2C3XA

Structure of iodinated cbm25 from bacillus halodurans amylase in complex with maltotetraose
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
93
structure length
93
Chain Sequence
b'TDITIYYKTGWTHPHIHYSLNQGAWTTLPGVPLTKSEYEGYVKVTIEAEEGSQLRAAFNNGSGQWDNNQGRDYDFSSGVHTLADGRILSGTPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-AMYLASE G-6
publication title A Structural and Functional Analysis of Alpha-Glucan Recognition by Family 25 and 26 Carbohydrate-Binding Modules Reveals a Conserved Mode of Starch Recognition
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Carbohydrate-binding module
total genus 20
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03423 CBM_25 Carbohydrate binding domain (family 25)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c3xA00
1EERB 4J1UA 3BMWA 3SGJA 2EXYC 3IXTA 3D69A 3L6FB 4W6YB 3RX8A 4HLZH 2DQTH 2XXCB 4BQCA 3TWCL 3VD3A 1KLGA 1MJ8H 1LP9A 5I8OH 1MI5B 1U8JB 4KUCD 4ODUA 1N64H 4JANA 2AJUH 2F9BT 4E41D 2AABH 3IFPA 5C9JA 1OM3H 4K8RD 4LQ1A 2CDFA 1DQJB 3SKMA 1UM5H 1T22A 3RI5K 4MB5A 4RMUA 2H3NA 4L3AA 3RDTD 5D1ZA 2HRPL 1CICA 2DB8A 4R97B 1DL7H 2Q8BL 4H8WH 1QBML 5F7EH 4NO3B 2BZDA 4YFLI 4E42B 1NCCH 4LHUG 4HWBA 3MBEB 1X9QA 4UDUA 3ULUC 4X6EA 4LSSL 5DA4A 4GH7B 5I8CA 2VR4A 5EPMB 4G7VL 1F11A 3F7PC 3FQNA 2PYFB 3QUZD 4GUPB 4NO2B 3GJEB 5J6HB 4JJ5A 3MRQB 4M5ZL 3T65A 4KI5D 1Q0YH 4AYFA 2R4SH 3B43A 1RZGB 3QZWB 2DL9A 2E7LA 3Q3GB 3M07A 3QIUD 1XEDA 3SDAB 3AXLB 2ZOLB 4HBCL 4HQQL 5IFHL 2DI8A 2HWZH 1VEPA 4PRDB 3RWGA 4LSVL 1I7ZA 2QV2A 4N9GA 1YJDC 4YHOL 4I77L 2UUDK 4MB3A 1FGNH 3H9ZA 1URLA 3VGDA 1QRKA 4R0LC 4U6VL 1NCBL 3WIFA 4QHNA 3HE6D 5GGSB 1JGUL 4WUKL 4CW1B 3MV8B 1EAPB 1WGOA 1NCWL 2W0LA 4Y5VC 1EHLH 3NFSL 4G42B 4P5TC 2EDDA 3H3PL 1OQXA 3T04D 2NXYB 4M48L 5BVJB 3LKNB 5CBAA 3EGSA 4HC1H 5DMIH 4AMKL 1QA9B 5D1XD 1G9NL 2C1OB 1CL7L 3BIKA 1XF3B 4G9FE 5J9PA 5FGBA 2IWGA 3BI9X 1SJEA 3WO4B 3WN5C 1IAOA 2NY0D 3CMOH 4BQ9A 4LEXL 3R0MA 2XPGA 4MMZC 1YNLL 1LNUB 1LO4H 3CX2A 4BZ2H 2MWCA 3HR6A 3U0TA 4I3RH 5DO2D 4OD1L 5H94B 2EKSB 3QFDB 4OJFH 4OIIL 2R2CA 4P5MB 3H6JA 5GXBB 3R1GH 3DHJA 4GKSA 1G0YR 3G5ZA 1BP3B 3CDGB 4M7KH 2BHUA 3VFVA 3DYOA 2R2HB 4DN4H 2D7QA 1CFSB 2YA0A 1QQDB 3V52H 1QFHA 3ZTNH 1DBMH 4Y16C 4U6HB 3QIWD 4NQCD 4YFEA 4LOUD 2E7HA 3D9AH 1T0NA 3KLDA 4PJDA 4U6XA 1WWAX 1CDCA 3FFDB 4CDGC 4LLVB 4NRXA 4X9IA 5BRZD 1EBAA 3HB3D 2DAVA 3MOAH 3D0VA 3FT3A 4QRPA 5CSGA 4Z77B 1MFBH 2GAZB 2EEAA 2FX8H 2QSCH 1NMAH 5E00B 5GRUH 4WNQB 3KPPB 4OLWL 3V5DB 3W9DB 3MLSL 3ZDZE 2VLJB 8FABA 1K8DA 1TQCC 4NRYB 2XY1A 3P4MA 3FFCE 1T04A 3AMKA 1T21B 4D0BA 2DQCL 3P30H 1DFBL 1FLRL 3OZ9L 2DYPD 4N0UB 2JJWA 3QNXB 4JFXB 1RJLB 1XZ0A 2KZ1B 1QYGL 3ROLB 2Z31C 4OCLC 4KC3B 3EYFB 1D9KA 1Q9WA 4ODVL 4PJFE 5MP6H 5C0DA 3T0BA 4PY7B 5I1HL 3VRIA 5DJXB 3NACH 5C6TL 3M1BA 1EPFA 2WUBL 3QEHA 4ETQA 3LQAL 3MXWL 4NQDE 4HFUL 2A73A 4CADB 5C08B 2BC4A 4EUPB 3FB6B 3LEYL 5I1LA 2DKUA 3AVEA 3ZHDA 2VDMH 1ZHLA 3QULA 5EU6D 3QDGB 4O9HH 4ODHL 2EICA 4RRPA 3CFBA 4PP1C 5C2UB 3IKCB 2X05A 4EI6A 3NGBC 5GJSH 4JFYA 4L4VA 5I66A 1JNNL 5C0AA 3GMLA 4N90E 4XTRC 5LWYL 1NMBH 1ONQB 2HG5B 4K23H 4IJ3B 1EFXD 4D3CH 4PRPA 4H26B 5DUBA 3BEWB 3RWCA 4NRZB 3T0EC 1OTTC 4GAFB 5F70A 1S7VA 1KXVC 3T4AA 2ESVE 1O7SA 4YHIA 2CUIA 5I16B 3P73A 2V9QA 4HMCA 2CIIA 1EO7A 3IU4L 4XH2B 4X9HA 1RUKH 3T3PF 4K2UL 5F89B 1KTDB 1ULVA 4PRBA 1XR9A 1XCTB 4H25A 2CRIA 4ZXBA 2OZ4L 4PGZA 4TSBL 1IFHH 4LQFH 1NGZA 4G8IA 4P5TD 1PLGH 1GHFH 