5HDBE

Integrin alphaiibbeta3 in complex with ro-435054
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
219
structure length
214
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alpha-IIb
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
total genus 33
structure length 214
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hdbE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hdbE02
3IS1X 5EU7E 3SKJL 5CEYB 3IXAA 1GYAA 4MVBD 4HEPG 1CZ8H 4PTUB 1RZJC 4X8XA 1GGUA 3V7AG 2UWEB 3LOWA 5ESAA 1T2XA 3BPNC 5GS2D 1Z9OA 1AXTH 3MO1A 4LVHC 4IRSD 1A0QH 1N6UA 4GKZB 1R24B 4PRIB 4QRPD 5TE6L 5CJOL 5GZNC 3DO7B 1ZVYA 1VFAB 1IBGL 1J9CT 3FMGH 1WBXA 4QCIA 5E2VH 4QY8B 1NH6A 2QHLA 3REWA 3WFHB 3QH3B 2UZXB 3CFJB 3OAZK 2XWTA 1PSKH 4GG6F 3C6LC 3RY4A 3ARQA 1VCAA 1MI5A 4FFYH 1RZFH 5FYLD 3S35H 2WLYA 4JO2L 1RIUL 4P4KD 1A14L 3LMJL 4XVTL 3FQXA 4M1GL 1GHFH 4KI1A 1UA6H 4ZXBC 2WK2A 3MV9B 4G8EB 1G9MC 4UQ3B 3QIUD 2P24B 4G9FA 5IEKA 1A6VH 3WXWL 4YH6A 2A83A 4FQXC 3EOYG 2R29L 1QTYT 3QUYB 4PJFF 5E9DA 4P2RA 3D87B 2NY7L 3G9VA 3BPCB 5FM4A 4ZFOB 4XVSL 1JF5A 3OX8A 4PGCA 1AGCA 2DQGL 4HKXB 3HR6A 3MBEC 4CRPA 3ZT5A 1C5DA 1FC2D 2J6EH 3GSQA 2OTUA 3MXVH 4H26A 5IW3A 1FZMA 1JTTA 1Z5LA 3RJQB 4BH8A 5D7KD 3MLSH 4N9GA 5D2LA 4FFWC 1MJ7L 4GBXC 2VC2H 4JPKH 1ZS8A 5HBBA 5BVPL 3MRBA 4MJIA 5K9QG 1WT5A 3B4NA 1H0DA 1NGWA 3HPJA 5BZDA 3UYRL 1VFBA 5IFAH 1YEEH 5IGXL 2EH7H 4P3WA 4AK1A 2X70A 3NIGE 5B39G 4LCYA 3S3PA 3QQ4B 4U1LB 3DUUA 4X6CA 2BY2A 4WW2B 5A1AA 3ZE1F 2BVQA 2ZPKH 3QEQD 3WKNA 2CJUL 5J11C 2JB5H 3HG1B 5BMFH 3UTTE 2HT3D 4NJAH 2J4WH 4S2SA 4ZDHB 1KC5L 3GHEH 3BJ91 4OCRH 3IAGC 4K3HA 4KQ3H 1YEHH 2A6IA 5CGMA 1FRGL 3IJYB 4NKDA 5GGVH 1J1PL 3KPTA 1BM3L 1LO5A 3P4LA 3PWLA 3P30L 3O3BA 4RWYH 4KVNL 3FT2A 1U8HB 5D1QB 4EIZC 1LP9B 2MJWA 2Z92A 3S3JA 1QSVA 4JDZB 2IG2H 1Q0YH 2X4QB 4HFUH 4JO4H 4L1HA 3V5KB 5EU5A 1DZBA 3PP3K 4L8SC 2HJKA 4KK8D 2PETA 3O41B 1A6AB 2FEDD 1XFPA 1VENA 1AY1L 2R0LL 3PGDA 2XQYK 2L4OA 4JFFB 4KTDH 1CTOA 3HNVH 1GC1L 1ORSB 4XCFH 3HMXH 2CO6B 4EOWH 2DDQH 1WVZA 2DIBA 3VXUB 2GSGA 4NC2B 2YC1A 5AYQA 2FX9H 3C60D 4W68A 5C08E 3LRSA 1YNLL 5E1AB 3DHMA 5LCVL 3CVHL 3ECBB 2E3VA 4PRNA 4G6JH 1R3IH 1RJZB 5C09B 9CGTA 4I0PA 2W65B 3SY0A 5K59E 1ZA6A 3SOBH 2NY1B 2WUCH 1YMMD 1A3QA 1MJUH 1XCQA 3H3PH 3HZKB 4F2MB 3RPIB 3GJFH 2ESVD 1CD8A 2MHAB 1A5FH 4LLVB 4HMCA 3DX6A 1IZKA 5GIRA 2GTZB 4DEPC 3H0TB 3UTSD 1LK3L 2IAMB 2QBWA 3HE6A 3WUWA 4EXPX 3D2UB 3UZQA 2VLME 5C0GA 4PD4J 2EYTA 3CJJA 4JRYE 1A1NA 4P2OD 4QWWC 4X4YB 5CCKH 4WCYH 3H3BC 1K8DA 3GFUA 2C4FU 1X5XA 1RPQA 1OSZB 2AJXL 2H9GA 3DVGA 4KC3B 4FQQA 2PXYA 3UYOD 3O0RH 4OZGA 4LLQA 1AFVH 4HUVB 1SBBA 5DJ6B 1W72A 5K9KA 4CN1A 3GB7B 3HR5A 1G0YR 1T1XA 3SE9L 1S9YA 3L3JA 1J1OH 4GG6B 1PAMA 1RUAL 2HN7B 3INUL 1V7MH 1T21B 5GZND 1IC4L 3ZKQD 2YMXL 4Q9QH 5ID0A 3GUTB 5IQ7L 2J7LA 2Z91A 4UIMB 1S7TB 3C6LD 1U8IA 5H37H 5ID1B 5CS7A 5IW1B 4JY4B 3LKRA 5DYOB 2NXYB 5I8CA 3RHWK 5B3JF 5C71A 3LDBB 3ULUF 2P5EE 4PJFB 1NEZB 2R56H 1YYMH 4LMQI 1DL7H 1INQA 1NCNA 1AKJD 1UQSB 2ZSVA 5JIKA 3LD8B 5TE7H 5CKGA 3A67L 3QAZB 5HVWA 1B2WL 4I8DA 2AJSL 2JJTC 3IF1A 3OGCB 4FP8L 1UWXK 4AEFA 4TSBL 4L4VB 1AD9A 3Q6FA 4FQXD 3AS1A 2XXMB 1FG9C 4HS6B 3LS4L 4JO3H 4HXBH 5FA4A 4EXKA 5FIEA 1A3RL 5JO5B 1IKNA 5HJ3B 1QBMH 5HHPA 4Y19A 2MCG1 4UOW0 4CDHA 2GJ6A 3TT3H 3MBED 4J8RA 4OGXL 1WGOA 2DLGA 2CDGA 2XTJB 3EYFA 4HGWA 1FVDB 4CAGA 1RAMA 2VERN 2NLJB 4JR9H 3VFVB 3ZYZA 5DS8B 3QFJB 4FFWD 1KPRB 3GRWL 1ZT1A 3EOAA 3G5VB 4MSWB 43CAA 1CI5A 4HJGB 5D7IE 1ADQA 4U1NA 3UPRB 3HNSL 3BD4A 2OL3B 1IEAB 1IEBB 3T1FB 4RMTA 1GH7A 3FONB 5J1AB 2DQDL 2VMFA 4TVPE 2G2RB 1FYTA 3KYNB 5KG9A 2GTWA 1UACH 1E27B 3AS2A 3DWTA 2YD5A 3HZMA 3KPNA 4GRWE 5DK3A 2CMRL 1B6UA 3F5WA 1ZHKB 4YIQA 4K7FA 3WNKA 4AG4H 5ICYA 5EUOE 3TO4D 3PGCB 3QI9B 1F2QA 2ARJA 3BZFB 4UNUA 1AQDA 4MJ6A 3VRJB 5FHBH 5AZ2H 3SBWC 3C5ZB 2YPLE 4KKLC 1I9RH 3I6GB 1QSFA 3QXDA 3BEVA 1CLOL 5C0JB 4I48A 2XN9A 2C3VB 4P59H 3MRGB 1UCTA 3LIZH 3P0YL 5LBSH 4BK5A 1BIIB 5EC2B 2R15A 4G7VH 3KXFD 3JSSA 1G7PA 3O3AA 2Y06L 1KF9B 4I2XA 4MX7B 5DDHA 4DGVL 3LQAL 1E6JL 4PRDB 1URLA 1LEKB 2IALA 4PY7B 4AENB 1AO7B 1M7IB 1WBZB 2JJSA 3RBGA 2XFXA 4FQ1H 4Z0XA 1T22A 1OPGH 3ZO0A 1FZOA 3ULVF 5IHUH 5I15L 5L6YL 2H2PD 1N0XL 4DTGH 1BFOB 4S0TD 4OF3A 4XPGL 4ZPVA 3SDXA 1WZLA 1XR9B 4P57A 4QXTB 3MRMA 3LV3B 3O2WH 3MNVB 1Q72L 4F7EB 3WKMH 4HKBA 3MOQA 1YECL 3Q5TA 4KV5E 4L4TD 5BQ7B 4YK4C 3AVEA 3E8UH 3G5XB 2VE6A 1HH9B 3UXFA 5K9JH 1TNNA 3R06A 5ICZB 4WW1B 3D3VB 2EIEA 4X5XB 2FO1A 4F3FB 3WFEH 3QUZB 3X14A 1I4FA 3JV4B 3GSOA 3GI8H 5I1LB 1ZLWH 1WC7B 4N1CA 3T2NL 4F37K 1MUJA 4EUPB 4FMKA 1K4DB 5D70H 3KHOA 3LSOA 1YY9C 1E28B 1Q94B 3ARDB 4FQCH 5EZLA 2AJ3B 3LKQB 1XF4A 5IB5B 3HAEA 3U0TA 1JZ4A 3SE8L 3BKML 1C5CL 1R3JB 5DZNA 1KCSL 3HN3A 3B6SA 2BRQA 1QFUL 3SDYH 4C58B 1TVDA 3MRJB 2CK0L 2HT4D 3U82B 4ZD3H 3CFCL 3NCJH 1XAUA 5EIIB 4AM0A 1JFQL 1BZ9B 1HDMB 3M17B 4UU9B 5ICXA 4HUUA 4NC1E 1KEGL 2PTTB 4PJBF 4NO0D 5HGHA 3L95B 4HBCL 2EDRA 2DQHH 3WE6B 4RRPG 4N8VG 1QR1B 2F54D 4RNRB 5DHYA 3VFUB 4WGVB 1D6VH 1WF5A 3ARGB 4QRSB 3G04B 5E5MA 2V7HA 3VGEA 1NGPL 4R4FH 1P53A 2NW2B 3CXDL 4XBGA 