2P48B 1F4WL 2PWHA 1FO0A 5IM7A 4MA7L 1PG7H 3RDTC 1QI3A 4HXAL 3RP1A 5IKCB 2UWEA 2OYLA 4BRVA 2EDEA 4HGKC 5D4QA 4PJIE 2NUPB 3CUPA 4TUKH 4Y5VA 5AW0B 1GY2A 3IM1A 5A2FA 4OZHF 5D1ZD 2DQDH 2XIDA 2XWTB 3HPLA 4E41A 4G8EB 5A6MA 2ID5A 4DFHA 3K46A 3GZOA 1OAQH 4QO1A 1F02I 4GIOA 4KC3B 1AD0B 4KU1A 2H3NA 2NQDA 4Y9EA 2XA3A 1R0AH 3ZMNA 3Q8CA 1BZ8A 3QXTA 2BOBA 5D7JD 5F8QC 3ZKXB 3DX0A 3NCXA 4PY8J 5DO2C 5AWNH 4B7LA 1KJMA 3BP6B 3RDJA 4W4OA 1A14H 1AKJD 2RCSL 4RSVA 3NP4A 4TQEH 4GP4B 2YSSA 2LU3A 4GINA 4LLAA 3T6VA 3TCXA 5GGRY 3FT2B 1GC1C 5IROD 1WD9A 2H2PD 3EF7A 3EOYG 5FDYA 5EEZA 1QRND 3REWB 4R4FH 1F41A 2WN3A 3PV7A 4MXWH 3ARYA 5AB1A 2VR3A 4AQ8C 4Q2ZA 2YMOA 4JFTA 3CU7A 4F2MA 3MJ9H 2KZBA 1YEHL 3C09B 1HL9A 2P7TB 4PVNA 3S5ZA 5C97A 1U3HC 2X1PA 1FG9C 5HHOD 4N24A 3GLEA 4H1LG 2V6HA 2ZWNA 3BEVA 4RDQF 4ISVA 5JHMA 2J1WA 2X5PA 1ET7A 5LGHL 1T0NA 2OX5A 2B4CC 2VUKA 3RJOA 2NZ9C 2XRAL 4L8DA 3V4PH 4AOFA 3KL0A 1IEAA 1ZXQA 3O6LL 5L2KE 2OW7A 4OLWL 3LV3A 1BXUA 3ZTJH 4OLVL 4YZWA 4HG4K 2QSTA 3W0WD 2R0WH 4I2XB 5F7DA 1THAA 2W95A 2RAMA 3GSRA 2PR4H 1PLGH 3OGOE 2WLYA 5D7JA 5E8EA 4PJ8B 3R8BB 1SDDB 2L04A 2VLKE 4MMZC 1Q9WA 3A6BL 1OF2B 1Q9OB 1SVCP 2P49B 3COOA 4HSCX 4QHUB 1AKJA 2FX8L 4A7GA 4NO3B 4XBGB 3GI9H 1HJCA 4WJKB 3L3IB 3APFA 4P99A 5ACZB 2B7DT 4C83B 2NY5H 5IROA 1L5GA 1G7IB 3HBPA 1EIBA 2ITCB 2Y3AA 3VYNA 1N5YH 1G0DA 5ESQB 2E0PA 1QRNA 3IE4A 1PLBA 1ZHLB 4JRYB 4DK6A 2MCG1 3SN6N 4K07A 1Z5LB 3GKWL 4UINH 3VWJD 5AFAA 3GRGA 5I6XC 1XXFC 4JFUA 1DJZA 1MY7A 1FFOB 1SQ2N 2WXJA 3NIFF 3V5KB 3HMXH 3II3A 2MMXA 3LEXA 3ILPA 1PY4A 1PMYA 2R4SH 2VN6A 5D7LA 5ID1A 1J5OL 5B3JF 5JZ7C 5C3IA 1UZ8B 5GGSY 4XBEH 5GS3A 4JGNA 2DQCL 1X5YA 2GBUA 2NRDA 2BY3A 5B38A 4E9RA 4QTHA 3GTTA 3H56A 3RL2B 3DYMA 2GTWA 5FGCE 3EOBA 4P23B 1R9FA 4I9WE 2VUOA 4KK6C 1E5BA 2FB4L 1U3NA 2XXCB 1D6VH 1VERA 2NDFA 4RMUA 4Q0XH 3W0WA 1XZ0B 2O72A 3CLFH 3JYBA 3LKRB 4NC1C 4PP2A 3JSSA 4PBDA 1OGAB 3ZHNA 3T6QC 5EZIL 4HULB 3KXFE 5BOJA 2E5EA 1BEYH 4OY9A 2IV9A 3NVQA 4Y2NA 2AVFA 4BK5A 4ZG1A 5HHQB 3WTSA 1T1YB 3ULAB 2D3VA 1IM9D 4JCWA 4WI5A 4FTDA 4DKTA 1QA9A 2BFVL 4MGXA 4MJIB 4PR5A 5I1CH 4XNMA 5KS9A 4IRZL 1NCBL 1JS4A 1IBGL 1FORH 1PQZB 3NJVA 5GSVB 5DZOA 3V6FB 4GAGH 2PETA 1QMUA 4JFQB 5I1GL 4FABL 3PGDB 3VWJA 2HFEA 5ISZD 2H26B 1IGFH 