3IETB 1TVBA 2KKQA 5KBNC 5IEHA 2YPLD 4DOHE 4PB0H 4NYLA 2BVTA 1HH9A 5DQ9B 5FYLL 3U0WH 4Y89A 5JORA 1D5MB 1SJXA 3UXFA 3KXFD 2CLVA 2A6DA 2SEBB 3QPXH 5DD0H 5IB5A 3RIAF 3DPBA 1QSFE 4P5KB 3ILQD 3QFJE 4F58L 3ZDYF 5HHNB 4U6YA 5CGTA 4U1GC 3KYKH 4M3JA 5FO9A 2PO6D 2RIKA 3RX5A 1U91B 4ELME 5CEYA 3FTGA 3MODH 3BT2H 3EAKA 3ARFC 2Q6WB 2V5SA 4HJ0C 2ZCLH 4OLXH 1S7WA 3K2UH 2L0DA 1MELA 3X14B 1RZFH 4DVBA 3IGAB 4JY6B 1OVZA 2AJ3A 2WUCL 2CR6A 2J8UE 1RVFL 2ZNXA 3HMXH 5JTWA 5ITFB 1YDPB 4Y16D 4JO1L 3FRPA 35C8H 5IFAL 5EWIH 4G8EA 1G0XA 2VISA 5EZLB 1G9NC 3KLHC 1DBJL 3QEUA 4AQOA 3UBXA 2NX5D 3PWJB 4OFYA 3GI9L 3CVHH 1WBYB 2UWEE 3I02B 3S37L 2ED9A 1E4WH 4RGNC 3ESVF 4EN3C 4QRQA 2DQUH 2DQJL 3ZE0F 1S9YA 3E6HB 4HKXB 4GKNB 1HHIA 1W72A 4GAJL 4Z0BL 2W9LA 1MAKA 3GGWA 1R3IL 2N1KA 2Z31D 4WI9A 4DZBB 2HJKA 3C6LB 4PB9H 4WUUE 1H8OA 1B0WA 1NAML 5ADOL 5JZ7D 4R2GB 4WHCA 4M1GL 5HYQB 4OZHB 1NBQA 3HN3A 3I6GB 2HH0L 4WFHD 4AEIL 4M6MH 5C86A 3FN9A 3MRJA 4J4PA 5KSBF 2HVKA 2HLAB 1LEGA 2ICEA 5D72H 2Q7YB 4GW1A 3STZA 1CK0H 4G6ML 3GI8H 1FG2A 3QI9B 3VG0L 3PIQA 2IBGA 3P0YH 3ZE2F 1M7IA 4U1NA 4PP1D 1ZVSA 2RGSA 3FRUA 2AXFA 4UNVA 2A74A 3N1PC 5A43C 1UG9A 1YMHA 4D8PB 2C3HA 4TOYH 3KHOA 5BS0E 2WAHA 4ZUSA 5CD5C 4QYOB 4LSPL 1S8DB 5TDPB 5FO7A 4XXDA 3T0ED 1XGYL 4UBDC 4U6TA 4GRMA 3L5WB 3U0PA 2DWEA 5EC2A 3W0WA 5JHDB 3D2UB 4TUKL 2XKNB 4BKLB 1MJJB 4NDMA 5GGTA 1HI6B 3G5XA 4Y4KB 4DGVL 3MJ6A 4OKVB 3PWLB 1SQ2N 2BSED 3LQAC 3LS5H 2EC9T 2GT9B 3U48A 4NPYA 5T5FH 5T3XE 3A6OA 2R1WB 4OT1L 4PJEA 1K85A 1XGUB 4DN3H 2VTFA 1FL3B 2APVA 5FGSA 5DWUL 3ARGA 1I4FA 4GG6A 4QHLB 4NJ9H 4PBXA 4G8GB 4Y5YA 3X3GH 4IDJH 4W81A 1ZGLB 1A4KA 5IB3A 4XMKH 2VITB 3RNQA 4UQ2A 5DMGC 3IDJB 5T3ZE 3S35X 5HGHB 3BQUA 2AI0L 4P2QD 4HWZA 1N5AB 4BFEA 2IEPA 3RGVB 4WTZG 4P46C 4PLKC 1X3DA 4KTDH 5ID0A 2ADFH 3AM8A 1DQTA 1MCOL 4K94H 2P5WB 1ZA3B 1QFUL 4PV8A 5C0FA 2WBJA 4AEHH 1OAZL 2FHBA 1U36A 1OARH 1OD7A 2YSSB 3PGCA 3ARFD 3KPSB 1R3JA 3PP4H 1CQYA 4RMWA 3MUGA 5KVEH 2DQFA 1FL5A 1HKLL 3MACH 3LKPB 5I9QC 4Y19D 2VLKA 3GBNH 3UTSE 2DTMH 3U30B 4TNVF 5SWZA 1GSMA 1F6FB 3PDDA 43C9B 4AL8H 3SCMB 3O8XC 4IEFB 1YN6A 3KLHD 2A9NH 1SM3H 3CH1B 3TO4C 1L7TH 2W0PA 3G6JB 4EEEA 2QHRH 1KJMB 1SBBA 1N3NA 5HGBB 4MJ6A 5I8KL 1PYWB 4RGND 4EN3D 1HSAA 2B1AH 4KXZH 5DTFA 3LHPL 4LL9A 1N59A 3ESUF 3U4BL 4JQVC 2W92A 1A1NB 1WAAA 4MA7L 1Z9MA 2C7UA 1W0VA 4H1LG 2E7CA 3O9WB 1CD9B 1IM9D 2P48B 3U9PH 1FIGL 2IPTH 4N0UE 4QXTB 1ZT1B 2LVEA 3ARTA 1W0WA 1JGVL 1IGIH 4R3SA 2VMFA 4MQSB 4BH8A 1PFCA 3D85B 4WHTA 2CGRH 4Y4FB 4XPTL 3WJJA 4L4TE 1K2DB 2BY3A 3BEVA 4PV9B 4NZUL 3MNWA 3NFNB 4AZ8A 1ORQB 1KIRB 5SWSD 4WWKB 5D7IA 3QUMH 4LVNC 3DBXB 3KGRA 4F15B 4ZQKB 4OZIF 1J0ZA 3CD4A 4DKEL 2ZSVA 1AHWB 3KPRA 2CK0H 4NWUH 1X7QA 1CYGA 2YZ8A 3MFFA 5H35A 3F12B 4KK9C 2OR7A 3DX7A 2UY6A 5JUEL 1G9ML 2Y7QB 1DUYA 4IIQA 1L0XA 1QBLH 3D3VB 1UCBL 1WCQA 4U1SB 3BXNA 2DMBA 4KZEL 3NZ8A 5T33H 3VFPA 1JHTA 3IDIB 1S7UB 4MHHI 4XPFL 3SY0A 3RWDB 4HV8A 4L8SC 1I85A 4L29B 4QGYA 1AGBA 2F19H 3PXJA 5DJYA 3VMOA 1JZ4A 3SPVB 4LCWB 3VWKB 1OP3K 2IPUK 1MPAH 4LKCB 4Z0XB 2IBZY 5KSAA 3OKKB 2F54D 3FQTB 2YN3A 1YC7A 2R69H 5B3JE 2OMBA 1OSPH 5HHPA 1UB5B 3FO2B 5GGTH 4HWEH 1DEDA 3MRIA 2HTLC 5IBTL 5DMGD 1A6AB 4LDEB 4P99A 1P9MA 2XRAL 4MJIB 4NZRH 4ZPTA 3SO5A 1IGCL 2I5YL 2IQAA 4DFIA 4P46D 4IDLA 4PLKD 4FTVD 3FT2B 2XA8L 3QR2A 5C0CB 1WCBA 1R5VB 1F4YL 4PGJA 2I9TB 4O4YH 3EO9H 2DQEL 2CPCA 4HFWB 1UWEL 4M7ZC 3GBML 4PJ5B 3MRDB 3LRHA 4IRSB 1DSFH 1T3FA 5L2JB 2HYMA 3L3JA 3GUTB 3GMQA 