5F8RC

Blood group antigen binding adhesin baba of helicobacter pylori strain s831 in complex with blood group h lewis b hexasaccharide
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
VQLQESGGGLVQPGGSLRLSCAASGSIFSGNVMGWYRQAPGKLREWVAAITPQGVPNYADSVKGRFTISRDNAKNMLYLQMSSLKPEDTALYYCNRLPNYRSWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Adhesin binding fucosylated histo-blood group antigen,Adhesi
publication title Structural Insights into Polymorphic ABO Glycan Binding by Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 27
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f8rC00
4P9HC 1MCHA 1BFOA 5ACMA 3CLFL 3NIGE 3E3QC 3P4NA 3B3IA 2OTUA 4NO2A 5MEOB 1PBYA 4QTHA 1MCIA 3VWJD 5GGVH 1FNLA 3VMPA 3PUCA 4GMSH 4IJ3C 2APTA 2GJZA 3IFLL 3ULVF 4ODVL 3FOMA 3S3JA 4DGVL 3CH1A 1O5DT 4M1GL 1GH7A 5DFTA 5DRZA 3TZVA 1QLFA 2CUIA 5B3JF 4NN5B 5T1MB 3V6OE 1S7QB 3O3DA 1G7IA 4GQ9L 3KWWB 2C3HA 5CZXC 3JTTB 5HHPA 5CGTA 1YEGH 3ZKQD 5AG9A 1HQ4A 4PJEB 1FG9C 2CGRL 1J0KA 3KPSB 4D3CH 5I16B 2FHCA 4XVUC 3HB3D 4PJ9A 5EU7E 4LKCB 5IKCA 4L4TB 5JIHA 1BJ1J 2CSPA 4JY6B 4N0CC 2AI0H 3KYNB 4OGYL 2Q3ZA 4PJGF 1I9JH 2AXHA 3FT2A 4DAGH 5I1AA 1AD0A 1JGDA 1QRNA 1FL3A 1RZ7L 5D2NE 4I0PA 1GGIH 5EUKA 4E0RB 4UUJA 1K8DA 1MCPL 5FV1L 2YMXL 1HQRA 1EFXA 1EMTL 2I26N 4U1NA 4POUB 1UZ8A 4IRZH 1TETL 1GYAA 4RFNB 4GLRH 2PCPB 1EHLL 1BJ1H 4O2CA 3BUYB 5CSZA 5TQ0L 5ICXB 3UDWA 1YECH 4GAGH 5IT2H 5KSAD 2XIDA 4XP5H 4UBDD 4MAYB 4NHCH 3GSUA 1ACYH 3RWJB 2DS4A 5DA4A 2ADGA 4CW1B 5DVNA 1BD2A 1EAPA 3NOIA 4TSBL 5HYSB 1H15A 1NSNH 1J12A 2O5ZL 3PF2A 1YN6B 3HI6L 1JF1B 1QA9B 3QUXA 5GISH 4OF3A 5JR1L 1QLRB 2HFFB 5HHME 2R2EA 2QR0A 3MBXH 1NC4B 4XTRC 2W65B 2F54E 4JVPA 2ARJQ 4HDIB 4BZ2H 2NLJB 3QEQB 1KN2L 3L3KB 5TDOB 3WLWC 3UBXG 3DTXB 4NNYB 1Y6KR 2X4TB 3MGOB 4KMTH 3GUTA 5IGXH 4ZD3H 3ZKNC 4LLAA 3RFZC 1QSFB 3IXTA 4YHIB 1T66C 4P4RA 1C7SA 1KTLA 3V6FB 3IDIA 1FJ1A 1AFVL 4LLQA 1JNLH 5E94B 3MLZH 1ZEAL 3ULSB 1TMCB 2XPGB 5F7UA 2P8LB 1H8SA 5EB9A 1INDH 1LP9A 5DJ8A 1E28A 3KYKH 4HZLA 1ZHKA 3MRDB 2HVKB 1KYOK 1A1MA 2BRRH 4CBPA 5TF0A 1P4IH 1HE7A 1XAUA 2J5LC 3MRLB 5HHVH 1Y0LA 1A47A 3QULA 1XCTB 4R8WL 1TZHB 1KLGA 1QLEL 1KN4H 1UJ3C 4WIQA 3DBXA 5EU6E 5I8KH 1CFTB 5I73B 1IM3B 4JZOA 3S34L 1FVEB 3PQYB 4HUXA 4TRPH 5FGCB 3SCMB 1CGSL 2JJTA 3T0EE 3BDYL 5F1NA 3QR2A 4Y8AA 4EN3A 1U8KA 1NEUA 5D1QD 1D6VL 3RVWC 1A64A 3CX5J 2XRAH 4JFPB 4Y1AA 5B22A 1AO7E 4UAOC 3ZYZA 4NOFA 5I17B 3RNQA 2H1PL 3F5WB 3LPGA 4YUEL 4BK5A 4NNPH 4KU1A 1QKZH 4H0HB 4JGUA 3ME0A 5F1KC 3U30C 3IKCA 1Z0MA 2CXGA 3PL6A 1NKRA 3MODL 1AJ7H 4LRIC 3T0AA 2XN9A 4NQCE 1GL4B 3BEVA 1DQLH 3FTGA 4PRHB 4JRXB 2AJ3A 4OQTH 4HLZG 1FG2A 1J1XL 1MCWM 3AB0C 1F6LL 1FNEA 4MQ7B 4ENEC 3VCLB 5JDJA 2GQHA 1I7UB 4XMKL 4RGNC 4OZHB 5EUOE 3FQTB 4HLZH 3I6KA 4CJ0A 4KROC 4FQLH 5JW5A 4JO3L 3P4MB 1C16B 2YD8A 1HEZB 4ONHA 5DMIH 4M6MH 4P57A 1LDSA 2NXZD 3T1FB 1EZVX 1BEYH 4H88H 3RNKA 4ODVH 5TF1H 2W0FA 4DGVH 1KPVA 5FHBH 2YKLH 5F96H 1JTPA 4HBCL 5LWYL 3MC0A 3VXMD 2OSLA 3QNXA 5LGJA 3QB7C 4QOKB 1QFHA 2EO1A 2CGRH 4S2SA 5ADOH 5JHDE 3U9UA 3AS1A 5ISZB 3BP7A 3BH9B 1QSEE 1WISA 5EZJA 5BRZA 2W9DH 3LS4L 1IT9L 4OGYH 3WV0A 4LNRB 4EOWL 1BVLA 4JAMB 1UACH 3MJ9L 4Y5XB 4KJQC 3LY6A 3L7EB 2DQTL 5IJVA 3IJYA 5C0FA 3DROB 3TIDB 1MCPH 4HPOL 2Z91B 3CU1A 5IIEA 3G5YA 4N8CH 4OZGA 3GBML 3IU3B 1LE5A 1GGBH 3H42H 1A14L 2YRPA 4J3XA 4NN6C 4NPYB 4MSWA 5ACZB 1J8HA 4M7LT 1I8IB 5TQ0H 4IRJA 1AE6L 4PJXF 2ICCA 3HNTH 1INEH 3QWOA 1QG3A 4P48A 5FKAA 2YOCA 4JZJA 3SGJC 5HVGB 4MHHG 2ATKA 5JXEA 5ETUA 3DJ9A 2V2WB 1F6AA 1EGJL 4HQQH 4TSBH 1T7YA 3SDCA 3W9DB 1SEBA 3W5NA 4BQ9A 2X4PA 4N1HB 1S5IL 2OK0H 4YFDB 3VG0H 5JR1H 1EHNA 4H25A 4ZSOA 3PIQB 3TYFA 2BVTA 4D9QE 2FLBT 3FHAA 5HDBF 4DJMA 3IVKA 5CGYC 4N0UB 4X7SH 5HGHA 2YXMA 4JRYE 1Q38A 5IFAH 4U1IA 4NO0D 1MCRA 1FDLH 3P77B 3SE4C 4P3CH 4YDIL 3CSYA 2F74B 2JB6A 4LASL 1G7LA 3VRJA 3DRQA 3U1SL 1AXTL 4D0CA 3HN3A 4RFEA 5IMMA 1A7PL 4KHTH 4XXCC 3M8OH 3RX7A 4POZC 3WFDL 4ODWB 4PGBB 2CDFA 3IU4L 5DRWB 2CMRL 1M7IA 4H8WC 1T0NA 4PBVC 1UXWB 4PJDA 4D9RD 3L6FA 3ZMRA 1CLYL 1UWEL 4OF0A 3TIEB 3VXSD 2VZSA 5CJQH 4PUBL 2HT3C 4OI8A 5KS9A 3FB8A 2ZKHH 4MJID 2JELL 4TUJA 2NY0D 3CMOL 3KS0J 3LN4B 3Q3GA 2O5XH 4S11A 5K9QG 4KKCC 4LF3A 4I13B 4AMKL 3UBXA 3QIBC 5EWIL 4R8WH 3ROLA 1U58B 4WJ5B 1ONQA 4WW2F 1I3GL 4Z0BH 4Z5RA 1VFAB 4MDIB 4OFDA 1QLEH 4UQ2A 1GIGH 1AR2A 4U1MA 4WFGE 3EYFB 1U6AL 3STLB 3MV7A 1S7TA 2NCMA 2NY5H 3IF1A 4QHMA 2IF7A 2J2ZA 4JDVB 3KS0H 3D9AH 4UNUA 1YN7B 3BDYH 4KJWC 5HHXL 3V6OA 1FL5A 3O6FB 4OZFH 3AVEA 3SGDI 4HH9A 4KRNA 3IDGA 3GJFK 5EULV 1FNFA 1MRDL 2R8SH 3OAUH 1NJ9A 4F58L 3SQBA 2BNRA 4ZFGL 1BFVH 4J4PD 3DGGA 4JN1H 3LKRB 1H0DA 5J89A 4P2OD 1UFUA 1IC4L 2H8PB 4LPCA 3MODH 2DQEH 4XB8A 2P5WD 3C60B 4NT6A 5JOFA 5JLZA 2PO6A 2WUBL 4ORZC 3WLBB 4HJ0D 5J1AA 4IM8A 3KPTA 1QSVA 2VYRE 1VCAA 2VABA 1XZ0B 4Y89A 1CQYA 1CD9B 2NY4C 4OIBA 4JFHE 3KPNA 2W0PA 1JV5A 4KC3B 4U1GC 4UT6L 5AYUH 5FA3B 1NMBL 1UB5A 3QFDB 3HE6B 5CEXA 3SHSA 5J9PA 3VWKD 4WGVB 2AEPH 1CXLA 4KTDH 3SQOL 2G75A 3NZ8B 1EVUA 1RZJH 1MCSA 4K3JH 5ENWB 1SMAA 3B6SB 5HHQB 3G6JA 2AABL 3QT2A 5DJZA 2L7UA 5IESH 4RFNC 3QDGD 3SDDB 1BZ7B 5E9DD 3UP1A 