5HDBE

Integrin alphaiibbeta3 in complex with ro-435054
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
219
structure length
214
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
molecule keywords Integrin alpha-IIb
total genus 33
structure length 214
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hdbE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hdbE02
3FB8A 3UEZA 3SE8L 1JUFB 5F7WC 4JG0L 3OKOA 3VFSA 2PW1B 1IAMA 2EC8A 1WZ1L 5E94B 1MFBL 3IFOA 4NC1C 4MDJA 3O4LA 5CP3A 4MAYB 4QF1B 3GJFK 1S7VB 2EEBA 3HRZA 1F6FB 5IFHL 3LMJL 2G2RA 3QXDA 4FQ1L 4P57A 1CIUA 4O2FB 4HJ0C 2WBJC 4ZUWB 4K94L 3PJSB 5SWSE 3EGSA 4U1IB 4BA8A 3MUGA 4MXWL 3NIDF 4LLQA 3UDWC 4OFYA 2QV2A 2NTSP 4QTHB 3VWKB 3K81A 4OT1L 4YHLH 1KB9K 4PJ8A 3PXHA 4Y4FB 5C08A 4LVEA 5GISH 3E6HA 1EFXD 2ICWB 2ZOKA 4XCNB 4DGVH 4I5BA 4PRPD 3VXPA 4OGYL 4F3FA 4YUEL 3CXDH 3G5YA 2X4TA 1QYGL 3FQXB 2NYYD 3EDDA 2IMMA 4PBWD 3BFOA 1E4WL 2IAMC 4LAQL 4YXHH 4OGXH 3LKPB 5DEZA 2G60H 3QWQB 4BZ1L 3FTGB 1KPUB 5I66A 1I7UA 4G9FA 2FJHB 1SBSH 1U41A 3C5SA 4NO3B 2VLMD 1KCVH 5EO1A 2ZCLH 1LHZA 3DWTA 3S5LG 3TIDA 4YHMH 2V9TA 3SDYL 3KYMB 1IT9H 1FBIH 1INDH 4HZAA 4FFZH 1DANU 3N85H 4ZNEE 3ULUD 1OPGL 2DQDH 5FCUH 2AGJL 1YNKL 1ZMYA 5CS7A 4GW4B 5FDWB 2XN9E 4P2QA 3VFPB 3UO1L 4AZ8A 2YKLL 5HPMA 3KXFD 4G7YH 3KS0J 3FOMB 2P5ED 4RGNB 2DKUA 3JVGA 5GSVA 3BZFB 3EYOA 3GSWA 1NCDH 4ZPTB 5BMFH 1HZHL 4OF7A 5ICXA 3W81A 4HD9A 4ODSL 1RIVL 4XTRC 3X13B 5BRZD 4WI3A 2C1OB 3G9VA 4JQVC 3BGFB 4FQ2H 3UAJC 4YDJA 3G04B 1NGQH 3U30C 3RNKA 1IGFL 4LOUD 4W4NA 2VRAA 4QHLA 2Y9RT 5HYJA 4OF3A 3M45A 5BZWA 1MHCA 4XVTL 4DZBA 1XF1A 2X89D 5IMLA 4WUKL 3CFJB 4ONHA 4LNVA 5DLML 5MHSD 3FAWA 1LO5B 1LD9A 1WWCA 1WZLA 5SWZB 5ESQB 4M1GH 1RZGB 4JDVA 4XNMB 1KNOB 4L4VE 5C7XL 3D6GA 4U3HA 5DRXB 4OCWL 2VDOL 5I1CH 3CVHB 1NMCC 2ADFL 5JMOC 3QZWB 4OZIA 4IBLT 4KK9C 1GVIA 3IJYB 3U7WH 1WT5C 2VLKD 4K3JH 4XCYA 4RFOL 3QO0B 3ZE1F 5E00A 2AJUL 1J1XH 1JRHL 1IGTB 3IDJB 4M8QB 1UM6L 4JFYB 4RRPA 1I3VA 3O6FB 3BEWA 3DVFA 4P5TD 2FBJH 1XCQB 4HMEA 1H3WM 3V9FA 5IB3B 1TIUA 3DETC 1JPTH 1QFWL 4UT7H 4NWTL 1I3GH 1CD0A 1W0VB 2X4OA 1SVCP 3G6DL 2BHYA 4YGAB 3T3MF 1YYML 1CFNB 1SJEB 3T0AA 4X5WB 1C8PA 4NQCB 4PRNB 4Z7UA 3UYOD 4MNGA 3JWOH 2BHZA 3QUYC 3TNNB 2L0DA 4UZGA 2WUBL 5FYJU 3C5ZB 4XWOD 1Q1JL 2EDHA 3T4YA 4X80L 3KJ4C 3FMGH 5ESAA 3FFCA 1W72H 5E6ID 3KPSE 1LVEA 4XNZB 5CKGA 2ATPA 5GRVK 4WV1C 1TNMA 1F00I 2VLKA 4UV7H 4MWFB 4RISL 4HAFA 3AGVA 5HI4D 3MMEB 3QCTH 4UBDD 5FGSA 5ID1A 4GKNA 4OZHB 4RWHA 1VPOL 3BH8A 4MHHI 4Y5YC 4PJ8D 5C08D 2LFGA 4MZ2A 1QFPA 4N8VG 1KIPA 4WNQB 3SDCD 2P7TB 4MD0B 1BFVH 5DWUH 1ZTXL 1D7FA 3MBED 2XA8H 2B4CH 2I27N 1UJ3B 2C9AA 3BSZL 3EYVB 2NX5A 4OCRL 4ZPVA 2QJDA 1U91B 4M8VA 4XPAH 5DD6A 1XGTB 5TE4H 2YR3A 4XPHL 2I24N 1HYRC 1WLHA 3MJ8B 3HMWH 1EVTC 1LWRA 3BZ4A 4RA3A 1BGXH 1ZA6A 3HMXH 5E9DA 2F8OA 5JDSB 3KPRD 1HH6B 1UJ3C 4LSTL 5FOBB 3HAEA 4FQLL 4C56B 1N6QH 3ZO0A 4NN5B 1QPXA 5I76B 4XC1L 3FT3A 5FGBA 3WHE1 3P4NA 4S11A 3EOTH 1ND0B 3VWKA 3TCXA 1RZKH 1CLOL 4ZNCD 4IOIA 2GITB 2OQJB 2OL3H 1XCTB 5FYKL 1I8IB 2NR6C 1MCLA 2LABA 3O2DH 4LHJB 5CCKH 5D1QA 4OM0H 3ARDD 3QFDA 4HGWB 4V1DA 4WY7L 3S3SA 4MJID 4L29B 1DVFA 2NQCA 1NL0H 3KJ4B 3KXFA 2JK5A 1TCRB 3HRZB 1T04B 5I8KL 3KPRB 4G8EB 2EIZB 2FNBA 1U8IA 4M3JA 3O2WL 4XP6H 3VFSB 3QG6A 1VFUA 3K1DA 5BVJB 3CZFA 4FQHA 4LDOB 4WEBH 3A67L 3D3VD 5DK2A 4R2GB 3WDJA 1J8HA 3RKDC 3MBEB 2VDLH 3NMEA 43C9A 1FGVL 3LPFA 5CUSH 2FRGP 3HCVA 5HVHC 2YPKA 2X4UB 1AXTH 3KG5A 4PJ7F 3CU1A 4I18C 2OK0L 3O6LL 5AAWA 4MAYD 4ELMF 5DJDB 1A6UH 3EFFA 5DHVB 1MAML 3BAEH 3GBNL 2X1PA 1S9KC 2RJMA 2VDMH 3O6FD 1LMKA 2W91A 3SE4C 4LBEA 4LSRH 2DLHA 2WP3O 5CCKL 3SHSA 2VZOA 2C3HA 4P2CG 4N0CD 5JO5A 2ZSWB 1CBVL 4QCIA 4R4BB 4MAYC 4ZFFA 5H35B 3BN3B 3R8QA 1IC5L 1SEBB 2Z35B 1RZ7H 4YHNB 1QFOA 4NYLB 2P48B 1U8MB 3ABZA 4XBEH 4ZXBB 4P4KA 1SJHB 5D6DC 3SDDB 7FABH 3KPLA 4KDTA 3CNKA 4KV5F 4ETYA 4S1QH 1A6ZB 3LHPL 1RK0B 1R0AH 4BELD 4Y2DB 2GHWB 3SKNA 3BKMH 4JFEB 5B3NA 4TTDC 1QA9B 2X7LA 1G7IB 2Z9TA 5C0RH 1ZA3B 1ZVYA 3T0ED 1NEUA 2WWMD 4FABL 1Q9WA 4HXBL 4KZEH 5C6PB 3QISA 3SKNB 2PCPB 3SJVE 3LKRA 5IBLD 5IWLC 4GLRI 5DJYB 5DK0B 1UEYA 2XIDA 5IF0A 2JJUA 4XCNA 1BFSA 1IC4L 3SDCB 3VFGH 2VLME 4GAYB 5DVKA 2VAJA 4JEGB 1X5ZA 2X4TB 3GMRA 1BFTA 4BQ8A 1MCRA 5E6IA 3QJHA 5AZEH 1ZGLB 4HC1L 5CEZH 1ORSA 4TUJB 4X80H 2H1PL 2ZSWA 2NY7L 3UTSE 2FO4A 1YMHB 4JRWA 3TPUB 1I7RA 2FB4H 1A3QA 4RIRB 3F65A 1KB5A 5FGCE 3VWJC 3DYMA 5D7SL 1RK1A 2VC2H 1ZWIA 2D0HA 1XGYH 2V2XB 3ZTJG 3G6DH 4JRYD 1QLRA 3D5OF 5FKPB 4KJQD 1CDUA 1DQMH 4HULB 3JTSB 2OSLB 2FBOJ 2J8UE 5GS2D 5IROA 2YPLA 5EO9B 4TQEL 1HZHH 4PRID 5CBAA 3MV11 3GJFB 2FJGA 4XVSL 1WIOA 5DVMA 3X3FL 5HHOD 2IALA 1V05A 1PQZB 2AW2A 2EKJA 1O7SA 1D5MA 2GCYB 4RFEB 4XMKH 3KWWA 4NRZA 4PJ9D 1WITA 3MLYH 3QRFM 5HVFB 2DB8A 4R7DB 1WBZB 5A16A 2NTFA 4LSVL 4PV8B 2EO1A 2HFEB 4DCQA 2E9JA 4YDVA 3THMH 2ADIB 2WQRA 2XICA 2I9TB 2E7LA 5GGVY 3S9DB 1NFKA 4F9LA 1KCVL 1EVUA 4PBXA 5IVOA 3RI5F 1N2RB 3NOIA 4OUUA 3HNVH 5T1KB 5J7CC 3DX6B 4KQ3L 3IF1A 5F7YC 1S9VB 3O4LE 1S7SB 2R0KH 2R29H 5D6CA 1J87A 3MRNA 3D1MC 5T3XE 4RMSA 2DM4A 3CDGA 4B7LA 1FG9C 