2J2ZA 5T3ZL 5IEHA 3GMLB 3TVMA 4O2FB 3NZHH 3MV8B 1HQRB 2IMNA 4EI5B 1DQQA 3OHXA 2DQJL 5JXAL 1M7DB 3VCLB 5FKAA 1D5IL 2X1WL 5H37G 3Q6GH 4OTXL 1BWWA 4R90L 4Z8FL 3EOTH 3ZSSA 1JGUL 2X4SB 1JPGA 1PG7X 1QPXA 5DUPH 5GHWL 3JWDH 1D5BA 1I8KB 4JJ5A 2AXGA 3W0WA 3D1MC 3TWCL 2VZ3A 4GW4B 1A9EB 1AIFA 2G9HB 3GBNL 4M9OA 5E4IA 5HHOE 3RP1A 3KNBA 4EZMA 1W0YT 2MCPH 1EBPA 2O26U 4XCCL 3B9AA 3NIFF 3OKNA 2AEPH 3CMOL 4XC3L 3PWPE 3VDBA 3UMTA 1LD9A 3L9RA 1GOGA 5CZXD 1EHNA 1FO0B 3I3DA 4NT6B 2GCYB 4YHPA 2E6JA 2IH1A 3ZDYF 4V2BA 3VFRA 1U3JA 4O58H 3D39E 4ODVH 1EEZA 4OD2B 2QKIA 4MD4A 5E0QA 5SWZA 3QFDB 4QYOB 5HGDA 1H3GA 2XZZA 3VGFA 1HNFA 5EO1B 1DQMH 5F6HI 2KUTA 1Y18B 3LQZA 1EA9C 1K9TA 3MYJA 1S9VB 3U30C 4KMQA 4O2EA 3VJ6B 4FN0A 4LLWB 3IFPB 2QQQA 3C87A 5D72H 1CGTA 4YNYA 4U0QB 4LGRB 4OM0H 1II4E 4X6CE 3MRIB 1SYSA 5LXGH 1QO3B 2HJFB 3CC5A 3GKWL 2VNCA 4NKMA 3RL1A 3VFSB 2P49B 4PRPA 3T3PF 2ZKHH 2YWZA 5E08H 2CLVB 1S7QB 4K9EL 1IGMH 1ZEAL 5M7QA 3LCYA 3MR9A 2LE9A 4XC1L 5EWIH 2FWOA 4K8RC 4LU5H 1WBYA 4XCNA 1TVBA 5D2NB 1YEKH 1JF1B 1VACA 2GY5A 1JWSB 3BMWA 4ZXBA 5IVNA 2XNAA 1PGRB 2X1PA 4WWKA 2IFGA 5EULV 4WUKL 5L9DH 3OAUH 4KPHL 4LLMA 3C08H 4U1MA 5IT2H 4FQHB 3TPUA 25C8H 2VSCA 1TTFA 4U6YB 1J86A 1MVUA 2LVEA 3U9UA 3FJTA 3QWRA 3BPLC 3V0VA 3D9AH 3RVUD 1NDGB 4LVOB 4HIHA 5C07B 1Q9KA 3P4NA 3G5YA 2FEEL 4GBXA 2YUWA 2DI8A 3TIEA 1G6RB 3GSWA 5F88B 3IDYC 1NCCL 1QACA 4DOHE 5BV7H 2ZG3A 1U93A 4U6TA 2X9WA 4TUOB 3DIFB 1YMHA 2AGJL 3EYOB 4HLZG 5T33L 4F58H 4N5UA 4AEIL 4NNPL 1TZGL 3QYCA 4NKIL 5BOPA 2BNUB 4CW1B 1YNTA 1FG2B 4NQEA 3FB7B 3SKNA 1FNSL 1YY9D 1TTGA 4AQOA 1HZHL 4U2ZA 3TESA 2Y7QB 1OSPL 2XZAL 1OP9A 3P0VH 4AT6B 1T0MB 5I71C 1IL1A 2PW2B 3BQUA 5I1EL 5L0QC 3BXNA 3WS6C 5INCB 4KK5D 2X4TA 4PJ7F 3RA7L 2I24N 1PDKA 2WBJA 1K3ZA 3VMPA 2H1PL 4RX4A 3B9KB 5IFJB 1YN7A 1PY4A 4L8SA 2F53A 1Q38A 2NY3C 1DDHA 2ZUUA 4X4XB 5A2LH 2CQVA 4XP9L 4X5WB 4IDJH 4E5XA 2APTA 4K3DL 5CGYC 2BSSA 3SDCB 1RURH 8FABB 4L3EA 5GJTL 3MLVH 5BJTA 1TZIA 2ZJSH 3LN5A 5C0DA 4GAYA 4R4BA 3DECA 4M03A 4JQIH 5E8EA 5EN2A 3WHXA 4Z7OF 3N9GL 1NMCC 2NX5A 1N64H 1XIWA 3EDFA 3FRPA 4FQPA 1F3DH 4XWGH 1XZ0B 2XXCB 1JGEA 4B7IA 1LO0H 3A6BH 3RWEB 1WFUA 5JW4Q 4YBHA 4M7KL 3S36X 4PRHD 4WHYH 4XGZB 5GS2H 2I07B 35C8H 1U58A 1FORH 1HIML 5D8JH 3RWJB 1DBMH 1RUQH 3KYKL 1LK2B 4NC0B 1OGTA 4RMUA 3T0EC 4JJHA 4D9QD 3DX8B 4OT1L 3S36L 3PDOB 2R9HD 4RIRB 1K6QH 5C70A 2EKSA 3QDJA 3D25B 1EO8L 1B0RB 4CJ1A 4ISVB 5F7FA 3OKDA 2XZQL 1ZT4A 4UOJA 4YE4L 5KSAB 1T1ZB 3ARYA 4EBQH 4B7LA 3TYGL 4C55A 2VLRA 1JP5A 1TJHL 3DYPA 2XY1A 5C6PB 2PYFB 1K8IB 4ZSOE 3U48A 4UZGA 3QO0A 4MZ3A 1MQ8A 1KCVH 5MERB 1A1MB 1VKXB 5FB8A 3U0PA 3V52H 4HF5H 1GZQA 1DEEA 5HDQL 1MHEA 3ABZA 5FECB 3LB6C 4QRRB 1LMKA 2VXTL 1OTSC 5E99H 1FH5H 3IDMA 5D6CB 1UKQA 1I1AB 4KY1H 3BIAX 2R0WH 3ZYOA 4O5LH 5CSZA 4LPYA 5DD3H 2OTWB 3NFPA 3SKMB 4ODWB 5EBMA 3ZKMC 3LQMA 1CK0L 1CCZA 3RAJL 4OFPA 1JRHI 1QRKA 1NAMA 4QRPE 3RL2B 4DN3H 4TUJA 4NQTA 1JV5B 1DE4B 3PUCA 4YZFE 5C0EB 5KOMC 2CRMA 3UTPE 4KMTH 2CDEB 1LDPL 4K8RD 4OZIA 4BZ2L 1F58L 1UKSA 4HHAA 1H5BB 2JJTA 3QXTA 2NMSA 1KB5L 3T65A 3EJZD 2VUOA 3HB3C 1WIOA 3SGJC 1Q1JH 1BD2B 3GMNB 4P9MH 1HSBB 1MHHB 2W9EH 1RULH 2YEZA 5IVZB 4DZBB 3O9WA 4L8CB 4U1IA 1WITA 4HULB 1NFDE 5D1QC 2F5AL 3EFDL 5BRZA 2LV4A 2JCCE 3SJVD 2XRAL 1R6VA 1HILA 4YHZH 4U6VH 4IRJC 1AP2A 2HRPH 4ZUSB 4OFYA 1CLCA 1YDPB 1FAIH 4H8WH 4XPAL 5IK3A 2WIIB 5MEQB 1NGYA 4HJJL 2HVJA 3PP4H 2RB8A 5IKCB 3FOMA 3TC9A 3O8XC 5TPWH 3VXNA 5GGSB 5D7KE 2KBGA 4RGOL 2ZUQC 5ESVB 5INDB 3FQRB 2W9LA 3C2SA 4JFXA 4OZ4A 5JQ6L 2FJHA 4H20L 4G8FA 3WV0A 4JFQA 2EO1A 1U91B 3SCMA 3QZWG 4LAJH 1MLCA 5FYJD 5KSVA 1FCCA 1HSAB 1QQDB 3U2SB 2BRRH 2JIXD 2ADIA 4M6ML 1MQKL 5J13B 3CCHB 3ZDXE 1KFAL 3CVIL 4OCWL 4D0DA 3R0NA 3U1SH 3FFCA 3TNNB 1UVQA 4WFED 5DSCA 4JHWH 3QEQE 1FZJA 2FL5A 3SDAA 2YA1A 3OZ9L 1AQKL 1CDIA 4J4PC 4XP5L 5HYFA 3QNZB 2AKRA 4Z7UA 5IJVA 1KXTB 1FFQA 1QLEL 5EU6B 1DN0A 2APXA 4R9HA 5ENWA 4YR6A 3MJ8B 3I6KB 3VMNA 5EO9B 1FNFA 1KTRL 1A7OH 2W60A 4OLYL 4EQ2A 4PG9B 3V79C 2HAZA 4LASL 5DLML 2BSRB 3F6IA 4K7PL 1EAPB 3MRFA 1N5YH 5DRWB 2EDBA 3OPZH 5DR5L 5DJ8B 2CKBB 1U3HB 1T6VN 2NY3D 5B39B 2AK1L 5JORB 4F7TA 5CGYD 3IU3A 1OGAB 1BQHB 1D7FA 1S78D 4BQ9A 3D6GA 3LS5L 3OB0H 1NSNH 1WWWX 4U31A 2AJYL 2NY2C 5D1ZC 1U0QA 4UDUA 4ZOBA 4CUCA 1Y0LB 1DQDL 2W38A 4QRTB 4M5YH 1OAUL 4YDKL 3A6CH 3B5HA 3GJEA 1RZJH 3BH8A 4LFHD 2J3SA 2E8ZA 4PRID 4NQCA 4XNQA 3TBVA 4JM2C 4PRBA 4WTXA 2I60L 1TIUA 4PJGE 2UZYB 1MF2H 5DTFA 1T20B 3OKOB 5GZOD 3BZDA 1BF8A 4UBDD 4OCSL 1A3LL 4OBSA 2BSTB 4XAWL 5FK9A 3GBML 4MXVE 3T0ED 3QEUA 2QQKL 1KGCD 2VN4A 3QUKB 4MWFA 3GIZL 1C7TA 2C3HA 1T7YA 1CR9H 3W81A 1CG9A 2FD6H 1B0WA 5IB3B 4WHYG 3KS0J 4JLRB 1YEGH 2IGFL 3TBTA 3AS3A 3UO1H 1NLDL 4U05A 3EGSA 4ONGH 3EO0B 4DVRL 1CFTB 4R0LA 1RJLB 1S8DB 1OTTC 3H9SA 4ZMAT 4LCIL 4HWBL 1T03H 1IGFH 5KJRL 3NFNB 5I19H 1U8KB 2KH2B 2YUXA 4RQQA 2R2EA 1CXHA 1FVEB 1QNZH 4KJWC 3RIAF 2IANB 3UTSE 4KRPB 5I1KL 5GS1C 1G9MH 3EDKA 1SEQH 3K74B 3C6SB 4K3JH 3TV3H 4UV7L 1ACYL 4YHOL 4G7YL 1AGEB 3BPOC 4KAQH 4NHUA 5DMIL 2NCMA 4QKXB 4J1UB 1Q9LA 3LB6D 3H7BA 5L7XL 4Z9KB 4BZ1L 5IOPB 5JR1L 4TUKH 3R0MA 