1AAJA

Crystal structure analysis of amicyanin and apoamicyanin from paracoccus denitrificans at 2.0 angstroms and 1.8 angstroms resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords AMICYANIN
publication title Crystal structure analysis of amicyanin and apoamicyanin from Paracoccus denitrificans at 2.0 A and 1.8 A resolution.
pubmed rcsb
source organism Paracoccus denitrificans
total genus 26
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1992-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1aajA00
2OV0A 2PPFA 1V55B 3PCYA 2X88A 3FYIB 1CUOA 3GXUB 4PCYA 2N0MA 1NTDA 2ZWNA 4A2EA 3OMIB 2MTAA 1W6WA 1NDTA 1ZV2A 4GP4B 1SHWA 2DYRB 1KDJA 4HAKA 1XB6A 2VW4A 3NSYA 4A2HA 2TSAA 5B1JC 2JXMA 4P5RA 3WI9A 1GY2A 4KNTA 1RKRA 2VN3A 4KO9A 1HAUA 2VSKB 2CALA 2QPDB 2HZHA 1J9TA 1JZFA 2IAAC 4JKNA 5B1KA 5TK2A 1HAWA 4AI7A 1ZDQA 2GB2A 2GC7C 1J9QA 4HCIA 4G72B 3ZBMA 3SBRA 1E30A 2HLEB 1B3IA 3BQVA 1M57B 3OMNB 4YSOA 3IE9A 1PZBA 3UGEA 1CC3A 2CCWA 2HXAA 2W8CA 2PP9A 1XB8A 5E9NA 2I7SA 3EHBB 1TEGA 1BYOA 3ASNB 4X4KA 1WS7A 2YAQA 1SF5A 1IKOP 2BW4A 3MBWB 3ABKB 1CYXA 3T9WA 4BXVA 1QHQA 3N2JA 4UF7C 4BWWA 4AKPA 3T6VA 1ILSA 1TU2A 2EILB 1KBWA 1NIFA 2YAMA 1WA0X 1J9RA 3T6WA 1GSKA 2CAKA 2GC4C 2FT7A 3FYEB 2QPEB 3S3BB 5I6LA 2EIKB 4YSRA 1OE3A 1JXDA 1NICA 1JZHA 2XX0A 2QT6A 4GP5B 4TXVB 5I6PA 1L9OA 3OMAB 4DP2X 1AOZA 4BWTA 1KDIA 7PCYA 3V9CA 1ET5A 4DP0X 5D4JA 3X1EA 4QKTA 1AZBA 1OOWA 5I6MA 1ASQA 2FQGA 4DP1X 1KYAA 2PPEA 2IDUA 3EH5B 3KW8A 1NWPA 4YSEA 3EH4B 3NJGA 3NSFA 1AS8A 3TASA 1A4BA 2EIJB 3QQXA 1XMEB 1E5ZA 1RZPA 3IN0A 1N70A 5D4IA 4YSSA 2VSMB 1M56B 4AKOA 1AQ8A 2FQFA 2H5UA 2ZONA 3G5WA 5AZUA 1T5KA 1I53A 1W8EA 3SBPA 4KOBA 3QJSB 1W6LA 1ASPA 4E9TA 1J5CA 2AZUA 3UAAA 5B1JA 3NJHA 3FPYA 1L9RA 1V10A 1OCZB 1QLEB 2VMJA 3FPXA 3ZDWA 3D12B 2FQEA 1EHKB 3DKHA 4DPBX 1BXAA 4P5SA 3FQ2A 5TK4A 3FQYA 3T6ZA 5I6OA 2OCCB 4JHVA 1JVLA 3NJJA 1SDDB 4HZ1A 1IBYA 3OD3A 4YSCA 1NINA 5FC9A 2HRHA 2PLTA 3H4FA 4GP8B 2UX7A 2Q5BA 1L9SA 9PCYA 2IDFA 1A65A 3TBBA 4YL4A 4M4RB 1AAJA 1PF3A 3TA4D 3FSVA 2I7OA 2YXVA 6PCYA 2P80A 2XVBA 2IWEA 2Q9OA 4M3HA 4HCFA 3AG3B 4W1TA 2B3IA 4BK5C 2BW5A 3ASOB 1PLBA 1JVOA 2YQBA 3S3DB 3TBCA 2XWZA 2J57A 1NIAA 4E9VA 4ENZA 4YSPA 3SBQA 2IDTA 2YAOA 5LDUA 3CZUB 3WKQA 3X1NA 1GS7A 2VM4A 1M9WA 2BZCA 3JT2A 3X2QB 1X9UA 3BVDB 2BP0A 8PAZA 3NSCA 2PCYA 3NT0A 3RYMA 3FSWA 2AFNA 2TSBA 2AZAA 3T71A 7PAZA 1BQKA 1ID2A 3S8FB 3NJNA 2NRDA 3QJVB 3QJRB 3S8GB 4ZK8A 2YAEA 3NYKA 4HCGA 2DV6A 2OJ1A 5B1AB 1JZIA 5F7AA 1A3ZA 2UX6A 4E9XA 4AKQA 1UATA 2BWDA 4Q89A 3PLYA 3UACA 1BXVA 4BXSV 4NB7A 3AY2A 1BEXA 1KV7A 3PPSA 1RCYA 4A67A 1L9TA 5B3SB 4WKXA 2XU9A 2XLLA 1PLCA 1WA1X 1MG3C 2BP8B 2FNWA 4NAJA 4DP5X 1PCSA 2ZXWB 3NJMA 1PLAA 4WTQA 2VM3A 1URIA 3KW7A 1BYPA 1PZCA 5A7EA 1AZNA 3OQRA 1NWOA 1J9SA 4YVUA 3UADA 1SFHA 3CDZB 1A4AA 4A2GA 3NJLA 3QJQB 3HEIB 5I28A 2FJSA 1WA2X 4YSUA 3FU8A 1BXUA 2DWSA 3WIAA 1KCWA 1KGYE 2R7EB 3WNIA 2BZ7A 4A68A 4A66A 5F7BA 1KCBA 4E9WA 1SDDA 4KO7A 2IH8A 3AW5A 4G70B 3HB3B 3H4HA 2HX7A 3ZIYA 5I6KA 1V54B 4G7RB 3X1FA 4UANA 4G7SB 2PP7A 4A2FA 1SF3A 3C75A 3GYRA 1OCOB 2XUWA 1MDAA 3QJTB 4BDVB 2FQDA 5B7MA 1ZDSA 1PNCA 4DP7X 4E9SA 1NIEA 5AFAA 1E67A 3JTBA 2DWTA 4E9QA 4DPAX 3TU6A 1OE1A 1J5DA 2Y1AA 3FQ1A 1FFTB 4HHGA 2HX9A 2FTAA 4YSQA 1AANA 4JHUA 2UXGA 2HRGA 5B7EA 4AX3A 3IN2A 4CSPA 4DPCX 1OE2A 4F2FA 2YXWA 3S3CB 4HALA 1AG0A 2CJ3A 5IY5B 4YSDA 1DZ0A 1MZZA 3AG4B 1WS8A 2WO2B 4YSTA 1FWXA 2UXFA 5D4HA 1MZYA 4NERA 2GBAA 4KNUA 4DP8X 1IBZA 3DTUB 1BAWA 1L9PA 1SFDA 3ABMB 3AG1B 1CURA 1AZRA 2Y69B 2WO3B 1ZPUA 3UAEA 3ABGA 2P80D 2AANA 3X1BA 3FU7B 2I85A 3ERXA 1L9QA 3CVCA 3NJFA 2CUAA 3AZUA 1ZIAA 3T6XA 2AVFA 5EHFA 1NIBA 1OF0A 2BP8A 4YSAA 3IEAA 4KNSA 4BWUA 1ETJA 2FT8A 1AR1B 3ZX1A 1NPNA 4FA7B 3PXLA 2GHZA 1JERA 2IH9A 2PPAA 1BQRA 1GR7A 3NSDA 4HHWA 1ET8A 1R1CA 2IWFA 2PPDA 1AIZA 3FS9A 3NJKA 1ET7A 3CDZA 5I26A 1VLXA 4DP4X 3FU9A 1E65A 1F56A 2IDQA 2FT6A 4HIPA 2R7EA 3SQRA 1ZIBA 2E86A 2IDSA 1AS6A 1NIDA 5B7FA 2YARA 1OV8A 2XXFA 2GSMB 1OCCB 1EZLA 1PMYA 2RACA 3FSZA 3QPKA 2YAPA 4GY4A 1DYZA 1CYWA 2BHFA 4GYBA 6PAZA 5I6NA 1TKWA 3L45A 4BDVA 2YAHA 1IUZA 3N55A 4G7QB 4GXFA 1ILUA 5I5JA 1GS8A 2BO0A 1BQ5A 1MG2C 4KOCA 1GY1A 1NZRA 1X9RA 4YVNA 3DIVA 2GIMA 3UABA 1SHXA 1RZQA 1PAZA 2WSDA 5AKRA 1AZUA 1JXGA 2XX1A 5ANHA 1AG6A 2QDVA 3PAUA 3NP4A 2DYSB 2HX8A 3GDCA 3H56A 2XV0A 2CBPA 1AS7A 4QLWA 1JOIA 2FWLB 4DP6X 3WG7B 4W9ZA 2J56A 3WKPA 4RH4A 1GS6X 5PAZA 1JZGA 2BP0B 2DY2A 4EF3A 2EIMB 2J5WA 5PCYA 2ZOOA 1HFUA 2PCFA 1A8ZA 3PAVA 2YAFA 4N4YB 5B1BB 1ADWA 3FU7A 2PPCA 1GYCA 1PZAA 4F7KA 2GI0A 2PP8A 4DP9X 4AZUA 1KBVA 1JZJA 1XB3A 4K9JA 2B08A 3CVDA 3V9EA 2XV2A 2XXGA 4FAAB 4E9YA 3U25A 2IWKA 1QNIA 1SJMA 2BWIA 1FA4A 3NP3A 4MFHA 5I5IA 4KO6A 1AACA 2VW7A 3X1GA 2EINB 1WAEA 2H3XC 3OM3B 1IC0A 3IBOA 1N68A 2VW6A 1SNRA 3WNJA 2JKWA 1OCRB 1YLBB 1A4CA 3EF4A 1E5YA 1NPJA 1PNDA 1ASOA 4A2DA 1JXFA 4CSZA 2XYBA 4N8UA 2A3TA 4Q8BA 3NJIA 2W88A 2JFCA 3FT0A 4PAZA 1GW0A 3MX0B 2LLNA 1PY0A 3CG8A 3EH3B 3CVBA 4L0PB 2QDWA 3AG2B 2UXTA 3FSAA 4KO5A 2X87A 4E9RA 3PAZA 5I5MA 4F2EA 2J55A 4UAHA 1AZCA 2XV3A 2H47C 1JZEA 3QJUB 2UXVA 1TEFA 2MRYA 4G71B 3ABLB
