5HDBE

Integrin alphaiibbeta3 in complex with ro-435054
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
219
structure length
214
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein/immune system
molecule keywords Integrin alpha-IIb
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 214
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hdbE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hdbE02
2IC2A 4XMLH 1ZLSL 1JRHL 1FNSH 1JTOA 4L8DA 3ZZ1A 2VDPH 4FQXB 1BFTA 2VLLA 3BRDA 1AC0A 2KH2B 4HHAB 4ZAKC 3BP5A 1HQ4A 2C3VA 2BCKB 1KCLA 3FZUD 5FB8B 4CW1B 1HHKA 3F58L 5IROC 3IDIB 3O6ML 2HTLC 4H1LG 5C2BH 5EBWA 3DROB 2UWEE 1B3JA 5FDWA 1MJJB 4H0IA 4U49A 3V7AG 5L2KA 3GMRB 2B39A 3QRGL 4FZ8H 5HGBA 4JQIH 2R69H 4DKAA 4PGDA 3U1SL 4HMEA 3JTSA 3MRDA 1MCLA 3IFOB 2IBGA 5EO0A 1EAPA 3T65B 5HYSG 4LP4A 1B0RB 3DV4B 5GGTL 1F4YH 1D7FA 1RURL 5B3JF 2R0ZH 3L95B 1INQB 2BVPB 1PQZA 4ELME 3HCVA 3X12A 1LP9E 3ME0A 3BISA 3PJSA 3EO0A 4KK5D 1TJGL 1KLFA 1JYWA 2OQJA 2OX5A 1I3GL 2DM3A 4H5SB 2IBBA 5H2BA 1CXLA 5D7LA 3KPSE 4S10A 3RVTC 1JWUA 2GEEA 2EYTB 1QKZH 2OL3A 3D85B 2IBZX 3CZFB 3ARFC 4J6RL 1QACA 4R3SB 4LU5H 3KWWA 5C0RL 1RIHH 3OJVC 1A1MB 5DJ0B 4M61B 1G7QA 2MQ3A 3QI9D 4PV8A 4Z7VB 2AK4B 4JFFE 3LKOA 3ZTJG 3KR3L 2R8SL 1BFSA 2FD6L 4OLVH 4F7TA 5T1MA 3I75A 3KYKH 1OQOA 2BOCB 1NCAH 1IAKA 2GSIA 2MCPH 3B2UD 1ZHBA 1KCSH 3SE3A 1CFBA 3CUPA 2FO1A 4EI5A 2UUDH 4GG8B 1MCNA 4W6XB 4UIMA 1FGNH 4W6WB 4PJEA 2FZ3B 1CXHA 5EUKB 2FIRT 3D69B 4F37K 1NAKL 4YGVA 4HAFA 5FO9A 2ADGB 1QBLL 4GUPA 2A9NL 1P84K 4P2QE 4PB9L 4Q6IB 5ICYB 4FG6C 4OZFH 1UQSA 2E6QA 1EO8H 4AJ0A 2XN9E 1YY8B 1I75A 4GRLC 1CDCA 4EN3D 1VKXA 1ULVA 2JCCE 5E2VH 4G3YL 2APFA 3G9VA 5FM5M 2NY4C 1NCDL 2DI7A 1W72H 2PYED 2QSVA 4QXGL 2D31A 4KKLD 4CDGC 4NSKA 4Y19A 2VLJE 2RBLA 3TO4C 3ESUF 3QNYB 5CP7B 5ESVB 5SWSD 4PJGB 3QPXL 4K7PX 4NQCD 4IRJA 5B39A 1FQ9C 2P24A 3M17A 25C8H 4LHUB 1Y18B 2ZZUT 4FP8H 5I71B 4YWGL 3QH3A 4ZAKD 2AV1B 5I1GH 3MV7E 3GJFB 1F97A 1EMTH 5C08A 1A3RL 4AEEA 1DQLL 4MXWL 5MERA 3U83A 2XZZA 1RD6A 1ERNA 4D8PA 2L7JA 3WHXA 3BGAA 3VXTA 5T5NG 2FSEA 1R3IL 3FFDA 3SGJA 3U0PA 4P4RA 1FL3B 2X9YA 4IMLA 5DZNA 3MJ9L 3MO1A 4L3CA 4ZTOH 2DTSA 1YYML 3BDBA 3FFCD 1M7XA 2QR0A 3LQZA 3QWRA 4HZLA 3KYAA 1IEBA 3JUZA 3UP1A 4D0BA 1OOAA 1MCSA 2VXVL 3IDUA 1HQ4B 4JFED 2C3VB 4POYA 3TO2A 3EOTL 4L29B 5D2NE 1HHKB 4PUBL 3FT3B 5EBWB 4HWBH 2FBJL 4K8RC 1TQCC 3LS4L 1S7XB 2EDRA 3MOBH 5DGQA 5HGBB 2CXGA 4R7NA 4GS7B 4PGDB 2H32H 2OZ4A 3MRDB 4OZHE 2ZUUA 1T1WA 3OB0K 4XX1E 1EAPB 1QFWL 3MODL 2AJSH 4M1CC 3T0XA 4L4JA 5D1XC 3GSRB 2ITDA 4Q9QH 3RVTD 5IIEA 1ES0A 3B4NA 3QUZC 2A6KB 1A7NH 4AG4L 1TPXB 2P46B 5D7IF 1URLA 4Y4FA 4F7CA 1PQZB 4R0LB 1EBPA 5JW4Q 3GUTA 4RFOL 3X12B 1N26A 3ARFD 1R3JB 1WIUA 5HSFA 2E9WA 3EO0B 2W91A 3C2AL 1X6NA 4UT6H 4XVSH 4FQHB 2OQJB 4I0KA 4CBPA 3ULVE 4WFHD 4I4WB 3HC4L 4Y88A 2CIKA 5H2BB 4N0YL 1KC5L 5FA4A 4WI2A 1JNHB 2N7BA 5D7LB 2NYYC 4G8FA 5ACMA 1EH9A 2MPAH 4FQLL 4KY1H 4AH2A 2X4OA 4LDLB 2J88L 4KI5F 2OL3B 4YEFA 1YEGL 1XF5A 4JY4A 1EGJL 3WKMH 4BK4A 1CS6A 3GMPA 5ETUA 3KWWB 3QCUH 4LCWA 5HPOA 1G7QB 1JPSL 1ZAGA 4PV8B 3LKOB 3HI1B 4QWWD 3HI5L 2R4RL 5C0BE 4FG6D 5GS0L 4M6NL 3QQNA 3SKOA 4GRLD 1IAKB 3WN5A 4OF0A 2GSIB 2VLRD 1OLLA 2EE9A 1ZHBB 2MQ0A 2NY4D 3V0VA 5I1EH 1YECH 3VFRA 3WNKA 4UV4L 3MRJA 5E1AA 3CUPB 1I3VA 4EI5B 1OPGL 4UIMB 1XF3A 3GO1H 4GAYA 4PJEB 1BHGA 3R0NA 2WWKT 4KZEH 4YGVB 3QXDA 1JPFA 5FO9B 4GUPB 1YN7A 3GI8L 1AGCA 3BT2L 4AQ1B 4HIIA 3ZDXF 2VYRE 2V2TA 2DJUA 1BQSA 4PJCA 1VKXB 2JB6A 4RNRA 2GK2A 3IXAB 2DQGL 4YFDB 4FN0A 5LQBH 2D31B 3TH2T 4XPGL 2YUXA 4K9EC 4TN9A 1K85A 1G84A 4ZFFB 1DEEB 3SBWC 4JREB 4TNWF 3J7HA 1H3GA 2Y36L 2P24B 5B39B 4LQFH 1BLNA 1G7JA 1MFAH 4Z7UA 3W2DH 4H25A 2R56H 3VXUB 1IAIM 5BMFL 1UCBL 4YBLB 3BH8A 1YDPA 2GIYA 3P0VL 3OBAA 1N3NA 1XF4B 4K94L 4D8PB 3M8OL 4K8RD 5SV3A 3WHXB 1MAJA 1GSMA 1OWWA 3CFJA 2FSEB 4DGIH 4JFPA 3V6FB 2OXHA 3FFDB 2PO6D 4G43A 5F9AC 3LZFL 3CX2A 1CN4A 3U0PB 1YNLH 2X9WA 3QCVH 4PJDF 4P4RB 1CDJA 1NUFA 2DLHA 2Q1EA 1LE9B 3BKCH 3MO1B 4JHAH 1OGAA 3ARGA 3U46B 2CSPA 4PRPA 2QADC 4M1CD 4KV5F 4AENB 1Q0XL 2NY7L 5D1XD 2VAAA 1FVDA 2QR0B 3LQZB 3X14A 3SJVE 4R4FH 1IEBB 5IHZA 1PKQE 5HJ3B 3MLPA 2VZTA 4OZGE 3QUZD 3WFBH 2F54E 2ADFL 2FWOB 4TRPH 4LNRA 3TO2B 5BRZE 4G8IB 1MHPL 1U42A 2X4TB 1OB1A 2Z8RA 1B2WL 4JY5H 3BE1L 4Z78A 4F7MA 2EDWA 1NDGB 1ZA3A 4PGCA 1OAUL 3CFCH 2F74B 1RJZB 3C09B 3WJJA 4R7NB 5BOZG 3AY4A 3UBXI 1F8TL 1RSFA 5K9KB 5J13B 1IC1A 2BJMH 1T1WB 4JFXA 1NGWA 1QFUL 1CFVL 1CXEA 2ITDB 2NYYD 5GJTL 5IIEB 4OZIF 1T1YA 1GAFH 2D2OA 5D1ZA 1IM9D 4JDZA 5EN2B 4JFDA 4Y4FB 4F7CB 5TPWH 5JR1L 4OCSH 3FRUB 3GUTB 4ZUSA 3C60B 3T3PE 2JB5H 3FO0H 1M1SA 5DRXA 2D7OA 1LDPL 4CADA 1P4IL 4NRZA 1B0WA 2BVQA 2CIKB 2BY2A 1FVCA 4NZJA 1NGPH 4HC1H 4G8FB 2HH0H 2Y5TB 2Y1VA 4AH2B 4QRPE 1QA9A 3UJTL 1RUPH 1RIUH 4OQTH 2W59A 4HBQA 4IDLA 4LVHB 1FE8L 1X5KA 1XF5B 2FO4A 4JY4B 1I8KA 1AO7A 3KJ6H 3GMPB 5ETUB 1G7IA 3FO9B 1N64L 1ZLWK 1BECA 2C5DC 1CLZH 4TSCH 5JHLH 4WW2F 5IEKA 1CL7I 2HJKA 5J57B 2CJUL 3ZYIA 1FNAA 1OTUC 1DL7L 1TJHH 1I3UA 1PBYA 2KZWA 2JELL 4FXKB 3U36A 2B20A 1QNZL 1HSAA 1IKFL 1BFVL 4PREB 