4X9HA 2ADGB 2YPLD 4MJ5A 1KC5H 3CXDL 3S5LB 4IIQA 1KB5L 5D2LA 1AJ7L 4JVWA 4OZFB 3DLQR 1UB5A 4FS0A 1WJ3A 3G6JA 1VSCA 1T0MA 3RPKA 3SO5A 4WFEE 3SJVA 3OG4B 4AEFA 5J89A 2SEBB 4C4KO 1OB1A 2BSTA 2IQAB 1YEFH 3GB7B 5KBNC 4Z7VF 4ALAL 3I3BA 2H6PB 4GW5B 2X6MA 5DMGC 3NABL 4ZOAA 4Z7WB 5I16A 4G42B 1INQA 1SBSL 4WW2B 4PUBL 3D18A 3KS0H 4N5ED 5DJ8A 1V3LA 4N0FB 3NCJL 3ARWA 4OLEA 1BP3B 3QH3B 4K7FB 5HVHB 3L9RB 4PGEB 3IFPB 1GC1L 1F4HA 1NCBH 2ORBL 3HNTL 3NH7L 3ILQD 1WFNA 1YNLH 4JZNA 1N2RA 1EO7A 5GZNC 1BZ7B 2X2YA 1E28B 1NGPL 1P69B 3LIZH 4JQVA 3T0EA 4LIQL 3TIEB 1ZK9A 3CCHB 4WWID 1G0DA 5H8DA 1OAQL 2FL5B 4TSCL 1T5WB 4M62L 3KPQB 1AGCB 5L2JB 1KGCE 4EDWH 4YHLL 2N1KA 3NAAH 1T6VN 4GFTB 1KC5L 4IHOB 3QIBD 4YDIH 1JGUL 4Q0XH 4M1DH 2DQFB 4OLYH 1DLHA 5C3TA 4EIGB 2Y07L 5EUKA 5C0AB 3WE6A 4X99B 4FQHB 3RAJL 2DQUL 1NFDE 4XVJL 3LEXA 4Z7NF 4L4TA 2F9BT 2GSIA 4P3WA 4URTB 3S4SB 2DD8H 3SQBA 2YSSA 1QP1A 3RA7L 3U0PA 3O8XB 4WCYH 4KY1H 1JI2A 1I9JL 1YEDA 3MA7A 3THML 2HKHH 3GMLA 4GW5A 3GIZH 1Z2KA 3INUL 2GSIB 1AGEB 3BKCH 4PRHD 3BGMB 5E6YA 2DDQH 4PS4H 3DO3A 1FL5B 1HYSD 4PJAF 2ZCKL 1HIML 1HHHA 4XBGB 2CSPA 4PPTA 5D5MA 2H3NB 3IGAB 1NMAH 1M7IA 3VXOB 3CSBA 4F7MA 1INEL 1LDSA 2A6JB 4X8JA 1OAKL 5I8CB 3NPSC 3MV7B 1IQWH 4IRJA 3TNMA 3L1OH 5FUCE 1OGTB 1EEYA 3FO1B 4N8CL 2YMXH 1PJ9A 3MO1A 1ZA6B 5E9DB 3H7BA 3ZT7A 1N64H 5HHOB 1KEGL 2YS4A 3K1KC 1H5BA 3LZFH 3NZHL 3TA3C 1FAKT 2I25N 1T2QL 1TJGH 4U1KB 4MCZA 4P3CH 3OPZL 1W0YT 1LE9A 1FZMA 3HB3C 3O81A 1XGYL 4O4YH 4KK8D 4L4JA 4X4XB 5C2BL 1M05A 2AV7A 5DK3A 2PUQT 5E8OB 1HKLL 4FZEH 3ULSB 1EHLH 4HKZB 3ZDZE 4E41B 3D39A 5ALBL 5L9DH 2EC9U 3LEVH 3DETD 1F4YL 2VAAA 3BQUC 3UYRL 4X8JB 2PO6A 1NANI 3C5SB 1CLYL 4U1HB 4WVRA 5EU3B 1U9KA 2HVJB 4DQOL 2IMNA 5CEZL 5EG6C 4BH7B 3AMLA 2M2DA 4U6YA 4KAQH 4M5ZL 2EXWC 2AQ1A 5DYOA 1LO0L 3R4DA 1RVFH 4JQXC 1I1AD 5HYEA 3ARDB 5IOPA 4F2MB 2DM3A 2FWOA 35C8H 2G5RA 4P59H 3SDXE 3F7VB 2YD8A 3G6AA 3QPXH 4ODXB 4QOKD 1JZ2A 5F7KC 3RPIA 1UADC 1QLRB 4KVCH 5FKPA 5IMOA 3TFKD 2JELH 2QSQA 3MUGB 4PP1D 1ZVHA 4RAVA 4AT6B 3S4SG 4GMSH 1T20A 5CIPA 4HKJA 1MCBA 4HUWA 5C9KA 3SCMA 5HI5D 4P3DA 4HK3J 5E8EB 2UWEE 3H3KA 1RPQA 1MELA 4LASL 2C26A 3IJYA 4ONGH 1DBJH 2DF3A 5HSFA 2OI9C 4AMKL 4NKOB 4R7DA 3K74B 4I18B 3FO2A 15C8H 3LKOB 3W0WB 4F7CB 3BAEL 3GBNH 4PY8J 5I1DA 4PGZA 3CX5J 2R2EA 1TVBB 1Q0YH 3TO2A 2XY2A 1B0WA 1TETL 2OJZH 4NNXA 2LE9A 3LPWA 1KV3A 2IQ9H 1R24A 1H3VA 2XKNB 3LQMA 3GJFA 4AEHH 3HG1B 5D9SB 1DFBL 3DSFH 3PDOB 3WIFA 4XNXH 4QXWA 1Z3GH 1BJMA 2O5XH 1SEQH 2MWCA 4JM4L 2IF7A 1FNGA 2KUTA 1FG2B 3FN0H 3CFKA 2PYED 5BV7B 2DI7A 3MGOB 2HT2D 5CJOL 4XPGH 1GCFA 2XQYK 2DQEH 3HE6B 3WS6A 1IKFH 1AGBB 2OTWB 5EO0A 1OM3H 1G6RH 1RUQH 3EOYG 3VRIB 3VXME 4GRLB 3SOBL 3STBA 1DBJL 2BSRB 3RWHA 5ETUA 3O2DL 1K9TA 3UJJL 5HPMB 3LV3B 3VWJA 1NPUA 1GOHA 4O9HH 1LO2L 1I8KB 4J6RH 4XNUH 2VXTL 3FQNA 1CVSC 4Z5RB 3LVEA 2F54B 3F62A 4OZIF 2BSRA 5E8PA 5IMKA 5DDHA 3WNKA 1J11A 1KIQB 4HZLB 1MF2L 4JO1H 3MBXL 4K7PX 1LDPL 1K4DA 1YYLH 2D9CA 4QKXB 1O7VA 2R0ZH 5ADOL 5GGRY 2PR4H 3I9GL 4NDMB 1IGMH 3MRBB 3SKUD 3CDCA 3VGDA 4CVXB 2C3VB 4QRRB 1RJLB 4HKXB 3MRIA 1WAAA 2YUVA 4RX4A 5E5MA 2KQNA 5TGBA 1D6VH 5CILH 5GSRB 1AO7B 5TF1H 3GM0A 3TNNA 1WBYA 4Q6YA 1BM3H 2MSPA 5D7JC 5JPMB 12E8H 2AJXH 2GCYA 3P73B 1S7TB 4X7TB 4ZD3L 4ORGA 1DLFH 4H88L 5HHXL 1KELH 1RVFL 2IPUG 4LU5H 5INDB 2AK4B 1IL1B 2R2CA 4PJEF 3C2AH 4EI5A 1JN6B 3VXSA 2EEAA 1IGCL 1UVQA 2HFFB 3O6MH 5AAMA 2VR9A 4NO0D 3B9EA 1O0VA 3F58L 5IJVA 4AK1A 2VDRH 4FFVC 3LEVL 5C0NC 4QRQB 5I8CA 1N5YL 5CSGA 4M8QA 3IS1X 3MRBA 1MCJA 1BREA 4P9HC 3UYRH 3HE7A 5BXFA 3FT3B 2AERT 3MRKB 4NQCE 3UPRB 3QI9C 4U0RC 4YIQB 5GS0D 1XR8B 1QEWA 2VLJA 5EZJB 1NAMB 2R56L 2QQKH 3MV9A 1YN7B 3L3JA 3VD3A 4MXVF 1LILA 3UTTB 5C0AD 3D3VE 5IV2B 1C12B 1HOCB 1P7KB 3S88L 4JFFB 2HJLA 4ZODA 5FK9A 2A74B 2Z91B 3TH4T 2OP4H 3RIFK 2F5AH 5BXFB 3CDFA 5JORB 4NWTH 1XGTA 5C07D 3SGEH 3TN0C 4V2CB 5C0CD 3S37H 3DMMA 3FT4B 4NC2B 5FO7A 5DEGB 1YC8A 1DR9A 1AC0A 5J6GA 1GOFA 4BFBD 3HS0A 1FVDB 3QXAB 4AIXA 3NA4A 1Y6MR 5BW7A 2AEQH 3HE6A 4LDEB 5C0BA 1I1CA 4QHUA 3ZHLA 2XWJA 4CNIB 5H94B 3I02B 3HPLA 3E0GA 4S1RL 4X9IA 4PS4L 3U7WL 5HGBA 2ZUVA 3BD5A 3S35H 3VGGA 1QKZL 2HKFH 5DD1H 3RY4A 3WFDL 4NKMB 3HZMA 2N7AA 3FT2A 5JXEC 2B4CC 1XGQB 4XPBL 5EBLB 2A6DB 4PB9L 5EUOA 3QIWB 3MNVA 1ONQA 4WUKH 5DLMH 3IAGC 3JSSA 4PJDE 3TBSB 1BQSA 5KSAD 3RWIA 4TUJA 5L0QB 4MNGB 2DYPA 3VXRE 1MLBA 1X3DA 3U2SA 4JY4B 1EA9C 5MENB 2HMIC 1A6WL 1E6JH 4P3CL 1KXQE 2VXUL 4NNPL 5L2KB 5KAQG 1NGQL 4I3GA 3GSQA 3BPNC 2AVGA 5MEQB 4Q0XL 4AM0B 3CPLB 5DJYA 3H7BB 1OD9A 3V0WL 3QHFL 3P73A 1U8QB 1R3IH 5FYJH 5FHBL 1JGLH 5TDOA 4IRJB 4KK5D 3NCBB 5IHBA 2A6JA 4RWYH 4S1SH 4IJ3B 4AH2B 3CC5A 4I2XA 4MD5B 4PLJD 2ORBH 2AQ3A 2DMKA 1I9RL 4OD1H 1UZ6F 2V6HA 3FQTA 3X11B 1I4FB 2A6KB 4H20H 3INUH 5JIKA 3AU1A 4I5BB 2YD4A 1QBML 1BQLH 5I8OH 4HF5L 2ZCLL 2FX9H 3KNBA 1P84J 4F2MA 1C08B 4ESKA 5JXEA 2QLVB 4LSPL 1LE5B 1MQKL 3KR3H 1NFIA 2UV3A 1AKJA 1IZJA 1GGCL 2NW2B 1CG9B 4L9LB 4WV1A 1MJ7L 5E8EA 1WFUA 3QULA 2IJ0C 5KSBF 4OGYH 2EH8L 5BOPA 4IOIB 4PJFA 4KMLB 1DQJA 4LVOC 4QRRD 5HGGS 4X5LA 2CKBH 1T03H 2FYYB 1P7QA 5SX5K 5FO8A 