1AXSA 1I1YB 2PUQT 2E27H 4NJ9H 5HGBB 2DWDA 2FJGA 1PLGL 4PUBH 4XH2B 5LVEA 4JPWL 1WEJH 3UJJL 4LF3A 4PB0L 2A77L 1KPVA 3QCTL 5DGRA 1WICA 4L9LC 3QULB 5E2WL 3L1OH 4NDMA 5D1XC 1UWGH 3ZKMD 4GUPB 3VG9C 4LVNB 5ERWB 2J5LB 3I3BA 2R1WA 3QDHA 2A6KB 3NABH 4LSDA 2BCKB 1CE1H 3CSYB 5FA3A 2I9LB 1G7HA 1EX0A 3ZHKA 3RWGA 3O6ML 4W81A 3QDGA 2OZ4H 5BXFA 2VDRH 4PJAA 5TJWK 4QF1A 3BHBB 1VHPA 2VDOH 2VXSL 2X4NB 3HB3D 3MJ9H 5E8PB 1XGYH 4JPVH 1K5NB 4HK0B 3MMEA 3R8QA 5T1MB 4Y5YC 1CFQA 5ANME 3TN0A 3TLRA 1AGFA 1MWAA 4A6YL 2V7NA 3QIWA 1YN6B 4K3EH 4P46C 2ID5A 2F8OA 5D1QD 3R8BB 1S7RA 3BWAA 2AV1B 2DM3A 1JGLL 4JCMA 5F7HA 1BVKB 3NCEB 1OL0A 2AQ2A 2PYEA 1HCVA 4IRJD 3UBXI 5HHQB 2WMPA 2N56A 3WLBA 3EO1A 2ADFH 3PHQA 1KJ3H 3VWJB 1W0VA 1JUFB 4YXLL 2OYPA 1GPOH 4IOFC 3O8XD 4BUHA 2XPGA 4PG2C 4JFFD 1L9NA 2PO6B 3F62A 1UCBH 3U36B 1FL5A 3VH8G 5E4EC 1KEML 1IGJA 1T89C 3QO1B 3I6LD 2DLTA 2P1YA 5D7IF 3VXUD 1MCFA 1CE6B 4UTBL 4JPIA 3ARBA 4JY5L 4K71B 3BDYH 4HJ0C 3EDDA 1SY6L 5EDXA 4LBEA 4JG0H 5D7JA 3UTTB 1MH5B 2IBBA 1OM3H 4XNYH 2C3GA 5EC1A 5CIPH 5IB1A 1SJEB 2BXYA 3VXMA 4JO1L 1QLRB 4OZFH 4QOKA 5FOJA 3S5LA 3LPGA 1QFHA 3VGAB 2LAAA 2C1PA 1EEUA 4J4PD 4DZ8A 5C0CD 1HHGA 4YDLC 5CP3A 1EJ6A 1SVZA 2IBZY 2X89D 4HFWB 1BWMA 1NBQA 5CEXB 3BISA 5ACMA 5JDSA 3U4EA 3K4DA 4ALAL 4NN7B 5ALBH 2E7MA 4I18B 4XP4H 2FIKB 1O0VA 3IJSA 3STZB 3SPVA 3U9PL 1BFVL 3S37L 1E4JA 3MLTA 4JHAL 1VGEL 5DJDA 3KXFE 1BEYL 1P4BH 1DUZB 1U92B 1U3YA 3STLA 1AR1D 1MRDL 1T1YB 3MXWH 3MUGB 2NY2D 2EE9A 3O6KL 1WFNA 5D1ZD 5CD3A 1C08B 1HE7A 5ISZD 4HX1A 5C08B 3LQAC 1RK0B 1ZTXL 3MCKB 2X4RB 1L7IL 4S10A 4F7CB 2GT9B 3QIBB 5HVGB 2Z35A 5CBEB 1D6EA 4LOUC 3M8OH 4KV5F 4JKWA 4PJIF 4L4TE 3QG7H 1KG0A 3IS0X 3OXSA 4MCZA 1GOHA 3FHQA 3I9GH 4MXWH 2ATKA 1XGUA 3EJJX 2W0FA 4TTGA 1S5HB 4JRYB 5BZWB 4MHHI 3W9DA 5F6IB 3WFBL 4ZOAA 1OTTD 3CPLB 2F5BL 2H3NB 1I7UA 2EDYA 5A2JH 5JQHC 3KYMB 5IBTH 4PR5A 2CD0A 1DBJH 3UC0L 3C8KB 1MJ8L 4F7MB 5AZEH 3LZFL 2C26A 1ETZB 2NW3B 2GHWB 5D4QA 5GRZA 1A7QH 1J18A 3QRGL 4GAJH 3CH1B 3GIVB 4NQSA 2YWYA 3OR6A 4I77L 3S98A 5ADOH 2XTJD 4LAQH 2GK0B 4NCC1 4WFFD 4WNQA 1X5FA 4H5SA 4GMTL 5F96H 3HMWH 5MEND 2RR3A 1EJOL 5HYQB 4WU5A 5A16A 2QQLL 1NBVH 3BP7B 1K2DA 4R4NC 3DV4A 1LE5B 1JCKA 5D1XD 1FBIL 4EQ3A 5KSUB 4PLOB 5EBLA 4Q74A 4P3CH 3O6FB 5HD8D 3VXQA 2DQTL 4AMKH 3ZL4H 4ORGB 4TNWF 3GJFB 4NM8L 5TQ2H 5F9AC 1GSMA 3OWEA 5EFIA 3RPKA 3VFWB 3HZVA 5GRWA 3I2CL 2P5EB 3S97C 4G8GD 4KQ4H 5CSGA 1IC5H 4NO3A 1IMHC 3ZTNL 2F54E 3QI9D 4FHBD 2FO4B 4S1SH 4WUUA 5EBWA 3DRQA 1X5YA 4XBPB 3VW3L 1GZPA 1FC1A 4MDJA 5DQJA 2DJ4A 3RNKB 4LPTA 4JFZL 3HC0A 2ENSA 2VDML 1VPOH 1OWRM 2VR5A 1SM3L 3V4PL 1HXMB 4Q97A 1GL4B 3IDGA 3GK8L 3RGVB 4HH9B 3TYFA 3FB6A 3R1GH 4FZEH 4P46D 1TVHB 4JG1L 5I6XB 1OAXL 3CFDB 3MREA 5HGAB 43C9B 3G6JE 5TH2A 1BVZA 3FTGA 3JTSB 1LE9B 4BQ8A 3L5WB 2O93L 1R3KB 3VMOA 1MHPL 5D7IB 1AO7D 2XY2A 1U8MB 2EICA 1HHJA 1MPAL 1KIQB 1INDH 5HI4C 5H94B 1YC8A 1UJ3A 5F9JB 1XH3A 4LLUB 5E7FA 4ZUUA 1JNHA 3IYLW 2AEIT 4KI5C 4XX1E 3MLYL 4LLDB 1EH9A 1FV1B 4FQLH 3RY5A 1NL0L 2HFEB 3QPXL 5CLTA 4CMMA 3KWWA 1T7XA 3BW9B 1P7KB 5FO7A 1A6UH 4HJ0D 4EJ1C 4NOBA 1KCUH 2IPTH 3SO3B 4BSVA 3LKSB 1FFPB 2IBGA 1MIMH 2YPLB 5DUBA 1T0NB 2EXYC 1HINL 5IFHH 2ZCLH 1TFHA 4CADA 2DM4A 4Z76A 2QLVB 4M6OH 4IMLB 4NQDA 4JRWA 2Y5EA 4JY6B 3H42L 4H25B 4QTHA 1UYWL 5DQDH 4N8CH 1X5HA 4NN6C 5CJQH 3EFFB 4X6CF 3IU4H 4WHTB 2VZSA 4CVZA 1RU9L 3FFCE 3LKPB 3P9MB 5M94B 3ILPA 5C8JB 5E6YA 4OZFG 1OW0A 1S7XB 4F33A 3BP6B 4LMQE 4TOYH 1M4KA 2VDLL 5JPNB 4L9DA 2R69L 5GGSY 3PL6B 4O51A 1C5BH 2P43B 3SGJA 3FQWB 2OR9H 5DI8A 5KW9H 1OAYH 5I1CH 2CLZB 3BX7C 4KUZH 5FV1L 4K9EC 5CILH 3U7WH 4Q0XL 1TLKA 2HA1A 4RMQA 3L3GA 3EIFA 5L8LB 3MROA 4JFOB 4TTDD 5ESQA 2P7TA 1CN4A 4XB8A 5GRUL 3O3DA 4OLXH 1CFNB 4JQXC 1EUTA 4Y0GA 2HTKD 3RRQA 5EZIL 1RZKL 4G9DB 2ZOLB 5TF1L 1S3KH 1WIPA 3MRNA 1MIEH 2L7JA 2JK5B 4LOUD 2BVOB 2YPVL 3LN4A 2VN7A 1CQYA 1LEGA 5SV3A 4NQCE 4ZFZA 3QWQB 3DUHA 3QISA 2BY3A 4MDIA 2Z0BA 1BREA 3KPMA 2CGRH 1XMWA 2ICES 3MV8D 5FUOH 5HDOA 5KVGH 1CGYA 4C56D 4UB0H 4EI5D 5LGJB 5IW6A 1WAAE 3OF6A 3WIHA 5CWSB 4MA8H 3WN5A 1JZ6A 4O02H 5C0BA 1GCFA 2DD8L 5C3LD 2DBLH 2F74A 1KN4H 1XGPA 2H8PA 1XT5A 2UZIH 2CIIB 4NSKB 4RGNB 4BSWA 1DVFB 5AUMB 3AAZA 2Z8VC 2BVPA 3F6LA 1CFVH 2UVFA 3O3EB 3BAEL 4XCYB 5TGBA 1HKLL 5J8OA 2R23B 3G5ZB 3T04D 4RAUB 1CF8H 4J3WA 1IJ9A 1WQVT 3OSKA 1I9IH 4CMHB 1A7NL 4MJ4A 3VFPB 4LSSH 4MA7H 5JA9A 5J89A 2ORBL 5CJXA 1P9MC 4L3AA 2APBA 4BK4A 3HI5L 1F8TL 1T4KB 3D18A 5CP7B 3AM8C 5ESAB 4R4ND 2GITB 2NPLX 2P4AB 1EEYA 4OZGF 1D5ZB 5I8KH 1DLHB 2XT1B 1ZWIB 3ZHLA 4HEME 5DMKA 5FM5M 4ERSH 1HHIA 1CFSA 3HZYA 1A6PA 1P5UA 4XMLL 2DMBA 2QHRL 2ILLA 2EIZA 4NN5B 2AERT 1UEMA 4XX1G 4C4KO 3ZTJH 3RX7A 4OLVL 2YA0A 3NFSH 5CHNA 2KQMA 2O61A 4JM2A 4QXGH 3NIDF 4J2XA 3OGOE 3GSNH 3IDIA 4EEEA 4P23C 5JW4N 3BP5B 1B3JA 2XQBH 2IWGA 1ZGLP 3FQXB 2V5YA 3TJHC 3WLWC 1EIBA 3GHBL 3RZCC 2HJLA 3G6DH 5T1LD 4KHTH 4UDTA 1ZVSA 3QDGE 4TSAH 5L2JA 4PJAE 5BOZG 2YD1A 4MNHB 2GUOA 4WI8A 2ICWA 5T3ZD 2A83B 5HHOB 1G9EA 3CX5K 3U7YH 5I8EB 1L0YA 4PRHE 1IAIL 1P2CA 4P2RB 4Z7WE 3FB5A 4HIIA 3ULVD 2V2XA 2BHZA 4U7SA 4ZFGH 1C12A 4D9QE 4M62H 