3EJYC 4P46C 4NCC1 4WHDA 2E27H 3NAAH 1J8HE 1I7TA 1D9KC 2V7NA 3F7RA 3MRJB 5E1AB 1A7PH 3MGOA 4NQDE 1HHGA 1R3KA 3Q1SH 4NPYA 3TGXA 1XF3B 4BKLA 2YKLL 4AIXA 2NY2C 4RIRA 1SBSL 4GAYB 2FECL 2R0KH 3HZYA 1FG2B 2GSGA 3EKCA 1MHCA 4P2RD 4LSDA 3QXDB 1JPFB 1UWGH 4P9HH 1I1AA 1YN7B 3O9WC 1E4JA 1YMHA 4EQ3A 1AGCB 1XCTA 1ZKAA 4ZO9A 1MQKL 1A7BA 3BPLB 4HIIB 1E4WL 5EUOA 2V2TB 5DLMH 5BO1L 4PJCB 2JB6B 4YE4H 4L1DA 1ZGLM 4RNRB 5J89A 1KPVB 4TSAH 1F3DH 3HZMB 1LE5A 5AG8A 3MJ7A 2YXFA 4NN5B 5J11B 2B7DT 3QO0B 4V1DB 4XP5H 2IPUK 3LEXA 1FNHA 4K2UL 4H20L 1T66C 3S35X 4QO1A 3AREB 1AQDA 4EVNA 1BLNB 4U6TA 2QADD 1G7JB 4OLUH 1RK0B 4Z7UB 5M95B 1Q9OA 4H25B 2VC2H 3CMOL 1UM6H 1BD2A 1FLRH 4NKIH 1HWHB 3RY6A 1V7MH 3MROA 3TYFA 1WC7A 3RBSA 4UZGA 3VXMA 1YEKL 3OB8A 5IT2L 1A6TA 3BKJL 3CFJB 5HHOD 2XKNA 4JFPB 4QRTA 5E2WH 4MJ2A 3F5WB 4JO4H 3V6OE 5ECJE 1XF2A 4N5UA 4NCC2 3OTTA 3B9KA 1WFUA 5ALCH 4NM8L 4D9LL 3ARGB 4EQ2A 4GO6B 4PRPB 3P30L 2D9CA 5DUPL 3X14B 1FVDB 3ZE1E 5IM7B 4M43H 5IHZB 5A2LH 2WINA 5CZKA 1NBZA 5DEFA 3IYLW 5A2IH 3MFGB 3BGMA 3PDOA 3T0BA 2DI9A 4F7MB 1ZA3B 4PGCB 4M3KB 4KJPC 4E0RA 2A6IA 2D9QB 3D39E 4AMKL 3DTXA 4OLZL 2A77H 5DD3H 3DMMC 1CFSA 3T0EA 1C5CH 4OFPA 4M03A 3S35H 3U82B 4JFHE 2RQ8A 3IETA 4PGBB 5ADPH 2FJHB 4JFXB 1NGWB 4QCIB 4GRWH 3V4PL 1I8LA 3ARDB 1J8KA 5IB2A 1JPTH 2OTPA 4CJ1A 1XH3A 2ZG1A 4F80A 3HLAA 1CD1A 4V2BA 5J06A 5EBMA 4GW5A 2JKXA 4JDZB 3QDMD 4JFDB 2DLFH 4CMMA 5FHBH 2MSPA 4L4TB 4NQSA 2QHRL 4LLVA 3ZYJA 3ZO0A 1KJ3H 1QRKA 3E3QE 3FJTA 3V0WL 2IALA 4U3XA 4KI1A 3VWJC 4BH7A 4C4KT 2DL2A 1OTUD 1FN4A 4L9LC 5FYJH 3TA3C 2H1PL 2R39A 5AYUH 4WTWA 1V3KA 3EYFA 3PL6A 2X4QB 4M1GH 1SEBA 2VDNH 3L3KA 4UILL 1SMAA 1S9XA 3EJYD 1HHIB 3JWDC 4R8WH 2IMNA 1C5BH 1D9KD 4MAYD 4NWTL 3O4LA 2WZPD 1I8KB 1AO7B 2R0WL 2NY2D 1U8JA 3QCTL 2Z91A 3QNXA 3EIFA 4HLZG 4MHHG 2XA8L 4O2FA 2HJKB 4NNYA 2EO9A 5FUOL 1T21A 3O9WD 3GBNH 4YHKH 4JPKH 4JY6A 4NGHH 3GRWH 1T22B 3LMJL 1PKOA 2PTVA 3OKKA 5DHVH 3U36B 2F19H 1HSAB 1F4YL 3B6SA 3HI6L 4X8JA 2W9DH 4N1HB 1I7TB 2V7NB 1ZANH 4KHTH 3MGOB 1HHGB 1R3KB 5B3JE 4NPYB 2LFGA 1CCZA 1UM4L 3CDFA 4JN1L 3HZYB 1MFEH 1T66D 2GSGB 2DQHH 3K1KC 2BRRL 3OR6B 2ZUQB 1MHCB 3EO9H 5J4MA 1YMHB 5E2UH 3B2VH 4PJIA 3PG2A 1XCTB 4UINL 4P2OB 2XPGA 4P3CH 5EC1A 3PWPB 1JZ6A 1J1OL 3DXAE 3TESA 3QDGA 3O6FA 3UTPE 1HXMA 5F8QC 2N1KA 5HYJD 5DI8A 2OI9C 3ZLQC 4LKXA 3SE4C 1I8MB 1RQ5A 3DVIA 1JV5B 5ISZD 4JB9H 2EZ0C 5JQHC 4LCCA 3UJJH 3CLEH 3FN0L 1K8DB 3ZT5A 4ISVA 2D03L 3SDYH 3GSVB 2FJGA 2V2WA 2COQA 1J1XH 4YDJB 3TNNB 3LS5H 3TN0D 3ETBF 4TOYL 4Y1AA 4X7FC 4M02A 1Q9OB 2PTUA 3K2UH 3TCLA 3KYKL 3ULUH 1BD2B 1U3JA 3DYMA 5HHMD 1YEFH 3DVGB 4YO0A 3TYFB 1WWAX 1YC8A 1WC7B 4HG4K 1ZTXL 3K2MC 1KENH 4QF1A 4MNHA 3S7GA 3G6JA 1A6TB 4KJPD 2ENSA 3VRJA 4QRTB 5B38A 3DMMD 2F5BL 1XF2B 1YMMA 4X4XB 1FDLL 4KAQH 4HUXA 4WEBH 3ULVL 5T1KD 3DURA 3B9KB 1ZSDA 2RIKA 5CJOL 3BP6B 4XP4H 4H8WL 3WFDL 2WANA 1RZ8B 2NY3C 5JA8B 4AT6A 4HIHA 3WD5L 1X4XA 2WINB 5I1KH 1B6UA 4ODXA 5DEFB 5C0IA 2W0KA 3RU8H 3O4OB 4I3RH 3Q6GL 1A5FH 2PCPB 3PDOB 4Z7VF 2ZNXA 4EOWH 4OGXH 5DUBA 4Q2ZA 5DK3A 1J87A 1LWRA 2A6IB 4NO3B 3H9SD 4R4BA 4E0RB 3QFDA 3DTXB 3VWJD 4F9LC 2IF7A 2OMBA 4G8EA 3T0EB 1QVOB 2V9QA 3TA3D 3IETB 3UDWA 1L0XA 3REWA 4A6YB 1XR8A 1WZKA 2DQTH 3WS6C 2FLRT 1IFHH 4PG2C 1FRGL 5IB3A 1PFCA 3Q48A 1ORQA 1CE6B 1CD1B 4NQVB 1IC7L 5EBMB 4CL7A 4LIQH 1IILE 5D7JD 3HE6C 4CMMB 5D8JH 4JRXE 1NUNB 4LLVB 8CGTA 3MBXL 2YWZA 2BSTA 1QSFE 1RFDL 2IALB 4Y4KC 3S4SG 3VFWA 4BH7B 1ZVSA 2G60L 3CCHA 5J6GA 4LCIL 1FN4B 1IGIH 1F3RB 2KDGA 4P5KA 5IEHA 3GSNA 3EYFB 3PL6B 2EDJA 4HBCL 1SEBB 3L3KB 4ELKB 4U1JA 3KNBA 3GMMA 1S9XB 3MJ9A 4ZFOB 4YUEH 4LVNC 4D2NA 3BPOC 4PJGF 5GS1A 4TTGA 3O4LB 4HWBL 2NNAA 2P5WD 1RZKH 5ID1B 2Z91B 3FONA 2DKUA 3PIQA 4NO0A 4WWKA 4NNYB 3QWQB 2ATPB 3GHBH 1T21B 2ZPKL 4HPOH 3MCG1 4JY6B 4RGMB 1NGYA 1A7RL 1QOKA 4Y89A 2P5EB 1BIIA 3PP3K 4OQ1A 4LPVA 4PJXA 3B6SB 5I1IH 4KHXL 4KTDH 4EDXA 4DW2H 3O6LL 2MFNA 5IGXL 2EZ0D 1U3HC 5TE4H 5D7IE 1WISA 4HEPG 3VFOA 2Y7QB 2FGWL 1OTSC 5BXFA 2EDNA 4HKBA 4JKPH 1BZQK 1V05A 5LAXA 4X80L 2XPGB 3QIWA 1QLEH 2R2CA 3WFEH 2F53E 4JE4B 5C09D 4WY7H 4G7YL 3QDGB 4MAUL 3O6FB 1HXMB 3AM8A 4J8RA 4OLWH 2H2PC 3QHFL 4LCCB 1HNGA 1M05A 1P7QA 4KI5E 5L0QB 4ISVB 3UC0H 1RU9L 1RY7B 2MHAA 1KBGH 1FZMA 1EGJA 5F88A 2NY3D 4Y1AB 4FABH 4Q9CA 4IRZL 3TZVC 3S5LG 3TCLB 5ITBH 1NBQA 1CTOA 3NABH 4ZS6C 3HR6A 2BSSA 4B7LA 1JUFB 3ZDYF 1EA9C 1UJTA 3QUXA 4LIQE 1W0VA 4PJ5A 4YO0B 4MNQD 4DGYL 5JORA 4ZO6A 3G6JB 5MEND 1U6AH 3VRJB 5B38B 4NZRH 2DRUA 2EDYA 1YMMB 3I2CH 3V4VH 1CFQA 2YUZA 4HUXB 4F58L 1N59A 1NAML 3DURB 1ZSDB 4WHYG 4K3EH 4XNXL 4KK8D 2DN7A 3K1DA 1DBAH 3BEVB 2DIAA 4LGSB 5I74B 4KQ4H 3CPLA 5FGCE 1ZT7B 5LWYH 1JBJA 1SQ2N 3CLFL 1QBAA 5DT1L 1UVQA 2R1XB 4ODXB 3X3FH 5C0IB 4YFLI 2MKLC 3V8CA 3HE6D 4XX1G 1XGTB 1A47A 4JRYA 3ZDXE 5F9JA 5MP6L 2H9GA 2FX7H 4Q2ZB 1DBBH 2CRMA 2QQLL 3L3IA 4R96A 4R4BB 2BNRD 3RKDC 3R0MA 4Y4KD 2BY0A 4G8EB 4MA8H 3PQYA 3SGEI 4OSUL 3ORJA 4PRAA 5IJKC 1RZJL 5TDNA 2DQIH 2ARJQ 3ARBA 2OJEB 3OKNA 2V17L 4YC2C 3MYZA 2FR4A 1XR8B 4GQ9H 5J1TC 1LEKB 3O45A 1T83C 3HC3L 3L5HA 1ORQB 3SDDA 4HUNB 4PJEF 5K9QI 4CN6A 1A6VL 2P4AB 