3RBSA 3WDIA 2GABA 5C07B 1ZVHA 5FF6B 3BUYA 1CBVL 1SEQL 3KPMB 3X14B 1W6LA 4FQXD 4KJQD 1I3GH 4RAVB 2X4OB 1E30A 4KV5E 2VSKB 1ZGLM 3HAEG 1XO8A 4QRBA 1NEZA 3ZDZB 1U8HA 4QEGA 5AOZA 1V5JA 4KQ3H 4A2HA 1HQRA 2NY2D 1P7KA 4I3SH 3E6FA 3MRRB 5E99H 1CWVA 1N64L 3HS0C 2MCMA 4FA6A 2DQHL 1YEJL 3D39E 1M3JA 4FE9A 2IQ9H 4Q6IA 5B1JA 2A9CA 5FR3A 3RGVB 4F2FA 3HUJA 3BIBX 3BGFC 4M7JH 4MHHI 2E7LA 3FFCD 3K74B 5GRUH 2AMUA 3OJ2C 4HIJB 4L5FE 3SDCA 4ABWA 1T2QH 1YEIL 3FRUA 3PPSA 5IZ7A 3BT0A 1Z3GL 4NYLB 2DN7A 5EA0L 3CV5A 5KSUB 3B56A 5JPMC 4LXFA 4KKNA 4PJ5A 1KGCE 3DUSA 2WMPA 3LS4H 4HWZB 3NN8A 3CFCL 3D9AL 4PN6A 5I1AB 5F6IB 5HI5C 2DWEB 1OOAA 3CZKA 1T20A 3K5RA 2CAKA 5F7HA 4K94C 2C3XA 1MFBL 5ANME 3K71A 3OPZH 4FD0A 1AP2B 3FUNA 2FJFB 2J71A 4AK2A 4WJ5A 5B39A 4P3DA 4R2GC 3ZTNH 4FQXA 5AW9B 1MJ7H 5IFAL 3FB5A 4H8UA 4Y16B 3NSXA 2VLJE 4RFOL 2AGJL 3LRMA 4MSWB 3FN0L 12E8H 5JNYA 3RDTD 2O1AA 5FOJA 5GHWL 4G42B 1AZCA 1IAOB 1JHTB 5CEYB 3UTZB 1BMZA 3MV8E 1N3NB 5D8JL 1CN4A 3TNMA 1XSJA 3U46B 5K9QG 1OSZB 3FC8A 1M1SA 2VIRB 4FAAB 1AYOA 3KL5A 3O2DH 3BE1L 4P3WA 2JWYA 1MRCL 4AKOA 1GC1L 3FFCA 2QKIC 3DI3B 1ITCA 4RIRB 3MR9A 3EO1A 2WYZA 5MEOB 1IIKA 3QHFH 4QRTB 1G7QA 5L6YH 5DO2D 1G9EA 2EIZB 4X4XB 3CGTA 4R7NB 5AALA 5IFHL 6PCYA 1TQVA 5KBMA 3DPBB 1KCBA 1NIDA 3VXNB 3WE1A 5E5UB 3UJJL 5BMFH 4O2FA 4J2QA 2ZWYA 1XIWC 5T1LB 3JWNG 4F3FA 4YHMH 1YC8A 2B4CL 3GSWA 3P4NA 1D5BB 1S7WB 1UWXK 2FGWL 4DW2H 1R46A 1OP9A 1JNLH 1UXWB 2IANB 5E8OB 1X5JA 2ZWSA 2E9BA 3LNIA 4NOFA 1UOWA 5C0JA 1AO7E 1OT1A 1U3HD 1DQMH 1IILE 4K2UH 4ZFOL 2EIJB 4DIXA 4LSSL 3HR6A 1MEXL 4WI2A 3RDTA 5CM1A 3DTXA 2HRPH 3APCA 2XWZA 4NO5B 2LR4A 2NZ9D 4GLRI 2ENQA 3OKDA 4DO5A 2WNWA 5E1AB 3AG1B 5J6SA 3FO9A 2ZSWB 3DWTA 3C6LB 4HEPA 4AUJA 1AGFA 5DA4A 1TQCC 4WU7B 1A8ZA 2ZOWA 4XH2A 4UOQA 1PD6A 1PFCA 4EVNA 3JZ7A 2E9WA 4YSRA 4NT6B 3QDJD 4S1RL 4CVUA 4YS4A 4JHBA 4AYMC 3EGSA 3NFNA 1SXSA 1A9BA 2ZXDA 4E0RB 4PWGA 2CDEA 1NIBA 4FTVD 1U2YA 2DZEA 4IRSB 4WTZG 5DD0H 5AYTA 1F4YH 5JA9A 4IOIB 4HJJL 1HH9B 2LVCA 3J27A 4M48H 2WJ7A 1XB6A 2EXTA 2K7QA 1A6VL 1K4DA 3FOLB 4HGMA 2F7OA 4NDMA 5HJ3A 3GJEB 4LPXA 4QXWA 1E9OA 3BQVA 1UYWL 2BIOA 3T08A 4AQ8A 1XCQB 4G9FD 1IBHA 1ZLEA 4CILA 3UGEA 5AVWB 1U3HA 3GUTB 1TQWA 2FX7H 1L6PA 3TA4D 5JZ7D 2XKSA 5M95B 1VHPA 3F05A 