chains in the Genus database with same CATH superfamily
4GLRI 3Q5OA 2WUCL 4WK4B 4ATWA 3VFUB 3LAFA 3I9AA 4Y9CA 2XG5A 3OGOE 3RY6C 2DI9A 3GXUB 3FB5A 1A66A 2AKRA 2WCPA 4F7CA 1HKLH 4DOHE 1QVOB 2AQRA 2O5XH 1LK2A 4KGJA 1ZV2A 4RBPK 4HG4K 4WW2B 3POHA 4JY4B 1ZA3B 1KUMA 4WSJA 1NMBL 1P4LA 4HS3B 4RRPM 2JXMA 4JR9H 3P3RA 5GS0D 2OULB 1CL7I 5CHNB 2I69A 3B56A 3FTZA 3OKYA 2CO6B 5KW9L 2DQUL 3SZ6A 4BHUA 1NBVH 3UO1L 1OGAE 1BFOA 1NBYA 3F7LA 3O2DA 4JM2F 4JRWA 5J11C 1P69B 4WI0A 3GSXB 1THCA 3R1GL 5E99H 3RVWD 4YXLH 1QABA 5IBUG 3WELA 4DGWC 1VFMA 3IE9A 2CO3A 4K55A 3HI6H 1N7MH 5ANME 5L2KE 3WEOA 4FNRA 4I0PC 2BIMA 4OLZH 3HC4H 1MEXH 4PJ8C 5DMIL 3ASNB 5AG9A 1CE1H 3OJ2C 3VW3L 4P59L 5ICUA 2YD3A 3IGFA 2BSDA 2YEZA 5LJYH 4W68A 1X5XA 2FH8A 4A7GF 2FEJA 2FX9H 2VLME 4HEME 3LKNA 3NSJA 3T6WA 5FYKE 2VABB 4NNPL 3VNZA 5C07B 5JQIB 3RFZC 4PGDB 4ORGA 5DK3A 4U1SA 5DMGC 3ZE2B 1SBBA 3ARFD 1TJIL 3AUWB 4LESA 4MBRA 1QLRA 1R5IA 1Z2KA 2XC8A 4ZTOH 3B2MA 3O41B 3QQ4B 5IMMB 1W72L 5I6PA 4TVPE 1XL4A 3THMH 1CXIA 4ZUVA 4OB5H 3U46A 2VL5B 3VFWA 5E95B 7PCYA 1YEDA 3FQUB 1U8NA 1JWUA 3X1EA 3WUWB 4Z7OB 3SDDD 5A2CA 4N8CL 4QKTA 1XAUA 3UYRL 4PGEB 3DMMC 4RNRB 4LU5H 4N0RA 4YXKL 3CH1B 4EI5D 3PRZA 4MYWB 4NZJA 5DHMC 4XP5H 1PTZA 2QLVB 4LLVA 1JPSH 2YWZA 1P1VA 3WIIL 2UY7B 2H6UA 5EU4A 3X13A 4YE0A 1BFSA 4AIZA 3S88H 1I1FA 1O75A 4RFNC 4G8GB 4JKPL 5AVQB 2DQTL 4XNXL 3SHSA 1S9WA 3LKPA 4PY7A 3TEYA 4FXLA 5SWZB 1YPZF 3PP3H 1A6ZA 1DTUA 4QXWA 1CFMA 5CIPA 2NNFA 5B1JA 2XRAL 4AMXA 1BP3B 2GITB 2VXSL 1KY6A 1E40A 4K3HA 4U6XA 4ZMXA 1DQLH 4TQIA 3MN8A 3PFQA 4MA7H 2XI9A 4I18C 1NBCA 3QEUB 1YJDL 4G11A 2VIRB 2XA8H 4XGZA 3T4AA 4KAQL 1FE8L 1WRFA 4RGNC 2OCCB 2A9NH 3NJJA 3E9UA 4L8SA 1IVLA 3OXRA 4NCC2 2Z8VC 1BZ9B 3TN0A 1TTGA 1ZLUK 4Z7QE 4UU9A 2DTML 3QUXB 5FC9A 2HRHA 4S10A 1I4FA 4QAWA 4GG6E 2VDMB 2AJZB 2EXWD 4HUMB 1CVRA 2EZ0C 1DJYA 3PL6A 2PCPB 1J8HB 1ANUA 4KJQD 1RK1B 3KPRD 3MR9A 4XMTA 1UJ3C 3GSVA 4I77H 4W9DC 2NTFB 2FJUB 4K7PL 4YH6A 5DEFB 5F7EH 3VXSA 5F1OB 4AGMA 5DD6A 3FFCD 4LL4A 2NY5C 2MQ3A 3KNBB 2C1PA 3APCA 3G6JE 2ZG2A 4JLRB 4JVWA 3V6ZB 4IBQA 4PFEA 4PUBL 3SEPA 5IEKA 2DH2A 4NQQA 1IM3D 4U6HA 5E23A 4YBQD 1UD8A 4JFDB 3GXNA 4CNIA 3BLBA 2DWYA 2VM4A 1M9WA 3CQQA 2CZNA 4NPJA 1JZ8A 2YSTA 4GNKB 2WQSA 2AEIT 5FCSH 3U1SL 3E6FB 3FSWA 1MHHB 2P5EB 2A7BA 2XJKA 3HUJE 3UIZA 1HESA 3VYPA 4I0CC 3VFNA 3D6GA 2DM2A 1EMTH 2X4NB 2L7JA 2E7LC 4RFOH 1RSFA 4W4OA 1KYUA 1L7IH 3COOA 2NY0C 4JFOA 3VQ2C 5FM5M 4Z0XA 4KKLC 3MRLA 1U2CA 4M5TA 5L2KD 3LN4B 3UGUA 2ZUWA 1I7TA 2WYIA 1DDHB 3KYKL 5DC4B 4AKQA 3BZ5A 1YNTA 1KIUB 2EKJA 4HBCL 1R24A 5L88L 1BXVA 1KIPA 3MRRA 4TUOB 1EANA 2YZ8A 5IVNA 1C16B 3FHAA 3CAFA 4XTRC 5LG6A 3FTGB 1R5WA 3QWRA 3IGAB 3WIFB 1FI8C 3FF7A 3TH4T 5L2JA 1UWGL 2O72A 3OG4B 3CHXA 4DK5A 4JO4L 2VLMD 5F0JB 1I1AC 2EACA 5DUJA 2BCKA 4N8PA 5H2BA 2VM3A 2D3LA 1URIA 3O9WC 3QNXB 4BZ1L 4NN6B 2Y72A 4MJ6B 1CXKA 1M05B 5IROA 5T1KA 2ESVB 4TVPD 3TZVD 3WKNA 3WIAA 2R7EB 4LPCA 3M1CA 1UENA 2ZSVB 5L4IA 1WCBB 3WJJC 1UACH 5DK0B 5EC2A 2ZXAA 3IDIB 4MAYB 3D2TA 2FDBP 4M8VA 1DVZA 4PREA 4NIKB 2A6KA 2A74B 1LWHA 4DT2A 3KLSA 4PV9A 1MELA 4G7SB 1ORSB 4KI5D 3GYRA 4P2RB 1MDAA 2EDKA 1T6WA 1JV2A 5DZOA 4JANA 4UDTA 1AD0B 3RZWA 4HC1H 4IHOA 5IQ9A 2YRZA 2OMYB 4H1LG 1C12B 2FBJL 2CJSA 1FO0H 1Z9MA 4XO5A 2DLEA 4M7KH 3EJYC 1WT5A 3V4PH 3KYNA 3CZSA 4KROD 4HHGA 1MDTA 1FZKA 1DE4B 1MLCB 2VQTA 5KVGE 2W9DL 3VRJA 4BKLA 4EUPH 1AANA 4AK1A 4YX2H 4DVRL 3O3DA 1WCQA 3O8XC 3ECWA 3V6OA 1IAIH 1OWWA 3C5JB 2EIBA 3VFRB 3MJ9H 4HXAL 3SDCD 3GZPA 2EXYD 5EO9B 2F19H 3AG4B 1QTSA 2JQMA 1T6BX 3PWJB 1MZYA 3DV4B 1DJGA 1ND0B 3FCGA 3F7YB 2W0FB 5SWQA 5DK2A 3OR7B 3T0WA 2WO3B 1ZPUA 3MCLL 1U8CB 2WYZA 4WU5A 4OZGA 4DAGL 3VI3B 1CTMA 2PABA 1MCOL 4OQ1A 5DEZA 2ZXCA 1KFAH 2YPVA 2VH5H 4JW3A 1H5BA 4MZ2A 4OLYH 4MDIA 5IK3B 3RWEB 4GAJL 1NGPH 5F96L 3GO1H 4JX0A 2AK1H 2AJXH 4OJYA 4D0CB 5C08E 4XP6H 3ZUNC 3CGTA 3ARDB 2BSEA 1RLBA 3VXQB 5I15H 2N1TE 1UWXH 4I5BA 2SEBA 4F37F 4GOSA 5CZXD 1QBLL 4AGQA 5JO5A 3J07A 3TV3L 4I3SL 3FS9A 4R0LA 1ZANL 1ET7A 1CBVL 4HMEA 5FW8A 3OPZH 4KK9D 2NZ9D 3F58L 5K9OA 4P2OD 5GRVL 4F5CA 1T22B 4F33B 3DJZA 1FV1B 3V10A 2VE6A 1GGCL 3WUWA 2HT2C 4B9GA 4KJYB 4GINA 2A6DB 4ZSOB 2BC4A 1HCVA 4L5FE 4HU2A 4JHAL 2VDRH 3T0XA 2FX7L 3T08A 4KMTH 5AQ0A 5HYEA 2YUZA 3B5HA 3IXTB 3ZYIA 1WAPA 4LQ1A 2ZYHA 4TPRH 5T3ZL 4KVPA 3S3SA 3GHPA 3V6BR 3IFLL 1VDGA 3U0PA 2LAGB 1FDLH 3JXAA 1P6WA 3PV7A 4P99A 1J11A 2Y23A 1AI1L 3N42F 4G8EB 2AJUH 1NJ9B 4TN9A 4TVSa 1VGEH 2HG5A 1VESA 3OHXC 1K5WA 1WK0A 1XGRA 2EXTA 2J71A 3ARGC 5IQ7H 1KPVB 1GPOL 4AQ1C 2ENYA 3S5LG 1RZFH 2YKKA 5AKRA 3GSWA 2BNRD 4Z5RA 3FH8A 4KFMA 1QTPA 2NY6B 3D2UD 5DVOA 4FYTA 4U6YB 1BDYA 2FSEA 2E47A 3GSUB 4ZMYA 4J3UA 1NLDH 4HAFA 5E8NA 5I1JH 1JF1B 4EQ3A 3W3BA 3BAIA 5I6XB 1BV8A 4KV5E 4U1LB 2WGNB 3QR2A 4HUVB 1UA7A 3PWVB 4WHCA 5DQJB 5E7FA 1RIUL 5LLIC 1ZS8B 1LGVA 2VAJA 1TTFA 5EU7C 5AAPA 3GRWA 2FJGB 4D3CH 5IB1B 1NH6A 1FZMB 2WLHA 4PJ9B 4U49A 1U8JA 4YE4H 3FO1B 2NNXA 4K9JA 1UM6L 4JLRA 3EYSH 4N2IA 3QQ9D 5AWNL 5TD4A 3V79C 3KPPB 3O45A 4MMXA 5I66A 2VZSA 5KSAA 1URLA 5DA4A 4B27A 5DC9B 3GDBA 4KXZI 4UTCA 4UOQA 5EU6A 2RQEA 4UV7H 5GRUH 5E56A 3KGUA 3LH2H 