3OKOB 4KFZC 3QA3B 3FO0L 4FFWC 3S35X 3MLSL 2AV7B 5KVEL 3MYZA 2GAZA 1UYWH 3MTRA 2AK4D 3B9KA 2DKSA 3U9UA 5KW9L 2R1WA 5MP6L 4WFHE 3MSPA 5CLTA 4YHOH 1WQVT 2BY0A 2H41A 1KN4L 4Y5XB 1RULL 1VACA 1J5OL 1A14L 3QQ3B 3BKJL 4JY5L 3G5XB 4POZD 1U95A 2X89A 3HE7C 3I6LE 4QRUB 3L7FB 5ESQA 3IB4A 4YNYA 1RJLA 4HKXA 4PB9H 3SKJH 3GMQB 2E9IA 1CLZH 1FV1A 3BISA 4Z7WA 5I16B 4JFZL 2R0LL 1KCSH 3C8KB 5HGHB 3W9DA 4H0GA 2IANA 4LRNH 5E56A 3MMEA 3B5GA 5ACZA 3RJQB 4UOW1 4ZFOA 4JFFD 2A0LD 4WO4A 1FL6B 3PG2A 4M7KH 4GBXD 2VDQH 5CIPH 3MOAL 5TDPB 5AG8A 1CGTA 1BFOA 5FB8A 3SQOH 3HG1E 5D5ME 1TZIA 1VHPA 2X4PA 1L7IH 4JQIL 3QUKB 2DIAA 4X9GA 5FKAB 2W60B 3HLAB 4BUGA 1CDCA 4KRMB 4NKQB 4U2ZA 1RMFL 3OF6D 2NY6C 4FFYL 1NEZB 4FP8L 4Q7DA 3PV6A 2VLRD 4Y1AD 1JHLL 2IEPA 4W6WB 4C83B 3LKSA 1I7ZB 1S78D 3ZKND 3KYOB 5CZKA 3HNVL 5DEFA 4LHQB 5IB3A 1RZJC 4X7SH 2Q20A 1OCWH 4FNLH 1RZFL 1R5VB 4ZAKA 2Q7NA 2NY2C 3O45A 5DJXB 1YPZF 4JR9H 5E6IC 3P4MB 1J8HE 3UP1A 4NQCD 4K8RC 4XWGL 1KXTB 3K2UH 5C0EA 2F15A 4RFEA 5C1MB 2AV1A 1XF2A 2E7LC 3L9RA 4PGEA 4JY6B 4JPIB 3PP3H 1WTLA 4XNMA 4NKIL 3D69B 3CVIH 5EPMA 5MEOA 1CFNA 1SJEA 4PLKC 5F3HB 5ILTH 4XZUB 3AAZB 4Y4KC 3T1WA 3MV8A 4JRYA 2B39A 4JFEE 1NBVH 1D6VL 5CILL 1NSNL 5DFTA 3K8MA 5C0RL 1CD1A 4YWGH 1VGKA 3DX9B 3EJYD 3TNMB 3QDJD 3DO7B 2HRLA 3RJDA 3TC9A 3LRSB 5LGJA 5B39A 2UVEA 3MLPA 1J8HD 2MNUA 3MNWA 1BJ1H 4G9FD 3GSNA 3TT3H 2X9WA 3MRPB 3MCG1 1H5BC 3DI3B 5C09A 4O2EA 3BRDA 3V6OA 4JGMA 1CD1B 2EYRB 1ZT4B 3QH3A 3RVWD 4LEXL 4U6VL 1UEMA 5AZEL 1MAMH 2OZ4L 5T1LD 1PVHA 1F3RB 3NIFF 4G9DA 4MA1B 3G5ZA 2KH2B 3BI9X 1T0NA 1FAIL 2XQYG 2OMBA 4JPIA 1CICB 3HFML 2J88H 3ARVA 4EI5C 1T1ZB 4FTVA 4X98A 1XCTA 3PHSA 5H37H 4POYA 1DUYA 2BVQA 4Y8DC 3T0DA 3QNZB 3EYFB 2Z8RA 3FB7B 1MHPH 3BQUD 1WTGT 5I76A 4G6JL 2C4FT 4KQ4L 5GJSH 1PG7L 4JDTH 3OB0H 3SGDI 1B9ZA 4CU7A 3IETB 5DJ6B 4LHUG 4CMMB 5A3IC 4G6AC 1XF5A 3TO4D 2XACC 1NGXA 2Y6SD 2VE6B 5CSZB 1FDLH 3DV6B 3LRHA 2ZCHH 1U8LA 4N8VA 4X7SL 1JZ8A 1TFHA 5D1ZA 3ARBD 1F4WH 1X6LA 3HR5A 2XWBA 3CZJA 2GTWA 4HIXL 3CX5K 3QR2A 3VG0L 1QSEA 1Z9SA 3BDBA 2V5YA 2JE8A 4OM0L 1UM5H 5KSVA 4N0YH 4FFYH 1EO8L 1JHTB 3FFDB 4P5MB 2ADJA 4Z6AT 1I1AB 1FCGA 3CVHH 5JLZA 5EUOF 3ARBC 5LCVH 3F7YB 5HBBA 3CMOH 1P7QB 4C59B 3MV7A 1CN4A 5FYKD 3WUWB 4JFFA 1T3FB 2H9GB 1DQQB 4DUVA 1R5IA 5JR1H 2H6PA 5I1AA 2GK2A 4IMKC 4NUJB 1A4KA 4X0KA 1CS6A 5T5NF 4M7KL 4OKVA 5DI8B 2XOTA 3MXWH 2QADB 3WBDA 1CG9A 1PG7H 4OD2B 1JF1B 2BVOA 4P2RE 4MVBC 3A0OA 3O2WH 3PABA 2LTQB 1CLZL 3C8DA 5IW3A 2DKMA 2YD1A 3PDGA 4ZS7H 5IFAH 1C1EL 1P2CA 4WFFD 3LQAL 4IDJH 3VXUE 1MY7A 4HWBA 1TPXC 1A7OH 4JY5H 1NJ9B 4UV7L 3T8XB 3AS0A 4LLQB 4IMLB 1EEQA 4CMHB 4KTDL 3ZT6A 5E7BA 1K8DA 1MCCA 3FO9A 1K8IA 3SKOA 5IESL 2FGWL 3MRFB 2Q76A 4MQXD 2YD9A 4D9LL 1M6OB 4NJ9H 2YA0A 3D0VA 3U9PL 1FLTX 4XB7A 4R8WH 4WI5A 4F7PB 3V5HB 2JJTC 4N9OB 3RVXD 5LXGL 1LK2B 1XF3B 1I9EA 1GPOL 4M5YL 3TEUA 6FABH 4MQ7B 2X42A 1G7HB 5JOPE 1NGYA 3HKFA 4HUKB 1YQ2A 4KROD 4X6EA 3OXRB 3SDCA 1Q8MA 3DYPA 3ARFB 1P5VA 4GQ9L 4OCRH 3V4VH 3QJFB 3DV4A 2A9NH 4DVRL 1L4IA 2VLRE 4HUVB 4XVUC 1UM6H 2APBA 3D25A 2ZJSH 4KRNA 3L3GA 4NQDB 3RL2A 4PGCB 3NTCL 4H0IA 4LCWE 5TQ2L 5FA3A 3MGTA 1ZA3A 4Q9QH 1JBJA 1NMCB 3QSKB 4DW2L 2XWTB 3VFOB 4D0CA 3MGOA 2C1OA 3QPQC 5EORL 2XNAA 4EQ2A 1OB1B 1N3NA 4OD1L 1ZWIB 4M1GL 3UJIL 2X4RB 5DC4B 1WWBX 3EYOB 2HT4C 4NQEE 2AJ3A 5DR5L 4XAWH 1OVZA 3GGWB 3CDYA 4MS8C 4YEEA 5DQDL 3FQWB 3ZE0F 2AXFB 5DUML 1E4KC 3GUTA 3MRCA 5A43C 4JO3H 4PJIA 5JO5B 4WHDA 1UFUA 1AY1L 3IJSB 3PWPE 5DJZB 1AIFA 1ORSB 2XA3A 3TYGL 2E7CA 5GGVH 4FQ2L 4PJAB 5D96B 1D9KD 1OTUD 4MMXC 4PJEB 3QHTC 2KZ1B 2NY3C 1DQLL 1P84K 1JTPA 3RAJH 1FH5L 1XIWA 2B8OT 1ADQH 4OZHF 1G7HA 3H42L 2WZPD 4P2OA 2DIBA 4W4OA 4H1LB 4KHTH 2OR8A 2EE6A 1D9KC 5GS0H 2HT3D 5EZLA 1U3HD 4KHXH 4G7YL 2CKNA 1OL0A 2HFEA 3WFEH 1IGTA 3KGRA 2WUCL 4UIMA 5IVXB 1J7VR 2P8LB 2MFNA 2CKBA 4LFHD 1DN2A 2CRYA 2X4SA 2AEPL 3N06B 1PX4A 3OTTA 1XF2B 3G08B 5HDLA 3UTQA 3QI9B 4U0RB 1IL1A 4FZ8H 1KCSL 5JIPA 2B1HL 2P24A 4NN6C 1GC1H 3X14B 2GJZA 3GSVA 2G5BA 1JGDA 1I1YA 4MJ4A 3SDYH 4OLVH 4U31A 1U8IB 3VJ6A 1RUKH 2FJFB 4XVTH 2BRRH 3GBLA 4MZ3A 1T66D 1KSRA 4ZFZA 4FFVD 3IDXH 3JWNC 3BPCB 1ZHKA 2IH1A 3STZB 1C5CH 3P9WB 3REWB 2HN7A 4MWFA 1SBBA 4KKBD 5J3HD 5M95B 4RNRA 1JPSH 3UTTA 1ZGLM 1T66C 1YN7A 3L3JB 1OF2A 1IM9A 1T83C 1MWAL 5DRZA 5ESAB 4HWNA 1RY7B 3D2UA 2IH3B 1QR1B 4M5YH 3P4NB 5GXBB 1D5IL 4YHKL 1J1OH 1BLNB 5GISL 3GSNH 5KSUB 4IRJD 3BH9A 5GJTH 1MFDH 1NBQA 2J5LB 5JW3H 4ZO9A 2WBJA 3C5JA 3CH8A 3RWGB 4DFHA 5HJ3B 1C5CL 3MJ8A 3MV9E 5HY9B 1I1FB 1KCUH 3JZ7A 4BSWB 5DRNA 2WBWB 4L4TD 1IKNC 3IDNA 2V17H 5DC0A 1AC6A 5JA9A 4Q97A 3LMJH 4AG4H 1HQ4B 5IQ7H 4MNQB 1WCQA 2D7PA 3QDGE 1K6QL 3MLVH 4OLWL 3ARFD 3ZE2E 3SPVA 1P6FA 2CK0H 2NY4D 2FHBA 2Z92B 4PLNC 1WZKA 3VXUB 2KZWA 2VB5A 5HI3D 3IDNB 1HHHB 4Y4KD 1LEIA 1CK0H 1MFEL 5HYSG 2V7NB 3BUYA 4H26B 2EKSB 3HAEB 4U1NA 5F1NB 3D2UD 3P77A 1HEZB 2HH0L 3Q3GB 4L8SC 1JWUB 2FX7L 4G9FE 5TH2A 2O5YH 3RU8L 3QHFH 3IKKA 5JXAH 3KPMB 3P0VH 3IJHA 1X5IA 4R4BA 5HHOA 4D94A 4HQQL 4K9EH 1JZ6A 1GZPB 5MI0B 1DE4B 5EU6D 5IJKC 3WKNA 3MODH 5C09B 4HLZG 2CLVB 1U58B 2YEZA 3HUJE 4LRIC 2WINA 2XZCL 