1CL7L 2BSTB 3BEWA 3UJIH 5E0QA 5SX5H 1A3LL 1JHLH 5CZXC 3ARSA 3WDHA 5C0JA 5GZOC 4WI9A 1D6VL 4DAGH 1ZVSB 4J3OC 4K3JL 2MQCA 1H15A 3CCHB 5DRWB 3DUSA 3O3AA 3DOSA 5D96C 1A1NA 4XCCL 4WUUB 1G0XA 3GSNB 1BQUA 2A38A 4DFHA 35C8H 4JPWL 4PJDE 3ES6B 4OM1L 5AYQA 1W2KT 4X5WB 5CILL 5D93C 3GMMB 3VG9B 1MJ8L 4KV5E 4GMTL 3CSYA 4XC3L 2X1WL 2OTWA 1GGBH 2HKFH 3U9PH 3C08H 4OV6F 2JTDA 1U3HD 4PRDA 3KPTA 3ZMRA 3PIQB 1SHMA 4WWKB 1OTSD 1I1RA 4JHWH 43CAA 1ZLVK 1E6JH 4H0GA 4GAJH 5C0CA 4XVJL 3MLVL 1U8MB 1FNEB 1NGYB 4FQPA 3WIIH 4NHCL 5FCUH 3S6CA 3H7BA 1P53A 3K4DA 4PJXB 1Q94B 5FECA 1UZ8B 2CH8A 3QDJB 3OX8B 2L4OA 2P43B 2VLME 2H2PD 4KRPB 4WFGD 2Q8BL 2ADIB 1NBVL 5I8CB 4OFKA 2GKIA 1UH3A 3VFOB 2AXJA 4QOKE 5BXFB 3SE3C 2FEEL 4EDWH 4C55A 2PR4H 5JW3L 5LAXB 4EI5C 3C2SA 5GGRB 3U7YL 4RMSA 1U36A 4JM2B 3TZVD 4MDJA 3F12B 3QEQB 4UAOB 1T04B 3UTOA 1VGKA 2IAMA 3H3KA 2YK1H 4AL8L 3L7FA 1OCWL 1YC7A 2HFFA 3VGHA 4OM0H 1P7QB 4LSQL 1RJYB 4J3WA 5B21A 4IRSA 3NTCL 4LVOB 2MHAB 1T89A 1BJMA 3LHPH 5F88B 1OSPH 2VDMH 4ODWA 1VPOH 2VXSH 4EEEA 2BSSB 3MRHA 4JO1L 4FFZH 3QUXB 4IRJC 2AQ3A 2VZVA 4WFFD 5A3IC 4QHLB 3BKYL 4XAWL 4AZ8A 4M5YH 4KZDL 5JORB 1CI5A 4NRXB 3RKDD 4X6DA 5EG6C 4KUCD 5BS0E 3MRRA 1XGQA 1RZGA 4BQBA 1CFQB 1XIWA 2I5YH 1N59B 3DETC 2HMIC 5KANG 4KTEL 2FJFA 5L2KD 5JDSA 1MCBA 5EA0L 1A4JA 1WCBA 3CPLB 3DO3A 5I15L 3SGJC 3OJDA 3BRGC 1YJDC 1UVQB 5TDPB 4IM8A 5L8KB 5BV7H 1QSED 3SPVA 2AJ3B 3F7VB 5I66A 3RY5A 4FNLL 3QZWB 2IPTL 2H9GB 4O02L 3L3IB 3CFBB 3U4BL 1JWSB 1P4BH 5CZXD 5GZOD 3LD8C 3ARRA 4G5ZH 5JZ7C 2XWTA 1DN2A 5CZVH 1U8PA 2I24N 5TDNB 2UWEA 3OKNB 5F89A 4UMGA 5DWUL 3GNMH 3TVMC 4U0RC 2EECA 2AEWA 4O9HH 2P7TA 5K59F 1CBVL 3SDDB 3AMLA 4M7JL 3O11A 3MBEC 2NXYC 5E8PA 3OJ2C 1XZ0A 2WQ8A 3FCTA 1KJ2H 3V8OA 4DQOH 3BEWB 1S7RB 2C1PA 3UPRA 1N2RA 4NNPH 1AGDA 2WWKO 5IFAL 1H15B 4XCEB 4OGAC 4PJCF 3IU3A 1N5YL 3O3AB 5GGVL 4OFVA 1JF5A 5J12C 3OG4B 1G9NL 4XBGA 4G9DA 2OBGA 3W82A 1RVFL 2W07A 3LN5B 5MI0B 4R26H 5SWZE 3SE8L 4C56B 4ZYKB 1G0DA 4A2MA 5D70L 2YPLE 1CDIA 4BUGA 2Q3AA 4XBEH 4YK4C 2OTWB 5JXAL 1LO2H 3KPSA 2D4DA 3I9GL 2E7CA 4PRDB 3X11A 2JJWA 4PRHD 2PW2A 4GKZB 4JZJB 1OD7A 2RFXB 3N1GC 2VUYA 2GTZA 4KDVA 4I0CC 3P2TA 1KNOA 3MACH 5C0CB 1JGLH 3TH3T 1F4XH 3PWUB 5L6YH 2VXUH 5FECB 3KDMA 4JFFA 3B3IA 5FHAH 2E9IA 2NXZB 3DX7A 3H9HA 2ICWA 5E8EA 3WUWB 3HAEG 1HDMA 5E9DE 4C58B 3HFMH 4G8GE 2VWEE 3THMH 3WN5C 4PYGA 3LPWA 4LARH 5SWQB 4GSDH 4FQJL 3SEPA 4KVNL 4NKOA 1N7ML 1NMBH 1OTTC 2Y06H 1KB5L 4Y19D 1YEJL 3WL9B 3NCYP 1G9MC 4WJ5A 4TYUA 1MF2H 1VGKB 2NZIA 4IRJD 2IAMB 4JEGB 4P2QA 5A3ID 5IB5A 4Z77A 4XVTH 3MZTA 2HFFB 3DI2B 3UEZA 4U3HA 1GGIL 2XN9A 5C08D 5DQDL 4HGMA 2JCCA 5T3XE 1X5IA 4FTVE 3QDAA 1B4JH 1MVUA 4TNWK 3EFDL 5LG1A 2ILLA 3DETD 2HMID 4JDVA 3NZ8A 5HGHA 1A6UH 1Q1JL 3CDGA 5J11C 2LAAA 2DQEL 2X42A 4ODWB 2VLJA 2GTWA 2DICA 5FUZL 1YZZA 3MRHB 1F42A 2XG5A 2IQ9H 2H3NA 2O5YL 2VZUA 4ZD3H 2DF3A 4OIAA 3HRZA 3MV7A 2E7LC 5TF0A 5JZ7D 4G7VH 1RZGB 3DBXA 2ZOKA 4B50A 1GGTA 4NP4L 1AH1A 5C07E 5EZOL 2D3VA 3TVMD 4OCXL 3K81A 4Q58C 3GB7A 3STZB 1WCBB 3ALPA 1QBML 3KLAA 3OJDB 2FX9L 1MJUH 3MBED 2NXYD 4Q74A 1F90L 1VFOA 3EYSL 4I9WE 4S2SA 3SPVB 5CJ5A 3I50L 3BZ4A 5JLZB 2EH8L 4PGEA 3U7WL 1A7OL 4BYHA 5EH1A 4QRRE 4IIQA 3BZFA 12E8L 3L3OA 4X6EB 1JMZA 1YEHL 5D2NA 2XWTB 2ITCB 2NY6C 4OGAD 1NLBH 2BNQE 5GPRA 1U8PB 4PJAE 3AVEA 3VFGL 5GGSB 4RWYL 1KOAA 1YNTB 2P7TB 4YBQD 3U4EA 5DSCA 1BP3B 1TETL 3O11B 4GMSL 1HN1A 3TJEL 1NGXA 5E8PB 4D0CA 4WHTA 5INDB 3OWEA 1NFKA 4XP6H 4YHLH 2C1PB 3UPRB 1G7HB 4HF5H 5DUMH 3AC0A 5HDOA 1G6RL 5D1ZC 2E6JA 3T8XA 1IGTA 3IU3B 4U1MA 5IHUH 3WJLA 1MVFA 3PWJB 4XBGB 4LLYA 4N1CA 1FO0L 1GZPA 1MH5A 1QTYT 2HT2C 3VRIB 4LCWD 3D25A 2V7HA 1TQBC 4ZTPH 5I1KL 1FYTD 4X6FA 3D2UD 2VDRL 1DUZA 3OF6A 5GRUL 5IFHH 4CU6A 4KVCH 4Y5XA 2VITA 3T4AA 1OY3B 4UIKL 3RVWC 2PW2B 4NQED 2QQKL 4WGWB 4Z7VE 2NX5E 1KNOB 1MCHA 4L4VD 3X17A 3NMEA 1HXYA 1INDL 4U1GC 5EU4A 4NDMB 5ADOH 4X99A 4OD1H 4HJ0C 2EH7H 4CNIA 5C1MB 4ZUUA 1J7VR 3KPRB 2NTFA 1LO5A 4D0DA 1X5XA 3KDMB 1LO4H 3ZKSD 4I0PC 3B3IB 2WP3T 5C0BA 3QUMH 1CF8H 2EDQA 4UOW0 3H9HB 4OLXH 4MA7L 3RWJB 2ICWB 1R0AH 5JOFA 5HVHC 1HDMB 4KJWC 3NCJL 2F8VA 2AJYL 1OF2A 2W65A 3U9UB 4G6KL 2VQUA 5I1CL 4NZTH 1KCRL 1WJ3A 1MRCL 1X5ZA 3VGBA 4NKOB 2NY5C 4CGTA 3FKUS 3FAXA 5F21B 5J0BA 4WJ5B 2E8ZA 3MLZH 3OG6B 3G6AA 3UYRH 1YQVH 2QJDA 3WO4B 3G5XA 1I1AC 3SDCA 4P2QB 4K71B 1TVHA 4Z77B 1RPQA 5E4EB 4ONOA 1MCCA 2IGFL 2JIXA 4HIXH 4P59H 2XN9B 2BX5A 5TE7H 2X1XR 3A0OA 2JCCB 1CLYH 1S7TA 1UWEL 3EYVA 1MVUB 1EEUA 3WIFA 2CKBH 3FB5B 1FP5A 3GHBL 4NOFA 4HWBA 4JDVB 1M7DA 1S7VB 5HGHB 3CDGB 3GIZH 2VDQH 3TYGH 4UDUA 3AFLA 3LQAL 4IOIA 4D9QE 5LGJA 2VISA 1UM5L 2DDQH 2GTWB 4CMHB 1A7QL 5EU6A 1KPUA 1JHKL 1MELA 1OGAD 3L3HA 4M62H 1YEIH 3AB0B 2XG4A 2H3NB 3C9NA 3TIDA 4DOHB 4WO4A 1JZ7A 3MV7B 3E0GA 4HIEA 3BGFB 1IKNC 1FZOA 4ZMAT 3DBXB 4C4KO 2NY6D 2VXQL 4MXVF 5CUSH 5F7EH 4LKCA 1MNUH 3CJJA 2VXTH 5DD5H 4JKWA 2H2SC 1FPTL 4POUB 3GB7B 1H9VA 3VGAC 3KLAB 3GKWH 4M5ZL 4KROB 2VTFA 1UENA 3HPJA 4JHBA 4S2SB 4UNVA 2P8PA 3WS3B 2EDEA 4PGEB 1NC4A 4YPGA 3CFEA 4ALAL 3KYNA 3SJVA 2X1OA 3IT8D 4AQOA 4OZGA 4IIQB 4J1UA 3BZFB 2FL5B 4M7KH 4YHML 