2BJMH 3BN3B 3PWPB 2UYLA 5B38A 4PRAB 3QXAB 4E41D 5C9JA 1C5DB 4G6AC 4N0CC 5I73B 1NUGA 3RNQA 4K8RH 2DWEB 3GSQB 5HI4D 2YZ8A 1CDUA 5KS9E 2WUBH 5IR1A 4NWUH 3S8WA 2YZ1A 3MLUH 2KPNA 4KI5D 5DUMH 4Q6IC 5IMOA 4C4KT 3FO9A 5H2BA 5ACLA 1CGSH 5D7LD 1JPSL 4Q2ZB 5DJXB 5C2BH 4MGXA 5CSBA 4NNYA 2FHCA 1H0DB 3HPJB 4X6FB 5MI0C 5BZDB 1VFBB 5H8DA 5C07D 1BF2A 1DSFL 3BE1L 2X70B 3MYZA 1MREH 4JVPA 4LCYB 5LJYH 3N06B 1OQXA 3DUUB 5AWNH 4X6CB 2FR4B 2EXYD 2B4CC 2ARJQ 1P4LA 4YXHH 3KPPB 4H88H 4XPTL 1GGYA 1NCAL 4WEMB 1TJGH 1LO2H 5SWSA 3BT2H 4K94L 1MFDL 4BFBD 4MCYA 3WFCH 5B3NA 4EN3C 2D7NA 1QSZA 1NC2A 2A6IB 5F72S 3QPQD 4DKDC 2IBZX 3FO0H 3FT4A 4KTEH 4R2GB 4Y5VC 1KIRB 4JEGB 3X12B 1FPTH 1LO5B 1F00I 3O3BB 3FT2B 4P2QA 1QHPA 1T7WA 1ZLVH 1W72L 1DFBH 4YZFF 3GO1H 4K3GA 4HXAH 5JHLL 1CBVH 3RVVC 3RVXC 3CDGA 1AGBA 1NKRA 2HJKB 4NO2A 4BELD 1LO3L 1G6RL 1ZA3B 3LN9A 3RWHA 4WV1A 3VXTB 5BO1H 4PJXA 3NN8A 5DJ0B 2I25N 4D3CH 3V5HB 3BVNA 1S9XA 2X1OA 2OLDA 4MNQA 2BC4B 1IGCL 1ES0A 5JHDD 2GSGB 2YC1B 5C2UB 4ZS6C 1TZHB 1SJHA 5C0ND 2UUDK 3LRSB 4X9HA 3SJVE 4RBPK 4Q6YA 5IUSA 5IJKA 4DOHB 4PRNB 2D31A 4I0PB 3UP1A 5L8KB 2E9BA 3SDXF 5F7MC 3SY0B 1IEHA 1T89A 2KZ1B 1KJ2A 4U1GB 1JPFA 3HPLA 1XF1A 4NZUL 2VAAA 3K2MC 4LCWA 1R5IA 2LVCA 2RCSH 4GW5A 3T0AA 4LDEB 1JTPA 3DX6B 1HYSC 3S88L 2BMKA 3RKDC 1EMTL 5EOCH 4XP1H 1K4CA 2EYTB 5DA0B 1RZ8A 4V1DD 3BMVA 2R8SH 5ALCL 3DV6A 1C8PA 4AIZA 1KPUA 4M1CC 5MEPB 1G0DA 3I50H 5EOTA 3DVGB 5HGGS 4FQQB 1ADQL 4LSPH 4WFEE 4R26L 5IMLA 4OZGB 5JUEH 2EYSB 2OK0L 1TDQA 4OCYH 2R4SH 3RKPA 4LSVL 2H41A 3S4SG 3EO9L 4NHCH 5D7SH 4TULH 1CXIA 4OLZL 1FVCA 1S9YB 1U42A 1O7VA 3UTZA 3QZWB 3IJHB 4HS8H 4OKVA 4PJ9A 1UZ6E 4XNUH 4WTZG 5DWUL 1I1CA 1KBGH 4CU7A 5BV7B 1NLBH 2Q8BL 3DARA 1GOFA 2OR8A 1UT9A 1FFOA 2VABA 2W91A 1KNOA 4OLUL 3ARFA 3QEHA 1I1AD 3S6CA 5FUCC 3GNMH 3PXJA 3LKRB 3FFDA 4X80L 2NTFA 4P5TA 4JFED 4P23D 3D69A 1INQB 2ZSVB 3WLWD 3QJFA 3RZCD 1KENL 4NFCA 3L7EA 3ZTJG 3IF1B 3PWNA 1AD9B 1PKOA 3C5SA 1NAKL 4BSJA 3Q0HA 2GJZA 3SKJH 4B0MM 2ZNWA 4GXVL 4NKOA 4MXVF 3T0EE 5IB4B 5HHPB 4MQ7A 4DCQB 5FHAL 1KGCE 1I7ZA 3IDNB 4G6AD 5MP6L 1NBZA 1GGBL 5HYSA 1A4JB 4JANA 5TE6H 5CJOH 4ZSOB 1BD2D 4YLQT 1IBGH 2IFFL 5E1HB 1N4XL 4Y2DB 1FJ1A 1OB1B 2FX8L 43CAB 3KPSD 4DWHA 1BFTA 1CT8A 2Z31C 4HIEB 2NY0C 3EOBA 4QRUA 4HAFA 3AXLA 3MRCA 3QHZH 2OJEB 3BYYA 4MA1B 2NYYC 4JO2H 4LRNL 1RIUH 1A14H 3LMJH 4XVTH 4M1GH 3KPNB 2FBJL 4OSUL 4I0KA 1UM5L 4TSCH 4APQA 1U8OB 5HPMB 3BD5A 3ZT6A 2E7CA 1DQJB 2ARJB 4ZNEE 2EIDA 2EDNA 3WXWH 2R29H 2VLJA 3IKCA 4JVWA 1OLLA 2WSKA 5C0AD 2NY7H 4JB9L 1YY8B 3QB7C 4EN3D 4HWUA 4XVSH 4NQDE 3VGDA 8CGTA 1ZKAA 4CU8A 1Z9MA 2DQGH 2CR6A 3OR7B 4NNXB 1EXUB 1NGXA 4FQJL 3O3AB 3TT1L 1G7PB 2RBLA 4I2XB 4U1JA 4OIIH 2W9DL 4ZO6A 5DDHB 2X42A 1MJ7H 4KU1A 3ES6B 5E00A 3RVVD 1O7SA 5HYIA 4OF5A 3RVXD 4QGTA 3MCLL 1JRHH 5J4MA 3BN9C 4N0UE 3V0AC 1TMCB 2IALB 4PJDE 3QIUB 1M05B 4XHQA 1NFDB 1A64A 2MQ0A 5CKAA 5AYUL 1KN2L 4IIQB 2GAZB 4WFGD 4YHLL 3AMKA 3BESR 2CUMA 4J12A 3UYRH 3KYAA 4YDJA 3NCMA 5I0ZA 4YGAB 5IGXH 4ZTPL 2WWMD 2P42B 3MODH 4M6AA 4ETQB 5FM5O 1EFXA 7CGTA 4M43H 4ZPVB 3NVQA 3MV7A 4R7NA 1KULA 4P57B 5E6IC 1P84K 1V05A 4ZUTA 1WWBX 2P45B 2CJUH 1F6LL 1N59A 2AJZA 1Z9SA 4O9HL 1UXSB 3EDEA 1P84J 1FCGA 3PHOB 1KC5H 1NFIB 3WJLA 4FFZL 1EHAA 2VE6B 4P48A 2J12B 32C2B 4KGJA 3R06B 1ZGLB 4PP2B 1TNMA 1BM3H 3DRTB 3VXRA 3KPOB 4JFFE 4KVNH 5ADPL 4ELME 1ONQA 5I1GL 1NC4D 4HUWA 1HYSD 2LFGA 5FCUL 4YUEL 4NRYA 1IGYA 4KK6C 4GXUM 3O81A 5GGUA 3T2PA 5B8CB 1MUJB 2K1MA 3LSOB 3LHPH 1G7QA 3M1BB 1FZKB 1AY1H 2R0LH 2WP3O 4UT6L 5EZLB 4M1CD 3QBTB 5F89A 4KKAC 5E8DL 1CLYL 3DI2B 4U1SA 4BYHA 3E1F1 4YPGA 3QWOA 1I3RA 4G3YL 3K4ZA 4HZLB 3DX9A 4LFHG 3VFTB 2FGZA 2G75B 3B6SB 3JV5A 5LAXB 5DHXB 5C0CE 3VFMA 3BD3A 2P8LA 4XVUC 2NY6B 3UJTL 5LCVH 3SQBA 3CVHH 5HYJA 1A7BA 4ZAKC 4UIKL 1QEWA 2A74A 5IV2A 2UVEA 3KS0H 5HGHB 2ZUXA 3KJ6L 4HW6A 5CD5D 5JOFA 4OGAC 5F7WC 2X4UA 3LRGA 1AHWB 1DEDA 3KPRA 4PLNC 1SEBB 3GMPA 4N8PA 4E42A 1JZ3A 3LY6A 4KJYA 3P4MA 4ZUWA 2V7HB 1S5IL 2OI9C 1X5GA 5F1IB 1LILA 4XBGB 1CVSC 5IEHB 5DJAA 4F15B 2BNRA 4RMSA 2WP3T 2AEQL 1A9BA 5ISZE 4JQVC 5DJZB 3MQIA 1QFWI 3OHXB 2VDPL 3FO1A 1KB9J 4LARL 2AJXH 4OLEA 1PW3A 4Y1AD 2SEBB 3K0WA 3VI3F 2ADJA 1D5BB 2YRLA 3NAAL 2HTLC 5FF6B 4RFNB 1D9KC 4JJ5B 4ZFFA 2FZ3B 1DLFL 2KQNA 4UV4L 5I18H 3SE9H 3WUZA 4LLYA 1MHCB 3RX8A 3KNBB 1ND0B 1RUAH 1IQWL 3UTSB 3INUH 5I75B 4O4YL 1OP3H 5D5ME 1Y6KR 1T7ZA 1F2XK 4JZJC 2YMXH 3OKNB 1BECA 3K81A 5IBLC 5IQ7H 1OF2A 3T3ME 4GRLC 4PREB 3BGMB 2NY0D 4YHPB 5GQBA 1SBSL 5I1HL 4KROC 3O4LA 3TIDB 1EEZB 4ZS7L 1FAKT 2NYYD 3BP4A 4PGZA 2QKIB 5CINL 5CMAA 5SWZB 2UY6A 2NXZC 1R5VA 1F3JB 3A67H 3AREC 5JZ7C 1QRNA 4Y5XA 3BPNB 1YEFL 4FP8H 1G7IA 4TSBH 5JOEA 4LVHB 4WFFE 2AEWA 1SJXA 2YA2A 3MLXL 3GGWA 2PO6D 4YNYB 3WFDL 1OLZA 5MENE 3VDCA 3HE7A 3VXOA 3B8YA 1JTOA 1GIGL 3LS4H 1SYSB 2PN5A 5B22A 5EH1A 3CC5B 3SEPA 2FIRT 3ZE1E 3WL9A 3C6LB 2AV7A 2VR4A 4HUNB 4OGXH 1DP0A 4I4WA 3UTTD 3SO3C 4XZUA 4RFEA 3V0WL 5LWYH 2C3XA 4OD1L 2WIMA 4HV8A 4Y16C 2YD9A 4G8GE 2LABA 5JMRA 3GRWH 4XCNB 1AXTL 4OJFH 1VACB 4ZXBB 2DQUH 1S7VA 1HYRC 4FXGA 3QUXC 4WWKB 1RJYA 3HNSH 3OAZH 4Y4HC 2WINA 3H2WA 