1AAJA

Crystal structure analysis of amicyanin and apoamicyanin from paracoccus denitrificans at 2.0 angstroms and 1.8 angstroms resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure analysis of amicyanin and apoamicyanin from Paracoccus denitrificans at 2.0 A and 1.8 A resolution.
pubmed rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords AMICYANIN
total genus 26
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1992-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1aajA00
2XWZA 1NTDA 2WO2B 3FU9A 5B1AB 1AZUA 5TK4A 2IAAC 3H4FA 4A68A 2HRHA 2XV0A 2DYSB 4E9YA 1AS6A 2EIJB 1MDAA 3QJQB 1FFTB 3ABGA 1IC0A 2GSMB 4HALA 5D4HA 3PAUA 1BYOA 3ZDWA 4CSZA 1CUOA 4KO9A 1NWPA 1AZNA 3NSCA 1BEXA 2FWLB 3UAEA 4DP1X 2J57A 2UX6A 3X1EA 4YSEA 3UAAA 3FSWA 4YVNA 1A4AA 3FYEB 4DP0X 5F7BA 4YSQA 1OCOB 1AZCA 2TSAA 4E9VA 1WAEA 3IN2A 1SNRA 4BDVB 2FT8A 1A4CA 2OCCB 2IDQA 3QJSB 5D4JA 8PAZA 1NPJA 4PCYA 3NJHA 4NAJA 4DP4X 4BDVA 4HCFA 2OV0A 1ADWA 2H3XC 2Y1AA 2UXGA 1NIAA 4KO6A 2IWEA 2B08A 1PNDA 1W6LA 1NIDA 2UX7A 3CVDA 4G72B 2R7EB 2XX0A 3NJFA 1AIZA 2YAHA 3OQRA 2QDVA 3NSFA 1BXUA 1PMYA 4YSDA 4BWWA 3NJKA 2VM3A 4A67A 3MX0B 4GP5B 2E86A 2I7SA 3ASNB 1HFUA 1PF3A 4M4RB 3AY2A 5AZUA 3TU6A 1KDJA 1GY1A 2IWFA 2PCFA 4YSAA 3EHBB 1E5YA 2FTAA 3MBWB 5B7MA 2QPDB 4BK5C 2JKWA 2XLLA 2DWTA 3GYRA 2XU9A 3OMAB 2VW4A 3X1GA 3PPSA 1FA4A 3L45A 3WG7B 3FT0A 1DZ0A 2GB2A 1J5DA 1E65A 2N0MA 2P80D 1FWXA 3NSYA 4QKTA 5I6LA 2I7OA 3UADA 4HHGA 2VMJA 4YSRA 3NJIA 9PCYA 3FYIB 4W9ZA 2OJ1A 2I85A 2J55A 3FPXA 1EZLA 2FT6A 3GDCA 2HX8A 2P80A 1MG3C 2XV3A 2X87A 1WS7A 1TU2A 4TXVB 3HEIB 2ZXWB 5I6MA 1GS6X 1MZZA 3DIVA 3BVDB 4KO7A 2VSKB 3PXLA 1QNIA 2YAPA 1CURA 3FU8A 1R1CA 2DV6A 2IDSA 1BQKA 4JHVA 5B7FA 2BHFA 4BWTA 2R7EA 4AX3A 3AW5A 3HB3B 2YAMA 2HRGA 1WA2X 4A2GA 2XXFA 1L9QA 1AANA 4DP5X 2XX1A 1AG6A 1ASOA 1OOWA 2PCYA 2VN3A 4KOCA 2IH8A 1ID2A 2HX7A 1RCYA 4UAHA 2UXVA 3QQXA 3V9EA 4WKXA 3ZX1A 4A2DA 2VSMB 3CVCA 3PAZA 3AG4B 4BXVA 1NICA 1SDDA 1AS8A 5TK2A 1X9RA 2BW5A 5D4IA 1ZV2A 4QLWA 2Q9OA 2PPCA 1YLBB 1ZIAA 3X1BA 2BW4A 5I6OA 1NWOA 1AACA 1ASQA 1L9TA 4CSPA 3T9WA 5F7AA 2PPEA 2W88A 2QT6A 1J9SA 1RZQA 5PCYA 1JOIA 4N4YB 1QLEB 3CG8A 3FPYA 1X9UA 2BWIA 2FQEA 2B3IA 3NSDA 1N68A 4HHWA 1PLCA 1BYPA 2DYRB 3UABA 1PAZA 1PZCA 2GI0A 3EH3B 2FNWA 2YAEA 4M3HA 1F56A 3QJVB 1JZEA 4G7QB 4BWUA 4HCIA 3S8FB 5B1JA 3T6VA 1V55B 3OMIB 1IKOP 1KBVA 3ERXA 3NYKA 5I6NA 2J56A 5AFAA 1PZAA 3CDZA 1GYCA 3G5WA 3ABLB 3QJTB 3T71A 2PP7A 4WTQA 3H56A 2CJ3A 2DWSA 2YQBA 2FQGA 3T6XA 3X1FA 4W1TA 1RZPA 4HZ1A 5B1KA 4L0PB 2PP8A 1B3IA 3T6ZA 1BQ5A 1ILUA 3UGEA 1AQ8A 3X2QB 2YXWA 3CVBA 4Q8BA 1VLXA 1CC3A 1I53A 1BQRA 2PP9A 2YAOA 3JT2A 1SJMA 1V10A 4A2FA 2X88A 3WI9A 1JXDA 2A3TA 2EINB 1JZJA 2H5UA 2BP8A 2FQDA 4E9SA 5I5IA 5I28A 7PAZA 1L9PA 1E5ZA 2YARA 3AG2B 1ZIBA 3S3DB 4A2HA 3GXUB 1GS8A 1IBZA 1KBWA 1WS8A 3TBCA 5IY5B 4FA7B 4FAAB 1OV8A 2DY2A 2IDUA 5B1JC 1KCBA 1AOZA 6PCYA 3IN0A 1ZPUA 4GY4A 1OCCB 2EIMB 2XXGA 2AANA 1BAWA 1CYXA 2JFCA 2BO0A 1JZFA 2WO3B 4HAKA 2GBAA 1N70A 2IDFA 4N8UA 4DPCX 3T6WA 1NZRA 2BP0A 2JXMA 3C75A 2IDTA 4BXSV 2GIMA 1J9TA 1A3ZA 2FJSA 2WSDA 4G7RB 1JERA 1ZDQA 1HAUA 3SBPA 1A65A 1NINA 4HCGA 1M57B 3ABKB 5A7EA 4KNTA 3S8GB 1AAJA 1XB3A 4KOBA 2VW7A 2EIKB 4NERA 5I5JA 3SQRA 3WKQA 4YL4A 1QHQA 3NJMA 2ZONA 3EF4A 1J5CA 4RH4A 4KNUA 3BQVA 1JXGA 2IH9A 3QJUB 1SF3A 2CUAA 2BZ7A 2BZCA 4KO5A 1ILSA 5E9NA 2CBPA 3NJJA 3NJLA 3OM3B 4E9TA 3FU7A 1EHKB 1OE1A 2XVBA 2ZOOA 3DKHA 3KW7A 4ZK8A 1KCWA 3TBBA 3ASOB 1CYWA 1TEFA 2VM4A 1J9QA 1HAWA 1PLAA 2BWDA 3V9CA 3PCYA 2YAFA 1JZIA 2XV2A 1TEGA 2GHZA 5AKRA 1MG2C 1OF0A 4GP4B 4YSSA 4E9XA 2W8CA 2H47C 2BP8B 3OMNB 4KNSA 2AVFA 4DP6X 2AFNA 4JKNA 4F7KA 3DTUB 4A2EA 1ET7A 1NPNA 3AG1B 3QJRB 2AZUA 1PLBA 3WKPA 7PCYA 4HIPA 3OD3A 3PAVA 4DP9X 1JVOA 2MRYA 1M56B 1PNCA 2PLTA 3WIAA 1GY2A 3RYMA 4F2EA 1A8ZA 1ET5A 4P5RA 1L9SA 4AI7A 1T5KA 1JZGA 1PZBA 3NP4A 2RACA 3X1NA 2CALA 1GS7A 2Y69B 1E67A 1TKWA 3IEAA 4E9WA 3NJGA 3AZUA 4YSPA 4G7SB 2Q5BA 1JXFA 1BXVA 4GYBA 1OE3A 3IE9A 4Q89A 2YXVA 1SHWA 1JVLA 3TASA 1OCRB 2HX9A 1MZYA 3FQ2A 3IBOA 5LDUA 3H4HA 1NDTA 1SFHA 3NP3A 2J5WA 3NT0A 1AZRA 4UF7C 3N55A 1KV7A 1AR1B 4AKQA 1XB8A 1AZBA 4EF3A 1W8EA 4F2FA 1WA0X 4YSCA 4YSUA 5B7EA 1PCSA 1A4BA 1GR7A 3ZBMA 1NIFA 1SF5A 4DPBX 4DP2X 5PAZA 4YSTA 1JZHA 3ZIYA 2PPDA 1E30A 3FU7B 2YAQA 3FSAA 4AZUA 5ANHA 5B1BB 4DPAX 3FSVA 5I6KA 5EHFA 4G70B 4DP8X 1NIBA 1WA1X 3JTBA 1ETJA 1IUZA 1XMEB 1AS7A 4K9JA 2PPAA 4ENZA 3N2JA 2FT7A 1GW0A 2UXFA 3EH4B 3AG3B 3SBQA 1ASPA 4GXFA 1SDDB 3S3CB 5I6PA 4DP7X 3TA4D 5I26A 1ET8A 2GC4C 4AKPA 2AZAA 5FC9A 3CDZB 2LLNA 2IWKA 1KGYE 4YSOA 1SFDA 2MTAA 2CCWA 1XB6A 1J9RA 1UATA 1IBYA 3ABMB 4GP8B 1URIA 2HZHA 3CZUB 4P5SA 3FSZA 4NB7A 2CAKA 3FQYA 3KW8A 2QPEB 4UANA 1V54B 1L9RA 1M9WA 1AG0A 2XUWA 2BP0B 3UACA 1OCZB 4JHUA 1BXAA 4YVUA 4AKOA 1NIEA 1ZDSA 2GC7C 3FQ1A 3WNIA 1DYZA 1OE2A 2UXTA 3EH5B 6PAZA 3QPKA 2XYBA 2TSBA 4E9QA 3WNJA 2QDWA 2EILB 1PY0A 4PAZA 1GSKA 3S3BB 2NRDA 4A66A 1L9OA 5B3SB 5I5MA 2FQFA 4G71B 2PPFA 1W6WA 4X4KA 1KYAA 2ZWNA 4E9RA 1RKRA 2VW6A 2HXAA 3D12B 3NJNA 3PLYA 1SHXA 1KDIA 3FS9A 3U25A 3SBRA 2HLEB 4MFHA