3L3OB 3R1GL 5BRZA 3RZCA 4P5TA 5D1ZD 5D2NB 1U8LA 2DQDH 1N6QL 3CZJA 1FNGB 1RZFH 5BQ7A 5D6DC 4X7SH 3EDKA 2R2BA 2JJVA 2HT2D 3ZKQD 2W0PA 5FYKD 1WBYA 3CFDA 3ALXA 5DSCB 5MHSE 4XAKD 1LO0L 3N0PB 1F4WH 1NGXB 4D0CB 3LV3B 3M07A 4I77H 3HA0A 1EO5A 4KKNA 4XHJC 1I8LC 1MEXH 3RVWD 3IGAB 3ZDYE 3MA7A 1JVKA 3QXAA 2CLRA 1JNLL 2NZ9C 4QXUL 1JYNA 1IGTB 1UB6A 2APTA 2ZP0T 4U1MB 3VXRE 3DX9B 1IZJA 2AKRA 1LO3H 5JIHA 1A9EA 4P4KA 3LRGA 1GZPB 5EU7E 4HJ0D 4WU7A 3D25B 1DQQB 1I7UA 2K9UA 1QFWM 4O4YH 1DUZB 1NAMA 4I0PD 3OPZL 1KIUA 3S96A 3LH2H 2CDFA 2X89A 4Y5XB 1U41A 3T4AB 1OAKL 4KJWD 4F57L 1DJSA 5KJRL 2VLKD 5LCVH 5E24E 5KAQF 5E08H 1F5WA 4QRPA 3TT3H 3DRTA 3JBG7 1W72B 3FOMB 1F6FB 4FZEL 1JNNH 3CK0L 1LHZA 3DNKA 3F8UB 2AS5M 4Z95L 3HMWH 3P9LA 4Q6YA 5LXGH 4X99B 4M6OL 5IMOA 1GHFL 3G6JF 2VNCA 5ESQA 3MRKB 4CNIB 2NTFB 4D94A 1LO5B 1I1AD 4FHBD 4D0DB 2GJZB 5DR5H 3VFNA 5JOEA 5C0BB 4BZ1H 4PPTA 2B1AH 3GSXB 3NBNA 1KXTB 5JOFB 4ONFH 5FUCC 4G6MH 3U2SA 1OF2B 2H6PA 5IMMB 4M8VA 3N85L 1J8HA 5F9OH 4RMQA 4RRPG 1E27A 4AEHL 1C16B 4JFEE 1GRWA 3P4NA 5T3ZE 4YFEA 1FIGH 4ONGL 3LKNB 3HNTL 1P9MA 1DZBA 4EBQL 1NLDL 2JK5A 5TDOA 3LSOB 1X7QA 4ZS7H 2JIXB 3WFCH 2VSCA 4PIRF 5KZCB 2VOTA 3EYVB 2I07A 5DD1H 3VXMD 3HPLA 3WIFB 1NEZA 3C5JA 1TIUA 1LK2A 1M7DB 5I16B 2H2SD 4M6AA 1AKJD 3LVEA 4UDUB 3DO7A 3VXUE 1BVLA 4JM4L 1RULH 4K8RH 2BVUA 4E5XA 2HFEB 5EU6B 3VXQA 2Q7YA 3CFKA 4PTTB 1KPUB 4GKSA 3L3HB 3C9NB 2X4UB 2VDLH 3TIDB 5I6XC 2Q3ZA 1L9NA 4ZFGL 2P44B 4WO4B 4JFQA 5DTFA 4NKMB 4HIEB 1FZOB 1UA6H 5EZIH 2HFGH 4L5FL 2BERA 1T2JA 4BZ2H 4LKCB 5L8JB 5J7CC 3IFLH 3GMNB 3V6OA 4TVPD 1NANI 2EIZA 3KPPA 3HPJB 4OGZA 1MCRA 3OSKA 3V95A 4GBXA 4OGYH 2EE3A 4XHJD 3KXFD 3CFEB 4HC1A 2ED9A 1IAMA 3I6GA 4J1UB 5J1AA 5BRZB 4P5TB 4YZFE 1RJLA 1EEZB 2NZ9D 1U8LB 1QBBA 4PJXF 1H3TA 1J11A 3RVVC 5BQ7B 1KN2L 2R2BB 3CVHH 2W92A 2VLRE 1ACYL 4DVBA 3D39A 3DX8A 3WNLA 3FMGH 1WBYB 5KN5A 3CFDB 4RISL 4HULB 3ILPA 5TE6H 2J1KA 2O5ZL 1XEDA 5F7YC 3UDWC 1VA9A 3EFFA 3IDNA 3GHEL 2FB4H 2R2HA 4YQXH 1NSNL 4OF3A 3MA7B 3FT4B 4F7PA 2J5LB 2CLRB 4JM2F 4WTZA 3TFKC 5GRJH 1VGEH 1UB6B 2RHEA 3MGTA 4K3DH 3MYJB 1A9EB 4P4KB 4XPFL 2PXYA 2ZSVB 2P8MA 4GOSA 4XMPH 3GMQA 2KUTA 1UJ3A 1G7LA 2BZDA 1NAMB 1EVUA 2AXFA 3O6KL 3NFNA 1WWWX 3CXDH 3D0LA 1QO3A 4ENEC 2EDXA 3S96B 5C7XL 2CDFB 1F6LL 5EOCJ 5L2JB 3VMOA 3S36X 4NHUA 4I18A 2XYCA 1T20A 5T3XL 5KSAA 3CU1A 3GJFK 4YBHA 5GS1C 3QFJA 4IMKA 2D7PA 3GSOB 3P9LB 5JXEC 5C2UB 4X7TA 4Z5RA 5MEQB 4HD9A 4A2LA 4XMKH 5EORL 4XGZA 4JKMA 4WWKC 5ESQB 4K9EH 3LKQA 5FM4A 3NFSL 4R4NC 3UTSD 1BZ7A 4MYWB 5D2LB 4Y2DB 4P9MH 1KGCD 2R1YA 4LQ1A 5K59E 2DBLL 4DQOL 1WCQA 5DQ9A 3U2SB 1RUMH 2XTJB 3ET9F 4J3SA 2H6PB 4S1RH 5GJSH 1J8HB 4NQXA 4P2CG 1U58A 3S37H 1E27B 4XNQA 2Q7NA 1SJHA 3BP4A 4LSRL 3P4NB 1JZ3A 4UTAH 2X4PA 1VDGA 4HUKB 4PY8J 3PP4L 4Y4HA 4JRWA 1DE4A 3TT1H 5FF6A 2X09A 5CINH 3RJQB 1AR2A 1KN4L 2ZWLT 3L5WA 4DCQA 2CK2A 2JK5B 5TDOB 3RPKA 1N4XH 1XGPA 1J0YA 4V1DE 5GISH 5DD6A 1PDKA 3QIWC 4DN4L 3DXAA 1JI2A 2DL9A 3F65A 2DBJA 2Y5EA 3S36H 5J56B 5JPNA 3AM8C 3HNSH 4Y16A 1T0MA 3HPLB 1NEZB 1MUJB 3C5JB 1H5BC 2WBWB 1LK2B 2CIIA 3VW3H 5KVFH 2XZAH 3P3YA 3DO7B 3HZKB 1BVLB 1VEOA 5HY9A 3VDAA 5FAAA 4LAJH 1KLGA 1NBYA 5F3HA 3RGHA 1RUQL 3VXQB 3CFKB 3NIFF 5C3TA 1ND0A 2Q7YB 5GSVA 1KELL 4KFZC 5JPMB 4XCNA 1A22B 1OAXL 1QLRA 2FATL 4DKEL 4LHJB 1CGYA 3VD7A 5ILTH 1GXEA 4JFOB 1Y6NR 2HA1A 2YZ8A 2LTQB 5GS0C 3WXWH 1LDSA 2G2RA 1IQWL 2CO6B 5T5FL 4UT9H 5B3NA 2AJXH 4LPWA 5AWNH 3QEGH 2YWYA 4MSWB 2O61B 1KACB 4XPAL 1BQHA 2J7LA 3KPPB 1ZE3C 4JFZH 4GBXB 4YXLL 4TTDC 5GSRB 1KB5A 5J9PA 1HHHB 1NL0H 2VN7A 1RZ7L 2UZIL 3NN8A 1L0YA 3I6GB 4OI7A 1Q72H 5E2TL 1Q9WA 4XI5C 3TFKD 4QNPF 3SGEH 1RJLB 4WI6A 1Q0YH 3C6LA 3BESR 3T2NL 5I1JH 4U1NA 4CU7A 1WZMA 4JGJA 4LLWA 3ROLA 3P4MB 4APQA 3D39B 2Q8AH 5F7UA 3Q5TA 2UZXB 4FFYH 2AEPL 3JWNC 5KN5B 5I2IB 4XC1L 1I3RB 3CX5J 4OD3L 2YD8A 4CVZA 1CLOL 4L4TE 4NKQB 1ROWA 4ENED 4X0KA 3BXNA 4FQ2L 3ARBC 4OFIA 2R2EA 7FABH 2R2HB 4EXKA 3H8NA 2HVKA 4QTHA 3HG1A 3IDMA 3VCLA 3NCFB 3P0YH 2CMRL 1FVEA 3QAZB 1N0XH 1WZ1H 5KVEL 1E6OH 4RGOH 4JRXA 1L7IH 4OLEA 1GOHA 5JXED 1FC1A 3MRMA 1L7TH 2PXYB 1QSFA 1WAAE 4JG1H 5M7QA 2P8MB 2XQYK 3VWKA 4NO0D 3GMQB 1G7PA 4PJ8D 1UJ3B 1G7LB 5I0ZA 1ETZA 4K94C 4R4ND 2AXFB 2VO5A 4RFNB 1CD9B 3DUUA 1QO3B 2BMKA 4JFYB 3FOLA 1NC2A 2IH3A 1FSKB 1J05B 4OLYH 3PABA 4D9RE 4XZUA 4DVRL 4PY7A 1TJIH 2H8PA 4XWGL 4NHUB 1DBKH 3UTTD 5KSAB 2EO1A 4FQQA 2EDDA 4NFCA 4S1SL 2C4FT 2B2XL 3QFJB 3PNWA 1XGRA 2SEBA 3FO1A 4JN2B 1NGZA 4OCYH 3RWHA 43C9A 4GAGH 1SY6H 2WBJC 3NGBB 5IVOA 4OIIH 2OR8A 2P8LA 4BELD 1J5OL 3LKQB 1K3IA 3G6DH 1BBJA 3MXWH 4U1KA 5CJQH 3SCMC 4LPUA 3B9AA 1BZ7B 5ICXA 1I1YA 4HUVA 3BX7C 5HPMB 3OKLA 2R1YB 3QIWD 5CHNA 1KIRB 2YD2A 2RR3A 5I1LA 2ESVD 5JQ6L 3HE7C 4N8VG 4OF5A 5JIPA 4KJYB 1KEGL 2KL6A 4U6XA 1MRFH 4XNQB 1UACL 1DEDA 1S78C 1ZGLP 2X4PB 1R5IA 3PWPE 1P7KA 5D7IA 2WUCL 1G6RA 1DE4B 5FF6B 3MLXH 4XXDA 5DK0A 3SKMA 3L5WB 5E8OB 2C3WA 4HKJB 5A16A 1A2YA 1DR9A 5D5MB 1A0QL 3MV9D 4AIOA 3A6OA 1AQKH 1MI5B 5IBUB 3LKRA 1R5VB 5DVOA 3BAEL 3IDXL 4S11A 1F6AB 5DD6B 2F53A 4NC1C 5DD0L 3DXAB 5GGQH 3LKSA 2DWDB 3P73A 1HSBA 4PJ5D 4H88L 4QHKI 5JOPE 