1AAJA

Crystal structure analysis of amicyanin and apoamicyanin from paracoccus denitrificans at 2.0 angstroms and 1.8 angstroms resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
b'DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMICYANIN
publication title Crystal structure analysis of amicyanin and apoamicyanin from Paracoccus denitrificans at 2.0 A and 1.8 A resolution.
pubmed rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 26
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1992-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1aajA00
3CVCA 2BZCA 4GY4A 2H47C 3NJKA 1OCOB 4ENZA 1ILUA 4YSEA 4HALA 2IDTA 2J5WA 5TK4A 2FT8A 2XXGA 4TXVB 2Q9OA 3HEIB 4FAAB 4A67A 4YSCA 4N8UA 1NTDA 2DY2A 2UXTA 2XV2A 2HXAA 1ZDSA 1AZRA 3IBOA 2YAEA 3KW8A 2BO0A 4ZK8A 1SHXA 3FU8A 2FQFA 2QDWA 1W6LA 3QJUB 4DP5X 2FQDA 2XX1A 2GC7C 4YSTA 2BW5A 4A2GA 4E9VA 2W88A 1NPNA 4AX3A 1PNDA 2YAFA 4DP1X 1AANA 2YAMA 1NIFA 1ILSA 4DP8X 2FQGA 4A2EA 2P80A 2FNWA 2BWIA 4P5SA 1WS7A 2AZAA 2XLLA 1BQKA 4RH4A 3SBPA 1AZBA 3ABGA 1ASQA 4YSAA 2UX7A 3T6WA 1NDTA 2HRHA 3H4FA 4UANA 3QJVB 4GP5B 1BQRA 2Q5BA 2GIMA 4G7SB 3L45A 1V55B 1XB3A 3JT2A 1SHWA 2FWLB 3X1NA 2YAOA 2XYBA 4KO9A 4BDVB 5I6LA 2DWSA 1XMEB 1X9RA 2IWFA 4P5RA 3N55A 2BP0A 2FJSA 2PPFA 1NZRA 1AZNA 2PP7A 4GYBA 1BQ5A 3ZDWA 1AS7A 3ABKB 3RYMA 1GY1A 1JZIA 3PAVA 4W9ZA 1PLAA 2CAKA 1A3ZA 2GC4C 1KGYE 2UXGA 2XV0A 1PMYA 1NIBA 3NJIA 3FU9A 2H3XC 3CG8A 2PPDA 2CUAA 3FYEB 3FYIB 1IBYA 4N4YB 4CSPA 3CDZA 4G70B 1BXUA 4BDVA 1AR1B 5AKRA 1MZYA 3FPXA 3NSCA 2N0MA 2XUWA 1QLEB 2P80D 1PZBA 1I53A 4BXSV 4BK5C 1NIEA 5B1AB 3AY2A 3H4HA 5B7EA 3H56A 4GXFA 1WA1X 2CJ3A 3S8GB 1MDAA 4L0PB 2WO3B 1AZCA 2BW4A 1BXAA 1FWXA 6PCYA 3IEAA 2ZXWB 3GYRA 1SDDB 3UAAA 3OMNB 5EHFA 3OQRA 2OV0A 3X1FA 3NP3A 4DPCX 1J9RA 5I28A 3MX0B 2PPAA 4E9TA 4DP0X 1WS8A 1JOIA 2AZUA 2JKWA 1GS6X 5LDUA 1PZAA 2VM3A 2ZONA 5D4IA 5FC9A 2FTAA 3WKQA 1SDDA 2IAAC 2XV3A 1RKRA 3WIAA 3ZBMA 1JZEA 4X4KA 4A2FA 4F2EA 1UATA 1E30A 1RZQA 3OD3A 5I26A 4DPBX 4MFHA 3ASNB 3FT0A 3NJHA 2IDUA 3T6VA 4YSPA 1AS8A 1HAWA 4YSQA 2GB2A 2TSAA 3ERXA 1OE1A 3X2QB 4A2DA 1T5KA 2XWZA 3TBBA 1EZLA 1AS6A 3PPSA 1EHKB 2ZOOA 2PPCA 2YQBA 2VW6A 4KNSA 3EH3B 1XB6A 2QPDB 3FSZA 4YVNA 5B7FA 2VW4A 3PCYA 4E9SA 5I5MA 7PAZA 2YARA 1PY0A 1WA2X 3FPYA 3FQYA 3ZX1A 2EINB 1ASPA 1CYWA 1OE3A 4G71B 2YXWA 4KO7A 4E9RA 2EILB 1ET7A 8PAZA 2WO2B 2HX8A 3FU7B 4W1TA 3ASOB 3WNIA 4KO6A 1BYOA 3UGEA 1A8ZA 3SBRA 2AANA 3FSWA 3C75A 1QNIA 5AFAA 4E9WA 4HCFA 1URIA 4KOBA 2IDQA 3ZIYA 1IKOP 3WKPA 4G72B 4A66A 3QJTB 1OCZB 1TKWA 2PCYA 2W8CA 1N70A 4YSRA 3U25A 2DYSB 3CVDA 2HZHA 4YSDA 3EF4A 4Q8BA 2AVFA 3IE9A 1AQ8A 2LLNA 5F7AA 1IUZA 3FSVA 4NAJA 1WA0X 3QQXA 2JFCA 3AZUA 4AZUA 1CURA 1B3IA 2HX7A 2AFNA 3BQVA 4F2FA 2B08A 4HCIA 4NB7A 3UABA 4E9QA 5B7MA 3BVDB 1OF0A 4M3HA 3NP4A 4EF3A 1JXDA 1KCBA 1NINA 1BXVA 1TU2A 3CZUB 4FA7B 2OCCB 4DP2X 1PNCA 1CC3A 1M57B 9PCYA 1PAZA 1N68A 1AAJA 1VLXA 1SF3A 2IWKA 2XXFA 2XU9A 3SQRA 3NJLA 4KOCA 1NWPA 2I7SA 1KDJA 3IN0A 2IH8A 2YAHA 4YVUA 5PAZA 4YSOA 4G7RB 2EIJB 3NJMA 2PP9A 3AW5A 2VMJA 1ZV2A 2YAQA 3G5WA 3MBWB 2IDFA 3UAEA 3NYKA 1NIDA 2GBAA 2JXMA 3NSFA 4AKQA 4M4RB 1OE2A 1OV8A 2PCFA 4Q89A 4UAHA 2IDSA 2MRYA 5D4HA 3PXLA 4GP4B 1GYCA 2ZWNA 3PLYA 2J56A 4HIPA 4AI7A 1NPJA 3NSDA 3T9WA 2VN3A 3JTBA 5B1BB 4GP8B 1J5CA 1PZCA 2XX0A 3IN2A 3TASA 1GSKA 1ADWA 2X88A 4G7QB 2GHZA 2VM4A 3V9CA 1WAEA 4JHVA 4YSSA 7PCYA 4E9YA 3S3CB 1ZPUA 5ANHA 1OOWA 1E67A 3EHBB 1ET8A 1E5ZA 1PLCA 1BAWA 1RZPA 1ZIBA 2PPEA 3X1GA 1JERA 3QPKA 2B3IA 1DYZA 4DP7X 1SF5A 4F7KA 4HHGA 1L9SA 3ABMB 2EIMB 3PAZA 1MZZA 4HHWA 1JZJA 3EH5B 3NJFA 3QJRB 5I6PA 1NICA 1DZ0A 1V54B 4NERA 1NIAA 3PAUA 1JXFA 1AZUA 1KV7A 4WTQA 6PAZA 1GY2A 1J5DA 3AG2B 1ET5A 4AKPA 1W8EA 5IY5B 4DP4X 1SJMA 3NSYA 5I6OA 3CVBA 3GXUB 3S3BB 1BEXA 2PLTA 2QDVA 3N2JA 2R7EB 3DTUB 2VW7A 1ASOA 3UADA 1TEFA 2YAPA 3TBCA 4CSZA 5I6KA 1AOZA 1AIZA 5I6MA 2Y1AA 2CALA 1A4CA 5I5JA 2DV6A 1J9QA 1KYAA 1ETJA 4K9JA 3FSAA 1L9QA 5D4JA 3T6ZA 2I85A 3FQ1A 3EH4B 5B3SB 4E9XA 1A4AA 2YXVA 1KBVA 1W6WA 3HB3B 2DWTA 3FU7A 2GI0A 1MG3C 2R7EA 1YLBB 3V9EA 4QLWA 2DYRB 4KNTA 2J55A 5B1KA 2GSMB 3D12B 1GW0A 2BP0B 2A3TA 3FS9A 4KNUA 1A65A 4KO5A 3TA4D 4PCYA 3DKHA 1L9OA 2HRGA 1E5YA 2TSBA 3WI9A 1FFTB 3DIVA 3GDCA 1KBWA 2PP8A 3QJQB 5PCYA 2BHFA 1OCCB 1PF3A 3AG4B 1TEGA 4YL4A 3CDZB 3X1BA 2X87A 2Y69B 5I5IA 2XVBA 2IWEA 1HAUA 1GS8A 1KDIA 1JXGA 1L9RA 5B1JA 3NJNA 1SNRA 3KW7A 3OMIB 1L9PA 1HFUA 2OJ1A 1E65A 3S8FB 4JHUA 3NT0A 4QKTA 1QHQA 2H5UA 4PAZA 1R1CA 3WNJA 1X9UA 4DPAX 1M56B 3OMAB 1IBZA 4A68A 1CUOA 1ID2A 1J9SA 1L9TA 1ZIAA 1JZFA 2HX9A 5A7EA 3WG7B 1JZHA 4DP6X 4YSUA 1PCSA 2CBPA 3ABLB 4HCGA 3AG3B 2FT7A 3AG1B 1BYPA 2MTAA 1XB8A 2UXVA 5B1JC 4UF7C 1SFDA 1JZGA 4HAKA 2UXFA 2QT6A 2BP8B 1KCWA 2FQEA 2EIKB 5TK2A 1AG0A 4BWTA 1IC0A 2J57A 5F7BA 1AG6A 3TU6A 2HLEB 4BWWA 1SFHA 2I7OA 1F56A 1A4BA 4A2HA 1NWOA 1CYXA 1MG2C 2WSDA 3X1EA 4BWUA 5E9NA 2VSKB 2CCWA 3NJJA 2BZ7A 1GR7A 2BP8A 2BWDA 2UX6A 3T6XA 3NJGA 1OCRB 3UACA 5AZUA 1GS7A 4HZ1A 3S3DB 1JVOA 1JVLA 1FA4A 3T71A 2NRDA 3FQ2A 2RACA 3QJSB 4JKNA 2IH9A 1AACA 1M9WA 2FT6A 2QPEB 2VSMB 4BXVA 5I6NA 1J9TA 1PLBA 2E86A 4DP9X 1ZDQA 1V10A 1RCYA 3OM3B 4WKXA 3SBQA 4AKOA