3RVVC 5BVJB 4JZOB 4OGXH 3UTSB 2ERJB 4UT7L 4OD2B 4LPYA 3T65A 4PGCA 1N10A 2XZAL 4TQ8A 1FN4B 2YD4A 3GHBH 4WI9A 2OJZH 3V4UL 5AW3B 1C5CH 4JJ5A 3ABKB 4LBEA 5ALCL 1WTLA 2MPVA 5FHAH 4QRPD 1LL1A 3OR7A 3EJQA 4KK6D 2GW5A 3L1OH 3MRKA 2WIIB 1RD6A 1HEZA 1S7RA 2GK0A 3ALXA 2VR8A 3KDPB 2O26U 4R26H 3RVXC 1PZBA 1QTSA 1QFUH 3QDJA 3OD3A 2VDLB 3L4WA 5J1AB 3DXAA 2JJWA 3WY4A 3BKJL 3QDGA 5CJ5A 3AXLA 1DQQA 2UY6A 3WD5H 3BVNB 1AGDA 2CPCA 2LU7A 4MMZA 4ORGB 3GZKA 1USZA 3MA7B 2QELA 1CG9B 3M88A 3MNDA 5GS1B 5A2KH 3KJ6H 3MV7B 3LRLA 2JELH 4QJ5B 1YY9C 5EEWA 4FXGB 3IJ8A 3NFPB 3BX7C 3X13B 4ZSOE 2YPLE 4BXSV 1A66A 4PSRA 1RJYB 3QXDB 3INUL 4X5LA 3ZKQD 2JIXB 5E4EC 5IW1A 3HC4L 4FLOA 3REVA 5IF0B 4MZIA 3RE0A 4G9FA 3KWUA 2JQZA 2R69A 3V5HA 2A9ML 5DTFA 3MUUA 2W0KA 3MRBA 5F1NB 3TASA 2X4SA 3U2SB 1MW2A 5EC2A 2A38A 4OGYL 4OUUA 2XQBL 2NY7L 3IDMA 1E8ZA 1MCWW 1XH0A 2M2DA 3PV6B 4FFZA 2YKLL 3GKZA 4H4NA 3E1F1 4WDIB 5J12C 2FLRT 4QRPA 4M5SA 5IMLB 1RL1A 5BW7C 3V7MA 3SDDB 4F58H 1HILB 1W16A 4C4UA 4UM9A 1B90A 2YFOA 3HKFA 2JLPA 3HI5H 4GS7C 4UQBA 1WPCA 1BIIB 5LNDA 4LPWA 3EDDA 1OSEA 2VR5A 3DIDA 5FYJE 3EYUH 2V9UA 1R5VB 5E2TL 3BMWA 4RZKA 4L9LC 5DUML 1JHKL 2XVBA 4K94L 3ZL4H 1PZSA 4PB9L 1XTMA 2JVUA 2ZOLB 3IWUA 1D5XB 2BO0A 3L3DA 3PIQB 4FGMA 4DGIH 3N43B 1WGVA 3FUIA 3QHZL 4YR6A 4XPHH 5IFJA 1FL3B 1FJ1B 3ABZA 1ZT1B 5FYKE 4P8QA 4HALA 4RQQB 3IGAA 2QKSA 3VO0A 5K5YA 2WAQA 3KDMB 4BWTA 1M05B 5HI5D 4HCRL 4OCSL 5AQ0A 2OZ4H 4UZSA 4M61B 3C2AH 4OB5L 4J8QA 3FMGL 3CDZB 4FJYA 1EEYA 4KRPB 5AVSB 5GGVY 2FQEA 3IFLH 43CAB 5T3XE 3KR3L 5GRZA 3BWUF 1HK6A 3KPRB 1WZ1L 3I85A 3L7FA 3TFBA 4UCFA 4R2GD 1A4CA 5IJVB 3RIKA 1L9NA 4NQDA 5TE7L 1E4WH 3M1BB 1N2RA 1OKEA 5HDQL 2Z34A 1LO0H 3P40A 4JRXE 3FFDB 1TR7A 2F5AL 2AXWA 2UXFA 3NYKA 4W9HC 1WFNA 3V9EA 4RMWA 4LHUD 4G11A 2XVKA 1QTPA 2WP3O 5DC2A 3Q6GL 4OH2A 3JWNE 3SKOA 3E8VA 4JHZA 3T8XA 2OXHB 2D7OA 5FO7A 5HI3C 3U79A 1BA9A 2VJ0A 4PSPA 5D2LB 1TTGA 4ZMAT 1N6UA 5JQ6L 1RJLB 1AE6H 3INOA 4FQPA 1KBPA 2Y1VA 4KQ4L 1WVZA 2I60L 4TSCL 3MNVA 4UV7H 1JWUA 1O7DC 3CC5B 2J8UE 4MJ5B 4L8SC 2N3JA 5G4OA 3MNZB 1P4IL 2C9PA 2UY7B 1N26A 3F7RA 3H55A 4JFYB 4OFDA 2WQSA 1NGZB 1XIWD 1XHHA 5L8KB 1KFAH 3KBFA 3NSFA 2Z65C 5E1IA 4MS6A 3P9MB 3FZUC 2CM5A 1NBYA 2ARJA 2C9VA 4YHOH 3T2NH 4B9IA 5HYJD 