chains in the Genus database with same CATH superfamily
4AGMA 8FABB 3MBEA 3MU3A 4LSPL 1KIUB 1BQSA 1XR9B 4O02L 5IHUH 3IDGA 5J3HD 1AS6A 4ODTL 1M1XA 1LDPH 1MWAL 3DI3B 4F1ZA 4Q9QL 3ARZA 3UJJL 3NN8A 3SGDI 1U8NB 5ITFA 1EX0A 1K3ZA 1QWNA 4LOUD 4XWGH 5AVRB 4HOWA 4FQCH 3JTTA 2KKQA 3VFVA 4JREB 3WXVH 4LBEB 3QCUL 4F7EA 1JTOA 3RQ3A 1NDMB 5TH2B 3ZDZF 4BE5A 4PG9B 1GHFH 3VG0H 5K1JA 3FYEB 2CRIA 3FZUD 2QLYA 1T04A 3IN2A 5DFWH 5BV7L 1H6UA 4QRSB 1QFUL 2IDQA 1GZPB 4JZNA 3GSQB 3VDCA 5B8CC 2OMVB 4PWJA 4OBSA 4KKBC 3NJHA 2FBJH 1NGZA 3AM8A 2EUXA 3RB7A 4PJGA 4ABQA 1E9PA 2FH8A 2D7NA 1CIDA 5JA8B 4H8WL 4KKPA 1FI8C 2CJUL 3HMWH 4KO6A 1S7UB 4PJEB 4PB0H 5TDNB 5EIIA 1KTCA 4FEMA 5C97A 2O30A 2KL6A 5C09E 2F54D 1P4IL 3I3DA 5I1IH 1JTPA 4JPIB 1NJ9B 1QOKA 4NAQA 2JJTA 2E4FA 4AJWA 3V0AC 3MZGB 4RFOH 4FQQB 2ITEA 2RBLA 2KMWA 1CDCA 3L3HB 3D48R 3PQYB 1PF3A 4L4VE 5CXPA 5GS0H 3K5SA 3SHSA 3X3FH 5IB5A 5DF0A 3T0BA 1NEZA 2O93L 1AHWA 3PP4H 3ZE1F 4WQOA 2I9TB 3ZR5A 4HW6A 3CAFA 4FQLH 1T4KA 2Y6SC 2ATAA 1W8OA 4YHML 4Z9KB 1I8MA 4BFJA 1NQBA 1XD0A 4LASH 1JF1B 3BZ4A 3G04A 4AVHA 4AZ8A 1NGQL 1FA4A 2JJTC 1IC5L 3UCQA 3MRKB 2CO3A 2E27L 3BDXA 3NSYA 4Z7VE 3PV6A 1L4IA 1WIPA 4OFYA 1LP9A 4G9FA 2YGNA 4BJLA 5LWYL 4POUB 4J4PD 4NQDE 4ONHA 5IB2A 4K3DH 4W9ZA 3FCGA 3FPXA 4J39A 4KKBD 3PQYD 1EZVY 1F18A 3L54A 5DHMC 2WINA 3PWJA 1J1PH 2WTOA 4ZW5A 5JZ7D 4C8XA 2F54B 3O3EB 2X44D 3VH8G 4JANB 3WHE0 1WQVT 1OT2A 3I9AA 4B3EA 5JDSA 1T3FB 5I2IB 2DQFB 2FATH 3S5LA 4U6VH 4RQQA 4ES8A 5JHLL 4KO7A 3RVWD 2X12A 1Z5HA 3DROB 3QSKB 4I1NB 3KLAA 4NO2A 1MNUH 3SKOB 4MB1A 2O61A 2Q7YA 1P7KB 5D5MA 2YLKA 5EBMA 1P7HL 2C3GA 1YEHL 3TA3B 2BNRD 2DAVA 2HMID 4L1DA 4PRHE 3HB3B 3QULA 2EEFA 4Z7WA 5KG9A 2EDRA 1KIRA 4KXBA 1I7RB 3WTXA 1E4HA 1B6UA 2AJXL 1S7TB 2A6KB 3DUSA 3IDNA 5I16B 3RAJL 3VD1A 4GRMB 2KQMA 4FZEH 3I6GA 2IH8A 1T21A 5FO8B 2MCPL 4WSGA 1C9SA 1S8DB 3ZX1A 5I0WA 1GYVA 4JZJB 5HGGS 1BX2B 3ZE2B 5J13B 1IGYA 1T1YA 1EVTC 2X4SB 1CG9A 3ZN6A 3WIHL 1MY5A 4ZMYA 4H1LB 2BVEA 1KPVA 5E2WL 4DAGH 1UWXK 1FLRH 3AT8A 3SE9L 2AI0H 4TUUA 5DJZA 1GOHA 2Q9OA 4D9QD 2PPCA 2ZG3A 1YLBB 1ZIAA 4Y2DA 5C07A 2KDYA 3AQDA 3GSUA 2F61A 3VM5A 4NJ9L 2L7JA 5KSBE 1J8KA 2E27H 4TNVF 2WXRA 1YUHB 3B34A 4PRNB 4AEFA 5C0BB 5T3ZE 4FFZH 3B9KA 4Y4HD 3BUPA 4DQOH 4JHBA 2QT6A 1MFCL 2XPGB 5H8DA 4R7NB 2D2OA 3HI5H 4PJCA 1DSYA 2CRZA 3PDOA 2A6KA 3VB9A 4BCXA 2F8XC 1JSYA 5ESVB 4P06A 2VLLB 3EBAA 1DJIA 4LPYA 1W9XA 2WKGA 5B21A 5C0GA 4Z7OE 1LO0L 3TYGL 3RTQC 4PGJA 2CWRA 4PRHA 3TTSA 3L4CA 2UY6A 1ONQA 1U3NA 2DJ4A 5GSRA 1V05A 1OXYA 1QAWA 1M2VA 2UZXA 2KH2B 5CEXB 1FIGL 3EYUH 1JZEA 1GGTA 2XN9B 4MJHA 3KMDA 4KDVA 5DZJA 2BOCA 4P4RA 4TLSA 3N44B 5FLVA 3NYKA 5I6NA 4KQ4H 1QRNB 1SHSA 2DB8A 2A38A 2HVKA 3LKNB 2IADA 4AEIL 1KJ2A 1YMMA 4LFHG 1K2DB 2WUBL 2VLRB 2XPGA 4HUXB 5CBAA 1E50A 4YDMA 2IH3A 3K2KA 3O41A 1NC2A 1S46A 1YJDL 1U93B 3OWEA 1C5DA 3T6ZA 3ILPA 3EJSA 3UGEA 4YN3A 2XN9E 2HRPL 2WLLB 3C08L 2ZP9A 1V10A 3QYCA 3WI9A 5DMIL 4IOFD 1SGKA 1DQDL 4E9SA 5ESQB 2BP8A 5SV3A 4QHLA 3WFHA 1E5ZA 2YARA 3CN2A 4NOBA 3WUZA 3V4VL 2FX7L 1TMQA 4PJIF 1RJZB 1MCKA 4AXWA 2AVGA 1KBWA 1XWVA 1RUKL 1UT2A 3OXRB 4NNYA 4QTIH 3QUMH 2LHAA 4TL4A 5C0FA 3P3YA 5IJVB 1KIPB 1T1ZA 3UC0H 3AT0A 1AVAA 3ZHDA 2VLRD 4APXA 2HVJA 4FTVB 4DGYL 3KPPB 1F4YH 3K2UH 3GKWH 3A21A 4ZZFA 5MENB 4B9YA 1BAWA 4M1GH 2VDQH 5BZWB 4GG6F 5F0LB 1QRND 4AYEC 4CADB 4BZ2A 5F7HA 1U33A 4L3FA 1R0AH 2DEXX 3JZYA 4XVOA 1HX0A 1SY6L 3MUUA 2J6EA 1JWMB 2V2TB 4EOWL 4UQCA 1BBJB 1JWSA 3K3QA 4OJFL 3AAZA 1X5HA 1SEBA 4DO6A 3HS8A 3SE6A 2GIMA 1SQMA 4WEMB 4HPYL 1A3ZA 2NW3A 4AUYA 4HOZA 1S2EA 4X7DC 4HDIB 2LU5A 3IWUA 2NY6C 3CQFA 5T3XH 4KY1H 1I7UB 3M07A 1CFSB 1IBFA 4AM0A 2FK9A 4M5ZL 1AAJA 5ENWA 4NERA 4RIRB 4LOEA 4APQC 1UM6L 3K6NA 1U41A 2LFEA 1LE5B 1A66A 4LCUA 4DFIA 4F93B 1QRKA 4IRSC 4LVOB 4RH4A 5CM1A 5MEND 5K1VA 1DQMH 3VTMA 1FRGL 1QACA 2CM6A 3EXLA 3IJYB 5EC1B 1BP3B 2VQ1A 5I0XA 2VJ8A 2VUOA 2OTWA 1L0XA 3UPRB 25C8L 2C8NA 2Z91A 4I85A 3RUGF 2NCEA 5DDHB 4FHBD 3P73B 1JJUA 1B4TA 2ZOOA 3IGKA 4YHLL 4O2EB 1YEGH 2ENJA 1CYWA 3LKQB 2GJZA 4WDIA 3SCMD 2AKRB 3VSTA 1K8DA 5FYJL 2ATPA 3QCUH 5CS7A 2WP3O 5G4NA 4N0YL 4FXKA 3U36A 1WAPA 2NXYC 4MJIE 3BQUD 4GP4B 2I9LB 1D7DA 5I17A 2HKFL 1RULH 2H47C 5C0AE 1IGCL 3OMNB 2ZP8A 3MRFA 5TDOB 4TULH 1VADA 2OA9A 2NXZC 3IJYA 4P2YA 4GSDL 5EC1A 3D39B 1HH9B 1R5VA 4IOIA 1D6EB 3RPIB 3TH3T 3V8OA 3BVNA 4QTHB 3OX8A 1EH9A 1PLBA 3DROA 4NO2B 1T0MB 4BFIA 2EDYA 3OD3A 1GGYA 3WFCL 2CBQA 2MRYA 4MVBC 4DP9X 3RZCD 1P9MA 1Z3GH 4IRJB 1DO5A 3EDKA 3HBZA 3MV7E 1WWAX 1TF4A 3MUJA 3QEQE 4I3GA 4F2EA 1I1FA 2DLFH 5IG7B 2WQUA 3BIAX 3MLRL 1AGEA 4X4ME 5HHNB 1GS7A 5BJTB 4LLQB 4JFDA 1ZANL 4OLZH 1BFOB 4PY7B 4LNRA 5EZJB 1DVXA 4HSAC 1ITCA 3CVHB 1KTJA 5AOIA 3CXDL 1BZDA 4UINL 3U48A 4QRPB 1HHHB 2B4CL 2WMPB 4WK0B 2P5EE 1A7BA 1JD9A 4ANXA 2XQYG 3FQ2A 1JPST 4L3ED 3I9PA 4HIQA 4PN6A 1GL4B 1D9KC 2ROYA 5H35A 3BFWA 4X7TA 1KY7A 3GINA 5JYLA 3IFNH 3UTSD 3MA9L 1M3JA 1HXYB 4R90L 4CVUA 5EFIA 1XF3A 3ARGA 3QO0A 2ZD0A 1PG7W 1JNLH 4YSUA 15C8L 5B7EA 1PCSA 3HZ3A 1S7XA 4K3EL 4N68A 5I0VA 1F2XK 4O4YH 1BVNP 3Q2VA 4HF5H 4F9LA 3QUKB 5PAZA 1BLNB 1LQSR 3OKNB 4JY6A 1KGXA 5DXWA 1SBSH 3I02A 1JZ5A 3QIBA 