4FQXB 3T0DA 5E2VL 4WI9A 2DQDH 3SDDC 3S35X 4LNRA 1W2KT 1MELA 3TPUB 4PJ5A 3PV6B 3QP3A 1MVUB 2PCPA 2CMRH 3E6FA 5E6ID 3V0VB 4XAKE 3W9EB 2ADGA 3NCFB 3LPFA 1IM9A 4OZHA 3PL6C 1U8LA 3G6JF 5I76B 1X4ZA 3P4NB 5I2IA 2P5WA 1FNGA 1INEL 4GBXB 1X5ZA 3TIEB 1JN6A 4U1HB 1AO7E 4N0FB 1CLOH 4YHNB 3F7VA 3P0YH 2ZSWA 5JNYA 3GMQB 5F8RC 1YMHB 1N8ZB 2Y06H 1HNGA 3ORJA 3QIBD 1A1OA 4DGVH 3LQAH 3T0VA 4M48L 1E6JH 1L4IA 4PJ8C 5B21A 2P8PB 5DMYA 2A1WH 4POYA 2KZWA 4NQEB 5J11B 4XI5C 1RZ7L 1J12A 2VC2L 2A2QT 4DKEL 5GGRY 3IETA 5I15H 1N0XH 3WEXA 5IVXA 4XPGH 2Q7YA 2WV3A 1U8JB 1J0KA 2AJUL 1Q72H 2X4TB 5CUSL 5D6DA 1IAMA 3S34L 4MQSB 1YQVL 4YDIL 3KXFB 4PGEB 1YECH 2Q8AL 3BZEB 5IHZB 1A7RL 3G08B 2DF3A 4U7MA 4ODUA 1I1FA 1YN7B 2JB5L 2DL9A 3IFLL 3PIQB 4I13B 4L8SB 4TNWK 2F53B 4RGNC 1A7PL 4Z7UF 1DDHB 2YPKA 2VLLA 4OGAD 4YO0A 5FEBA 1F4HA 1LNUA 4E5XB 1KT2A 4FZ8L 2BSSB 3OJMB 3WD5L 4LKCA 5FO9B 2AXHA 5A2FA 3GSRA 3RWFA 5BJTB 1TZIB 4XVJL 1NAML 3L3DB 3T2NH 1JWUA 3QJHA 3V4UH 4PJEA 1ZLWK 2QQNL 2NX5B 3PP3H 4GQ9L 1XIWB 4M61A 5KAQF 5CIPB 4DUXA 4ZTOL 2IPUG 2ZWLT 5DVMA 5C0IA 4OZFB 3CFKB 4L4TB 3AFLA 2B1AL 3T2QA 3DXAA 1TETL 4GMSL 3FOLA 2FHFA 2DLFL 3SE8H 3BKMH 2P5ED 1C5CH 1KCSH 5IIEA 1PKQE 2R4RL 2HTLD 3NTCL 1D9KD 1QFUH 1U8QA 3PJSA 5GRJL 1RZKC 2CK0H 2UY7A 1S7WB 2EKSB 3QDJB 3CFCH 4DEPB 3SKOA 1ZHNB 1MAMH 1KEGH 3V5DB 4XTRD 1NGZB 2YKLL 3PQYA 4GG8B 4ODXA 4C56E 4ODSL 2NR6C 2D7PA 2HFFB 3ESUF 4U6HA 5IBLD 5T1KA 4GRLD 1U3ZA 1H3UA 4JGJA 5C6TL 3RGHA 4DAGL 1Q0XL 4JRXA 2ZUTA 1MJUL 3NPSC 1T66C 4M3KB 1JNLL 1NGPH 3QO0B 4KROD 5J9PA 3CXDH 5T3ZH 4H1LH 1SJVA 1IAII 4M93C 1A5FL 3DTXB 2NXZD 4EDXA 4FFVC 2DYPD 2XG5A 2DQJH 5JZ7D 5JXAH 1ZLSL 3MOBH 3IDMB 3S96A 2B20A 1D5IH 3AB0C 4OTXH 2ERJC 2R1XB 2GFBA 2B2XL 4R90H 4JDVA 1EEQA 1UZ8A 4XXCC 1JGUH 3RX5A 5BW7A 4Z8FH 4NO0B 5EU4A 5GHWH 4FTVD 4NUGH 3EZJB 2DJUA 3LEVL 1NUFA 5EZOH 3ESVF 1OOAA 1WIUA 5EBMB 2DAVA 2F54B 4LCCA 2OR7A 2EC9U 3RVTC 3GBNH 4TUJB 5MEOA 3GSVA 2ITDB 4HDIB 3BIBX 4G42A 4XCCH 2YPLD 4W4NA 4Y16D 2CLRB 4OUUA 3CMOH 2X9YA 4J23A 1DR9A 3BUYA 4XC3H 4HHAB 3JWDC 5H35A 1T5WA 3EYSL 3GMRA 1V7ML 3QUXD 1V7NL 3IAPA 4OUOA 5T1DL 4DN4L 5BVJA 3TO2B 3G6JB 3QQ3A 3DVFA 5FGRA 3SDDD 2E6QA 1WZ1L 1D5MA 1ZSDB 3MUY1 1I3GL 3W39A 4TVPL 4TNVF 5HHXH 3QUML 3IXTA 4QHUB 4PJAF 2X1QA 5IP4A 4U1IB 4IHOB 5T3ZE 2FBOJ 5A3ID 4I3RL 5BRZB 2XA3A 1KIPA 3PL6D 2XWJB 4Z7WF 4MA3A 4R3SB 1UWXH 1AP2B 5I1DB 3ULVE 4WI5A 3ZKND 3H9ZA 4G5ZL 5IWLC 2QV2A 2D9CA 5FOBA 1NGYB 1WCBB 3MV7E 4I3SL 1B90A 2HVJB 3GKWH 1D3CA 4WO4A 4E41E 4X6BA 2WLZA 3ROOB 4JZOB 2Z31A 3E2HC 3VXNB 3NGBC 5CEYA 1JE6A 4K9EH 4PTUA 1ZEAH 4BH7B 5IMKA 5CEZL 4KI5E 4JE4B 1QBML 4HWBA 4XC1H 2UWEA 4JFXB 5D7LE 4OZ4B 3BKJL 3GM8A 4F8QA 3ZE2F 4BFIB 4PJ8D 4LHUD 4GKZA 1E4XL 2YRZA 3DO7A 3UBXG 1VFAA 1DCLA 4WUKH 5C07E 4XI5D 4D0DB 1I8MB 3B8SA 4KPHH 4GO6B 3CFJA 3FFCB 1UVQB 5DSCB 3QHTC 1A4KA 3SDAB 1UM4L 2J8UA 4U1KA 1BZQK 2E9WA 4XNZC 4YR6B 5ENWB 4ZQKB 4LPWA 2DL2A 2W60B 4AG4L 3HE6C 5DQ9B 4Z7VA 3MV9A 4TVSa 4UQ3A 5DK0B 3MRFB 3FB8B 4I9WD 15C8L 4UQ2B 4RGND 4URTB 5EOQL 3QUYA 1NCCH 3NCBB 2OCFD 5FHBL 4UOW1 5GXBB 3BPCA 4F7TB 4ZFOA 2ZNXA 4XHJD 2PXYC 1IT9L 3TH4T 5ILTL 2PTUA 2XWBB 3RI5K 5T33H 4D8PA 4TRPL 4AEIH 4PJBE 2VDQL 4NNPH 1TZGH 4NKIH 3DO3A 3DPBA 3KPRE 5M95B 5GS0L 1FNSH 2XOTA 3GJEB 1HZHH 3T8XB 1I7TB 3RU8L 3H9YA 4NQCB 1G7JA 4XNQB 3TBVB 1OSPH 2HFTA 2XZAH 4PRBB 4YK4B 5JHDE 5IVOA 3TA3C 3NZ8B 5I1EH 3WJJC 3FAXA 2A9NL 1PX4A 3QEUB 5DHVH 2K3TA 2AVGA 3RA7H 3B2VL 3QQ4A 1MWAL 2K9UA 4N1EA 4WW2A 1MI5D 3CUPB 4P9HL 3HG1A 3TBTB 3EGSB 4O2CB 1XGQA 2NR6D 2G60L 4M7JL 4ONHA 4XP9H 4G9FD 1OP5K 4D0BA 2R1YA 4C59B 4RQQB 1I8IB 5HDLA 4YHYC 3IJYA 1VSCA 4G6ML 3C8DA 5GJTH 5E9DD 4P2RD 2EE2A 4XPBL 4MAUL 3RWIB 3P40A 4V1DE 4L4JA 1EGJL 1PBYA 3KLHC 1U8HA 1IKNC 3P77B 2Q7NA 4MD5A 4JDZA 2X4QA 2VDNH 1Q9LB 1WISA 4MLIA 2X5PA 4WIQA 4FFVD 2O5ZL 3V5KA 4Y4KC 2X9XA 3C5JB 4ZOCA 4ZAKA 1N7ML 3ZKXC 4JREC 3ZDYE 4MHHG 3O41A 2AQ1A 4PJHE 1A6AA 4WGWB 4M7KH 3K2UL 3MZTA 4H1LG 1NCDH 3KYKH 2NY4C 3U46B 2BFVL 1ORSA 1F3DJ 4OT1H 4TYUA 4MJID 1YYLL 3S36H 4YXKL 3RVTD 5TF0A 3WNOA 1XF3B 1EO8H 1T04A 3K80A 4UMGA 1IILE 3SDYL 4QGYA 5E1AA 4D9RD 2I5YL 4YE4H 2IH3B 3CGTA 2MPAL 2ZG2A 4JQVA 3RWGB 5C09A 1F4XL 1LEIB 3QDGB 5BXFB 5L88H 5GRXG 3TYGH 3QEGH 4PYHA 4PJAB 3T3PE 1VERA 3IVKB 2D7QA 5C7XL 3MRDB 4A2MA 4CU6A 2B4CH 5L2KA 3S4SB 4PRHB 4WJ5B 4JFEE 3HZKA 4Z7WB 2EECA 3MMEB 3OJDA 4F2MA 3RPIA 1B0GB 2OQJB 1CFQB 4RZCA 2MHAA 4DK6A 1D6VL 3L6FB 2EXWC 1AGFB 5HDQH 2HFGL 4LLVA 1C1EL 5AG9A 1H15A 5JW4M 2GTZA 2VXTH 4MJ2A 3H0TA 3FN9A 3WO4C 3L5HA 2IAMA 1F4YL 3BWAB 3D2UA 3OKMA 4RCAA 5KS9B 3BKCH 4G43B 4X4YA 4JZJA 3WLBB 3EO1B 4S1DD 3N0PB 3PHQB 2WBKA 1FFNB 4NZRL 4W70A 2I9TB 1OSZA 1V3MA 1CK0H 1W0VB 3RAJH 2JJSC 4OGZA 5JLZB 3VFOB 2XPGB 4PJCE 1CGWA 4Q9BA 1BD2E 4JFDA 3ZHDA 3VE0B 4OCXL 2PTVA 3DSFL 5DJ6A 3UPCA 4AY0A 1JPST 1RQ5A 2YBRB 1UXWA 1IGJB 3GB7A 5IQ9B 1RIHH 2E7LA 3CSGA 3KPSE 3CD4A 1LDPH 4B5EA 4BZ2H 1BX2B 1F58H 3GSNB 3AREA 5J6HB 4QEGA 2HN7A 3U30B 2BY0A 1T21A 1KB5H 1Z6JT 2PR4L 4I0PD 3GUTA 2FECL 3MUZ1 2EO9A 3BRFA 1B6DA 1MCEA 3QQ9C 3S5LB 4HPOL 5ID1A 2NY5L 5IW1A 4JY4A 5DYOA 5F7DB 4DZ8B 