4KKZA 4A04A 1S9VA 2WUCH 3X1GA 2AS5M 5GISH 2F1EA 1RZ7L 3PYCA 3RPIB 4PJDE 4B5EA 2A99A 1LEIA 5EZOH 5T1DL 3NZUA 3VD2A 3MREA 4A2DA 3QDJA 3SYPA 4CSZA 2IGFH 2DYPD 3DJTA 5C7XL 1NMBH 1WAAA 2VXVL 4TNWF 5DHYA 1U93A 3KLQA 2OL3B 2C3HA 2W60B 3Q2LA 2OX5A 5C0ND 1TITA 4L4TA 1JYXA 1WD9A 1LNUA 4Y5XA 2ODIA 4BA0A 2V7HA 5KVFL 5FGBA 3RI5F 3UO1H 3BVTA 4N6QA 4Z7VF 4LRNL 4YDMA 3R1GH 2DIAA 5KN5A 4FNLL 2VZUA 2Y3NA 3FB6A 3BZEA 3SGDI 3VD7A 4H8UA 4X7TA 1MAML 4FA8A 3QNXA 1V55B 2FYYB 5H37G 4HGMA 4A6YB 3GUTA 5DMIH 4ELME 2X88A 1LP9A 4PP2B 4P59H 1XGPA 2ZKMX 3D87B 1U3YA 2LV4A 2I25N 1NTDA 2WTRA 4ILDA 1CFTB 4V1DD 4G80A 3V6FA 3OKKB 1S7QA 1JPTL 1FFQA 2GIXA 3RNKB 1C5CL 5IHZA 4HZLA 1MCLA 3ILDA 1QTYT 3RIAF 4NNPH 3V5HB 3H42H 1F8TL 3MC0A 4P5RA 3UTTA 5B39A 1IGIL 5AAWC 3B34A 1CDHA 2PYFA 3TS8A 3A6BL 4K94C 3NCYS 4QF1A 3HFFA 2XTJD 1QG3A 4FMVA 4QDGA 1W72H 4JY6B 2IAAC 3IMBA 1T3FA 3W5MA 2LOEA 1AD0A 4U1GB 1F11B 2IXQB 3BT2L 4MMYB 1PZ5A 2CGYA 1MH5A 1G7IB 1JFQL 4AIOA 4N8CH 4P48A 2EE0A 4UQ3B 4DETA 3UYRH 1XZ0A 2DL9A 1HL5A 5BS0A 3HN5A 2Z4TA 3DYMA 1HL9A 1YEKL 5DVMA 4GQPH 4TKWA 4AJVA 4YXKH 3FCBA 1C9SA 4DFHA 3HOGA 2EE6A 1TEGA 1HI6A 1THAA 1NFDF 5TGBB 3CUPB 3UZEC 3P02A 3UEZA 3GI9H 3WIIH 4EEEA 5HDQL 1ML0A 2GBUA 3TA3D 2IANB 3N2JA 4RGMB 5KS9F 4QT5B 4AKPA 4IKNA 5BRQA 4JKPH 4M8RA 2DQTH 2EILB 4XNXH 5ENWA 4MA3A 5ITBL 2LU3A 1WA0X 1RPKA 1SHMA 3LJ3A 3QXDB 4XXDB 5ISZE 5CLWA 2XRAH 1IAMA 2VXSH 3S3BB 1T4KA 3MUHL 5EOQL 4I18A 3LRLA 5KYYA 1DQTA 4CMHB 1IO4C 3ESUF 3AAZB 2EDLA 3ESOA 4NKQB 2FHCA 2QQQA 3RGHA 4DP0X 4KAQH 3A5VA 4HJ1A 1FE8H 4OIBA 2QADB 5ERWB 2YD2A 3UTSB 5JYLA 4QCIA 3WFCL 1O9VA 1KCRL 2ZWLT 4FXGB 4K8RL 5IGXL 4JRXE 3LVEA 4OIAA 3N44F 3BN9C 3KBHE 3EH4B 4PW3A 5L0QB 3STBA 3FTYA 5C2BL 1I9JL 3FFDA 2R23B 4F1SA 2QVFB 5LGKA 1M56B 3QXAA 1QYGL 2D31B 1VF5C 3EOTL 1RP9A 4S2SA 2V0AA 3WO3B 4K7PH 1H6UA 3W56A 2E76C 3SKMB 2D7OA 1W6LA 4PUBH 3QUKB 1V10A 1OCZB 4YDKL 4K73A 3VTTA 4ZXBD 3B7RL 2XWJA 3VH8B 4OCWL 3QRGL 5CJBA 1PCXA 2X4OB 5DLML 2GTWB 2ZPKL 5EB9A 2X4RA 3U1SH 1GVIA 2HFTA 1IRAY 3VJ6A 3QZWG 2FLRT 3IJ9A 2WAQA 4LHUA 5HI3D 3ZHFA 3KPSA 1EAQA 3UZVA 1RLWA 4YSCA 4HJ0C 1YY9C 2OMXA 3CDGA 4UUJB 1GJWA 4PJBA 1YYCA 1MVYA 3KYKH 1FN4A 2ISDA 4HBCH 5L88H 3L1GA 4WJ5A 5AUMB 4W1TA 2XKNA 4BK5C 4KH9A 3GS7A 1E2VA 3ASOB 5FKAA 1JDAA 4NZRL 3ULUD 1I1AA 3OR6B 4LLQB 1UWGH 5KOMC 5IW1A 4HKJB 4JO4H 2FH6A 3O9WA 5FLVA 3OZLA 5CO1A 3U4KA 1XO8A 2UVEA 3HRZB 1OTUC 1ZS8A 5HTSA 3QSKB 5JIDA 1SRDA 1OQXA 2KDGA 4X4YB 4UOW0 4BZ1H 5C2UB 4NQEE 1IARB 4GO8A 1NDGA 4IGBA 3F83A 1YNLL 1JPEA 3G5YA 4NO3A 4IRSC 3LHPL 1G7PB 1PSKL 1G1YA 4X6CA 4XO8A 4E41B 3OBAA 4HULB 3VFOB 3CSGA 1HEZA 5ETUA 3CN3A 4M8QB 3K0YA 5F44A 2QGDA 1BVNP 3ISWA 3L9RA 3WFDL 3TV8A 2VISB 1N0XH 2EEFA 2IQAA 3FUEA 3PLYA 1UA6L 1Z66A 4HMDA 2IV9A 1G6RB 2PWFA 1JTOA 4GKOA 4IBTA 3VAEA 4WO4D 4GW1B 1VIWA 1YDPB 2CBOA 4A2LA 2CO7B 1FORL 2BNQB 3UXFA 4H44C 4Y1AE 2FBJH 3P4NB 2DKMA 4JFED 5ISZD 3KW7A 2XBDA 1MREH 1N8OE 3FO2B 1KJMA 3RDTD 3SQBA 3BH8B 1NWOA 1FG2B 3HE6D 4PN6A 5HI5D 5IOKA 5I1LA 5CBAB 4J6IA 4LCWB 3VD1A 4IIQB 2KZBA 4HXAH 2D3NA 4GQ9L 4R9HA 2ZE0A 4AE0A 5IUSA 3O6FD 3QA3B 4GRLD 1AHWB 1HXYB 1S7VB 2X4UA 4IOIB 3TBWB 1MCEA 5I8OL 2AEOA 1FYHB 1HSAB 5MEPB 4GSRA 4OF3A 2FR4A 4IU2A 2Y6TE 4RDQF 4KI5F 2QVTA 3MCLH 4GBXC 4A6YA 2FQDA 1X7QA 4ZW5A 1ZDSA 4DAGH 2A0LD 4MMZA 1EIBA 3KHOA 1N6VA 3IK2A 5EO1B 2MH4A 4KK6C 5M95B 4MJIA 1R3JB 2GJ6E 4NQVB 3K72B 4GAJH 4I9XA 5F96H 3QNYB 3ZL1A 4ZAKA 3TU6A 1PKQB 2DQMA 3MKGA 4JEGB 5KVDE 2YGQA 3PJSA 4RX4A 5EBWA 1RZIA 2EIZB 4HS8H 2Y2TA 3BP5B 2FTAA 3EJPA 4YSQA 1X6NA 1ADQL 1C5BL 1I9EA 2WXPA 3H2WA 4OVVA 4E2OA 3MA7B 1TZAA 2YXWA 3TV3H 1FC1A 3MO1B 1ZANH 3B9KB 5DC2A 4LRIA 4Z7WF 1CBVH 3CQFA 3F58H 2ZOUA 4EIUA 1G7MA 3DJ9A 1E8ZA 4Q74A 5J9PB 1JVKA 2VGLM 4O2CB 1MWAA 3WN5C 5I0XA 1GGCH 1LD9A 4K94L 2BOBA 2PXYD 1L4IA 2K6ZA 2WWKT 3ARBB 3IU3A 5FO9B 2IJ0C 4PMEA 4NYLB 1JWMB 3N41B 2FX7H 1NOAA 3FB8B 2XJLA 1MVFA 3IT8D 2ZCHH 3TWYA 2E4TA 1PQZA 4FG4A 4R97B 1A0QL 1CTOA 2BJML 3FU7B 3Q8AA 3LKOB 1KTDB 3C6LA 5T3ZH 3M46A 4NRYA 5BXFA 3EO0A 5HJ3A 2J8UB 2AVFA 4POZC 3QJOA 2VQ4A 4IBYA 4NPYA 4ODUB 2F53B 4KNSA 3TONA 4PRHD 2FT8A 4ALAC 5AVVB 4FQCL 1EEYA 4HV8B 5FDYA 4NKIL 1U2YA 1Z3GL 4C56A 4UMGA 3Q0HA 1ZA6A 3BGMB 1GPOH 1E27A 4P3DA 3FOMB 5C09A 3AAZA 3IDGB 4NQED 3AC0A 4D9LL 4IBWA 4YHPA 1QO3B 4IBSA 5IBLC 3BUYA 3WDJA 1X44A 1J0JA 3HUJF 1FNEB 4WRLA 3ARSA 1WWAX 1D9KB 4YBLC 2K4WA 2ZUQB 4DIXA 3HHRB 3RVVC 1RIUH 1TR7A 4NCC1 2JV6A 5FYKH 1HDMA 3DI3B 2IDCA 4XODA 4MASA 4PJ6A 3MNZB 1PBYA 1TTCA 4D7PA 3D39B 1X5FA 3F85A 1NAKL 3GXIA 3QI9B 4DPRA 3K6SB 3QXVA 5EBLA 3QIUB 4Y1AD 1UM6H 1A25A 5AWNH 1B3JA 5HHOE 1MVUA 1WGOA 4Z0BL 4YAQA 3MLYL 2OMUB 4MLSA 1HHIA 1F4WL 3F00A 1ZHKA 3VXUE 3H9SE 4N5EC 3F04A 3GMMB 1UB6A 1SBSL 3F8UB 1T2QL 1YY8B 2IG2L 3BP4B 3LZNA 4P23B 5D4QA 5IOPB 2WXNA 4AQAB 4JJOA 1RZ7H 2OR7A 5F7MC 5BNXD 3H56A 1NAML 1ORQB 3CHSA 1HH6B 3D7PA 5IFJA 1HQ4B 4QHLB 4FA6A 3VMPA 4QKXB 1XR8A 4TTDD 5C7XH 2VXVH 3ZDZF 5FYLE 3MOBL 2D2OA 1CYGA 1HWGB 3OF6D 4KDTA 1TZGH 1BMWA 1JGEA 2EDEA 2X42A 1ZHNA 3EYQD 2Z34A 3EJUA 3VRLF 2CLVA 2AXJA 1OSPL 2WY3B 3IETA 4N20A 2WIIA 4OLUL 3NGBB 3C5XA 5KVFH 4WU7B 