4K7PL 4MDIB 1XD0A 1X5LA 1MIEL 3C5ZC 2I9LB 2J20A 2MNUA 4MS8C 4GP5B 3TEXA 5FM5M 7PAZA 2E76C 1NQBA 3HNSH 2KUTA 1CGSH 3V0IA 4E5XG 4WNQA 1PNCA 5JYMA 4NGHL 4FCAA 4OQTH 2EIDA 1GOHA 4PCYA 4OCYH 5LCVH 3D18A 2ROYA 4ODVH 2BSSB 3CPLA 4ATTA 1BX2B 2OMTB 1NCAL 4LHUA 2J5WA 1SJHB 4NC0B 3HHRB 2XN2A 1NSNH 4PMEA 5I1HL 3VCLB 3CX2A 3X3GH 3EDFA 4BH8B 3QIWB 3U1SH 2QKIA 2CGZA 1BM3L 4L3FA 4WUUD 5D7IA 5C0BA 3TVMC 3SE3C 4BSWB 3EFOB 4PHZA 4QRFA 3EGDA 1IFHH 3EH4B 5EOCH 1IMHC 3VWKA 3ZYIA 3WFZA 1JZIA 2FO8A 1EO8H 1IGYA 4RWHA 5IB1B 1CL7I 2O93L 1QSFB 1EJFA 2IBGA 3EJTA 4XGZA 3EDEA 2GJRA 4ZNEA 1RULH 2ZX8A 2VZOA 1IC4L 1CDUA 2ZKHH 3RZCC 1EEZB 5KBLA 3UGUA 4DP0X 5DVKA 1QR1A 4OZGE 5A2LH 1XIWA 1BD2A 2A6KA 3GDBA 1QSEE 4KDWA 3SJVB 1J1PH 2AQ2A 3N40F 3SDYH 5KBKA 2WWKO 3U82B 3WIAA 1ZV9A 4FI6A 3ES6A 5CMAB 1XH2A 1AQ8A 3DX6A 3LNGA 2QTVA 5F89B 4W9CC 5IVZA 2IOIA 5DYFA 1COBA 5DC4B 5T3ZH 1UD5A 1XSOA 2ZZUT 4QHKI 3RVVD 4FCHA 3RFRA 1UGNA 3G9VA 2J4WL 4ANKA 5BRQA 3QG7L 4XX1G 4AEIH 5D5MF 2D7TH 1RU9L 4FHBD 5DDHB 1Z2KA 1OM9A 3PWJB 4PH8A 3O4LA 3FTUA 2DQJL 2WXLA 1D9KC 1H3PL 1BFVL 1WITA 4GAYA 4GXVH 4LSVH 2ZUQC 1AOHA 2WZ6A 3LYRA 1KBGL 5MEQB 1CFTA 1PY0A 3WEXB 1U93B 3QCTL 5CWSA 4A63A 4HIEB 5ECJE 3EO0A 5B1CA 3SOBL 2VDKL 3RVXD 3JV0A 3NRQA 3DHUA 4OIFA 1TITA 3PWVB 4DNLA 3I6LD 2AXGB 4P4RA 3CZJA 4PV1C 5K39A 2E9IA 2I32A 1MG2C 4DGWC 2KLSA 4JFZH 5I6KA 2OK0L 2WKGA 5LWYH 3QZBA 3IU4H 2DYPA 1YY9D 2AJZB 3JWDH 1JF6A 1J0JA 1V3LA 2BXZA 5HHVH 4Y7MA 1YMHA 3HPJB 4KXZH 5IP4A 5IMOA 3FQXB 2C1OA 5D1QB 4LRIA 4UANA 4XVJH 1EMTH 2V17H 5B21A 2WQUA 2NY6B 1O75A 1T0OA 1INEL 2Q7NA 5BO1L 5GSRA 2FX9H 2X4PB 2J21A 5K9KB 3MCLH 2JJUA 5I19L 1NCOA 1H6TA 2LVEA 1R3KB 3FTGA 3MGAA 3FPXA 3NZHH 4GSDH 3G6JE 5EHFA 2XTSA 2WTPA 1JTPA 1NCUA 3VTAA 4KROC 2P8MA 1OAXH 4R7DA 3FHQA 2PTTA 4Z7QB 3PAYA 3DYOA 3F00A 5CGYC 1CK0H 4Q4IA 3NJGA 2GTQA 4B7IA 2BCKA 3EYOA 4AMKH 3AXIA 3IXTA 4IM8A 3IN0A 1TQTA 4AQAB 2BFGA 5J3HC 4C57C 2G4GA 1KYUA 4K5LA 2PPDA 3BPNC 5B38G 4JKPH 1RZJL 2XV6B 3KWXA 4JZJC 3AB0B 4YHPB 2HP4A 2FT8A 2N0KA 2ZYHA 2CR6A 2H6OA 3LVEA 3QFJA 1NPNA 3EFFA 3K6OA 1XGPA 4JZNA 4M8QA 4PV8A 4YNYB 4XMXA 2Z9TA 3LZFH 2DTSA 2F19H 4G72B 3T4AA 4M1CC 4OGZA 5MEPA 3KHOA 5BPPA 4HH9A 2CBMA 2R1WA 5F2FA 3U9UB 2KLRA 2GY5A 3KPOB 4ICXA 1NFAA 