4R4NC 4OIIH 1FCGA 5JXEA 1I7ZA 5J1AB 1ZTXE 4K94L 1NCWL 1PDKB 2OTPA 4F7CB 2IH1A 3BZFB 1XMEB 5CP7A 2ICCA 3GJEA 3MNWB 2H32H 1NM4A 2BSED 2W65A 2UXFA 4M1CD 2IAMD 4QO1B 5A2BA 5AG8A 3CFTA 3VFGL 5EN2B 2NX5B 2ITFA 3TA4D 2ZXQA 1DJXA 1NOLA 2P8LB 4FRWA 5GJSL 3QIUA 3U83A 1J0IA 3ATBA 1KNOA 3FB6A 1TZGH 2VH5L 1RZGA 4FJYA 2X7LA 1RD6A 1FPTL 1MH5B 2ZKHH 3BCDA 4LAJH 1URIA 3CZUB 3NK4A 2YPVH 3IPEA 2NNXA 3ZGHA 4APQB 5IHZA 1L5GA 4EI0A 1LK2A 4X6EB 3MLSL 4EI6B 4L8DB 2YXFA 4JEGB 3T3MF 3QUZB 4KKNA 1SBBA 1PAMA 4G1EA 5KZCB 3L17A 2J4WL 1ZLSH 2GUOA 3B5HA 5F9OL 3RIFK 1QSFD 5AZEL 1CLCA 2X6UA 4XOBA 1JZ2A 5EF1A 3DX1A 3MRHA 4NUJB 4XAWL 1F86A 2DQUH 4U6XB 4O2CA 5DQ9B 4WEUD 4C54A 2IAMB 3NFNA 3DNKA 2NX5D 2HTLD 1KN2H 3B2UD 1FNSL 3GSNB 2NUPB 3JXAA 1CICC 4IKJA 4N0FA 5GHWL 2BINA 3IAPA 3SJVE 1IC4L 4XOAA 2WWOA 5C86A 1JGLL 1MFUA 5FAAA 5K93A 4M1GL 4W9HC 3C6LD 2X7LB 3HRPA 1YY8A 5MEPB 3UC0L 5DJ8B 3RWJB 3I9IA 1CZ8H 2HVBA 3KPPA 4OU3A 4Y1TA 3WFBH 4HIEB 3JV5A 4HFWB 3VYPA 4UQ3A 2BCKA 2R27A 1VRSA 4ADIA 4JM2D 1IEHA 1XGQA 5IJKC 2LV4A 3SQBA 1L7TL 2VLKE 3MCKA 4NO0D 4TNFA 3DARA 3MV8D 2CIKB 3VRIB 5JHDE 4OM1L 2WOYA 1YNTA 3MREA 3QUZD 4HWBA 1Y0LA 1IC0A 4NEHB 2BPBA 1FDLH 4EVNB 2LOEA 2OXGB 5D7SH 1NDMA 2J8OA 5TH2A 5AW6B 1QNZH 4XB8A 4ZMQA 3RGBA 4JY4B 1W91A 3DO7B 1E4XL 4YDKH 1HC1A 3PWPE 1XXDC 4HIJA 4A6YB 5IJKA 4IBTA 3LNDA 5MEQB 3RG1C 1RK1A 4CKVX 2CO1A 3LNHA 3JWDL 4OLUH 2OCCB 1WZMA 4UYPA 1K4DB 1UT9A 3PWVB 4JM0A 3HR6A 4TF4A 3IK2A 1BECA 4LU5L 3IFLH 1ADWA 3IXAA 5B22A 4JCWA 2YD5A 1C08A 1NCAH 1NBQA 2NY0C 2ITDB 3X12B 3CVDA 3VCLB 2R7EB 1V3LA 2OI9C 3QULB 4Z7WB 1YEIH 2QDVA 2QVKA 4QAMB 3NCBB 1ZGLM 4FNTA 2PN5A 4O02B 4PGCA 2DRUA 3OPUA 3SIKA 3EH1A 5IW3A 4AK1A 2OSXA 3WBDA 1NFDE 4YNYB 3TJHD 1TNNA 1BAFL 1SRDA 2DQMA 4XHQA 1K8IB 3ESPA 1NBZA 1TVHB 3CZNA 4KITB 4AUJA 1S7VB 4YHZH 2A73B 3STZB 4DW2H 2AF2A 5A2KH 1KSRA 2QPDB 2IG2H 5D1QA 2WO4A 2HWZH 2YSSA 2KYIA 4ZUTA 5DT1L 5D2NE 2OMUA 4ZDHB 4KAQH 4JZJC 4DUXA 3GBEA 3HRZC 1KYFA 4HXAL 3Q9QA 2WXOA 4KK6D 4L8SB 4HSCX 5J12C 3MNZA 2VDOH 2E74C 2I7OA 4BSWA 3WL9A 3LHAA 1UYWH 3IDYC 4Z0BL 4ZMZA 1HXMA 3FUEA 1E4WL 3GRGA 4Y8AA 4KJWC 5DEGA 5FM5O 3E8VA 4NKIH 2A2QT 3SKNB 5IIEB 5L7XH 2P45B 4JQIL 4ISVA 3GDCA 2ZWYA 2VLKA 4LCWD 4DFHA 2P52A 4FXKC 2VRAA 3ALWA 3I3BA 3V0EA 1JPEA 4PRPD 2XZQH 2FATL 3F58L 3PGDB 4ETQA 5FHAH 5IFJB 2VDQB 2VN7A 1N10A 3MUGA 1Q9OA 5CLYA 5INCA 4NCDA 4DNLA 4HT1L 1CVSC 2IGFH 2ZKWA 5L2JB 2VSKB 1QVOB 1R1CA 3BVUA 1RUPH 2RALA 3QO1A 1A21A 3KXFA 5FS5A 2VKWA 1WZLA 1U6AL 5JA9A 2BVTA 3SJVA 4CGUB 1EHLL 2YC1B 3QXVA 2FWOA 4C83B 1RIVH 2C1OB 3D2UA 3FAXA 3FQRB 4OZFG 4P5KB 3DC0A 3L16A 4WSKA 5HI4D 5FUZH 2P44B 5FF6A 3EYVB 1FL5A 4OIIL 4O5LH 1AG6A 3QDMA 2HMIC 2X1WL 2LVCA 3IF1B 5E9DA 1XGYL 3CFKA 3HCVB 4K5LA 5AOJA 1DQLH 2XOTA 1ZT4B 2EYTB 1ROCA 2EE2A 3DRQA 3GI9H 3M1CA 3MGOB 1G6RB 3ARQA 3WEXA 5AB0A 2VDOB 4RA0C 4RGMB 1A6ZB 2R9HC 4XVSH 1KXTA 1OTTC 5HJGA 3A6BH 3IGLA 1MH5A 1TQCB 5KEZA 4UM8B 1MJUL 5JW5A 4XGZB 2NNRA 3BKCH 3RI5K 2VLLA 3QWOB 5EIVA 1KF9B 1AJ7H 1YN6A 5FUCC 5I8OH 5AZEH 2AJVH 4WW2A 4LSTH 1QFOA 2ZX9A 1TTCA 2EEXA 5HVGB 4EN3D 3M6DA 4O2FA 1NCBH 1V3JA 3CFKB 4X8XA 1PLCA 1M71A 3C5SB 1J1XL 3F3HA 2J8UE 4V1DD 2FJHB 5C9KA 2NUPA 3IDMA 1GKOA 1MEXL 2DTMH 4P5MA 2P5WB 4X50A 5TFSL 1BZEA 4KK5C 3IJSB 3ALPA 3M45A 2KZ1B 1KJ2B 3KNBA 1ACYL 1D5XB 2DICA 2Y7LA 4Y5VC 5L2KA 3B43A 1X6LA 1NAMA 4JZNB 3BZEB 1ZSHA 2CJTA 1MWAA 4ZNEA 1I9RH 3OV6A 1TETL 3IB4A 2M8XA 2YHGA 4HLZH 3PGCA 3PY9A 3JTSA 5GZNC 4RWYL 3BPOC 2NNFA 1HQRA 2J8UB 1NSNL 4Y1SA 4IU2A 2WQ8A 4YGAB 1ZT1A 1DBML 5EBLA 4RISL 3U46A 2NY0B 2ODIA 2EDWA 3Q5TA 1URZA 3CBRA 4KJPC 4NN7B 1JN6B 1A6WH 2OXGA 2Q0ZX 4JFSA 1QBMH 3S3DB 1RJYA 5DUML 5CJQH 3CN3A 5D1QD 3QQ4A 3TBCA 1O7DE 3UCRA 3U2SB 2VR5A 2EIZB 1GXEA 2P5WD 3B9AA 4OSUH 3FULA 3TF7C 3DECA 3NCFB 4JFYA 4AYDC 1UJ3C 1E42A 4NLAA 5FGBC 1E2ZA 1OCCB 1Q94A 1YYMH 4GO6B 5KJ7E 5ILTH 1Q9KB 1D3CA 3OTTA 1BMGA 5D93B 1YEEL 4WHTA 4MA3B 2D7TL 4XP6H 2ID5A 1LP9B 1JUFA 4TTDC 4YMPA 3OAYK 2GK0B 3LYRA 1J9TA 3GHEL 3JWNE 5HYJD 5I76A 3WMPA 2JB6A 1G6VK 2Q3XA 3EAKA 3O6FD 1UUNA 2C7UB 4YFLI 3QUXA 5ICYA 3MZTA 4I0PA 3VSUA 1XCTB 3NZUA 1IQWH 2E7CA 4LNRB 4R3SB 3P3TA 1A1MA 4S1QH 5K33A 3N3EA 5I1GH 4JFYB 5ITBL 3LCYA 2QVMA 4HD5A 2OI9B 2OR9H 1ZTXL 5DEFB 3V0IA 1FC1A 5HDQH 2EYSA 5GRWA 4XPFH 4OZHB 1SF3A 1OGPA 4M7JH 1INQB 3FRPG 4Y1AB 3F83A 2DJSA 1A5FH 4AV5A 2ILLA 5HPOA 4FNRA 4CBPA 3ZO9A 1JCKA 1R47A 2YRPA 3T2OA 1AH1A 3GHBH 1OL0A 3S36L 4JFHD 1TZAA 2B9BA 2DLGA 2HT2D 2OX5B 2ORBL 2ZKYA 4JFOA 5I0ZA 2XTJB 1HZLA 1GGBH 2B1AL 4ANKA 1IGIH 3MROA 2R0WH 3V5HA 1FNAA 3MYZA 1NC2B 3D6GA 3D30A 1OW0C 4WFFE 3T0VA 4NKIL 3SPVA 3WJLA 4KTGA 1MRCH 1I1AD 2XG4B 3PHAA 2FJFB 4D2NA 3Q43A 1IGYB 5I73C 1I8LA 5BO1L 2WUBH 2BP8B 4PV9A 5KVEH 1BDYA 2W65B 1BXXA 4MA8L 5DSCA 1GVIA 2R1WA 3ZL1A 4H26B 2FEDD 2V6HA 4PCKA 2DM4A 4K2UH 4M9PA 4WWPA 3WEBA 5F8RC 1TJXA 2Z64C 2NLJA 1F4AA 3CMGA 4LLWB 4LKCB 2VXQH 2QV4A 4MX7B 4ODWB 1OW0A 3NACL 1UH3A 4LDLB 5C09A 2OSYA 1PJWA 1QFWL 5IG7A 3KL0A 2ZCZA 4JO1L 5SWSB 2XT1B 2QGCA 5B1CA 3WNMA 2X89D 4XWGL 3FU5A 4HS3B 3ULUE 4Q9BA 4QHNA 4QRUB 4XPGL 4Z0XB 3V6ZA 4Z78A 4FNQA 3VB8A 3C60A 2MQCA 4ANWA 