2F5AH 3EFDH 3K1DA 4PJFA 2NZ9D 2XRAH 1NEZA 5C0AE 2PKDA 1UQSA 3U4EB 2YRPA 2R2BB 1NMBL 3HE6D 4IDLA 4XPAH 3EUUA 3CLFL 3OGCA 4HJJH 4L4VA 1NANI 3IJSB 1JBJA 5D72L 4S1QL 3SPVB 3EDJA 1HH6A 3VD4A 3MLTB 5ACZB 4JKMA 4HS6A 2A9ML 4PJ7E 4Y4HA 3BZ4A 4RGOH 3UPAA 4X6DA 4HGMA 2PXYD 5JO5A 3STLB 2ZKHL 5JQ6H 4PS4L 4PJDF 4H20H 3ETBF 3BPLB 1XF2A 1IGML 4HX1B 3ISWA 2NY6C 3VFVA 3OB8A 4I3GA 5EWIL 3QFJA 1ODAA 3SJVB 4M6MH 1KPRA 1MQKH 4DVBB 3G5VA 4MSWA 1KFAH 3CVIH 5EORL 3D0LA 3WIIH 1Z2KA 2JJUA 4PGBA 3HI1A 1J0YA 3VWKA 5EPMB 3UPRA 4HUMB 3V95A 1IEAA 1IEBA 3VXSA 3IDYB 2QR0A 3T1FA 3OZ9H 1D6EB 1AQKH 4XP5H 3CSBA 3MNWB 5HDBF 5ITBL 2G2RA 4PP1C 3KYNA 4QRQA 2Y5TA 4RWHA 2I26N 1E27A 2D2OA 3OXSB 3DXAE 4MCZB 4D0CB 1JI2A 4OLYH 2ATKB 3TGXA 4XT1C 3TVMC 4LASH 5DLMH 3PGCA 4K7PH 2Y4SA 3FO2B 3TBWA 3BZFA 3V6ZB 2LTQC 3MRKB 2ZUYA 2AK1H 2JIXB 1WJ3A 3C5ZA 2B0SH 1I7UB 2D7OA 3KPLB 3LS5H 4LQFL 1ORQA 5I71B 2AJYH 3MRGA 5LKNA 1JGDB 5CZKA 5L0QB 1BIIA 1QBBA 5EC2A 3ME0A 2WQ8A 2HLFC 1XGRB 2ICCA 2NQCA 4Y19D 4MX7A 1DQDH 2GJ6D 2X40A 4M7LL 4NQSB 4YDKH 4PRDA 4BQCA 4QHKI 6FABL 2GKIA 3MLZH 1PYWA 4PY7A 4AENA 4CVXA 3I3EA 1M7IA 1WBZA 4AIXA 2NY3B 5DVNA 1A3LH 2NY4D 3GBMH 3JV0A 5TE4L 1KV3A 5EBLB 2QQKH 2E7BA 2PF6A 3GIZH 4QXTA 5J56B 3LV3A 1L6XA 4N90D 4F7EA 1FYTD 3HZVB 4X7TB 4YAQA 2NNAA 1OAQH 1NMCB 4DVRH 1BOGB 1DBBH 1FSKC 3CLEL 4LCIH 1NFKA 4HWBH 4FABH 5FGCB 3G5XA 3SQOL 5KJRH 5FUCE 2VLKA 2Q76B 5I1KH 1SHMA 4MDJB 5ICZA 3ARPA 4NBZB 4WW1A 3D0VA 3D3VA 3E6HB 4UV7H 4YEEA 4X5XA 1QSFD 4YX2L 3RQ3A 3UTPD 4BQBA 4UNVA 1ACYH 4XXDA 4YHOH 3QUZA 4G7YH 3T0EB 3ZE0E 2EXWD 3JV4A 4OCLC 5DMIH 2XN9D 5FYJU 4BZ1H 5JR1H 3TYFB 3FB6B 4JM2F 4E0RA 3F12B 2E6PA 2DTSA 4Y1AE 3MREB 3CSPA 1PLGH 1FIGL 2F58H 1K4DA 2ZUWA 4JPWH 3UJJH 1E28A 3ARDA 4P99A 4PB0H 4QT5A 2A77H 2OXHA 4LKXA 3T77A 3QCTH 2ZUVA 5E2WH 5IB5A 4WWKC 1T83C 4R8WL 1MRCL 5FDWA 4XPFL 4XP6L 5D5MF 4ESKA 4ZUUB 4F57L 2CK2A 3T3MF 3EHBD 5F9OH 1VEMA 5HYEA 3MRJA 3IKKA 3U4BL 3O6MH 3M17A 3KWWB 2PTTA 3F65A 5FO7B 1R3LB 1UADC 4ZYKB 3O45B 4M1DL 3KLAB 2VXSH 3L95A 4ZO8A 4BSVB 1CICC 4XCEA 3UYPA 5FYLL 4XXCA 3VA6A 3WIHL 12E8H 4CADB 4Z76B 1U9KA 2RJMA 1CD9B 4NQDB 3ARGA 5ELIA 4A6YH 3U79A 1DJSA 2DMCA 2QJDA 5F44A 2NW2A 4LSUH 3E3QC 4NYLB 3GMLA 1JGLH 4O2FA 1E4KA 1DANT 1HQRA 1QBAA 5FUZL 3IFNL 5DFWH 3HS0A 5F1SA 1M7DA 4X4MA 3LEYL 3VCLA 5FXCH 1BQHG 4L1DA 4N0UB 2R0WL 1EUUA 1N0LA 2DM7A 2J8UE 4PJDB 5FO8A 4N1HB 1M71B 3CZFA 4MQXC 4O5LL 4HC1A 5T5FH 4O51B 2BNQA 5F7LB 1I8KA 4YHIA 3WNLA 1KEMH 3BQUC 2V2WA 1A9EA 4UTBH 4JY5H 3B2UC 3MNZA 3Q48A 2NY6D 3MROB 1SY6H 1FLRL 3LVEA 2WBJC 3NOIA 1EO7A 4IRJB 5JIHA 1WK0A 5IWLA 4IRZH 4JO1H 3P0GB 4IM8A 3MJ7B 4NT6A 4PJXF 4Y7MA 3O8XB 4GS7C 4ELMB 1LEGB 4PP1D 2ZUQB 2VQ1B 2QSQA 4ZFZB 4KFZC 2V5TA 1MCQA 4DGIL 2DM2A 3CFIC 4ALAH 1XR8B 1Y18A 3TVMD 5KZCB 5IG7A 5HTSA 4MQTB 3IFPA 1XIWC 3U9PH 4U6VL 1BFVH 2H32A 2V5SA 3S37H 5IW6B 4JHAH 1VGEH 4OQ1A 1BIHA 5C0FB 4H8WL 3HCVB 3MRIA 4ODHL 1JHKL 2Q6WA 4NQUA 5ETUB 1BEYH 1QO3A 2HJFA 3JVGA 3P9LB 2H8PB 4YBLC 1ZHLA 3O6KH 3MCG1 2CLVA 1S7QA 4BSWB 1K3IA 2XA8H 5C0CB 3W0WD 4OIBA 1CD1B 3HC3L 4LSRL 4PD4K 1ZTXH 3ILQC 1L7IH 2OM5A 4NP4L 2V2TB 3OMZA 2J88H 4U0RC 1G9NL 4GAGL 4K55A 5ABDE 4UTAH 3Q3GB 2OS7A 3X11B 4U6YA 1JHTA 3O2VL 3CAFA 3ULSA 2XKUA 3HFML 4M7ZC 5DMKB 5HHME 2XKNB 1UENA 2NY2B 1HHIB 1CFSB 4OF6A 5SWZD 3VDAA 5D1ZB 4IS6B 2EIZB 4PPTA 5ISZB 4EDWL 5CLWA 2A6DB 3WFBH 5CHNB 3A0OA 2F5BH 1G6RA 2QSVA 3FZUC 5ITFA 4JM2B 1GGTA 1NKOA 3GBLA 5C9KA 3IDIB 3TA3A 3MACL 3JV6B 3UC0H 1MJ8H 1KIUA 3WJJA 4NQVB 4X98A 3NCYP 4J3XA 4TUOA 3LZFH 3DIFA 3EBAA 5L2JB 4PRPD 3EYOA 3QR2A 4KVCH 2BDNL 4I77H 5L2KE 1Z3GL 3V6FB 1P2CB 4GMTH 4MJ5A 5D5MB 3FB5B 3FB7A 1U2CA 1J1XL 3CVHB 1QFWH 4NGHL 1CLZL 3N1GC 4ZXBD 3RY6A 1UB6A 4ZUVB 2Y7QA 1FBIH 4WWKD 4AT6A 2Z8SA 4ZNCD 2VZOA 5J3HC 1KTDA 5FYKU 4KZEL 2PNDA 2COQA 2DQTH 1KTLA 4KDWA 2PW2A 2FSEB 2JJWA 5JXEC 5IR1B 4U33A 3D85A 2G5RA 5INCA 5GS1B 3FKUS 3BRDA 2DQIH 3O9WC 5CGTA 3I2CH 4LDOB 2RFXA 2HVKB 3QWRD 3ZTNH 3BPOB 1B4JL 1KJ2L 3ARWA 3B9KA 5E5UB 4Y4KA 5IFJA 2EDLA 2B5IC 1GGIH 3IGAB 5JIIA 5MENB 3OKLB 4X4XA 4WI3A 5E2JA 4GBXD 1YEIL 3AU1B 4JFZH 3FT3B 4X5WA 1T03L 2VDMH 3SDCA 4L9LB 1NDMB 4MNGE 3V4PH 5D1XB 8FABA 3DUSB 3GK8H 3VG9B 4IJ3B 5IM7A 1VFOA 4JG1H 2WBWB 2X6MA 1OAXH 4DQOL 4YGVB 4FTVE 4G8GB 4KKCC 4GKNB 1YUHA 3SCMC 4RA0C 1MHPH 3RWEA 1EV2E 4NQED 5JTWA 4HKJB 4KHXL 5GRVK 1HI6A 3F7YB 1WEJL 2JELH 3OJ2C 1MPAH 5J1TC 4XGZA 4P2QB 2I07A 2Y07L 3MBXL 4MQXD 3RWJA 1J0JA 2X09A 1E4XI 3MLYH 3J8F7 3B3IB 3CDGB 4Y5YB 3BQUD 1NL0H 3PDOA 1KCLA 3SDAC 5J1SC 3QPXH 3D25A 1B0RA 4YHML 4P46B 1Y6NR 1SMAA 2Y23A 4WFHD 2WBJD 4YQXL 4RX4D 5KSAA 1T1ZA 2Z93B 2OZ4L 1ES0B 1HINH 4CBPA 2F53D 5I1JL 3OXRB 2VH5L 1MCSA 3T0WA 2VDOL 3H42H 2PYFA 4X7SL 1UYWH 3EYVB 5EB9A 3MJ9L 1K8IA 1OD9A 2FGWH 5DD5L 1E4WL 4CDGC 3LKNB 5MERA 1A1MA 2YD6A 1VKXA 2GJJA 1BGXL 1KTKE 4L3ED 5CJBA 5FECA 5E4EB 4QRRA 2MQ3A 1MNUH 1RU9H 4OLWL 5KVEL 2R0KH 1QKZL 1X4XA 3VXSE 5D6CA 3VFGL 3I75B 5E94B 5IESL 2NX5D 3IDJB 1BLNB 4P4RB 1XIWD 4LP4A 4LCWB 3VD9A 2VDLH 3OKEB 2R69H 3VD7A 4KI5F 4PJIE 4R97C 2ADFL 1JYVA 5K93A 1M6OA 4ODWA 1FGNL 2BMKB 4OM1L 1P7HL 3ZLQC 