4NO5A 1AGEB 2UWEF 5D7KD 3WDJA 3LDBB 4MAYC 2OJZL 2F54A 3DARA 4QRTA 1LHZA 2VZ1A 3GMOA 2BSSB 3V52L 3TO2B 2HMIC 2IEPA 5D2LA 3OKLA 3F7QA 1CGVA 4C83A 4LGPB 4YXHL 3TWCL 3ZDXE 1GZQA 3RJQB 1BMGA 3LS4H 1GGTA 1FVCA 3HZKA 4I3SH 4NFBA 5B4MC 2FBOJ 4PJHF 5J06A 1AGBB 4BYHA 5IHUH 3OQ3B 4GKNA 2DQTH 1FZOA 2R1XA 5E2WH 3HRZA 5EBGA 2UZIL 2EIZB 4FABL 4XMLH 4ZOCA 5KG9B 5DHYA 4MJ4A 4JREB 3ULUD 1RJLB 2PXYB 3GM0A 1U8HB 5MENE 1OAZH 1KIQB 3ET9F 1ZHLB 4E5XB 5M95B 1AE6H 5J12C 3H3BC 3UTSA 3HZMB 4NQTA 3KXFB 1MAKA 3OB8A 2DYPA 1PGRB 2AJYH 4WI2A 3L3GA 5ICZA 1YNLH 2H9GB 4HKXA 4I2XA 3H2WA 5INDA 3QXAB 3QHZL 1YPZA 1KTDB 1A6TB 1U8JA 2HJKA 3RHWF 1IM9D 1NAKH 4MA8H 5DSCB 2ZG3A 4F7MB 5JPMA 4BKLA 4F9PA 3QXTA 4R3SB 4ALAH 4IMLA 1UCBH 1N0XL 1I8MA 3DIFB 3OKKA 4N1CA 4WW1A 5JUEL 3V7AE 3TNNB 3QXDA 3IDXL 3V9FA 4M1CC 3SCMC 3LS5L 1CFNB 2UYLB 2NNAB 1NLBL 8FABA 4X98B 3IU4H 4JO4H 3VGGA 1T1YB 1E27A 5T3ZL 2DI7A 4NQCA 2YRLA 3D85A 4M6AA 4YHYB 3SEPA 3SE8L 4WI6A 4Y4HB 4TSCL 4CL7A 3BHBA 4HIXL 4OZIA 3Q1SH 1E4WL 4RMSA 3LRGA 3P9MA 2CRYA 1OAUL 5E8EB 1RI8A 3CMOH 2ESVD 2MTPA 4IRSD 4HKBA 4JRWA 5J4MA 1SY6L 1I3GH 3P2TA 2AJUL 5C08B 1MIEL 4GQPH 1I7RA 5C0GB 3BZDA 3H9YA 2PF6A 3A67L 3RWDA 1IC5H 3IS1X 1EFQA 4MA3A 4DVRL 4U6HB 5T1LA 5I71B 4MJ5B 2NXYC 1EX0A 2GTWA 3L3JA 3OKDB 4TVPD 3SDXE 2WNGA 3MLWL 2WZPD 2L4OA 3W82A 4KI5C 4BSVA 5CILH 1P7KA 1I1FB 3NAAL 4K3EL 1XGYL 4HGWB 3LHPL 4LLMB 1CDYA 2Y4SA 2CDEB 3OR7A 1DVFD 4R4NC 5KSBF 2IH1B 4WWKC 3P9WB 2NY7L 3BAEL 4FQXA 3V4VL 4S1RL 5DHVA 4YC2B 5ITFA 3KGRA 3RU8H 5DQJA 3SKOB 2BDNL 3ARBA 4ZAKD 3LN5A 4HMCA 3MZGB 3VGDA 3WFCH 5IWLA 3UPAA 1M7DB 4CMMB 3OAYH 5GGVY 1N8ZA 1A6VH 4UT7L 4R97C 2X4OA 3U46A 2DRUA 1DBMH 1A22B 4YR6A 3LKNB 1HCFX 1A21A 4GRWB 1ZLWH 2EYRB 1A3RL 2W91A 3L3OB 3TBVB 2AKRA 1C12B 2JTDA 2AS5M 4NQDE 2D7PA 2RIKA 4RX4A 2IMNA 4QHUB 3JV5A 4I3RL 3PGDA 2IQ9H 2XACC 3SQOH 5J3HD 3H7BA 1IZJA 4KKBC 3WKML 3BZ4B 3HB3C 5L2KB 1Z9LA 3QUKA 3MLXH 1KJ2L 4F57L 2QKIB 3D18A 1P4LA 5HI5D 3V2AR 3K4DA 2BOBB 3PWVA 5GGRB 4U4BA 4KXZH 3V52H 3ILPA 1U3YA 2YN5A 2X70A 1WCBB 4U1JB 4U6TA 1WFOA 1OF2B 4WEMB 1PG7W 5FGBA 3WKNA 1K85A 5C07B 1E6JH 5BQ7B 3WEXA 1VFUA 4UTAL 3B9KB 4G3YL 3VG9C 1KIRB 5F7FA 5LGHH 3BGMA 2NZIA 3NCMA 1M6OB 3DX7A 2UZIH 5KSAC 4PJ8A 4Z76B 4I48B 1XGTA 1QR1B 1EEZB 2IAMA 2APVA 1D5ZB 5CZVL 2A38A 4J12A 3OJDB 3H9SD 4F15C 2Z8SA 1HI6A 3ECBB 4L8CA 1VACB 4CADA 2EIDA 2VKXA 4EJ1C 1A9EB 1QO3B 3FAXA 5DJ2B 5DJ0A 5IW1B 3MJ9A 4FMKA 5T3XE 4Z7WB 2VL5B 4PRBB 2WWKT 1FSKC 2DLFL 3INUH 4FTVB 2ICWB 1IAIL 4JFFA 4E41E 6FABL 3EFFA 4CU7A 1NUNB 4LPUA 4RRPG 3TO4B 1G0YR 1IEAB 1I8KB 4K94H 4OF5A 2LQRA 5ILTH 3KPRE 4OT1L 5CIPA 2HTLD 3MGTB 4Y4KA 3UXFA 4W6WB 2A77L 3BRFA 4Z7VE 3RAJH 5JW4N 1M71B 1P7QA 3JUZA 1BECA 2ADFH 3ES6A 3MR9A 1S9VA 4HMEA 4PJ5A 5BZDB 3CGTA 1EGJA 1PDKA 3ARTA 5F9JB 1L9MA 3B4NA 3DUUB 1QYGL 4IDLA 4TUKL 1QPPA 1BAFL 1BREA 1U8QB 3IDXH 3KPQB 2MSPA 5E24E 3CFJA 3LS5H 2JCCA 3GB7A 4IEFB 2DLEA 3VFPB 3C08L 2FJGB 4K3DL 4ZNEE 3BRDA 3BISA 3SKNA 1B0GA 4M48L 1CGWA 1MF2H 4KZEH 4UILH 5FYKD 3GSVB 2PR4H 2IPUK 3BP5B 3I3BA 5GGQL 1CGYA 1FYTE 2VH5L 2AXGB 3FO2B 1LE9A 4HC1H 3NIFE 4CGTA 2VQ1A 4DVBA 3C60C 1JRHH 4MAUL 2AJUH 3MCLH 3VFUA 5D1QC 4YWGH 1FNAA 3A67H 1U2CA 5AG8A 3VFVB 3MX0A 4FFVD 2LAGB 1EERB 2CJUH 3GSRA 5F1IB 2X89D 2E9IA 3UJIL 4X4ZA 3HR5A 5FB8A 3BRGC 4YBLC 3QUMH 2X4UA 4JG0H 3MRFA 2Z31A 1XGYH 3LHPH 3HE6C 1LEGB 3HC4H 5L88L 1AQDB 3F62A 1CCZA 4PJGA 4S1RH 4LCYA 1RIUH 4ZMAT 2F53D 1DUYB 4UU9A 5L8LB 5JIPA 3SDDC 4GH7B 4NN7C 1LWRA 4LCWA 1GOFA 4KZDH 1S9WA 5T3XH 1FCCA 2NW2A 3E3QE 3LDBC 4UT7H 3VXRA 5BOPA 1JZ6A 5ITBL 4J3TA 5GJTL 4Z18A 3EOTH 2IANB 1K6QH 3ZE2F 2B4CC 1JBJA 2PYEB 1RUAL 1A3RH 1IQDB 4ZUUB 4KJPD 3T2PA 5DWUH 2OM5A 3L3IB 3OGCB 2AK4E 3G6AB 4I3RH 3A6BH 1DBKH 3JV6A 4Z9KB 2NY6B 3ARFA 5CEYB 1DQQB 2ZUXA 4YHLH 5E8OA 1G1CA 2ED8A 4DUWA 3HI1A 5FF6A 4HIIA 4F57H 2B8OT 2GJJA 1WT5A 3F7YB 4LHUB 1UWGL 1K8IA 4FFYL 4AYFA 3UCRA 3OR6B 4M00A 1SHMA 2QL1A 3JWOH 4J3WA 2DBJA 5C70A 2VXUH 3WSQH 1UH3A 1HHKA 1U8PB 3HAEG 5LJYH 3CFKB 4PTUB 4NYLB 4P2RB 3VXQB 2WSKA 1YMME 4WWID 2BVQB 1CYGA 1H5BC 1WC7A 3G5VB 4DOHE 2B2XH 4OF8A 3LMJL 3WL9B 4HT1L 3ARDA 4R7NA 4D0DB 3SKJL 2P4AB 4NQSB 2ZCKH 5CD5D 2ZSWB 4Q6IA 1D7FA 2YPLA 1ETZA 3DX9B 4TTGA 5J6GB 4LLYA 1NPUA 5DJXA 5IB5A 5DGQA 3OKEA 4YHYC 4ZTPH 3JVGC 1ES0B 3HFMH 4IOFD 1KSRA 3C09C 4OT1H 3WHE0 4D0BA 5D9SB 4NKOB 1ZSDB 3MXWL 5BVJB 4V2CB 4P9HH 3PGFH 5J13B 4Z6AT 3L95B 2IPKB 5IBTH 3PWPB 4QRPD 4WO4C 2FJHA 3DSFL 4KMLB 5EIVA 5TE7L 1VGKA 3TCXA 4JKLA 3WMSA 1V7MH 2ICES 3HC0B 2CLRB 3T2OA 3VXNA 4MNGE 5I71C 2PW2B 2VDNL 1N4XL 4LCIH 3RWGB 4BUHA 3UMTA 3OJVC 3V4PH 1CGTA 4GG6E 4K3DH 3HC3H 3W0WA 2OR8A 3ALWA 4GW5B 4KK8D 3D39D 4XWOD 4RRPA 1QP1A 1BLNB 4AL8L 1JGUL 4J2XA 3CFEA 1G6RL 3MV8D 2ZCLH 2BY1A 1CD1A 3BN9D 3VFWB 2VH5H 4YC2C 5F8RC 4O51A 3RI5K 1BOGA 2ERJC 1RD6A 2MQCA 4YNYB 2P49B 1A4JB 3L5WB 3CH8A 4YK4C 4G8FA 4PY7A 1S7UA 5FDYA 3Q6FB 3EYQD 1A9BA 1JPSH 1NCBL 3QO1A 4QHLA 4MJ6B 1NFDE 2Y7QB 5LKNA 1IVLA 3S9DB 2NZ9C 1OAYL 2YD7A 1RZ8A 4GS7B 4XBGA 2NR6D 4RQQA 4J4PC 3SY0B 2B1HL 2EDDA 4OM0H 4UZGA 4P2OC 5CBEB 1MI5D 2BP3A 1D6EB 4X99A 4JR9L 3V5DB 2C1OB 4BH7A 4L9DA 1SY6A 