1GC1L 5CMAB 2DF3A 4KI5E 3HE7A 1JFQH 1HKFA 4IRJC 4WJ5B 1U8HB 1S5HA 4C56B 5J6GA 3BN9D 4FN0A 4PREA 5CHNA 4ZFFA 3SDXE 4ESKA 3BP5A 1ZHBA 3S5LB 5GRWA 3SE3A 1MWAB 1XGTA 1VEOA 1INQA 4OTXL 1BGXL 4JFED 5KVFL 2EEDA 1XT5A 4A6YA 4AG4L 5C6WH 4WO4B 3GBLA 1UEMA 5D1ZC 3V0WH 4EXKA 4HJJL 1CICC 1IEHA 1J1XH 1UZ6E 3SE8H 2EDLA 5D7JA 5BJTA 1JPSH 4KWUA 4X8XA 1A9BA 1NDMA 3O8XD 3VXUB 3WMSA 2C3GA 1FVDB 5KS9F 5I6XC 4KV5F 2ED7A 5INDB 2YZ1A 4R97C 4ZFGL 4L3EB 3HUJA 4KROD 3BUYA 1U8KB 3TV3H 3ARBA 3NMEA 2YBRA 4MJ4A 1MF2L 1Z3GH 1EUUA 4HH8A 2XG5A 4R4NC 3U46B 1OOAA 4JPIA 4PR5A 4TN9A 3VW3H 5CJBA 4UTAL 1N0LA 1OAUH 1D5IH 1A7RL 2KUTA 4TTDC 1C5CH 4EI5A 2VC2L 1E0OB 1BQHB 5AYUH 3X13B 2VDOH 4L5FH 3SQOL 3EFFA 4KKBC 3OKNB 1MHEA 4OB5H 3PF2A 4UV7L 4CN6A 3SDAC 3NCEB 1RI8A 2RB8A 3OTTA 3K74B 2RR3A 5ANMB 5C0GA 3TPUA 1KCVL 5IBUB 1A7NH 1QSVA 2VDQH 3TYGL 1MHCB 3EYOA 1DBBH 5EIIB 2WM0A 3CNKA 3RNKA 4N0YL 1DBKH 3G04A 2IPKA 4KKNA 2VWEC 1YEGH 4P2CG 4M1DH 3EO1B 1Z6JT 4OV5A 1JNHB 5ITBH 1QRND 2OTUA 2HFGH 2GHWB 3MUY1 1YECL 3DROB 1BBDL 1VKXA 4KK9D 4LIQH 3GO1H 2X70A 4PJIB 4X7SL 3OKLB 1H3XA 1P4IH 4MAYB 4W6WB 3O6KL 3G6DL 4YHNA 5IVZB 1CGTA 1WK0A 2APFA 3L7EB 4I4WB 1A6TA 5IMLA 3AS3A 4AH2B 2Q7NA 1W72L 3VXRD 5FDWA 4TRPL 1JWSA 2Z92A 2LTQB 5DEFB 3OF6D 1G7MB 3OKDB 1WISA 4XXCA 1J11A 2L4OA 2DLFL 5DSCB 2R0KL 5FUOH 1QSZA 3DVGA 5DQDL 5BVPH 5E70A 4MMXC 3AU1B 1J0KA 1VFAB 4LMQI 4S2SB 12E8H 5AD0B 5CKGA 1GYAA 4ODSL 2YD7A 1NGYB 2ITDA 1OAXH 2BCKB 4LKXB 1YEDA 2F5AL 5I2IA 4FP8L 2XWTA 4AENB 2HTLD 2D0FA 2B20A 3WSQH 2DWDA 4M6AA 4C57C 2P8LB 5K9OB 1RJCA 1H5BB 1G9MC 4Y5XA 5CEZL 4X8JB 4NN5C 4M7LH 3PP3H 4Q74A 4P4KD 5IKCB 3H0TB 5TE7L 4HKJB 5ERWB 3QRGL 4W70A 4WTXA 2Y06H 2BX5A 1BLNA 4JN2B 5I19L 4HAFA 5DURB 2Z0BA 4ACPA 2VIRB 3BP4A 1T03H 3HAEH 4HUMB 4Q9RH 4XAWH 2CKNA 3MRHB 4IRJD 4XBPA 1HEZB 3IJSB 1QLRB 4YHPA 4XWGL 2OR9L 3WE6A 4Z7WF 1EX0A 4G5ZL 1AGFB 1QO3B 3QIBB 1BQHG 3OQ3B 3NN8A 5FDYA 4FNLL 1HH6B 3SDDA 3T3MF 1YEKL 4QNPE 3B9AA 2VAAA 3OKOA 4D9QE 2IALA 1KEGL 5D1ZD 3QXAB 1CICD 1ACYL 3D48R 1JTPA 1Q9LA 5AAMA 2FWOB 2VDRL 4L1HA 1LWRA 5E6IA 4NC2B 1SEBB 1MH5A 3BIAX 4GRLB 1J1PL 4AM0A 2J88L 5EC1B 4O2FA 3DOSA 1K4DA 4GAYB 1U42A 2A0LC 4R4ND 1AP2A 3GSOB 4X5XA 3LKOA 1I8IA 1IBGH 3O2DL 3ULVL 1EMTH 2ARJB 2CJUH 3N85L 3LEXB 1P1ZA 3KXFE 1KENL 2YRZA 4NNYA 2AV7B 4K3DL 3FKUS 5MI0B 1GC1C 3KYMA 4TTDD 5EOTA 5JW5B 4J7RA 4JPVL 2XZAL 1HN1A 4ODWA 4Z95L 4KKBD 4ONFH 1DUZA 3SDAD 4NHUB 4NNXA 3VXMA 5D6CB 1T89C 2JK5B 4WFFE 3FMGL 5BOPA 3WNLA 4G3YH 3QJFA 3QBTB 4M6OH 5F88B 1QKZH 1MFEL 2YUVA 4JM2F 3CDCA 5AG8A 2PYEA 4HJGB 4UT6L 4HIJB 4MNHA 1U8LA 4KMTL 1J8HB 1R24B 5D5MF 3WD5L 5JIPA 3D18A 3V4VH 2PTVA 4B7IA 4KDWA 3CFDA 4I8DA 3KR3H 5JPMA 1KCUH 4M62L 4ZFZB 2A83B 1F58L 2NX5E 2GCYA 3RY6A 1J8KA 3LRSA 4LPXA 3MLUL 2NY7L 4HEPG 3TESA 1CT8B 2ENSA 1U0QA 3S4SG 1I9RH 2VKWA 3FQRA 5F7NC 4ONOA 1AE6L 4JRXE 2MOVA 3KPLA 4ZDHA 2V2XB 1TZGH 2HMIC 3L5JA 4RSVA 3ALXA 4LLYA 1AJ7H 4YK4B 3EJZC 3ZKQD 2X4TB 4UTBH 5EBWB 1CG9A 1XF5A 5L0QB 4B7LA 1H3WM 4Y1AA 5EZJA 2Q87A 5TQ0H 2J5LC 1VFOA 2DQHH 3MLVL 1N6QL 5IM7B 2BSRA 3B83A 2XZQH 3BFOA 3LCYA 5DR5L 3IFNL 5CD3A 4UINH 3ARXA 3NZHH 4RFNB 3THML 3ILPA 3VFNB 3DSNA 2OJEA 2NY2B 1BM3H 2CDEA 3GM8A 5ESQB 4N68A 1JGLL 1XH3B 1S9WB 2QEJA 1T1ZA 1DLHB 4QRPD 3TBWB 2FR4A 1X5KA 4HLZG 3NAAH 5EFIA 3MC0A 1JRHL 2QSTA 4N5UA 3QQ3B 3LSOA 4OI8A 4JG0H 3ZKMC 3MUHL 4GAGL 4ODXB 1G9EA 3WS6A 1UACH 2OS7A 5FYKH 1QVOA 3BGFC 5FCUL 5GGUB 1KN4L 3RWHA 2IH1A 1RUMH 3EYSL 4RMQA 3SE4A 