5AVUB 1AC6A 4Q4EA 1TENA 4MNQB 4MMZA 3HTLX 1T66C 4LSPH 1M2VB 4M7KL 2NYKA 1TO5A 4ANVA 5F88A 1IC7L 2H7WA 3MGAA 5F9OH 4EUPB 4OCSH 1D5ZA 4WLCA 1F3DH 2XNAA 4F7MB 3F12B 1HCFX 1H6TA 1Z1WA 4DUVA 1SXCA 3DSFL 1NBVL 4HGWA 4HUVB 4WCYL 1NUDA 3DYOA 3R0MA 3CU7A 3SKMB 4M8QA 2Y3AA 5KVGL 4GPVA 3CZLA 4RAVB 3RDTD 4KK9C 1LWHA 4AIZA 1WUNT 3FH5A 2BJMH 3TJEL 5IFHH 2V7NA 3D7PA 4YSTA 2NOYA 1MW0A 1XTMA 2BSSA 4Z7OB 3VXUE 2BP3A 1R17A 4OD2A 3D0VA 5BUAA 43C9A 3SDAC 4I3RH 1WA1X 3OBAA 1VAHA 4PPTA 4U2YA 4G8FA 4XO5A 4DZ8B 2XN0A 4N0CD 4A55A 4PLOB 2WK2A 1ASPA 4ZQKA 2CO2A 1D5IH 5I26A 4YO0A 3UYRL 1A02N 4AKPA 2AZAA 35C8L 3A67H 1BZ9A 1H3GA 4U1IB 4WJ5A 4MD5B 3T4YA 3UZQB 1MFNA 3D33A 2X70A 4ELDA 1SUJA 1SXAA 2DH2A 5T1KA 3DX8A 1KWKA 1JTTA 2VDLB 4ZAKA 1JWMA 4XB3A 1VACA 3ARGC 3LNIA 5FIEA 1F1DA 4PWGA 4FADA 5GHWH 1S9KC 4QRQA 4U0RC 4YUEL 4ESKA 5JW4N 1KPRA 4F9PC 3LZQA 1BM3L 2FJUB 4ZQKB 3QFJA 2VZUA 3G5XB 1GSKA 4IYKA 3S3BB 4YDVA 5AW5B 4YLQT 3ILEA 3VD5A 4MCZB 3UROR 4TQIA 3FUFA 1UKQA 2VMFA 3QXUA 3BT0A 4RRPA 2XKUA 2EDKA 2G3MA 5DC2A 1PKQB 1XIWD 4B7IA 4JO3L 2AXFB 4LSTL 2E7HA 2CLRB 3EADA 4PJEA 2YJQA 2H3KA 2Y72A 3VO0A 4GQRA 4KC3B 2FD6L 2EXWD 5DJDB 4Y9BA 4N22A 4Q2ZB 3WO4C 2CNZA 3M17B 3ZLQC 5KSVB 3CD4A 3G9AB 3KR3L 4DOHE 4N90D 1HSBB 4GAFB 4XVSL 5IMKA 2CGYA 3OAZK 3EH2A 5DEGB 1SY6H 4LVHC 2A9NL 5ETUB 1T21B 3TIEA 1LQBC 2QLVB 4DP1X 3S9DB 3RHWK 2I9TA 3SZKC 3FO1B 1S5HB 5I1GL 1Q1PA 4HAGA 3GS7A 1Q9WA 15C8H 5F7BA 4F8QA 2VIRA 4HWBL 1AZCA 3AQZA 5J6SA 4QXGL 3QORD 4JJ5A 4IKLA 4PR5B 1E7VA 2B59A 4NZUH 1UQSA 1BFSA 3RPKA 7TAAA 5DJAB 4J27A 1ZVYA 4ZMAT 4IIQA 4NUPA 4ZXBB 4BDVA 5AD0A 5DUJA 3CHOA 1YEEH 3FB6B 4PY8J 4G6MH 4EI5C 2LW3A 3Q3GA 4PREA 1SLVA 2NY3D 2UX7A 3IFPB 2QZ5A 3PABA 5ICZB 2C1OA 1AIZA 3Q9PA 2O72A 1FBIL 2VLMD 2HT4D 3NIFB 3B3IB 1BXUA 4B50A 3TIEB 4MJIB 3LD8B 3BSZH 3D05A 4XTRC 3REVA 3KYMB 2MPAL 3Q48A 1XR8B 4WNQB 1CE6B 4PSPA 4ZMTA 3WIIH 1YEDB 2VTFA 4XZUA 3RNKA 3O4LA 4RZCA 2IXQA 4JG1L 1EGJA 4P3DA 1JHLH 3C8HA 1RVFH 5CEXA 1A1NA 3TCLB 5I82A 1R0AL 2YSTA 4LLVB 1PKOA 2CHZA 4XMVA 4FQXC 3IDJA 2DWTA 4PGEB 2RA1A 4WSJA 1RULL 5C08E 5E7FA 3ECUA 4B60A 2B2XH 5MHSD 4K55A 4JRYA 5I1EL 5DJXB 5SWZE 1QSZA 4ZTPL 3WSQH 2AK4A 3LIZH 2EVGA 2QPFA 1YEJH 4DO4A 3FYIB 1NMBL 3ZU8A 5I8KL 5GS0D 1JRHI 4EE2A 4EO5A 2NY2D 2HN7B 3CXHK 4E42B 5JO5A 5H37H 4AUUA 4BSVB 5E03A 3P2DA 5FYJH 3ARBB 2DMGA 4PS8A 25C8H 3RY4A 4HU8A 3R0NA 4MDJA 4M48H 3AMKA 1JV2B 2HFFA 3WTWA 2VN4A 4IHOA 3KNBB 1HILA 3BVDB 3DV4A 4G7YL 3GMQA 5D93C 1P6FA 4PJHF 5CJXA 5FM4A 3QXAB 3QUMB 4ZYKA 4JFXA 3I50L 3RJQB 1MWAB 3K4AA 5F2FA 1UJ3B 3L3JA 5CZXC 5TQ0H 4KUCF 4KY1L 4PJXB 3X3FL 1WICA 5F7MC 1WEJH 5CSZB 3B6SB 1GGIL 3LSOB 3WJMA 4DP5X 2EC9U 1ZWIA 2GSIA 3MXVH 3ML8A 4K3JL 3VFPA 4KFZC 4Q74A 5CJ8A 4ZFZB 2PCYA 2UZYB 3CHPA 3IYLW 3HKZA 3QT2A 1RCYA 3QJOA 2BNRA 1T5XB 4ONHB 1TU2B 1YEFL 1I7UA 4D9LH 1MVUB 1S5IH 2BNUA 3DA0A 2ZOUA 3ILDA 4OY9A 1TPXB 1CWVA 3SGKA 1KYOK 4BXVA 2J6EH 3EF7A 1CBJA 2VRKA 2ZUQB 2GSGB 3QAZC 2V8LA 3B9KD 2BW5A 1KTRL 3RGHA 3U2SA 1ZV2A 1XH2A 2R69H 4NENA 4PW9A 4XGZA 2FBOJ 4TPRL 2CHXA 3W0WD 1OTTD 2JTDA 2XQYA 4YGVB 1L9TA 4JN1L 3SE9H 3T9WA 1AFVH 3PWPD 3LQZB 4QCIA 1FVEA 3QHFH 3RVTD 1EXGA 4XPAH 2PNDA 3AS2A 4IGBA 4DKFL 2J1ZA 1WBXA 5B38A 3DDGA 5B4MC 4N1CA 4EXKA 2EO7A 2FNBA 3DETC 1F4HA 5K9OA 3KZ8A 3D0AA 2X10A 2SEBA 1BVNT 4OUOA 5EO0A 5JR1L 3WS6A 3L9EA 5DJ0B 4QYOB 3QJVB 5CR8A 3L95B 5CGMA 5GRJL 2LTQB 3H9HA 4HKBA 5MERB 2QSCL 3RJOA 3KCWA 1KTLA 3QUYC 1TLMA 3W39B 1X5AA 4GQ9H 2AAAA 1FNHA 4AG4H 4WY7H 3WU1A 3M1OA 2I60H 3ARDA 4MCNA 3QARA 5IFJA 4OUUB 4UILH 1T20B 3R7QA 2FWSA 3CN0A 4ZUSB 3GMPA 4P2RA 4Y2LA 3V0WH 1TQCC 1QQDA 4J3OD 1CXEA 4GKOA 4HZ1A 3GMMB 1TQTA 3AABA 1GGIH 3QUYB 4ICXA 4EQ2A 5LAPA 4LSRH 3KWXA 1FZJA 1ILUA 2VAAB 2YOCA 3WDHA 4F8TA 5IQOA 5K9OB 4YXKH 4I88A 1DLHB 4R26H 3E6HA 3CZGA 5LBVA 3CSYA 1WT5A 4D8OA 1OGTB 4MSWA 4YHIB 4BCYA 4W6XB 1ZIBA 1YECL 3U30C 2N01B 1UA3A 4TSBL 3V4VA 1TO4A 4KRMB 5E5LA 4FFZL 4GW5A 1TZHA 5C0GB 1U42A 4BZ2L 4XN5A 4JRXE 1AKJA 3WFZA 5C6TL 5L4FA 3L4UA 4K7PL 3VJ6A 3KYOB 3PNWB 3D3VD 3K72A 5ALCH 2DF3A 3T1FB 3R8BB 1MCRA 2XSKA 4YHYC 1K72A 3PP4L 5ICUA 1FZOA 3I85A 4X0NA 1XGRA 2X5PA 2CUHA 2DTSA 2FHFA 3GBNL 3EO1A 4KVNH 5IQ9A 5EUOE 1JGLH 3LJ3A 1TFPA 4QHUA 3V0VA 5H94B 5J06A 3GQFA 2BSBA 1KEGL 1MQKL 3ASWA 2OMNA 4N25A 4J7RA 2VERA 1I7TB 1BQUA 2VXQL 4OZIE 1KCKA 1NINA 3O2VH 5FKPB 3ZDYF 4I18C 5DO2C 1N0LA 3DOSA 4D3CH 2F53B 3EYQD 3PGFH 1U9KA 1K5NB 3WUWA 2QV2A 4P2QE 5GJTL 5INCB 1J5CA 3X13A 4UT7H 4CSSA 1D5ZB 3QJUB 4R4FL 3MOAL 1P5UC 4XCEB 2BZ7A 2ITCA 3KPOB 5CEYA 5FW6A 4R5VA 4WRLA 4APXB 2UVFA 5I74C 3BAEH 4E9TA 1DDHA 4ZD3H 1NAKH 1J8HE 4PJCB 1JNHB 4YQXL 1BAGA 2GKIA 3ARBC 5A3ID 2G0LA 3BRFA 2QADD 4NPYB 3LNFA 3MV7A 1F4XL 2I26N 1PLAA 4A1RA 4DVBA 1B0GA 4ECNA 3UIYA 3UBXI 1P5UA 1TJHL 3PG2A 1M05B 3TC9A 1XT5A 1I31A 3LZFH 1HQ4A 4X4ZA 2HG5A 1EDHA 3AM8C 3C5XA 4QNPF 3SGJC 2CA4A 3UTSE 4W9EC 5C6PB 5F9JA 4AYMC 2AVFA 3TO2A 4QWWD 1CCZA 1F90H 4NKOA 1V7ML 3MO1A 4KXZH 4AV4A 3WKPA 3WAKA 4XXWA 2WXMA 4EQ3A 4N2BA 2WBJD 5CBEB 5HSFA 3WY3A 4QF1A 1TJGL 2PLTA 1R24B 5EZIH 2B14A 4KU1A 3M7OA 3FO0L 4HK3N 2HYMA 4QRUA 1PG7X 4LL9A 1LVEA 2ED8A 3WNKA 