5D72L 5GS0D 1OAZH 2N7AA 3LB6C 4YDIH 5IF0A 3DRQA 2AJUH 3MLWL 3KPMA 2CIIB 2HYMA 3EOAA 3QDME 1V8HA 1Z9OA 2MNUA 2HJLA 3Q6FA 3CH8A 1BD2E 4PD4J 3VFSA 4YXHH 4LSVL 2D7TH 5DVKA 1DQDH 1BM3L 4IRSC 5F1NB 5HY9B 1NBYB 2OP4H 3BPCA 4M3JA 1ND0B 1A6WL 1PY4A 1BQLH 4GRWB 4TTDD 5GSVB 5EPMA 1FBIH 1A3QA 3EYUL 4ETQA 4XCNB 1IAIH 1UWXK 3FQNA 4HWZA 3IDYC 4QYOA 4XI5D 2HRPH 1A9BA 2Y07L 1Z5LA 3JWOL 3ZT6A 1NCCL 4JRYD 2G2RB 3P9WB 1JGUH 3OAUH 3F7YA 1BVZA 3PQYD 2IH1B 4P5MB 1G1YA 1I8IB 2O5XH 4R2GB 1BQHB 1U8OA 1XIWC 1OD9A 3W81A 1F02I 1SM3H 2OL3L 3MLYL 6FABL 3ARBD 3U6RB 3S88H 2VH5H 4RX4A 3T0EE 2XXCB 5GHWH 1KIQA 4NC0B 4U1NB 4LLWB 3ROLB 5IR1A 3HS0B 3JWDH 4JPVH 3PWVB 2GJ6B 1JGEA 4WI3A 4ERSL 2XRAL 3QHZH 3DGCR 3HMXH 2AJVL 3BIBX 3TC9A 5DHVB 1MIEL 3MTRA 4KK6C 3QG7H 3VXSD 2HVKB 3HG1B 3IDMB 3VCLB 7CGTA 5CEZD 1FVEB 5DA4A 1TZGL 2Z4QB 5HTSA 4ZSOA 4LFHG 4EJ1C 2YC1A 3MRMB 4JGMA 4G9FD 5T3ZL 3SKUD 4MXVE 5E6IC 3DHMA 1JZ4A 2WBJD 5ISZE 1P4LA 1BGXL 3MXVH 3BI9X 1ETZB 3SCMD 5C0AD 2ICCA 3DUUB 4XNUH 3K8MA 3O4LE 1BAFL 3R06B 4YDKH 1NC2B 3IS1X 4LMQI 1EZVY 1DVFA 4OCRH 2BFVH 5L9DH 4PJDA 1AD0B 3PABB 4TUKH 3SOBL 1XR9A 2Z8WC 1W8OA 4XZUB 2BC4A 5ELIA 5E03A 3Q5OA 4DEPC 3HE7D 4PRNB 3SQBA 3GI9H 5FO8A 2DIBA 4OBRA 4QRUA 4WNQB 4FQQB 3V9FA 1S78D 3L7EB 5DS8B 4RQQB 4XNYL 1IVLA 5HHME 1WEJH 3HNVH 2P5EE 3PNWB 2SEBB 1NGZB 5FK9A 3RWHB 4UT7H 43C9B 4RAUB 2V9RA 3L5XL 1BBJB 1F4WL 3ARZA 4U1KB 4Y5YC 5ICXB 1FAIH 1I1YB 4MWFB 1FCGA 4LLDA 3S9DB 4MX7A 1AXTL 4X5LA 2M26A 5HHNA 1F45A 3IFNL 5CHNB 5JTWA 3T3MF 2J6EL 5I1LB 3NACL 3LB6D 4EUPH 2MKWA 4U6XB 3VXNA 3EUUA 3PGFL 3VI3F 4HKZA 1MFDL 3QQ4A 4JLRB 2QSCH 5EIVA 1P7KB 1Q9LB 3K3QA 4LSTH 3LIZH 1CQKA 3QDGE 1CIDA 4HV8B 5I8EA 2BVYA 2XWJA 3NCBB 4IRSD 4I3SL 4Z0BL 1KPRB 5DK0B 1OP9A 1BJ1H 4JZNA 1KF9B 1MFBL 4LHUG 4QOKA 3SKMB 1GPOL 3H9SE 5A16B 5TQ0H 5IESH 4TPRH 2DLGA 3QUKA 1CE1H 1BBDH 3LKRB 5JUEL 2F53B 5K9JL 3LKSB 4PP2A 4DZBA 5LCVL 3P73B 4ODSL 3NPSB 1D5XA 2OSLB 2OZ4L 3WO4C 4NNXA 3X3GH 1MAML 3UAJC 3DRQB 3ESVF 2GUOA 3ZKNC 4UQ2A 3V5DB 2AI0L 2XACC 3Q6FB 3VFSB 3VGEA 3QEHB 4BQCA 1XIWD 4HPYL 3BPCB 4RMVA 4XXCC 1MIML 1NCBH 4FA8A 4K3HA 4AY0A 4PJ9A 4ETQB 4WW2A 1GYAA 4HWZB 3A6BH 4QYOB 2YXMA 1YMME 4BSWB 1F58L 1A9BB 3MRIA 2FX8H 4W68A 1VFUA 4AEFA 1ZT1B 5D1QA 2AJZA 4EKXA 1DFBL 4ZPTA 3RDTA 1FGVL 2DYPA 4J7RA 4LLQB 3LPFA 4IS6A 5BS0A 3GBML 3UTQA 2Y6SC 1BOYA 2P5WE 1U8OB 4PRBA 2F15A 4E41B 1IGYA 4KK6D 1QYGH 1XGYL 3I02A 5E8DH 5FGCB 1KJMA 4OZ4A 5HYEA 1GJIA 1H0DB 1EUUA 3O8XB 3ARPA 4AK1A 4HCRL 4KMLB 3HR5A 3C5ZA 3AS2A 5HHXH 1TNNA 5IR1B 4BQ9A 1HH6B 3MJ6A 5E6ID 4F15C 1JGEB 4HXAL 5DGRA 3ZYZA 1WT5C 1KEML 3RTQA 4ZNEE 2QTEA 2X41A 2WP3O 1UYWL 3BSZL 4FXGB 4OB5L 5K9OA 3RIFK 5KSVA 3MLUL 2ZUSA 4P23A 3U30B 1CR9H 3D3VB 1KCVH 4NZUH 4ZSOB 3DWTA 4N0UA 5EU3B 1N6UA 4M93C 5C09E 3V4UL 2CD0A 4WUUE 1AHWA 3QIUC 3QJFA 3KPSD 4KDWA 4P49A 4LDEB 1P4LB 3MLSL 1IC4H 1HINH 4JAMA 1E28A 3GK8H 3WJLC 4QEGA 3BPNB 1INEH 2HN7A 1IGCL 1GIGL 1XR9B 3BOVA 2ZCLH 5GRYA 5AEAA 5SWZA 3ULVC 3W9DB 2BDNH 5JDJA 4JFFD 2YPLA 3TCXA 4QRUB 5DMIL 2P48B 4H8WC 5EIIA 2NY0B 5GRXG 1I9IH 1EVTC 1U8QB 4LLUA 1CTNA 4JO2L 5DC0A 5FK9B 5JO5A 1PG7X 2EEAA 5T33H 3QDJE 2F9BT 5MENE 3D5OF 3C8KA 3FQXB 4MJ4A 1U91A 5H94A 4RFEA 3E6FB 2P45B 4XT1C 4LLDB 5I1DA 4YH6A 1TLKA 2A74B 3G5ZA 1YNKL 4FQ1H 3RGVD 2XQYG 5JW4M 1EDQA 4P2QD 4U31A 3UAJD 4WENB 4YR6A 3VXNB 4YLQT 3ZKND 2K7PA 4HFUH 3QQ4B 1MCFA 5E9DA 3O2WH 5DJZB 1PSKH 4QTIL 4G8GA 3QEQE 1T3FA 5I8EB 3RA7H 1DSFH 2XWJB 5B39G 1RHHB 3BJ91 1AXSB 5FYJU 2WUBL 1BWWA 5CEXA 3QUKB 1CK0H 2ARJA 5T1LB 3RBGA 5H37H 3AS1A 1PY9A 3RX7A 2VLJD 4PP2B 2OCFD 1AC6A 1NMCB 5HDQH 4DGVH 1MCPL 1D5XB 2VZ3A 4N8VA 4L8SB 3BQUA 3SDCC 2ARWA 4M4RA 3DSFH 2GUOB 5D7SL 4UQ2B 5BVPL 2APBA 5DJCA 4ZXBB 2CK0H 2EC9T 1LILA 2Z31C 4F8TA 1FZJB 2Y6SD 5AZEL 1PG7H 5FGBA 4FTVA 4D3CH 1ZA6B 2I9LA 3QIBC 4WI5A 3P11H 1WFNA 1ZWIA 5D7KE 3BDYL 4WW2B 1AFVH 3RWDA 4Z8FH 3T3PF 3F6LA 3ZTNL 4S1QH 1ZV5A 1MFCH 4KC3B 3M45A 4NFDA 4PBXA 3KG5A 3F6IA 2ICEB 5D1QB 2AJZB 4ZPTB 3RDTB 2DYPB 1MPAH 4UTBH 1YEEH 4IS6B 3IAPA 1Y6KR 3UTQB 5C6TH 2XT1B 1AGFB 4KUZL 3JZ7A 4PRBB 5C07A 2ADJA 1IGYB 1CICB 4PJBB 2BCKA 5FB8A 1KJMB 4OZ4B 5EOQL 4XRCA 3C6SA 4UB0H 1OLZA 2ZKHH 3HNSL 2NPLX 3DROA 1PYWB 5F96L 1MJJA 3C5ZB 2CQVA 5IW1A 1MRDH 3QIUD 4X9BA 1JI1A 2IFFL 5D2LF 4QRRA 1F00I 4UQ3A 3RZCC 4WFGE 1T03L 2VDOH 2BNQA 4YXKL 2XKSA 4PJAA 3RFZC 4NJAL 1QR4A 3MV8D 4TULL 1B0RA 1Z3GH 3DV4A 1F3DJ 4TQEH 1PLGL 4NUJB 1V3LA 3QJHA 3QBTB 4YHOL 3DGGA 3NIFE 5KSVB 3ULVD 1K6QL 5CFHA 2BVPA 4LOUC 5ALBL 1MQ8A 1KTDB 4I13B 1BPVA 4LP5A 4N0UB 2VKWA 4NIKB 5DURD 3QJFB 5BZWA 4JR9L 2WQRA 2A73A 2JJTA 1GC1L 3VJ6A 1KFAH 4QKXB 4C56E 1ZLUK 5AWNL 1KT2B 3MRPB 5I9QC 4H5SA 2E7MA 4JAMB 1IJ9A 1E28B 1RI8A 4NQUA 4O58L 2HN7B 3PE9A 4ZPVB 4ZODA 4JHZA 2KQMA 2DWEA 4WUKH 5SWZB 2WV3A 3DHJA 1GOGA 5EB9A 2YMXL 5I30L 2CDEA 5IK3A 5KW9H 3H3PH 5I73C 4OT1L 4QNPE 1HQRB 2YA0A 1QRNB 4WFFE 5DJ0A 4M61A 5CJXA 3MLRH 3SQOH 2NX5A 2ZOLA 3C8KB 1A14L 4Y5VB 4M8QB 2NY1C 5H94B 5TH2A 5E00A 2A9MH 2V2XA 4PS4H 4RFEB 2GCYA 4HX1A 5I1DB 2BOCA 2HRLA 5C3LD 3HKFA 3UYPA 4XTRD 4O5LL 3G5ZB 1RZJC 3SDCD 3TV3L 3EHBC 4YR6B 5IB1A 