chains in the Genus database with same CATH superfamily
4F8PA 4L0YA 1E9OA 1KYUA 3E38A 5LNEA 3OF6D 2ZCKL 3MRBA 3U9PH 5BZXA 4EIBA 1A1OA 1AHWC 4FFYL 1GC1H 5CUSH 4W6WB 2OTWA 1TJGL 1LP9A 3RIFF 5HPOA 1T1WA 4KXAA 3U4AA 1J8HE 2RAMA 4YXLL 3BSZH 2EYSA 2WXJA 3KXFE 5KTEH 5HJGA 1SHXA 2MCMA 4TPRH 2XTSA 3QJUB 2CQVA 1YJDH 3DJRA 3ZT5A 4ZAKD 4ZOCA 1HQ4B 3D39E 1NBVH 2A77H 5IHUL 2Y7OA 5IHWA 1A3LL 1M6OA 4G80A 1AGFB 4JG0L 3L3OC 3UBXA 3A22A 4NQCA 4QOKA 4TS6A 1UTDA 4X4ZA 4NKMB 4KHTH 3LN5A 4RH4A 4OCWL 3A47A 3U46A 1HKLH 3QIUD 4HUUB 4HWBA 4PRHE 3WENA 1YAZA 1KEML 1U30A 4O4YL 4JRXB 5EZIH 1HKFA 1EX0A 2GIMA 3NFNA 5AALA 2ZNXA 2CRYA 4A2MA 4IRSA 4LVNB 3IU4H 1HQ4A 3IWUA 4PP2A 3VI4B 2B9AA 3JWDH 1O7SA 3W9DB 4LSRL 4E5XA 4LQFH 3X1NA 4KO9A 3UTSB 2ZCHL 3D9AL 1U8NB 2IG2L 3T0AA 4BGDA 1T1YB 1CDBA 4NKMA 3WL9B 1HHHA 1BQ5A 3SKMA 5HHQA 1FL5B 1YN7A 1SLVA 4I9WE 2W07A 3L3DB 1VPOL 5KUKA 3Q9QA 4M7ZC 5DLML 1NFIB 4Z7VA 2AJZB 4PHXA 5I24A 3B43A 3PJSB 3B3BA 1KCVL 2X9ZA 3GEFA 43CAB 1KY6A 1CE6B 4S1DD 5E6RB 5C0BE 4JPWH 4QO1A 5HYJD 4N87A 2OZNA 4OLEA 5IP4A 5IT2H 5EOCJ 5FHBH 4RFOH 1JSYA 5AKRA 5E1GA 5E8OB 3UTSA 3R1GL 5D2NE 1HOCB 4LB8A 1PZBA 1T1YA 1G6RA 4LHUD 3FF8A 4FQIH 1M2VB 3A4AA 5KVGL 1NC2B 1AGCB 1V27A 3DX1A 1M9SA 2FVNA 3ALXA 3GZKA 3ORJA 1NFIA 4URTB 1C16B 3GJEB 1P4LA 2HTKC 2NW3B 1CE6A 1HVXA 4WW2A 5DJ0B 4M5SA 3C6LB 2ADIB 2XA3A 4IYKA 2BNRE 5FA4B 3DURA 4NENA 2P48B 3BPOC 3HZKA 1DJIA 3ESNA 5FFGA 4ZG1A 5I1LA 3VFUA 1T7ZA 4M4PA 5EF2A 2XQYK 2BS71 5D1QE 4RWYL 2Z7YA 2UV3A 4YBQC 3WV0A 3IU3B 5DUBB 3VFVB 4HJJL 3F7YB 3M1OA 1WD9A 4P05A 4ODXA 1EAQA 1AGCA 2H6PB 1BZ8A 4JJ5A 3RTQA 3FNKA 1OTTC 5FF6A 3MNMA 4ELMA 4L3AA 1NCJA 2F8IA 1E0OB 2IAAC 2RHEA 5F9JB 1QSEB 5JPMB 2B4CH 4NZRL 4H8QA 4A2FA 1IMHC 5ITBL 3KLAB 5TDPA 4FKHA 1RIVH 4IHOA 3UP6A 3IU3A 4MDJA 5DUBA 3VFVA 4YX2L 1Y6MR 4GRWB 5B39G 4AQ1B 2OZ4H 2DS4A 5IMMB 3IFOA 4GG6E 2IAMC 3HS9A 4YSQA 3X2QB 2O6CA 1SJEB 1T5WA 4XMPL 2ZXDA 1ZK9A 3MLZL 1YEJL 4Q9CA 4Z7OF 4FEIA 5F9JA 2YQBA 2VW6A 4RX4A 1U3HB 3TBWA 3E3QE 5IQ7L 2Q10A 5LXGH 3QZWB 1BM3H 4HG4K 5BS0E 5FUZH 3UCQA 2BCMA 5KAQF 3AS0A 1WA2X 3SO5A 3MLXH 2NR6C 5E8NA 2R23B 4G1MB 4ONHA 3WE1A 4RSVA 3RL1A 1PBYA 3GTNA 3T09A 2GTZB 1II4E 4FE9A 3CHPA 2HX8A 4W1TA 4WY7H 1DDTA 3VXMB 1OP4A 4Q52A 3O6LL 2DH3A 2CBMA 1KIUB 4Y2NA 3PV7A 3EGDB 2ZX7A 3FFCD 4FQHA 3EO9L 4KKCC 1QFWH 2AANA 4NWTL 4JKLA 3OSVA 1WTLA 1FN4A 4NJ9L 1YC8A 2F53D 2OPCA 4L4TE 4XNDA 1LE5B 4P0DA 5I9QB 2VLKA 2IANB 1KJ2B 3GK8L 1OPGH 4N9GA 5DUPH 3SPIA 2MFNA 1R17A 3ZRSA 3DV6B 3CLWA 4Y5VA 3VXMA 3ZOAA 2DYPD 4OZFB 3HHRB 1FE8L 4NAJA 5FYLL 5JPNC 1KXQA 2J1XA 1CTNA 3INUL 4JPSA 3UABA 5C6PB 3ZYIA 1J8HA 4M56A 5LN8A 4BKTC 4DW2H 2ZX9A 3KGUA 5ELIA 3KXFA 4J1UA 1OF0A 4OLZL 3NP4A 5C7XH 1LE5A 4MJHA 3DNKA 3VFNB 2H45A 2OCCB 5IB1A 3TF4A 4M8RA 3T0DA 3V52H 1CC3A 4O51A 1KCRH 3VXUB 3BKYH 3FFOA 3TT3H 3H3PL 3LN4B 4PGBB 3VQ1C 2NY7H 3SQRA 3ILQC 3MV11 3VDBA 3P0VL 5KVDH 1AIFB 5F8QC 4BRJA 1RURH 4JHAH 4RNRB 2E56A 2HG0A 4E68A 4PRHA 1JRHL 3KE0A 4JDEA 1SDYA 2W91A 3GS4A 2EVJA 3BKMH 3OR6B 4H26A 3RZCB 5EO1A 3TT1L 5I8EB 2VH5H 3UAEA 3VXUA 5LNDA 3ISWA 1EGJL 3BH8A 2GBAA 5E2WL 4FTVD 3FUEA 5E1HB 3NSFA 4ZT1A 4KTGA 1NKRA 1RJYB 2R29L 4OD2A 2P45B 3QXDB 1OZTG 2GK0B 1AE6L 5HJ3A 1AIFA 1IKNC 3V4VH 2BY2A 1NL0H 2AK1H 2J56A 3PLYA 3SDDC 1XXFC 1T21A 4FXKA 2H9GB 4RRPM 3R8QA 4JQVA 3DX7B 2AF2A 2XG4A 2ZKXA 2HTKD 1PZCA 4NLHA 4KHXH 5I8EA 1YEKL 1CGVA 3IJHB 1WYJA 4I18B 5K9KA 1KB5B 3P9LB 2YK1L 1AHKA 1YY8B 5HYJE 3QXDA 4YBQD 4EVNB 4JPIB 5ANHA 5IQOA 1NCBH 1OOWA 5L2JA 2R56H 3PWNB 3AM8C 1ID5I 3K5SA 3ZE0B 5T3XE 3VG0H 5IOPA 4OM0L 3HG1D 4XHJD 1BREA 3QZOA 4I1RA 4JZJA 1IAMA 2PMZA 4M5YL 3DX7A 1FFNA 5HDQL 1OTTD 3H9SB 1NLBL 2F5BH 3I02A 4PBVC 5CGYC 2NX5D 2R0ZL 3UZQB 2AK4B 3WUWG 4NO5A 1XIWA 4UTBH 3S88L 2GQHA 1JZJA 3EH5B 1N6QL 4BH7B 5EO9A 3K1KC 2R69H 2EH7L 1PPIA 1YY8A 4JN2B 1AZUA 2BNQD 4EVNA 5DQDH 4JPIA 5D1QA 3DOSB 1R47A 5FW6A 4EDWL 4U1IA 4G7VH 1JXKA 1UGNA 2E9IA 4WU7A 3L1FA 2IAMD 2BPBA 4OCRH 3CN4A 3H9SA 1AHMA 2RALA 2EEBA 3BCDA 5IMOA 2AK4A 4JEGB 1U8KA 4G2AA 1AOZA 4CADA 5DZPA 2C1PB 1I85A 1PQZB 1LJMA 4ACPA 1CFVH 3NIGB 2KT6A 1KYAA 3SDXE 2YKKA 4K9JA 3VXPA 1FL6B 2NR6D 2ZWZA 1NMAL 1KELH 4GG6A 1L7IL 4WQOA 3RPBA 4EOWL 7FABL 2QGBA 2ENPA 4JM0A 2ZXCA 2A7BA 1KWKA 2DIEA 1DR9A 2GBUA 1UWGL 2WC7A 3G5XA 3KYOA 2M1KA 1Q9WA 4NRYB 2EDHA 3O3EB 5L7XH 5EA0L 2E6PA 3Q5YA 4HJSA 4QAMB 5DWUL 4KKCD 2DMGA 3P9MB 2PWGA 1G7QB 2YPKA 1FL6A 5DJCB 4IMLA 5H94A 4RRPA 4AMKL 3VUAA 2JIXA 1CDIA 4PJ7A 1UJTA 4GXVH 4QXVA 2A9ML 1X6LA 3WFEH 5I1AA 3HHSB 2X87A 5DMIH 1Q0YL 3KPRB 2IBBA 1MN4A 3CFCL 4MCZA 5LNGA 4ES9A 3OKNB 4NRYA 1A4KB 1QI3A 1E9PB 3T2PA 3FMGL 1X9UA 4AGLA 4A68A 2E9BA 3KYKH 5KYUB 5DJCA 2ICWJ 1YECL 4DETA 1BVOA 4M8QA 5JOFA 4PUBH 3F84A 4IMKA 3FFCE 2WQXA 2P46B 4L4TA 3IAQA 3KPNB 3NAAH 3WO3B 3PWPB 3BP7A 1X5FA 3D4YA 1E8YA 3FB6A 2YPVH 4JFPA 1SLUA 2F53E 1DFBH 3FT4B 3V0VB 1ZHLA 1P5UA 2K7PA 1MH5A 2NZ1A 2UXFA 3OKNA 5E9DD 3W57A 1BDYA 1A4KA 3SE3A 3RL2B 2L3BA 1P7QB 3ILQD 1UOLA 2X2JA 4FMKA 2GW5A 1PJWA 1UUNA 3W81A 3QS3A 5DJZB 4XC1L 5D7JC 5GS1C 1T80A 4RGNC 3RIFK 2OI9C 4ZMXA 5E08H 3GKZA 