3TYGH 1G9MH 3MRQA 1T20B 2X4UA 1M7IB 3VXOA 3PF2A 4P57B 5D2NC 1VA9A 4RGOL 4YX2L 4IRZH 5BO1H 3GSWB 2FEEL 2XT1B 3ESVF 3OKMA 3PGCA 2NY6D 4M6MH 4UTAL 3QFJA 3VXQA 4K3GA 3WN5C 1A1NB 2ARJA 1RUPL 3WIHA 1Z6JT 2H1PH 3DUUA 4XNXL 4OIIH 4UB0L 1H8OA 4ZSOB 4XMKL 4C55A 3MBEC 5F3HA 4JZNB 1A0QH 4QHKI 2IAMD 2EH7L 1A4JB 3GHEH 3S34L 1RUAL 2RCSL 1B0GB 4WI2A 1JK8A 4KXZI 2C3GA 4QOKB 2QADC 4U1GB 1QD0A 3CC5B 4I2XB 1I85C 2WQ8A 2Y5EA 4B5EA 3Q1SL 4G5ZL 1ZKAA 3BP4A 3QUYA 4X6DB 3U1SH 2EDFA 2E6JA 4HWBH 2HLAB 1PW3A 1NGWB 5I66B 1N4XH 4R2GD 1QFUL 4NHUA 5JW4N 3MV8E 5KOVC 1GXEA 1T5WA 3VH8G 1EAJA 3FN3A 5HY9A 3MZTA 4GMTH 1FSKB 2EDDA 4YPGB 5FA4B 4Y19E 3P0YH 4FMFA 4HKJB 4JFPB 4K23H 5CGTA 1RAMA 2XY1A 1A5FL 1X5GA 2QKIB 4OQTH 2PTVA 32C2A 3BGAA 5HI5C 1LE9B 4JHWL 3DROA 1QSFB 1CFVL 4LLMA 4IDLA 2BNRD 4JZJA 2AK1L 1G7MB 3RNQA 5CEYB 3ILPB 4XCFH 1GHFL 3QDMD 4IIQB 4N9GA 1YQVL 3W2DL 3HI6H 3ULVC 4OJFL 5T3XD 1I8MB 3GBMH 4M61A 3LKNA 1PKQA 5J57B 2VDML 5F93C 4Y7MA 3EBAA 3Q1SH 5D1ZC 5EOTA 2JF1A 4FXKB 4GG6F 3TA3B 2LU7A 2X70B 2Z93A 1WC7A 5GZND 3VFOA 3ZKNC 1R5WB 1AXTL 1UACH 3LQAH 5I71B 3VFWA 2FATH 3MRDB 5DD5H 2E9WA 2BCKA 4K7PY 3NZ8A 4HXBH 2MCPL 4C58B 4QGTA 2C5DC 5D1QC 2BZDA 3S6CA 4EVNB 3TO4B 4OFYD 3GSVB 3MJ9H 1OP3K 4L8BB 4MGXA 2PR4L 4QRUA 4PJ5B 4MQXC 3HZYB 1QQDB 3RBGA 1A5FH 4NQDD 1AXSA 4OQTL 4IMKA 3MBXH 5KSBB 3OJMB 4L4VD 4ODUB 1L0QA 2FZ3A 3FOLA 5CEZE 5IEKB 3O9WA 2ICEA 1ZXQA 2FR4A 3VA6A 4UIMB 3W39A 2XZCH 4D0BA 1MH5B 1S7UA 1A6TA 1LK2A 2CGRH 2AP2A 3Q2CA 5ACMA 3H3PL 4HS6B 4N0YL 3PE9A 4ETQB 1H3PH 3HUJB 3U0TB 4JFYA 1QNZH 2Y5TA 2R9HD 4Y4KB 4ODVL 3QUXC 4QNPF 3ZL4L 4D0BB 1AP2B 2G5BB 1KIUA 2PTTA 2Y36H 4XP5L 1PEZA 2X1XR 5ADPH 4K94C 2JJSA 1KB5B 3KWWB 4NWUH 3AXLB 3GHEL 2G2RB 3EOBB 3QXDB 4I48A 4ORGB 4X7CC 1NCWH 5GGRB 4GW1B 1KPRB 3D85B 3P40A 1FJ1A 4HUUB 3SDDD 2IALB 3BKCL 3RVXC 4LGPB 3SE9H 4RGND 1YJDC 3T4AA 4XCEA 4KDVA 1LD9B 5E6IB 4P2RA 4XT1C 5CP7B 3VFUA 3TVMD 3GMRB 4JZOB 1N3NB 2DLTA 1PYWB 3IDUA 2VYRE 1J86A 3PL6B 3QEUB 2HT4D 4Z0BL 5H2BA 4Y16A 1QRNB 1ULVA 3ULVF 5A2LH 1JNNL 5F21B 1M71B 3K8LA 4DVBB 5BRZA 2XZQH 2MHAA 5IKCA 4GKZA 4YHIB 2F5BH 4JVUA 5IBUG 3MFGB 1MCEA 4NO0A 5FYKH 3B6SB 4NUGH 3T0WA 3QCVH 1MLCA 3ZYIA 5GGSY 4WRLA 5KW9H 4K3DL 1VGEL 4JHZA 4XWOC 4LEXH 4U6VH 3N9GH 4YH6A 4X6BB 1G7IA 1X5XA 2EZ0C 1U2HA 1J1OL 5F7FA 1MCDA 5ETUB 5IUSA 4MA8L 1WV7T 4RA0C 1XGUB 1OLZA 5D7IE 4ZFOL 5F6IB 1AXIB 3I84A 1T6WA 3VXNA 3VCLB 4R96B 5C0JA 3EO1B 4LHUA 2EH8H 2JELL 3PWVB 5IP4A 2P46B 2ICWI 4G6FD 4DAGL 4LEOB 1NQBA 2GEEA 2AJYH 3LDBC 3MYJB 1AD9A 3W82A 5GZOC 3PGFH 3I6LD 5EU7E 3SBWA 1BAFL 1JIBA 4HPYH 1J05A 3L5WA 4HIHA 3ZYOA 4PV8A 1KN2L 4HK0B 5A16B 1DL7L 5C0BD 1C5BH 2OL3A 1J1XL 2H2SC 1G7QA 3VFTA 2BFVL 3CFBB 4PD4K 5EZOH 1RHHB 1S9WB 4E5XA 1OSZA 2IQAA 1CXIA 2GY5A 2Y6SC 3WEXA 1RV6X 5CD5C 2DJUA 4LHUB 3MFFB 4GXVH 5I1IH 5C0DA 3QNYB 4HJJH 3L95A 1YZZA 1A1MA 4UQ2B 4MLIA 5J56B 4MX7A 4U1SA 1W72A 3C60C 5AD0B 4EKXA 2V5RA 3JWOL 3QEQE 4K7PH 3GKWH 1J1PL 3S5LA 1QVOB 3V0WH 1CFQA 3AXLA 4KKLD 5HYSA 1AQDB 2P42B 3KXFB 3W5MA 5E9DE 3LEYH 2CQVA 4Q58C 1NMBL 1T2QH 1TJGL 1B2WH 1FLRH 5DJCA 3RI5K 4KJPC 5C71A 5I74B 3TP4A 2YPKB 4LLWB 4PV9A 4FQCL 2XTJB 4ACPA 2AABL 4KK6C 2R0KL 3CJJA 3G6JE 4NQTA 1EEZB 4QLRA 5BV7H 2Y7QB 1JPST 3MA9H 1IQWL 1UCBL 4CJ0A 1EFXA 1T21A 1FFOB 3ARGC 4UU9B 3SQOL 2GTWB 5BVJA 3QWRA 5FYLD 1WF5A 3VXRB 5LGHL 2CXGA 1AE6H 2FECI 3MLRH 3K46A 4XRCB 5E1AA 2ZCKH 4HBCL 4F57L 1CXEA 1ODAA 2AEPH 3RVUD 1EFQA 1CGWA 2AK4A 1TCRA 3S35L 4JN2B 3GI9L 5LQBH 4PJIE 3JTTB 4MLSA 1U3HC 1FBIL 1GRWA 3UTZB 3BX7C 2VZTA 4W6XB 2DQIL 1FGNH 4KTYA 3X3FH 2HTKD 3QUZD 3FONA 5KVDH 3BD4A 2D31A 3QUMB 2UWEF 5DS8A 4HKZA 3AS1A 4XVJH 4QYOA 2CDEB 1N7MH 1Q9OB 3GIVB 3F8UB 3ZDYE 5CEYA 2G9HA 4OFVA 2Z0BA 4FQCH 1MFCL 3OX8A 1ZLVK 1NMBH 1VFBA 2F5AL 3ARZA 3VH8A 3X3GH 1BQHA 5GGUA 3SDDA 1FC1A 1HCFX 2VZ1A 5D72H 5E08H 4YXLL 3VFRA 1CQKA 4P46B 1IBGL 3C6LA 3DXAD 3MCKA 3WDIA 4LMQI 1EEYB 3FO1A 4I77H 1SYVA 3SCMC 3QUKA 4PYGA 3I75B 2AS5M 3QO1A 1KJ2B 1NGPH 4J8RB 4NN7C 4CUCA 3QIWC 1Q72H 1S8DA 4LLDB 4OF5A 4PRHE 4HC1H 4X6FA 2YOCA 4K3DH 5D7IF 3ZSSA 3HNTH 4O2CA 5JMRA 5EORH 4HS3B 2I9LB 3OF6A 4YPGA 5FA4A 3UPCA 1SQ2N 3FHAA 1T0PB 4KKBC 2XTLA 1IARB 3BGMA 2IANB 3O11A 4Z7WE 5IFJB 3QQ4B 4YHML 5SWSD 4EN3B 1CL7I 3GFUA 3OKNB 4MD4A 5LVEA 1DLFL 3RGVB 1V3MA 1C5BL 3BIKA 4LCCB 3DI2B 1KLGA 4OGAD 4XMLL 4XXCA 3NCYS 1QFWI 3QDHA 5GS0C 1QBMH 1FNHA 1D5XB 1U8KA 1N5AA 2XZZA 1BBDL 1F3DH 3DUSA 5ALCL 1NCWL 4AIZA 1HSAA 4GBXA 3ULUC 2VWEC 2R1WB 4YZFE 4UDUA 2ED8A 4XP5H 1RHHA 1JGLL 1MCQA 3G9AB 3AM8C 3V7AG 3A6BH 5IBTH 1BVLA 3QDJE 4QCIB 4I0PC 4GRWH 4XNYL 5DO2D 2WIMA 5D2LE 1Y6NR 4GS7C 4OM1H 2KDGA 4GXUM 3I2CH 3SGEI 3BRGC 5K9OA 4O2CB 4QY8A 4HX1A 1I9IH 1UA6L 5SWSA 3QQ9C 1C7TA 5IHZA 4FQ1H 1OTTD 4OZGB 2AJVH 1T7YA 1V7NH 2FD6L 4AIZB 1FDLL 4CVWA 3TYFA 5E2VL 3SE4A 3WDHA 4TVPE 5EZIH 1P53A 4PY7A 2VWEE 1MQ8A 5TE7H 3ES6B 3VRLE 1I85A 2UYLB 1SEQL 3CSPA 1CXLA 1WBXB 3RDTC 4NQXA 3TBWB 2GFBB 4G6JH 2D4DA 1RURL 2O5ZH 3TT1L 4OLXL 3ARGB 3NZ8B 3M17A 1E4XH 3EJZD 4L9DA 3DGCR 3MRDA 1FFQA 4Y4FD 2DOCA 3UBXB 1OOAA 1ZLUH 1FE8H 1PD6A 5IQ9B 3R06A 2UZXB 4JREC 4RFNC 1IGJA 