1MRFL 1GOGA 2VZOA 4L1HA 3PGCA 2R0KH 3TA3D 2YK1L 3FB5A 1DLHB 4PRAA 4X6BA 4HXAL 2HLAA 5C0RL 5HYJA 1T20A 2VLJE 4BK4A 5KVDL 4ODSH 2E9WA 1MHEB 4DCQB 1I1CA 5AYQA 1OM3H 4XCYA 5DRNA 3OXSA 4RGNE 5C7XL 5ID0A 3QWQB 4PJXA 4PLNC 5BS0B 4WENB 1A7OL 1A6AA 4I5BB 1YY8A 3QRGL 3HPJB 3BW9A 1R6VA 3TZVD 4NQEE 1RHFA 4LP5A 1I85C 5KZCB 3DXAD 2NTFB 1IL1B 1NFIA 4Y2OA 3ESVF 4G9FD 2M26A 2AW2A 4AM0B 1F8TH 1UKSA 4M61B 3QYCA 1D3CA 4P2YA 1FORL 2E3VA 4Z95L 1W0VB 3U4EB 2XA3A 4JN2A 5DK2A 2ICWI 3BH8A 4DGYH 4NRXA 5CP7B 3QEHB 1ORQB 3KPRA 5C0AD 1U8OB 3TT3L 4KUZL 3PJSA 4Q74A 5ICYA 3BQUB 3MV9B 3O6KL 4G6FD 1BP3B 1U8LA 2ADIA 2D7MA 1BBDL 3AS0A 2HJFB 3CDCA 1G9ML 1TJIH 4WHYH 1J0YA 5HDOA 5E08H 1NCCL 3VGEA 5GS2H 3ULUC 5JO5B 1INQA 5DQDL 5IR1B 2OL3L 5EIQA 3HZYB 3SGKC 2E6PA 3HE7D 5FYJL 1KJ2A 4PJAB 4RZCB 1W72B 2YBRB 3TLRA 1YEEL 2NX5A 5C09E 4TOYL 1GRWA 2DQGL 4I0KA 1LO4L 3MO1A 4N0YL 1RUKH 3FN0L 1A0QL 4U0RC 4M8VA 3BYTA 3GHBH 3HCVA 1EVTC 2O93L 2D31B 4AG4H 2VLKB 3UPRB 4UV4L 2J8UB 1BVKB 4K7PX 4B53A 3HAEA 4R2GD 3PDDA 1PAMA 3C2SA 3U4BH 1TZIA 1KJ3L 3MXWH 2YR3A 3NZHH 4JDTH 1ZVSA 3C6SB 3CVHH 2I60H 5EZIL 3X13A 5DMYA 4N0RA 5GGUA 4KQ4L 3PDOB 2JK5A 4QXTA 3GI8H 3PV6A 3CUPA 4RA3A 4K2UL 3D3VD 1KG0A 1CE1L 1LO5B 3DI3B 3QCVH 5J6HB 4H0GA 2P5EB 5E4EC 5ADPL 4MWFB 3I50L 1N4XH 1Q1JH 1ITCA 1PSKL 2M2DA 3MXVH 2QADB 4JHWH 3O9WA 4X6CE 1VEPA 2E6QA 4NHUB 4M1DL 4V1DD 4NM4L 4XB7A 1KNOA 3MOBL 4AL8H 1CLZL 3C2AL 1CXKA 5F72S 3RIAK 3QIWD 3RIFK 2IALA 3RDTA 3V8OA 4OUOA 1A7NL 2RJMA 2WAHA 3VH8B 5JW4R 3TH3T 5CMAA 5DK0A 2WWMD 2UVFA 1C08B 4P3WA 5MEPB 3WXVL 1CL7H 2HYMA 1YNTB 3B8SA 4NQVA 3KPMB 3VGHA 2F19L 2QTEA 2X4RB 4Y19A 1IC7L 2AK4A 3T3PE 3N9GL 1IKNA 2UWEA 3PWNA 2V2XB 2B1HH 3S4SG 4FXGB 2F5AH 2PTUA 1U0QA 3P0YH 4Q6YA 3WUWB 4ZAKC 4P46D 5I1EL 1NGYB 2CDGB 3K46A 3S7GA 4LSSH 4P2QB 1MRFH 3HG1D 4PJHA 3GJEA 1L7IL 1CGXA 4Q58C 2NY6C 3FB7A 3WBDA 5C0RH 4XMPH 3D69B 1OLZA 2ZPKH 4TYUA 4HUMB 5KVDH 4ACPA 2EXWD 4F2MA 4W4NA 4CRPA 1IGMH 2OTWA 4LQ1A 4PJEE 3KPSE 1DR9A 5IEHA 1IGYB 5FK9B 4L4TE 2MJWA 3EJZD 3FFDB 2PETA 2XQBH 3EO1A 3QRGH 1HIML 2LU3A 3WIHA 2X4SA 5I19H 4L3ED 4ZUSB 2V17H 4HWEL 4DZBA 4Z77A 3P4NB 1DBJH 1ADQL 2OTUB 2YD2A 2DDQH 3B3IB 3VE0A 1PY4A 4QTHB 4FQIH 2X40A 3OPZL 2FEEI 4KUCD 4RIRB 4F7EB 4Z95H 4X4MA 3ZL4L 4K9EL 3QPXH 1OCWH 5AEAA 2I25N 3FOMB 5HPOA 3CH1B 1KENH 4OCSL 2C3WA 1YEKH 1FH5L 5D7LA 5DRZB 3ARED 2FX9H 4KUZH 1QLFB 5F7DA 1MJ8H 4YXKL 3O3DB 1G7IB 4AEIL 5HI4D 2OCFD 4JFDD 5CCKH 3O6KH 1REIA 4WTWA 2Z8VC 3B9AA 4K55A 5HHPB 1FC1A 1N0LA 4LLWB 5AD0A 1R3KA 3WFHA 1HQ4B 3QCUH 4TULL 3ZKSD 1A6PA 3P4LA 5DQDH 2Q8AH 3QEQE 4PJ9B 2A6KB 5IKCB 3BSZL 2GJ6D 4XP4H 4LIQL 1QOKA 4XXDA 2HT4D 3FT2B 2VXSH 4A6YA 1AD0B 3NIDF 1QSFE 4TOYH 1JGDB 5I1AB 1QRNB 2DQGH 3S35H 5TE4H 1LO4H 4UUJB 1A0QH 5DFVC 1HQRB 1EFXB 4U1NB 3MCKA 4JPWL 5EH1A 1XR8A 2HTLC 5CSZB 4ZFFA 2HKHL 4UV4H 3GSUB 4HKZA 3W2DH 1KXTB 2Q76A 5D8JL 2ADGB 3M1BA 1JMXA 3T0XA 1BD2B 1MRCH 1X5GA 3G5XA 1EAPB 3PHSA 1H15B 1MLCA 3QUXB 1JPTH 4LSVH 5CP3H 2R2EB 5KSBA 5HI3D 1OVZA 4DKFL 4KK5D 4DZ8B 5K33A 3O4LD 5ABDE 1IKFL 3PQYE 5FGCE 3VI3E 5D7JD 1FPTH 1EBPA 3LKSB 1SQ2N 1MFEL 1VESA 1YC8A 3TYGL 3UPCA 3GUTB 1X5XA 3GEWB 3LZFH 2VXVL 1MSPA 1SYSA 5L7XL 5I76A 3IXTB 5CEZE 4XPGH 3R0NA 4P4RB 2XWBB 4Q97A 4GG8A 1KTLB 4OCMC 4PG2C 1I7TA 2R4SH 3BOVA 4U3HA 4M1DH 4WUKL 3V0VB 4NM4H 2BMKA 1FJ1B 2MMXA 1V3KA 2BJMH 3QG7L 1UZ6E 3C2AH 1VFBA 4Q9RL 2KKQA 5DJ8B 2XWJA 1E28B 1IAOB 4HZLB 1ZHKB 3IDNA 4HS3A 4PRHE 5IVNA 3SO5A 3VDAA 5FOBB 4JRXE 2E27L 2GW5A 3QQ4A 3T8XB 4TPRH 3E6FA 5DEZA 1Y0LB 5C0BE 3D0VB 5JXAL 3IGAB 3QULB 2F19H 4OKDA 1UXSB 4OZHE 3EDJA 1KLGB 1G6RA 3DBXB 5CD3A 4KI5E 1Y6MR 5FUCC 1RQ5A 4HUXB 3EJJX 5F7EL 1KPRA 4FMFA 5GRXG 2VITA 5F1NB 1J10A 4EN3B 1U8KB 2P8PA 2QBWA 3QIUC 4HPYL 3ARGD 4Y1AB 5C0CE 5D1ZA 2EDKA 3RL2A 5DUMH 3L5JA 3RWEA 3MRBA 3RNQB 4X8XA 4Y5YA 1MCDA 4PGCA 5DJDA 1IAKA 4QOKE 4KJPC 3PL6B 1UT9A 2EH8H 2XN9B 1C5CL 5ISZE 3FTGB 3KR3L 2FL5A 1CN4A 4R0LA 3GKZA 3PWJA 2BK8A 3EDKA 4FP8L 5I9QC 2AJ3B 3RGVD 2V5TA 2IBZX 1FG2B 5DLML 1I3VA 3S4SA 4OBRA 1F4HA 3CZFA 3MJ7A 1FNEB 1Z2KA 2FNBA 3LPFA 1UEMA 2VDOL 5F3BB 4KHXH 2K1MA 2MWCA 1EO5A 5HHMD 3I6KB 4Y2DD 5JW5B 1MCOL 2DQUL 2H41A 2FX8L 1A7BA 4ONHB 3S88L 4P57B 3ZL4H 3TCLA 1S5HA 4OCRL 1X7QA 1FRGL 4UOW0 2W0FB 4MVBD 1U3HA 4OCSH 3ZHKA 1IEBB 1FH5H 5CEZH 5FM5M 3VFRB 4G42A 2KZ1B 3GMNA 3A6CH 3BKML 1MCWW 2FLRT 2Y06L 4RGOH 2OI9B 3BFOA 5DZOA 2CK0H 4BQ6A 5LGJB 2EIBA 2OMNA 5KBNC 3QCTL 4N0UE 4S2SB 2B7DT 5C0EA 2CLZA 35C8L 4GXVL 3U9UB 3U7YL 3BP7B 3O6LL 3NBNA 4P4KA 5EZJB 5BRZB 1FNSL 5FFLA 5CD5C 1N7MH 2B5IC 1CLOL 1BVLB 4X6CA 5I0ZA 4AEEA 5IJVB 3IJYB 5C0FB 1F4XL 4LVNB 4ISVA 3U7WL 3P9LA 1I75A 3EHBD 3MLYL 5IIEB 3G5YB 4OTXL 1LE5B 5EU6D 1QVOA 3O3AA 5C3TA 1X5AA 1TVHA 4IOFC 5T1KA 4S1QL 4EDWH 1VEOA 4MSWB 4PV9A 2OL3A 1TJHH 1UM6H 3T0ED 4JZJB 1G84A 1YJDC 1RFDH 2ATKB 4XPHH 5ETUB 1F6AB 3SDCB 1AO7D 4LAQL 1NLDL 1SEBB 2WW8A 3FL7A 2WINA 4GRLD 4NFDA 4RBPK 1J1OH 4H25B 4OCWL 4D2NA 4ZSOB 4OI9A 1MCKA 2IH3A 2VL4A 4QY8B 5IW3A 3IVKB 4L29A 3HUJF 5HGHB 2G9HA 1T1XA 4LU5H 4KJYA 5GJSH 1FIGH 4U1IB 4ZXBC 2J88H 4KK8C 1I4FB 5HY9A 4XWOC 3CSYB 3L9RA 5D96B 1OARH 3KWWA 1G7LB 2KH2B 4HEPG 