4JN1H 3SKNB 3H42H 4ZW5A 3SEPA 4JO1L 3HE6C 3HZYA 5ITFB 2FX8H 3L4ZA 2E59A 2VSKB 4ZXBC 4P57B 3ULAB 3ZQ9A 2RBLA 5TE6H 1ZVSB 2QGEA 2EDTA 3V0WH 3ATEA 2COQA 3ZHDA 3UACA 4L8SC 4DIXA 1UD3A 4JFQB 4F58L 3CNKA 5JYLA 1R5WA 2N7SA 2Z8WC 1CGSH 3IYLW 5ADPL 3B2VH 1NCWL 2AJVL 4WEBH 4WTZG 1Q9KB 4JLRA 1NGZB 5CJOH 4UNVA 3QNZB 1CFTA 3D6GA 5B3JF 3LMJL 3NN8B 2OMUB 4S1SL 2FT6A 4NC2B 1GTFA 4YHOL 2IVFC 3N85L 2V2XB 4RZKA 5FO8A 1WITA 4P57A 5FCUL 5FWQA 1BFVH 5F70A 4Y19D 5AAPA 2VAAB 2P8LA 5FKPA 3P2DA 3PHSA 1IC7H 5KZCD 3C09B 4JFVA 3GBMH 2D7MA 4FTVE 1ML0A 3C8HA 2WK2A 3HUJF 4G6KL 5JOEA 4YHKH 2ZXEB 4JFXB 1A9BB 2NY0B 3ELQA 3MQIA 3GMLB 3HNVL 4NPYB 5CGYD 1AGEA 2WQWA 3EADA 3QWRD 3IBOA 4MMZB 3DGDA 2QR0A 3L5JA 3QAQA 2A6JA 4TMPA 2Y06H 3SDYL 4F8TA 2VR9A 4U1GB 1T6BX 5BCAA 5IMLA 2XX1A 3OHXB 1ACZA 2WSKA 4DFHA 4U3SB 2W88A 1EDYA 2OSLA 2YZ1A 2K3TA 1HZHH 4N25A 1A9BA 3NJXA 4DGYL 3D52A 4LHUA 2OMZB 3RWIB 2XLLA 1BQKA 2VSCA 2Y3AA 4S1QL 3PNWA 1AI1H 3ABGA 4UNUA 2ZUTA 4AXWA 1GGTA 3HG1E 2UX7A 4RCAA 4LDLB 4QYOB 1B4JH 3B9DA 1KBGL 3ARYA 4OZIF 3H85A 3SYOA 3RHWF 3OHXA 3U2IA 1T20B 1CGXA 1V55B 1FH5L 4YDMA 4X6CA 3VGAB 1RP9A 3G08B 6FABL 5AW9B 2IH1B 5DD6A 2GEQA 3VGEA 2BNQE 1TOXA 1X9RA 1ZSHA 3N55A 2IBGA 2PP7A 2HLFC 4HWBH 1J0ZA 1W72L 3LHPH 5AB0A 1MAML 1LMIA 1DVYA 3ABKB 1UKSA 1BCIA 3RYMA 3VQMA 4ZNEA 1NCOA 3UTZB 1E7VA 4LSTH 2Z8VC 2C3HA 1JAEA 2DD8L 3SDXA 9CGTA 2A74C 1SN2A 3VD7A 3T3MF 3BOVA 2IBZY 2HB0A 1TTBA 1Z5LB 3JV6B 1QABA 1E5CA 4ZFQA 3FAXA 5HYSB 3V79C 3FTSA 1TTUA 4AVJA 4WU5B 4LHQB 3TA3B 3I3EA 2CUHA 3NA4A 1CBVH 3EFOA 3GJFK 2XWBA 4NUGL 1AZCA 4YHMH 5FGCE 4HEPG 2WGXA 2KZWA 2VCOA 1WBXB 2DWDB 4EQ2A 1OARH 3F2LA 5HHOD 4MQTB 3BW9B 5D9SB 4N90D 2OR9H 1Z5LA 1JF1A 2A9AA 2MQ0A 1VZHA 2YD2A 4GMTH 4GKZB 5MEOA 2OV0A 4F92B 5GGTL 3ULVF 1G6RH 1LM8V 2F74A 4WU5A 1I7TA 3TA3A 4M5ZL 3PDGA 3NCYS 1IARB 1SXZA 5D7KD 2CR3A 3SGDI 4X4XA 3CFQA 1GS6X 2DIAA 3O6FA 1PZAA 2C7FA 1UWEH 5D4IA 2APSA 1NGQL 2J6EL 3CZFB 2CK0H 3EJRA 4HPYL 2FTAA 4NRXB 4IU3A 2EIDA 2EIZB 1WBXA 4OCLC 4YNYA 3GB7A 3O11A 1JHKH 2YXFA 3SDAB 1JK9B 5D7JD 5DMGC 1SZNA 4RGND 5D1ZC 1K2DB 3S36X 4NPJA 3HG0A 4GKZA 4JHWL 4AK1A 4L9LB 2XG5A 3MREB 1SXAA 2FGWL 4DVRH 2YRZA 3HE6D 1DCEA 4LPWA 5HYQB 1U8HB 4MFHA 4ZXBD 4AWJC 4NX0A 2F53A 4MAUL 3RDTA 1MCSA 1P69B 4NRXA 2VDLB 1HI6A 1ZT4A 5E9DE 1BAGA 1JK9A 2FYYB 3SDAA 1PSKH 4KNSA 3AACA 4MQXC 1F0LA 12E8H 3L3OA 3S48A 5ICYA 2IMMA 2YEQA 2ARWA 4G6JH 4IM8A 4CILA 1EEZA 3MLUH 2KH2B 3N44B 1QP1A 2D9CA 1AXSB 3HBQA 4M00A 4ONFL 1JMXA 4YHLH 2NTSP 1XL6A 4AW7A 4M29A 4UU9A 4XVUD 3V4LA 4TNVF 3S6CA 3ULVL 5LLIC 3RB7A 4FOMA 1J1OH 1RERA 1LK3L 2E27H 4PJHE 5JUEL 1BZQK 4JY4A 4UTAA 1WFMA 1F90L 3A3YB 3RTLA 3PDDA 2AJ3A 3QIBB 1AO7D 4B9KC 4N6RB 5C3IA 5TE4L 1F4YL 1QNIA 2R0LL 1TT6A 4NYLA 2DQCL 3U4BH 2IDQA 3D3VB 2O61B 4QT5B 3NACL 4A66A 4C56B 1F3DH 3BVTA 1EFXD 4IIQC 1JL8A 3GM0A 1E7UA 1RJLA 5ALCL 3WFDH 1CVRA 1IGIH 4N2MA 1HH6A 4JFDB 4KXZI 4Y19E 5F1NA 3O2VL 1KYFA 2GBTA 5LBSA 1RZIB 4N6RA 4ENEC 3BRFA 3GS7A 2OULB 3CFDB 1XCXA 4G6FD 5DU7A 3R7RA 3ZKQD 5I1IH 1PLGH 4PJIF 1HU8A 4PW3A 2XTJC 2O61A 4D3CH 4C56A 4JPVL 4U6XB 4HULB 3L9YA 5HJBA 2FWUA 2FLBT 2YUWA 3DJ9A 5I8KL 1E9QA 1CFNB 1F3JB 2CBOA 5HSFA 3BSHA 4GUOA 1OSEA 5DC2A 4YAQB 5JQ6H 3QRLA 4GAJL 1ND0B 2HP4A 3GTVA 2XPZA 1G7HB 2PW2B 4LPVA 2C4FT 4J27A 2WOYA 4NC1C 2X7LB 1JMZA 1RZIA 5F44A 3OGCB 2HLFD 4OD1L 4BUHA 1A7BA 4R90L 3G3LA 4BZ2L 1MVYA 3LZQA 2ZP9A 1YEIL 2OCFD 3F64A 3GBNL 5BVPH 5GGQL 4L2LA 1OP9A 5TDOA 4E5XG 2AXWA 5ANME 2QMKA 4XBGB 1F3JA 3T0WA 1ZRUA 3G5WA 2EDKA 4RMTA 2AJXL 3MFFB 3LZRA 4XNMB 1NGYB 4YPGB 3GTTA 2ROXA 5ECJE 4H44C 1CR9H 2YRLA 4GP8B 2GSIB 4Y88A 5FLUA 4LGSB 3BI9X 4Y9FA 3TTSA 2X1WL 2YD6A 5CXPA 5IK3A 1I8MA 5C9KA 3ZSTA 2X44D 4PRID 1J0HA 3BLKA 5LBVA 3T2NH 4NBXB 4YDZA 4U1KB 5E1IA 5HJDA 3FTWA 3CX2A 3NPSB 1A64A 3E8VA 5E2VH 3WJJC 5DDHB 2QL1A 3W0WE 2R1XB 2P5WD 4EN3B 1IAIL 2GSIA 2NQDA 2X09A 1NFDE 2Y36H 2VKWA 4PRPA 3VFMB 4HHGA 3Q2LA 1EAOA 1YDPB 5DMGD 2WNKA 5D1ZD 3RURA 1U3JA 3DMMB 5G2NA 3LHAA 1CVSC 5HHOE 1MJ8L 2ITDB 4K0OA 5KBLA 1JXFA 1PZ3A 4N90E 3RLSA 1SLWA 1HT6A 1G9EA 2CCLA 3GXUB 3AAZB 3EOAB 4NQUA 1MOEA 2R1XA 5SWZD 2R7EB 3L3IA 5JPMC 3BH9B 2IFFL 4TVPH 5D7KE 1EJ6A 5A7BA 1AQHA 2C9XA 4PWFA 5SWSD 4GAFB 4KMTL 1R3JB 3ZVVA 1SXCA 4P23C 1JWUA 1S9KC 1MSPA 1CU4L 2NYZA 5FW7A 2RQEA 1AGDA 2VDRB 4JKKA 1MRFH 1UXSB 1HIMH 4FXGA 4GUCA 4U7SA 5B21A 2KL6A 1TLKA 3DXAB 4YHZH 3ZYOA 3QORB 4CVXB 2A73B 4GW5B 5F6HI 3EYSL 3HLKA 2R7EA 3LKNB 1U3HC 4B50A 1KIQB 4N2CA 2AQPA 1DEEB 2ZZUT 2AEPH 3MOBH 3J07A 4KTEL 4K7PY 1R3JA 4MVBC 4ZZFA 1JYXA 1FNSH 1HDMB 1UCBH 2OKMA 1Q94B 3UYPB 3DJZA 1Z0MA 3NFSL 1SM3L 1TVDA 2JK5A 2YA2A 3ZL4L 4HU8A 2QVTA 4JMNA 2R83A 2WZPD 4FLSA 2PP8A 4NEHB 5PCYA 3QORA 3BHBB 3AG4B 5J6SA 3PGCB 4XWGH 3WGUB 3LKNA 5HDLA 2PO6A 5BV7L 2WTOA 3EJTA 3HZVB 4BZ1A 1KDIA 4R7NB 1DEEA 4DGUA 1DE4B 2A6DA 1IQWL 4IQHA 2OJ1A 4XBEL 2HRLA 3BPLC 3UYPA 4ENED 5I9QC 3LZFL 1UT1A 1JZFA 1ACYL 1KGWA 2GJJA 5A7EA 1S4IA 2WVVA 1K3ZA 3QFJD 4OZGB 2X53A 2BOBA 2IMNA 4UDUB 2A6IB 1AO7E 2XTJD 3IGFA 4CJ0A 3VFWB 1Z3GL 2JCCF 5DTFB 2E7LC 3PGCA 4NNYB 5AOMA 3NTCL 2PF6A 4Y2OB 4G6AC 4R7NA 4B60A 1KN2L 2O5NA 3HLAB 3TC9A 1HNYA 