2PR4L 4IDJL 3FC8A 1DQQA 3HMWL 4BZ2L 2E7HA 3B43A 1Z9SB 4KTYA 3QZOA 3QPQD 2ZT9C 1QFUL 4JRYB 4LRNH 1Q9OA 1SJMA 3UMNA 1LO0L 3FU6A 4FNLH 4CUCA 4Y4FD 2GBTA 3HRPA 3G04A 3VXNA 1A9EA 1IKNA 4JN2A 1MAMH 3BLKA 1PY4A 2RBLA 4XN7A 1PG7L 1NCJA 4DQOL 5CMAA 1S9YB 4JZOA 5ESAB 1N8ZB 5F9DC 4FEIA 2DJ4A 4PH8A 3LDBB 3T1FA 5ITFA 1A4CA 3QYNA 4S1RL 2NX5A 1ASOA 5TPWL 1R5VB 1Z5HA 4XE5B 1JPTH 4NHCL 4F2MA 3CE1A 3IFOB 3CBKB 4L9LC 2LLNA 1T1WA 1F8TH 4F8TA 5B4MC 1IGIH 1EGJL 5HGHB 3CVBA 4XCCH 3A6BH 4PMFA 3LD8B 2EDXA 1XH0A 3M07A 4HGWB 2FATL 2XN9E 4YHYB 1P84J 5FIEA 1I3GL 1TCRB 2OCJA 4KO5A 4KK5C 4N0FA 1JYNA 3BT2H 4G6ML 1JFQH 1ES0A 2OAAA 4NRZA 3VXRE 4HKXA 2UZYA 3WEXB 3DWTA 1JZ7A 3QJUB 1X5ZA 3HC0A 1K8DA 2C9QA 1MIEL 4UZSA 2X4TB 2V2TA 3KLAB 3ZDYB 1HCZA 1QWNA 2PYEE 1QSFE 5DJYA 4PG2C 3MBEC 1I9RL 4IS6A 3QT2A 3ZKQD 3VXSE 2R15A 2G0LA 1QUNB 3NJVA 4TVUA 4XVUC 2E9JA 2FECL 2XCMC 5HDQH 3ZE1E 4P4KD 1G94A 4N2BA 1G0XA 3FT2A 5DURD 2R4SL 1NDTA 2I24N 2DMKA 4A1RA 1TIUA 2MOQA 1VFUA 4HAKA 2BZDA 1CB4A 2VW4A 5D6DA 5ITBH 3QIWC 1P5UB 2PO6A 1A5FL 3GLDA 4XRCB 3SGJA 5F0PB 1VFBB 5EOQH 2AXFB 2WXGA 3VDAA 4H20L 5EH1A 2WMPA 4DESA 1QSEA 3ZKXB 1ZDQA 3WNLA 3TJHC 1J9QA 3O2VL 2B1AL 3A4EA 4JPVL 1I8MB 2F8XC 3ECBB 1TTRA 4N2LA 3ILPB 4GMSL 4RFEB 4WK0B 4P5TD 3WFCH 1KCRH 3K4ZA 3P0YL 4K8RH 5IGXH 3HE7A 2ZOKA 1HC1A 1FO0B 3HZYB 5HHOD 5D7IA 2NDGA 5E4OA 5G2NA 3SE3A 3V4PB 2HXAA 5I1IL 5SWSE 4QXGL 3VXUD 5D2LE 4FQLL 3H9SD 3BSGA 5FXCH 5C2BH 1I9JH 2G5UA 4JHWL 4LLDB 5IVXF 3QDGB 2AJYL 4O9HL 1P1ZA 1TFHA 1BJMA 4OT1L 4AV5A 1QYGH 2X41A 3EOTH 1AQDA 5I17A 1UKTA 4ZS6D 1WFTA 1H6FA 4WI7A 3K71B 3A23A 4HWUA 1GSKA 4PTTA 3KVDD 2EYTA 4OF8A 2GUOA 1MLBA 3RVUD 5I6LA 4H25B 3ZTDC 3S97C 4YDKH 5HDBF 3WTSA 2X9WA 1UXWA 2ZZUT 2BERA 4LNRB 1BQUA 5FYLD 5TDNB 3ECUA 4OCWH 1N5AB 1FL5B 2MQGA 4AV4A 2WWKO 1D5ZB 2BOCA 1Y0LA 5DLMH 3BRFA 5D4JA 2ZPKH 4APXA 5EU3A 1IL1A 3S5LA 3RUGA 4BINA 3E6HB 1AZBA 3SOBL 5IJCC 4FDWA 1QZNA 5MEND 4DP1X 1S7XA 2LGNA 2N7AA 1ZVSB 1QHOA 5DFTA 5LBSA 5CCKL 1B4JL 1JD9A 2KPWA 4HLJA 3UH8A 2BSTA 4M7ZB 4NRXA 2I9TA 4J4PD 3UC2A 4LSPH 1ZT4A 4GUQA 4QTHA 1JPGB 4DGIL 5F1SA 2HJFB 4OCXL 3O3AA 1I75A 2P47B 2EVJA 3B2VH 3HHSB 3GQFA 1I53A 4QHUB 3SBPA 4NHUA 1FNEA 4Z7AA 4UAOB 3UAAA 2IOMA 3S4SB 2P24A 1J05A 3BSHA 4WV1A 1FAKT 5K59F 3VDBA 2BVEA 4HCRH 5E94B 2VDRB 3UAFA 3UYOD 2ED9A 1UWFA 2Y0SA 2B4CH 1TVDA 4XPTL 2RALA 3L1FA 3TPUB 4KU1A 1YNLH 1YUHB 2OXGB 3LHPH 4H26B 4IJ3C 1NMAL 3WGVB 1PSKH 3WNMA 2N1KA 4KKBD 2QKSA 1XWVA 5BCAA 4OZHF 3H7BB 1SZNA 2EYRA 2QHLA 3CFQA 1GGUA 4JFHE 1A22B 2IOIA 4QXVA 3VXRD 5IWLA 9PCYA 4NO2A 3WFDH 3Q8BA 2PYED 1AYRA 1QSFD 4Y5VC 2I7OA 4AQEB 5JHDA 2OR9H 3D85D 3F64A 1UA6H 5JLZB 2ARJQ 2Z0BA 4AJ0A 3KCWA 4ZUTA 3TYFB 2Z93A 1OB1A 4X5PA 1HOCB 4PJCA 5L7XL 1FORH 1F0LA 3ULUF 4B9IA 1JVOA 1NEZB 5C07E 4HOMA 1HE7A 5ESVB 3ZE2E 3QUZC 1F4XH 1G7JB 4R96B 1WTLA 4FHJA 5I24A 3F01A 3DRTA 4K9EC 3BZDA 4QGTA 3RZCA 1A1NB 3UTOA 4F5CE 1UQSB 2R56H 1IGJB 4PJXA 1K85A 3SGEH 5E6IC 4MXQD 1AGBA 1Q38A 2AFNA 3LH8A 3MV7A 7PAZA 3X3FL 4PB9L 1GRWA 5A2BA 3OG6B 1QR1B 4GQ9H 4NN7B 3BT0A 3AABA 4HCGA 4O4YL 1LDSA 5E1AA 3VTAA 5INDB 2QELA 2YA0A 1HH9B 1H9VA 3FO0H 4GFXA 3NQKA 3PQYD 4E9XA 2Z0UA 4Q89A 5I8OH 5SWSD 4XB7A 3RGVC 3EHBC 1MW2A 4OLVL 3BPOC 4FTVB 4NB7A 4UDUB 1TNMA 4XC3L 1ACXA 4G8GE 4ZT1A 5CU5A 5FGCB 4B3VA 4ELKA 5SWZE 4B9JA 3CSYA 1JZ3A 1ZCRA 3BRDA 3AWEA 4JFFD 4DZ8A 1HWWA 4KRMB 4WTQA 1NC4B 3EDJA 1HT6A 1ZXQA 1J9SA 4IK7A 4PJFF 4WWKB 3UADA 1JRHL 4L9DA 1ZKAA 2JJUA 1ADQH 1C5BH 1JN6A 2ZWSA 4WNSA 1J48A 1MN4A 3D4CA 4X8GA 2WN2A 3S0PA 2A73B 5FW6A 3V0HA 2ZKWA 3BQUB 5LNDA 5AKTA 5DJXA 2BVPB 2OMNA 2AEWA 3MFGB 3AREA 1MW3A 4FQQB 3WJLA 1FNSL 4ZRGA 3HFML 1MI5D 1HHJB 4AZ8A 2DL2A 3PNWB 4BD4A 4LVHB 3DOHA 1L7TL 3G9AB 4APQD 2UZXB 2BVYA 3R7RA 3WEXA 5IIEB 3VWKC 1AGEB 3B9VA 2DMBA 3B8SA 2H1XA 4NP4L 1KOAA 1TKWB 3ATDA 3HJ0A 1SF3A 4E36A 5KSBA 4LL9A 3PGDA 5T3XH 1WZMA 2I32A 1A3RL 3PWNA 1A0QH 2BJMH 2AQ1A 2WKOA 2YD5A 1XSJA 1SJHA 3EO9L 3S7GA 2Q2LA 5AFAA 2FEEL 3FUJA 3ZTNL 5ESQA 3EXJA 2XWBB 3W82A 3E3QC 4NQDA 1HZHL 1A2YA 4JFDE 4KWUA 3ZZ1A 3RKPA 4U4IA 4FQCH 5MEQA 4MJ4A 4NKIH 1XXDC 4P3WA 1Z3GH 2HRGA 4CSPA 2Q7NA 4DPCX 4JPIA 2E6PA 4E42A 3LNEA 3Q2WA 2P5EE 4X9FA 3FHEA 4PJHA 2QSCL 5IJVB 4FLRA 5HHXL 3BMVA 4FFWD 3L3JB 2VL4A 3E8UL 1PPIA 1NEUA 1W72B 2WQVA 4AJWA 2CDGB 4WW1B 4XXCC 4XNMB 4JO3L 1T04B 3BXNA 4LBEB 1UZ6E 4QNPF 2R2CA 3VA6A 4Y19D 2NCMA 3C60B 4M29A 4L8CA 4O51B 1T1YA 4Y5YC 1CDBA 2PCFB 4DKEL 1H6TA 1IGCH 2CRIA 4L4TE 3GSQB 2HJKA 5DMKB 4EUPA 4HD5A 2I85A 2Z91B 5DJ8A 1O6SB 2A9CA 3NJFA 1JIBA 2VQUA 7CGTA 5KSVB 1ZIAA 4TRPL 5CEZL 2Q10A 1NAKH 4F15C 1NIBA 1FHNA 3HS9A 3QZMA 5KAQG 3RWFA 1J8KA 3DX7B 1ETJA 4I88A 1DBKL 4X6DF 3HVDA 1N19A 3T4YB 4Z0BH 3QZWA 4LCCC 3MLYH 1F4WH 4HIJA 5LCVH 4YEFA 1LP9E 2ESVE 1BOYA 2G2NA 4LNRA 1U9KA 4DP4X 1SBSH 4ZW7A 4J3XA 1T2QH 5EOTA 1UKQA 2IG2H 3HCVB 1BF5A 2QZ5A 3AB0B 3C8DA 3ULVC 3KPMA 2XQBL 1UUSA 1OCCB 1NAMH 2HWZL 4H0IA 4AEHH 1CXHA 2NR6A 3CVHA 5FYJD 1HQRB 4R2GD 5TF0A 4QD2E 3T0EB 3PGCB 1TQBC 4O58L 4P2RE 5E08H 4XP4L 2EKSA 3OX8A 3BAJA 4XVOA 3VWJC 1UVQA 1KJ2L 4AYFB 4FFZL 4KHXL 3MOBH 4XPAL 3S96A 4BDVA 3REVA 5TQ0L 5JPNB 3CFIC 5IJKA 