3FRUA 3JXAA 3V0WL 3DRQB 3VRJB 3B2UD 1HZHL 4D0CB 1GGYA 4RFEB 3JTTA 5IMLA 5IMMB 2VUOA 4N0FA 5CP3A 4XRCA 1B88A 3GBNL 4PJEA 1QFWL 2CDFB 3ZDYF 4HUWA 1U92B 5DZLA 4CN4A 1XIWD 1M7IB 3ZKXB 1T0NB 4PJDB 3EYQC 3L6FB 4PY8I 3PP4L 2R0WH 4PJCF 1JYNA 4Y4FD 3KJ6H 1RUPL 5KS9B 3FB8B 1SMOA 4R6UA 2JIXD 3WNOA 4TUJB 3MRJA 4JHZA 1JWSA 4P49A 3Q3GB 3ARQA 3UBXB 5FXCH 3LEXB 1ONQB 4Z5RB 2OBGA 3T0DA 3UTOA 1J7VR 4NSKB 4U1MB 2X1QA 3PXJA 3THMH 4KGJA 5JHDD 3MV7B 1CZ8H 1DEEA 1S7TB 5EORL 4JFOA 5D5MF 4QHMB 1QSED 3RY4A 2VXTH 3S6CA 2NYYD 2QQLL 1RSFA 3SDYL 4HH9B 5GGSY 3IDGB 4IIQA 2D2OA 1QA9A 4U1HA 1VKXA 1FNGA 1YMHA 1A6WL 5EBLA 1QLRA 2BNRB 1F58L 3CCHB 3DGGB 3NCJH 1NDMB 2VXQL 5GRUH 1H0DB 4P9ML 1S8DA 1VFMA 2R23A 5TDOA 3TZVC 3QUYD 4YFLF 4Q9QH 4NNYA 4UQ3A 2EC8A 4WUUB 2Z92B 5ESAA 2QSCH 5JOFB 4C56A 2BVOA 5IFHL 1IBGL 5E8PA 5JLZB 2PO6B 1QSFA 1HOCA 4XC1L 4ZYKB 5DLMH 4JY5H 1A6UL 5J1AB 1UKQA 2VABB 4PJ9C 4S1DD 3KPNB 2VJXA 1OB1A 4D9QD 1MJUH 2FX8H 1OTUD 3VXSB 1EHAA 3MUHL 3CFDA 3MRDA 4JRYD 2DQCH 5CS7A 5D1XD 5J9PB 4OCRH 1DANT 5E99L 3RZWA 5AWNH 3S37L 4I0PC 1PZ5B 1EIBA 2VDKH 3VW3L 3KXFE 1F6FB 1CBVL 1RIVL 4L8SB 4WHCA 2ZSVA 4YDJB 4OJFL 1P6FA 1CI5A 1LK2A 2NY3B 2VB5A 1ADQA 4JKPL 3BKMH 3GMPA 3HE7C 1XF2A 3OB0H 4I77L 3RTQD 4MA1B 1CFTA 4QRTB 3GMOB 1FVEA 1HINL 4U6YA 3QCTH 5D2LB 3OKLB 3O2DH 3U7YH 2VDQL 3DURA 3O6LH 5GQBA 3LEVL 1GZQB 3RPKA 1FCGA 4HWZB 3QUXC 1FVCB 4YQXH 1XH3B 2D9QB 2VC2H 4WEBH 5T1DL 3KLHD 4YXLL 3QAZB 1KB9K 2R1XB 5I17A 3HRZB 3F5WA 4ONGH 1G7QA 4YAQA 1F4XH 3U7WH 1ZV5A 5DVKA 3RY5A 3MLYH 1PG7H 2AJXL 4LDLB 3TVMA 3RZCA 2P5WB 4FG6D 4WFGD 4G7YH 2YPKA 4AH2A 2AQ1A 5HD8C 4GAFB 1BX2A 4JRXA 5IB1A 4HXBL 4ZS6C 3DRTB 2YA2A 4H5SB 3Q0HA 1MQ8A 5IV2B 2DYPB 1FFPA 4OSUL 1P7QD 3NGBC 4P23D 3L3GB 5ICZB 3HMWH 3MLSL 2B1AH 1KFAH 1EEUA 3GRWH 3VCLA 2NW3B 3ZKMC 5KW9L 3T04D 4R96B 3IDMA 4I2XB 4C54A 1C16A 5INDB 1HNFA 2WBJD 5C08E 2H2SD 2CKNA 1P4BL 3T1FA 2J1KA 1YPZB 3X14B 1U8JB 1FZKB 3GSOA 3BWAA 3KJ4B 4OLWH 5JPMB 4BKLB 3GSNB 1H3VA 1I8MB 2CIIA 2YZ8A 5FYKU 3OKKB 4NC1E 4U2ZA 5C71A 2D03L 1BZ9A 4WW1B 2N4IA 3QIWC 1CFVH 1LO3H 3QH3B 1V05A 1X6NA 3CDFA 2ZCHL 3RBSA 5FO8A 2CUMA 2JJSA 4JFHD 1K5NB 1XF3B 8FABB 1IQWH 4QOKA 3TBYA 2JJTC 3MNVA 1CICA 2YPVH 2A6JB 1FO0A 4OGXL 1E27B 4HJGB 3D85B 4Y16D 1BFSA 1SJHB 2AJZA 3BKCH 1F90L 1Z3GH 3H0TB 3BHBB 4OZIB 4LNRA 1RUPH 5EC2A 3WFZA 3P9MB 5KSVB 4Y5XA 4HZAA 2VLLB 4PJIE 5TPWL 3PL6C 4HKBB 4GBXA 3WIIL 4P46C 4GRWE 5CJXA 1I7RB 1R5IB 5ACZA 1I8IA 5EU3A 3Q2CA 3RWDB 2DQDH 3RX8A 4MA3B 5T1LB 4YDKH 4GAJL 5TFSH 3UZQA 5IMKA 2EXWC 2QQLH 2GTWB 3L3JB 3OKMA 4EXPX 3V8CA 2CR6A 2XWTB 2AJVL 3CXHK 5A2FA 1NUFA 4NP4L 1NBVL 3ZYIA 4BSVB 1T89A 2YWYA 5BV7C 4GSDL 3K80A 1N5YL 5L2KE 5MHSE 3OR7B 4RDQF 3EJZC 1F58H 2H32A 5CUSL 5DS8A 3T2NL 2UV3A 2VXQH 3TN0D 1HYSD 5ITFB 1BPVA 3L7FA 5GS1C 2EDJA 5MEND 5DQJB 2BCKA 2YN3A 1I8LA 3LN5B 4U6VH 1NMAH 3RPIB 3P30L 1QBBA 4JVUA 5IFHH 2F74A 4F7PA 1T04A 4XC1H 5C07E 1N8ZB 5IB3A 2X4OB 1A6UH 1WTGT 4RMTA 3QEUA 4YR6B 2DJ4A 4Y7MA 1Y18B 1VENA 4HFUH 4QEGA 4PGBA 1NCUA 5AZ2L 4M9PA 1D5IL 4LCCB 3BJLA 5IJKA 3FZUD 2DM3A 3AREC 1TJGL 3RP1A 4LEOA 5HI4C 5JW4Q 5M7QA 1YDPA 5CJ8A 3BD4A 1JWMA 3PGDB 5F9WB 1N64L 2RHEA 2D7NA 1MFDH 1CBVH 3NPSC 4IRSB 3H7BB 3LN4A 2KQNA 4Z7UF 2VKWA 2FR4A 4V2BA 4W6XB 4KK9C 4Z7WE 2E7MA 2WQ8A 4FTVE 1J5OL 3QUKB 4X80L 1TCRA 2QQKL 2BVUA 5SWZA 3D18B 4UV7H 4QXUL 1P4LB 4IRJC 5FUOH 2E8ZA 2QHRL 1MWAL 3PWVB 3RUGE 4GLRI 1ODAA 3BZFA 2HT4C 3LQAH 1HINH 5T5FL 4OM1L 2J8UF 3PNWB 3V5HA 3ARDD 1QACA 4JDVA 2X70B 3SJVE 5EZLA 1CTOA 2B20A 4LRNH 4G6MH 5I1KH 5T1DH 3VRLE 3WEXB 5F6IB 1TQCC 3OAZH 3DX7B 5SX4I 4PJ8B 4GRWH 4HD9A 4KPHL 2AJXH 1XGTB 4NO3B 4OD3H 4R9HA 4PR5A 3MRHA 1M05A 2YUWA 3PHOA 4G7VL 4HIJA 5MERB 3IFNL 5KJRH 3QUZD 3TJEL 1OWRM 3BKJL 1HI6B 3N85H 1HHHA 3WLBA 4JDZA 2GT9B 5HI3C 4KK5C 5DJ0B 1P53A 3MLSH 3UJTH 2Y36L 3ZKXC 4JFFB 2UUDH 2OZ4L 3EFFB 1KBGL 3FCTA 3AFLA 1T2QL 4L3CA 5FA3A 2C1PB 2MCPL 5CIPB 4Y4KB 2UY7A 3IKKA 3REVB 2CD0A 2DL9A 2VZVA 2XICA 5ENWA 3ES6B 4W81A 5HHQA 1S9VB 3V95A 4PJ5B 5HYQB 3BP4A 2N7AA 2ZCHH 3KLDA 5D6DA 4XGZA 1WWCA 3VMNA 4DK6A 3KAAA 3CFJB 2ICWJ 1F02I 4HV8A 2JCCB 2A9NL 3QDMD 3GB7B 3VI4F 2FECL 2VLRA 2YD3A 3V6OC 2IQAB 4GRMA 4NQDD 3SKNB 1B0GB 1YEHH 1R5WB 3RI5F 1AKJD 1ZTXL 4O02L 12E8L 5E56A 3UYPA 5I8OH 4CMHB 2E9JA 1LE9B 2I9TA 5EU7C 4WI9A 1DQMH 5KG9A 2YUVA 3RWHA 2IANE 2VQ1B 2PYEE 3MUGA 3C6LA 4XVTH 2DICA 3VFUB 3P0VL 4E5XA 3ARYA 3ZT6A 5JORA 1UKTA 4F9LC 5D2NC 3UC0H 1H3WM 1SEQL 3KXFA 2EDLA 3EYSL 4TTDC 2AGJL 3HR5B 5FB8B 1MH5B 2X4UB 1NBVH 4OLYL 3K8LA 3MRFB 2Z31B 2H9GA 3EDDA 1MJJB 4ORGB 2RCSL 3RGVC 3T2NH 3BP6A 3QXAA 3OJMB 4PJGB 5DI8A 4DGIL 1CK0H 4ZPVA 5DSCA 4UU9B 5SX5K 1Q9WA 4I18A 4R3SA 3P30H 4N8VG 1ZGLM 1AGDA 3K1DA 4UIKL 1ZLUK 3DIFA 1CFBA 1I1AD 4ODUA 4LCWB 1JTOA 1S9WB 2NW2B 2IGFH 5F9DC 2EDTA 5T3XD 3VXRB 1KEGL 1WWAX 4P2RE 4E41D 3QFJA 1CFNA 3STBA 4G9DA 4JFQB 4EVNA 3KPRD 4IOIA 1NCAH 2WWKO 4L4VA 1KCVH 4OLXH 4UTBL 3U79A 4Y4HA 2CRIA 3LQMA 3GO1L 4BM7A 4ODTL 3D2UD 1N64H 3CFCH 3JV6B 4PD4K 3ORJA 5E8EA 3ARFB 1WBZA 4ONOA 1A5FH 3HI1B 5FF6B 4EI5D 1J5OH 4HIIB 5C08A 3ZE0E 1K8IB 3GSQA 1OP3K 1JNNL 43CAA 3O41B 5DR5L 5T5FH 5K59E 4LKXB 4MJ5A 