4HIJB 1LO3H 5TK2A 4BWTA 4PJ9B 2F8OA 3VXSD 1N5AB 5F97E 2YD0A 4JRXD 4KY1H 3MRMA 4UDUA 3NFPB 1M7IB 3CC5B 2FWOA 1OQXA 5C2BH 2CHNA 2N7BA 2IPUG 4OLXL 4TKWA 2DQEL 4OI7A 1CN4A 1KLUB 3BP4A 4NQDE 4WO0A 2AKRB 3P4NA 2BZ7A 2HN7B 3HLAA 2BWDA 3WNKA 1JZ5A 1NM9A 1W80A 4HIJA 1OCRB 1Q9OB 2FUQA 2ZAIA 1TJHH 4LLUA 4KK8C 2FO8A 3VI3A 4X6DF 3ZRFC 3FTXA 1JVOA 4AVHA 3GKWL 5T5NG 3RZCC 3WIFB 1A22B 1M7IA 3CFBB 4AH2A 5CZVL 5D71H 1OP5K 5HHVL 2OL3L 3I9GL 4KAQH 2O6FA 4NUPA 1KPVB 1U4EA 3GNML 3MKKA 2CNYA 5IB3B 3BDBA 1LEKA 5SWQB 3K4DA 3LEVH 3RHWK 4J28A 1IM3A 1NC2D 3CGTA 1E4KA 4ZUUA 5BXFB 4P46A 1U95A 1CIDA 1M1XB 4JL2A 2H47C 3KYAA 3LZPA 4OSUH 1EDHA 5ENWB 3L3JB 4HDIA 1J8KA 4PCKA 4RZCA 1WO2A 1FFOA 5HPMB 1RFDL 2XFXB 2DY2A 4I18C 4CC4C 1CPUA 1IGMH 4MNHB 2UXTA 4Q6YA 4U3HA 5J12B 1KPVA 2FL5A 5F7EH 3V6BR 3GLZA 3H1ZA 4BSVA 3DX3A 5IB3A 1UEYA 5AW8B 5SWQA 5I8OH 4KUCF 2VRKA 3O45B 2Z3FA 2J2ZA 1RUQH 2DJSA 2EH8L 4KV5E 5EG6C 5DVOA 3M8OL 4V1DA 4UMSA 3WN5B 4XXCC 2YFOA 4PRIE 4CSSA 2AAAA 2DLFH 4UIMB 5HGHB 1YNTA 5AOLA 3VDAA 4KDTC 3SGEI 4BFJA 1QPPA 2XFXA 1AMXA 3W0WA 4WNQA 1QNZL 1MFBH 4MNHA 1QSFD 2X1OA 4U33A 3MBEC 4EI5B 1N19A 1FCCA 1ES0A 5ID0B 4CSTA 5LWYL 2IPKB 5FYKL 3QJVB 2P5WE 2OJZH 4P23D 3VVWA 1UA3A 3PGFH 3U7WL 4ZUSA 2FO1A 5T3ZH 1GXEA 4BSWB 1B0GA 3CMOL 2ZD0A 1IX2A 5DI8B 1M05A 1Y6KR 3FQNB 4TYUA 5T3XH 5F7HA 2DLIA 3WN5A 1D3CA 3SYQA 3LOWA 3DPBB 3QYNA 2VDQH 4JB9L 3WIIH 3RWJB 2BP0A 1U3HD 1ZT1A 2O1AA 4ZD3L 3OKYA 5DD0L 1BF2A 2K4WA 4YEEA 2AGJL 1C5DB 1UH2A 5ID0A 4ORGB 4QXTB 4Q2ZB 3UPRB 5L0QC 2JNZA 1P9MA 1PLAA 4PJFF 3SYCA 5F71A 1RJZA 4M8VA 5D70L 1I9JH 5SWSE 5C9JB 1N10A 5GS1A 2H3XC 3FQNA 4GW1B 3RIAF 3U7YL 1MXGA 4QD2E 2W94A 1AP2A 4PJBE 1UWXK 5LCVL 3RWJA 3TNNB 3TO4A 4PY8J 3VNYA 5B1AB 5IBTH 4I3GA 3Q6FA 1C5DA 1WA1X 4KFZC 4L29A 3CQFA 3QIWC 2VC2L 2B15A 4O9HH 4RRPG 2BW4A 2YJQA 1UACH 3ECQA 1PEZA 2GIYA 2ZXWB 2OMVB 2IAND 5DF0A 1XGRA 1NDGB 4YGAB 4Z3TA 1TQWA 3KPPB 4EJ1C 5BVJB 1KJ3L 3DSNA 3T65B 1CTMA 2HKHH 3KLLA 4XNQB 2ODHA 2C3WA 2XZCL 1ZTMA 4WI2A 4EIZC 3VXNA 4TNVK 1CT8B 4PWKA 5IFHL 1IFGA 1T0PB 4KFMA 3F7VA 3CJJA 5E8PB 3DVGB 4BBWA 1NDGA 3EXLA 4JO8A 4L1LA 1DBKH 4ZQKB 1C7SA 3KPPA 4YDKL 3JYCA 3OAYK 4F2EA 1WIPA 2EDMA 3QFJE 1A6UL 4Z76B 1GMIA 2XTJE 4P3CH 4PTTB 2GK2A 4HS6B 5AW3B 3RX8A 2QQLL 5IGXL 4PU2A 1YNLH 4FQ1L 5GGSY 4JG5A 4Q58C 5C0GB 1D6VH 5GHWL 4UOZA 4XX5A 3WKML 2H0JA 1U8LB 1M3IA 4KK8D 3SCMC 1EHKB 2ZOOA 2GY5A 5CEYA 3RZCD 5IESH 4ZQKA 3SY0A 2I07B 1X7QB 3IXAA 3NCJH 4XNAA 2BCKA 1KPUB 3VXSE 5I5MA 4P3DB 3GRGA 4BFEA 1UB6B 4M6OH 4X5QA 4JRXE 4F7MB 4NQDA 1YUKB 3FPYA 5A6MA 5CLWA 3EFDL 2EUWA 5IF0B 3K8KA 3ZX1A 3N41F 4MB5A 4O58H 4ELDA 5ALBH 2ZUVA 4G82A 1TETH 5C0GA 3BVVA 4FLHA 1PAMA 4A63A 4WKZA 1U8LA 1DQTA 2J8UB 1TZHA 4PJDB 4OJAA 3IDGA 4FD0A 1P1ZA 3TPKA 4EXPX 1GIGL 1YPZB 1X7QA 3O2WH 1KPUA 1NKGA 4I3RH 4YXHL 3BO8B 2HA1A 1UB6A 4IBZA 1P7HL 5FHAL 3II1A 3ZRCC 2XWTA 1MKFA 1DUZB 3FT2B 1Y1UA 3MRGA 4D9LH 1IEHA 3WFCH 3I6GA 5CJQL 1QKZL 5IF0A 3C09C 1RIHH 4BSJA 3QJTB 1THAA 1BQLL 1TKWA 5L2KD 5DYFA 1QA9A 3RBGA 2A74A 3US9A 3MNVA 4UTAH 2J8UA 2ITFA 3O9WC 1ZTXL 3I3DA 2NY0C 3KVDD 4R96A 3CSYA 5I73B 1RUAH 3BT2H 4ZW3A 2E75C 3NESA 1NCDL 2Y1YA 3VJ6B 3WJMA 4L3FA 1WP6A 3EBIA 2HH0L 1FRGL 5F0JB 3MBED 5B7MA 2YOCA 5T1KD 4E0RB 2AJUH 3FT2A 4U1GC 4OV5B 1BBJB 2X6VA 3E6HB 4RMWA 3F7QA 3RKDC 5T1LD 4KPHH 4NQXB 1LD9B 4Z3EA 8FABA 2MTPA 4JAMA 4MJIB 1JFQL 3WDJA 3E80A 3EDDA 5DVMA 1RI8A 1Y07A 1JP5A 1WEJL 5LBSH 2AV7A 3BYTA 2ED6A 2L0DA 2Y07H 1EAPB 1G5GA 3CVHL 4HJGA 3EYFB 4OTXL 4JY6A 2I7SA 3RRQA 2G3ZA 1HN1A 2NCMA 3CDGB 1RZJC 3QCTH 3QT2A 3AXLB 5MEND 2AP2A 2BFGA 3MJ9A 2BRRL 2EIJB 3CAFA 4GKSA 1QSFE 4HK3J 3IJ9A 4MJIA 4ODHL 5K9QG 1IGCL 5DRNA 4LBEA 2G75B 2HYMA 2E7HA 4Q9RH 1UKTA 3GWJA 3MRDA 4UOJA 1OV8A 2JTDA 1BLNB 1EAPA 2PYFA 4L9DA 3BPCB 3FQXA 3KWUA 3JZYA 2GYSA 1FP5A 3CHQA 3A6BL 3QIWD 4M02A 4WDIA 4AI7A 4ETYA 2XT1B 3SE9L 1RIUL 1S7WB 2Q87A 3FRUB 4HUCA 4OM1H 4ERSH 1OHZA 1ADWA 4G7QB 1MLCA 3KLDA 4OLYL 4MA7H 3KPRD 4MDIA 3SY6A 3MUGA 4KVCH 1G0XA 1U8JA 3S3CB 1XFPA 3O3UN 4LGRB 3RB5A 2ZE0A 1ET8A 4N0CC 2ZKHL 3QDAA 2Y1VA 1RZPA 2IQ9H 4X7SL 4YE0A 3U0TB 2CMRL 3P3RA 4PR5B 1S7WA 1UXWA 2VDNL 3B2XA 4DKAA 2D03H 4DP7X 3FRUA 2VLMD 5I0XA 3MV9B 1XSKA 3FO1A 1KLGB 5J4MA 3S5YA 5CJ8A 3PWPD 2OK0L 4ZBJA 3IGUA 4Y1AB 1X4YA 5CP7A 4TSCH 2R51A 1DZ0A 1YEHH 2CLVA 1HESA 2IANE 3SDCB 3L1GA 3GMPA 4ZFGH 4ODWB 1P7QD 3BDYL 3BAJA 4KKLC 1QBLL 5FKAB 5I6OA 5HVGB 1K72A 3S3BB 4LEXL 4PR5A 3G6DH 4IIQA 5GS0H 5KBPA 1YYLL 2VXSH 4KGJA 2VZUA 4Y2DA 3DTUB 4B9ZA 3IJYB 1ETZB 4AEEA 4TSBH 4L9LC 5MHSD 2YSTA 3SCMD 4AIXA 4H40A 1X3DA 4Y1AA 5AL8A 1RL1A 4GMSH 1AIZA 5JZ7C 1F5WA 1FZOB 5JIQA 3T6ZA 1KMGA 2WVUA 3I6SA 1RK0B 4IU2B 3VD9A 2AI0H 1QFOA 4OAWB 4UIKL 1GGCL 1UKQA 43C9B 4E42A 1U8OB 2VN5A 4IRZH 1T3FB 3NK4A 3FU7A 4AL8L 4ZZKA 1WICA 5ILTL 2KC0A 2GSMB 4FKEA 4QY8B 3VFTA 4AMXA 2V2WB 4KNUA 3ATDA 2BP5M 3F6LA 3GMMA 1T89C 3E2HC 2ZUXA 4ZDHB 1BAFH 4LBAA 2EDXA 2YMXH 4PY7A 4RQQB 2QELA 2ZSVB 4DK5A 1V7NH 3V4PL 1T66C 3A21A 4OAWA 3KPSA 2L4OA 1F2QA 3MUUA 3UJTL 4AQEA 3BN9C 1B3JA 1A7PL 1U8OA 2AQTA 5BO1L 3S34L 1E28A 4WF7A 3SQOH 1T3FA 4MTMA 2KZBA 1R24A 2XZAL 1G9NH 2HWZL 3O9WD 3QIBC 