4K07A 4JRWA 4QOKB 2EDNA 5IR1B 2YWZA 1NGPH 2EDYA 1YPZA 4PJ5E 3B9EA 1A7BA 2MQ0A 3OAUL 1MRCH 1V7ML 2P47B 4Z7VF 3P4OB 1N5YL 4GQPH 4ZOEA 5LG1A 1IEBA 3MREA 2UVEA 1ZT4B 4C59B 1IQWL 2XTLA 2D03H 1RFDH 4JPKL 3VA6A 5F72S 2BOCA 3RI5F 5J1SC 4QRSA 1A5FL 1RZ7H 1QNZH 5GRZA 2DICA 4X0KB 4X6CB 1DN0A 1MVUB 1P6AB 4GO6B 3MOBH 1J1OH 4HKZB 3K46A 1S9XA 1XGQA 3T8XA 4IMLB 4L4VD 3CFEA 1E4KA 5C0AD 2A0LD 5JO5A 2ZWLT 1FZKA 3QHTC 3HNTL 4P2QE 2E6QA 4C83B 5CJOL 4XP1L 2VLLA 5ID1A 1NGXA 2EIZA 4L8DB 4ZUWA 4UOW1 2WWKO 4ZUVA 3UTZB 4RNRA 1IL1A 1LP9B 5FAAA 5MENB 2CUMA 1NLDH 4KRLB 1H8SA 4OIBA 5F1NA 1T2QL 3BSZH 4MSWA 3DURB 5C9JB 3A0OA 1A64A 1XGPB 4GBXA 3L7FA 3LQZA 4MAUH 5DD3L 4ALAL 2AK1H 2H3NB 4CNIB 1DZBA 3U9UB 4Y19E 4K3JL 4A6YL 4MQTB 3ZTJH 1MOEA 5A3IC 1MWAL 3ARGC 1JPGB 5CP3A 1B0GB 1NGQL 3GSXA 4M43H 5IV2A 3EDKA 4JGMA 4MA8H 2NY6B 4XNQB 1MY7A 4OF6A 5IHBA 1VPOH 4JRYB 3SKJH 5I1DA 1I1AB 4HZLB 3FONA 4OCYL 3MRMB 3ULVC 1RZKH 2YXFA 4CL7A 1E6OL 5DJCB 3FAXA 2P8PA 1CXLA 4YHLL 4YHMH 2EYSA 3RPKA 5L9DL 3RGVC 3QO0B 5CZXC 1JGEA 4PJIE 1NSNH 4XCEA 2JTDA 2GJ6B 2DM7A 1JN6A 4NFDA 2FIRT 2B4CL 2HMID 4NN6C 4F7TA 3ZE1E 1ZS8B 3KDMA 5DF0A 2VDLH 3NCJH 1YN7A 5GGVH 3EOBA 1Q94A 3HR5A 2W0FB 2ZUQB 4JFFA 3QEGL 4KTYA 3DXAE 5DUMH 3SOBL 2VDNL 2IFFL 4KAQL 2QKIA 3GKWH 2P49B 4D0DB 4Y8DC 3TCLB 2QQNL 5KN5B 1WWBX 3TNMB 2MMXA 1HHJB 1WIUA 4U7SA 2X4PA 4OFIA 1BOGB 4F3FA 2EYRA 3V6BR 5B39A 5J9PB 2X9WA 5E8DL 1ZWIB 2ADIA 4PGDA 3BRDA 4PRHA 3RL1B 1ZT7A 5SWSE 4POYA 3ZKMD 1XR8B 3I9GL 4UNUA 5L7XL 1EVTC 5F3BA 5EU3B 5EZIH 2D4DA 1OGAA 4WY7H 5E9DA 2YOCA 1IM3A 2ORBL 2JCCF 2HJLB 1A0QH 4ONGL 1I7UB 1CDUA 2X4NA 4HF5L 1TCRB 5DD5L 3TBTA 1LK2A 3KJ6L 5HTSA 5I8EA 4JGJA 4O02L 1E4XL 4RMSA 2FD6H 4LBEB 2ZG3A 3RBSA 1JWMB 3T1FA 3GSVA 1MFCH 3BJLA 4KVNH 2AJVH 1MFDL 4F33A 2VL5A 3WUZA 1Y0LA 3UJIH 3UTTA 5IW6B 1FHGA 3DGGB 3O3DA 3CVHB 3WJJC 3HRPA 3UJJL 3EYVB 4PJDB 1UWGH 3IT8D 2CKBH 4G7YH 3TYFA 3WFCH 1CBVL 3V4PL 4U49A 1WZMA 3K4DA 5SX5K 4YWGH 5CEZD 4EDXA 4ZUUA 4Q6IA 1IAIL 1GGBH 4I3SH 2C4FT 5M7QA 3BZFA 4X4XB 4FFZL 1FFOA 3P9LB 5IB2B 3DV4A 2GFBB 2ILLA 1C08A 3QCTH 4O51B 4YH6A 3CU7A 4EIGB 1F2QA 1FPTH 4I48B 4RGOH 4NQVA 2CMRH 5GS3A 1FNGA 1GZQB 2ITCB 3W0WD 1L9NA 1HHHA 1XZ0B 5E99L 4JN1H 1WF5A 2YRPA 3GMPB 3O6MH 3VXNA 2BNRA 2QSVA 4L8CA 1CLZH 1I7TA 2O5XH 5F71A 1DQDH 5EULV 1P2CB 2X9XA 1WT5A 3M1BB 1KJ2H 3QEHB 2ERJC 4XPHH 1CXFA 5KSAC 4O5LL 3TBVA 2ZKHH 4NP4L 2FO4A 4PD4K 1QG3A 1NUNB 1AKJB 1XFPA 4PGEA 3JWOL 4JFQB 3L3KB 3QXTA 1FAIH 5A3ID 3ARGD 4QHMA 3TM6A 3S96A 4PG9A 4DGIL 3QULB 3V7MA 3BYTA 1FN4A 3S9DB 4P2RB 4WI2A 4LPUA 3WEXA 4ZTPH 5IT2H 3RKPA 3BQUD 4G8GD 5SWQA 4EI6B 5C2BH 1P9MC 3ULVD 2YK1H 3GMLB 3R06B 2DQTL 3EFDL 4KKCD 2H32A 3CH8A 4WW2F 1LEIB 4ISVB 4PRPB 1MJ8L 1LO0H 3O4OB 5CIPH 1RIUL 3RGVD 3LD8B 1OPGH 4KVCL 2AJUL 5CZXD 2FATH 2EO9A 2WBJD 3DRQB 2WINA 5TPWH 1Z9SA 4MLSA 5CWSA 5EO1A 2G60H 4HEME 1GXEA 2P5WD 3P73B 2OJZH 2CIIB 4IRSC 3R4DA 1A6PA 5TDNB 4F9PC 2VLKD 3I75A 2D7OA 2UYLB 3MRBA 4ZXBB 5FYKU 1F3RB 5J57B 5EBLA 2P5EA 1JIBA 4F7EB 4QHUA 1TTGA 4KRPB 5D7JC 1U92B 1UYWH 1FCGA 4NYLB 5EUOE 1QD0A 3GFUA 3LS4L 3QYCA 2P8MB 1KG0A 1XIWB 4JEGB 5FYJL 3HG1A 1PQZA 4C4KT 5F7HA 2AEPL 1A21A 3UZQA 4KHTH 3EYQC 2CQVA 3U1SH 3WBDA 1MQ8A 2B1HH 3F6LA 1QRNE 1G7JA 3HHRB 3VFOB 2Z91B 2HWZL 4XVJL 5JXEA 3KNBA 3GJFH 2XWJB 3OJDA 3GM0A 4ONHA 2B4CC 5CEYB 3QCVL 4I0PA 4RA3A 2AXHA 2EDTA 4MJ5B 3SEPA 3OJVC 4V1DE 3UTQA 2FX7L 4JFOA 2G9HA 1KIUA 4NGHL 3RWFA 3JTTB 4DVBB 4FMKA 3T4YA 2V7HB 3NCYS 1AO7B 2AJ3B 