4QLRA 3EHBC 1P9MA 2BXZA 1UM5L 1OGAA 2VERN 3PWPE 4HEME 5JTWA 1FYTD 2QHLA 1P69B 2Y07L 1KULA 4G6KH 5JW3H 3NCCB 5MP6H 2CDEA 3PV7A 5I8CB 5AAMA 2IH1A 4OCYL 4O2EB 1WC7B 4MHHI 2A74B 1RZFH 2G60H 3SKOA 4FFWD 3DMMD 5ECJE 4R7NB 4WFEE 4GRLC 1GAFH 3MUY1 1OPGL 4Q6IB 1M7DA 5E5RB 5EO9A 2XTJC 2YPLB 3IYLW 3OKNA 1ETZB 2E7BA 3C5ZA 4XVJH 1D9KD 2DD8L 4KRPB 3GJFA 4BQCA 4H8WL 2BFVL 5DJXB 5IB5B 5EBWA 3WD5H 3OKEB 2EYRA 2FYYA 4RFOH 3TBVA 3G9VA 3F7PC 3SPVB 5GZOD 1T2QH 3QDHA 4Z8FH 1PKQA 1MPAL 2V5RA 4D0BB 2NY2B 3F58L 5I30L 4PRIA 3GI9L 2NY1D 2RR3A 1DSFH 3VXUA 3D48R 1UH4A 4RGMC 1QR4A 1Z9MA 3BZ4A 4UNTA 3I85A 3FO9B 1VGKB 1NANH 1W72L 3LKOA 1Q72H 3VXNB 2XZQL 2C4FT 2A1WH 2V9RA 4IMKA 5K9QI 2MQ0A 3DO7B 3RIAF 2VZ3A 3RIFF 2DQFA 2FRGP 3W0WB 5D7SL 1DE4A 1X9QA 5C9KA 4MA7H 5GRJH 2AK4D 1NEZG 1PVHA 3CFEB 1T83A 4O02H 3EYVA 4WCYH 5BQ7A 1WZKA 4MNQB 5DD0L 3P40A 1CD1B 4FQXC 5L9DH 3V0AC 5JMRA 1BOGB 3RVTC 3WFBL 3ARBC 1QR1A 2NY5C 5BS0E 2NYYC 1D5ZA 2AXJA 4LLVB 5E2TH 3OJDA 4G8FB 1G7JA 3HLAA 4PY7B 5IWLC 1JGVL 4P5TB 3P0VH 3QO1B 5J57B 4QHLB 2OX5A 4OB5H 4HWBL 5FKPA 4MZ2A 1G9NL 3IT8D 4DN4H 1RZ8B 2EH7H 1QO3A 3EYSH 3WO3B 3EFDH 1N6UA 4PTTA 4PRBA 3U6RB 5JPNA 3C8DA 4X99B 1YMMD 4JCLA 1TNNA 1Q0XL 4BH7B 5HHOA 32C2A 2DQJH 3IRPX 2ITCB 3PGCB 1C7TA 2Z0BA 3FB5B 3WIFA 5C8JA 4XCFL 4PRAB 4X6BB 2ZG2A 3NACH 1FBIH 2HLAB 5HYJB 4UOJA 1JHLL 4NC0B 1M71A 2P42B 2X10A 4YFEA 3MNZB 4LPXA 1OTUC 3GNMH 4XCYB 1WJ3A 1A8JH 5DRNB 5E6ID 4BZ1H 1N3NA 3OXSB 1U8QA 3KPQA 5D1XC 5ID0B 3FQRB 5L8KB 2O5YL 4PJAE 3NN8B 4MS8D 1A6AB 1YY8B 2HA1A 3BW9B 2IPUG 1O7SA 3MRMA 4NZTH 4XI5D 3WLWD 5FGBC 2D4DA 1RZJC 2HG5A 3ZYOA 5D93B 5F6IC 3ROOB 4QRUB 1NFIB 4JM2D 3ZKND 4ERSL 3GO1H 1T1WB 2KPNA 4ODTH 4KV5E 1KELH 5CHNB 5KTEL 1RULH 2EE6A 1NAML 2IAMC 1SBSH 3BKYL 3HUJA 2XKSA 1AY1H 2BC4A 4JN2B 4OGZA 4RNRB 3BH8B 5DK2B 2VLKE 1HXMB 2ATPA 4NRXB 4N8VA 2G5BA 4J3OC 4O5LL 2DF3A 2XZZA 2LU7A 3PJSB 5ICYB 4LVHC 5C3LD 3X17A 1K3IA 2ADIB 1KIUA 2FX7L 3ZTNH 4OD2A 5F1IA 4G8GA 3ELAT 2E8YA 4PB0L 1FZMA 1INQB 4XNUH 5GS2D 1FGVH 2VQTA 4XAWL 5GPRA 3QDAA 1LEGA 5FA4A 3CVIL 4XC3L 4S1SL 4PJCA 4LMQI 3JV0A 2P5EE 5BW7A 4RDQG 4OCYH 2X7LA 2D4FA 4PV8A 4EQ2A 3WJJC 1MWAA 2NX5B 4ZS7H 1ZMYA 5FDWA 3MUJA 4P23C 1DUYA 3DLQR 5F8QC 2RAMA 2VDLL 2XTLA 3MO1B 1TIUA 4ZODA 3BGFC 3IAQA 5D4QA 4YHPB 3FOLB 4WV1B 4WW2B 3JWDL 5CWSA 2FO1A 3HCVB 3RVWD 2K7PA 5H35A 4OIAA 2WBJC 2H2SC 3KYAA 1KEMH 1WF5A 3GMRB 4B50A 4X6DF 1JYXA 2BNQA 2BFVH 4X9FA 5DJ6A 4LARL 3TBTA 4BUGA 3HAEB 4ODHL 3DXAB 4RAVA 1WICA 3FO1A 3L5XL 4X0KB 4U49A 2VZTA 3F58H 3BMVA 4G9FB 1TZIB 1OOAA 2VLJD 1ZVSB 4OFYA 3OGCA 3X13B 2HWZH 1JCKA 3FB6B 5I1LB 5GGUB 3LKQA 5GSVB 4QXTB 3PV6B 4X6EB 3CUPB 3PG2A 3ZO0A 4RGND 4FQHA 1KG0B 3O8XD 2HVJA 4KROD 2WIIA 4Y16C 1AGCB 2XG4A 2OZ4A 1W72H 3F7YA 1L6XA 5HGAA 1L7TH 4YO0A 3ZHLA 4JQIL 4P2QE 4G6FB 2GY7B 2VR4A 4NQED 3O9WB 1I1YA 5ESQA 1HKLL 4NGHL 5E6ZA 1KNOB 2Z31C 3O6ML 4DWHA 3SO3B 1J0ZA 1RZKL 2MKLC 3HA0A 3W11C 1T03H 4YPJA 4WGWB 3CFKA 1D5XB 1ZA6A 4FQPA 4LQFH 5FO9B 4OIIL 4DW2H 4FZEL 1JPFA 2HAZA 5CMAB 1L0YA 5DK0B 1GZPA 4Y88A 2DWEA 1X5ZA 3MRQA 2NPLX 1R0AL 4NQSA 4Y19B 4HWBH 3TH2T 5I1GL 1IGFL 2UWEB 2WM0A 3PWNB 4JY4B 4NUGL 4NZRL 1QUNA 1HYSC 3OF6A 1WEJL 2FATL 25C8H 2W60A 2IFFL 1JIBA 4XNXL 3FJTA 3W81A 4R2GB 2A6DA 1NEZA 3WXWH 2HP4A 4AQ1B 5C09D 3H3PL 4PJHB 3UX9B 1ZSDA 5FYJU 5BVJA 3FB7B 5SWQA 3GHEL 1YJDH 3X3GH 5D7IF 2KZWA 1JHLH 3QDJA 2D7TH 4F2MB 1XF1A 3L95A 3O4OB 4GKOA 1FVDB 5KVGL 2OTWB 4GW4A 3VA6A 1WT5C 4JO1L 4FHBD 1VERA 4LSTH 5IEHB 1IILE 2CLRA 3IDYB 3LVEA 5GZNC 2O5YH 2PW2A 4PLOB 4KXZI 5CGYD 2X9XA 2Y23A 2FGWL 3EO1B 4Y0GA 1QRNE 1SM3L 1ZVYA 5KANG 4Z77B 1WGOA 1DFBH 2GK2A 4OCXL 1Z5LB 3RWFB 2WLZA 3VE0B 4M5YL 3HPLB 1YYML 4ERSH 3DVGA 3BWUC 1MFBH 4M7ZC 3PABA 5EOCL 3SE9L 4LEXL 4ZO6A 2AEIT 5I1JL 1WZLA 3MBED 4POZD 3ARDC 5J11B 2FD6L 1HH9A 1MHPL 3L5WA 4O5LH 1RU9H 5D7LB 1LVEA 1WAAF 3HNVH 1BD2E 3ESUF 3GMLA 2HT3D 2ED9A 4G5ZL 3B9EA 3MNWA 5AD0B 3SY0A 1R3KB 3WFHB 1CD8A 4PB0H 1DLFH 3UYRH 3WE6B 2CO6B 3CX5K 1W0WA 2G2RA 3CVIH 5JHLH 5DD3L 4S1SH 5E1AA 2R0ZH 4MXWH 2QQNL 1U93B 4ZTOL 3CLEL 1A3LL 1T6WA 4A6YB 1DLHA 1SJEA 1HNGA 1TPXB 5SWSA 4OI7A 3I2CH 1C5DB 5FCUH 4EUPG 1P84J 1QHPA 5A3IC 4F37K 3TV3L 3MCKB 2F5BL 5FM8A 1JNHB 3EDFA 3SOBL 4ZFFB 1ZA3B 2B0SL 4Z7OF 5D72H 1J88A 1F5WA 4L3EB 4QKXB 2DB8A 5CAYB 4FQ2L 1TQBC 1MLCB 1S9KC 3IFOA 4EEEA 4ELMB 5KSBB 4ZUTA 4XXCA 3EIFA 3MRNA 4O9HL 3KPSD 5C86A 3ULUF 4LSQL 1LK3H 4L4TD 1DP0A 4N68A 1LO2L 1JRHI 4UDUA 4HH8A 5EZOL 3KLAA 4XCEA 4RCAA 1SYSB 5I76B 1VPOL 3MV9A 5BMFL 4Y1AE 2VLME 4GG8B 1NCWH 4Y5VA 4MD4A 1HKLH 4NGHH 2BMKB 4NKDA 4OV6F 3QIBA 4M62H 1RZKH 5JO5A 3ILQD 5H37G 1VFBB 2VE6A 2XWJB 3HZYA 4KFZC 3N0PB 5LVEA 3HNSL 4YZFE 2XN9E 3IDNB 2J6EL 1PYWA 2DTML 4MAYD 1RVFL 5IOPB 3QQ4B 1MJ7L 3E6FB 5H37H 2DN7A 3U9PH 4Z7UA 2AK1L 2ZUQB 2WK2A 2IMMA 4WEUD 2IADB 4P5KB 4XX1G 5B4MD 3U0TA 1NC4D 3BPLC 1G6RB 1QBAA 5CD3B 2IPTL 5DT1L 2B4CL 4U1SB 5ERWB 4M3KB 5LBSL 1QD0A 3QEQD 2J8UA 1T5WA 2YA0A 1NC2A 5E2UL 1RUQH 4XVSL 3L5IA 3QWRA 2DM2A 3E0GA 2VITB 2VN7A 4QRRA 1I1AC 5CFHA 2P8PB 1QSFD 1HYRC 4KKAD 1OAQH 3RL2B 1GHFH 4Y8DC 4OD1L 3RWEB 3MRBB 4HWBA 4Y5YB 2AV1A 5IVXB 4PGCB 5I75B 3BT2H 