4QY8A 2NY0D 2WNXA 3PIQA 2FX9L 4ZDHA 3O2DL 1CS6A 1E65A 1FGVH 3MODH 1A6VL 2P5EB 4N26A 3ATBA 4ZYKA 4LP8A 1FPTH 4QHNA 3IDNA 2V7HA 3IKCB 1KJMB 4OJFH 5DD3H 3ZTNH 3WTXA 1E3XA 3QQDB 1G9MC 1S9WA 3P30H 4PEEA 3S3SA 4BQCA 3ILPA 3RKDD 1R3LA 4Z0BL 4I85A 4BZ1H 5J6GB 1Z9SB 2JJTA 5CINH 4QRTA 1TCMA 3GF8A 4XPAH 1F42A 2G9KA 5L2KE 4AZ8B 4Z3IA 2FHFA 4Q9QL 4PRDB 1F8TL 3F3HA 5F7BA 2JTYA 3VRLF 5AZEH 2Q86B 4K73A 1GJWA 2X1QA 2PW1B 1GPOH 1IAII 2VXQL 3EF7A 1WHPA 4GBXB 4GQQA 5SX4H 3ALPA 4H0IA 3H8NA 1CYXA 3HMXA 4JDZB 4U1HB 3SZKC 3DX4A 2ZCLL 1NC4A 1QTYT 2R2EB 4LAQL 5KVEE 3NJGA 5KSVB 4X80H 1DUYB 1RY7B 5TE7H 3NZHH 4PRDA 5D2LF 2X6MA 4OCXL 2BH0A 3MCLH 1P7KB 2YS4A 4XCNA 2PW1A 1ZLVH 4JUTA 2RR3A 3REWA 5C97A 1S7TA 1N0XL 4N8CH 2YKLH 3UPCA 5MENE 4ZS7L 3GJFB 4PMEA 15C8H 4U1HA 1JHLL 4N6QA 2P1YA 2E47A 5IJKC 4AYID 2UWEF 3DJSA 4Z7OB 4JO4H 5HHPB 1BJ8A 4L37B 5CBAA 5I1EL 4FGMA 3KNBA 4PRNB 4J6RH 2OQJB 4Y4FB 4OQ1A 1AQDB 4PWEA 2IDTA 4XVSL 3IDIB 1FVDA 2VTFA 1R9FA 2N56A 2VR7A 3WFZA 3V95A 4JZOA 5GZOA 2DMCA 1UD4A 5E51A 1LHZA 2ZX6A 5GGSB 4QTHA 1IL1A 1T2QL 4LASL 4XP1L 1GZHC 4M6NH 1QPKA 3TYGL 1KTKE 3LV3B 2ALWA 1GYAA 2J4WH 1JCVA 4L23A 4ZK8A 3FO0H 2NSQA 4FG4A 3MNZA 2X28A 4Z7AA 5DO8A 4XBPB 4JM2C 2GC7C 1V7ML 1I1YB 1Y0LB 5HGAB 3RIAK 2JB5H 4R5XA 5E94A 1KYOK 4Y4FA 3K6SA 1LE9A 1AQDA 4U0QB 4EN3C 4KKLD 2YAFA 4HC1H 4ZI8A 4EMZA 5DZLA 3TNMB 1GC1L 2PYEA 3UX9B 5CUSL 1XGPA 1X5LA 4H5SB 5CCHE 1A4JB 5E6ZA 2WSPA 3EG9B 3DMMC 3TYFB 2NDGA 2P5PA 1JI2A 3WELA 2VR6A 4DKTA 2Q7YB 4UV4L 4ZFZA 2VLME 3VA6A 4NUMA 5JZ7D 4MJ4A 4UOW1 5FYJD 5KTEL 2ZXBA 1BQRA 1K6QH 2Y2YA 1QLRA 1I8LA 4G7SB 1Y0LA 5HGAA 3WAKA 4Z7WE 3AITA 4YDVB 1YJDL 1EGJA 4G9FD 3U2SB 1BX2B 2F54D 4F37F 3MI6A 1NBVL 2A77L 2W38A 3ZKNC 2R29A 3WXWH 2E7LA 3HC2A 3OZ9H 1Z0NA 3TNMA 3CK0L 4IKNA 2XQBH 3HBGA 4NHCH 1JZ7A 2EICA 3ZDWA 3CHSA 3ARBB 4KHTL 4X7DC 3ROLB 3AU1B 2FJHA 2DAVA 5IEKA 1XBDA 4MB3A 1I82A 1HKLL 3ET9F 2CAKA 5MHSE 1KEGL 3SPJA 4YLQT 3AFLA 3E6FB 5C08A 3EDKA 2KS0A 1INDH 3RWEB 4UQAA 5B3NA 3IU4L 4RMRA 3BN9D 1MZYA 3JWDL 5CEZH 1CDUA 2QSQA 2K70A 3VWKC 2C9PA 4AEIH 4K8RH 2W95A 3RWDB 4XXWA 3RWCB 3QIBD 3H56A 3X13B 3VSQA 3Q2CA 3P3TA 4U7KA 2KLSA 1MDAA 3II3A 2J8HA 1NGPH 2R2CA 3KHQA 3UAJA 5TQ0H 3D3VD 5GS2H 3VD4A 3O81A 5JW5B 3H6JA 3OMNB 2WKOA 1NBCA 4ZSOE 5LKNA 3JVGC 1EVUA 3FC8A 3HRPA 3JQOB 5BUGA 5IT2L 2F5AL 3UTTA 4JFDD 3LQZB 3ZYJA 4RFOL 4ZW6A 2HJLB 1TUPA 1BIIB 2PPAA 3RWCA 4GXUM 1SHMA 4FQIL 2VZVA 1WIUA 3VRIA 1G7IB 3L2LA 4JVPA 1HH9A 4TSAH 1PG7W 5DSCB 1OK8A 4PJEF 1AQKH 1QYGH 4JRWA 3P3YA 4OCSH 5MERB 5IJVB 1A2YA 4NKIH 1EXUB 5GRUL 3QUXB 1LWRA 3SBWC 1S5IL 3U6RA 1UM4L 3QYCA 2HJLA 1H5BA 2IADA 3OQ3B 4U1NA 4LKCB 3GMOA 5E00B 5BUPA 4PJ9C 2GCYB 2OW7A 1TZGL 4K5LA 5CD5C 5ESAB 4WI4A 5L2KA 1T22A 2V3DA 4A38A 4F5CE 4QXUH 2WXLA 3CDYA 4M1DH 5DSCA 5F7DB 5L4JA 3N0PB 3JWOH 2EKSB 3QO0B 3OG4B 4LF3B 2ZP0T 4FX5A 1P84J 4OF8A 1JWMA 3L9EA 4N2BA 2B4CL 4PTUB 2J5LB 4XMTA 4HETA 1QR1B 3GSVA 5G4OA 4XCEA 1WSST 5JO5B 3IM1A 1L9NA 4JFTA 1H8LA 1F4AA 5E00A 4HIIA 2GCYA 4W9FC 1RIVL 1ASPA 1OE3A 2AERT 3Q44A 1WT5A 2A2QT 5ESAA 3DO7A 5EU7C 1UENA 2OZ4L 3VFPB 2Y72A 5F7DA 4B96A 1PG7H 5FV1L 2YRPA 3QO0A 1J0JA 2I24N 4A6YA 5GJTH 4MSWA 2EABA 2BMKA 3N42F 3FHQA 2X4SB 3V4UH 3IJSA 1UD8A 4OCMC 2EAEA 1TF4A 3OXSB 3KJ6H 5I66B 3ZGHA 2HAZA 1QR1A 1S46A 1BM3L 3QDJB 5JO5A 1OTUC 1RK1A 4X8JA 2XRAH 3MUJA 4YE4H 3AWGA 3N6YA 4AUUA 3MLXL 2PCYA 1F97A 2X4UB 1J11A 1CK0H 4JM2D 4LQ1A 3V8CA 4YK4B 3VFPA 5ISZD 2E0PA 1NFAA 4HW6A 4OD3H 1EH9A 1CI5A 4EN3D 2H4EA 4QI3A 5DYOA 1TVHB 1T4WA 5AB1A 3DX2A 3L9BA 4WY7L 3GSRA 4XGZB 1AQMA 2NY2B 5J12C 2WXIA 4KRPB 5KS9A 4NQVA 3UIYA 3GLAA 4PS4H 5F7YC 3DMMD 1NM4A 3OXSA 5ICXB 5C09A 3QIWA 5DHYA 1QFWL 2YWZA 2BSBA 2GABA 1N8ZB 3QNFA 4AIZB 1OP3H 4QHUB 5LUMA 4F15B 2X4UA 4J7RA 2DQJH 2V2TA 4NCC2 5TGBB 3ARGB 1Z1WA 5JYMA 1OPGL 5GZNC 5GISH 4ZX6A 2EDQA 1IC5H 3CXFA 1TVHA 4XO3A 2JXMB 3PQYA 5T33H 1A6WL 3ZKND 1TPXC 4EI5C 4NN7B 4N86A 5HGGS 5K33A 1P2CA 1EBPA 1FZJA 1BWWA 3FTVA 2O4EA 3IMSA 4J3OC 4IKLA 2EEDA 1RHFA 5IW6B 1XO8A 4JHBA 2NUTA 2A83A 3MNDA 1WVZA 5PAZA 5LXVA 3SGJA 4C4BA 2VDKL 5C7XL 5F9DC 3ARGA 4R2GB 4Z7WA 3V52L 1KCRL 3DDFA 1FDLH 4L5FL 2JXMA 3D2UB 4OCYH 3BKYL 4X99B 4YL9A 5FYJE 1RPUA 5C3TA 1CXHA 5GRVK 3TT3L 1G6VK 3JTSB 1L9MA 2MRYA 3VWKD 3ZDYF 5IM7A 3ARRA 4HKZA 4U1JB 3ETBJ 2WXFA 4G9FE 2F54E 3MJ9H 5ETUA 1MIEL 1I1AB 3FDWA 3NA9H 5B38A 3L7FB 1NBZA 1RURL 1B9ZA 4ZUTB 3FN0H 5DMYA 1N2RB 1XZ0A 3QO1B 4RSYA 5CZRA 4HKBA 2RQ8A 4KKRA 2VH5L 2Y5TA 2DBLH 4ZTPH 4X99A 4XCCH 4ODVH 1BYNA 3SGDH 4JRFA 2XZZA 3HC0B 3JTSA 2ZCKH 1OTSC 3QDGB 4NQEA 1CCZA 1MHEA 4LCWD 3BUPA 1GGBL 3LKOB 4NP4H 5DUML 5JDJA 1EHXA 1I1AA 3VXOA 4JG1L 4OH2A 4AENB 1AMYA 5C1MB 3KPMA 1JNJA 2J12B 1NL0L 3IMTA 1BMZA 4OF5A 1CFQA 1XL4A 3S96B 3UL4A 4Y4HB 3ARFC 4G43B 1A1MA 1ZHKA 4J8QA 4YXLH 4F7KA 5FEBA 3TIEB 1N2RA 1W72B 2NOYA 2UY6A 3QO1A 5FXCH 2GTWA 5IUCA 4NHUB 2X6CA 2ZAHA 4KHXL 3HUJB 3CDFA 4ZSOA 5EZLA 3EOYG 1FIEA 2WTRA 5FIEA 3STBA 4OLWH 4UQ3B 3AG2B 4OI9A 4UOW0 5IHUH 3MGOA 3H54A 3MYZA 4PJ9D 5DEFB 2GAZB 1I7UB 3CN0A 1NCBL 3EOBB 3NSYA 5A6LA 2R56L 5CD5D 5KYYA 2PLTA 4JFDE 4NKDA 4HK3N 5F9WC 2K7QA 2QDVA 3TBYA 3S96A 5C71A 4G43A 