3ZSSA 4DTGL 1QSEE 3G5YB 2FZ3A 2Z31D 3BMVA 3D69A 2J4WL 3KLHC 3QIBD 1IT9H 5DMYA 3O2VH 3U0WL 4NJ9H 3A6CL 5CEXB 5KVGL 5TQ2L 4M48H 1XAUA 3UYOD 3WYRA 1AE6H 4CUCA 3I6LD 3E8UL 5IVXE 3JTTA 4YX2H 3DI3B 5BV7B 5IBLC 1FFQA 1BFOA 2B4CH 2HVJA 1YJDH 4A6YL 5DJCB 3E2HB 1JZ5A 3O0RH 3QNYA 5C8JB 1SY6L 5I1HH 1P5UA 1HOCB 2FECI 1ORSA 4PG9A 3MXWL 4BH8B 1EFXB 1Y18A 2DTMH 1ZWIB 1V3JA 4MA1B 3F62A 4QRSA 2BSED 4PV9A 5DJDA 3GJFA 4N8CH 3RWDB 3UXFA 2X1QA 4W4NA 1MJ7H 2OR9H 4LRNL 1BOGA 2EDLA 4LCUA 4MJIB 2ZCKH 1H3PL 3IKKA 3P9MB 1KJ2B 4NUGL 1NC4D 1RUAL 3UROR 3SJVD 4O51A 5DO2C 2IG2L 2EIEA 2F54D 2YHGA 4GXVL 3ZE2E 3RZCD 2MJWA 2CLVA 4EIZC 1FL3A 1IBGL 4UU9A 1NH6A 5FO7A 4ZFOL 1NMAH 5CBAA 3V52L 4PRHE 5C07B 1EJOL 2ADJB 3DYOA 3T1WA 1I85C 3V6OC 4N9OB 4L29A 4XRCB 4K07A 4I48B 1RUKL 4LOUD 5DFVC 3C6SB 3FT3A 2YPVH 2FIKB 4GBXC 2F5AH 5IW1B 5MEOA 1S7XA 1MCJA 1U8NA 4QRRB 3MCLH 3PHQA 2Q76B 4P0DA 4UQ3B 3ZKXC 3L1OL 1SVZA 5IVNA 1I9JL 4HS8H 2BNQB 4F7EA 2OP4L 4L1HA 2J8UF 4PJAB 3Q3GB 1YPZE 3GSRA 5I8KL 2NW2B 1T2QL 4OKVA 2A6KA 3MPCA 3QJHB 3DGGB 1DBJL 3ZE0F 4R0LA 3MRCA 2CRZA 2EDOA 1R3JA 1I1FA 4ODHH 4PRIB 1MREL 5D5MF 5BZWB 1S3KL 2A73B 2OJZH 4OUUA 5DMGC 3VJ6B 4FQHA 3N1QC 2AGJL 1ZEAH 4QRPD 4I4WA 4XPHH 5IWLC 3QAZC 5L7XL 2NY1D 3VXRA 4MQ7A 4EN3A 1KCKA 1JNHA 2F58H 5F71A 15C8H 3S34L 3MNZA 1CFNB 3E3QC 3T4YA 4M9OA 4IEFB 1R6VA 1LQSR 1CU4L 2NMSA 4K23L 1SEQH 2DWEB 5B8CC 1WICA 1FYHB 5JHDD 2ICWI 3EHBD 1E4KA 2CDEB 4JG0L 2J3SA 5IK3B 2OLDA 1OM3L 1G9MH 5F1KC 3PF2A 4NQCA 1X5LA 1UXWB 4GRWF 2XKUA 2EKSB 4CJ0A 3FL7A 2AEQL 1IEAA 5LKNA 4I18C 3KLHD 3KPRE 3IAGC 2Y25A 2CKBA 2NX5B 2ZOLB 4LAQH 3HI1A 3LEVL 5TH2B 4NQDD 3IS0X 4IMKC 5E00B 2V2XB 5IROA 2GCYB 4HX1B 1M6OB 4G6JH 2DQCH 2HWZH 4MD0A 3S97C 2FYYA 1CD8A 2RB8A 5FXCH 5EWIH 2BHUA 5L88L 1IGMH 3O41A 2FEDC 5IBLD 5E94A 2OS7A 4WCYL 1EHLH 4GLRH 1AY1H 5I8OH 1DQML 3I3BA 4HXBH 5IB1B 5SV4A 3MOAL 2NR6D 4YHZH 3N9GH 1JK8A 3FFCA 4YAQB 1MCOL 3LPGA 2VL4A 4LLMB 2R29L 3EYOA 5CCKL 4JFEA 1QFHA 1X5GA 1S9WB 4YDKL 4YHPA 4X6CA 3JTTB 1K8IA 4Y4HC 5BOPA 2ZNWA 3SKJH 1CVSC 1AP2A 4N0CC 3IXAA 3GMLA 1BFOB 3NH7H 4RMUA 2HVJB 5E99L 1G9NC 1S5IH 4ZFFA 1DEEA 5DFTA 1JGVH 4KJQC 2BVOB 5DO2D 2ZUTA 5A43C 1CZ8H 1D5BA 3P77B 1LK3H 4Y16C 2IJ0C 4PG9B 1ORSB 5F7HA 4DOHE 4QRSB 4PV9B 5DJDB 4B53A 3VXUA 1CGSH 3ARFA 2HTLD 4ETYA 1BOGB 2C3HA 4LCUB 4XP1L 4J3TA 4FFWC 3VG0L 1XF4A 4LRIA 2X05A 3ZYOA 4LF3B 1VCAA 4GG6A 3T3ME 2NTSP 1ZHNA 3V6FA 4OJFL 4XCFH 3GSNL 4O51B 1DLFL 2J6EA 2QSCL 1H3WM 1SYVA 2CLVB 1LE9A 1NPUA 4UU9B 5FO7B 5CBAB 3VI3E 2BVEA 2ATKB 4OV5B 3U46A 3NA9H 4AENA 4NN7B 4NQEE 2KQNA 1NGQH 4KMTH 5TJWK 5HJ3A 4H1LH 2FWOA 4L4VE 3BD5A 5FYLH 5T1DH 4U2ZA 4HDIA 4G8IA 1F11A 2X4TA 4JFHD 5TFSH 5FYKH 1NDGA 4U4BA 2XZCH 5MEOB 5DJ8B 2F74A 3QI9B 1U8NB 4NWUH 1RJZA 4UNUA 5CLTA 1RIVL 3PHQB 4M7LH 5DMGD 2YS4A 2ZUXA 4ZUTA 5K9KA 3ULUF 2IMMA 3TWCH 4K7PH 4IHOA 3C6LC 2MOVA 4F7EB 4GRLA 4MZ2A 3BHBA 3D9AH 5EZLA 3D1MC 1C1EH 3MNWB 5LBSH 3RVUC 2VLRA 3A67H 4LEXH 4APQC 4YDVA 1XGUA 3M1BA 4OKVB 3PGDA 3T04D 4YDLB 5EN2A 1WFOA 1FV1A 3FRUA 3MRCB 2XZQL 3C60A 1I1FB 2AVGA 4MVBC 3RKPA 3J8F7 2I9TA 1YYLL 4FQIH 4JO3L 2XTLA 3LEYH 4S1DC 3HC0B 4OUUB 3WHE0 5IFJA 3VXRB 1WBZB 4MQ7B 4EN3B 2DD8L 5DZOA 1GGCL 4XNZB 3JXAA 1NCWH 5LGHH 3MNZB 1DDHB 2Y5TA 2PYEB 3T4YB 3BJLA 3VWKC 2FEDD 3H7LA 1X5AA 2NY5H 4Q9RH 2QEJA 4HH9A 3VH8B 1IGFL 1KCUH 1LNUA 4TSBL 1UZ6F 4M00A 3GMOA 3WSQL 5SWSB 4NQCB 4DN3H 3FO9A 1YUHB 1C7TA 4M6MH 1TVBB 3ZTJH 3RAJH 4U7KA 2ZJSL 1IEAB 2QQNL 4HCRA 4ZAKB 2CKBB 3R8BB 3NIGF 1KYOJ 4FXKA 4YHYC 4PGJA 1U3ZA 1KV3A 4MD0B 1AI1H 2FYYB 4Y4HD 4PREA 5F7LB 3KPQA 4PB0L 3MCKB 3O41B 4OFYD 5ANMB 4HW6A 4MJ6A 5E94B 4N0CD 4TUJA 2PO6A 2AEIT 3BN9C 4PJHB 4RSVA 1DBMH 2GITA 4KJQD 3TO4D 1FG2A 1JK8B 4OCWH 3NIDF 3FFCB 3RL2B 3UTPD 5D1XA 4WV1A 3PHOB 4Y16D 3ZT7A 2G5RA 3EYOB 1JYVA 3LDBC 4MQTB 4ODVL 4JFEB 5KAQG 1VFAB 1I1CA 1ACZA 4YHPB 3BFOA 5C0FA 4X6CB 1K8IB 4KKAC 4KXZH 4FFWD 1UC6A 4U6VL 1KPVA 1AP2B 3HZMA 3GMLB 3EOYG 3QO0A 4V1DA 1TZHA 5B38G 4DKFL 1CDBA 1C12A 1RMFH 3INUH 3CSGA 1D5BB 4DK6A 3AREA 4R97C 5EU6E 3LKPB 1DUYA 2EIDA 2P42B 5AZ2H 1RK0A 1HIML 3I84A 1IM9A 4KI5C 3ARFB 4LEOA 2OMNA 2CO7B 3C87A 1BVKA 1R24A 4XP9H 5I19H 1QHPA 1RV6X 5F6IC 3GGWA 4TVPH 4GG6B 2A83A 1ZHNB 4PJFA 4HFUL 3F5WA 4HWEL 4OTXH 4XVUC 4GXUN 1SYVB 5KANI 3O2DL 1EZVX 2B1HH 3MNVA 3C6LD 2HLAB 5DFWH 4QXTB 4FQCH 4KKCC 3RVUD 3TNMA 5C9KA 5IM7A 3LRHA 4APQD 1P1ZB 3BYYA 2RCSH 5KVDH 1I9RL 2A1WH 3W39A 3MA9H 3R8QA 3W11C 3SN6N 4HDIB 5ABDE 1F11B 1Z0NA 1PEZA 1OAYH 1P69B 4MVBD 4XPTH 5I75C 3NZHL 1OAQH 5I18H 2W38A 4S1DD 1OARL 4ZUTB 5E5UB 2XOTA 4PGBA 1A02N 3IU4H 4IHOB 2FJHA 4GRLB 4JRXD 3BHBB 4Q0XH 4QCIA 5E7FA 5EZLB 1Q38A 2AABL 2QLVB 1ZLSH 2VLRB 3ARDA 1JRHH 2VERN 2NY4B 1QSFD 3VWKD 4YDVB 8FABA 1XGUB 3M1BB 4XPBL 3PGDB 2FRGP 2F8XC 2APVA 1FV1B 5EOCL 4L4TA 1ZHLB 2HKHL 3F58H 3O6MH 5DZLA 2I9TB 4GW1B 3LQAC 3SGDH 3IJSB 2GK0B 2ERJC 3BD3A 3QRGH 3EDEA 3BUTA 5IFJB 1JP5A 3U1SH 2X4QA 4V2CB 1WAAA 2ORBL 3L6FB 4KPHL 1M71B 3VGDA 1HHIA 2N56A 3P4OA 5HI4C 1C08A 4HJJL 2A6JA 4K55A 4HH9B 5GGTH 1LNUB 1RURH 2I60L 3GMOB 3WIHL 5D71L 4KQ3L 2ENYA 4EI6A 3RUGA 4IOFC 1DVFC 1TJGH 4TVSa 