5DJDB 2I5YL 1IAKB 4X5LA 1Q0YL 5D7JB 1WIUA 5DEFB 2AEQL 4JKWA 1AIFA 1DL7L 2A9ML 2FL5B 4GW1A 4R0LB 3PWJB 3DHJA 5IK3A 1E4JA 5BRZE 3UAJC 4CDGC 3IRZA 3QNZA 3S4SB 4NWUH 3CZFB 3MJ7B 3NVQA 2DQHL 5DUPL 4HF5L 1SM3H 1Z9OA 2BHUA 1FC2D 2H26B 5I74C 1IGIL 4EI5C 2GUOA 4XNZB 1JGEA 4O4YH 3CU7A 1JGLL 5K9KA 4K7PL 2R69L 3RKDD 4RMQA 3MLPA 4HUVB 1AHWB 3PQYD 1J8HE 4QRSA 1CR9H 1UYWH 5I1JH 4M1CD 1S5HB 3SCMD 1X7QB 1YQVL 3JWOC 3ZE1F 1G0DA 2VIRA 1U3HB 2FD6H 1A1OB 4DKEH 5J56B 5KVFL 2J8OA 2NTSP 3NTCL 2NMSA 5CEZD 2YA1A 4G42B 3GMNB 1NCTA 2DIJA 3L1OL 2VDPL 2V2XA 4XPFL 4ZSOE 4KKNA 3T65B 3ZT7A 4FXGA 1KCRH 1YEJL 2PNDA 1MHHA 3O81A 5C0EB 1NAMA 4R4FH 3BPOC 1IAII 1TDQA 3M07A 3DMMC 4PRHD 4PRPA 1EV2E 2X05A 5I1IH 2CDGA 1GPOL 1PX4A 4P4KB 1MAMH 4FFZL 3ARGB 3GK8H 3KG5A 4QO1A 2CIKA 2HFGL 2WP3O 5C0BD 4JG1H 1AD9B 3D69A 4QGTA 4ISVB 4OLVL 1PLGH 3K8MA 1I9IL 1QVOB 5GZOC 3FFCA 4KI5D 1TVHB 4XAKE 5T1KB 4K23L 4PV9B 4NBYB 1LDPL 4X9IA 3U7AA 4PJDE 2NY1C 1IGYA 3O9WC 2B0SH 4TNWK 1UA6L 1HXYB 4TUOA 4FQ1L 3GDBA 1MFCL 5KS9E 1JZ3A 2ID5A 2J12B 2P45B 1XCQA 4HJJL 2HKFH 4ZUSA 4UOW1 5C0CD 1EO8L 4FQ2H 1WBXB 3RDTC 2WINB 3IAPA 3E2HC 4M7LH 3IDUA 4O00A 4Z78B 3N1QC 5DQ9A 5LQBH 4RIRA 4F7EA 4RA0C 5CSBA 1NGQH 4ZG1A 2IH3B 4L29B 3VFGH 3NABH 2G9HB 3F12A 4WY7H 1T1XB 3MV7E 4KJYB 4EUPA 5ISZD 5FYLL 3Q5TA 5HY9B 5HDQH 2JF1A 3L9RB 1K4CB 4M7JL 1IKNC 1VPOH 3TT1L 3QXVA 4Q2ZB 3FRUB 1SVZA 3VD7A 1ZLSH 4PJBF 4Z7NE 5IMLB 3G6DL 1CU4L 4N0FB 4LLWA 1J86A 1E4XL 4C4KT 2BNRE 4KKBD 2V6HA 4XRCB 3IJHA 3OZ9H 4HUWB 1G9EA 3FMGH 2SEBB 4MJ2A 5DD6B 3QISA 1C5BH 1X5IA 1ZS8B 4RWYH 2A6KA 2XV6B 3ZDZE 3DV6B 1RIHH 3HNSH 4WUUE 2LTQB 5TQ2L 3O2VL 1TNMA 3RVVD 3BE1L 3AMKA 4KMQA 5GRYA 3SBWC 3MRJB 4H20H 1JWSB 1T7VA 5FGSA 4BFBD 2DQIL 5INCB 4JO2L 4H1LG 3QNYA 2YUXA 3KPLB 2VZUA 4M93C 5F6HJ 1YUHA 5IHLB 4D9RE 2IPTH 4WWKA 3T0EB 3BIKA 1DEEB 1ZWIA 4JFOB 3GSNL 5DC4B 5E2UH 2ENYA 2GAZB 2O61A 1FAIL 3LEYL 3SE3A 4G6JL 3S37X 5E4IA 3VWJA 3G6JE 4HCRL 5E6IC 4IIQB 4U1HB 1VKXB 1FNGB 4XPTL 1YMHB 3NFSL 5E5UB 5EBLB 4X5WA 5SX4H 2VN4A 3MRIA 1FNHA 4DZ8A 1KT2A 2Q7YA 4OLZL 3FT3A 4MS8C 1N26A 2I5YH 4ONFH 1S8DB 3T0WA 7FABL 2R23B 1JK8A 4EIGB 3Q6GL 4XI5C 5D2LE 3C5JB 4UQ3B 3LKSA 3H8NA 5ESAB 2MPAL 4C56B 1E6OH 5FYLE 4JM2C 2BVOB 4D8PA 2V5YA 5E8PB 2QV2A 1HOCB 4RAUA 4AEHH 9CGTA 2XWBA 4OFKA 3VGAB 4AY0A 2DQHH 4UINL 5DUPH 4FRWA 3RGHA 4R26L 4Z7QF 5ELIA 3V0VA 4F7TA 4JQVC 4KVNH 4XHQA 2Z8WC 1IGIH 2PN5A 1XIWB 4WFHE 2Q86A 1OB1B 1UQSA 4NJAH 1J9CT 3CFDB 3GSXB 1IAOA 3FO0H 5CKGA 2F58L 5K9JH 1TPXC 5JIIA 5FOBA 3UTSE 2XOTA 3T8XA 3QQNA 2ADJA 3B5GA 1MHCA 1QSZA 4OFVA 5L0QB 5LXGL 4MX7A 3O6FD 1BQLL 3NTCH 2R56H 2ZSVB 1W2KT 3D0VA 4NQXA 3IGAA 1LK2B 2D0FA 3WN5A 1UXSA 4N9GA 3GMPB 1DUZB 1RK1A 5EPMA 1XF2B 4PYHA 4YHOH 4I2XE 1UWXH 1ACZA 1T5XA 5KSAA 2V7NA 4U6YB 2VMFA 1YPZE 3HI5L 3CJJA 1B3JA 5I18L 3OAYK 4WHTA 3DURB 3C60D 2GSIB 4WDIA 1GPOH 4JJHA 4OZFB 4JPVL 4M3JA 4PGDA 1FGNH 4NZUL 2X42A 2EDEA 1S7WA 1ITBB 2K9UA 1ZLWK 1GC1L 4D9LH 1HWHB 1JTTA 1G7QB 3MLRL 4YAQB 2FGZA 2XTJE 3TVMB 3RZCB 2YPKB 4K23H 3HE6D 4AH2B 5BJTB 1BX2B 5IB1B 4L5FL 1F4WL 4FQ1H 4OZIE 4DTGL 4QNPF 1FFPB 4DEPB 5IW6A 3CLFH 1G7HA 5F3BA 3MACL 1KJVA 3O8XC 3SDDD 3IDMB 4LSUL 2P24A 3IFLH 3GSOB 2M1KA 3BWAB 1JJUA 5ALCL 1DEDA 5FYLH 4KK6C 4MGXA 4M1GH 1IEBA 1JL8A 1KF9B 4DQOL 2CIIB 3VFRA 2DM7A 2QLVB 1CL7I 4J23A 5E03A 4GQ9H 1BZ9B 1HDMA 1NMCB 2BX5A 5E95B 2AV7B 1CF8L 5FO8B 3T1WA 3G6DH 5I1CL 5EOQL 3LV3A 3IXAA 2BNUA 3TBYB 3MNVB 1K4DA 2EECA 1CICB 2PXYD 1FO0B 1L0QA 2J4WL 2ARWA 3EOAB 3B5HA 1OSPL 2AJZB 5D1ZC 5D1QA 5IMOA 3WS6A 3F6LA 3KXFD 5EC2B 1HCVA 2CH8A 3BE1H 4RMVA 4U0QB 3LD8B 4EIZC 1RZ7H 1IJ9A 5F3HB 1U36A 1X5HA 2YMXH 5GRZA 4GBXB 1EMTH 3GIVA 2I27N 4F8QA 3D25A 3LB6D 1TETH 2ZJSL 1EHLH 3SDAB 5EU3B 4MQTB 2GCYB 4DFHA 1WZMA 1N2RA 4LVOB 2J6EA 1CLCA 1QNZL 15C8L 1SYVA 2JB5L 3KDMB 5IMKB 5EO1A 3OKMB 2X6MA 3LEYH 5EOTA 3QI9B 2R0LL 2O5ZH 1ZT4A 3GZKA 3UZEA 3HI6H 2XZAL 4QHNA 4XPTH 4PJFF 2KDGA 5T33L 2H32B 5DS8B 2AERT 2M8XA 2YWZA 2C4FU 1RV6X 4QY8A 1ZGLB 5F7WC 3L7FB 4MNHA 1NQBA 1KN2H 2BCKB 1I4FA 4H1LA 1WZ1L 4F7PB 1T04B 2W9EL 1NGWB 5IB3B 2RFXA 3ULVL 1QFUL 3VXMA 3B43A 4YPGB 3QEUB 4GXUM 4X6DA 3MBEC 1AFVH 3L3DB 2UZXB 4WO4D 1U92A 1ZEAH 4WHDA 3ZTJG 3DYMA 3N1GC 3N1PC 5C08D 2Y9RT 4M43L 4LEOB 2FWOA 1YDPB 2XZCL 1CG9A 1OD7A 2F58H 1T7XA 3Q48A 1JWMB 3RVUD 5LXGH 2CLVA 2FEDC 4F80A 1KC5L 1TFHA 3M45A 1BQLH 2FR4B 2HFTA 3BD3A 3LEXA 4JFFE 1TCRB 3O0RL 5SWZB 1LEIB 3B83A 5E8DL 5DHVH 4NSKA 3BZFB 3S34H 1H5BA 5TH2A 4JJ5A 3V5HB 4YHKL 5I15L 1CGSH 5EZLB 3MYZA 1MCNA 2EEBA 1D6VH 4NZUH 1BQSA 2Z35A 1M1SA 1OW0A 5FECA 4PJ5E 1CXHA 3D6GA 2NZ9D 5E1HB 4KTEL 2YC1A 4TSAL 2H1PH 4JVWA 4YUEH 3LPWA 3CCHA 4I9WE 5SV4A 1YEIL 1NDMA 4PR5B 3DVIA 3MRHB 4LMQE 3OX8B 2JCCE 5CZKA 1N6QL 4NO0A 1M05B 1PD6A 2PTTA 5FYKL 3PHOB 4HIJB 3S98A 4NN5C 1XGPB 4WUUA 2Z92A 1MVUA 1HHHB 1F4WH 4JB9L 4L9LA 1J1XH 1CVSC 4ZYKA 4JDZB 2Y5EA 1F11A 3P73B 5KOVC 3RA7L 1KCUL 2O26U 5J1TC 1T3FA 4YLQT 3DO3A 5I66A 4XMKH 3ULVE 3RWIB 3FCTB 4K3GA 5L2KD 5MHSD 1GXEA 2FH8A 4JO3H 2VDRL 3FQUB 4L3CB 4LSUH 3VXSA 3D5OF 2R1YB 4OBSA 1EA9C 2FO4B 5B3JE 4MJIA 3K2UL 1PZ5A 2YHGA 1J05B 5D7IA 3DYOA 5EBMA 4QXWA 4L8SA 