3NFNB 4D0DA 3KLAA 5EU4B 3I02A 1IAIH 1OP3H 5JR1L 1DVFD 4OI8A 2I07B 3RWDB 4JZJC 3LKSB 3ARGA 1B3JA 3MUJA 5JHDE 1FAIH 5HGDA 1MIMH 2OS7A 4UV4H 1AHWB 3V95A 4X6CF 1PGRB 1CICC 3MACH 2OL3L 3KPSA 5JIHA 1A7PH 3OKEA 4XCEB 3SDAD 3H3PH 3KYKH 4FQJL 2HJKB 5KS9B 4D8PA 5BZDA 1N6QL 1JZ7A 2FECL 4Y4HA 5T5FL 5MENA 4U1LA 2VZ3A 1G7JB 1XH3A 2QL1A 4LVHC 5J06A 4ZUVB 2QQLH 3OX8B 3BIAX 3REWA 2R69L 1U3YA 2NY7H 2QSCL 3ARBA 5GGTL 3STZA 3GNMH 3MO1B 4PJ7E 4YWGL 3KYAA 3TZVA 1EDQA 5K9KB 3BDYL 2DL9A 1UJ3A 4QRQA 5EC1B 3O6FA 5I1HL 1JNJA 4KPHL 4P2QD 4YO0A 2VLRB 2J88L 3NFSH 3F6IA 3E3QC 5ISZD 3SDXB 5AWNL 5TDNA 3T65B 3KLAB 1CE6B 5EU4A 5LG1A 1LO0H 5E2UL 1G6RA 4O51A 3WD5H 3QZWA 3X12A 2NY1C 4PJFF 5HJ3A 3HR6A 1U8HB 5JW5B 4EQ3A 4LCYA 4Y5YB 3CXHJ 3BQUA 3BO8B 4CKVX 3W2DH 4F33A 3PABB 3RFZC 2DQJH 3GNML 4WU7B 1CLYH 4FN0A 5ANME 4NQVB 5JHDB 3NCYP 4MD4B 2R0ZL 4JAMB 3M1BA 4K07A 2AK1H 5ALBH 4PJ7B 2EXWD 4LPTA 4R26H 2D2OA 4HIEB 3VXMA 2IADA 5D1ZD 3RZCA 2V5SA 4X5WA 1LO3L 2VXVL 1T4KA 3S3PA 5E8PB 3X17A 1UWEL 2ZUYA 2ZWLT 3T65A 2X10A 2VLJB 3OGCA 5CKAA 1CBVH 5DSCA 4G8GB 5HPOA 4GMTL 5T1LA 3V5DA 2JIXB 4HWEL 3ALXA 3PL6C 2IBGA 3FB5A 3D0LB 3T08A 1N4XL 2CLZB 2QHRH 1G6RL 3PHOA 3TGXA 1QSEB 4PP1C 3K0WA 4UQ2A 4G6MH 4M7LT 3B2UC 4R6UA 1ZSDB 1JRHH 5I0ZA 2NY4B 4JY4A 1FGVH 2DYPB 1B4JH 2HH0H 4QXGH 4HFWA 5HHVL 5MEPA 4XP1L 2CO6B 1JNHB 4DKAA 3DVNB 1H8NA 1BBJB 5BW7C 4ZTPL 1S5IH 4JRXD 2CDEA 3DHJA 1Y18A 4WUUB 1RZ8A 3L3KB 2DQHL 4IOSD 1BOGB 3QDJB 5B8CB 4JFZH 4AEHL 1YDPA 1QSFD 4OQTA 5JA8B 1QRND 1EX0A 3CUPB 3MRFA 4LCCA 5B4MD 3B6SA 1H0DA 1NGWA 3QNZA 4G9FB 1E27B 1G84A 2H8PA 4XHJC 4PP2B 1OSPL 4WU5A 4I8DA 2XWJB 3WS3A 1I1AC 1CL7L 5FECA 3AUVA 4NYLA 1KCUL 3QIBA 1ZSDA 1G9ML 4W81A 4AMKH 4X6FB 5A40E 1H3TA 4Z9KB 5D7JD 4FXLA 5HTSA 1A4JA 2R8SL 1JGUH 5K33A 5MEPB 5F72S 1MLBB 3MOBL 5I9QC 3KJ6H 4XB8A 1QLFA 4ISVB 1A1OB 3SKMA 3WNLA 1SYVB 3MNVB 3A6BL 1FVEB 1NCDL 1UXSA 5BMFL 1RD6A 4ERSL 3OJ2C 1IZKA 3LD8B 3MLTA 1R3LA 2WK2A 1II4E 5DJDA 1G7PB 1U8OA 3EAKA 3HZKA 3J7HA 3GSUA 1T3FA 2H9GA 2KBGA 2IPTL 4Y4KA 3WUWA 4U6HA 2OXGA 5I1EL 4P5TC 5IMOB 4IMLA 4OZGA 5KANI 4ONFH 1NCCL 5ALCH 5AEAA 4J23A 4K3HA 1I3RB 3OGOE 3CFDB 4WHYH 2EDJA 5C0FA 3IDXL 3L5JA 3NCMA 3WIIH 4PGBA 4O58H 4XP9L 2X05A 3W39B 4V1DE 4YBLC 4M3KB 1A14H 5IW6B 1OTSD 2FX9L 1X6NA 3ZTNL 4XNZC 3QCTL 4KH2A 1JPGB 3A6CL 5TH2B 2R0WL 5D2NB 4ELMB 4HDIA 5KSBA 1QHPA 4NCDA 2WWKT 2G60L 2H32B 3FCTB 4LRIA 3ZHKA 5IV2A 2HJFA 2UUDK 3ZKQD 5B38G 1AHWC 4BKLA 1TQBC 1AP2A 3O6KL 2CRIA 4LPUA 2BVPB 4UT6L 3QUML 3ZDXF 4QT5B 2B5IB 4YE4H 4DN3H 4YDLC 4MA3B 1CF8H 5FHBH 4QHNB 4GJTB 3DHMA 1HHJA 4H1LA 3BIKB 4PJ8C 4W6YB 3RVUC 3RGVA 4FTVD 3ZYJA 3UC0H 4XPTL 4OUOA 4RCAA 1ZEAL 1I7ZA 5D7LD 2R15A 4AT6A 1BZ9B 4DKDC 5GS1A 2OCFD 4U6XB 1IM3A 3BVNB 3FOLB 5IGXL 3HZVB 1LO4H 2QR0B 3VRJB 3U82B 3C87A 1IAKA 5E94A 1IRAY 4XPFL 3CLFH 5HD8C 3LB6D 3MR9A 1ZLUK 3RWDA 4JG0H 4GOSA 4FQQA 4PRDA 2MTPA 5E5UB 2EDOA 1FNEA 2BVTA 5K59E 2EYTA 3LRGA 4GG8B 4HJ0D 2FCBA 2BCKB 3ARYA 4L3EB 1IGJB 5F3BB 1ZT7B 3P4LA 5H37G 5FV1L 1MCPL 1KTLB 1PX3A 2Z93B 3VFTB 4YHPA 4QXUL 5CWSB 5HHQB 4TVSa 3TBWA 5D1XA 4KZDL 3MV8B 2UVFA 3VDAA 4X6CA 2UY6A 5DRWB 5E03A 4UNVA 2YUXA 4JJ5A 2ZOLB 2IAMB 3STLB 1YMME 3DRTB 4MSWB 3TYFB 4PJXA 1XIWD 4JZJB 3WFCL 5C8JB 4F58L 1HQRA 3I3EA 4K55A 3MRGB 5DUPL 43CAB 1Y0LB 5F1KC 3RGVC 5JHLL 2ZG2A 4L1HA 4JRXE 5C0BE 2DJ4A 3VCLA 3LEYL 2IPKA 4M62H 2HG5A 4PJAE 6FABL 4F7TA 4JFFE 1XCQA 1OT2A 4OV5B 5I18L 4XAKD 3UPAA 4PY8I 1O5DT 2ITCA 5GZOD 1OARH 1CGUA 4UMGA 2VDRL 5FUZH 4EBQH 3CFEA 2DQDL 2Q87A 3UJIH 4OQ1A 4H25B 3DO7A 1XGRB 4OD3H 1VEPA 1OP5H 4X98B 2Y72A 3LS5H 4U33A 2I5YL 4PJBE 4KUCF 1N5AB 1SY6H 1VKXA 3CLFL 1QQDA 3BEVB 4NC1E 4JAMA 4XP9H 3B8YA 5EB9A 1OAYH 3BWUC 1YEDB 1NAMH 1OAXL 2DIJA 5C0CE 1AIFB 4LCWB 4R4FL 4ZTOL 4W70A 1KJMB 2AK4E 1JWUA 4BQBA 3ZKXB 3PGFL 4ALAH 3FQRB 4FHBD 1TNNA 2Q86B 4MX7B 4U1SB 5TPWL 3ZDZF 5SWQA 4PTTB 5J0BA 1KG0A 4BM7A 3LSOA 2OX5A 1PDKA 3S88H 2AV1B 4XAKE 2R2BB 3FRUA 1E0OB 1QBLH 4NO2A 2CJUL 4UQ3A 2SEBA 4YDJB 5FUOH 4YC2B 5AYQA 5GHWH 4IEFB 3L5XH 5GIRB 2Z92A 1VFOA 1T22B 4TN9A 1UC6A 3OR6A 4YAQA 4OFKA 3CFBA 3T2NH 1I8IA 3LH2L 1P4BL 1S7RB 5F7NC 1G7QB 4JM2A 3U4BH 1WFTA 1U8PA 3QUZC 2IGFH 1I1AA 4P23A 3HI5H 3MOBH 3W9EA 3LPGA 3NVQA 3JV6B 4NJ9L 4B41A 3SE3A 4WO4C 5IK3B 3MCKB 3LN5B 3QCVL 5D71H 4APQD 1D5BA 2BERA 5I75B 3HPJB 3MNZA 4PJ9A 3IDYC 3JWDL 3QNXA 5BJTA 3QG7L 1FORH 4N8VB 4BFIA 1DCLA 3B5TA 3BZ4B 4NM8H 4RAUA 4NIKB 4WO4B 3W9EB 4HCRL 2EDRA 2F74A 1ZHBB 3L3DA 4KK5C 4GT7A 1RFDL 5DZNA 2IH3A 3FN0L 3SCMD 4MNHA 4NPYA 1TZIB 2D03L 4M48H 1IEAA 4MB5A 5JOEA 5DFVD 3EHBC 4G42A 4HW6A 3P9MB 3MRMA 3EO9H 2P7TA 4MD0A 5L6YH 1EGJH 1KPUA 2YUWA 4R0LB 5D7LA 1F3JB 3B9KC 2BY3A 2N56A 3OKLB 3QUMA 3L3DB 3HN3A 2BSED 4KJQC 1LDPH 2EECA 3MX0A 4TVPD 1UB6B 3JV4B 5IG7B 3ILQC 3QQ3A 4PJHE 2HMID 4RBPH 1YEKH 2BXZA 5JW4Q 1K8DB 1TVHA 1KULA 5ADPL 2AKRB 1JF6A 3MJGX 1F90H 4YFDB 2Z8SA 1R3JA 4HV8B 5MENE 1YECL 4LSSL 4P5KA 4DGYH 5ICYB 1KUMA 3JV6A 1FYHB 2KQMA 3CSGA 3O3AB 1Q0XL 3K7UA 3RX5A 3WFHA 4QTHA 1HH9B 3SOBH 3VXRA 2Q1EA 2NW3A 3F6LA 1JWMA 4XGZB 1JYVA 3DGGB 1DLHB 4GBXC 1JYXA 1C12A 1J12A 1WZMA 3FFCE 