4LRNH 4O2CA 4OUUA 1UZ8B 5DJ8B 1RJYA 3MQIA 2OI9B 4XP5H 1LO3H 4EQ2A 1HIML 2ADGA 2F53B 2OQJB 5DMIL 4Y2DA 3QQ4A 5TDOB 2VISB 1G7PB 4OZFA 1U95A 5HI4C 2R23A 3ZYOA 5CAYB 5DEGA 4CAGA 1I3VA 2AEQH 3F5WB 3IDUA 5C1MB 1FYTB 3KPRD 3MCLH 1ORSA 2ZOKA 4J3WA 4RIRB 4S0TD 1P7QA 3CMOL 3RTQB 4FQIH 4RRPG 1QBAA 3H9YA 2NY1B 3V4UH 4X9BA 4QRQB 1KBGH 1D5XA 2H9GA 2XICA 5DK0A 1U8IA 3UO1H 3MLPA 3M8OH 5I1AB 2GSIA 1FRGH 2K3TA 4ZNCD 3M17B 1HHIB 5F7DA 3WUWA 1T20B 1MQKH 1N7ML 2X4RB 4PLJC 1BFVH 5ALBL 3GGWB 4J6RH 5GRJL 4RDQG 3OKMA 4HPOH 4JDVB 5ICXA 3V6FA 1LP9E 1F4XH 4XXCC 2DQGH 3QUMB 4HD9A 1DANT 1UT9A 2HN7B 3ZTNL 4EZMA 5IMKB 4NKOB 1KGCD 5KSAD 3D9AL 3MX0A 6FABH 1AGEA 5JHLL 4NOFA 4Z6AT 1FC1A 2CXKA 1INEH 1VGKA 3MV9B 1JUFB 3PHOA 4XPBL 1DVFB 5HY9B 3P77A 1S9VB 1S7SB 3OGOE 1QTYT 2K7QA 2FX8L 1C12B 1BIIB 2EE6A 3PIQB 1IGJA 3IU3A 3NH7H 4XCNA 4JFZL 1ZVSB 4EBQH 3JWDH 3Q6GL 5T1DH 1A4JB 2WIIB 1FNEB 5CLWA 3IRZA 3PG2A 2A74B 5HYJA 1PZ5B 2ZUVA 5KTEH 2R0ZH 3P30L 4GW5A 5DI8B 4JRYE 2ZNWA 3MRGB 1CVRA 3TGXA 5GS0D 3D39B 5I1CL 3O6FA 5I71B 2UY7A 1LE9B 1H5BC 1CFQB 3ZDZF 2FSEB 5C0CD 5F9WB 5DRNA 5EO9B 1NAKH 4MD4B 4PYGA 2DWEB 3WHXA 2X10A 1RZJL 3G5VA 2BMKB 5K9JH 1WV7T 4G6KH 2H32H 1U58B 2M1KA 1T7VA 4YBQC 5ACZB 5F7KC 5FB8B 2A38A 4LAQH 4PJFF 1J5OL 3JWOC 3HFMH 5D2NB 3QIBC 4XCYA 4YGAB 1NBZB 5D7JD 4O9HL 1PSKH 3C08L 4YIQA 3QXDB 5E6IC 2EYTB 4HIEA 1JK8B 4OSUH 5AUMA 5GJSL 5TGBB 3FRPG 5FA3B 5J7CC 5J1AB 1SYSA 1KN2H 5JDJA 1TPXB 3ARBD 2VWEE 1EEYB 1Z5LA 1S7QB 4PJ9A 3UBXG 4NZTH 2FYYA 1RHHA 3I3EA 4X7EC 1TETL 1EBPA 4FABL 5F6HI 4PV8B 4PRID 2VUOA 2H6PB 1RUKL 3O3EB 3PJSA 5GS1A 4YNYB 5D7SH 4NN7B 4LEOA 3PGCB 2X4OA 2NW3A 5MI0C 1R3JB 3GMNA 1TVHA 3S98A 3WFEH 5D2LA 3ARUA 4QTHA 3WDIA 4KHXH 2KQMA 2ZPKH 1PLGL 5GRVK 1JF5A 4HUVA 2A9MH 4XRCB 1V3MA 1G7HA 1OW0C 2I60H 3HZVB 3KPQA 3RU8L 4PJDE 5C0BA 4JFHD 1EIBA 3GSWA 4LARH 1MIEH 2HKHH 3ZHKA 1ZEAH 4F57L 2XV6B 1M71B 4QRPE 2R8SH 2C3VA 5DC4B 1N0XL 3QDMA 4I2XA 5DTFB 5KVMC 1MFAL 3RY6C 1QLEH 3V0VA 3JZ7A 4KTEL 3PE9A 3ZT5A 1LK3H 4OLXL 1CDHA 4QRRA 4JQXA 1RZFL 3QAZC 5DZNA 3I85A 3FCTB 4ELMF 4JR9L 3KWWB 4MNQA 2FEEL 3GRWH 3P0GB 5IOPA 4XP9L 1UVQA 1ZAGA 1D6VL 1YEHL 35C8L 4U1HA 2I26N 1MJ7H 4FQPA 4YK4C 2FB4L 5IVXB 5K93A 3BZ4B 4U0QB 2DQIH 4HW6A 3AY4A 2CLZA 2Z4QB 3J7HA 2J8UF 4OZIB 1K8IB 4HZAA 3ZL4H 3H3KA 2RQ8A 1UJ3B 4CVZB 4XMLL 3T0VA 5DK2A 4RGMC 3BDYL 5KSUA 2D31B 2DQUL 3K4AA 3F7YB 4NQTA 1JI2A 5CINL 3WS6C 3QQNA 3V6ZB 4G43A 5TQ2H 4L4VE 5J11B 4Z78B 2UWEF 5C0AE 5D1QA 2IMMA 1DQLH 1R5IA 1H15A 4F80A 4HHAB 1YMMA 2F8VA 4PRPE 1U3HA 1JHTB 5E6YA 3SE4C 4F37K 3SY0B 3VFWB 1C1EL 4KZDL 3MNZA 3I6KB 1LO2L 3IJYA 4I18A 2FIKB 4TUJA 2XKUA 5ILTL 3C60B 1S78C 4RQQA 4YBQD 1YEIH 2X1XR 3FJTA 3SDDD 3KAAA 2PETA 1ND0B 1KJVA 1V3LA 2BVOB 5DFWH 3QIBD 2EH8L 2FGWH 4YC2B 2ATKB 3P0YL 3O11A 5E6ID 5IIEA 3EOTH 5T1LD 4L8BA 2Z93B 4FZ8H 2R2BA 5E8NB 3HI5H 3QQ9D 3HAEB 3QNZB 2NY3D 4NQEB 5E4EC 1NFIA 4TSCH 1F6AA 4OGYL 4EDWH 1E4KC 5JOFA 3P3YA 5EBGA 5I75C 1DTUA 2Z35A 5EU4A 5HHMB 2A6KB 5C0IA 4MB4A 4JO4L 2B0SL 4LGSB 3HKFA 2VRAA 4WFED 3OJ2C 3S3PA 1YEEL 5F3HA 1RZIA 1IGFL 3KYOB 1RZJC 4M93B 4I3GA 5J6GB 1IAMA 1E28B 3CK0H 1DQMH 2HKFH 1VADA 4WI5A 2C3WA 5IROC 1S7XA 4JO2H 3VXMD 1MREL 1T1YA 3UAJC 4G8FB 3LMJH 1CFTB 3DX8B 3A67H 2NTFA 5KS9B 4NJ9L 4J2XA 1EJOL 3FOMB 3D25A 2ZJSH 5BOZG 4LLWA 3PL6B 4NCDA 3KYAA 1TCMA 4XNXL 1J9CT 5FYJD 4DCQB 3BPNC 1FG9C 1LVEA 3LZFH 5J0BA 2FL5A 2JIXD 4YX2L 4OIAA 2YPKB 2NY6C 2XNAA 5TF1L 1J8HD 1ED3A 5CZVL 2BFVL 4X7TA 1VFBB 