4FFTA 4G8GD 3S35X 3FUIA 1ILUA 3B5TA 4XP9L 1A6WH 1XCXA 2APVA 1OSPH 4C47A 2X0VA 2IOOA 5BS0E 5I16A 1G0YR 4Z7UB 5EUOF 5F0MB 2PR4H 4BZ2H 4S1SL 2QKIB 4XH2B 5EG6C 3JTTB 5MI0B 4MVBC 4A63A 1QFUH 1KYOK 1RPUA 1NQBA 1QHPA 4F7EB 1LO0H 2RMNA 2WSDA 3Q13A 4HPOL 1F86A 2BSSB 5EBMA 1KLUA 1PG7H 1XF5A 2H0JA 2OTUA 1BHGA 3AXHA 5IHUH 1EXUA 2WK2A 2NY2B 2K45A 2HT3C 4PTUB 4BELD 5HVWA 3BEWB 2VR4A 5IF0B 4HOZA 4KX7A 4UTBA 2R29A 3QUXD 1C5DA 3K7UA 5DJ0B 4S1RH 5TPWH 3WKPA 3OB0K 4ZNEA 4RH4A 1ED3B 3TC9A 4NHCH 3L5JA 4L9LA 4HOXA 1J8HD 1K4CA 2VO5A 5PCYA 3VI3E 2CR6A 3K46A 4RBPH 5J1AA 3W57A 5IEHB 1EGJH 2NSMA 1QFWH 2X6BA 1JGIA 2JELL 4OZFG 5E2TL 2FATH 2Q6WB 2M26A 4HWNA 2AJ3A 3NFPA 4ZDHA 2P46B 2A77L 3CVDA 1NBZB 1NCDL 3UBFA 4P46C 1U91B 4G6MH 3I75A 3P0VL 3TURA 3D52A 4R4BB 3N40P 3IAPA 1U8OB 3ZHLA 4LFHG 3OXSB 1DCLA 3LQZB 2GFBB 2EE2A 4JM4H 5DRWA 3OV6A 2GIYA 1BBJA 3BGFC 1KSRA 1DJZA 1TZIB 4PG2A 4UIMA 3TESA 2P5ED 5CJQL 1I9RH 4OD2A 5E03A 4L1BA 4ZSOE 1OM3L 4RWHA 4K9EL 4I3RL 1V3KA 2R4SH 4IDLA 3EF4A 4J3OF 2DEYX 3BSZL 5ICZA 1T21A 2XYBA 1DBJH 3RWHB 3VM5A 4K3JL 1RZ8B 4PV8A 2PTUA 4XN8A 5GGSB 1EXHA 4F8PA 5DS2A 1XH1A 3CG8A 1A5FH 3GBLA 1CE6A 1P7QA 1LDPH 3MRBB 1OGTA 4KGLA 2WGXA 3QQNA 2CQVA 3DOIA 2QDWA 4H20H 1NKRA 4AW7A 4IIZA 1QASA 2B20A 1VSCA 4YDVB 3UFIA 3BPNB 3C9NB 3O2VH 4Q4EA 4NC1E 2J55A 4GMSH 1TQTA 1HNFA 3P0YH 4GEIA 1H19A 3P3UA 1TEFA 1AFVL 2OYLA 3JZYA 4LVNC 4AYID 4J8QA 4U1MB 4ODVL 3I6GB 5I1IH 2V7NA 4QXGH 2ESVD 4NKOB 5D1XC 3ZRFC 4FQLH 5JHLL 5I0VA 4JHWH 2AJYH 4O9HH 2B16A 1E4XL 3MJ8A 4OT1H 4A2EA 5FB8B 1UOWA 1XF3B 3MXVL 1IZKA 4L1SA 4N0UA 5AOIA 1J0KA 3LKRB 3WD5H 1OP9A 2DMGA 3NCCB 3CU1A 4A2HA 4Z1PA 5IP4A 1LO5B 1GGBH 5JXED 5F6IB 4BFRA 2OYKA 2F2HA 2V5YA 3OKDB 3DX6B 3WI9A 3G5VB 1PY9A 2AK4A 1GY2A 3A24A 2E9GA 2VN3A 3DUUA 3VI4A 2JKTM 3ULUL 5AYUL 3K74B 3GS0A 4OV6F 1BQLL 2VZ1A 1BBDL 5J11B 4G72B 2OTWA 4WEBL 1E5UI 4PW9A 2VZOA 4ZOEA 5D1QD 1KLGB 2IAMC 2YIHA 3TBSA 3IMTA 4J3OC 4F58H 4FQXB 4I0PB 4PJ5D 1BIIB 1XGUB 4PJ7F 4XO9A 5DRNA 5EUKA 1I8UA 3JSSA 1B4JH 4PRAB 1BZOA 1FNGA 2BLFA 4X7EC 1MCBA 3AXLB 1XF4A 5E2UL 4WI2A 2YRBA 1BYOA 2YPKA 4JGUA 2YAQA 4HSCX 1ZLUH 2D3JA 4QRTA 2YK1L 2FD6L 4CADB 2NZ1A 4DGIH 3F5WB 4OCXH 4MWFB 1RK0B 4YIQB 1HKFA 4OV5B 2PWDA 3NRPA 2Y06L 4Y8AA 2Y5TB 4DGYH 2DEXX 2P45B 5D93C 1EZUA 3RFZB 1UT9A 1T04A 2D03L 3BWAA 4NO0A 4WNQB 3O0LA 3MX0A 4O51A 2C3VB 1JZHA 4TXVB 5DUBB 4GUPA 2VLLB 3FQRA 1UWEH 3GNML 1WYJA 1FNAA 3SYCA 4K23L 3MOQA 4L4VB 3DMMB 3HTLX 4IOSA 2YN5A 1DEEB 1XGQB 3ARDD 5CWSB 2B7DT 3EH5B 1IU1A 1NWPA 1GZQA 2AV7A 1K2DB 3BZ4A 1PD1A 3LEVL 3NJGA 3PDGA 4Q6IC 5AW4B 2A6JA 4W6WB 2EH8H 1MRCL 2CRMA 1FFOB 2ADGA 1M4KA 2OJZL 4OLEA 1TVBA 2W91A 5ECJE 3D5OF 4HIEB 5HHME 3IJ7A 3R4RA 4FTDA 3RURA 3HCVA 3AGWA 3ZQWA 5F7HA 2FQFA 2MEJB 5LQBL 1X5LA 1S78C 2QSQA 3NACL 4YDLC 2AQ3A 3L2LA 1HWHB 5L7XH 3RILA 3FCTA 1MF2L 1WBZA 3DSFL 4LIQL 2D7QA 2UWEA 3PGCA 3MRHA 3US1A 5CU9A 1NOLA 3ZGHA 4XNQA 5GS1A 1AO7A 4RGNB 4H8WH 5K9JL 1A6UL 3L54A 4JHVA 4NN5C 3QORC 4WAFA 1FPTL 3VO0A 2ARWA 4B9ZA 4UIKL 1V7NL 4G43B 5FM5O 4R7LA 2QFPA 4PB9H 3X3FH 3QQDB 3U6XS 3H9HB 3GJFH 2JK5B 3DXAD 4IRJC 1U8HB 2G2RB 3T8VA 4CJ0A 1PLGL 1S9XB 4E5XA 4O4YH 1FFPB 3J2PA 4KDWA 3MRNA 2E9WA 3LPPA 3RGVA 3W0WA 4F7EA 2JI3A 4ENED 4DEUA 1HZKA 1BX2A 3S3JA 3MNWA 1UJ3B 2NY6D 1FL3A 3NABL 4I3GA 2EEBA 4PJIF 3ILEA 3AS0A 4LSUL 2JWYA 1CD0A 4Y16A 3GBDA 4RAUA 3FQXA 1ZWIB 4KUZL 1J0HA 4HISA 1DL7L 1VRSA 2CKBH 2OJEB 4ZFFA 2ADYA 5C6WH 4YHOL 3VFSA 3U36B 4FI8A 1GS7A 3X1NA 1BLNB 2D2CC 3SJVB 1INQB 2OKMA 4HQQH 1M7DA 4L29A 2WO4A 5HYIA 2G5RA 3PG2A 4AQOA 2XN0A 4P9HC 2GY7B 5HYQB 5F1NA 5FKPA 3QARA 4PJ9D 2TSBA 3UTSE 2CDEB 4R7NB 4OI9A 3NJNA 4N2CA 1FNSH 2NY0B 3HFMH 3JWNG 4P07A 4QO1B 2OSLA 3DX4A 3BD4A 3L95A 1CLOH 1L7TH 3EOAA 1P9MA 3O11A 2X4SA 1ZLVK 1H8SA 3HN3A 4HUWA 3L3HB 4ZQKB 4NP4H 4RLDA 1VZIA 4G6AD 2ALWA 3VU2A 2N4IA 3MUUA 4G3YL 3SQOH 1XCQB 1A3RH 1B0GB 2XLLA 3OGCB 3MFFA 4L4JA 3L3OA 4Y4KC 1WA1X 5JOFB 5J12B 4W9GC 1NFIA 1RUKL 3BYYA 3D50A 5DS8A 3EO9H 3CLEL 2EEXA 3QHFH 1OPGL 3L6FA 3KPQA 3ZTNH 3M1OA 2CSPA 2G0KA 1HZHH 3Q6FB 2FRGP 2CGZA 3B3IA 4ZFOL 1XCTA 2DLFL 1DQKA 5BZWA 4YSUA 1U8IA 1U58B 3FAXA 4GKSA 2XG4A 4OCSH 1KGYE 5EIIG 4JJ5B 4XWGL 2X09A 1A21A 4KKPA 4XX5A 1SDDA 3E8UH 5DD0L 1NGYB 2A1WL 3BAXA 4I89A 3L4YA 1AC0A 1Q9WB 1V54B 1Z3RA 2YBGA 4JO3H 1W0WB 5F88B 1UXMA 4OAWB 4YEEA 4Y5YA 1E5BA 3H53A 3QG7L 3LEXA 2HT4D 3HAEG 4ANWA 4X5WB 5SX4H 1BF8A 4LOVA 3HZVA 1IQDB 1NUFA 3BUPA 4DKEH 5B7MA 4PS8A 2DQFB 1T5XB 4NDMA 2ZX7A 5KBLA 1H6EA 4IEFA 3MV9A 4QRSB 4TRPH 5CEZH 3BP6B 3U1QA 2WWMD 1KIQA 3RWCB 1RP8A 1OE1A 3E7JA 5FA4B 1G9EA 5EN2A 3FQ1A 1DBKH 4GSXA 3LQMA 4JHBA 3LN9A 4LCCA 4QRPB 4MHHG 5FF6B 4A7SA 3ETBF 3O8XB 3DX6A 1U8KA 5B7EA 3G5VA 5IBUB 3UC0H 5CM1A 3ZZLA 3MRIA 1OT4A 2Q76B 4PGBA 5CINL 2ZSWB 1BIHA 4E41E 1F90L 5CCKH 4LSQH 4L2YA 1A4JA 2C1OB 2WO2B 2NX5E 1FWXA 2P8PB 5DWUL 1HHHB 2XQBH 3FQNB 4MB4A 1OF2B 4S1DC 1AQMA 2WN3A 4NFBA 1EO8L 4GQZA 2VRKA 2KZKA 3ZXAC 2X6MA 1IGML 2Z7WA 4U1KA 3VWJA 1UEYA 1VKXA 2ITEA 4O58H 5IT2L 2FLMA 4H13C 3I6SA 4XP4H 3CZLA 1G9NC 4ANKA 3ERXA 3CXFA 1LILA 4GMTL 1SLUA 5DT1L 2IAND 4EI6A 2W81C 4PRBA 2XWTB 3CFBA 1OCWL 4XP9H 