1Q9KA 4DEWA 4H0IA 3I6LE 1NGWA 3SDCA 4A7GA 1H6FA 4QYAA 4CC0A 1FRGH 2B16A 4URTB 1E67A 4HUKB 1CXLA 3C09B 1W0VB 3TBVB 2E8YA 4CW1B 5CU9A 3BHBA 4KI1A 5BOPA 1ZGLB 3BJ91 3GSVA 4ZX5A 5LN4A 1AD9A 1KXVC 2GHWB 3TO2B 1JL8A 4XBGA 5EU6A 4K0OA 3K6FA 4QUOA 4JR9L 2G5RA 1HL8A 4HQQL 5MEOA 3Q06A 2WB1A 4MHHG 4A6YA 3H4HA 1XZWA 3F85A 4EI6A 1H8NA 4I3SL 3SO5A 1ZA6A 3CU1A 4MYPA 3VGHA 4CC1A 3KJ6H 2YQ3A 5KYYB 2YMXL 3GHEH 1WFIA 3GIZL 3P77B 4GS7B 4U4BA 3G6JB 4NQDD 4AM0Q 5T1LB 3EJYC 4CNIB 3UPAA 4L3EA 2O5NA 5CGYD 1TZIA 3ZSSA 3IMRA 4JUTA 3BW9B 3PRZA 4TNGA 1QKZH 3TXAA 4KNQA 1OAQL 3B1TA 2Z7UA 3DO4A 4PGBB 5E00B 4ZW8A 5I6KA 4RFNB 4GBXD 4PRAB 3U2IA 1MAML 3MROB 2YN3A 4J3OF 1L0YA 2GCYA 2Y1VA 1R3KA 2ZOLB 3SPVB 1DVFB 1NBZB 4WJ5B 2HJLB 1JVKA 3APFA 5D7JC 1FZMA 1G7PA 4LLYB 1ZS8A 4UQIM 1XGTB 4TSCL 3OAUL 4CDGC 1R3JB 3CFJA 4AENA 3WV0A 2B59B 2JCWA 1NCUA 5EF0A 1TUPA 3GTVA 4JGNA 3BIKB 2HLAA 1MCFA 1DQML 5D6DC 4EBQL 2QFPA 3VXSE 5KYXB 1EXUA 1SJEB 1RJCA 2YGVA 3ZHLA 5FO2A 5I6XB 1UADC 3B2UC 1X3DA 3RIAK 2CXKA 3IAQA 4WW2C 2QL1A 4NRZA 3ZK0A 1MCEA 3WY2A 3NDYE 3HZVB 1GIGL 2G5BA 1NM9A 4DF9A 3GLDA 1M3IA 1QSEA 2Q6WA 5ECJE 4V2CB 2QDWA 1DVFD 2OYMA 4TNEA 4ZOBA 3BKYL 1S8DA 1Z9NA 4CVXB 4AQEA 1BGXL 1M6OA 3RGVC 5E9DD 1QR4A 2W59A 3VVWA 4FTVE 1P7BA 5I1CL 2AV7B 2VW6A 3MLVL 3D12B 5EA0H 2C1PA 4G7VH 3PLYA 4DERA 3EBHA 3BISA 3GHPA 2NX5A 1KDIA 1MHEA 2HKAA 2EJ1A 2Q76B 3B9EA 2XI9A 2MPVA 4FS0A 2DQTL 5IBUB 5IESH 1AR1C 3KEDA 3UTPD 2ZUTA 1ULVA 3E1F1 2FVNA 1X4ZA 1BF5A 1I9JH 1ETZB 4N8CL 4BFGA 3PWUB 3BUTA 1XH3B 4ZAKC 4PJDA 1YMHB 4LLUB 5DJYB 2EVFA 1BWWA 2EKJA 5JIHA 2IBZX 1B4LA 2HFGL 2WINB 3TN0C 2HCZX 4L4TE 5B39B 1M7IA 5CKGA 3ZKXC 4OV5A 1G7HB 2UZIH 5HJBA 1NBYB 2XACC 1NWPA 5D4QA 4N8VB 4LP5A 5ID1A 1AO7D 5D5MF 4FA8A 5KVGH 4ONGH 4OLZL 2CH8A 4V1DA 4GKLA 4DP0X 3EDFA 2D7PA 3IJ9A 3BD3A 4Y1AE 5IOPB 4XP5L 2FBRA 1A4CA 2C9PA 4M6OH 1WWWX 4PJEF 1LEIB 1Y6NR 2IC2A 2WPGA 4JQIH 3TTYA 2PYFA 3IJEB 4DEPB 4CAGA 1BZ9B 3QUMA 4ZYKB 3VXRD 5I1AA 2UXGA 1XO8A 4JFDD 1EBAA 1RL1A 3BQUB 3NSJA 4O58H 3BO8B 3WKNA 3RFRA 1OSYA 2NXZB 1CDJA 2EDHA 2JKTM 4Z0XA 3V6ZB 3L7EA 4Z78B 3KPRE 3ZYZA 1PDKA 1UA6L 5ANMA 3MCKB 2KZWA 4UI2A 3ZYJA 5E6IB 4UYQA 4XP9L 4PVMA 5LAXB 3ZTDC 1N67A 3EJPA 4BHUA 1AQHA 5JIPA 4P5MB 5GZOD 2VDNH 4H8VA 2GTQA 2ZPKH 3EHBB 1FJ1A 5B7MA 1U3YA 3BGFC 5IW1B 2CO4A 3L3DA 2B15A 5CZRA 3VFMB 2P43B 4M9OA 5DJCA 4M1DL 2EH8L 2NY1D 5KYWA 3ECBB 4RX4A 5HYSB 3D85B 4I3RL 2EDFA 5BO1H 3IM1A 4ZW3A 2XFXA 3UGXA 1GZHC 2X6BA 2N56A 5CHNA 2YO3A 4EZJA 1ZSDA 3II3A 2VLKD 5FF6B 3RVUC 3G04B 4NSKA 5J7CC 1DJWA 1WG3A 4IRSB 1J0HA 2XHNA 1YJDH 4MAUL 1L6ZA 1MCOH 4KKZA 3V0HA 3F64A 1V27A 4G80B 1PG7H 4M6ML 4G8IA 5FECB 4MJ2A 3GSVB 1DQQA 3D69A 1NKOA 1HYRC 4QTFA 1A6PA 3FQWB 3MLTB 4L1LA 4M5ZH 4RSYA 5E8DH 1YMMB 2Y36H 2HJFB 1NUGA 1EFQA 3VXOA 5T1DH 3HZMB 5I6MA 1A6UH 3SODB 1KTLB 2F8OA 3JVFC 4JG5A 4XVUC 4XX1E 12E8H 3MOBL 2IH3B 4GAYA 4XHJC 2K7QA 4NWTL 3VWKC 1RZIA 3BYYA 1T3FA 5I2IA 1KLFB 4X6BB 3ARDB 3K2UL 3T3MB 5A6MA 1WP6A 2CJUH 3DX8B 2YKLH 2C9XA 3TH2T 4EIBA 1I9EA 1WZAA 2KHAA 2VR3A 5F89A 2VQ4A 1OTSC 2BHFA 2LVEA 2UWEB 3N85L 3Q2CA 3UJTL 3VXPA 2FUQA 1U3HB 4WHTB 5CJBA 1HEHC 4DGYH 3FMGH 4LCYA 4TUKL 4D0BB 4LAQL 1LLAA 3F62A 2N1TE 2LLGA 3TZVC 5G55A 1TETH 3OHXC 4NQXB 5FYJD 1OB1A 1HXMB 4JPVL 4XP6L 4F7PA 2NPLX 3LXUX 4RA3A 1X5MA 2UVEA 5F1NA 1G7MB 1NEZB 4Y5VA 1VKXB 4KH2A 1N7ML 3WS3A 1X5GA 4QLRA 1RK1B 1MCIA 2BMKA 1NAKL 4EBQH 1CG9B 4BSJA 4AJVA 2EO1A 4MJJA 5F89B 1G7IA 1KJ2H 2Z0UA 4J1UA 1MRFH 5H4YA 2BW4A 4BQ6A 5FA4A 3N42B 5IQNA 2P8MB 1M1SA 3LQAH 3KJ4B 2AJZA 4FNSA 1OAKH 1WC7B 3ZTEA 2DQDL 2FCBA 3LEVH 5HJDA 3S5ZA 4Z76B 4J5VA 3MJ7A 1QSVA 4JG1H 2SEBB 1BQLH 1F4WH 4WI0A 2TRYA 4MS6A 1R75A 2GTZB 2F6AA 3GO1L 4JGUA 4N90E 4JFFD 2I25N 3N0AA 5MERA 1HEZB 3S4SG 4HIHA 2J5LB 5EZJA 3MVSA 5E1QA 3VI4B 4X98B 3V5DA 4QJ3B 3U82B 3GMLB 4HCIA 5D96B 1REIA 2B3RA 1YNLL 1NGYA 4QRPA 4RQQB 3KH4A 3QG6B 2YFNA 4LCWE 4YFLF 2WQAA 4P4RB 4U4IA 1B2YA 3K71B 3QNZA 4NQEE 4KY2A 3HLAB 3VFRB 3UTZA 4X6DB 1J1OH 4BGDA 3CFCH 4KZ0A 4WU5B 1FO0A 5IROD 4W1TA 4ELKB 3O3DA 3FMGL 3CFBB 3NGBC 2VDML 1NCIA 3WL9B 3PS6A 3GJFB 1RUMH 2VXVH 5B3JE 4O4YL 4Q8BA 3RL2B 4GKZA 4JY6B 4UT7L 2X88A 2PWHA 4M7LT 5I17B 4MZ2A 4URKA 2A4ZA 4ONGL 4XXCA 2A5UA 5EIIG 3ZSTA 4XP1H 4BA0A 3VTAA 3AG2B 2XA8H 2EIEA 4I1PA 4L23A 4OAWB 5FO7B 1D6EA 1KGCD 2EXTA 2WSKA 3UDWC 3PWPB 1M42A 5D1ZB 3H7BB 3FUMA 4CC4A 1JPSH 3VFGH 3ZKSD 3UJIH 5C0NC 5IOPA 6PCYA 3MJGX 3UTZB 1WCBA 1QBLL 3WEOA 2YZ8A 5DLML 3MMEA 4IIQC 3VYOA 5ADPL 3QHZL 4P23B 2HB0A 3QEQD 2EE0A 2WXKA 4KHTH 1FFQA 4UV7L 4XXDA 1MLCA 5CN1A 4HJGB 4J2QA 5GRYA 1WSST 1CIUA 1YUKB 3VXRE 3UDWA 4U1HB 4YPGA 3IJHB 3CX2A 3HE7A 4L5FH 3DJSA 5KOVC 3S35L 3QDMB 3EKCA 1TT6A 4Y19E 3I74A 5L6YH 4PY8I 3ZKND 2AXGB 3UL4A 2Z35B 4IEFB 2WY3B 2XZCL 4APQD 1NFDB 1GMIA 5FYKU 1ADQL 2YPLD 1A65A 4RGNE 3ZMNA 3TV8A 1T1XB 3E7JA 5MENE 4HDIA 1XB3A 4YE0A 2K1MA 2VW7A 4PS4H 4M6NL 2ZXCA 2BXYA 3PHQA 5DD5H 2ZZUT 5H35B 3S98A 2HJKB 2R1XB 3D08A 4ODWA 3ENEA 3T09A 1TTUA 3OKMB 4PJIB 1MLCB 4KO5A 1HH6A 1ILSA 3S5LG 4U1IA 3NJJA 4UOW0 2ETWA 2X09A 3GGWA 5ACLA 5EORL 1NMCC 4HFWA 3DDFA 2WZ0A 1Z0NA 3P9LB 1ZSDB 4E68A 3QDMD 