1GJIA 5C07D 4YDJA 3ILQC 3OV6A 3B9DA 3B9KD 4G8IA 3BP4B 4HBCH 4XGZB 1UADC 2V7HA 4PP2A 4L8DB 1JHTA 1JPGA 5LWYH 3UO1L 4HV8B 2E5EA 3LKPA 1V8HA 4XBEL 1ZHNA 5H2BA 4PJGE 5L6YL 1T4KA 1UM4L 2VLRB 4QYOA 4YGAB 4GRMB 2R29L 1W0YT 4HWZA 4JFYA 1IT9H 4OCLC 1XH3A 4EOWH 4LCWE 2R2CA 3MJ9H 3MJ8A 4QHKJ 3VXRE 4NBZB 4J4PA 2I9TB 3MCG1 1A7RL 4FTVD 4HPOH 4P2OA 3AUVA 3RWHB 1AQKL 1B6UA 4XZUA 3TO4D 1LP9F 3GBMH 2PYFA 4LSPL 2ARJA 3QUZB 1A14H 3FHQA 3C6LB 3MUGB 2P5WA 5CIPH 1WAAA 1P2CA 3K1KC 4XCCL 4NUJA 5JORB 4XNQA 4KKAC 4OUUA 3DRTA 3SJVD 4H5SA 15C8H 2JB5H 5IV2A 1YNKL 4JFEB 1TLKA 1KACB 1EGJH 2NW3A 3F8UB 1I9EA 5GGTL 4HS8L 3MLUL 4R96A 1S5IH 1OLLA 1ZANL 4YHML 3O3BA 3CDYA 3BP6B 4BSWA 3CXDL 3VWKA 5DI8B 5DMKA 2HRPL 3X14A 4FNLL 3E8UL 1FZKA 1JHKL 3AS2A 4ZPVB 2N56A 2YXFA 1Q9WB 3G5ZA 4I18B 3GSNA 3LN9A 2CO7B 4YDIH 1AGDB 1I85A 2X1WL 4ODUB 4PLKD 1GVIA 3QDGA 5E9DA 3K8KA 3RKDC 4LASH 3QH3A 3U1SH 1AXTH 5I73C 3ULVH 4HCRA 2H45A 5A2IH 1QBML 4XNMA 1A7PH 2EDFA 3QDMB 4HULB 3QFJB 1K5NA 1XF3A 3WFDH 1NGPL 4WI3A 2CMRH 4G9DB 3G9AB 4EVNB 2A6JA 4IOIB 4L4VB 4HX1B 4R4BA 2P7TA 4AQOA 4HJGA 1XMWA 3B2VL 3I9GL 1CLYH 1UWEH 1SJHA 4PUBH 3H0TA 5AAWA 4PP1D 5KSVA 2LAAA 2JELH 3SGEH 2VLLA 5CINL 2YPLE 4XPBL 1WBZB 1KC5H 4I3GA 4ZO9A 4PGZA 4AMKH 2HT2D 5EWIH 2VDML 2OS7A 2B39A 3FQWB 4NNXA 1B6DA 1R5IA 3GSQB 3ALPA 43CAB 1U6AH 1LO0L 5E6YA 4U7SA 4PS4L 4KI1A 3NH7L 3LSOB 3MYJB 1OGAB 5HHXH 2XWTA 3DUSA 2I9LB 2AEWA 4JM4L 1MRDH 2ZOLB 5F88A 4KUCF 1AI1L 3V4UL 4F58H 4ELMF 2ORBL 2IAND 4ZFGH 4P3DB 1IFHL 1YEIH 2PYED 2ITDB 1IM9A 1J0IA 1S9YB 4NWTL 5DD5L 1B4JL 1IC4H 4X4XA 1OGTA 2OR9L 2EXYD 3W0WE 5AZEL 1FZJA 3RPIA 3QA3A 3S35X 1KLFA 4OKVA 5DD1L 2JJSC 1BIHA 2WUBH 5EO9B 3OKNB 4MNQE 2NY6D 3P3YA 4J6RL 4APQB 3C5ZB 4Q7DA 5FO7B 4OZGF 3GJFB 4K8RL 1Y18A 4OLEA 5F7KC 5EBWB 1IGCL 2FYYB 4LCCA 4UT6H 5DGRA 1PKQB 1CDGA 4LHUD 1NMBH 4Z7VB 2WV3A 2BVEA 3O2WL 4PRIB 4Y5XC 5T3ZE 1X5FA 2X5PA 3AXLB 3ARWA 3VXUB 1CDUA 1QQDB 2ESVA 4AIXA 4IRSA 4GBXC 2DI8A 3WJLA 1KJMA 2AABH 3PWUB 1S7XA 1NGZA 4P2RD 2I24N 3I6GA 3MFFA 4BFIB 1EPFA 3LKOB 3VXPA 5L2JB 2OJZH 3RVVC 5A2JH 3R1GL 3EYUL 5L6YH 3PNWA 2DQFB 4IDJL 1OP5K 5DC0A 1X3DA 3WO4B 1DE4B 1ZXQA 3ZSTA 4YXHH 5HYJE 3PDGA 3TWCH 1DBBL 5HSFA 5ANMA 1EJOL 2CXKA 1K9TA 3EYVB 5DJAA 4FQQA 3NA9L 1DVFA 3QEGL 1PZUB 1CE6A 4FABH 5IVXF 4NO3A 4PJXE 2OP4L 2XXCB 1RURL 4UDTA 5HDLA 1AQKH 4ZAKA 4LSPH 1F2QA 3PHQA 1YC7A 1Q9LB 1G7JB 3HLAB 5MERA 4XCCH 1OAXL 4MMZC 1HSBB 5FKPB 4YX2L 3NIGF 4OFIA 3V5KA 1Q8MA 3W5MA 2W59A 2GT9A 2FBJL 4LCUA 4U31A 4PTTB 3PWPD 1V7NL 5HDBE 1FP5A 5JPNB 2X9YA 5GGTH 4HS8H 2XQYK 5DFVD 4G43A 3W9EA 1LGVA 1V3LA 4OLUL 5F7HA 4HGMA 1ZANH 5HHOB 32C2B 2C1PA 3QHZH 1MEXL 3TPKA 3WIFB 5C8JB 2R1WA 5F93C 1MCFA 3REVA 4WFED 3DETC 3JWNC 4LHQB 1N0XH 3AC0A 5JUEH 5HYQA 3PE9A 1N3NB 5IHZA 1VA9A 2C3GA 4IJ3B 3WNLA 1Q94B 1QBMH 1PJ9A 3S5LG 1NLBH 4NKMA 1OP9A 2DKMA 1VGEL 2NX5E 4XCNA 2IQAA 3MRMB 3O6FC 4OGAD 5T3ZH 2HG5B 1R5WA 3SE8H 4TSCH 4HIXH 1IARB 1T7ZA 1CT8A 1E4WH 4UB0L 5LG1A 1DJSA 1OAUH 2X4QB 4FXKB 3HUJB 2BC4B 2ATPB 3RY6A 4N8VB 2G5BB 2OXHA 1SY6H 2MOVA 3H9SA 1MIEH 4P5MA 1S3KL 1XGUA 5AUMA 3UTTB 1KB5B 3P11L 4DVRH 4G9FE 2F8XC 4OD2B 3NH7H 4G8GB 3WNMA 2FCBA 4LSRL 5F44A 4X5XA 3MLWH 4KQ3L 1MH5A 1FZMB 4W4OC 1ZLVH 3FONA 4KKLC 4JM4H 3NAAH 4K3EH 1MJJA 5FA4B 4JE4B 1AI1H 4DOHB 4PJCB 4ORGA 2VSCA 5BS0D 2X7LB 2NY7H 3BAEH 4PV8B 4XPAL 3V4VH 4F37F 3WIHL 2EDYA 1MWAB 5E00B 5FDWB 3VFNA 5BXFA 2BDNH 1FLRL 4NOBA 5KZCD 4YEFA 4KDWA 5CWSB 5D6DC 3QIUD 3Q5YA 5H35B 1HHJA 5DK3A 1VB9A 1T21B 2KUTA 2Z4QA 5D5MB 2BNQB 5I6XB 4K8RH 5DJ6B 2D7QA 1JWUA 3REWA 3TBTB 1F4YL 1QFWI 1IGCH 4JFQA 3TBWA 3GMQA 5TE6L 2ZP0T 5IFJA 2W0LA 4RAVB 3FO1B 2OMBA 3O2WH 3BQUD 2XYCA 4Y19E 1KLUA 1TCMA 5EIIB 3QPQC 4PG2A 4UT9L 2UWEE 3LKQB 1P1ZB 4JREC 3WKMH 3TM6A 8CGTA 2OTPA 2PXYC 4LAJH 3T08A 4FQHB 4NM8L 2HVJB 1KJ2H 2WIIB 3MLVL 5GHWL 5HGAB 4YO0B 4A6YL 1OL0A 3O41A 3R1GH 3EYUH 4PJHE 2X89A 1N6VA 4L8BA 4LKXA 3WNNA 1I1YB 5ESQB 5GIRA 3FQXA 5DDHA 3A0OA 3LB6C 4LLDA 1ZA6B 1DDHA 4G3YH 4UTAH 3QEGH 4GUPA 1YYLL 5I1HL 1F3RB 2VLKD 5I8CA 5C2BL 1JPFB 2N7BA 4O2EA 2F53A 2OP4H 3HAEH 2A74A 1GZPB 5CZVH 1XEDA 1QTYT 4YBQD 2DWEB 4MD5A 3MRQB 5DURB 5GGVL 4KDTA 3MMEB 1RPQA 4GMSL 4UAOB 2GIYA 2X09A 2FBJH 4S10A 5EUOF 1X4XA 2CK2A 4X4ME 5EU5A 4UIMB 4B0MM 3U30B 2W60B 2DLFH 3TJHD 1IAIH 6FABH 3QO0A 1EBAA 3NFNA 5I8EA 2P5ED 2A6DB 1NEZB 3JBG7 2ZG1A 4Y4HC 3SPVA 3CZJA 1F2XK 5D7LE 2DLGA 2VISB 4CN6A 2EC9U 1RY7B 2QADD 1WITA 2A77H 3BI9X 5SWQB 4UI2A 1D5BB 3QDJB 4D3CL 5BO1L 4IS6A 1H3UA 4XHJD 4GW4B 5GS0L 1DZBA 3SKMA 5DUBA 3MRPA 2ZUWA 2AI0L 3DGCR 3FO9A 1QYGH 2DMCA 4TUKH 5GGTA 5BZWA 1BAFH 1I9JL 4DAGL 3RVUC 2IBGA 4NRZA 1GGIL 1P9MC 3EGSA 3DO7A 3C08H 4NC1C 4FN0A 1BBJB 4TVSa 5FGRA 1IAMA 2MQ3A 4ZXBD 4M48H 2OYPA 5C0JA 5E70A 4IRZL 4CNIA 3DVGB 1QHOA 1EDQA 4MNQA 5GGQH 3VJ6A 3PABB 4N5EC 3SN6N 4GAGL 5IT2L 4XP5L 5KSUB 4NHCL 1ACYL 1SVCP 3LQAC 2DJSA 4PRNA 2YZ1A 3JTSA 2XNAA 4AENA 1HH9B 4MAUH 1T1ZA 3P0GB 4LLVA 4P2QD 1NSNL 4AIZA 2LV4A 4P5TA 1FL6B 2BERA 5GISL 1S3KH 1A1NB 3GMLB 2UY6A 3MBXL 2EICA 5C0IA 3C5ZC 3LOWA 3S5LA 3MNWB 4ELME 5C6PB 4BZ2L 5KSBE 3UJIH 2EIEA 2EDBA 4KQ3H 4HG4J 2BSED 3U6RA 2HFEA 1W0WB 