1R3IL 1RIVH 2JIXB 2P9RA 4NQCA 2EVHA 3HLAA 1TTUA 3BO8B 3LNGA 4Z6AT 4HXBL 1A7PL 3NESA 2JKIS 3QDMA 5I74B 4S1SH 4NUJB 1GR7A 3II1A 4HHWA 2PPDA 1R46A 3IRCA 3UG4A 2APWA 1T1ZB 3DVGB 4YHNA 3MRPA 1XBRA 3MCG1 4LCWE 4HPOH 2G3ZA 3QNFA 5JQ6H 3UPRA 4E68A 3H3KA 4UZUA 1OGSA 2QADD 1YEGL 1YYLL 4QTIL 3UTSD 4ZW3A 4Z7OF 4Q9QL 1GYWA 3O4OB 1K5NB 4W4NA 1NIDA 5I8CA 5HY9B 2GSMB 3KYAA 2Y1ZA 3T3MF 1U8LA 3NMEA 3U0TB 1DYZA 3H2QA 1UOLA 3EGXB 1SY6A 4EN3A 1EHXA 4RMRA 2VDOH 1IC5H 1QSEE 4MQ7A 1AXIB 2XACC 3MUY1 3VFMA 3VD5A 4BFBD 5CKAA 1B2WL 1UURA 2C26A 3WEMA 5A6IA 5AZ2H 4PM1A 4HIIB 2JELH 4LCYB 5J3HD 3DO3A 1UYWL 1Z6JT 3OHXB 4JM2A 4YBHA 1PKQE 2YPLB 5A6LA 2A77H 1NCDH 3ARGB 3AY4A 1REIA 4AQ1B 3C87A 3K1KC 4XP1L 3P0VH 2AP2A 4YVNA 3DIVA 2Y7LA 3EFDH 4MZ3A 1U0QA 3B7SA 1QATA 3UP6A 2NY3C 5E9DD 1OTTD 8FABA 5FDWA 2XX1A 2ENPA 1L9MA 1EH9A 1FAIL 5KVEL 1FG9C 4Y0GA 2BIPA 5J57B 3SODB 3FT1A 2FWLB 4UM9A 4DP6X 4I3RH 3ZKMC 3BSZH 3ESNA 1FZJA 4K3JH 1YEIH 4MRBA 2COQA 1Z7JA 3I3DA 1NC2B 2P5WB 3MLTB 3DBXA 4NC2B 3MACL 4B6ZA 1VZHA 5GS0C 1HFUA 3I3EA 1R3KB 4GW4B 3IVKB 4QRRB 2WQXA 4CGUB 1ADWA 2J8UE 3HZKA 4XBEL 4TLTA 3RUGE 1ZXKA 5T1MB 4AZUA 1JZJA 3ZTJG 2QEJA 1BD2B 3ZUCA 2KZ1B 3QE5A 3GHEL 4DUXA 4XBGA 2C9PA 3OKEB 4HUXB 4HHAB 5C0RH 1KNOA 2OJEA 2R9HC 1S5IL 2QGCA 1AFVH 4TYUA 1R3LA 2GEEA 3EJCA 4X6BB 1BLNA 5D1XA 1F2QA 5KSUA 3JWNC 1J5HA 3WLBB 4ODVH 3MLPA 1N26A 4LOEA 1JYVA 3MMEB 4X6EB 1VCBC 4G9FB 4E41D 1OO2A 4AVHA 3N42B 1CDUA 1CD1A 4YMPA 3GGWB 3WNJA 1S8DB 4C83B 3MXVH 2JKJA 1YPZA 5E1QA 3WYRA 4CAGA 1EAOA 1H3TA 3FQ4A 4FKHA 4P9HL 5F7YC 5CLTA 3TCXA 4PAZA 4YDNA 1MQKL 3IE4A 5JUEL 1EHAA 4HAGA 2F7IA 2WZ6A 1A6TB 1GGYA 1KLFB 2L04A 3IMRA 2FWUA 2YMXL 3D39E 4NQSB 1JUFB 3ULUH 3QIBB 5AYUH 1YVLA 2BNQD 3LIZL 3D0VB 1BYNA 1BQLH 2VJXA 1BBDH 1GZHC 1KBGL 4WEBH 1RY7B 3KWWA 2ZUTA 2BXZA 2IGTA 3I74A 2XZQL 2XV3A 2EDQA 5GGVY 1WIOA 4W9EC 2ERJB 5LXVA 2UXVA 3T2QA 4G71B 2G3NA 4C4KT 1QP1A 3QUML 3O81A 4LCWD 1FUNA 2N7BA 5HHVH 1KT2B 2YK1H 3FT3A 5AB1A 4JJ5A 4FQHB 1Q9LB 1W6WA 5D9SB 4P06A 5DQDH 1JRHI 1ODUA 2APSA 1KDJA 2Y06H 5TDOB 2HKHL 1XB6A 4QHNB 4M93C 4H1LB 2XFGB 4BH7B 4FXKC 5CGYC 2D03H 3NZSA 5E1IA 3EDEA 4PJXE 3GMNB 3VXTA 2VSKB 1AQHA 1J9TA 5EU5B 2WNWA 2X6VA 3VCLB 2GC7C 3GNMH 1B0IA 4K23H 3SBRA 4DUVA 2B3RA 2HLEB 1B3IA 2J2ZB 3PGFL 4HEPA 4WUUB 3B2PA 2Q7YA 4LOUD 2XWXA 4Q6IA 1Z0MA 2EXWC 2XN2A 3LEVH 4UQ9A 3RTQA 1JHTB 5GZOD 3LRSA 2O5ZL 1DSFL 4MJ5A 1DDTA 1CFNB 1KG0B 1MRCH 3B9KD 1P5VA 2I26N 4GAGL 4OM0L 3WO4C 2OJZH 5LXGH 3HI1A 2X28A 4UF7C 4PYHA 3RY5A 4BWWA 2W07A 2VQ1B 3EYOB 1TU2A 2BP3A 3SD5A 1Z5LB 3VFVB 3H0TA 3OAZK 3G5XB 1JFHA 5LQBH 1MFCL 2YAMA 5C0CA 1QW8A 3ARBD 3ZL2A 3NACH 4ADIA 3F12B 2V9QA 3VXMA 1OHZA 4ZX6A 2JMRA 3LYRA 1MF2H 4YBQC 1E8YA 4K3GA 3DSFH 1CWVA 4LIQH 1NICA 3SDXB 1BVOA 1AOZA 1J10A 1A1OB 1C1EH 1VERA 4G1MA 4PLJD 2WW8A 3GB7A 3QORA 5DSCB 5K9JH 1ZGLP 1A6UH 3KYMA 5G4OA 4MXVE 4L1TA 4X6FB 4KTDL 5E8OA 2F53D 1YQVL 3BEVA 4QOKB 1JK8A 3KPLA 2PPEA 2WTOA 5DO8A 3GKWL 1G9NL 3D3VA 5EOCJ 1PLGH 5DVLA 4HX1B 1FNLA 5KSBE 3T8XA 3ZDYE 2DZEA 4TQ8A 2W92A 1FGVL 3V2AR 1KWKA 4DKAA 1RZPA 4D9QE 2WUBL 4YFLF 4PR5A 1NGQL 1K8IB 3NABH 1E6JH 2O61A 2OMZB 2HG0A 4LSUH 5BQ7B 3SKJL 4D8PA 4FZEH 5DCCA 1D9KD 3IB4A 4FF9A 4KUZH 1MNNA 1TQVA 4CW1B 4OZFA 3U0TA 4PRNA 5GIRA 3TBYA 1NAMB 1DL7H 1YNKL 5C0DB 1MCSA 1A6AB 3NIFE 4GS7C 3FRPG 3W11C 1Z9PA 3VUAA 4YHOH 1BPLB 1NFDB 1SJEB 4NJ9H 4UM8B 3FCSB 5TK4A 5LGYA 5CFAA 5JPMC 1CI5A 2QV4A 3D39D 3PNRB 5KS9B 3QI9D 3QFDA 4EI0A 4HFWA 1GMEA 3K2UL 4LARH 4AM0B 3QIUD 1TQCC 3Q43A 2WCGA 3OD3A 3L3GA 5LGHL 1LQSR 4ZUWB 2CLZB 2Q5BA 1AD9B 2QHRL 4JQIL 43CAA 5INCB 3PWLB 1JDCA 4RA3A 1U95B 2E59A 1L0XA 5AW6B 4M4RB 3C09C 3WS3B 1KYDA 2XQ0A 3QDGE 1RERA 4DZBB 2HMID 4P23D 3BFWA 3CFJA 4HCRA 1IT9H 1PX3A 3MBWA 4P57A 1RD6A 3TVMC 2WHVA 3N0PB 3U9PL 1EEZB 3MLVL 3UTZB 3VX0A 2H3NA 2N3JA 2RHEA 1TT6A 1RUKH 4CA4A 1G4MA 2M83A 2V5TA 3CLEH 3GC3A 4KKAC 4MNGB 1OPGH 4WHDA 4E9VA 4EI5B 4ZX5A 4KROC 2VWEE 3MRFB 2ICWJ 5IKCA 1GIGL 4XN4A 2DLFH 4UQDA 2NY1C 4NO5B 2XFXA 1U3JA 4IRSB 4GW4A 4NNYA 3U6RA 3HG1B 1T0MB 1LO2L 1ONQA 4XWGH 1A1MA 2LTQC 3BGAA 3BVNB 4ZZFA 4JRYD 5DD0H 3QW9A 1EA9C 5HGDB 3HC3H 2BFVH 3AWFA 1KIRA 4LDOB 1J7VR 1OSYA 4PG9A 3VMOA 1HK6A 5BZDA 2BWDA 2QFRA 3UO8B 2BIHA 3LKQB 3GIVA 1ETA1 2VDKL 4JFZL 3WIHL 2AEQL 1XGTA 3QG7H 4UTAA 4BXSV 3V0IA 2UZPA 3RKDC 3PHOA 3I6KA 1MHCA 3WEAA 1CFQB 3P3SA 2AAVA 5FYJL 2BP8B 4CJ1A 2R1WA 4X98A 2BDNL 2WLLB 4M6ML 3DSNA 2ENJA 3ARRA 3W9DB 3IDNB 5I71B 1MCWM 5BJTB 5D7LA 5HVHC 1D7FA 1RZJL 2X2UA 3K2IA 4OQTA 2W9LA 4YVUA 4HK0B 5CZXC 1TETL 2NLJB 2VZVA 2A2QT 2Z6FA 3PIQA 2FLBT 4A2GA 2DQDL 3UAJC 5EF2A 3T04D 3KPRB 1WA2X 5KUMA 2KMWA 1F6LL 5CINH 2D7TL 2J8HA 4KK9C 4YO0A 5I30L 2JH2A 3ET9F 4A68A 1INDL 2C9SA 2Z4QB 2P8LA 1T2JA 4OH2A 1A4KB 4FG0A 4GQRA 2DWDB 1ZPLA 5EPMB 1CGSL 2LVCA 2J3SA 1EO8H 4ZBJA 3NOIA 5C0GA 4Z7NB 4GBXB 2BSRB 1DUZA 1IGMH 2EDRA 3OWRA 2AQ2A 4YUEL 3VGHA 1JP5A 4QJ3B 1S5HA 5IMKB 4J3OH 4GMTH 1ADQA 5BQDA 3BUTA 5DT1H 1CMOA 3OLDA 4XCYB 5EZLA 3JTBA 3CZGA 1R3IH 2WWOA 5ACLA 1J5DA 2WQ8A 3G08A 3RIFK 1A6VL 2HRPL 3S35L 3NEOA 1A7PH 1E4XI 3W9EA 3RVXD 3MNVA 1KJVA 4PB0L 1D5BA 3BZFB 3EYFB 1O9WA 4Y2DC 