5AQ0A 1Q94B 2IPTL 3A67L 35C8H 5GRVK 5JOPD 3RFZC 1NBCA 3CSGA 3EO0B 4I2XA 5FWQA 5HHQB 5GGVH 4U6YB 1XDTT 2HLFC 3BZFA 1OF2A 1AD0B 3V52H 4PW3A 3FSOA 2PCPA 3OKYA 3V9CA 3D3VB 4UV4L 3ZRCC 5I0YA 5T1DL 2L7UA 1RJZA 3T0XA 3O11A 5I1JL 1QTPA 3OHMB 5DD6B 2XNAB 2ZJSH 5KBMA 4AL8C 1OCWL 1F0LA 5A2CA 3AC0A 4NDMB 1G6RL 2KI6A 4I5BA 4PTTA 2FJGA 5IVNA 4XNXL 1OT4A 4F20A 3VXOB 2CNYA 3GXNA 4ZTOL 1N2RA 3NH7H 2E7BA 3LZOA 5JLZB 4RAVA 4YX2H 1DQLL 1VADB 1FORH 1J0ZA 1MOEA 4G1EB 2BSCA 3NABH 4P59L 3RWHB 1JGVL 1H15A 3R4DA 2NQCA 1ROWA 1A3RH 2WXLA 3Q7JA 2V2TA 2K45A 2WYTA 1GY2A 3HAEB 3QORA 5EPMA 1INQA 5F0PB 4ZS7H 3PWLA 1L9SA 1BJMA 1OGSA 3U46B 3MV9A 4AI7A 1W0WB 4PJAA 3PL6A 4OGAD 4XBMA 2YK1L 4OZGA 4Q6KA 2CALA 3KL5A 4DCQA 1WBZB 1HHIB 3BSZA 2Z4TA 2V5RA 4KHXL 3BUDA 4FYRA 3QZWB 4B3VA 3GSWA 3EO1B 5L2KD 3NJXA 4HWUA 4XNQA 2WBXA 2F2HA 3QB7C 2XCMC 3PL6D 3WIFA 3HG3A 1N2RB 2JCCB 5EG6C 1DUYB 1S7SA 1NPUA 2FJFA 2IANA 3DWTA 3MRMA 3RA7H 5FEBA 2PYED 1A6VL 4XE5B 5KBKA 4L9LA 4FG2A 4EDXA 2XPZA 2WAHA 4PG2A 2WCPA 4O9HH 5BVPL 3OPZH 2Z7WA 4PEEA 3K4ZA 3EJZD 2P4AB 1XF4B 2OKMA 5FGRA 5EC2B 4BA8A 2WLJA 3PWNB 4DPBX 1U21A 3VX0A 4DP2X 4G7YH 4HJ1A 1QTSA 4KI5D 1I7RA 4PJDB 3GZOA 3I84A 3NJVA 2DQEH 5B1BB 1C12A 1S7RA 1ORSB 4S1DC 4ZFGH 1MCWW 5FV1L 5J89A 1G4RA 4NRYB 5ALCL 4JFHE 5FV2A 4MJIA 4NQQA 3X11B 4GW5B 4K9JA 2PR9A 4ENZA 5BV7H 3OJDB 2NY5H 4XNAA 5HPMA 2OMTB 3MRMB 4DKFH 3H3BC 5ECGA 1F3JB 1J1OL 2NDGA 1ZVNA 2X4SA 1N7MH 5JXAL 4L9DA 5EOTB 4YR6B 2XBZA 1FL3B 2Q8AH 1CDGA 4BFKA 5E8OB 1WE5A 4YSOA 3T8XA 4D8PB 2NY0D 4PJ7E 3GMOA 5CEZD 3VI4F 3IETA 2A0LD 5GGTA 4PRID 4UOW1 3WLBB 2VDKH 2L7EA 1FUNA 3UJJH 3HFML 2W60A 1LMKA 5AB2A 3D2UB 1BF2A 2R69L 1E3FA 3FQRA 4JKPH 5D8JL 5I15H 1CICB 1JS4A 4WIQA 3KVQA 3K2MC 4OTXL 3WNIA 3VNZA 1Q9LA 4FQXB 3KLHD 3QPKA 2NYYC 3NN8B 1G5GA 4PJ7B 1W72H 3WNJA 1F6AB 1B2WH 2G3XA 3KLSA 1XBDA 4RSVA 2AV7A 5I5MA 3QHZH 5C0AD 4IMKC 4XRCB 5ICXB 1O5PA 1U8JB 4BE6A 2R69A 4HISA 3ROLA 4OCXH 3MMEB 2HTKD 3GS4A 2HLEB 2P46B 4JG0L 1UB5A 4ONFL 5T1LD 3RWGB 4WK4B 2BNRE 1ZY9A 4RCAA 3O6FB 5I30L 3QI9C 1G4MA 4P5TD 2HFGH 4C58B 3HNSL 1DDTA 3CFDA 4JHWL 5JQIB 4G6AD 5DU7A 1O9VA 1BM7A 3B2XA 4FEIA 3W0WA 1JGDA 5KYYA 4EZLA 3BPNB 2WJ7A 1FL6A 2ZXDA 2HKHH 3CCHB 3QJQB 4FMKA 3US9A 3TFKD 4BH8A 1G7JA 4IW4C 3IDIB 2EH8H 1H3XA 3C5SA 1FYTB 1QO3A 3HG1A 1YYLL 1QYGH 2AXHA 3VI3A 2DWDB 2XY1A 2BNRB 5FK9A 4YSEA 3RDTB 4Z7NF 2EYRA 1HCYA 1MCLA 3IJSA 3T2LA 1ZV5A 3OSVA 3QJHA 1U8IB 1CGYA 3BAJA 1KBPA 3U6RA 4AWJC 4DN3H 4BD4A 4LVHB 1MIML 1U0QA 5K9JL 2DWXA 5DFVD 2FT8A 1RPQA 4QRRA 5K59E 4JKLA 4KJPD 3ISWA 5DJXA 3BN9C 3OZ9L 3RZWA 1ZHLA 4WWNA 5BRQA 2AV1B 1JI1A 3WO4B 4X80L 1P6AB 2WWKT 2XQ0A 1VGEL 5I23A 1ED3A 1GSMA 1PEZA 1ORQA 2NNCA 1JHTA 2J6WA 1HQRB 4POYA 5JPNA 4LDEB 3CCHA 5FDWA 1TTAA 4S11A 5EOCL 3SDCB 2DQUL 5ISZA 1E5UI 3FRUB 2XICA 3OQRA 3V52L 4RMUA 5T1JA 1KBGH 1ZT4A 3DX3A 4JRYE 2R8SH 5LGJB 1KCUH 5EUOB 4YSDA 1NCJA 3SPGA 1INEH 5FK9B 3LEYH 3OKLA 1X5LA 5FHBH 1WAAE 3QPQD 5EU5A 1WIUA 1OIOA 3CX5J 3QHTC 5E7BA 4OZIB 4F8NA 5ISZD 3HS0A 3BSZL 3VXNA 1YY8B 5T33L 4HETA 3VFOB 3VFMA 5CWSA 2HT3C 1S3RA 1AZZC 2NTFA 1ZK9A 5DD0L 1EEZB 3CIAA 3O2WL 2JWYA 1JV5A 3B8SA 3CBKB 4LGPB 2A73A 3STZA 5EF2A 3VW3H 4OZFB 1BQHA 3GMNA 3BWZA 2VW4A 4L3CA 3BRDA 4PJBA 2AAVA 2GEEA 1S7UA 3ARSA 2XN9D 3S34H 1MHEB 5KSBA 3KYKL 3UYPA 4HHGA 4IBYA 4FG6D 5LKNA 2B0SL 4QHMB 4V11A 3BEVA 3MRQA 4QOKD 1YYLH 4OJAA 4N1EA 4ACTA 2J55A 3DUSB 3IDNB 4XI5C 3KPNA 2PO6B 3BPLB 4AIXA 1RZ8A 3S3SA 3RGVB 2Y24A 1MG3C 2FX9H 3FCSA 4TN9A 2CJSA 2DM3A 5DHYA 4DKEL 3BFQG 2BVOB 4PUBL 1EA9C 3MA9H 1ODAA 3I3EA 3HEIB 2R0LL 3I6KA 4N2EA 3JWDH 5CUSL 1BVLB 3O3UN 2OMYA 2E46A 2P47B 3GRWA 2I07B 3LQZA 4QCIB 4DVRL 5FCUH 1UG9A 1T0MA 4BFIB 1YYML 2PKDA 3S0PA 5IF0A 3H9SA 1KCSH 1QW8A 1GA2A 3SBWC 4JDVB 1EJ6A 2F1EA 3CDCA 3DMMB 2VZTA 4JO3H 4RRPG 4H20L 3UO1L 1KCUL 1BG1A 5GS1B 4XZ4A 3G6AA 4KK8D 5DJ0A 1RZ8B 5LBSL 2VN3A 1AE6H 3LIZA 4PJFA 2X4NA 4YLCA 3ZVVA 3O3EA 3NTCL 3QQXA 3L3IB 1I82A 4A2DA 3JVGA 3ZXAC 4P46B 5I1LA 4IRZH 4NZ8A 1DVUA 3LMJL 4F58H 2NY3B 1AGBB 2C1PB 4GINA 2WIIA 1LNUB 3WEXB 3BFOA 1JPGB 1HTYA 4MDJB 3MPCA 4OZFH 3IFNL 4P3CL 1I85C 3Q0HA 1FZJB 4JDVA 4O00A 2WBWB 5I9QB 4Y9FA 5DZAA 2P8PB 4EN3C 3MJ8B 5DVMA 3O9WA 1KIRB 1ZTXH 3PABB 3CH1B 5C3TA 2N0KA 2RFXB 2UYLB 3GO1H 4HXBL 3E1ZA 1MW3A 1FFNB 3EXJA 4QHNB 4YPGB 3B3IA 4R3SA 3N1GC 3RVWC 1E5BA 4LEXH 3SSGA 1BYPA 2JJSC 3UYOD 2ADFH 2B9AA 1KJMB 3BPNC 2DWEA 1PZCA 2GI0A 3ARDD 3PGDA 1YMMD 4LVNB 3ETSA 3OQ3B 4C56E 5IWLA 1PYWB 1FH5L 2N59A 4MQXD 3AB0C 1ADQA 2VR9A 3V7AE 4C55A 4FL4B 1X5FA 1V55B 1YAZA 2ICEC 2QPUA 1CK0H 2CLZA 4NP4L 3P1VA 4GRWB 4I48B 2H2SC 4XE0A 5EH1A 3WEAA 1LEIA 3UTTE 3FCUB 3K7UA 3C5ZD 4LZKA 4Z7UB 4WCYH 5L8LB 1N8ZA 3X1FA 2X0VA 2ADIB 2A74A 2I69A 1RZPA 4RFOL 3BUBA 1AGDA 2EH7L 1XF5B 4HFUL 4P48A 4NI3A 1AQ8A 4E0RB 1JFHA 1M2OA 1N5AA 2EECA 1BQRA 1G87A 1K6QH 4NQDA 1XCXA 3S8WA 2FLMA 3RTQB 4X7FC 2H5UA 1E6OH 2HN7A 2AJUL 5JO5B 1S78C 4E42A 1QWHA 5I5IA 3NFNB 4IRJD 5I28A 4KJYB 2G60H 2ICWI 1QSFE 4XC3H 5HHPB 3QIBD 5EEZA 4LBEA 3P4OA 2VR7A 4WO4D 3MLWH 4XBGB 4M8UA 2DS4A 2ZNXA 4AYFA 5BXFB 1MFBH 1OAZH 4F7PB 4L37B 4LBAA 3HFMH 1S9VB 3QP3A 4QPEA 1UOVA 