3U25A 1BBDH 3VSVA 3MJ7B 2OA9A 1BP3B 5AYQA 3GRWL 1V54B 3OKLA 2WB1A 3BSHA 1KEML 2Q1EA 3FSAA 1A3RL 3QXAB 2IDUA 4KY2A 3FUFA 5ITFA 4PD4K 2VDRB 4JQIA 1QLEB 2C3WA 2PABA 4ZUTA 1H6EA 2F7IA 2AJ3A 3MLUL 2X4UB 3G5WA 1X6LA 2ZIDA 3FSWA 4MNGB 4G5AA 5EOQH 3VFOA 3HG1D 4O02A 1TTBA 1RSYA 2W59A 1T7VA 1MJJB 3IE9A 4NM4L 4APQC 4RGMB 1S3KL 5CD3A 1JZ8A 3BO8B 1V7NH 2BINA 3L95B 4YHKH 4IBUA 1CFVL 2ZSVB 3LQAH 4J3OG 4W9JC 3W56A 2FIKB 2DH2A 2F7RA 1GRWA 3ULUH 4XRCB 4EXKA 2OI9C 4Z76A 5F88B 4YSEA 1C1EH 3NEOA 3BAJA 1QSZA 3KH3A 1SZNA 5HI3D 1NEZG 1NUGA 3I50L 4L9LA 1ZJBA 4FNLL 4NQXB 3IDNB 5TF0A 3LAFA 4LVOC 1JPTL 4NNXA 3WFBH 3DOIA 2ED8A 2F15A 5IGXH 1A7NH 3O4OC 4XPTH 3IPFA 2OTWB 3MNWA 3MRPA 3OGCB 4FQ2H 4NAJA 5DQDH 1YMMD 5E6YA 2DS4A 2BNRB 2ESVB 1DBBL 3D2TA 3LEYL 1WFTA 3LKQA 3LKSB 4Z0BL 5GGSA 4ZW7A 3T9WA 2VXSL 3CLEH 3LZLA 4PRPD 1F13A 3LRSB 1HC1A 1H3TA 3PGFL 3FZUD 4X9YA 5EU7C 1MCBA 1T1XA 1UKTA 2OMVB 3LIZL 3V9CA 5EF0A 4GQRA 3K6SA 2YC1A 4MB3A 3C5ZD 1OP3H 1X7SA 4G6AC 3GD1C 4MS8D 1NDGA 3W5MA 2D0HA 3RY4A 4G7YL 3L48A 4UTBL 3S5LG 1PF3A 4D2NA 4X6EA 4PJDB 5C0CD 3OZKA 4RMTA 3QO1B 4X80H 2G2NA 4OT1L 5M94B 2DAVA 2VDRH 5KEZA 2A6DA 3WIHH 1QLEH 4Y4KB 2A1WH 4XWGL 4G6FB 2R0ZL 2Z91A 1K9TA 4EAEA 3K72A 1I3RB 1CDBA 5DJCA 1TCRB 1TPXC 1AXTL 5IG7A 2FJHB 3BPLC 1UJ3C 2WKOA 3QIUA 1G7PA 5B39G 2R7EB 4KX7A 1J86A 1ODUA 1QPXA 2BDNH 2OW6A 4XCCL 4G5ZL 4TQIA 1C12A 1JNJA 3MNMA 4JKLA 2V2TB 1GS7A 1P4BH 1SEBA 2FQFA 2XQYA 2CH8A 3OG4B 4ODUA 5EBWA 3TVMD 5L9DL 4R96B 5LBGA 1WQVT 2F7QA 4I85A 3QQDB 1CS6A 4NUMA 1MFAL 5IY5B 4PAZA 4GLRH 4N0RA 1XGQB 5B1BB 1XGRB 4GSUA 5J7CC 2DWDA 2C3VA 4MA3A 5IB4B 3GS0A 4UTAL 4L8SA 4KUCD 4EI0A 4PRAA 3RZCD 1B2WL 1RMFL 3EF4A 1N5AA 1FZOA 2B59A 5FM8A 3I6SA 1JZHA 2XA8H 2P8LB 2QHRL 3P0YL 1KTLA 4G80A 3T0EA 1T2XA 3MLSL 1ZGLB 1DBAL 2NY5C 1TKWA 1AKPA 2WUCL 3MOAH 1DUZA 5F7NC 3OKOA 3SEPA 3CVDA 3MRLA 3TFKC 3QNFA 2ZP8A 3C5ZA 2CZNA 1LTXA 1J1XL 3HEIB 5EOTA 4YWGH 3DURA 2WTRA 5AZUA 3SDAB 2XWEA 4Y89A 3NZ8B 3HI1B 3HCVA 1KTCA 1KGXA 3RILA 5C0CA 5IR1A 1EH9A 1OB0A 1VADA 4FQCH 4MLIA 3WIIL 1NCIA 2XKNB 1G84A 4EUPB 1TOXA 1I1AA 2C9XA 1D9KD 4DVBB 4HQQL 4PRIB 3KPTA 2DEWX 3W3BA 3VA2C 5EIIB 1RIVL 2IMMA 2WCGA 1U8QB 2VXVL 3PABB 4XNQB 1HINH 2D7MA 3WNPA 3C09C 2MCPL 2ITDB 1U3ZA 3CVIH 3FU7B 