4U1LB 2O93L 3STBA 1AIFB 1FORL 5D2LE 1Z2KA 4LSUL 1T22A 1I3GH 1K9TA 3HUJF 3V5HA 5LGKA 4ODTL 2XTJE 1X9QA 3KPQB 4NM4L 1CXFA 4MJ6B 4TUJB 2PO6B 2GITB 4W70A 2CGRL 3RHWF 2Z8SA 4PD4K 4J6RH 3OR6A 5D1XB 4WV1B 3KXFE 3FO2B 4PJBF 3MRBB 2FLBT 5C0RH 2OK0L 2W9EL 1BF8A 1J9CT 3QUZB 2PUQT 5F9WC 5HGAA 4P2OA 4JANA 3TPUA 3KR3H 2VDKL 3PWPA 4KI5D 3KS0H 2R8SH 3OZ9L 4RMRA 5C0FB 2FD6H 1ADQL 4HKXB 3CU7A 1I8MA 3EJZC 2LVEA 1JV5A 3BW9B 1KG0A 5IQ7L 1K8DA 4MB3A 1TZHB 5KBNC 4XVUD 3GSVA 4L8BB 1J0KA 1NCNA 3KJ4C 1C12B 5DRNA 5A40E 4JDTL 4LASL 4YDJA 1OGTB 1II4E 3TNNA 4KKCD 1DUYB 1TCRA 1NAKH 3CVHB 1QR1A 1QBLH 1E4XL 1IM9B 2A9NH 2FEEI 3IXTA 3QDMA 4PB9H 4BSJA 3W11D 2UUDK 4LEOB 3DVGA 1BVKB 1R24B 1CGXA 5IW3A 3QZWG 1IMHC 4G3YH 3GGWB 4PJ9C 2A83B 1QEWA 4OF6A 2GY7B 4PJFB 4QXGH 5AD0B 4RX4D 1F3JA 4X4XA 1XT5A 4WDIA 3MNVB 1H3VA 3BP6A 3QPXH 1RZ8A 4Z0XB 3TNMB 1D9KA 1ZVHA 4MAYA 3W39B 4YWGH 1BIHA 4KH2A 3RNQA 2IFGA 4G6FD 2PCPA 3H0TB 1A3RH 1DQLH 2B8OT 4MXWH 2GY5A 3VFMA 2YD5A 1MWAH 4NO3A 5IBTL 3UTSE 1BEYL 5CIPA 5KTEL 3QUYC 1QVOA 1R3IH 3QISA 1JPGA 4A6YA 1MOEA 3PHSA 3C5ZC 3MJ9H 3DLQR 2EXWC 3ZL4L 1YYMH 2ZCHL 3K8KA 1HH9A 1SY6A 4HQQL 8FABB 1BX2B 1CE6A 5HI4D 4NQVA 4Z7QF 1HKLL 2VXVH 5KSBB 3CVIL 1CGUA 3RTQC 3EOTH 5EZJB 5IVZA 2QHLA 3MRGA 4IOFD 2B0SL 3VGFA 4P2RB 4PUBH 1DVFD 3WXVL 4M1DH 2FBJH 3LS4H 3CSBA 2AK1L 4P23C 1V7NL 3VI4F 1JHTA 2EYRA 1LEIA 1OSZB 5HHVH 4XMLL 2L7UA 1FNSL 1EO7A 3GIVB 3IB4A 2X40A 4EXPX 1CD0A 2VDPL 1AHWC 4UOW1 4ELKA 1M7IB 2AW2A 1QFWH 3D48R 3MODH 2EDFA 4RA3A 5ISZA 4P46D 4IJ3C 1T1ZA 3P4OB 4ZFOA 2D7QA 1C08B 2A6JB 5C2BL 3QFJE 4AG4H 1NEUA 3WUWG 4EI6B 1AJ7H 3RUGB 2G75A 5C0GA 5ID1A 3O81A 4FZ8L 4RFOH 5HDLA 4JQIL 2R69L 4GW4B 2QADB 3VXPA 3TN0A 3C2AH 2ATPA 3FB7B 1JWMA 1EHNA 2P5EA 3HC4H 3V5HB 2GYSA 4PJ7E 4N0YH 1KC5H 1QSZA 3ZDZF 2J8UE 4G42A 5GGVY 3EJZD 5EO9B 2R0ZL 4QOKD 5HHOB 2R15A 5HVWA 4FQLH 3ROOA 3DMMA 2J88H 5HI3C 1J86A 2PTTA 4JVWA 1BMGA 2YD6A 3ZE0E 1YEGH 5T1KA 1EGJH 3O3UN 2Y7QA 2FH8A 2QSQA 3K7UA 5D5ME 4Y2OA 1MI5E 1NUGA 1JPSH 5HGAB 4UV7H 4JANB 3TPUB 3HI5H 1S7WA 2R4RH 5DYOA 5GS0H 4M6NH 4ZDHA 2VWEC 3W9EB 3K0WA 4O2CB 1QKZL 3H9SA 5CKAA 1TZIB 4PJ9D 1KG0B 4PJAF 4UV4H 5TGBA 4LU5L 4ODUA 1J0HA 1RIHL 2BHYA 5DRNB 1OPGH 4JPIB 3BQUC 4GRWE 1HZHH 1TCRB 1QR1B 4OLVL 1KULA 3GI8H 3E2HC 3IXTB 3JUYA 3QDMB 5D7JA 4Z9KB 1NCAL 2YRPA 5BS0D 3BT2H 1JUFA 2Q86B 2MCPL 5FGBC 1KCSL 3SKNA 1KTLA 2B5IC 3QEUA 2GT9B 4CAGA 5LVEA 4NN6C 1J88A 4YEEA 4X83A 1AXIB 1QEWB 3N50A 4HWUA 1FGNL 2DQGH 3DIFA 4L3ED 4XPGH 1F3JB 1A4KA 3QUYD 3N9GL 4P99A 1C7SA 1A21A 2JLLA 4X7EC 5FYJE 4WDIB 5E1HB 5AAWA 5FFLA 3C5ZD 3ZSTA 2Y36H 3BEVA 2YSSA 2EXWD 3CH1A 2E7HA 1ZT7A 1D9KB 1EO8L 4MAYB 1OT2A 2R1XA 2D7MA 2EDBA 5E2VL 3RNQB 2P5WA 2NY2B 5BMFH 1XGTA 3RTQD 3VFTA 1W72L 4FQXC 1UCBH 3OAZH 1VFBA 3VFMB 2GJ6E 3P0VH 5E4IA 3HTLX 4K94H 1IGJA 3O9WB 2RJMA 3M8OH 5CIPB 4CVUA 3KYOB 5GGUA 4P23D 1QG3A 3PV7A 1EIBA 25C8L 1EX0A 3LZFH 4X5XA 1JPGB 2OJEA 4FP8L 1KSRA 2XWBA 5CEZH 2ESVE 4GJTB 3SE4A 2DOCA 5FM5O 1LEKA 5I1GL 4GFTB 3HG1E 1HH9B 1Q0XH 2NY7H 1EMTL 5ENWA 3NCMA 2ADFH 4ZNEA 3CSPA 4BA8A 1MHPH 3MRGB 5IVZB 1B2WH 1Z9SA 3BE1H 3VFUB 5SWZD 1OAUH 1JHTB 2EYRB 5DRWA 1LEIB 2YPLD 1F8TH 1RJCA 5C09A 5FOBB 4ZTOL 4DUXA 4WUUA 2R0LH 2APXA 4HSQA 5HYJB 3QWOA 3ES6A 3GZKA 4X5WA 5F7DB 3TJHC 2JJTC 1QFUH 3W0WD 1CFVH 4LPCA 5ISZB 5DJAB 1T1ZB 2EC9U 3RWCA 1X5JA 4TUOA 5GJTH 2VKXA 3GJEB 2CLZB 5HI3D 4HLZH 4NQTA 4MNGE 1N8ZB 5HHQA 5JR1H 2G75B 5C0GB 3MOBL 2VR4A 1ZGLA 5KS9E 3AU1B 4GXUM 4XBPA 3VXPB 3OKYA 3TN0B 3IJYA 2KKQA 1LDPH 1IE5A 1JWMB 1PEWA 1P4IH 1QD0A 1U8MA 1FNEA 4OI8A 2AJSL 4GRMA 5HHMB 5E9DD 3ULUE 4Q9QL 4G8GD 2X4NA 3FB8A 1Q94A 1A1OB 5CJXC 4G42B 1UZ8A 3QDJA 3OX8A 1A7NL 4N68A 5MENA 3QHTC 1AGBA 4AIZA 5C71A 5FCSH 3ROOB 3DMMB 1NCTA 3UJTH 2PTTB 5GS3A 2ADIA 2DM4A 2YEZA 1FE8H 5I8CA 5T1KB 4JQVC 4UT6L 1KTKE 4XVSL 1FAKT 3G08A 1N64H 1TCMA 3BQUD 1MCKA 5GGRA 2CJUH 1T80A 4JM2A 2C4XA 4WFED 1DL7H 3F12A 3HE6A 1OQXA 1S7WB 5DYOB 2PYFA 3QEQA 4MJ5A 2MPAL 1T04A 4KY1L 2JELH 4ZDHB 5T3XD 4CVXA 3V2AR 4FTVD 4L3AA 3UTZA 1K5NA 1QNZH 5E8NA 1UCTA 2X7LA 3H9SB 1BFVH 1IQDB 3VWJB 4Q6IC 5GRWA 1N0LA 2VE6A 2HLFC 5ESAB 1NFDB 2X6MA 4KKBC 5F97E 2BP3A 3WKML 4HUUA 4UNTA 2AP2A 1DANT 5E5MA 5TGBB 1RJYA 3TA3B 4ODUB 4JKKA 3QCUL 4BK5A 1UZ6E 2YKLH 1SBSH 4HMDA 3VXSE 5HYFA 5CEZE 1Z9MA 3HZVB 3MRNA 3OGCA 2IPKB 5D7JB 1MQKH 1E4WH 3NIGE 4N90D 2E3VA 4G9FE 5I1EL 1YECL 3SKNB 1KTLB 3QEUB 4QHLA 5BO1H 4FQXD 4M7LT 1U93B 2VZOA 5I71C 2WLYA 1HEZA 4NRXA 1MLCA 5C0AE 2V6HA 3GO1L 3DIFB 4I2XA 1S7UA 1A4KB 3FTGB 1RAMA 3V5KA 3MRQA 4KZEL 4K2UH 4H20H 4UUJA 4E41E 4LNVA 3CNKA 2YSSB 3NIDE 2Q20A 3FT2A 3CH1B 4TNVK 1NDMB 5TDPA 2C26A 3GSWB 2IPUG 2AJ3A 3F7VA 2BNQD 3CMOH 2ICES 2P5WB 5A2FA 3VFTB 3QZWA 1HYSC 5LQBL 1U9KA 1VFBB 3CFBA 1JWSA 1IGJB 1YEKH 4OIBA 5IT2H 2CRIA 3BWAA 3BKJH 5GGUB 4N8PA 1ZMYA 4H26A 1JL8A 4NC1E 3WEXB 2CXKA 4LQFL 4X5XB 1T7VA 2XWBB 1REIA 1MFAL 2OI9B 3W2DL 3B9EA 4PJHF 3TJHD 4NM8H 4D9LH 2R56L 2ID5A 4GS7C 3ABZA 3P30H 5DUPH 3D3VE 1RZIA 5ENWB 4ZSOE 4OZFG 3TIEA 4HIJA 1S7RA 4DGIL 1GCFA 3IRZA 3UMTA 4LGPB 1YNLL 3QCVL 1TPXC 4X6CF 4XCEA 4AMKH 4MQXC 3BKCL 3TZVA 3D85D 