4XHJD 2G9KA 1QRKA 4ZUSB 3RL1B 1MFEL 3WN5B 1YEGH 1YYLH 2WJ5A 4Q9QH 1OEZW 3TO4A 5E6SB 4JQXA 2GBAA 4EZJA 2V9TA 4MXWH 4NIYE 2J2ZA 4LSRL 4HIHB 3BIKB 4YS4A 1SOKA 1OSEA 4KY2A 5E24E 4D0DB 2IPTH 4CU7A 1AGCA 4FTVE 3RX9A 3QDGD 4X4ZA 2ICWA 5IB3B 3ESVF 5FGCE 5AL0A 1G1KA 5DUPH 1B2WH 3QUYB 3HZMA 5CCHE 5F7UA 3ARZA 2XZCL 3U2JA 1JF6A 1UYWH 4Z7VA 4F57L 1WWCA 4KZDL 4NZTL 2O5NA 1UT2A 1FGNL 5CD5D 4OZIA 3MGOA 3KHQA 4XP1H 3UDWA 1D3CA 1BVNT 2IH3A 3FXIC 5A2JH 4JDZA 2F8VA 4PCTA 1LTXA 5J1SC 1E9PB 4POYA 3D69A 5I26A 2BIOA 3A4DA 4ORZC 4LSVL 3WBDA 2LQRA 1T0NB 1FAIH 1A7BA 4O00A 4X9YA 5KVEH 2EVGA 1AS6A 3O3EA 1KF9B 3OJMB 1JV5A 2E9IA 4X6FA 3WL9B 4YBLB 4EMZA 4PVLA 3IM1A 1JSYA 3CFKB 3S8WA 1CYWA 3FFOA 3R18A 5I6NA 3TLRA 2EUXA 3QHTC 1SQMA 2NW3A 1NGXB 3FMGL 3AS1A 3MACH 1L5GB 5FPIA 4G8FB 5TH2A 3V9FA 1BQHG 5LCVA 2WKGA 1ZE3C 4XBEH 2H8PB 2E9BA 1CFVL 2BWQA 1N0LA 2WXOA 3AM8C 2N56A 3DTXA 4OIIL 1T7ZA 2H45A 4MAZA 1FFNA 5EF0A 2DJMA 1MJUL 4UT7L 1UHVA 1S5IH 5GGRA 3T09A 5J06A 3OLGA 3HS0C 3D9AL 1VGKA 3V4VA 4OJAA 1WWWX 3N1QC 4TUKL 1YN7A 1TDQA 2QDVA 2DYSB 2MCPL 3Q48A 1DQJA 4P4RB 2CBPA 1T83C 4UT6L 1WBXB 3ZKSD 2NNAA 4JMXA 4PCKA 3LB6C 4PWHA 4P9HH 3GJFB 2K6YA 2IH1B 2P49B 3SPHA 1A7RL 2BS9A 2G75B 2JTDA 1KBPA 2ATKB 2ITDB 3ARFA 4M4RA 5DS1A 2J5WA 5A40E 5JUEH 4YZFF 4MCNA 3T77B 2A83A 3RDJA 3V0GA 2H3KA 4F7KA 4LAQL 1IGTA 1GYCA 4P2OB 1XIWB 5D5MA 2YMXH 3DUHA 3SDDA 1S7RA 3LIZH 3V52L 1C7TA 1D6VL 4AE1A 5HI4D 4FAAB 1IAKB 5F70A 2HAZA 4URTB 2AGJL 4FQ2L 1AZZC 1U92A 5EIIA 1A64A 1IIIA 3X14A 4L8BB 4EI5A 1N6QL 1KTJA 4NQXA 4MS6A 1TF4A 3N5AA 4DTGH 3QUMH 2OZ4L 3P2BA 5B3JE 3P4OA 1U36A 5FECB 4PJGB 3TIEA 4PY8I 5FO7B 2DQEL 5AALA 2R1XA 3QH3B 4RMUA 1RH8A 1SJVA 3FW6A 3H3PL 3HAEA 4PP1C 1WSST 1U8PB 3TF4A 4UNVA 1S7SB 3T0EE 1EXGA 4FXKA 3OJDB 5GZND 1AO7E 4PRPD 3FH7A 2JCCA 2K1MA 4FTVD 1NCHA 2V4LA 1W0YT 3QO1A 4O2EA 3AWGA 2DD8H 3RU8H 3WLWD 3JVGC 3D18B 3QNZA 3UMTA 2UXTA 3FSAA 4K7FB 2ZNXA 4TM9A 1I7ZA 2PTVA 3H2PA 4WTZG 3P9MB 2R59A 1EDYA 4ZODA 4AL8C 1VFAB 2NYYD 2W59A 5I5MA 4BM7A 4F2EA 4P2CG 1FNFA 3PGFH 4NM4L 4P2QB 5DJDA 2F7PA 4L3CB 3SPGA 4B50A 3D30A 3T2OA 1NC4D 1HN1A 4YNYA 4WWKD 4Y4HD 3ZDZB 3MBEB 4FULA 1KB5L 3BQUD 2O5ZH 4GAGH 1U8QB 2F74B 3W5NA 4OM0H 2VOTA 3G6DL 4M1GH 3FO9B 3FFCA 1I8IA 2J6WA 2YC1A 5G4NA 4U3SA 1VAHA 4FP8L 3NSYA 3ARYA 1E9OB 2QSTA 1LO3H 1MCRA 2TSAA 3QIWB 4JKMA 4PJAF 1IM3A 3CWGA 4CU8A 2X1QA 1XR9B 1U41A 1XGYL 2DIJA 4U3HA 5HYJB 1TG8A 3TFKC 1LM8V 1MQ8A 2CK2A 3MUZ1 4FNPA 1M2VA 5FOBB 3RWIA 4A2MA 3ZBMA 1RFDL 1PEZA 4X50A 3C5ZC 5I1AB 1Y6NR 4XCNA 2VXQL 1TLKA 3BQVA 4KTDH 2MSPA 5C0BB 1YQVH 4U7SA 3LV3A 4DHLA 4R4NC 1IFRA 3DJRA 1R0AL 2J6EL 3D09A 3GKWH 2VMCA 2NT0A 3INOA 5L2KA 5D55A 2QQLH 5T1KD 3LQAC 4X4KA 2FJHB 4AX3A 2GKIA 1FGVH 2VUOA 5CSBA 1ZGLM 3OKMB 2BW4A 4FLOA 5KBNC 2MHAA 1KTBA 1BZ7B 1NGQH 2WLZA 4QMEA 3MGTB 3S5ZA 4OFYD 5LNGA 1YEWA 2CIIB 2DKSA 5BRZB 1KWGA 5EEUA 3SKJH 5BW7C 3MRJA 4HEMA 4AG4L 3N41F 2GC4C 3HS8A 2PWGA 4M7LT 4WENB 1NLBL 3C60D 4ZTEA 3LKSB 5B3NA 1YNKH 3EJSA 3NG5A 4Z78A 2XZZA 4GP5B 4DP2X 2ROXA 3JTSA 3GT6A 4BWTA 5JPMA 2V2XA 4IBLT 2I5YL 3TZVA 3WDHA 2YD6A 4ONHA 4X9GA 4FFVC 3SBWC 4R26L 4AUYA 5ICYB 2WQUA 1CL7L 1KJ2B 4LDLB 2FO8A 2QGBA 3K2UH 4N8VG 2E7CA 3GMRA 1K4DA 3DVFA 5DO2D 4YSEA 4XX1E 1NUGA 3VVWA 2QHRH 3GPEA 4JQIH 5F2FA 5IG7A 3A6OA 3BWUC 1U33A 4ZO6A 3C8KA 3DROA 1H15B 3BDYL 4AKOA 4XMLH 1WF5A 2EEAA 1IEBB 5IR1A 3W39B 3EOBB 3RX8A 4BSWB 4Z3TA 2H5UA 4GKNB 4TULH 1SEBB 4B41A 2MKLC 2BHUA 4YHZL 5KVGL 4OJCA 5FA3B 4I4WB 4I9WD 1OW0C 3MLVH 3U9PH 4E9TA 4F93B 3VXPA 3WMPA 1L9RA 3VG9C 3MV01 2EJ1A 3OAYK 3MYJA 5AW3B 3RDTC 1TJHL 1E8WA 5AL8A 2BVQB 2D9CA 1JBJA 1GIGH 1AH1A 4OU3A 4G8FA 4Z7WA 5JHMA 3SDCA 1RL1A 4IJ3B 3RX7A 2DQIL 2CIKA 2FZ3A 2B9BA 5TE7L 2FHBA 4OKVB 3O6FC 4TMPA 4LQFL 5JW3L 1CLVA 3P2DA 4HIXH 1HIML 2XBZA 3R06B 3F84A 2FL5B 1A65A 3TBBA 2XKSA 1AJ7L 5HDBB 1AAJA 4Y5VB 2ICEA 4YDJB 4JFZH 2YXVA 4Q9RH 2VDKH 1IC7L 2AEQH 1I1YA 3RWJA 1ZSDA 4MA1B 2NY2D 4FL4B 3BUDA 3LRGA 5AEAA 3DX9B 2K3TA 4KVCL 5FYJH 4Y2OB 2BK8A 5ABDE 1NCOA 5ACZB 2OI9C 3G6JA 1IE4A 3QDME 3UTPE 5JZ7C 4QI3A 3GMOA 3QUZB 3X12B 2BDNH 1MJ8L 5D1ZB 1G87A 2F58L 4M1CD 1A9BB 3JT2A 5MEOA 2L4OA 1RZJH 2WLIB 3BVDB 1YAIA 5E6IB 4K07A 1YO4A 2DQDH 4WCYL 4AITA 1DQDH 3KCPA 4L4VE 5H4ZA 1GGIL 2YD0A 1BQKA 2D7TH 3Q6GL 5DVPA 5I30H 4JZJC 3HUJA 4KRPC 5T3ZE 4QRBA 1INDH 4ZMWA 4HWEL 2FX8L 4ZK8A 2Z64C 5HDWA 2DV6A 5B1AB 1PVHA 4XCEA 5F7AA 4X80L 2XWRA 2ZXEB 4NZFA 1CGSH 4ZXBB 4GKLA 2CKBA 4J6RL 4GXVL 3II2A 3ZKNC 1SVBA 3HR5A 4A7VA 1JNJA 5FECA 5FO7A 3MLXL 2SODB 2VDMH 3MDJA 4OZHB 3TH3T 1PLAA 1U8PA 4QXUL 5HHQA 3KLHD 2PWHA 2XV6B 3MV8B 2VITB 4NC0B 2A5UA 5GRVK 1A6VH 2HRPH 4CILA 3OJDA 5M94B 4FFYA 3LPOA 4YK4B 4PB0H 5EORL 2BNRA 3MJ7A 1JHKH 1MW1A 2MTPA 3D2UA 1I1CA 3BJ91 1BREA 4IU3B 2X1XR 3FONA 5E8PB 4L18A 1NCWL 1AIFA 5JORA 4XNDA 1MFEH 1OT1A 3S36X 2WOBA 1B0RA 5AB9A 3ZDXF 1LE5A 3TO2A 3I6LE 3VWKB 2WBXA 4YOKA 5CBEA 2Q86B 3HMXL 4LSRH 4X5XB 2VUKA 3PFUA 3SDAC 1VACB 4KKNA 3BAKA 3BH9A 4Y2NA 3QG6A 2WZPD 4AL8L 1MHEA 1Q94B 3JV6A 3WFHA 4L1LA 5GSVA 5LAXA 3V0JA 1NL0L 2ZYIA 3IJEB 3ME0B 1FLRL 1KPUB 1AR2A 2YD7A 3B6SA 3EFOA 1V3JA 3BPCB 5D6CB 5E6UB 5KYWB 