2FGWH 5AAMA 3DSNB 3ULUL 3IN0A 3DPBB 2ICES 3AGWA 4XAKE 2X3AA 5TTRA 2JKNA 1IM3D 4JDZA 4KUZL 1BEYL 2Y1YA 2Q20A 4XR8C 2WCGA 1LL1A 3N91A 1CFQA 3PPEA 5AAWA 1N5AB 4J4PA 2WO3B 4FG4A 1Y7VA 2GBAA 4HAKA 5AW8B 1NANI 2J88H 4NGHH 1ND0B 2FSDA 1NZRA 2VZ1A 3FFCA 3T6WA 4CVZA 3C75A 4ZPTB 1NC4B 1PD0A 1ZA3B 5C0IB 1UWYA 3D4YA 4YXHH 1UVQA 5IMMA 3IDMB 2HFEB 4G7RB 1ZDQA 3TN0A 5IM7A 1ZLUH 2X05A 5G2NA 4OFKA 4PV8A 4G6KH 5A2IH 2Z8WC 4GMSL 4JY4A 3IVKA 1XX9C 3QZLA 4N6RB 1EJOL 5IZ7A 4KQ4L 1KIPA 1T1ZB 2YD4A 3S88L 3WFCH 1OAYL 3DPBA 3SGEH 4M8VA 1HEZA 1JZ6A 3CPLB 1RFDH 1XBRA 3EJRA 3KHQA 4LIQE 4PLJC 1XQ4A 3D39A 4UZUA 5E9NA 5CD5D 3B83A 2HT3D 4FJZA 5IVZA 3CHSA 4MD0A 3U0PB 4ERSL 4U6YA 3QZMA 3K72B 4MKMA 3KW7A 2Y6SD 4ZMLA 3AT9A 1G9HA 2OYKA 5E4EB 2WGNB 3OG6B 1KZYA 3CFNA 4GG8A 4LCYB 4N0CC 4PRPE 4U1NA 1O7DC 1V5JA 5DYOA 2GAZB 1K85A 4Y4KD 2JJUA 1O6TA 2G2NA 3LDBC 1DE4B 3MRRB 4JM2A 4FNUA 2R0LH 2VCOA 3KPRB 1FVDA 1QA9A 1C12B 1S7RB 1T0OA 1WFUA 3C2SA 4U2ZA 1FFPA 1QSEB 2Q6WB 4LCUB 1NL0L 4Y5VB 3FB5A 5KZCD 4YE4L 5FYLE 5CLWA 1VKXA 3RDJA 2XPYA 4Y0GA 2E75C 3PJSA 3EFFA 1EFXD 5TQ2L 1DLFL 3N44F 3HS0C 2AFNA 1X44A 5B38G 1WFTA 1EDQA 4NQVA 1DQVA 1U6AH 1KYUA 4PG2C 4NRXA 4EI5D 4BFBD 2XN1A 1NOFA 2A83B 5D7IE 4YBLC 3VI3E 3WUWB 2CBMA 3QDJB 1IAMA 3PAVA 3P73A 4OGYL 4UTBL 3Q8EA 5F3FA 2ARWA 4JQXC 3C6LC 4Y16C 1DBKL 43CAA 3BESR 3DMMA 2MOQA 3CQPA 3N43F 4G2AA 3QR0A 3JV6B 1W0YT 2DJUA 4P9HL 5EU6D 5HDRA 4PWEA 1T66D 1SY6A 3BGMA 2JB6B 4QHKJ 5GGSB 6CGTA 4WW1B 4KPHH 2CK0H 3BN3B 4KVPA 3TT3L 2OZ4L 2VMDA 3GXMA 4GEIA 1FZKA 1YEHH 5BW7A 3J7HA 4HC1A 2W9DL 3CZFB 4LOVA 4QGTA 3EGDB 4D0DB 2VXSL 4G6FD 3A3YB 2H4EA 5LBSA 3U0WL 1U95B 4WWKD 5AAPA 1HHKB 1U8MA 3NT0A 4ZUWB 4FFWD 1L7TH 5IT2H 3N55A 4D94A 2AQPA 3MA7A 3LZFL 5JHAA 3L3KB 2CHDA 4KTDH 4NNPL 5IGXL 1LD9A 4G9DA 1CF8H 1A4BA 2XV6B 5IHHA 2LAAA 4M6NH 1CN4A 3IPBA 3WKMH 4PIRF 5D7HA 1VCAA 2H2PC 3LIZL 5F1IA 4OD1H 5DURD 3JWOL 3UBXA 1R3HB 4J3UA 1J1XH 3VRLE 3CTTA 3NZHL 3QAZB 2VJ0A 1S7WA 5AKVA 2JNZA 3KWWA 5TFSH 1PYWA 1TPXC 6TAAA 1IARB 1KJVA 4JPWH 4AGQA 4KKCC 5TE4L 4DP7X 5JW4R 1HHKA 3ZKQD 1PX8A 5DK0B 3ZE2E 1ET8A 1CFTA 4IIQB 4XH2A 3IFLL 1MW1A 2ITCB 4I48A 4HX1A 4QY8B 2FZ3B 4J8RA 2HZHA 3MC0A 1UGKA 3VXUB 3VU1A 3B7SA 3WY1A 3E9TA 3FQYA 3MUY1 5B39A 1WTLA 1H15B 4H1LG 4N20A 4CMHC 5KVFH 3JVGC 2ZCLH 1JYNA 1KGUA 1UM6H 3P77A 1ZDSA 5EWIL 1MIMH 2O5XL 4AVKA 5KSUB 5ES4B 3QWRA 2MCAA 3N40P 1HQ4B 2TSBA 3Q8AA 4DQOL 3DUHA 2WSPA 4IMLB 1ZLUK 4GG6B 5EZOH 1PZDA 5DMGC 3MXWL 5E6RB 1BM3H 3QNXA 3RX9A 2IANE 3QEHB 4TVPE 1PZ2A 1IV8A 1CD1B 5CJ5A 5DJ2B 4YHKH 2FGWL 3BT2H 2A9ML 1HJBC 4TQPA 4TNVK 3ZE2F 1A7PL 3AREB 4RESB 1DVFA 3AUWB 4FQ2L 4MFHA 2XWZA 1PS3A 2BX5A 4GAJH 4I77H 4TOYH 5HYJE 3IDGB 1KACB 4F5CA 4XO9A 3VD3A 5DWUH 4M62L 1A6UL 1IFRA 3QDME 1MJJA 4E9YA 2ZXEB 2J1XA 2N4IA 1A22B 3F7KA 3L4VA 3RKDD 1EEQA 1F5WA 1K6QL 2WXIA 4OJDH 4CGTA 2DM2A 3BX7C 1KGWA 1MJ7L 4HALA 5J5EA 3QPXL 3S3PA 2MNJB 4QAWA 1PKQE 3T4AA 5D9SA 1MHPL 1FSKB 1O0VA 2WANA 3MI6A 3VXTA 1EAJA 2Z7YA 2WXGA 3HIZA 4UUJA 1UXSB 2WNGA 1E27B 3MLRH 1ZLVK 4WO0A 5AVVB 2VXVL 2DQHL 4JRWA 2AQRA 4XBEH 3TBTB 8PAZA 2WWMD 1GC1H 1H3TA 2CR0A 1D5RA 1G7IB 3OKEA 4ELMA 1AYRA 3A0OA 3KPSE 2P5ED 3T8XB 4D8PA 1GCYA 3PDDA 1SOXA 3CJJA 2B08A 1Z9PA 3FH8A 1XSOA 4GFTB 1YNTB 2ORBH 5IBUG 3ULVL 4A6YL 4JFTA 3P0VH 1H0DB 3LX9A 4Z3HA 3TBYB 4G8GA 5FB8A 3VMNA 1G1KA 3ARFD 2O6PA 4DGVL 3GTTA 3WOVA 3GIVB 2WC7A 2NR6D 1Q0XH 3E8UH 2XJLA 5FA3B 4PJFB 4HT1H 5T3ZD 1UFUA 2I7SA 2VDRL 3ASNB 3UJTH 1NCDH 1O75A 1PGRB 5D1QE 4OV5B 1A0QL 3D39E 1KENL 5AAWC 3KPSB 1BFTA 3AY2A 2GBTA 1CE6A 3PXJA 5D7IF 5A1AA 3TU6A 5ITBH 1NCAL 3EYSL 4OZFA 3T2PA 4PWFA 2K0RA 3V95A 5KANI 3TURA 3DX2A 2FLBT 4PP1C 5F1SA 2XYCA 4N2CA 1FYTD 1EMTH 1W2KT 4ZSOE 1QVOA 4DGUA 1N12A 4JO1H 4X5PA 5H2BA 1DN0B 1C5BL 1I1RA 3GXTA 3UOAB 4JO4H 2J71A 5C0BA 3CN1A 3A22A 3MRDA 1FE8L 4Z7QB 3MAWA 1N64H 4JHAH 4KQ3H 2WV3A 3UADA 2VMJA 2WHVA 5C0CE 3P4MA 2PW2A 3GK8H 4OFQA 1I75A 1UWEL 4EDWH 4WFED 2APTA 4JAMB 1UKTA 4OT1H 5BO0D 2HX8A 1SYVB 4HPHA 3MRIA 3PU7A 3DSFH 2P28B 2JCCE 5LQBH 2XV3A 3HC2A 1BVLA 1H3UA 2UY6B 1D9KD 1HHHA 1YAIA 2WMPA 1WBYB 4ZSOB 5FCUL 2R1WB 5D1ZA 1U4FA 4JJ5B 4PR5A 1PY4A 2ZXWB 3UG5A 1KXQA 3ARBA 4DKDC 1RURH 3NPSC 1WGVA 1P7KA 1LO2H 2NT0A 4H0HB 1A6ZA 4J6RH 3FHAA 4LGSB 4ZPVA 1UZGA 2WVSA 3FQUA 2WXHA 4OGXH 1KCRH 4PRPA 3NIGB 2PF6A 2QSVA 2QQQA 1P7QD 5EU3A 3L3DB 2APBA 2QMJA 3BPLC 1J8RA 3MLVH 1XH3A 5EA0L 4WI0B 2C3XA 2R0ZH 4L4VD 1KTDB 1LO5A 5C08A 3V7AG 3X14B 1JK9A 1WA2X 1XL6A 5IB4B 1LILA 5GSVB 1ACCA 1M7IB 3RZCB 3SKNA 2CHNA 4XPGH 3TYFB 2C3VA 1Q9LB 1Q0XL 3E8UL 4ZBJA 1S3KH 4FQ1H 1VEOA 1D9KB 4N9GB 1CD9B 1S7WB 2WD0A 3CFUA 4JX0A 2UXVA 3HVDA 3SYAA 1EQWA 3ZMEA 1I8IB 4LDOB 3AG4B 4JMNA 3SPJA 2ZOKB 2MHAB 4NNXB 1FVCB 1JPFA 4JQIA 4X9GA 4X6DA 4QRPE 4M7LL 4PGEA 4QOKB 3BAXA 4JK0D 2PYFB 3IJEA 4HJJH 5AWNL 4NO0A 3NOIA 3RTLA 2GT9B 4KZCA 3SKMA 2R8SL 2BSRB 2R2HB 4P49A 1OAUL 4A37A 4QF1B 5AW7B 5H94A 2Z9TA 4OLXH 1KLFA 3JBG7 4X6BA 5IFHL 3PP3K 1WFNA 1JOIA 1NCCH 4UT6L 2E5EA 5DCCA 2CR6A 4RWHA 3UXFA 5IB3B 4HBCL 1EO8L 5T3XE 1AO7A 4M5YL 4U6XA 4HHWA 3SOBL 2EUZA 4J3OH 1J0KA 2EDXA 4H88L 4BK4A 4RNRB 5F1KC 2CE6A 4OCWL 4BELD 