3JWNC 4JKKA 4AIOA 1AJ7H 3RL2A 4X0KB 1PQZA 1RZ8B 4Z95L 4E9LA 4Q0XH 1JV5A 4YFEA 1DE4A 1UCBL 3DV6B 4AIZB 3TJEL 1KPUB 4YDLB 5C0EA 3UJIL 3C09C 1KELL 3MOAH 3QDJD 5E2TL 4FA8A 5IF0A 1BJ8A 4YFLI 1RUKL 1P6AB 2AK4A 3QDMA 1EK3A 1H5BA 5IMLB 5EZIH 1RZKH 5GGTL 4QWWD 4R0LC 5TF1H 1IAKA 1Z9LA 3PDDA 3BUTA 1AD0B 4W4OC 5DJYA 2O5XL 3MGTA 5F7EL 2VLRD 1FVCB 2A73A 1MHHA 2YPVH 3U0WL 2XZCL 4KDVA 4DZBA 1KOAA 4OD3L 3K3QA 3UTZB 3NACH 5DT1L 4L8CA 2R0ZL 4I9WE 4NBXB 3UBXB 4RGNE 3IDXL 1BBDL 1V8HA 1LO4L 3HLAB 2VABB 1TPXC 2BP3A 1KNOB 4ZUSA 1OQOA 3ZYJA 1FL6B 1YDPA 1MCWM 5MEQA 3O6LL 3AUVA 3ARFB 3ZKSD 4Z0BH 4AEHL 3FZUD 1YEJL 4LNVA 1HK6A 4P5MB 1E6OH 1LDSA 4P5TB 3ARXA 5GGSA 4AL8H 1WSST 1PKQB 4WI4A 2VQTA 5INDA 3B5GA 2EYRA 3FQRA 1BP3B 3BAEH 3VXPB 3PWNB 1J7VR 2HP4A 1HKLH 1X5AA 1G84A 4U6XB 3C5SB 1TQBC 2GJZB 3AMLA 4RGMC 5GS0C 1HSAA 1A7NH 3U2SA 4JM4H 3SGKC 4C56B 4F80A 2ORBH 4GT7A 1L9MA 4MQ7B 1Z0MA 3HI5H 1MCPL 3X3GL 3RTQC 1I7ZB 1MI5E 1BBJA 3TNNA 5BCAA 3CU7A 5EZJA 1NBZB 1RY7B 2ZZUT 1G0XA 4UINL 3QNZA 1A2YB 3TN0C 1T1WA 3O9WD 1FJ1B 1BQUA 4XMLH 2EKJA 2EEAA 2EDOA 5EU6A 2ZOKB 2J1KA 3QIWC 2CUHA 3MJ8A 3I6KA 1PG7L 1IM3B 4G9FE 4MXWL 5EO9A 1QFPA 4P9HC 4UILL 4QRUB 3EOBB 1YZZA 4HUXA 2BSRA 4OLVH 5BRZD 3AXLB 3MSPA 1X7QB 5E9DE 3MRCB 4P2RE 5DRWA 3VI4F 2VZTA 1CL7L 5DJ8A 2FH6A 2CKBA 1U3HA 4OFYD 1AC6A 5B39A 1PZ5B 3TF7C 4NQXA 3TBSB 3GHBH 1OCWL 1OGAA 5IBTL 1UJTA 1HHHB 1DBJL 3VA2C 3QXUA 4PJHF 5D2LE 2VLJB 3E0GA 2C3WA 3VD3A 1A21A 2V6HA 1LGVA 1IAIH 1Y0LA 4ORZC 5KVFH 1G1YA 5GS3A 2DKUA 1QBLL 4KKCD 1J8HA 3SCMD 1RVFL 3ARBC 4MJIE 5TDPB 2A6JB 4LRIA 4HG4J 2BERA 2EDXA 3HMWL 4MXQC 3M07A 3EYQC 5D7JC 2BHUA 3OKOA 2OJZL 3DBXB 4U1JB 2BSTA 2VQUA 2H32H 4D9RE 4KKLD 4CL7A 3FFCD 2IADB 5E00B 2VXUL 4XPHL 3R4DA 5T1LB 1HOCB 5IROA 1J88A 1JPSH 3SDAD 2FECI 4AMKL 1EBAA 2C1OB 4XMKL 4HIXL 3O4OB 4JFYB 5IB3A 4H1LB 4HAGA 4HCRA 4JLRA 2B39A 4LHUG 2BNQE 4CN4A 3EO0A 5FV2A 1DSFH 1V3JA 3BE1H 5GSRA 3QDAA 1QA9B 1RIVH 1S8DA 1FNEB 1EFXB 4IOIA 3S3SA 4DK3A 3WS3A 3MV7B 1WTLA 3LAFA 1U8KA 6CGTA 2GY7B 4E41B 3BH9A 4PYGA 1FVEA 3T1WA 2IANA 3IFOB 4XPTH 1T83A 1NCAH 2AJZB 3C6SA 4F37F 2EDWA 4K94H 1ITBB 1MFDH 1AI1L 4L3CB 1ZANH 2DTML 4XNMA 5D7LB 4OV5B 3X3FL 4JHZA 1I1YA 1CXEA 1U8NA 5HGBA 5EUKA 4PJCF 3HC4L 4XH2A 2N7AA 1W72H 1CICA 5F6HJ 4NQCD 3QULA 2FATL 4MZ2A 5JHLH 1RZIA 3SE3A 4NRYB 1IGYB 4X7FC 4ZPTB 4X8JB 1ZLVK 4NUJA 4GUPA 2VJXA 1L7TL 3K7UA 4I0CC 4LLAA 5K9OA 3SHSA 1N26A 5DD0L 4YHKL 1LWRA 2A6KA 2IQAB 1L0XA 3KYOB 5F97E 1PJ9A 4NN6B 1PG7W 2I9LA 4Y4FC 1NCWL 1WCQA 3F7RA 2DQCL 1I3RB 2ED8A 2VITB 1X3DA 5E8OB 2W92A 1X5KA 2X4NA 5E8PA 3H9SD 1K5NA 4HK0A 4KDTA 3BOVA 2V9QA 4QNPE 2NY5C 5IVXF 1PD6A 1QEWB 1PVHA 5IV2B 1MFCL 4JCLA 3QA3B 4PJBB 1F11B 2P44B 5JOFB 3MA9H 4RFOL 5DZOA 2X4UB 3ARSA 3F8UB 4NZUH 5EU3B 3KPRB 5HHQA 3GMPB 5KN5B 5GSVA 4KJYB 5FDYA 2B1HH 4KJPC 3CXHK 4OZGE 3VWJA 2ZUSA 5JHDB 1JUFA 1EMTH 3CK0L 4N0YL 4X4ZA 1A9BB 1IVLA 3JTTB 1ROWA 3CXHJ 5ALCH 1JPTL 1N6VA 2C4XA 3WXVH 3QO1A 4LPUA 1FLTX 1UG9A 2JB6B 4Z5RA 1WFTA 4KUZL 3FQUB 5EOCJ 1ADQH 5CILL 2YD2A 1TJIL 4HMEA 3H9HA 2CO7B 3NIDE 1DUYB 1TQCC 3OKYA 2FYYA 5GS0D 2OK0H 2DLHA 5LGKA 5IHBA 3TZVA 4LSVH 3DI3B 3QDGD 5DK2A 1ZGLM 4OLZH 4MAYC 1JGVL 3HNTL 4LLYB 1A47A 1QLRA 4WHCA 3GDBA 3P3YA 1WZMA 1QD0A 2IF7A 3RFZC 3PGFL 2RIKA 2YUZA 4V1DB 5E95B 3TN0D 1RUML 4HFWA 3QIWD 3RUGA 5CEXA 1F6AA 4PBVC 4D9LL 5HHVL 3F58L 4OLUH 2J6EA 4I18A 1QSEA 1XF5A 2FIKA 2VO5A 4D94A 2PYED 5IB2B 4X80H 4G8IB 3ARRA 4PJHB 3VFNB 2YN5A 3WO3B 1MFAL 4Y19E 1R5VB 4JKPL 1U92A 2GJ6E 4GRMB 1KENH 1UJ3C 3BDXA 5HHNB 3MUGA 4JHBA 3WFZA 1NAKH 5TDOB 2L7UA 3VXOB 5DHVB 1C08A 4GXVH 4ELKB 5C08A 2OSLB 1U8PB 5AAMA 1JNNL 3MCKA 2X4RA 3Q5YA 3ARBD 4F7CA 4JN1L 2GT9A 5FHAH 3AC0A 1I8LA 3MRQB 5MP6H 4MXQD 5D7JD 1GGBH 1HQ4B 4KWUA 4MA7L 4N90E 5CBEA 1FYTE 1WFOA 4HV8B 2RHEA 4JFEB 4P23B 3VXMD 2IFFH 4P3DA 1N4XH 2FX8H 2Y36L 4QOKD 3RZCB 3ROLA 3K1KC 5I8KL 3RIFK 2DKSA 3K8MA 1N3NB 2DQFB 2WINB 1A6TB 1S5HA 1AC0A 4JRYA 5AD0B 1QPPA 1QYGL 4QTIH 4X7DC 4NZDA 1QSFE 4LRNH 3ZE0F 1MCRA 1OW0C 5SWQA 2FBJH 3P73A 4OSUH 2PCPB 3CPLA 5TFSL 1LQSR 2VL5B 1UM5H 2XN9E 2H3NA 2B8OT 5GJSL 3FCTA 2XQBL 4PJCB 3C8KA 4I2XE 2IPKA 2VXQL 5JXEA 5JPMA 5I2IB 2P5WB 1N2RA 1ETZA 4KHTL 2NW3A 1FNGB 4JB9H 4Q6IB 3CH1A 1JN6B 1B4RA 3KPSB 2HWZL 2JE8A 3BKYL 3HAEH 1HXYB 2GK0A 3WUWG 1H3TA 4UUJB 3O11A 5MI0B 2V17L 4BJLA 4K2UH 2V5RA 5T3XL 3TT1H 2ATPB 2CXKA 5DD6B 3BP7A 1MCOL 3N50A 3L3KB 1A1OB 3SDXE 1LE5A 5HPOA 3QNYB 2D4DA 5KSUA 2C7UA 3MCLH 3O6FA 1BQLH 4FQ2L 2AW2A 4K23L 2F15A 4LGPB 1UKTA 4HWNA 1S7SB 1KLFA 5AYUH 3VFWA 3KLDA 1KN2H 4YHLH 2OXGA 5DEGA 1J0IA 2UWEF 5C0AB 4ZTPH 3GEWB 4EN3B 1WZKA 2D7MA 3WEXB 2FO4A 4Y5VB 4XBPA 1QVOB 2ICWI 4P4KC 3RNKA 4O9HH 4PJ7B 3B9EA 3WN5C 1HKFA 3NH7L 4LGSB 2F9BT 1H8NA 4FFZH 4ODUB 1I1FB 4LDLB 4YXHL 3RGVA 4H88L 4LSQL 1SQ2N 2J8UF 4U3CA 3CFDA 3DGGB 4RRPA 43C9A 5HVHC 4N8VA 5ADPH 5KSBA 2FLRT 1LE9A 3JTSA 5DVKA 5TQ0L 5KANG 4Z7VF 5I1GH 1R3KA 3GSRB 1A6ZB 5D7IA 1NANH 2FDBP 4YUEH 1DANU 1KB5B 1U8MA 1JWUB 5CJXC 1KIQA 5H94A 3BEWA 4LLUA 3GMOB 4M61B 5FYJL 5E2UL 4MYWB 5DEFA 4LLDA 1FV1A 1S7UB 5IMMB 2ICEB 4LEXL 4UT6H 3QUMA 3UDWA 2HFEA 1CLYH 