4NN6B 3C5SA 4ZD3L 2G2RB 5L88H 5E1AB 4BSJA 2ITCA 4XPAH 1AXIB 3WIHH 1S7RA 1SJEB 2EEDA 5SWSB 3MLZL 4QRPA 3S36X 4TNWF 4J1UA 1INDL 3I75B 1PG7X 3MNZA 2BSTA 1RHHA 3V6ZB 2BRRL 5ITBH 1P4IL 5GJTH 3FQRA 3NN8A 1RUAH 2EE3A 5HHVL 3LQZB 5TE6H 2Q7NA 3D39A 3RQ3A 2V9QA 4QRQA 1CVRA 3ROOA 4QRUA 3B9KC 4J3VA 1R3JA 3MV8A 1KN4L 2XKNB 3CD4A 1T1WA 5I8KL 4PJFA 3IFOB 5CHNA 4ZUTB 4TRPL 3QJHA 5K9OA 2YEZA 1FN4A 3MRNB 4RNRA 1HXMA 4PJ9D 3TNMA 4NM8H 3H6JA 3MLVH 4UDUB 2XRAL 1XF4B 3KLAB 4XCEB 1UWGH 4A6YH 4FFYH 3L3HA 1B9ZA 3OXRB 4B7LA 1QRND 3X11B 4NNPL 4I0PD 2H2PC 4Y5VB 4MD4B 4NKDB 1EFXD 1MI5A 4LPTA 3QIBB 3TO4C 1AJ7L 5DRXA 4X7DC 4KTYA 2VE6B 3WNPA 3T4YA 4OQTL 3DNKA 4LOUC 3ARSA 3TA3A 1PYWB 3VFTA 1TTFA 4IOSD 1RJZA 4WI8A 3LMJH 4MD0A 1BD2D 4Z7UB 4JZNA 4HT1H 3MPCA 5C6WH 4FQLL 2DOCA 3FQNA 4YHPA 3SKJH 1HH6A 3DX8A 3FOLA 4WV1A 4WW2A 3QUXD 4C58B 2HJLA 4E42B 5DMIL 1OP5H 5HBBA 4M6ML 3RKPA 3U0TB 2BZDA 4N9OB 1BEYL 1KXVC 4H88L 5D71L 5TF1L 5DYOB 3GMRA 2CRZA 1T5WB 1NC2B 4HFWA 1MNUL 3DV4A 4KVCL 5FHBL 3DPBA 2YKLL 3DXAA 4QRRB 4BFGA 3QXWA 4X0KA 5F96L 4PLKC 5HD8D 4G9FA 3CFBA 1WVZA 2VRAA 4ZS6D 4BQ8A 5KVEL 4LGRB 3FB6A 5I1LA 2AV1B 3UTQB 5GSVA 5ADOL 3ARRA 5BO1H 2NY4B 4X6EA 3ZKMD 5GS0H 4U1GB 3DSFH 4G80A 1X5JA 2W9DL 5C0AA 5TE7H 3MTRA 1AGCA 2OR7A 1AIFB 3TH4T 4GW1B 1MFAL 3AM8C 1UACL 1W8NA 5IK3B 4PP1C 2QSQA 2VDNH 3S8WA 5FAAA 3QNZB 3RL1A 4H0IA 2WANA 3ZDXF 5GXBB 4WU7B 2OQJA 4OZ4A 4I4WB 4RISL 2HT2C 4N8CL 1H3XA 2YSSB 1QFOA 1GGBL 2KBGA 3H42L 1JGUH 2GUOB 1JGEB 1G6RH 5K9KB 1CGUA 3HE7A 1D5XA 5BW7C 1JNJA 1JUFA 3HNTL 1INEL 1OTTC 3DECA 5FO9A 4QRSB 1V3MA 5E7BA 5FYJE 5F1OB 2DMKA 3N1MC 2VIRB 4HQQL 3RWCA 3HS0A 2VR9A 5C9JA 4EN3D 4Y1AD 1NCBH 2VLMD 3VG0L 2OK0L 1ED3A 4JFXA 1OAYH 5DXWA 3KLSA 4JY4A 5K93A 4X7SL 5I6XC 4JQXA 5IFAL 1KCLA 3I6LE 1MHHB 4YFLI 3PL6D 1NAMB 1FDLL 2R2BB 4P3CL 5CSGA 5DEGB 2EXYC 2XN9D 4JR9H 1QZ1A 4PRPB 4ZUVB 1NKOA 3IS0X 1N59A 5J12B 2CIKB 2YK1H 2C4XA 4KHTL 4HXAH 1T0PB 3M8OL 4UMGA 3U48A 2WMPA 4HIEA 1FVDA 3D3VA 3ZE2E 5KN5B 3FFCB 5C1MB 5CJQL 5EDXA 1JZ2A 4F7CA 5C7XH 1NANI 4N90E 2ZKHL 3AY4C 3BUTA 4TUOB 1A7OH 2O5XL 5I2IA 4X7CC 2FECI 3WFEL 1XCQB 4V1DA 1VADA 3OB0K 4LSDA 2AXFB 4Z0BL 3STZA 5TDPA 1Z5LA 3RWFA 1RJYA 3HPLA 3QIWA 4J3UA 1GIGL 5DQ9B 3W39A 5F89A 2YRZA 5IEKB 1FORH 2NY5L 1CD0A 2FHBA 5DFWH 3F12B 5JQ6L 3D9AL 4EUPB 5BRZD 3TT3H 1U8MB 3MJ6A 3JSSA 2R8SL 3OAUL 3PP3H 1NBYA 1EEQA 4OV5A 1BFVL 4W68A 3SDXF 1BBDH 2LE9A 4JN1L 1G9MH 3K4ZA 5CBAA 1ZVHA 1RAMA 1NCCH 3IJHB 2DQEL 3WE6A 4KK9D 3ZSSA 1DN0B 4P46A 1KXQE 2OL3H 1J8HD 3HG1A 4I8DA 4IRJD 5FYJH 1M7XA 5IF0A 3RRQA 1F4AA 3KPPA 4IHOA 4C56E 1CDIA 3T77B 1YEEH 1U93A 5C0BB 3KNBA 4QF1A 5DVMA 4HAGA 5J13C 2NXYB 5HGDA 5JXED 1C5DA 1U8IA 7CGTA 5IP4A 3SDCD 1J1PL 4N0YH 3FN0H 5AYUL 4QT5B 3QNYB 3D1MC 2GITA 2ZOKA 3K7UA 4H26A 1YUHB 1OTSD 1JNHA 3EO0B 5D71H 4WWKB 1ZA3A 2AEPL 4KTDL 3VFMB 1J87A 3BIKB 1ZWIB 5GS1A 1A4KA 1BQUA 1RZJL 1MNUH 4K3JL 4L3EA 1U91A 4KVCH 4NKQB 2O61B 5C0CB 5IESL 2Y1VA 4XP6L 4YDVA 2A6IB 1R3LA 3VWJB 3CDGA 1KJ3H 5EZIH 4R97B 3H9ZA 5KVEH 4X5WB 4ELMA 3MRIB 4KQ4H 4WI5A 5H94A 1YEFL 1KT2B 2Q7YB 1IGTA 3FT3B 1FO0L 1BF8A 4XAKD 1ZOXA 1JK8B 4K2UH 4OGAC 2X9WA 3FT4B 3AREA 1CE1H 5HVWA 1FYHB 4I3SL 4NC2B 5F70A 2W38A 1MFAH 4D8PB 5ADPH 4ODXB 3K3QA 2R4RL 4JFDA 5IHUL 3I50H 4GS7C 5E2WL 1PSKH 4RAUB 1FFOA 4XMLL 3UROR 4RISH 1CFQA 2P46B 4F7TB 2I07B 3MOBH 1CLZH 1OAZL 1KV3A 2Q86B 1UQSB 2EO9A 2VOTA 2BY2A 1A7NH 2GJ6A 3MV7D 3BIBX 2WP3T 4QWWC 5IOPA 2AJYL 5A1AA 2F8OA 5E2VL 1YNLL 4LIQE 2ADJB 3MV11 1MHCB 3EDEA 4MX7B 3P4OA 3VDBA 1EJ6A 1V5JA 3WXVH 4NQXB 1EEYA 3DX6A 3WN5B 2IADA 1IC7H 4N9GB 4P5KA 3VG9B 1RK1B 3R06B 3N9GH 5EPMB 4X7EC 5C92A 2BNRD 5GS3A 2WQRA 1T5XB 4U1SA 1Q9OA 5ERWA 5KSAB 1NAKL 2V7NB 4MA8L 4B7IA 4CVWA 2VO5A 4C4KO 4ALAL 1UCBL 4WUUD 3GFUA 4WHTB 2YD9A 5I1EH 2FDBP 4WDIB 5DTFA 4F15B 2PO6D 4C55A 4PGDB 4Z7VF 1FIEA 1L7IH 1S7WB 4ETQA 5EC1A 4YHZL 1Z6JT 2MHAA 5IVXA 4TTDD 3O4LA 3KPOA 1WK0A 4JO4L 1FSKB 1X4ZA 3GIZL 5D7JA 5IG7A 2DKUA 5DEFA 5IROA 2BSRA 2W07A 4WTZG 3QJFA 3BQUC 3Q1SL 3J8F7 1YEDA 5MI0B 1AP2B 4Y5VC 1HIMH 5IW6B 3WFEH 4HWEH 1L0XA 1G7HB 1ADQH 2H26A 1KJVB 2NY3D 1WIPA 4OZFG 2ZUYA 4WTXA 3OPZH 1IC5L 3NIFF 4ODBD 2F54D 4HUVA 1AHWA 4K9EH 3R8BB 3DVFA 2P24B 4HSQA 1FFQA 5JQ6H 4LDEB 1A1OA 5FYLD 3S97C 5CILL 3OAZK 1L9NA 4YXKH 4AEIH 3PWLA 1HDMB 2VR5A 3BO8A 3AROA 5HHNA 5DMGD 1G6VK 4WFHD 3RU8L 3T65A 3LV3B 3MQIA 3IXAB 2JKXA 4TULH 3C9NA 2BNUB 1K4DB 2C7UA 4YBQC 1S7SB 3WFCL 2F9BT 1JP5A 4F3FA 4PB9L 3EOBA 5D1QB 5IMOB 3BSZH 3ARGA 3UTSD 4LIQH 1A6VL 2Y6SD 3CMGA 4F9LA 1DBML 5D2NA 3MA7A 2DYPD 3M17B 1G9NC 2UUDK 3U0WL 1AD9A 2APFA 3H7LA 1J1PH 4ZO8A 3TJHC 4YBLB 1OQXA 3GIVB 1S9XB 3MRGB 3D25B 4JPWH 3RGVA 1XGRB 2QADC 4OQTA 2HKHH 1N2RB 2IQ9L 1HXYA 3BXNA 1SYVB 2BVPA 5D8JH 5EO1B 1JZ8A 5EOTB 3H3KA 2DTSA 4XHJC 4XP6H 3MLXL 4NN7B 4Y2DA 2DLIA 1WBXA 4YE4L 1ZT4B 2FSEA 4QHNB 3OWEA 4Z78A 2CRMA 3EJYC 3MOAL 5SWZE 2NXZB 2XTJD 1AXSA 4DKFH 1YEFH 4O2FA 1FO0H 3NCYS 4MNHB 5KANI 1IKFH 3D0LB 4NQCD 3D85D 1MFEH 4H1LB 4DK3A 1E6JL 1DQJA 1R24A 3TYGH 1K4CA 1ORSA 2R4RH 4MQXD 2VXVH 5LGHL 5L7XH 4Q2ZA 3LH2L 2RFXB 3QHFL 4PLJD 1SJVA 3VXMB 1YY9D 4WUKH 4X6DB 3JV4A 2IFGA 5IQ7L