1KWGA 1M6UA 2JJWA 4NS0A 2Y1AA 3HUJA 3TBTB 2BSSB 2B20A 3BEVB 4HAFA 2P24B 4UTBL 2W9DH 3MRLA 2R69L 5INCB 4E9XA 4FN0A 3X3FL 5DQDL 2GAZA 1I7UA 3D9AH 4HBCL 3SODB 5LGHL 2XCMC 5H2BA 2DWTA 1YHPA 4G7VL 5I1DB 1PYWB 1YLBB 2Z64C 4U1SB 5AKSA 4OZIB 4OZHF 4OCRL 3SHSA 4DWHA 2LT9A 1A65A 2MHAB 2NY5H 3JWNH 2VRAA 2W1NA 1G7JB 4PCYA 4UM8A 5KANI 4G7YH 1L9OA 1HXYA 2VT0A 3GZQA 4WK2B 2RD0A 1NOAA 4Y9BA 1XF4A 2W5PA 2CKBL 1OT1A 5C6WH 1OTUD 4R9HA 4UINH 3APDA 3R1GH 3RQ3A 1E27B 1PF3A 5EU4A 1MWOA 1J7VR 3FCSB 4XB7A 2CDGB 4KXZH 1PYWA 4U1SA 4EI6B 2NYKA 4Z9KB 4OZIA 4OGYL 4MYPA 2ZYRA 1EZVX 2DQ6A 4NKOA 4AQAB 5CJXC 4HKJA 4QRRA 5CMAB 4KXCA 4JHZA 3NIDE 2J6EA 3LKSB 1OT2A 4PAZA 5DQ9A 2X0UA 2DF3A 1IBZA 1ID2A 3TFBA 5A16A 1T1XA 2CE6A 4KQ3H 2ARJB 5I1CH 4PPTA 2VZSA 3VYOA 2EQDA 3TV3L 2APFA 3FCSA 4RWYH 3DIDA 2ICWI 5I73C 5IBLC 3GRBA 4HJJH 4PJAF 5GZND 3AQDA 4QF1A 3CV5A 3MFGB 4C55A 5GGVH 4EI5D 1KCWA 5ISZE 4BKLA 1NJ9B 3P1VA 5F0PB 4J3OD 2DJ4A 2P9RA 3GSOA 3WCYA 1NCUA 1TZAA 3U36B 5I1HL 2WTPA 3K72B 4UM9A 3WFBH 2ZQKA 4A04A 2DEXX 5K9OB 1U93A 1NEZA 2WLYA 4ZOBA 3EAKA 5C0CD 4JGMA 5IREA 3ZZSA 2CUIA 3WS6C 2YPVL 3C12A 4G5AA 5JIKA 4ZFOL 1DFBL 1XR9B 3TBVA 2B5IB 1MJJB 4XMPH 3MLZH 2FX7L 1FI8C 4LFHG 1RZGA 5IMKA 3C5XA 1U2HA 3BMVA 2KLRA 1GS7A 2ZJSH 3QXVA 5CU5A 1VKXB 2WVTA 1FA4A 1KT2B 1CL7L 2VLRD 5IQ7H 2QJDA 3BVNB 3FQ2A 2H6UA 3QJSB 5E4EB 3T77A 3KBFA 4ZMLA 3HMXH 2MNJB 1KIRB 4EN2A 4J3SA 1IGJA 1M71A 4JN1L 3PHQB 4AQOA 5E08L 1Z9PA 3TOPA 3H42L 1J9TA 3UERA 3GMNB 4C4KO 2AQ2A 3OKOA 4LLYA 4WSKA 3WMSA 4WGKA 2BSED 1IBFA 2NXYB 1HHGB 4WKXA 1XR9A 1LP9F 1XF3A 4MAZA 4F9LC 3GMRA 1BFOA 4FQJL 1I4FA 1OTSD 3U4EB 3M17B 3UYRH 3V0WL 2LLGA 1EANA 3LEXA 4G9FA 1KT2A 3HHMA 4LGPB 4TXVB 3JXAA 3HEIB 1CGSL 4PFEA 3MO1B 1KLFB 3L16A 2K1MA 2BSCA 3B2VL 3BVNA 3EO9H 3US0A 1KGUA 2J6WA 3ARFD 5CJOL 3PHQA 1LQSR 3OJDB 1ZDSA 3L5WB 3KW8A 3WU1A 1DQLH 3B9KA 1Z66A 3CUPB 3GK8H 2WIMA 3DHUA 4JGNA 2QGCA 2CHDA 2Q6WB 2ZT9C 1BFVL 1S7VA 4HD9A 1FE8H 2ENYA 2VRQA 1OLLA 4PJGE 5EC2B 3TXAA 4AYMC 5FYLH 4YN3A 3D2TA 3GBML 1OIOA 3KMDA 2FQGA 1BD2D 4P5SA 3INUH 1PKQA 3L81A 5DA4A 1ZVYA 2JKRM 4LCWE 4TRPL 4YHKL 5EBMA 4HLEA 4YSAA 4Y5YC 1MVUB 3KCPA 4OLZH 2XDHA 2DI7A 3SDCC 2V9UA 3SB3A 4FG0A 2X4TB 3K2UH 4WFED 3PV6A 3QAZB 4NSKA 2BXYA 2Y06L 4HIEB 2B59B 3K3QA 5D5MB 4Z7VF 2ALAA 3B83A 5EC2A 3RGBA 2XYBA 2V9TA 3QGVA 4PJIB 3JWNG 3CSFA 5T8IA 2L7EA 4ZMOA 1NGWB 3B34A 4FP8H 4A7QA 1TVBB 1MVUA 4MD5A 2P8MA 1NCIA 4UAOC 4PJXE 2ICEB 3ZR6A 3ZW3A 3ETTA 3DJTA 1B4JL 4GUPB 1PMYA 4NO3A 3MXWH 4J2QA 1EGJH 1OF2B 2CDEB 4NDMB 5DEGB 1NOLA 4X9IA 3EDJA 5D5MA 3HI1B 2FR4B 2R29H 2EE6A 2M2DA 4ZMYA 2N0MA 4UT7H 1AE6H 4WW2F 2GUOB 3B1TA 5DS1A 1NGWA 4MNQA 5ICZB 3BZFA 5E9AA 2WMPB 5EU7E 1OW0A 5BW7C 4YMPA 2ICEA 4L0PB 1KBBA 2J21A 2DTSA 2EYRB 1MREH 2XETA 3UO8B 4GUPA 4XPTH 3B5TA 4X0NA 5D7SL 2IOMA 1TJIL 4X0KA 4MZRA 5DEGA 4LSTL 5E6IB 5JHDE 1L4IA 4BA8A 2VMFA 3HI1A 5EU6E 2FR4A 2YK1H 2K8QA 1N7ML 4XX1G 5D72L 3TN0A 3E7JA 4V2CB 4ELMF 5C8JB 4NJAL 5IBLD 1INQB 2NNCA 3H9HA 1AKJD 2D3NA 4JANB 3LZOA 2WMPA 4Q0XH 2XKNA 4M5YH 1CBVL 4CGTA 1NLBH 2ADGB 1EHLL 1SVBA 4QGYA 1F1GA 4GS7B 3CHXA 4YHML 1JK8A 4XNXH 4X50A 1ROCA 2C9SA 5E6IA 5F3BA 3HIZA 1WWAX 3ZKXB 3QHTC 1KTLB 4X4KA 2VXVH 4GMTL 1KB3A 4IDLA 2BOCA 1RZQA 1G1CA 3OKEB 1D9KC 1G6RL 3L17A 5CCJA 4X8CA 4JANA 1VERA 1PDKB 3DTXA 3T6VA 4BIKA 1ZSDA 2WB1A 4W9JC 4JM4H 3QUHA 5BV7B 4GBXC 1IFHL 1UWEL 3VD5A 3HAEB 2MCPH 2CK0L 1L0YA 1I9IH 2RTTA 2IV9A 3IDMA 1K4DA 2P26A 4E41B 3AROA 4QCIA 5I15H 2QPDB 3FSZA 1CD1A 2I69A 2HG5B 3UDWA 3BQUB 4WI7A 3BZ4A 5F7NC 1G0YR 1PDKA 2V3FA 1IGFL 3C6EA 3H2WA 4KDWA 3Q0HA 5C0CE 4UBDC 2EADA 7FABH 3RY5A 4XT1C 3L9RB 1CFSB 2TRHA 3BGFC 1A47A 3LSOA 3NG5A 3C8DA 1T0OA 4Y4KB 4WAFA 2MKWA 3VXRB 3HAEA 1JXJA 4IBVA 4QHLA 2G5RA 1UZGA 2H41A 5DWUH 2BVUA 2F2HA 1PSKL 1QHOA 2Z31A 4HGWA 1A8ZA 3RPIB 12E8L 4QRAA 1SUHA 4AMKH 5AFAA 4AK2A 6TAAA 2A6KB 2VLRE 2EXYC 3F62A 4G6JL 4LEEA 3X3GL 1NEPA 5D7IA 2I25N 2E74C 3BUQA 1OCZB 4ANXA 3P11L 2BK8A 4YHLL 3CFCH 2C4XA 1AC6A 4X6EB 5IW1A 3SGEH 1SQMA 3GIVB 5C0RL 4A6YH 1P7BA 1BOGA 1J1OL 2WWOA 3MV9D 4H8WL 5EIIB 1S7XB 3FSVA 3C60A 5H37A 5LJYH 5DGRA 3VWKA 1CURA 5FCSH 3G5ZA 4HCIA 1QZ1A 3BVDB 4PH8A 1USQA 1UWYA 1MFCL 1WWBX 4M3HA 1JUFB 4YHNA 1PNCA 4LLWB 3ZIMA 2A9CA 2DM2A 1M57B 2OL3B 4X6EA 5FPIA 1ZPLA 1RULL 4LOEA 4X7CC 1S7XA 3P4MB 4PJGA 4RAUA 2IWKA 4KZ0A 2VE6A 5J9PB 3ES6B 1KDJA 3IN0A 2E8ZA 2JCCB 4XC1H 2WCGA 4LVHC 4RA3A 2KYIA 2OJEA 4WUUB 5DC4B 1CLZL 3APFA 3LZLA 1BD2E 1E6OL 1FVCB 4G7RB 3KPOB 5D96C 1PLGL 2X2YA 1IAOB 4H8VA 5HGDB 1L5GB 3I50H 4YBLB 2VMJA 3FF7A 1SJHA 2OL3A 4BM7A 4D3CL 2WV3A 3SJVD 4PJCB 5F89A 3WHE0 2UZIL 1H15A 3CTTA 2DL9A 3ARDB 3P4MA 3RG1C 1S7SB 3ARBC 1QI5A 3II2A 4UAHA 5BZWB 3SZ6A 5JQ6L 4WWKA 1FF5A 4HJUA 5J9PA 3UEZA 4M7JH 5ADPH 5DD1H 4M8UA 1NCWH 4F7PB 3U79A 5A1AA 2OXHB 2J3SA 1ZT7A 1JGEB 3TESA 4UV7H 1FVCA 3VW3L 5AOKA 4PJXA 3KPOA 2EC8A 2WHVA 2AJYL 1L5GA 5BVPL 2AXGA 2CGRH 2VDML 3O0RL 4YHOH 3UEQA 3TASA 3UPAA 1Q1PA 1YMMB 3L1EA 3L95B 4PJCA 3VCLB 1UM5H 2YR3A 4X6DB 1YQ2A 1SVZA 4IRJD 7PCYA 3FO9B 1MFEH 1FJ1B 4QHMB 2R2HB 2BVQB 2P5ED 3KYNB 5EEVA 3RIKA 1A9VA 4NWUL 1CR9L 3O3AB 2F58L 4RLDA 4XN5A 1X4XA 