2HLFC 4HUXA 5EBMB 1OGTA 1NEZB 3TBSB 1J0HA 1VEMA 5JMRA 2RCSH 5EA0L 3U7YH 2HAZA 4LLDA 1GGYA 1KLUA 2ATPA 2R56H 3PP4L 3PGFL 3RA7L 3VCLB 5MEQA 4EI5B 5KVEL 3PHQB 4GXVH 1T1XB 4G9DB 2Y6SD 1IZJA 3VDCA 5DRWB 3EHBC 3PWPB 2V9TA 3SDYL 4FZEL 1ACZA 2VXQH 4OM0H 4MCZB 1FLTX 2OM5A 4PY8I 3CFKB 1EHNA 3IAGC 5IQ7L 2ZUQC 3RNKB 2A9NL 2BHZA 1T4KA 3CDFA 1OP3H 1SMOA 4LLQA 5HHOA 4FQCL 3O81A 2FX9H 1RURH 5IESL 1IC7L 5JIKA 1C16B 5CBEA 1AR1C 4LCCA 3IDXL 4P4RA 5DK3A 1UH4A 3WIIL 3PABA 4MXVE 5CEZE 4HH9B 4CUCA 1JBJA 1BVLA 5GGRB 4QRTB 2JJSA 3U9PL 5B3NA 5IMLB 4QTIL 2IADA 3DVFA 3PDOA 3WXVL 1NDGB 3GMMB 5CUSH 3GSUA 2P7TB 1OP9A 3M45A 4NNPL 4NQXB 4IHOB 4M9OA 1S78D 3NTCL 2GJZA 3ET9F 3I50H 3W0WE 3RZCA 4HIHB 4DKDC 3IFOA 1EO8L 2GK0B 1C5DA 4YPGB 4N0FA 5IK3B 3RL2B 1J88A 1DBAL 2BJMH 4K9EH 4UB0H 4WVRA 3L9RB 5DD1H 3T2OA 1OT2A 4PJEE 4HCRH 4U1LA 1T7YA 4NWUL 1DEEA 1F90H 2V5MA 1CDGA 2FJFB 1A1OA 4GG6E 2DWDB 5E8OB 4Q6IC 5ISZB 1S3KH 3CXDL 4Y5XB 1QBLL 2H26B 4ENEC 4GRWH 2YMXH 4GFTB 5CFHA 2O61A 3GZKA 4XB7A 5HDOA 2DM4A 2XG4A 3ULVE 5C0RH 5I18H 1M05B 4F2MB 2CIKA 3BHBA 4HXBL 1A6ZA 3U7WH 4Z7WB 1OCWL 1FZMA 3S35L 2F19L 1LDPL 3CPLA 1KEML 4ZYKA 5A2KH 2HFFA 1MFNA 4DVRH 3S36L 5F7YC 4OM1H 1CZ8L 2DIAA 3UAJD 1IKFL 4E41A 1V7NH 4MCYA 4HIIB 2MJWA 4KUCF 2OL3H 1ZKAA 3UC0H 3OGCB 2VLKE 2DI9A 2Y36L 4JCMA 4R26L 1Q9LB 1P6FA 3RDTA 1AD0B 5B3JF 3BKMH 3AC0A 3AREB 5SWZE 2Z8RA 2FECI 1R3HB 4K3EL 5DVKA 1D5BA 2X44D 4H0GA 4P59L 4PGBB 4DKFL 3MR9B 1KT2A 1HWGB 5TE4L 1VB9A 4Y2OA 2NY6D 5C0EA 1NCDH 1I1RA 2R2EA 3TO2A 3HC0A 1P1ZB 2EDJA 2GUOB 2IANB 3QEQD 2XWBB 3L3HA 5T3ZH 1NFDA 2B2XH 1L7IH 4LCIL 2NLJA 3CMGA 3JTSA 4F7CA 4KGLA 2YD9A 4ODWB 1JPFB 1G7IA 1QFWL 5I30H 1OAQH 1DUZB 4KI5F 3AS0A 5F1IA 7FABL 2EKJA 3EHBD 2EE2A 1RMFL 1WAAE 5KZCB 2CXGA 3HI1B 4U1KA 3SDXF 1Q9KA 4JM2B 5CJQH 3MZTA 1N8ZA 3MRLA 4P2YA 1BEYH 3E6FA 2EH7L 3QP3A 4OLYL 5D5MB 2Z8VC 3HE6A 1WWWX 5F7MC 1PKQB 5BMFH 3C09B 5CJ5A 2PYEB 3VFSB 2DLGA 4LIQE 5IVXE 1UZ6F 2VH5L 3MROA 3GHBL 3FN0H 5DRXA 4BK4A 4RAUA 1Y18B 4OZIE 5DYOA 4OLUL 5HDLA 5D8JL 1A7OL 1U8MB 1Q72L 4PRHD 1Z0MA 1AR1D 2QADB 4JPWH 3QJHA 4W4NA 1KJ3L 5D7IE 1ES0A 4WENB 1OAUL 5HPMB 5E24E 2LE9A 3KPRE 3BVNB 3RIAK 1OGAD 4D2NA 5E9DD 2C5DC 5AYUL 3P11H 5JXEC 1X5IA 3FQRB 3MJ9H 5CS7A 1NC2B 1I9JL 1P7HL 4OD2A 4ZSOB 4I0PC 5GIRA 2VXSL 5EN2A 5BQ7B 1A7NL 4NHCL 5DD6B 4M6NL 1TZHA 4JFDB 4BSWB 1BD2D 3TJEL 1P4BH 5MEOA 1XF5B 4L4JA 3JUZA 3VFTB 4U33A 4ZAKB 1JYVA 5FF6A 4X5WA 4PJ8B 3I2CH 2GTZB 1U9KA 5LGJA 3TA3A 3ZHLA 4PTUB 4M1DL 2CO6B 1KGCE 1K9TA 1HCVA 2X4SA 3WKML 1ZHNB 4R7NB 3TLRA 3LRGA 5E1AB 5C0NC 2VQ1B 1MAJA 5JLZB 3GIVA 5KG9B 5L2KB 3BKJL 4YEEA 1I3RB 5LBSH 1ZGLM 1G6VK 5BRZA 1JZ3A 3IDNA 5GPRA 2XQBL 4ENED 3K1KC 1G6RB 3X11B 4NQEE 1FZJA 1AGCA 1GGIL 15C8H 3MYJA 3S34H 4IM8A 32C2B 5LAXA 5C07A 2BP3A 5EO0A 3GB7B 3RTQC 4U4BA 3UX9B 1MRFL 1QVOB 2I07B 1CXKA 5LGHL 3P40A 4X5LA 1NL0L 3MBXH 4X83A 1MAML 3L3DB 3KHQA 1LO5B 2BSTB 1SYVA 2CKBB 2MPAL 4Z7VA 1T5WA 5HVGB 2BNRD 4PJGA 1T6WA 5IGXL 1JHKL 2UZIL 4LNRA 2F5BH 4NWTH 4PJBA 2COQA 12E8L 2VLRA 2OK0L 3MLWH 1VA9A 4JKMA 3H9SB 4TVSa 3DTXB 1X5XA 1OAXL 4F7PA 4Q58C 5B38B 1FNFA 2FNBA 5HI5D 2P46B 4G80B 1ITCA 4WCYL 2YPVH 3VWJB 4RISH 4HIXH 5EORL 5TH2A 1I1YA 1AKJD 5KVGH 1DVFC 3KJ4B 4W4OC 1FNSH 4Z7NF 3BP6B 3JWNC 3UPRA 3OKEA 1HINH 1MUJA 5EU6A 4JAMB 3OXSA 2AJZA 5GSVB 3ECBB 4K8RH 5FA4B 4RFOH 3L5XL 1FZKB 3VD4A 4WW1A 1EH9A 4QT5A 3VRIB 4U1IB 5EOQH 3HUJE 1EEZB 1UM4H 1JWUA 3MRCB 4GKZA 1KJ2B 4R6UA 1CFNB 5BZWB 5TJWK 1TJIH 