3ZHDA 4F7MB 1LK3L 3DVGA 4S10A 3ZLQC 2FHCA 5F70A 1H9VA 4U3CA 1UCTA 4PTUA 5CLWA 1KF9B 2DWDB 1HCVA 5AZ2L 1R5IB 5JOFA 4OV6F 2Q86A 4YXKL 3U0WH 1LE5A 3VGEA 5FF6B 3HUJA 2B0SL 1U2CA 3MCLL 1S5IL 4QRSB 2VZUA 2F8XC 3ZE0E 3GJEA 3MFFA 5TQ0L 4QT5A 3BW9A 2X40A 4HWZA 2DWEB 1B6UA 2BVPA 4HDIB 1A1MB 4LKCB 5D70H 2OTUB 3TZVC 2ICWJ 4NSKB 4HEPG 3G08A 3FB6B 5D7KD 4CADA 4JB9L 5IHUL 2NXZB 2V5MA 3D3VB 2ZUWA 1KNOA 1BJ8A 4IOFC 3CSYA 3OXSB 4HWEH 4HXAH 4X5XA 1NUFA 4EZMA 1I3RA 5C0FB 4X6DE 3O4OB 2Q7YA 2YN5A 1MVUB 3U0WL 1A3RH 2NR6D 4Z76A 4EJ1C 4S1QL 2E27H 1BVKA 5FIEA 2NCMA 5IFJA 4L4VA 4NJAL 3KPNA 3CPLA 1LNUA 2YWZA 4WUUD 2QQLL 3KPPB 4HIIA 2VDPL 1RQ5A 4PGCA 9CGTA 2CLVA 4OTXH 4FQJH 5ITBH 3NCCB 1BVZA 1Y0LA 4JCMA 2ZUTA 3O3EA 3TCLA 1R3LB 5FCSH 3P0YL 3B3IB 5F88A 5T1MA 5J11B 2W07A 2OR9L 3B83A 4GUPA 3OHXB 2FEEI 4ZO7A 5E7FA 4ZO6A 1G7PA 3GUTB 3G6JF 4N1HB 3CVIL 5FUCC 1SM3H 1NBZA 3QIUD 4OAWA 5ILTL 1WSST 2JLLA 4P2QB 1YNTA 3WHXB 1BHGA 4TPRL 3TBYA 3LQZA 3DXAE 1HHKA 1X5FA 4NGHH 3UTOA 1REIA 4MYWB 3U46A 2O61A 4PR5A 4HIIB 4LHUD 2VL4A 3UROR 5I1LB 1FNGB 4G3YH 2AEIT 3S36H 5IKCB 3QRGH 3WS3B 1I7TB 4Y19D 4P2RD 4U1MA 4WWKB 5T5NG 4PJIF 3VJ6B 2AQ2A 2PNDA 2F54E 3PL6A 5AZ2H 3G6JB 4Z7OF 2NNAA 5FYLE 4LKXB 2XTJE 3ALWA 1OCWL 4FNLL 4Q6IA 3L5IA 1S7WB 1G7LB 4NNXB 5EC2B 5A2JH 4EI5D 2VN4A 4P5TA 4Z18A 5F7DA 5IT2H 4TSAH 4C4KT 1IGFH 5DC9B 4NNYB 5GRJH 4LKXA 3RKDD 2BJMH 4FMKA 4DEPC 1Z5LB 2DI9A 4KI5F 1IEBB 4LPXA 3PQYA 5LBSL 4Q2ZB 5EZJA 1L7IL 4JQIH 5F9OL 1ONQB 1YECH 4LSSH 2Q8AL 2O5YL 3VMNA 4FQLH 4L4TE 2F58H 5M94B 1ES0A 4C56A 3PWNA 1AFVH 4H8WC 3O0RL 1K85A 1MJ8H 4TUOB 5EU5B 5IEKA 1FE8L 4GRWF 1KJ3H 5JQ6L 1CTNA 2CPCA 4EI5B 1QBLL 3TFKC 1OPGH 4WHTA 3DMMD 1JPGA 5JLZB 2XA8L 4PLKD 2PTUA 3DIFB 4F9LC 2D03H 2IADB 3BPLC 4KKAD 3H3BC 4QO1A 4LCYB 1HSBA 1W0WA 4JANB 4Y5YA 4ZTOH 1F4AA 4G8FA 2YN3A 2V17L 4NM8L 3A6OA 4XBPA 2V7HB 1ZLSH 2K1MA 4LPYA 5DTFB 5JW4M 1PSKL 3SDAB 2RBLA 2A74A 3NPZB 3B9DA 1T80A 4UINH 2VLRA 3V0VB 4KMQA 1UB6A 3JV4A 5JNYB 2NZ9D 2OL3B 5GSRA 4S2SA 3DOSA 3FO0H 1D5ZB 5FUZL 2R4SL 3LKQA 2W1NA 1BX2B 1K2DB 3KHOA 4ELKB 3MLSH 2RAMA 3G5VA 3RIFF 5GS1C 2EC9T 1OD7A 4LVNC 1CZ8L 3WYRA 3EZ8A 4FRWA 2B1AL 5I18H 1MRCL 3QUXA 5KSAA 3UTPE 3QUZA 1V5JA 3FFCD 4MNQA 5IR1B 1CCZA 1UH2A 4Y5VB 1YYMH 4HMDA 1ZHBA 4CJ1A 4NQCA 3X3GL 2A6IB 4FOMA 4PRHB 3SE3C 2CJUH 4LAJH 4YC2C 5IMKB 1S3KH 3KVQA 4OZ4A 5D5MF 3BP5B 1BBDH 4BFIB 5IB4B 3H9SD 4JPVH 3Q5YA 1BMGA 2X44D 2WBJB 4F80A 5EBLA 3O3EB 1DTUA 3TCLB 1ZLVH 1AO7A 1CI5A 3C09B 5I8OL 3ULUF 3HHRB 4LQFL 2W59A 3KPSD 1QSFE 4NKMA 4Y1AE 4H20L 1JRHI 3IDYB 4OD3L 1DBAH 4OIBA 3MLYL 3BZEB 3EW3B 3SDAA 2VDOH 5I1CL 1R3HB 1HH9A 2VISB 2GJ6A 3VWJD 3O3AA 1S7QB 2MMXA 3BKYL 1JNLH 1Q9KA 5I17B 1EPFA 2BOBA 1P2CB 3GDBA 3E2HB 1FVDA 4JRYB 2MCG1 1QSZA 5JXED 1U8HA 5JW5A 3VXSE 1R3KB 2WLZA 4ODTH 3FQNB 5FGBC 5EFIB 4JN1H 5DGQA 1DANT 2DQCL 2VLJE 5J6HA 3S98A 4X6CE 3DUUB 2JKXA 2EYRA 3QPQD 4RSVA 2AABH 3GSXB 1A1NA 1DQML 5EULV 2BOBB 5FM8A 1NFDA 2ARWA 2APXA 2VDNH 3AU1B 3ARUA 3V52L 1Z9OA 3X11A 1MCOL 5FF6A 2ZKHL 2ZUSA 3VD4A 1S5HB 5L0QC 1CXHA 1KLFA 3N0PB 3VFNA 1SVZA 1A47A 5T3XL 4ZSOE 1KBGH 3ORJA 3RDTB 3TVMC 1KENL 1BQUA 5I6XC 4ODHL 1L7TH 3KPMA 1RZIB 4HSQA 4YE4L 4DN3L 4RAUB 1XR9B 3P30L 3ROLA 5BS0A 2NY3D 3F58H 3D3VA 1V8HA 2R23A 3VXSB 2FX8H 1D3CA 3IVKB 3N1GC 1T04A 3OZ9L 1LEIB 3WFHB 3MLRL 5TQ2H 1YEIH 4R4NC 3SY0B 3ECBA 1RZGA 2BDNL 2EKSA 2AEQL 1BM3L 4NQSB 1MFAL 4KZEL 3MQIA 5IW1B 3I6KB 1DBKL 5CSBA 5D5MB 3K80A 4IRSA 2XZAL 4NC0B 1ZEAH 4J3WA 4E9LA 4QNPE 3SCMB 1KCRL 3HC0B 4G43B 5D7SH 4NO5B 2NY3B 4RMWA 2LQRA 5HYFA 4OCYL 2WANA 5EU3A 4P4KD 5J13C 2QHLA 4Y2DC 2BNQE 3IS0X 4OFPA 1U3HB 3RIAK 3O8XA 3HE6D 1FL3A 2VIRA 1J88A 1SMAA 3ULSA 4NZRL 2R1XB 3I50L 2XXCB 4J3UA 3MV8D 4WDIA 1IAKB 1YMMD 1QSFA 4KJYA 4LLMB 4X4XA 1S9XB 3O6ML 3QO1B 3PDDA 2JB5H 3QDME 1BECA 3TVMB 1ZLSL 2OXHA 5LAXA 4RMRA 2I26N 3M07A 1IKFL 1KELL 3MGAA 4LU5L 2ZNXA 1XR9A 2VDKL 3OXRA 2VE6A 4XBGA 1DL7H 5EU5A 5TFSH 5MEND 5FV2A 2PXYA 4FABH 2VMFA 4D3CH 4PFEA 3IFOB 4J1UA 4PGDB 1XF3A 1G0XA 4QWWC 1J0JA 4MA3A 3HC4H 1WBZA 1WGOA 1A7QH 3I6KA 1FNSH 4ONFL 2LV4A 2VITB 2AJZB 3FTGA 4CADB 3V5KA 4PRBA 1MPAL 4WI8A 4CN1A 4CDGC 1MF2H 3JBG7 2JJVA 4GSDH 4OZFH 4PJXB 4Y5XA 1K8IB 4KROB 4OCXH 4Z0XB 2BNQD 2GYSA 3NIFE 1AFVL 2X4NB 3AREA 5SWSB 2VITA 1FZKB 1CR9H 5LCVL 4KUZL 4H5SA 1FO0H 4M6OH 4XNUL 1NC2D 4XHQA 4P99A 4BJLA 5LBSH 4E42B 3O9WC 2NXYB 4H8WL 5BOZG 4MXVE 3PGCB 1AD0B 2P5WE 4MB4A 2V2TA 3PQYE 3VG0H 4JKPL 3EOTL 2UZIL 4P48A 5DMKB 5FEBA 1FNEB 1WWWX 5E2JA 2YRPA 5LAXB 1MCHA 5C6TL 1ZOXA 2ZG3A 3HMXL 1LP9A 4DTGL 2V2TB 1NBZB 3OAZK 4MAYA 4QF1A 4U4BA 1GZPA 1KEML 1VCAA 5TE4L 1U8KB 2W60A 1S9YA 4JFDE 2DQHH 2CDGB 1AGFB 4G3YL 3MLXH 3MUY1 4V1DD 2KKQA 4HG4K 1AR1D 5JW4R 2IANE 3U0PB 3RWEA 3RDTD 2IFGA 5F1SA 2MCPH 5C8JA 5EUOE 2XNAB 3CFCH 4XC3H 5T33H 5IB2B 4ZFOB 4CGTA 3RZWA 1GIGL 3V5KB 4MNGE 1OQXA 3C5ZD 1QNZL 5HHNA 4Z78A 1NLBL 2I9TA 4XMPH 2VJXA 3IT8D 1AQKH 2A6DA 3O3BB 2QTEA 4YDVB 2YUZA 5TE6H 1J8KA 4PJDF 3P9MA 4YBLB 5GPRA 5CGYD 1J05B 1AGCA 5L2JA 1HI6A 3KYNB 4XP4H 3VXTB 3QJFA 4Z95H 3GKZA 1YUHB 4XCFL 1T83A 2F74B 4EUPB 2QSCH 5GGTH 5DT1L 