4EUPB 4OLZH 4R0LC 5C09B 4JHAL 4LFHD 1EFQA 3QSKB 3VU2A 3MREA 3QWOB 3QB7C 4R4FL 2RCSL 3V4PH 4WI8A 3O2DA 3LN5A 4RCAA 5DJ2B 3WFBL 4C56A 1UH2A 4HGKC 4TRPL 4ZYKA 3T1FB 3RWCB 3JWOC 2AK4D 4TUOB 3S98A 4JY5L 3LN4A 5HHQB 4XNZC 3CFCL 1D5ZA 1UADC 5EU7C 4GKZA 4JZJA 4UI2A 2QHRH 1ZGLB 2IADA 2RFXA 4XBPB 2NY3B 3IJYB 3V0WH 4RZCA 2BJML 3Q2CA 1E4KC 3GEWB 2DLTA 2EYSA 5SX4I 4GRMB 3L3GA 3EOBA 4MNQB 3PWUA 4GG6F 2H1PH 4HWNA 4OD2B 1PG7W 2X4NB 3FB8B 1GAFL 4UILH 5MENB 1AGBB 4AIZB 5TPWL 4OCSL 2HLFD 4HK3N 4KKBD 3WUWA 2JB5L 3FO0L 4QHNA 5IJKA 4NWTH 3JV0A 2YEZB 4BFGA 2R0WH 3G08B 5I76B 1AGEB 1LEGA 3QCTH 5SWQA 2DKMA 1T83A 2XA8H 2J12B 3WNPA 5DHXB 1FZKB 3OXSA 5FUOH 1QSEA 4LSPH 1UKTA 1NGPL 3HE6B 2E5EA 4HC1L 4ZS6D 3WL9A 2HH0L 2WW8A 2PYFB 1ZLWH 4MJ5B 3LMJH 1FLTX 4CVXB 3C5SA 3UTZB 1ZHKA 4J3UA 1K5NB 5E8NB 4LHUD 2VZ1A 3BIKA 1RUPL 1RIUL 2X7LB 4OQTL 3G9AB 4YZFF 2BNRB 3REVA 2X5PA 4DFIA 4Y4KB 1X4YA 3HI6H 2VE6B 3RY4A 1NFIA 3KGRA 3KJ6L 4HUUB 5E5MB 4D9QD 5IVXA 3IFPB 1WUNT 3UPCA 1CLZL 4TSCL 5JHLL 3IDGB 1A64A 1UM4H 4JN1H 4YHNA 3WIHA 2BRRH 4KMQA 1TJHL 5BZDB 3EDJA 3CD4A 3DVFA 1K4CB 3MRNB 4LVNB 3BPOB 3OGCB 4JREC 1YN6A 1IARB 4UINH 1HI6A 1QZ1A 5F7KC 4RMWA 2E27L 3EJJX 1J1OH 3NAAL 3HUJE 4PBWD 4RGNE 1HYSD 4G80A 1A7PL 3Q1SL 1HEZB 1MLCB 3IDJB 2R0KL 4I2XB 1S7UB 2A6DA 3TBWA 3V5KB 3FN0H 4WHYH 3MRQB 4YBLC 2D03H 1UWGL 4P9HL 4LRIC 4UUJB 3STZA 3FT2B 2B4CC 4PJBE 5DLML 4TOYH 1ITBB 3QQ3B 3BO8A 4KDTA 4XB7A 3RWGB 4YE4L 1VESA 1U3HB 4QGTA 5JLZA 4HZAA 1TTUA 4PRHA 4TSAL 5TF1H 3FAWA 1H8OA 1ZTXH 3WUZA 1ADQA 5JW4R 4XP5L 4X6EA 1UB5B 3BWAB 5MHSD 2ITCA 4BUHA 4MQXD 4H26B 4RDQF 2X2YA 3JVGA 1T6WA 4X9HA 2F5BH 2X4RB 5IJVB 5HGDA 1FDLH 5INCA 4OLUL 3TBSA 5GGSA 3ULVH 3C09C 1YNTA 2VC2L 5CJOH 1UM6L 4QWWC 4H8WH 1FLRL 3WFDH 1EEYA 4NKIL 5J13C 3MFFB 4CN4A 1V7ML 3WD5H 3WE6B 1MSPA 5IB4B 3ALWA 4OFDA 1RZIB 3MLTB 5INDA 1FNLA 1ODAA 3VXRD 4N0UE 1YPZA 5EOTB 2XY1A 5D7LD 3X13B 3Q6GH 2VJXA 3TIEB 4HIJB 3DPBA 5E2WL 1G7HA 3KPLB 4JO4L 1F4AA 1K4DA 4Y4FC 3TZVB 5K93A 1Y0LA 5ALCL 3C60C 4E9LA 3PWJA 3VRIA 3MREB 4M43L 4EIGB 4PYHA 3OAZK 4CKVX 1FRGH 1PJ9A 1KXVC 3KLDA 2QL1A 3VD9A 1IC7H 3LN4B 1OW0A 1D5ZB 1MWAL 1QRNE 2QKIB 5CSGA 2IADB 2A77L 3MBXH 5DD3L 1C5CL 4MLIA 4F3FA 3S35L 4RZCB 1RFDH 1EEQA 4LVHC 5ERWB 5ADPL 4EI5D 1R3HA 2EYSB 1CXKA 2G60H 5DMJB 1RK1B 4LCIH 4NDMA 1S5HB 3L3GB 3EOBB 2XICA 1JPTL 1PGRB 4L8DB 4PJFF 2VLLB 3KPRA 4HBCH 3N1MC 3BP5B 3FQWA 1I7ZA 2DLFL 5FHBL 3QQ9C 3VMNA 3RWJA 5T3ZD 4Z7QE 4QHNB 1KJ3L 4JKLA 4M1DL 4FRWA 4YC2B 3U9UA 5FDWB 5L2KB 1LEGB 3TVMA 1NEZG 5HHVL 1Y6MR 5FYJL 2PO6C 4X4YA 4GKOA 3OXSB 4CVWA 3JTSB 3MBEA 3PGCA 5AYUL 3B9DA 4G6AC 4GT7A 1QSEB 2AERT 2ZPKH 5CS7A 3VI4E 4M1GL 2VDNL 5EO0B 3DYPA 1A7RH 3C5SB 4R8WL 4WV1C 1ZHKB 3RIAF 3B5TA 1C5BL 3BIKB 3K46A 4HFWA 3REVB 2Z8VC 1NFIB 4KHXH 3BPLC 4ESKA 1AJ7L 3VXUD 3O6LH 5IGXH 3HCVB 5C86A 5IVXB 5D96B 3IKCA 1WLHA 3MV8E 3PJSB 4LDOB 3TM6A 3FB5A 2BVTA 4U7SA 4YHNB 3GBNL 3OKDA 5D93B 4YHKL 1JIBA 1S7VA 4JPKL 2FGWH 4NGHL 5KSBF 4NN5C 3GRWL 2F19L 1YN6B 5A2KH 2CUIA 4X80H 3AREC 4MJIE 3QXVA 1HI6B 3MQIA 2W9DL 3L3JA 1S8DA 2UVEA 4G7YH 4MAUH 4G80B 1JWUB 3ARXA 1ZANL 4KHTL 3QWRD 3ZDZE 5A1AA 1MFEL 2DQHL 2A6DB 2VAJA 3QHFH 1WAAF 3TBWB 4KRLB 3H2WA 3EO9L 2HFTA 3ULSA 2FNBA 1RU9H 3BZDA 4NO5A 1FYTA 5E2UL 3CIQA 3WNOA 2VQTA 3D2UA 3B2VL 3KLSA 3MUJA 4UV7L 4P3CL 1UH4A 3RUGF 3BO8B 4F7TB 4IRZH 5T1MB 3I75B 4IDJH 3WS3A 4PRHB 3ARGC 4NQEA 4JB9L 1L9MA 4DGYH 3UJJL 3CLEL 2FDBP 2FL5A 4L4VA 3SDYL 4WTZG 4Y4FD 4WEUD 1B6DA 1FNGA 1J1XL 1U95A 3C60D 5HGDB 2IANE 3LS5L 3VMPA 1HZHL 5INCB 3TBSB 2FBOJ 4F58H 1MHHA 1NAMH 3OJMB 3WJJC 4XNXH 3K2UL 3AY4C 4P3DA 3ULUL 3H9YA 1EEYB 1YEFL 4KTYA 4Q97A 1UQSB 3LV3A 3LAFA 3CLFH 5DT1H 1KENL 2WMPA 1YPZB 4PRIE 3AGVA 3ZHLA 3RIFF 3ARDC 3IGAA 2EDKA 3PXHA 3DSNA 5MP6H 1OVZA 5GQBA 1CT8A 2QQLH 3K4AA 4JJHA 1K4DB 4KAQL 2VABA 3I6LE 4WEBL 4YFLF 5HBBA 1Y0LB 3DX9A 4NSKB 4Y19B 1HYRC 3K4ZA 1KYOK 4OSUH 4XP4L 4IRJB 4NBZB 3M17B 1RZJH 3SHSA 1DQQA 2V17H 1C8PA 3QH3B 2E7LA 3RU8L 2XQBH 4I3RL 1A5FL 3HC3H 3QQ9D 5C08B 4OZFA 5J3HC 4HEME 2QSTA 3ARWA 3EYQC 4OGXL 5MERB 4EOWL 3F7PC 1A6VH 1CL7H 5FV1L 3VXTB 1W72A 3SDXF 3FOMA 4F3FB 3P4LA 1JPST 1A3LH 5MEPA 1D6VH 1R3HB 4K3JH 4Q9BA 4G6AD 1OTTD 4IMLB 2DQTL 4LK4A 4EZMA 5CEZL 1IFHL 4L3CB 4XCCH 1G6VK 3MRKA 4JVUA 3BN3B 4JPWH 4HZLB 1JZ2A 2GJZA 4OM1H 4D0BB 5CILH 5SX5K 4LIQL 2YN3A 3FQWB 1I7ZB 3HAEH 3LD8B 3MMEA 5D8JL 3GSXA 5IBUG 4ACPA 1MJ8H 4GMTH 2H26A 1B88A 4XC3H 3NCYS 3CFIC 1BREA 5IMMA 2DLEA 5CD5C 3RHWK 4KGLA 3TVMB 1GL4B 4U0RB 2UY7A 4B7IA 1VADA 4X4YB 1C16A 1IGIL 3MBEB 3PGCB 2NXYB 3BH9A 4V1DD 1YY9C 2R0LL 4PLKC 3LKNA 4XVJH 3MLVH 3DX6A 2DQJH 3ARED 2ZUQC 4NHCH 3H6JA 3ARQA 3S3SA 4YUEL 2W1NA 4HFWB 1ES0B 1VEMA 1H3UA 3B83A 3LSOA 4P2OC 1GC1C 4H1LA 1RZKL 5A2JH 1J12A 1MLBA 3PP3H 3BVNA 5J12B 3IKCB 5JA9A 2Q8BH 3N1FC 4U05A 1NBVH 4HPOL 3OKDB 1YEDA 5I16A 1PVHA 1FFNA 4I8DA 4YGAB 1VACA 3FN3A 3RJDA 4Y0GA 5JW3H 3HRPA 1IAOA 2H32A 5FA4B 4YK4B 4FS0A 5HYSA 3FQUA 3U7YH 1BQHG 2HFEA 5I1IL 4PTTA 5AAMA 3L3JB 1S8DB 4KTDL 3ARGD 5F7FA 4PRPD 4DW2L 2X4UA 2X4OB 3CAFA 4AL8H 5HXMA 1OCWH 4NKMA 2C9AA 5TE4L 3RY6C 2J8OA 4LSQH 1FIEA 3ULSB