4ZUVB 3JV6A 1NFKA 3NABL 1K5NA 4MD5A 3WFHA 3SHSA 1FDLH 3MLRL 5F9WC 4MXWH 1MVFA 3B9KB 4RZCB 4F7MA 3P9MB 3B9DA 2H41A 5C7XL 4Z8FH 4ZO9A 3TT1H 3HPJA 3DX9A 4P0DA 4R0LA 3PWPE 4QNPF 5HBBA 3JVGA 5FGCB 1RY7B 5CSZA 3OB0H 4HWUA 4YXHL 5CIPB 3MRFB 1UWXH 4YFDB 5D2NC 2HTKC 3C5JA 1MY5A 3GNMH 5HHVH 1N6UA 2BVQB 1FNAA 2CRMA 1I9IH 1DE4B 3BAEH 4YE4L 1EHXA 4JO3L 1J0JA 2YPLA 3T77B 2PTTB 1IBGL 4FQLH 4OQTH 2ZCHH 2CJUL 4XPGH 1X6LA 3GMOB 2FH6A 1A6VH 1NGWA 2ZZUT 1CF8L 1B4RA 3W39A 4JFHE 1TPXC 4XC1H 3WN5A 1WZKA 3A6BH 1MCDA 1B90A 1MCNA 5L88H 3MCKB 4BQ6A 2NNAA 5JXED 2HP4A 4GSDL 4LLMB 5GS1C 2FO1A 5GISH 4I0PD 1CLYH 5B8CB 1E6JL 1YUHB 4APQC 2WLZA 3G6AA 1CDJA 5DJ6A 5DJDB 4EXPX 3TH4T 4UAOC 3QHFL 3GIZL 4RX4A 4UU9A 1KCSH 3F58L 5B4MC 3BZEA 1GGCH 4LGRB 1A2YA 5FHAL 3JUYA 4AIOA 4U1MB 3SJVB 4M8QB 3W11C 3WXWL 1C5BH 5IHZA 4JDZB 4TNVK 2EIBA 4UT7H 1X5GA 3QDJB 1R3LB 1QLFB 2FEDC 4Y2DD 4JG1H 4Y16A 3IFLH 3FB7A 5C0ND 3GJFB 1GPOH 2BNQA 3AFLA 1WZLA 4HS3A 2XYCA 3DO7A 1MLBB 3EYUH 2F53D 4M5YL 2EYRB 4CVUA 4AEFA 5FYKE 2AGJH 4XVTL 1ERNA 4R96B 5H37H 1P7QD 2R29H 2OTWB 1B4JH 4S1QH 3RWIB 2QQKL 5F3BB 1HXMB 3RPIB 4CU6A 4YO0A 3DV6A 4HPYH 4K3GA 1QR1A 4QCIA 3ARRA 1I3GL 4FXGB 3MV7A 5FV1L 1T5XA 5E8EA 2FJGA 1H8NA 3JV4A 2WQ8A 4R8WH 2X4NB 1B0RB 3KVQA 3O4LA 4YBLB 4PTTB 4Z7WE 1M6OB 4MWFA 4UV4H 5DVNA 2VXTL 3FQXB 2D7TL 2IH3A 3PNWB 3DARA 3GSVB 4QRUB 4K71B 4NM8L 1XF2B 1UXSB 1BECA 3HC4H 2BVPA 4F33B 2YC1A 2AV1A 4UINL 3F7QA 3CUPB 3UTTB 4PJCA 3G5YA 3O3DB 3NA9H 4LPYA 4QF1A 4D94A 3ARQA 4XBGB 3VI4F 3BPOB 4H1LH 4WRLA 3X3FH 4ERSL 4S1RL 3DNKA 4LSRL 3EDDA 4YR6B 5IF0B 3MO1B 2VZVA 3MV9D 1FVCA 2F58H 4JY5H 1DVFD 4P2OB 3MV01 4DK3A 3QH3B 2J6EH 2GITA 4Z7UA 2ZUSA 5HYJD 3BO8B 1N6VA 2APBA 2EDRA 2KL6A 2D7NA 1FNLA 1NGPL 1IC5L 4FXLA 5BZDB 4DEPB 2ADJA 1G7QA 3BE1H 4P3DA 3V8OA 4Q97A 1HDMA 5J11C 4WFEE 1H3TA 2RFXA 3QCUL 4X6BA 3HPLB 5DDHB 5HYEA 3MRPA 4WEBH 3VXNB 1CU4H 1ZLWH 4LCUA 1BWWA 4I18C 1OQOA 4MD0A 4OBRA 4OFDA 3BOVA 3KPOB 5I73B 1F4WL 5KAQG 1N26A 4ZUTB 3V6OC 4C58B 1PG7X 1QACA 1FV1B 5I1IL 5AZEL 3RWJB 3TBVB 2AJXL 3VXME 2Y5TA 1TQBB 2V2WA 3PQYA 1KC5L 2BRRL 3MJ8A 3MOBL 1R5WB 1EV2E 2PUQT 5K9KA 4K7PL 3DIFB 2MFNA 1FN4B 1JE6A 4YC2C 1WLHA 3WEXB 3PP3K 4WW2B 5C09B 1D5ZA 4U3CA 5IUSA 2PYEE 4NKDB 5FYJE 1P7KB 2H8PA 5CSBA 2JB5L 1A9EA 1FVEA 3WYRA 4PJ9D 2H32B 5CCKL 4QXWA 5B39G 1CL7I 3I3DA 2R15A 3NCYP 3LV3B 1AFVL 1K4CB 4N8VB 1HCFX 4YZFE 4LASH 2VZ3A 3B3IA 4APQD 1TJHH 1TTFA 3INUH 5H8DA 1OAYL 1SEQH 5LXGH 2NTSP 1TZIB 5DMKA 4ZSOE 2PCPA 5B4MD 3BH9A 3OHXB 5I1KH 1EFQA 4MA3B 3RIFF 1XF4A 3W11D 2CK2A 4Y1AE 5ALCH 1B88A 3DMMB 2FEDD 3HI6H 3P4NB 5HDQH 5DMYA 5L6YH 1CE1H 4Y8AA 2G5BA 4FQQB 5FKPA 2AJYH 3MFGB 3PL6C 3HZKA 1NBVL 4TULL 5C0BD 2J3SA 4FQ1H 4LSUL 1X5AA 4J8RA 3B2VH 4XGZA 3DVNB 3LKSB 5L2KE 3QDMD 1W0YT 4YHZH 4OUOA 3L3GB 2XN9A 2CSPA 5E2UH 5B21A 1IILE 4CVXA 4HSQA 5D7LD 4EN3A 5ICYB 2DM2A 3OJDB 1VENA 4JZOA 5GGVL 4B41A 1AQDA 2XZCH 5A2FA 3ME0A 3RZWA 4PJIF 3T0WA 3G08B 5DUML 1BVKA 1JHLL 1A7PL 4MNQD 5I1JH 3RWFB 1IM9A 3ZE1F 1TITA 1YPZE 3H7BB 5JQ6L 2W9EH 3LOWA 3PWUB 5JDSA 4QO1A 4ZOBA 3HS0B 3LKQB 4X4YA 5CEXA 2AK4D 3MA7B 1WFNA 5D71H 1FH5L 2DKMA 3QQ4B 2ZG1A 1D6EB 3IVKB 5HHQA 4JDTL 1DN2A 3QG6A 5FO8A 1RUQL 4G9FB 1KPVA 3VH8B 2APTA 1U93B 2VDKL 2ZOKB 5JQHC 1NC4A 2QSQA 3P0VL 2HFEB 4LCCC 4M7JL 1JGDA 2J12B 1PG7H 1U8IB 4UILH 5F96L 2VDPH 3FL7A 1IC1A 2JJSC 1Z9LA 3KG5A 4ZMAT 1G6RL 4WI6A 5A1AA 1RIHH 2F74B 4X6FA 4OCXL 4PRAB 3LEVL 4YDLC 3CSYB 3FO9A 3UJIL 2W59A 5E8PA 2YUZA 