4K23L 5HHNB 4Z78B 3RZCD 5B8CC 2ENYA 1I1FA 1ORQA 2VLLA 3GSQB 1KGCD 1T1ZA 4PJ9B 5DT1H 1MY5A 3O3DB 3MNZB 2R4RL 1BQHB 1QSED 1D9KB 5CJQL 5GGUB 3TZVD 2XN9D 4ZO8A 3MLUL 1DDHB 3RTQB 3BSZH 4IOFD 1EEZA 4N0FA 4UT9H 3RDTA 2XI9A 2FBJL 5AG9A 2CD0A 3C9NA 3I3DA 4KVNH 2IG2L 4LARH 3T0EE 1MI5D 1FL6A 5AWNH 1I8LA 3B8SA 3U4AA 5T1KA 2FH8A 3RVVC 1PG7X 3O8XD 4NKDA 4WJ5B 4BH8A 4TRPH 1MCSA 3BPCA 3MROB 4HIJB 2P8MA 4WGWB 4GKZB 4OCWH 3FQRA 5CGMA 1HYSC 1I3UA 5DA0B 4GLRH 1OAUH 3RY6A 4JGUA 1HWHB 1T21B 4YX2H 4JHWH 4OCLC 4F9PA 3BQUB 1S9WA 3QCUL 4RGOH 2YRLA 2GI7A 4NFDA 4NBYB 3FB6A 1F6AB 1OGAB 4MA7L 1FYTB 2PTTB 3MRHB 3GZKA 3BPLB 3PJSA 4R7NA 2Z4QA 4NFCA 1F6LL 4OKVB 1V3JA 2IBZY 3I2CL 1OQOA 3H9SE 2D7MA 4Z7WF 2C3VA 3HB3D 4MJIB 3D9AH 2WWKO 1HWGB 2AJSL 4EDWL 2HVJA 4M6OL 2EE9A 3MYJA 4HQQH 4BUHA 4JN1L 3JV0A 4TSBH 2YD5A 3KHQA 5IBTL 1YEGL 3S3JA 3UDWA 5T3ZD 1JUFA 3IAPA 3ARED 4JGJA 5D1ZB 1KFAH 2HVKA 2OTPA 1UVQB 3WJJC 1EK3A 2VOTA 1RURH 3HR5B 1H3UA 1OSZB 4UDTB 1FYTA 4MCZB 4OLWH 1T1YA 5T1LB 2J8OA 4MVBD 1WCBA 3T2OA 2MQ3A 5KN5A 3CD4A 5D7KE 4WWKD 4O5LL 3H9ZA 4U3XA 5GS2H 2UY7A 4BFEA 4JPKH 3RBSA 1RULH 1U3HA 3K4ZA 5HHMB 3V4PL 4JFHE 4HH9A 1QA9A 5C09D 3RL1B 3KPNB 3DMMC 2VZVA 4APQA 1A22B 1D6EB 2H8PB 5TDPA 4U6HB 4D0DB 3HZKB 4ODWB 5JIIA 1TZGH 1X4YA 3GSNL 5IB2A 1RZ8B 3L3KA 4Q9BA 2IFFL 2YD7A 2VSCA 4M6NL 3WIHH 4Y2DA 5ISZA 5IMMB 1CZ8H 3NA9L 1QLFB 3UYPA 2IFFH 4HFWB 4KRLB 5D2NE 1G1CA 3T2QA 2ADGA 5GHWL 1X5JA 2VQUA 1G9NL 2HVKB 4XCCH 4JFPA 4UOJA 5FOJA 3FO2B 1A7NL 1IT9L 2J8UA 4HJGB 25C8H 2WBKA 3NCJH 3U0TA 4NT6A 4AENB 4ZFFB 5C70A 1IQDA 3TBTB 2FO1A 3A6CH 3QEHA 4CW1B 2R9HC 4PJCB 1CDBA 1A6TB 4XVUD 5LGKA 2ITCB 3GRWH 2NMSA 2NY6B 2JJSC 1C7SA 4JCLA 2P1YA 3BN9D 4ODUA 3IDGB 4JFEA 1E4WH 1B0GA 5IM7A 5D4QA 1JHKL 1TQCB 4XXCC 4HH8A 2XG4A 5KOMC 5JQ6H 1S9XA 1OARL 4KJYB 1HQRB 2ZUUA 3SBWC 5JPMA 2ICCA 4PJHF 4JY6A 5IHLB 5AUMA 1IGIL 4RMTA 1EERB 3E3QE 4KKAC 5D1QB 1KENH 5CBAB 3STLA 5DJXA 4U1JA 2GQHA 2PO6C 4I0PA 3U4EA 4NRYA 1GGBL 1UG9A 1MWAH 4WFFE 3JTSA 4P4KC 5D6DA 2Y1VA 4JG1H 1BEYH 2PKDA 5E08L 5CJ5A 5DEFB 4ZYKB 5JPNB 1CD8A 1DQLH 4NZTL 2VDNL 3C60A 1MCNA 2I60L 1BD2E 2W9EL 1A3LL 1UM4H 5I73C 2ICEB 3L3IB 1I8MA 5DDHB 4GRMA 3OAZH 1LP9B 1N7ML 1AY1H 2NZ9C 4M7JL 2AAVA 1J0IA 2F19H 4UNUA 1Q9LA 3D87B 3ILPA 4YGVA 1P1ZA 4X4ME 1J8HB 1FHGA 5FKAA 5K9QG 4PJDB 2EIBA 2X4PB 2XRAL 4LSVH 1CFTB 3DXAB 4KI5C 4G80B 1UKSA 3ELAT 4QXUH 1IEBA 3ECBB 1YY8A 5CEZD 2FIKB 5CJ8A 1QTYT 4HX1B 1AGBA 1MCIA 2VERN 4PG9A 5HD8D 3UTTE 4HBCH 5EIQA 4IJ3C 1LEGA 4R9HA 4O51B 1L6XA 3O41B 3RQ3A 2WUCH 3NBNA 2FEDC 3EYVA 1B4JL 3T09A 5A2IH 3MRNB 3LS4L 4H0HB 3NTCH 1HILA 1X7QB 3MRIB 3OR6B 1HXMB 1I7TA 3BPOC 4YAQB 4KHTL 4ZXBD 4R0LA 3VI3F 4UQ3B 1FH5H 5IQ9A 1HILB 2AJYL 3OSKA 3PGDB 2J6EL 5E8DL 1Z0MA 2ICES 5GGVL 3RWGA 4OZGF 3IXTA 3C8HA 5MERA 2OJEB 3Q0HA 1X4XA 1LEGB 2EDTA 5IVNA 5I0DA 2P4AB 4KI5D 1YJDH 5I1KL 3MLWH 2FJGB 2E27L 3BEVA 4DKFL 1P4LB 1GZQB 2ITDA 1YY8B 3UTSB 4Z7UB 5K9JL 4PRIE 1TJIL 4HXAL 4X83A 1BLNA 1RUML 3VG9C 1KIPB 4UNTA 3MRPA 4QRPD 2FGWH 4WHTB 2W0FB 2Z31A 3WO3B 2OK0H 4KKCD 4UUJB 3CK0L 2NXYC 1KN2H 5T33L 1C1EH 1F58H 2ATPB 2VH5H 1YPZE 2HRPL 1XFPA 2GT9A 4LCIL 5DURD 4WEBL 5B3JF 2Y06L 1IGML 3FB8B 3DX7B 4HV8A 1PKOA 4PRPE 3RVTD 4LPCA 3MXWL 5EFIA 3UTPD 3AVEA 3BDYH 3KPTA 1QRNE 1YYLL 3D69A 3OKYA 4NQSA 4LCWA 1C08A 4DTGH 4QHLB 2MPAL 5TDNB 2C7UB 1F13A 5B22A 3FJTA 3MRQB 5IHZB 4FG6C 4HGWA 4P23D 3CX2A 4I0CC 3IKCA 1TQCC 4YHZH 3S96A 4WY7H 5F9OH 3PNWB 1HQ4A 3SJVD 1EJOL 3Q48A 3U9PH 3UTZA 1HHGA 1CLOH 1VGEH 1NGZA 1YN6A 2HTLC 1CQYA 1EJOH 3F5WB 2CGRL 2C4XA 5E1AB 1M7XA 3KLSA 4U2YA 4XCYB 1QBAA 1U42A 4F3FB 5ICZA 1ZVSA 1U93A 3VGFA 1VFMA 5MEQA 3C6SA 2NW3B 2COQA 3BP5A 1ZT1A 3GSRB 4LVOB 1W8NA 1Z3GL 4JVPA 4XP6L 1MRFL 2UWEB 5BV7C 4JO2H 4EUPG 4KQ4H 5GJSL 4LCWD 1FZJA 5GS3A 3VW3L 5DWUL 4YGVB 5IMLB 1MHEA 1VFBB 2HN7B 1J0YA 4ELKA 4A6YA 2B2XH 1OAZH 3KYMA 1NDMA 4KDWA 2C1PA 3HFMH 3QIUA 1V7NL 1AKJD 3L5HA 3PWUA 4LMQE 5CP3H 5I9QB 1YEJL 3EFDH 3CFKB 4NCC1 2PO6B 4KK8C 4P4RA 3NACH 4NPYB 5K9JH 4F37K 4P2QE 2JJTA 1A9EB 1P5UA 3DMMB 2OR9H 4M4RA 5B38B 4E41A 4DKFH 3K3QA 5KVMC 4BZ2L 4NQDA 2IGFL 1MCKA 2V2WA 4UBDC 2XTJD 5J6GB 2Z91A 4OZHE 1WCBB 7CGTA 4NHCL 5F96L 3FQXA 3TM6A 4P5TB 2BK8A 5GRYA 4KK9D 5C0GA 4R97B 1WIUA 2QQNH 2XPGB 4KVCL 3NIGF 5DF0A 4WTZA 1W8OA 5BS0E 3VXSD 2XTJC 4ODBD 2GJ6D 3LQAC 2OSLA 3T77B 2Y5TB 3QPXL 3V8OA 4RBPK 4ZUTA 2E8ZA 4YPJA 3HAEH 4WW1A 1CIDA 35C8L 3ULVD 4HIJA 4I3SH 1HHJB 4YR6A 2FATL 5IB5A 4BSVB 3EO1A 4OZFG 1U8OB 5DVLA 1ZLWH 3RY6C 3D0VB 3EJYC 3MC0A 2O93L 1YEHH 3BESR 2YD3A 1OP5K 1F42A 2HWZL 4M5ZH 4RISH 4RAVB 3WL9A 4CU8A 1NKOA 3CLEL 4Y19A 5DHYA 1AXSB 1RUMH 1W72L 4O02H 4ELMA 4YDLB 1OW0A 1MEXH 3ZKMD 4WHCA 5INDA 3EJZC 1TVDA 4JRXB 1ZV5A 4QOKE 3KPSB 4KDTC 1OGAD 5FYKE 3VGAC 2R39A 1GH7A 1ZHLB 5BRZB 4PJGF 5BO1L 3LEXB 2XQBL 4OCYH 1EHLL 2WUBH 3OB8A 4OLZL 4E41E 2E8YA 2LU3A 1YMMB 3I6GA 1MCOH 2EYTB 2P43B 3PWJA 4GG8A 1A6VH 1N59B 5FO9A 2HLFD 3KYKL 1UM4L 3QFJD 4L4VB 5JHLH 2NY4C 1CICD 5GRWA 1PKQE 2YMXL 1HXYB 4G8IB 3WFCH 3GSUB 3HA0A 3MACL 4JFXB 3W0WD 3O2DA 4RMQA 4OFIA 1AO7E 5D7LE 4PJIB 4N0UE 5EDXA 4X5XB 4CN4A 4NQEB 