1TTBA 1JPFB 3KPQB 1Z9SB 2YD7A 2WXQA 4I77L 2YUXA 3MFFA 2OL3H 3VRJB 2CQVA 2BY2A 5E1GA 5F7UA 3HC3L 3V4UL 3GD1C 1JNLL 5L6YL 3G5WA 1T03L 1UH4A 2KC0A 4IBSA 2OMVA 1JNHA 2RCSH 2GJ6B 3H56A 3WD5H 1XGPA 4FP8H 4X7EC 2OXHA 2YWZA 4DAGL 1NLBH 4DVBB 2RJMA 3QUHA 5AVSB 1A6AA 3NSXA 3L13A 3SQBB 1EZUA 2F1BA 1IAIH 2DQIL 5A43C 1I53A 2K4WA 4ZFZA 2YAOA 4N2IA 1SJMA 2W0KA 3BVWA 2GJZB 4WDIB 2KQNA 5F0JB 1Y0LB 3SYQA 1YPZE 3N40F 1Y18B 4GRLA 5DI8A 1EAPB 5D7JA 1HHIA 5C07E 3W9DA 3SPIA 5J1TC 4LSQH 1UXWB 1UTDA 4LMQI 4ZMNA 4JFEB 4FG0A 4XPBL 3KPRA 4CN4A 4H25A 3K5RA 4PJ9C 1CLVA 4X9FA 4AQ8A 3I6GB 1BQLL 1E27A 1F4WL 2JJVA 3P9LA 1XGPB 4ODHH 5DR5H 5BVJA 2GQHA 1ZPUA 2DIBA 4GI6A 1CD0A 2XTJC 2JFCA 4WGKA 1A6WL 1DVFC 2BO0A 1JZFA 2UWEA 5AZ2L 4KWUA 1OD7A 1PW3A 4Y1AA 3IS1X 4UIKL 3FQXA 2DL2A 2DYPD 2Y7QA 1AQDA 4PRIA 3BHBB 5IMMB 1ZGLA 3LQAC 1CZ8L 1PY9A 2X9YA 2B4CC 3IGAB 1FZOB 3MJ8A 5T1MA 4AGPA 3MLZH 5EO0B 5HHNA 3B5TA 4DGVH 5IMOB 5JUEL 3HI1B 4AQ1A 5EV7A 1M57B 1A7QH 2YRLA 1YQVH 2IG2L 4HSQA 3SQRA 3FB8B 2HP4A 1F3RB 3G9VA 1FAIH 1ZHKA 2JLPA 2ZONA 4PCSA 2EICA 3FQTB 1O7VA 2EXYD 2B5IC 3U0PA 5FUZL 1L9NA 3H7BA 4TNWF 3ALXA 2BSTA 1OVZA 3LS4H 4TRPH 4Y89A 3V4LA 2YGOA 1TQWA 2V0AA 3HBGA 4O2EA 3VAEA 4GG8B 1MFMA 2IV8A 4WI8A 1XSKA 1DN0A 1OE1A 4G9FE 4JKMA 2HG0A 1OPOA 4ZUVA 1TKWB 1MCDA 3PFQA 4WI2A 1YMHA 5DJYA 3VG9B 4B0MB 3U36B 2CKBL 3GK8L 5ALBH 5K9KB 3PCYA 4GKNB 1UM4H 4JE4B 3QIBB 3ZL4L 4E0RA 1IM3B 5ADPH 5FO8A 1MVYA 1FSKC 4X98A 1NCGA 4E9XA 2Y2TA 2XVKA 3UZEC 3MUHL 3P02A 4KMLB 1CFBA 4QRFA 1Z5LA 1YDPB 1MI5B 3L4YA 2OJEA 1BJ1J 1GH7A 4UDTA 4JKNA 2BSTB 2MQ0A 4XRCA 1AP2A 3E38A 2CDGB 1W72L 3SPCA 1Q1JH 4HIPA 1M56B 4JL2A 3OXSB 4MZIA 1UKSA 2WN3A 4LMQE 1XF1A 3RIKA 3TT1H 3IXTA 2YQGA 1J05A 4HUWA 4RMQA 1PIFA 4PJ7F 1G9MC 1A8ZA 4XNZC 2YN5A 1CLYH 3GKWL 5BZWA 3BDYH 4FULA 1R24A 3KS0H 4LPCA 2AK4B 4B96A 4MHHI 2HWZL 4PWKA 4P9ML 3NCJH 5AW1B 1NCOA 2PW1A 1TNMA 3GLAA 4ILDA 1AHWC 1Q72L 4HPOL 4OB5H 5BS0E 4YHZL 3S6CA 3MACL 4QRPD 3EBGA 4BH8B 2X9WA 4GO8A 3AZUA 1MN4A 2B20A 5B3NA 2OJEB 4UDTB 3U9WA 4XCYB 1BXVA 5LNGA 1UUSA 3IE9A 3G3LA 2YXVA 3TASA 4GG6A 4LFHD 3MODL 3MOAH 4M93C 2MCMA 4XP4L 5LDUA 4MX7A 4XMKL 2WYIA 4KRNA 4N6RA 4W4NA 2Y5TB 1G5AA 1AY1H 3DLQR 4HJJL 1IGTB 4WFHE 5DJ8A 3O6LL 3RWJA 3L9BA 5KYWB 1U58A 2C34A 2MKLC 2R2HA 1KB5H 5JIDA 3VGAB 4YSCA 1QUPA 1T7XA 1A14H 2F19L 2B1AH 4UQ3B 2BY0A 2FR4A 4TL5A 1SF5A 4XMTA 3SDXA 2ZX5A 4H40A 1CDUA 1EJOH 2C9QA 3R4RA 4PTUA 5D2LB 5GRJH 5C0CD 1G9MH 4G11A 1JXKA 2NY1B 1MJUH 1B3JA 4R9HA 3JTBA 1K8DB 1TVBB 1H6EA 2CBTA 3ZYOA 4AXWB 3F12A 3TESA 1SDDB 1YVLA 2ICEA 3NK3A 3PXHA 4FNPA 1CQYA 3HS0B 2OMWA 2FZ3A 4HZAA 4J8RB 4HMEA 3VXNB 1IT9H 3LKPB 3HZMA 3UTTB 3KLDA 1RV6X 1JBJA 3VD9A 4FXGC 4MJID 3KBPA 5CIPH 1A4JA 1A2YA 2V2WB 2WM0A 3HE7D 1UT1A 4B9KC 1ITBB 2P24B 3P9MA 1JDDA 1QEWA 5BV7B 4PTUB 3SDDA 1X9QA 2AW2A 3CFJB 3HZYA 3LDBB 4LQFH 2FUTA 3O0RH 3VH8A 1RJLB 2I27N 2AI0L 3T77B 4YVUA 2RTTA 4L3EE 4UV7H 3KGSA 2BOBB 4DWHA 5FO9B 1QSFB 1V3MA 2E7LC 1UXWA 4I8DA 1D2OA 3LN4B 4FZEL 4OKVB 1PY0A 4HD9A 4LU5H 4NBZB 2OZNA 2DBLH 4HWNA 5MEPA 1SMAA 4XCFL 3HC4H 5MEOB 4TNWK 3ZKMC 4BZYA 2PXYC 5ETUA 1N9PA 3ME0B 1IFGA 2K7PA 4X4KA 3CE1A 1Q4NX 2WWNA 3KPSA 2A1WH 4WY7L 4YLBA 1B9ZA 3ETTA 1BV8A 1LTXA 3U25A 5D7LB 3SBRA 3VMOA 1ANUA 3NCMA 3O8XC 2Z1PA 4OCYH 2F19H 4NO3B 4K8RD 2OMUB 5LBSH 3FQXB 3W11D 5DJAA 3IETB 4EIGB 3BOVA 4Y2DD 5C07D 5H2BB 3MA7B 5DURB 2Y4SA 4WHYH 3JWNG 4JFQA 3T4AB 4N28A 1HWWA 2E9BA 5EORH 3TOPA 3ABGA 3FF8A 3QZWA 2AS5M 4OZIA 4YXLL 3HOGA 4M00A 2ZCHL 1YN7A 5DD3L 2DKMA 2EKSB 1H3VA 3B1UA 4TTDD 5CILH 2NNAA 2UX6A 2OSWA 5CO1A 1N4XL 2V17L 4X6CE 3MLYL 4Y7MA 5TF1H 3QEGH 3GMLA 4YVNA 5DFTA 1A4AA 5HYSG 2BSDA 5HYQB 1A4KB 4K3GA 4ZD3L 5BQDA 1NLBL 1PZ3A 5E8NA 4F5CE 4N2MA 1IC4H 5CCGE 2DI8A 5LGHH 5CINL 4WHCA 1N0XL 1JDAA 1AGCB 5D4JA 2HAZA 3UP1A 1BSIA 1N59B 3ZE0F 4XH2B 2Y1AA 4UIKH 2W5PA 3ARRA 3EDEA 32C2A 3VFNB 3M17A 5KSVA 4Q7DA 2VXSH 1HVXA 5JW4M 1AGEB 3AVEA 5BRZE 1Z9LA 2OCJA 3FT1A 3BYTA 3GKZA 3W0WB 4RVBA 3DX6A 4IJTA 1SMDA 5D70H 3NJKA 1M6OB 4ZOAA 1HFUA 3WGUB 1MCCA 1G7JB 5I1HL 5FDYA 1I8IA 5BPPA 3Q6FA 4JRYD 2ZUUA 4G5AA 4R0LA 2FTAA 1XSJA 1GOGA 4IBZA 4HJTA 4BK5C 1OEZW 5J11B 2F5AL 2LR4A 3D87B 3O81A 2XLLA 1WAAA 4GW4A 4JO4L 1N3NA 3ZPDA 5JTWA 5IHBA 4OFPA 5IK3A 3GMQB 5DC0A 5KUKA 1YHPA 1C16A 5F21B 3IFPA 1NFIB 3FT0A 2E6QA 3JV0A 5GS1A 2BSRA 1T7YA 4YC2C 4M7ZC 4HKXB 5E23A 1L6XA 2AV1A 2VDMH 4ZTEA 1HNFA 3LH2L 2FWUA 3FTZA 4AVIA 3V6FA 2JB5L 3O2DA 3PAYA 4N2AA 2ALWA 4JR9H 4YHPB 4EN3B 3O4OC 1U30A 2EEAA 2Z4QB 4ENED 2PTTA 3VFPB 5IW6B 2WNKA 3SGKC 4PJGF 1ETA1 2P5EB 2K78A 3CHRA 1NJ9A 1USQA 1NKGA 3FT9A 5E24E 1CFTB 1H3WM 3ZTCC 3MRNA 4OI7A 3TIDA 1KNOB 5EU4A 3QO1B 2NQDA 4IIZA 4HS8H 1JYXA 1S9VA 5DMJB 1BZQK 1C16B 4LKXB 1WFJA 2Y0SA 5GRUL 1LO5B 1QHOA 3HG1E 2IDSA 2F7RA 3QDJE 3BKJH 4U1SA 3FTXA 4ALAC 3SDYL 2FE0A 1K4CB 3HR5B 5CP3A 2HRGA 2NTSP 1VESA 2V7NB 5KSBB 3FTGA 3JWOC 2UZXB 1RH8A 1Z3GL 2GJRA 5C0AA 4LRIC 4B9GA 2BP5M 1DN2A 3H0TA 2J88L 2W95A 1NEPA 3A23A 4P99A 2FECL 3TBYA 4HKZB 3FTYA 1P1ZA 2AJYL 4I89A 1MY7A 1SXBA 3X13B 3WE1A 2NT1A 4R7DB 5EDXA 5HHMD 2ZWZA 3EHBC 3R06A 5TK2A 1QTYT 3E0GA 3C2AL 3RL1A 4CN1A <