2FD6H 1VADA 2EIMB 5JXEC 3H7BB 5JHDA 5DQJB 1TO4A 5EU6A 1QLEL 2I27N 3TO2A 4B9FA 3VTAA 3WY1A 1D9KD 2GEEA 4QHMA 1A6ZB 1J5DA 2R2HA 1W8EA 1JCKA 2GT9B 2ITCA 1HNGA 3T2NL 1JZDC 1FZKA 4MJ5A 5E2VL 1BEXA 4N1HB 1E4XL 1UZ6E 1X7TA 1ROWA 4IS6B 4XR8C 3UADA 4GBXD 1NOFA 4HLZH 4JKMA 1TENA 3CLEH 1J0YA 3QUXC 1JS4A 2VC2B 4A55A 1KBGH 1ZANL 3H7BA 5E5MA 4GG6F 1BF5A 1HX0A 1FGNL 2Y7MA 3W2DL 2C26A 4C8XA 5I8CA 5JOPD 5EU3B 1E40A 2XNAA 1BMWA 2X70B 4W81A 4KWUA 4HZLB 2XV6B 4TOYL 4ELKB 1XQ4A 3LNGA 4UBDD 5KSUB 1XF2A 2XWCA 5JXAH 2XWEA 3K71B 5B1KA 2VJ8A 3QG7L 1CBJA 5FM4A 5ADOH 2JCWA 4PJ7F 1QRNB 2ED7A 1ZGLP 5AVZB 3QQNA 5KSBA 3APMA 3N9GL 2VJXA 4TUOB 2DQFB 4Y8AA 1U8IA 2LW3A 2EXYD 3DIVA 4TQHA 3D50A 1ZHNA 1BZEA 3TWYA 1MRFL 1E50A 3QJQB 2EKJA 2J88L 1B0IA 2DOCA 4ELKA 4OJYA 1MHCA 1I7RA 1W15A 3CDZB 4GJTB 5KSUA 4YHZL 1DVUA 4PJFB 4I48B 3RWFA 1L9RA 4GAYB 1K8IB 3D48R 5GRJL 4QRBA 3U6XS 4ODUA 1H8SA 1FSKB 2H5UA 4TUOA 4DPAX 2DQFA 4I0PA 2ADJB 4U3XA 1OCWH 1ZIAA 4OIIH 4HK0B 3QWOB 3BPNB 3WTTA 1IAKB 4WIQA 4LPYA 5JNYA 2J1KA 2QFPA 3OKDA 2ICCA 3VRJA 4AVKA 3QISA 2NY2C 4UF7C 4PJFA 1U4FA 5BRPA 4ILDA 1XEDA 1J86A 3Q43A 4J5VA 5EO0B 2V5RA 1O9ZA 3QDMD 3T2QA 5C0DB 2J6EH 1LEIB 3RNQA 3Q1EA 4OJCA 4K7FA 5DRXB 3CLFH 1REIA 4JFSA 3HKZA 1VCBC 4X6BA 4F15C 4W4NA 2BC4A 1OAUL 3S5LB 2MMXA 1WFOA 1WCBB 4XBMA 2KZ1B 2FGWH 3UJJH 3ARFA 1EO8H 1BZ9A 1X5HA 1O6TA 1MG2C 3DVIA 2O5YH 2ZOKB 3N43B 3NJJA 4MB1A 1P4IH 5EEUA 3ARBD 2WB7A 4MB4A 5ERWA 1LEIA 3ROOA 3X11A 4B9IA 1DVFC 4MCYA 3V0JA 4P5MA 3D4ZA 1G43A 4ZJ9A 3FUNA 5F8RC 5IBUG 1IM9A 1FG2A 3S5LA 4KY1L 2NRDA 3KEHA 3WDIA 1BD2A 4R2GC 5D55A 2E7BA 3Q1SL 5BRZA 2BWQA 5C2BL 3I84A 3OLGA 2ZOKA 3KDMA 4ETQB 2RFXA 1OSPH 4ONFH 4AYFA 4DP9X 4JGJA 1HYSC 5B38G 3OM3B 4L8CA 4ZMPA 3QZPA 3ULVH 4YWGH 3IFLH 3KHOA 1LK3H 3SJVE 4AIOA 1DQVA 3DUSA 1S9XA 3ESVF 5EDSA 5JUEH 4CNIB 2D8KA 1XBRA 3AMKA 4L4VA 4YSEA 4NCDA 1TJHL 2J20A 3R7QA 3QUKB 2OBGA 5K5YA 3ML9A 2Z8RA 3N41B 4WCYH 2LAAA 5TE4H 3CVHB 4M3KB 3O8XB 1VFMA 3S36H 4S0SD 3AWFA 4KAQL 4ZO9A 5EPMB 4P3WA 3SPVB 3C87A 3NACH 3P4OA 4GQPH 4LMQI 4ALAL 5JXED 3CQQA 2HVKA 3LEVL 1OGPA 4A2GA 4NNXB 2SEBB 5ALCH 4Y4HC 1UWXH 1NCAH 3O2VH 5EOQL 3SYPA 2YO3A 4OSUL 1JPGB 1OVZA 2F1EA 3CVHA 3UZVB 2P5EE 2CLZB 1I9EA 3FTUA 4X6CF 3VXTB 3O8XA 3P73B 3D85A 3QUXD 4N8VB 5CJXA 1SXSA 1IGML 3MR9B 4LEBA 1UJ3A 5F7EL 5BQDA 5I8KH 4JKPL 5J06A 2ADYA 1W0YT 3ULSB 3WFHB 2F1AA 5I8OL 5KBKA 2XBZA 4LSVH 1DQML 5CJ5A 2KPNA 4H1LA 2NXZC 1RUQL 1MUJA 1UOWA 3F05A 2IWFA 4P5RA 1MIMH 3I85A 4MMXB 4OD1H 4DSYA 4ODSL 3SDXF 5EEXA 4Z77A 2DLFL 1AKJA 1KTRL 1P4BL 1YEIH 3FUIA 5FDWB 1I1RA 3VXQB 1YG9A 1JDAA 3UGXA 1MFBL 5EUOB 2VDNB 3GHBH 3FOLB 4C4KT 5F1KC 2XHNA 1MY5A 2ATPB 2XV0A 1JGDA 3O3DB 3PGFL 3OAYH 3MV7B 1IBYA 3TWCH 2X6UA 2ICWA 4NZUH 2WINA 3RJQB 1R3KB 5JOPE 5T3XL 1Q1JL 4BH8A 3B5HA 4GRMA 4DAGL 4D0BB 3G04A 1EAJA 3OTTA 5B7EA 2VDQL 3WS6A 3WIIL 1XDTT 2FATH 5EUOA 1CD0A 4PY8I 3QDJD 6PCYA 4PIRF 1CL7I 3HFFA 1SMOA 2HJKA 3IEAA 4YDIH 4D0DB 3UAAA 2CA4A 2X89D 4IBTA 5EHFA 4UCFA 1I9JL 3X12B 2Z7WA 4LZKA 5FM5M 3OGOE 4Z5RB 1K5NA 3BLBA 4LAJH 3LN9A 2NY2D 2TAAA 1AD0B 1WE5A 5CJBA 4Y9CA 3L7EA 2XVKA 3CFNA 5GRWA 4OF0A 5IBTL 2VL4A 1IAIH 4O9HL 1HWWA 3GBDA 5DJAB 4KKZA 1TMQA 2NZ9C 3HPLA 4HFWB 4CBPA 1FNLA 1UACL 3WTYA 2XV3A 4LLVA 3ME0B 2YN5A 2J7LA 3X12A 1C12B 4LSQH 1XD1A 3U30C 4DT2A 3FFDA 2NY1C 1NBYA 4KH9A 2OMXB 4RGMB 5IB4A 4DPBX 3T1FA 1FZMA 4AEHL 4NN6B 1SY6A 1IGTB 2G0LA 3E0GA 3V4PB 1AD0A 1I3GH 3FUMA 3H3BC 5CHNB 5FOBA 3WJLA 1I8AA 2ZOUA 5I0YA 4TTDD 2FSEB 2ZUYA 5FM5O 1CGUA 3TCXA 3ERXA 5SX5K 5JQIB 2WY3B 2P47B 1DVFD 1NEZG 1T5KA 2JQZA 4Q6IB 3DRTA 3D1MC 4ZODA 1MFVA 2VN7A 2W0PA 3QDME 2CWRA 3EH3B 1C12A 1PW3A 1CU4H 1QEWA 1IV8A 2JKXA 2ROYA 4L1BA 4R2GD 3QE5A 4MAYB 1PEWA 5F7WC 5GQBA 2C3VA 4JQIA 3VMNA 3JUZA 1C7TA 4M1GH 4W9HC 5J3HD 1IGTA 2IPUK 3JV4B 2B5IC 5CHNA 1I1FA 2LHAA 5J56B 5KG9B 2YXWA 3EYSH 1DJYA 1YNLL 3V55A 1JE6A 2EILB 4N8PA 1FYTB 3F7KA 1B90A 1D6VL 2WLZA 4PJ8A 3H2PA 3KYMB 1HSBA 3WNIA 1MWAA 5FECB 4IBWA 1UOVA 3IAPA 3O2DA 4U0RB 3O3BA 3NFSH 3CBRA 3BEWB 4UTCA 2YOAA 4MAYA 3ZL4H 1N18A 3NK3A 4UQIM 5IESL 1CF8L 4RETB 3QVAA 3KPLB 3RFZB 2NXYC 1G84A 2YLKA 5J0BA 3T6QC 4M6OL 1W9XA 3QDGD 1H6UA 3FTYA 3CX5K 1KTCA 4WI3A 5CAYB 4G72B 2CR6A 4UDTA 2W8CA 1N70A 4JFFB 4O58L 1D5ZB 1PZ2A 3CPLB 1TETL 3L2MA 2AV1A 1G7LA 3HAEH 3SJVA 3MGTB 5BZDB 5H4ZA 5IVXA 1E2VA 4KRMB 4Y4HD 2I9TA 1IQWH 1F1DA 5AVQB 1PVHA 4N2LA 2Z9TA 3QZLA 4XZUB 3UC0H 1WA0X 3X14B 3BKJL 4GSRA 5FWRA 4X9YA 1FL3A 1UASA 2AQ1A 1M7DB 1J87A 5K59E 3O2WL 1ACYH 2OTUA 4PWJA 3QG6A 2DB8A 1FO0L 4NFCA 3QEQA 1Z3GH 5AAWC 1A7NH 4I87A 3WFCL 2F7QA 1N59A 1D5ZA 2Q3ZA 2IGLA 1RIHL 2ZOTA 3CPLA 3KL5A 3NTCH 5F6IB 5BZDA 4MD0B 2NXZD 4ZMAT 3RX9A 2GHWB 4G11A 5H37H 5E95B 2UVEA 5B8CC 4UTAL 1U8PB 3FUFA 4IRJA 2XY2A 5DJXB 2AAVA 1RUAL 3NUKA 2FB4L 4R0LB 2ILLA 4UOQA 5C3LD 5HP5A 5I1KL 5E2TH 4H8UA 4YO0A 2DKUA 3I75B 4LNRB 3AADB 4F3FB 5B39B 3F85A 3QAZC 4YVUA 4AVIA 5JHAA 3O4OB 1THCA 5LGJB 1ZHBA 4MXVF 3P77B 4XVTL 3KLQA 4HHAB 4KPHL 4WWNA 1JD7A 3NOIA 3ZLQC 1NIDA 4K3JH 4WO4A 5E1AA 4M7KL 4QRPB 2AXHA 5EOCH 4AKQA 2H3NB 1U8PA 2H26B 4M93B 3NGBC 4G9DA 3B9VA 2CM5A 4AJ0A 3D0VB 3HG5A 5D4HA 4PD4J 