1CLOL 2LLLA 5ENWA 4NZDA 2EVJA 4ZX5A 2GAZA 3IDIA 2ZE0A 3TVMA 3ZMRA 3H9HA 4MMYA 3SE3A 3MUGA 4XNUL 3HN5A 1MCIA 2BHZA 4IU2A 3W38A 3V6ZB 3AM8A 4PLOB 3BW9A 2ILLA 3MRNA 1SXZA 5DD3H 3K91A 3L3OB 3ULUF 1TJIH 2XUWA 4R4BB 5AKSA 4DP2X 1SYSB 4HEPG 4NQTA 1FVEA 3MZGB 4PIBA 3GIZL 1QRNE 2I5YL 3QUGA 3SBWC 2OL3B 3GF8A 4WFFD 4Y4HB 4XNBA 1MJUH 1OTSC 2IPUK 5AOMA 5IBTH 3GBML 1K2DB 5IW3A 3LKOB 4Y2DA 1YPZF 4PJ8C 1YNKL 1K72A 4X4YA 5E2JA 3DKHA 1JUFB 1ES0A 4JDEA 1BF2A 1N0XL 4OI7A 4H88H 1X5HA 2ZX6A 4IBQA 3VSTA 3B6SA 3F7PC 5HHOE 2ZCHL 1T5XA 5DSCB 3NQIA 4OCWL 5DJ8B 1XGYL 1ZDSA 1ETJA 2F7PA 4Z7WA 5GISH 2DQGH 4NI3A 4ZUVA 1CMOA 1Q90A 1N12A 2H6UA 4XMPL 4K3HA 4NNYA 2WXNA 3DV6A 5DUBA 4AYFB 3CFUA 1Q9LB 1D9KA 1U8NA 4UDTA 2W9LA 3SPJA 1H0DA 1M42A 4KROD 3O0RH 4K3JL 5F72S 3W0WE 1FZMB 1R3JA 3LKPB 3WY3A 5CGYD 3H9YA 4QRAA 3RLSA 1ZANH 3WUWA 2DRUA 4JNXA 1YNTB 2O30A 1E4HA 1U8OB 2P44B 4HK3N 1U33A 1KIQA 2IH3B 5J3HD 4M00A 4HK0B 1GH7A 2VLRD 1YDPB 2ZJSL 4I1NB 3ARVA 4UQ9A 3ELAT 4P23C 2AQ3A 5EO1B 3VFVB 2X44D 1DFXA 3BP4B 2O61A 3OKKA 1FFQA 3WJMA 1ZDQA 3AG3B 1JNNL 3PYCA 4YDVA 3U9PL 4HJUA 1JPSH 4OM0L 5DC0A 1NMAL 4M1CD 4ZD3L 4H7VA 3CNKA 3R0NA 4ZMNA 3QQNA 3JBG7 3NCMA 3HZKA 5EUKA 5GRWA 2VM9A 2A99A 4W9KC 4AQZA 1M7DB 1HHKB 4ZPVA 3FSOA 4N2OA 1UC6A 4EPSA 2Z7ZA 3RIAK 3ZE2B 1XV8A 1NL0L 2OL3H 4LFHG 2IV8A 3KGRA 3QUMB 4V1DD 5JUEH 1MCOH 5JLZA 3O3BA 3U6XS 2CLRA 4FFWC 4UQ2B 1GSKA 1KCRL 2IWGA 4F7EA 1CD1A 1ESOA 4UQDA 2ATAA 4APQD 1KJ3H 4ACPA 1JZ3A 4GMTH 1VFBA 1OAQL 1G4RA 4RAUA 3U9WA 5KSBE 1UA3A 1K8DB 2ZKXA 2EYRB 1DZ0A 3BRFA 1CXKA 1YYLH 5I0DA 1E9QB 1KTJA 3FTWA 1I8KA 1AQKH 5H4YA 3U83A 3MJ8A 5EPMB 1AFVH 5FCUH 4WQOA 4X6DB 4CVWA 4OU3A 1E65A 1ZS2A 2EQDA 3GBLA 4JZJA 4LEEA 3T0AA 3V6OC 3TH2T 3VD3A 3ATBA 3TWYA 5CN3A 3EO9L 3VRLF 5DVNA 3P4MA 2NSMA 2E7HA 3EDJA 3JVGA 1HOCB 3N42F 2X9YA 1MFCH 2NX5E 2N7AA 3BHBA 3HE6A 1YZZA 3MJ9L 2K70A 3RGVC 3P0VH 4XN1A 5AVUB 3GSQA 5CBAB 1FNHA 2R2BA 4PJHA 5HHXL 4B9GA 3T4YB 1OZUA 2DOCA 5ISZE 3VGFA 3D33A 1H15B 2QVMA 3MKGA 5DLMH 4PI2A 5JPNB 4YN3A 1CGWA 1WWWX 4H5SA 2WCSA 1XF3A 1MWOA 5IVNA 2M1KA 2Y24A 4JUTA 5I26A 4DKEH 4V1DA 2GUYA 5IHZA 1S7UB 1ZT4B 3OXRA 1MRDL 3TEUA 4DKFL 1X4XA 4PJCB 3WE6A 2BSTB 4ONGH 4QIRA 5FFOA 2XDHA 4G6AD 2NCEA 5F6IC 4YXKL 1HX0A 2BH0A 4J3VA 