2DWTA 2Y7NA 4L8DB 1OSZB 1CGTA 2N0KA 4F57H 4HKBA 4KZDH 4NZTH 5IMOB 3ZHNA 4BKSC 1FGNH 1OZUA 1UZGA 3SJVE 3WHE1 3J8F7 5I2IB 3MROB 2D7MA 1ACZA 3K5RA 1SJXA 2Y07L 1MSPA 4HALA 4CKQA 1DZBA 5HD8D 2GTQA 4ZYKB 5F1IB 4NEHB 3CC5A 4WO4B 5D7SL 5LWYL 5A2LH 3NN8B 2NXYC 3KPOA 1XGZA 1KBBA 2JF1A 2E0PA 1FL6A 1X4ZA 2Z8WC 3M1BB 4MQXC 4X83A 2AC0A 4KFZC 1CIUA 4DQAA 1YCSA 1TPXC 2R69L 4I0PD 5KVFE 4JFEB 1IBZA 4F3FA 2I27N 1M71B 2DYPA 1RJZB 3DK0A 4PJ8D 3D25A 4YPJA 4PJFB 4TTDC 2P80D 4QXTB 5CEYB 4QRQA 1CGYA 1D5XB 3FMGH 2J25A 3DRQA 3LZFL 4JREC 1Q9KB 2XN1A 3EYQC 3CU7A 1N10A 5CNHA 3FRPA 3S37X 5A2IH 4F15B 1T7VA 3VE0A 2Z31C 3LQAL 1QWUA 3AM8A 3UTPD 2P4AB 5DMGD 7TAAA 4JAMB 2GHZA 3FUDA 1G6RL 4OIIH 1AZVA 1J12A 1SUJA 1GOFA 1ZHBA 2QR0B 4W70A 5E51A 1ETB1 1MJUH 4O2FA 4Y4FC 2HVBA 4LKXA 4UT7H 1EBPA 4BFIB 4YLQT 4QYOB 5D7JC 3QXUA 1HYRC 4L4VD 5JNYA 2OBGA 4TUKH 3GM8A 2IDSA 2G5BA 3DMMD 4MQTB 5DZ9A 5T3ZD 1QEWB 1NCBL 3CN4A 5F7DB 2MCPH 1HS6A 4V1DA 5CD3B 1T83A 4LLUB 3DDGA 4UT6H 3Q1EA 2BHFA 1TQBB 4X8JA 4ZMAT 1SXZA 4RZCB 2IALA 3LNIA 1A6PA 2B59A 1NGZB 3P73A 1A7RH 2NUTB 4NKDA 5D2NB 5G5DA 4Z77A 2WP3T 5JW5A 1H3GA 4MD0A 3U4EA 1LE9A 4LAQH 4X2UA 1N64H 2D0GA 2ATPB 2GK0B 1GS8A 4BSWA 2BO0A 4H8QA 2CMRL 3GSOA 3RIFF 2AQQA 5JDSB 2JB6B 2E74C 5I76A 3V52H 1D6VH 3QHZL 2DRUA 2WNGA 4QRPE 4YGVB 4PWIA 4FQ2H 4JFPB 4AYDC 4K3DL 4N9GB 4Y89A 2QV2A 1N6QH 1L6XA 3KGTA 1TLMA 3Q7JA 5E4EB 4RGND 2WBJB 3F05A 5FCUL 3B5GA 4LB8A 5IVXA 1WG3A 1A02N 2OZ4H 4RISL 3ES6A 1F6AB 2H32A 3DUSB 3TA3A 2DQEH 2FWOB 1X3DA 4F91B 4QAMB 4LMQE 3H3PH 3VXME 1KB9J 2HFEB 1Y1DA 1DVFB 2HKFL 4CVZB 3ZYOA 3I6LD 2EZ0D 4NFCA 3ROOB 5B8CA 4KQ4H 1W2KT 4OF6A 5GGUB 1EAPB 4AC2A 1UB5B 2LT9A 3P0GB 2YAFA 1C08B 4JFXB 4QJ4B 1E7VA 2P7TB 2GI0A 1TVHB 4ISVA 4JFSA 5F21B 1XB3A 2WC7A 4PRDB 4UOJA 1BWWA 3A67L 4P46B 4G9DB 3VRIA 5JOEA 2UY6B 1MY5A 3NTCH 5J6GB 1G1OA 1G6VK 1PS3A 4NM4H 1JK9A 5MERB 3SJVD 2WAHA 4OM1H 5DVNA 1KB5H 2RGSA 2RIKA 4ZFOB 5FGRA 3VQMA 1GC1L 1VA9A 2VW6A 2NY0D 4PJDA 4R83A 3SD2A 4AYGA 4R7DB 4PPTA 4KKLD 5EUOB 5IQMA 1DLHB 4LASL 35C8H 1RURL 3FB7B 2P8MB 4D0BA 5J7CC 2FJFA 4ZX4A 5T1JA 3FT0A 4F7TA 4MZRA 1WEJL 4TLUA 5I75C 1PY0A 2B1HL 3TBTA 1XGYH 3ZMNA 3IJYB 2TRHA 3I02B 5FFOA 3GMLA 5IB2A 2TAAA 3VSVA 4N2FA 1RHFA 2Y7QB 4FG2A 4U1JA 5CJXA 1DQVA 1LMIA 2GCYB 3PJLA 1HZLA 2DKUA 2O6PA 2OMWA 2W9EL 4LVNB 3NBNA 1KXTA 1YZZA 1CGWA 1SYVB 3ABLB 3GTTA 3GSNL 3WOVA 2WWNA 4PHXA 2V9RA 3WUWG 1YEHL 2L8AA 3SO5A 4G7VH 2PN5A 5L6YL 1IZJA 3C5SA 4MD4A 2N0MA 4BK8A 3US0A 4I1PA 1OAKL 1OAXL 4RMQA 1T1XB 4EVNA 3SYOA 4GLRH 4TOYL 3KEDA 3CH8A 2DYRB 3L3IA 2EYSA 4NKMB 5TE4L 3WENA 4HWZB 3SKNB 4ES9A 5BW7A 2H41A 4ODBD 5B1JC 1UCTA 2ARJA 3L1OL 5EU7E 3WKYA 4HT1H 4AG4H 2H26B 4V2BA 3B9DA 1YNTF 1NLBH 4CN6A 5ILTH 1WIUA 2ZKYA 3AU1A 4QRRE 3SSGA 4WI3A 2I07A 2O6EA 2QPDB 2ZOLB 1S7UB 3V7MA 2PW2A 4LDCA 3RQ3A 3DV6B 1E9QB 1BCIA 4L8SC 2PWEA 3EJYD 1I7UA 4R26H 4AEEA 3TN0C 2IAMB 2ORBL 1CL7H 4GRMB 4XVTL 4ZPVA 2X1PA 2VR5A 1K3IA 1ZVHA 3N04A 3QULA 2VAAB 1WWBX 5EIQA 3D1MC 3IPBA 1KXQE 3P9LA 4FNTA 4QRPD 1UEMA 3WN6A 4MB3A 5HPMB 3ENEA 3CHOA 3O8XD 3PL6C 5E9NA 1RHHB 3MROA 3DOSA 3L7EB 1MFNA 1XV8A 4DEPB 1JGVL 3KM1A 4G9FE 3ABKB 1FSKC 4MCYA 4MNHA 1SOXA 2GAZB 3BDYH 3T9WA 3VD4A 4WO4A 4OBSA 3TX4A 1OOAA 4QIRA 5DZNA 5F0LB 1OW0A 4YHZH 5D7LE 3PREA 4ZOCA 1V7ML 1BQHA 5ISZA 3NA9L 4K8RD 3G9VA 1IAOA 2W95A 4LGSB 5ALCL 1VJSA 3RDTA 3ROLA 2GSGA 2XX0A 1UCBH 2XQYG 3CD4A 3O3BB 3HE6A 3NCMA 1Z5YD 3L3DB 4Z76A 4KJWD 2CDFA 1DN2A 4NUGL 1EAJA 1G7LA 2YLKA 2ZP0T 4MXQC 2EIDA 2X4PA 4MHHI 5CSZA 2ZWZA 2DQIH 2JIXD 1OOWA 3PXJA 3KWXA 4HLZG 3K81A 4W4OC 3O6FA 4GRLA 2O5YL 5TE7H 2XY1A 4JRXA 4XBPB 2YBRA 4ZQTA 5HHNB 2FO1A 4LQFH 1LEGB 3IJHA 5J89A 2Q8AL 1J9CT 3IDMA 3PP4L 3PHSA 4PJEB 4HJTA 2DF3A 1IC7H 1T0OA 1UZ8B 2GT9A 2ZWYA 4PS4L 1ETZB 2HT2D 2WXLA 3AT0A 5K1VA 3RNQA 5LGJA 1ZLVH 5AZUA 5HDRA 4BH8B 1T5KA 2JKLA 4YDLB 5CP7B 1NDMB 4KVCH 5J6HA 5DI8A 1AHMA 1GYAA 1JWSA 2ITCB 1KC5L 5GSRA 5T5FL 1AXSB 2F58H 4OZGF 3D12B 3WU1A 4L3EB 1BZQK 4HUKB 3DKHA 1OIOA 2O26U 1BXAA 3QQ3B 4MYPA 5IROC 2NUTA 4NN5B 2JB5H 5D2NA 3FQYA 5T3XE 3SIKA 4WCYH 4UQ2A 2P3YA 2WXFA 3FRUA 1GGIH 4WUUE 2YPLD 4IRJB 5KYUA 4WHYH 4Z7UF 3V0WL 3ARGD 2Z35B 4DO5A 4UOW1 3SY6A 4HWEH 2PXYA 5J8OA 4PGCA 4I2XB 3WE6B 3QO0B 4APQC 1BVKB 2J43A 4X80H 4PW4A 1EV2E 5HGBB 5F3HB 2WXQA 2NUPB 4QYAA 1MJ7H 2DM7A 1JZ6A 1SUHA 2XETA 4J6RH 2ZJSL 4GXVH 1AYOA 5LDSA 3NEEA 1K9TA 2O30A 4G6FB 4DKFH 4F8NA 1T03H 3VXOB 2XZAL 1F6AA 1YN6B 1ZT1B 1X4XA 3QAZC 2Z92A 5B39G 4Z7VE 5ICXB 1MJJA 3BOVA 5H94B 2HFGL 1QPPA 4F9PA 1SXNA 4X6DA 4PRHA 4ZPTB 3SBQA 2DQHL 4QXUH 2I9LB 2P5WD 4WTZA 3M7FB 3SDXE 1T89A 4Q9BA 4KQ3L 4QRRD 3V6OC 4H88L 4OZ4B 1W0VB 5EORH 1VFOA 4NQEA 4EJ1C 1OP4A 2F61A 2AZAA 1TVHA 3CFEB 5L9DH 3OKNB 1BD2D 2K6WA 3PDOB 2ZF8A 1NCWH 5HGAB 3JWDH 4EIGB 1XHHA 3FN9A 4ES8A 4MX7A 4YR6B 3ZRSA 1NA8A 5C3IA 5BOJA 3D05A 3VGGA 1ZVNA 3HI5L 1R75A 3HMXH 1ZGLB 3GPSA 3O2DL 5MERA 1RJLA 4WKZB 2ADIB 3N6YA 3BKML 4M1DL 2VLRB 1CLZL 3E80A 5DEGA 4AL8H 1QMUA 4G9FD 4MLIA 4LCUB 4WGVB 4Y4KB 1H5BC 5DJZA 4U0RB 3QUMB 4J8RB 1MG3C 1FLRH 1TJGL 5AVYB 1PL3A 4Y1AA 2DWEB 1Y18A 3FBKA 3OC8A 1G9MC 4HK3J 4NZ8A 5E7BA 4U2YA 2R2EA