1D9KA 1WFTA 1CICA 4OFVA 3CFMA 2Y07L 1N0LB 3GKWH 3I75A 4Y8DC 3SO3B 4FJ6A 3QCTL 4GG8B 1DDHB 2OL3H 3BXNB 3TH4T 3ZJAA 1KN4H 4HHAA 1OY3B 1CLYH 2GHZA 1R5VB 4FFWD 2LTQC 4W93A 5D2LB 4FQ2L 2PR4L 1IQDB 1WBYA 4QRPA 4C4UA 4DHLA 5DK0B 4OUUB 3CFJA 2JKTM 4LDEB 2XWJB 4B97A 3QZMA 3MLSL 1SYVB 1ZE3C 3A6CL 2PXYC 1HQRA 2X4PB 3JBG7 2N59A 2KQNA 1YEDA 4DKFH 1P5VB 2NZ9D 1UURA 4XNUL 1J05B 1R3HB 4OM1L 5GIRB 2NY1D 5I6PA 1UYWH 1D5XB 4N85A 5DK0A 4WHCA 4OUUA 4CKVX 1C5CL 1MCBA 5CS7A 3ZE1F 4KVCL 1ET5A 3VFRA 3DRQB 2OYLA 1FV1B 4A7SA 4GS7C 2VITA 2VUYA 2X4PA 3ZGIA 5LG1A 2GIXA 4H25B 4N2NA 2IQ9L 1SEBB 4R7LA 3GSXB 3CWGA 2GVYA 1QNZH 2AQ3A 2X9YA 4FA8A 3FUHA 4JE4B 1P5VA 3ZKXC 5I0ZA 1TEFA 4U6YA 2D03L 4PBWD 3QEUB 1MJ7L 2E5EA 5FYKH 2VAJA 2MEJB 4PG9B 5CEXA 5LN4A 1R3HA 3U7WH 3CFEB 1J9QA 3CMOH 4TSCL 4P5TC 3U2JA 3IMRA 3QUZB 1YEHL 1DN2A 3DRQA 4JRYB 1H0DA 5FK9A 4BFKA 2MPAH 3F7LA 3FAWA 5BV7C 1S7UA 4H25A 3S97C 4TNEA 1UM6L 3OJVC 4X4YB 4ZD3H 2NQCA 4QLWA 1RMFL 4OB5H 3SSGA 1VGKB 3G6DL 2AGJH 5DT1L 2WKLA 1G7PB 2YUVA 4ES8A 3QEGH 4TSBL 4AYGA 2DICA 3TA4D 2VO8A 3BQUC 5K9JL 3JVFC 4L3EB 1Y6NR 4AJYV 3BN3B 4Q4IA 5D70H 1XSJA 3VWJA 3CH8A 2VN6A 4LL4A 3IAGC 4BUGA 4PJHF 2Y5QA 5IWLA 3U7YH 3HAEG 5AYQA 3M1BA 4PW4A 1TCRA 1DQJA 2ZICA 3IB4A 4WK0B 2CGZA 5IHZA 1R4XA 2NY6B 4FHBD 3MRRB 2QHRH 1BAFL 1NEUA 3U0WH 4HCRA 2YMXL 1P84K 1V7NL 2CBPA 1KJ3H 3WTUA 3ZO0A 4XP9H 1KNOB 1JZ4A 5H37G 2VMEA 2FT7A 4WFFD 1SOQA 2MTAA 2CNZA 2YMOA 5C0AD 1VFUA 3SQOL 3FOMA 1PCXA 3WUWB 2ERJB 4PREB 3WEXB 5T1MB 5J89A 2D7TH 5DLLA 1WG3A 4LL9A 1G1KA 1D7BA 2J44A 3QUYA 4KROB 3UJIL 1FPTL 1A6TA 2FHCA 4NFBA 1TMCB 5DD3L 3ZTNL 1PX4A 3GUTB 2FNBA 1RPKA 1Z9NA 4CW1A 1F4WH 3U9UB 3L13A 1ZGLB 1D6EB 3VI3F 1MNUH 1F11B 3QQ3B 5E0QA 2V5TA 2Y22A 3UTQA 4PJEB 3T8XA 4BZ1L 3IDXH 5CINL 4EI0A 4IEFA 4BQ8A 3BCFA 5H35A 4JFWA 4XPAL 5EDXA 3WLWC 2EXTA 2JKNA 1YEFH 5DRZB 1E4XI 2HFEB 5EEWA 4QNPE 3KVPA 4NXKA 2K78A 4NC0B 4R8WH 4TNGA 3WXVH 1FYHB 1GPOL 3UBXG 2UY7A 1ZGLA 2IH9A 2YA0A 1MQ8A 3H2QA 4HX1B 4YJZL 2N4IA 3EFDH 2BDNH 1HEZB 3QQ3A 1PLBA 5FA3B 1E8XA 3QI9B 4I1PA 5E56A 4QR7A 4AKOA 3CCHA 4Y0GA 5ESVB 4JFEA 3HE7B 5GJSH 5I6XB 3SKOB 3OR7A 3LYRA 3DX6B 5IEHB 2SODB 3HNSH 4K3GA 4LLMB 4X80L 2PXYD 5AW5B 5TE7L 3NZHL 4EZLA 5AVWB 2HFEA 1PU0A 1GIGH 1UH3A 2APTA 2IQAB 2XXGA 3AQXA 3MA9L 5J6HA 3MCLL 5ECGA 4A67A 3ULUH 4YXHH 2WXKA 1OKEA 2WIIA 4N2OA 1XMWA 5TPWL 2PKDA 2HLAA 1NTDA 3FQRB 2DWEB 5HHMB 1NH6A 4HX1A 1GZPA 1VACB 2D3VA 3QFDB 4N8CL 2YKLL 4R7DA 3WUZA 1KPRB 1QKZH 3UIZA 4X5XA 1EV2E 2MH4A 5FA3A 15C8L 1F6AA 3QI9A 3K6IA 2GJ6B 3MRQB 1YNTF 4FEMA 4P4KB 3U1QA 1EJ8A 2VDKB 5ESVA 5F96H 3N42B 1XGQA 4JO4L 3SKOA 1A9EA 5IEHA 4B9PA 3QXTA 1ZTXH 4LLMA 4DP1X 1UA6H 2IQAA 4HIHB 3T3ME 1X7SA 1KJVB 2OMWB 2HH0H 1XGTB 2V7NB 3FQRA 1AZBA 4E36A 4XVOA 4TUJB 1HHIB 2DWEA 2ZSWA 2CO7A 1X5GA 4NM4L 3RUGA 4H13C 2F08A 2BNUB 4PJ5A 3T0EC 1TZIA 2EC9T 2HFGL 3T4AB 4YZFE 2J4WL 4P5TD 5HVHB 1H3PH 2GSGB 3FO0L 2PWEA 5EN2B 4P2OA 2X89A 5C07B 1JPST 1T0NB 5FO7A 5KSAB 4CDGC 1SHWA 2YD9A 2VIRB 1ED3B 2JB5L 4HIHA 3BFOA 4PG2C 4ADIA 2HUEA 4QJ4B 3MGAA 3CVHH 2OMWA 4GRLB 4AOFA 2NNRA 4E41D 8CGTA 2VMDA 1S9YB 2N01B 4BK5A 1AS7A 3TCLB 3TEYA 1ONQA 2OP4H 2LAGB 5D93B 1A8JH 3W5NA 1X9LA 5MEQA 3BQUD 3T4AA 2LU3A 1IVLA 4XCYA 5C0EB 3PWUA 1TO5A 1XH2A 3RVVC 4XP6H 4H1LH 3GT6A 1VEMA 4OV6F 1K6QL 5IR1B 2H1XA 4G70B 5LGYA 4R5TA 2XFGB 2J73A 3ZL1A 2CD0A 1YY9C 1EMTL 3CFKB 2BIOA 4RGOH 3WXWL 4O2CB 3TCLA 1KFAH 3IWVA 1TQVA 4NHCL 2XQBL 1CE1H 3H9YA 3SE9H 3CZNA 2W81C 1FWXA 4QRQB 3N5AA 1SDDB 3ZTJH 1JWSA 3FB8A 5DZVA 2BLFA 4JO2L 3TVMB 3AXIA 5IR1A 4K9EH 3VGBA 1FLTX 2XC8A 3WN6A 3RILA 4JFYA 1INDL 3ZL2A 4W9LC 3P0YH 2QTEA 2W59A 1IO4C 3CFKA 2ZKHH 3HOGA 3NVQA 4PP1C 3OX8B 4E9TA 1FSKC 4G42A 2P4AB 2WGNB 4X7SH 4FA6A 4AEIL 2CMRH 2JKWA 3LNDA 3PY9A 2WQAA 1S2EA 2JMRA 1AY1L 1ZY9A 3MUZ1 4EEEA 1NGPL 1EERB 1SDDA 1EEUA 4X98B 2IGTA 5TQ0L 1CQYA 2YGVA 1ACCA 4G1EB 2B39A 3NCWA 5IKCA 5IV2B 5IFJB 4YDJB 2BIPA 2GG1A 3OD3A 5GGRA 2H32A 4KKPA 3ARZA 2CKBB 1X9QA 3NCCB 4Z7QE 5C2UB 2VLJB 4WFFE 1YYLH 2H2PC 1F6LL 1FH2A 2QKIC 2TSAA 3AB0C 3MV01 4MBRA 4U05A 4WI0A 4WUUD 5C0AE 1N3NB 3V0DA 5HY9A 2WYHA 1EZLA 2WZ5A 2XPGB 3WLWD 3I6KB 4TSAL 5IQLA 5DK2B 5A2CA 4NN5B 3B2DC 4G8GA 2XYCA 4EUPA 1MI5B 1NCTA 1OGAB 1XB6A 4GSDH 1U3ZA 3RGVC 1H3TA 4OCSL 4MRCA 3JV5A 1GGIH 1MELA 1IEAB 4I3SL 1SY6H 7PAZA 4F33A 2YARA 4R7XA 1WAAA 3AREB 1VFAA 2H6OA 5I0DA 5E4AA 2VLJA 3U7AA 2Z34A 2CA3A 2XN9D 4GKLA 1JN6B 4HKXA 3S5LG 3CH1A 4AL8H 3HS0B 4PJIE 5ILTH 3LNHA 5IJCC 2YGNA 3Q13A 2XN1A 1ORQB 3I6KA 4JFOB 3J27A 3ASOB 4Y5XA 5HI3C 5DK2A 3JTTB 2DW5A 1VGEH 2F7PA 3BJLA 3MRIB 4QXUL 2NNFA 1OGAA 3CZLA 1YMMD 2ID5A 3GMQA 4JQIH 4TLTA 3FB5A 2DM3A 1IEAA 2MCG1 4X5WA 2J8UF 3FTZA 4F91B 1HSAB 2Y25A 2W60B 3DA0A 3GPEA 1A7PH 4NM8H 4BINA 1DL7H 2XZAH 2IF7A 4DKEH 2J1WA 3HS0A 2IH3B 2V3EA 4CVZA 2A1WL 3LPPA 2NYYC 4FNUA 3FHAA 4MA1C 1MWAH 4JFOA 3NIFE 2FX9H 3I9IA 2X9XA 3O2DH 4NRZB 4R4NC 5ESQA 2MQ3A 5F7AA 4ZFOB 2P44B 1IUZA 1PG7L 1Q90A 1U92B 2O6DA 2ZAGA 4G3YH 3S35X 4CN6A 3HFMH 5GJTL 1ZA3A 4XXDB 4P2CG 2D4DA 5ABZA 3BFQG 3DI3B 3V4UL 4KV5F 4LARH 1IVTA 3T0ED 1KCBA 3PWVA 4Z0BH 4F2MB 2XRAL 4YE4L 3L3HB 3FONB 9PCYA 3VE0A