3RWGB 2NUTB 1ET8A 1WZLA 3QJHB 4RMSA 3QUMH 1TJMA 6FABH 4MFHA 1WV7T 3RKDC 2WUBH 4N25A 1ACZA 4OZFB 3VFMB 3MYJB 4FFTA 1CR9L 3IMVA 4OLXH 5FCSH 3S37X 4EE2A 1WUZA 4AH2B 1FH2A 3RU8H 4Y16C 4PGEA 4EIZC 3C8DA 3SPHA 4GKZB 4BH7B 2EO7A 3G5XB 1YEKL 5GJSH 2WSPA 5FHBL 2LOEA 3NCFB 5J56B 4U4BA 1BGXL 3MMEA 2AABL 3D4CA 2R23B 3QWQB 3U0WL 4HK3J 2IIJA 1ORQB 2NW3B 1VFAA 1OP4A 2F1AA 4XMLL 5K9QI 4PV9B 2Q86A 2QFPA 1S9XA 4QHNA 4MTMA 1RZKH 3PU7A 3QI9B 3EH3B 2R4SL 4MJ6B 5B8CB 3CZFB 4Y19A 5HPOA 3VMNA 1FIEA 5L2JB 4H2CA 4OTXL 3F5WA 4TLKA 4XVTL 5CNHA 1S7SB 5E5MB 1X5XA 4OZIA 5BUPA 3QR2A 5DRXB 5B7FA 1QNZH 2FBJH 3TFKD 1BPVA 1N67A 3QXVA 3O81A 1X5GA 3B37A 3UAEA 4QF1B 4NZFA 1SNRA 3ZGHA 5DMGC 3US1A 2HVJA 1UB5B 2YUZA 5E94A 4PREA 4Q0XL 1RZ7L 3BKYH 4AW4A 3UC0H 5FUOL 1S7TA 5T5FL 2DMKA 5L2KB 2FVNA 4PG2C 1PTZA 2VC2L 1OPGH 3CFDA 2AEPH 2XY2A 4ALAL 4UT6L 3CQFA 3V4PA 3KD4A 4ETYA 4YDKH 3UBXA 1KCVL 5KJ7E 1HZHL 3LN4B 4DTGH 3FO2B 3GZQA 2VXQH 4PB0H 2PKDA 4PY7A 3B2VL 2ZX7A 3OMIB 5IKCA 2YBRB 2Y7LA 3SKMA 1IC5H 3TP4A 4OZFH 3J2PA 4FYTA 5K9JH 3Q48A 2NUPA 4GAGL 2Y22A 1M1XB 1PZ2A 4X98B 1TF4A 4WLCA 2PP7A 5T1LA 4LHUG 1IQWL 2XWTA 3C6LC 2WXOA 1FL6B 3VD7A 1U41A 4M7ZB 4FLQA 3V0VB 5I76B 3NFSL 5HTSA 2C7UA 1OTSD 1C5BH 3BGMB 3QUKA 2DL2A 1PKOA 4MWFB 4PJ8D 4U1HA 3EGXB 3BP6A 4UV4L 3VD5A 4J12A 4IRSC 5JOPD 5E00B 4YUEH 1WCBB 5AAMC 4KQ3L 2J56A 3CZSA 3SDXB 4HBCH 3TV3L 1LYQA 2CO6B 4UOW1 1NJ9B 3FT2A 3HMXA 4D8PB 2FBOJ 2ZT9C 1MLCB 1ZSHA 2KDYA 1OE3A 3HN3A 2V33A 4JO3L 1SF5A 2ZOTA 4PJGE 2WLMA 1U42A 4JRYD 1EHLH 1DP0A 4W1TA 4FYSA 3OAWA 4E9LA 2FO4A 2PCXA 2ZYSA 4L0ZA 4TULL 4UIKL 5CUSL 3D3VB 5G2NA 4NNPH 4FYRA 2DQIH 3WI9A 1G9HA 2ERJC 4GG6F 2CDGA 4FTVE 2FTAA 4OD1H 1TZIB 1XBDA 5TK4A 4N8VA 3VDCA 1QASA 2H45A 3IRCA 2CQVA 3UG4A 3BZ4A 3VD4A 4P23D 4X99B 4AEHL 2BP5M 4DK3A 2YRPA 1EJOL 1A7QL 5LQBH 2BVTA 1RJCA 3QNYB 3MRHB 4I2XA 1CYGA 3SBWA 4G8AC 4HOXA 1OGAD 2K3HA 1A1NB 1HI6B 1KBWA 2EADA 1JWSA 1SDDA 4K4KA 2AEOA 1A3ZA 3NJNA 5HHNA 1YYCA 1OF2A 2YXFA 4W68A 2Z8WC 2ICEB 3PDDA 4QHUA 4HS3B 4QOKA 4NO3A 4XBGA 5TK2A 5GS1C 1Q72H 1JV2B 2Y5EA 2J88H 4MJID 2Q7AA 4B9JA 5ACZA 3L3IA 2KDGA 4OVVA 1JXKA 1KNOB 3ARFB 4M6ML 4FXGC 4C83A 4FFWD 1MW1A 3C6SA 4HUMB 3P9LB 5IMMB 2ITCA 2Z0BA 5ESQA 2Z8VC 1RCYA 35C8H 4BFRA 2AK4E 4QRPE 