2OZ4A 1A6ZA 5EC1A 1ZLWK 3TIEA 1ZS8B 4RQQB 4C56D 3V6BR 3VRIA 1T1YB 2F53D 1IAIL 2OTWA 4G6KL 4J3SA 4Q74A 3WNMA 5BCAA 5C09E 2FX7H 3OZ9H 4X7DC 1SJXA 1JNLL 1UXWA 2DL2A 43CAA 2DDQL 1T1WA 3QIUC 5T1DH 4IRSD 3R1GL 1VEOA 4B7IA 1FCCA 3GMPA 4NQEA 5C7XH 2HKHL 3V6OE 1RUPH 1H5BB 5D9SA 3SKJL 4L5FH 4WCYL 4BZYA 1IGYB 3ULVH 1KBGL 4MQTB 3MREA 1CDJA 2Z8VC 3VXTA 1KN4H 1UCBH 1HI6B 3KYNA 5B39G 1MVFA 2OR7A 3HG1A 5EOCL 5T3ZE 5GIRA 4LEOA 4UDUB 4OGXL 4X6EB 1QRKA 2AI0H 1S7XA 2Y07H 2CR3A 1DBMH 3GMNB 4MNQE 5A3ID 1OTSC 1XZ0B 1AD0A 2ZG1A 4TSCH 2CUMA 3NIDE 5JXAL 2O26U 5EO9A 1P4BH 4OAWB 2NPLX 2H2PC 3HUJF 2YD6A 3TWCL 1KTKE 3DIFA 2D3VA 1OAQH 3VI4F 1KLGB 4OT1H 4FXGB 2F54D 5F1IA 4MJ5B 5E99L 4UT6H 4FXKA 5I1GL 4KXZH 1MLCB 5BZWB 2YHGA 3QFDB 3C9NB 4V1DB 4KGJA 2M8XA 5C07E 4YHIA 2Z31B 4LRNL 2NY1B 3IDIB 1B4RA 3ARDC 5EU6B 4DK6A 4K3EH 3PWNB 1U3JA 3WLWC 3D39E 1VGKB 3DX9A 2ZPKL 1ITCA 2AJZA 3N85L 5C6WH 1PEWA 1UWXH 1UT9A 3OJDB 3I85A 1WEJL 2P5EA 2HYMA 4P2RB 5CP7A 1XZ0A 1MFBH 4HS8H 5IJVB 1NC4A 2CDFA 1HN1A 4HKBB 1QZ1A 4YFLF 2FZ3B 5I19H 1VENA 5D7IB 2NLJB 5GGTA 1IC1A 1UKQA 4EBQL 4EI6B 5I1EH 3OKEB 3U48A 1I9RH 1UYWL 1B6DA 2PCPA 4YQXH 4X4MA 4PJBB 4WW2F 1J0ZA 2PYFB 3CGTA 4KTEL 1KB5H 2BNUA 2DLFH 1IBGH 1WK0A 1ZHNA 5DJ0B 3QHZL 2R4SH 5DVOA 4RGNC 1IEHA 1INQB 3MRMB 3IU3B 5ABDE 1IEAB 1FIEA 4J12A 2M26A 3H42H 4K94H 4PJGE 4UINL 3TZVB 4NO5A 2BNQB 4AQOA 5FOBA 5DXWA 4KK6D 1MJ7H 8FABB 5EOQH 5EBGA 3GB7A 1UWXK 3DRQB 1AGFA 3BMWA 4ZUVA 4L3EA 4YHNA 5IFHH 1N0XH 5D7IA 5JUEL 2EIDA 4NZJA 5ENWB 3OL2A 4Z0BH 1RUKL 1S8DB 1TMCB 1OSPH 3H9HA 4CMMA 5D1XC 1K4CA 2KL6A 3BGFC 3SE8H 5CHNA 2P8PA 5EBWB 2D0GA 4HK3N 1FZOB 4ORZC 4IS6B 3C2SA 4X4ZA 5ENWA 5EO0B 1U58A 2YEZB 3S36L 4HUXA 2ZUXA 3C6SB 1KFAL 1AGDB 3VFWB 2YC1B 5DMJB 4ENEC 5DK0A 1MJJA 1A6AA 1AE6L 1XMWA 5A1AA 1NLDH 3DNKA 4JQXA 4RGMC 4TPRH 5TJWK 5DMYA 1P6AB 2F58L 4Q9RH 4G8GE 3UBXI 3HC0A 4LARL 5FYJL 3CZFB 1A8JH 1FO0A 3ZL4H 1U8NB 4KRPC 4ZS6D 4A6YH 3D9AL 1DEDA 4OV5A 2QHRL 5AD0A 2CR6A 3S4SA 1W72B 2XKNA 1YPZB 4LSUH 4U1GC 4R90H 3PHQA 5AUMB 2OP4L 3PWLA 1B2WL 1DQTA 4BKLB 3RUGF 3IKCB 3DROB 1CFSB 32C2B 5EUKB 1LP9E 3BOVA 1RSFA 1U8MA 3S37X 4HWZB 2DJSA 3SO3B 3QCUH 2NY2B 5F89B 5IB5B 3PHQB 5KJRL 1HINH 2A9ML 1YPZA 2NY0C 5BJTB 5FGCB 5H35A 1GPOH 4NN6B 1BD2A 2D7OA 4PGJA 4XPBH 3ARGD 2F53E 4NHUB 4TTDD 4UU9A 1FFOA 2ESVB 1T7XA 2YPLB 3B43A 2D7TL 5SWZD 1P9MA 4KKNA 1MFNA 4K71C 4D9RE 2EDWA 1BIIB 2VISA 4NN7B 5C0IB 3QULB 4LP4A 1AGDA 3QB7C 3O9WB 4LLDA 2ERJC 3DX8A 1MJUL 4TRPL 4DGIH 1EBPA 4WDIB 3BZDA 4PJFB 4B0MM 4IS6A 4JO4H 2PN5A 3J8F7 2ZNWA 1MCFA 2X41A 4I3SL 4LGRB 4GO6B 2ZJSL 5D8JH 4PJ5A 3E8UH 5DK2B 3NFSL 3VFMA 4RFNB 4L8BA 1QO3B 4Y1AB 3TN0D 2DLGA 1F2XK 1DBBL 3FOMA 5DJ2B 3E6FB 5DZOA 1NFIB 2L4OA 3HTLX 3VD9A 4G8IA 1KEMH 3SGDH 3DRQA 4ODWA 1BZ9A 1R5WA 2VUOA 3BP6A 3GEWB 1EHXA 1T7WA 2NZIA 2E7BA 4POUB 4ZFZB 2WINB 1GSMA 1ZANL 1RIHH 3EIFA 3O11B 3TIDB 1JTTA 4JPWH 2Z8WC 1ZT7A 1A3RL 3GSOA 2RGSA 4O9HL 1U8QA 4XP4L 2BMKA 3N9GL 4I2XE 4FFWD 4AH2A 3VFUB 4D9RD 4S1DC 3GSRA 3KLHD 4J8RA 3QDJA 5B8CA 3IVKA 2VO5A 3KPOA 3RVTC 2BVUA 3U9UB 4GW1A 4Z7QE 1BFOB 1DSFH 1DUZA 4QRPB 2B2XL 4PJHA 1MNUH 2WNGA 1T1WB 3BDXA 4LIQE 4F37F 4J3TA 4OUUB 4TUKH 5HDQL 4XC3L 5CUSL 1UGNA 2VQ1A 4NBXB 3MPCA 5I74C 3DUHA 4YJZL 1A0QL 1BVLB 1MRFH 2HLAA 1S7SA 3E2HC 4Y4FC 1NAKH 5CMAA 1EHAA 4DFIA 3T0XA 5FM5O 5TE7L 4Y2DD 3MRLA 4NWUL 1Q0YL 5ACLA 4NO0B 2X4QB 1X44A 2Y36L 1TQBB 2R2BA 2EDNA 4N68A 3RGVD 5JNYA 5GRVL 1A7BA 1NL0L 1AGEA 1RJCA 4JKPH 3S7GA 2C4FU 5E2WH 3GI8H 1HNFA 3C09C 4RGMB 5CJBA 4P2OD 3QEGH 4DGYL 1Z9MA 4RDQG 5F71A 3ARQA 3GI8L 4Q9CA 4WFHD 3QI9A 1I4FA 1RUQL 2A6KA 2EDXA 1KIRB 1LO3H 4PGBB 1R6VA 2DQEL 3U36B 2NY2D 4JFQA 2QR0A 3VRJA 5F7DB 4H25A 3B5HA 4RNRB 3TT3L 5DQ9A 4LLWA 5DHVH 3BVNA 1WC7B 3MJ9A 5JZ7D 4HIHB 3O3UN 5EZLB 1YY9C 1MHHA 2OQJA 4AM0A 5ID0A 5BVPH 1X5LA 5K9KA 1LEKA 1F58L 2OJEA 3EOAB 3PWVA 4I0PD 3VFPA 4GG6B 4YK4B 2APFA 2A73B 1G7JA 3O3DA 2BP3A 3QUXB 1G9MC 5DD0H 4U1LB 3ZYZA 2FR4B 3CVHA 1JGVL 2ZUQB 4BQ6A 3QIWA 2A6IA 4PRHA 3HE6C 1WBYB 1NGXB 1BPVA 4NOFA 1F3DJ 1CT8A 3FT2B 5DRWA 5EN2A 2A77H 5KSAB 1YJDL 1QHOA 2W38A 2R69H 3IDMB 4PP2A 4OB5L 4JR9L 1TJHL 1L7TL 1SJVA 2QADD 3GJFH 5HYJB 1M1SA 3RL1A 5T5FH 4XBPB 5E5MB 5TGBB 1RZFH 3EYFA 4XH2A 3TH3T 4HH9B 5KS9F 5L2KE 1H3XA 1DUYB 2BVQB 2A83A 4HLZH 4GAJH 2WBJD 3QXAA 3TN0A 1T89C 3HS0B 5DA4A 3FN9A 1N64L 1KCRH 1JNHA 1HHKB 5DUPH 2JCCB 1AR1C 1MHEB 2ILLA 1T0MB 4NQVA 4GAFB 2R2HB 4P4KB 1A2YB 3WMSA 5E24E 4NQXB 4PJ8B 4Y4FA 4P2YA 5C08B 3WHE0 4D9QD 4N1CA 1TXKA 4N8CH 4G5ZH 1SEBA 2UWEA 4WFED 2HJLB 5FK9B 2VNCA 3EDJA 3FB5B 1WAAF 5M7QA 4Y88A 1FGNL 4MMZC 4M1CC 1A2YA 5IVXE 5C9JA 1JVKA 2A73A 3T3PE 1NMAL 2IBZX 1T1XB 4XX1E 1XR8A 4X9FA 3SDXA 3MUZ1 5KVFH 4HFUL 3MBEA 1NCNA 3EOAA 5DO2C 2X1QA 4UB0H 3GJEB 3DURB 3RVVD 2EDEA 2A83B 1DBAL 2EXYC 1JHTA 5CZXC 5C0BB 4M1CD 4MDJB 1F4YH 2Z4QB 2RIKA 4QRTB 5EZIL 3NFPB 2DLIA 3WFEL 2ZSVA 5JOFB 5T3XH 2VQ1B 1BWWA 1R24B 3KPRA 4NP4H 4KY1L 2Q7YB 3FT4A 3L7EB 1UZ8A 5GS0L 2XN9B 5CZXD 5DQ9B 5EN2B 2LU4A 1Q38A 1RZJL 1DP0A 1JHLH 1NCAL 3WL9B 4QOKA 2DQUH 4YHYB 4XXDB 1A3LH 2A1WH 3MRRA 1QR4A 3DUSB 1NGYB 3WUWG 2D4FA