3DXAB 2VR9A 3FOLB 5F3HA 3AY4C 1AXIB 5EUOA 1VADA 4OGYL 2P8MB 3H7LA 2VAJA 5IIEB 1BJ1J 5SX5K 3ARTA 3LKSA 1FFPA 4WUUD 2OP4L 3UJTH 1NC4B 1T0NA 2UUDH 3WCYA 1DTUA 4RBPH 4IMLA 4UIKH 4JY6A 5C0RL 4H25A 3SKOB 2ICWJ 3PQYB 4ODXB 1GC1C 3WMSA 2HT3C 3T0BA 2WM0A 1EVUA 2R39A 3N1QC 4PB9L 3EFFA 5E7BA 4WHTA 2BVYA 1RMFL 2CUIA 3LKPA 1KJMB 1NCTA 3FAWA 5C8JA 2WANA 1S7XA 5BS0A 3BP6A 2IPUK 3OAYH 5DRZA 1S5IH 3B5TA 5JPNA 1KSRA 1EERB 4XBEL 2AEQH 4M7LT 3W0WE 2Z4QB 3SN6N 4W4OA 2VDPH 3TBYA 3S96B 2CLZA 1FQ9C 3PNWA 2XIDA 4M5ZL 2FEDC 4JDVB 4G6KL 5EU4B 1Y6MR 5EIQA 4JFOA 1D5XB 3NAAH 4WY7L 2VKXA 1QLFA 4KXZI 1OTSD 1DLFH 1T2QL 3VRIA 2VZ1A 4UV4H 4J7RA 1CDCA 4KZDL 3C60C 1G9NC 1IQWH 5SWZE 1W8OA 4O4YH 5LQBL 2JK5A 2BVOA 3T2OA 4CNIB 1J8HE 4NQDD 3DROA 3BUYB 5H35B 4QHNB 1T5WB 4IJ3C 1IRAY 4ODTL 1T5XB 3QCUL 1NLBL 5KOVC 3EYUL 5EA0L 4Y1AB 1SBSH 5I1HH 5BVJB 2X1XR 3QQ3B 3LKOB 2OBGA 4ZS7H 4ZFOL 1D5MB 5CINH 1U95A 1AR2A 1RHHA 3SGKA 1J5OL 3GKZA 3IXTB 4PRPE 1G6VK 4WDIA 1DBKL 3RTQA 1REIA 1YEFH 2EE3A 1AGDB 1KIPB 4P2OC 1NJ9A 4MA3B 5F3BB 4NSKA 3WFDH 1DVFA 2HMIC 1GIGH 3C9NB 3O3EA 2LAGB 5FGBC 5FOBB 5I8OL 4GH7B 5DVOA 2QSCL 2R23A 4WV1C 3G5ZA 2Z31B 1CS6A 4RAUA 4S1RH 2NY0B 3I02B 1BQSA 3VFPA 1KXVC 3V0WH 4R6UA 5IMKB 1EHLL 2DB8A 4OD1H 5DJ2A 1T4KA 5CP7A 2GITA 5I74C 3HAEG 4M00A 4NWTL 3WNNA 5F9WB 1D5ZA 1DLHA 5IJKC 1ZWIA 3PXHA 2EH8L 1EGJA 5HY9A 3CDFA 2AI0L 2RGSA 4GW1B 3UAJC 1GRWA 3WSQL 5KZCD 1HN1A 1A4KB 4YFDB 3EW3B 3QHZL 2J8UB 2Q20A 4U1KB 4M4PA 3OF6D 3E3QE 3BP5A 2R2HA 1DQTA 1MAJA 5C0BD 4TSCL 4Z7VB 1INEH 4AH2A 2VUYA 4MNHA 4NQEE 5HHOA 3GMMB 4NZJA 2VDKL 5I8EA 3BJLA 4OAWA 3FRUB 1VA9A 5TDNA 1P7QA 1EFQA 3RWCB 5JW3L 3PWPA 4PRAA 3QXAA 5CZVL 4D8PB 4M48H 5E6IB 2DWEA 4F7PB 2CDFA 2DI7A 5GPRA 1UFUA 4HKZA 3MRPB 1AE6L 3DETC 4OIIL 4KJQC 4AYFA 3HRZB 3D39A 3DMMA 3N85H 3VG0L 4WFHE 4X6DF 3FN0L 4HMDA 1RZ7H 3NA9L 3MV11 5MHSD 4A6YB 4DKEH 4PJ9C 1JRHL 1G7JB 5DFTA 4R96A 4Q2ZA 5DJXA 4BFEA 2F53E 3FHAA 3TNMA 2CPCA 4X6FA 4WEUD 4TQEL 2AJUH 1H9VA 5CUSH 3S34H 3MODL 1YQVH 3ARFC 3MA7B 4YDIH 5FYKL 2MOVA 4L3EE 2FR4A 4M43L 2Q8AH 4JZNB 4JM2D 5DXWA 3TO4C 1P1ZB 4P5TC 1A7RH 3IFLH 3KPPA 3T4AA 2NX5E 3VI3E 1A7PH 2GIYA 1P5VA 2AXFA 1XGQB 5D96C 4C83B 4YC2C 2V9TA 2C5DC 4ONHB 1JMZA 1VGKA 4FZ8H 3WD5H 3QNXA 4D0BB 2R1YB 2L0DA 1XCTA 4Y4FA 1AH1A 1KIRA 4RAVA 3X12A 2VYRE 4XVJH 1NAMH 4AJ0A 3JWOL 3PHSA 1ZOXA 4NPYB 2D7TL 2QQNH 4MD5B 3RUGE 1A02N 4GQ9H 7FABL 2X7LA 1C16A 4ZTOH 3QDJE 5DFVC 3B83A 1QSEE 2B1AH 4ZAKB 2VISA 5KTEH 4KJWD 2DMKA 3W2DH 1TETH 3RDTA 1MJJB 1ZA3A 4GMSH 1KCKA 4IMKA 1T80A 2DLFH 3LHPL 2YOCA 5HHMB 3W11C 3VXTA 1FDLH 4X9BA 3DURA 4GKSA 5DJ0A 3V5HA 2R4RH 5GGRA 2VLRE 2ZCHL 3NTCH 2H2PC 5I16A 3F7PC 5GRJH 4HIJA 5KVMC 3OKKA 2BC4A 4H0HB 4KK9C 1TZHA 1T04B 2OI9B 5J6GB 2YKLH 4WU7B 1CL7I 4ODSH 4APQC 2FX7L 3MLRL 5A2IH 4D2NA 1R5WA 5C6TH 5SWSD 4DAGH 1Q0XH 5L2KB 2CSPA 1NGQH 4PV9A 1JNLH 3OJDB 3L5XL 1IFHL 1NC2D 4JDTL 4RZCB 1HEZA 5FKPA 5I0DA 4P5KB 1UWEL 1D9KB 1H15B 1X9QA 1LHZA 3PWVB 1F90L 4MAYA 3S9DB 1ZLSH 2HG5B 4P2QD 3MRHB 3OKMB 1IQDA 2B2XH 2J8OA 4GSDH 1CU4L 2HMID 1ULVA 4OZIE 4JZJB 3X17A 1T6WA 5MEPA 3LEVH 4WI7A 4GRLB 4XAKD 3O4OC 5DZLA 3PWUA 5EO0B 4HK3N 2OL3L 4KRLB 4Y89A 2EYSA 1RK1B 4JFDB 4KROB 2QADC 3T0XA 2Y25A 1UXWB 4MNQD 3L3HB 1FE8L 5I18L 2HT4C 4ONFH 2NXZB 4PLJC 4DGYL 2DYPB 1A6WL 4MNGB 3QZWA 3AREB 5LG1A 5E8NB 3IJHA 4IOFD 1FN4A 5BRZE 3EYSH 1V7NH 5T1DH 3WJLC 4DN4H 4FTVB 2GSIB 1WZ1H 4PBXA 4Z7QE 1I3GH 3UAJD 1G7LB 1JIBA 4TVPH 3QUMH 5CJ5A 3SE4A 4GRWH 4UI2A 3WIFB 3PABB 4LCWD 5D2LF 3KR3L 4I3RH 4QHLA 4L29B 5HXMA 4Y16B 5I30H 1Q9WB 4G5ZH 4F9LA 1MRFL 2FEEI 4I3SH 3BGFC 2XYCA 1NCBL 1HH6B 3QUXB 3C2AL 3P11L 3N1FC 4Y4HB 3BZ4B 4X6DB 3SDDB 5CEZH 5IB4A 3FRPG 4Z78B 4L5FL 4DCQA 2MKWA 3DVNB 3BKJH 3IDNA 4M8QB 3MJ6A 2YR3A 4MS8C 4QHMA 5DMJB 5F71A 5LWYL 1KCRH 1UB5A 4Z7UE 1L0QA 1A4JA 4LCUA 4NRXB 1E4XH 4ZSOA 5KSBE 3DETD 4KJQD 4Y2DA 1OB1A 4XRCB 2BVEA 3D0LB 3TCLB 4OJFL 4PGBB 2DBJA 4PJ9D 3BIKA 2DQUL 2HH0L 3HI1B 5CZXC 3VWKB 4HIEA 1YEDB 5A2KH 1IKFL 4X7EC 3VXSB 4JKLA 3THML 1UM4H 2QR0B 2VOTA 2OJEA 1IAOA 4Q9CA 4MB5A 1HHKA 1VESA 4PGDB 4QRQB 2Y5TB 1EDQA 3ARFD 4PJIB 5I1IL 1TCRB 2MFNA 1OAZH 3BO8B 1U8OA 5HPMA 3FQTA 4P5TD 1SMOA 3TBWB 1I3UA 1DQJA 4CN6A 15C8H 4IRSA 4LHUB 4PJ8B 5CBAB 4QRPA 3TH3T 1H3WM 3PWJB 4NKQB 3Q1SL 4M4RA 5EOQH 4J3TA 1YY8A 1DQLL 1BZ7B 4MB3A 4FOMA 1RZGA 3OV6A 1IT9H 5J12C 1GGCL 5ILTH 5IHLB 1ORQB 3OR7A 4DKFL 4NNXA 4KRMB 4TRPH 1EXUA 2OTPA 2Q86A 2VDQH 5CEZE 1FL3B 4P4KA 1I3VA 1XGTA 3T08A 3L3OA 5GS0H 3ES6A 3DNKA 4YDVA 1MY5A 5DFVD 3RU8H 5BS0E 2A1WL 1PYWB 4CVXB 3QIUA 1M05A 4HK3J 4Z77A 1NFDA 2EC9T 1I7RB 4IIQA 3W11D 2GAZA 1JWMB 2JCCA 4HH8A 3H9SE 3ULUL 4PV8B 2BOCA 2A9NH 1N5AB 1ED3A 3QHFH 3L5IA 3B2VH 4QNPF 4ETQA 1X6LA 1MWAH 5JW5A 2QTEA 3IXAB 4KK9D 3RVUC 4P9HH 2ED9A 4M3JA 3ZDZF 4G80A 2Z8RA 4YAQB 2NNAB 1B88A 1RHFA 3T4YA 1UXSA 3BDBA 3FQNA 3PHOA 4APQD 4N68A 4Y5XC 1NFIA 1IARB 2D0HA 2G60H 4M7JH 4HPYL 4HLZH 3MO1B 2VLJD 2VLKB 3HE7C 4G6MH 32C2A 1OHQA 1ZGLA 4PP2A 3AY4A 4XPBH 4ONOA 1WBXB 3DRTA 4HC1L 3D0VB 3KPOA 4MAUH 4QCIB 1XF2B 3REWB 1EGJH 4XXDB 1V3KA 2XWTB 5LGHL 4JAMA 4FNLL 2O5ZH 4E0RB 2FNBA