4X9GA 3LN5B 2ORBH 1ZHLA 3CK0H 1T1WB 3H7BA 5F70A 4NC1E 5ABZA 2YUVA 4LGRB 1FFOA 4PTUB 1KCUH 3V5KA 1YAIA 5C07D 5L6YL 4Z3EA 4I0PB 1YEEH 4DEWA 3EOTH 1UZ8A 4CU7A 1GAFH 3QO0B 1JZ4A 3KPSB 3IFPB 3RFZB 4KPHH 1KXTB 2VM4A 5BMFL 1JG9A 2NY3B 5J57B 4P23A 1PYWA 4N5EC 4CC0A 1UZGA 4OIIL 4DPCX 7FABH 1U92B 1P6WA 5AW2B 3ZZQA 3SDDC 4PJIF 4JHWH 3IFNL 2MNWA 3GSOA 3LKRA 2BIIA 1XF5B 2V5YA 3KNBA 3GBNL 2AJUH 4OF6A 3P2BA 5F97E 3RGVD 2A77H 1QFOA 2BSBA 2AVGA 3VFWA 3O41B 2EC9T 1MFMA 2YWZA 4RDBA 1QW9A 5ANMB 2H1XA 2P3YA 4R6UA 4LF3A 5JOEA 2KYIA 2AJVH 1G7JA 3SBPA 1NLDH 5TF1L 1MVFA 3ZXAC 2K9FB 2ZAIA 3WDJA 2QZ5A 4MJIA 3QAQA 1AQDB 2Y06H 4WF7A 4XMWA 4NIYE 4S0SD 4EEEA 4HS8H 4CUCA 3LH2H 3GMRA 5DHDA 3V6FA 1JDAA 2CLVB 1UH3A 5C0IB 2EJ1A 3D08A 1AMXA 1U8KA 3KLAA 4QLWA 4ZX4A 3Q3GA 2AXFB 1NMBH 4QPEA 1WWAX 1LNUB 3DX7A 5KYYA 2R29H 4KRPC 3RX8A 4ZBJA 3DVNB 3RKDD 4A37A 1ASQA 3UAJC 5C07A 4X4MA 1NANI 2OCFD 3KPMA 3X1GA 4RAVA 2X4OA 3QP3A 5SV3A 3Q43A 4Y16D 3I6KB 5EIQA 4UTCA 4Z7UF 3O2DA 4I4WA 4M48L 5CO1A 2B5IB 5GIRA 3NPZB 3MRRA 2DDQL 2X41A 3L4CA 1VACB 4CN1A 4GYBA 4L1LA 2P46B 2V3DA 2OKMA 3WEOA 3PAUA 5J06A 5J11B 4Y5XB 5IHUH 3WKQA 1KY6A 2W9EH 4L5FH 3ZSTA 4PJEE 2B1HH 3L2MA 5IEHA 3N55A 4DP5X 2H7WA 2FX7L 2EH7H 4JGUA 5IQ7H 2GJPA 1A3LH 1BQLH 3VU1A 4B9FA 3ARXA 5EH1A 4NYLA 1F8TL 5L88H 1BQSA 4JQXA 3UMNA 4A68A 2IDCA 4JX0A 5I1JH 2YEVB 1AO7B 5EBMB 4EO5A 4JY4A 2HN7B 5FHAL 3TEWA 5EN2A 4IK7A 1MH5B 4JKMA 4TNVK 1QUPA 5DMGD 1ACXA 2DWEA 1ZY9A 3DVFA 3CSYB 2I24N 4MD4B 5T1LD 2HT4C 1IAIM 4HWNA 2WWKT 5IHBA 3EG9B 1FC1A 3UYOD 1OW0A 4PJAF 1YEDB 3CH1A 1FL5A 4WKXA 1NKOA 3VG9B 2IAND 3SGDI 1Z9SB 2WLKA 4Y16A 2QMKA 3B3IB 3SIKA 3BKCL 4MSWA 1RIUH 2ZCLH 2WB7A 4KHTL 1NC2B 2JELL 4TSBL 3VXSB 1KENL 2PW1A 3MBEB 4LAQL 2F9BT 4YFEA 2E9GA 3CVHB 1RLBA 1IAOA 3UTZA 3V8OA 2EYTA 2PWFA 5EBLB 1OSZA 1F90L 1P5UB 1VFMA 1YCSA 5JHLH 1R3HA 2VIRA 3C6LD 2YMTA 1NGXB 3UPRB 1IE5A 1OY3B 1RZGB 4RESB 2KHAA 3GM0A 3QIWC 4HISA 3CMGA 1I7TB 5TE4H 3NCJH 4DGUA 3VDBA 1F11A 2XQYG 3Q9PA 4I77L 1TETL 4QHLB 4RIRA 5AVYB 3BVXA 3DI2B 3H8NA 1XVSA 3VGBA 3JWDC 3N3EA 5HYJE 5MEOA 4QRTA 1U6AL 2AQSA 2EIZA 5DEGB 4W9EC 4P5TB 4X4XA 4ZAKB 4IRSD 3C8KA 3TIEA 1AGCB 3TURA 1KZQA 5I17B 3HMWL 5J13B 5C2BL 3QNZB 5H4ZA 1LP9B 1AMYA 3MLWL 1RPKA 3PDOB 2PN5A