1UM6H 4PP2A 2A2QT 3QUYB 3ABZA 3MMEA 2DLEA 1UWGL 5FHBL 5IG7B 3TWCH 4IS6A 5D7KD 1RZ8A 3PHOB 4ZTOL 3DRTA 2E8ZA 2FBJL 2F54A 1BZ9A 2PXYC 4QWWC 3RFZC 4HGWB 3UMTA 1QSEA 3RY5A 5HJ3B 3CGTA 4Y4HB 4BK5A 4X9FA 3WS3A 1GGBL 3HCVA 1IGYA 4N1CA 2APWA 3HZYA 4NUJB 4OLVL 3LN9A 5D9SA 5IHUL 1B9ZA 1JYWA 4PJAA 2GJJA 5JNYA 3S3SA 4RGOL 1U8OB 2HRPH 2W07A 3ULUL 3FFCB 3KYNA 3O6FB 4HT1L 4P46A 1QBMH 4FTVA 4LF3A 3Q6FA 1EEQA 2H45A 3E3QC 5EIVA 3MRNA 5HYSB 3FQWA 4LSSH 2JJTC 3DYMA 1DQDL 1IGTA 3QG7L 1KJ2L 3QA3B 4PJFB 4G7VH 5DJ2A 3VE0B 5A2JH 4QKXB 4M5ZH 4UDTB 4J3XA 1WWCA 2XTJC 3C8KB 2FCBA 1T0MB 2QR0A 1NQBA 3SKNB 1S7RA 5HPOA 2NCMA 5ICZA 4O58L 4JFFE 4NQDA 4HBCH 3CC5B 4HQQH 2DLTA 3RUGA 5IFHH 5DJZA 2C4FU 3HLAB 3LN4B 4PYHA 1UQSB 4LSVH 4ZTPL 2V7NB 4YHOH 5INCB 4I77H 2YK1L 4QXUL 3O8XA 4MXQC 1RJZB 3PWNA 2AJSL 3PL6D 1NKOA 2VQUA 2X7LB 4U6VH 3PUCA 1NCBH 3AREC 4XCCL 3MJ7A 2OMNA 3MOQA 4OZFG 1X44A 3J8F7 1JGUH 4WUKH 3AROA 3TN0A 1NCWH 3TO4A 2PW1A 4OZGA 5IMMA 3RX7A 5FM5M 3NFSH 1NJ9A 3H2WA 4PRHE 5J89A 2YD1A 4F8QA 1U3YA 2ESVB 5C71A 4M48H 3VFMA 2QBWA 4P23B 4PUBL 1OGAE 4FQHA 4AMKH 4HUUA 5E9DE 1FO0A 1CL7H 5ESVB 1C7TA 4ELKA 1H3VA 5IEKA 3WUWG 4MQ7B 4I1NB 1FFPA 2BK8A 2AVGA 3E8UL 1AY1L 2VO5A 2C26A 1IARB 4PJHA 3UYPA 4LEXH 4WI8A 1YNLH 4KQ3H 4PLNC 1UYWL 2B39A 4WDIA 1DDHA 4HUVB 3VFUB 1KB5A 4AIZB 1CWVA 4OD1H 3VFGL 5DJAB 4MDIA 5D96B 4DOHB 1RZKC 4RBPH 3UTTE 4OIIH 2ZUUA 4BUHA 4GQ9L 1KIQB 4LHUB 5HHOD 3KLAB 3PWVB 4KHTL 3MNVB 1IEAB 3SDCB 2VZUA 3C09C 5EUOF 1M1SA 3AB0B 3VA2C 3B2UC 5JA8B 2LQRA 1HQ4A 1MLCA 4CVWA 1EAJA 4R7DA 3QFJB 3TIEA 5F9OL 1VDGA 3KPMA 5L8JB 4I2XB 2WW8A 5DJ0A 3VD5A 1QSFA 4PRNA 3IF1B 2C1PB 4ELMB 3RRQA 3GSQB 4I5BB 3QDHA 5A16B 1PDKA 1R3KA 4Q2ZB 5DHYB 4F37F 4FFVC 3W81A 5F1OB 3VXSA 1PVHA 2NW2B 4OLWH 5H2BB 3MLSH 1VACA 1CD1A 5ETUA 3VXRA 4ORGA 1OAKH 5MEPB 3RZCD 3OF6A 2J8UB 1OB1B 1LE5A 2DQCH 2BNRE 3L3OB 3ULSA 4NSKB 3GK8L 1FLRH 3OZ9H 3TA3C 5ADPL 2PXYD 2GIYA 1MCPH 4QWWD 5LQBH 1S5IL 4TUOA 4NFBA 4NIKB 2YD6A 4ODTL 4XZUA 1QYGH 1F45A 3VXQB 4GG8B 3C5SB 1U6AL 4ODVH 5DK2B 5I1HH 1ZHKB 5C6TH 1UKSA 2WUBH 3REVB 3PV6B 1IC4L 2UWEB 4ZG1A 3MXWH 4PJ7A 3FB8A 4HFUH 3L3IA 4L3CB 5CLTA 3LIZH 3WLBB 3R0NA 1N2RB 3ZLQC 3LEYH 1UA6L 2V2TB 1BFVL 2CRYA 3CCHA 4LPWA 1U8QB 4MDJA 5BV7L 1CGUA 4LSQH 4HPOL 1YMMB 4ODHH 4YXKL 1F3JB 4X4ZA 2VJXA 3V5KB 4LK4A 4X99B 4WUUB 1JNNH 3L6FA 1CTNA 1S7TB 2EDKA 4IRJA 5LWYH 2GY7B 4RQQB 1INEL 2WBKA 4HS8H 1BZ7B 2XTJD 4XVSL 1MI5A 1U8JA 1LP9F 4YXLH 2XA3A 1KJVB 4Z5RB 3B5GA 3NH7L 4TTGA 4EBQL 2P5EE 3MGTB 5T1DL 3IU4H 1DQJA 2XFXB 4MXQD 4OF3A 4K2UH 1IMHC 4GS7B 1NFIB 2J4WL 3X12B 2E7BA 4NKMB 4O2EB 2OZ4H 4TSBH 5HGDB 4NO3A 5BS0B 5E2TL 5JR1L 5IJVB 2Z35B 1KCLA 2LABA 4E42A 1CE6A 5F7FA 3HG1E 1FBIH 3MBEA 3UTPD 2OL3B 4J3TA 2YN5A 3SBWC 1TXKA 2UV3A 3KPNB 4MZ3A 3W2DL 5EPMA 2PYFA 4NO2A 4GUPA 3GJEA 5J6HA 2ZSWB 3GHEL 1FORH 3VXPB 3MRQA 1FZOB 3O3AB 4FQXC 3S97C 3WIHA 1RZGA 1XGRB 1T1YB 3HFML 3QZWA 1L4IA 3Q3GA 3SDAA 2ZOLA 3T2NL 2R0LL 4PRDA 1JJUA 3ZDXE 2R1YB 3D25B 5KZCD 1MRDL 3U6RB 4PJXA 1I8MB 3JVGC 4N9OB 3V7AG 2A6IB 5JPNB 4JHWL 5FUZL 5GGSA 4YDIL 4CW1A 4YFLF 3MV8A 1EAPA 2WWKT 1NPUA 3BPLB 3B2UD 1G0DA 2WUCH 4G42A 4H88H 4Q0XL 1ED3B 3TNNB 3CFIC 4ZD3L 3MLYL 4X7TB 5A2LH 5F6IB 3LY6A 4CJ0A 5BVJA 3LKNA 4CRPA 1CFVH 2MCPL 2JF1A 2PW2B 3QSKB 4JQIL 1QA9A 1UXWB 1Q9OB 1XF3A 1ZA6B 2X5PA 1PEZA 3O45B 4H5SB 2I24N 3WFEL 3WL9B 2PKDA 2R4RL 4FFVD 2GQHA 5KSVB 1RHFA 1FFRA 3BYYA 3BWAB 3VRLF 3S37H 1LNUA 3UTSB 2A9ML 4OLZL 5H94A 5CP7B 2DQJH 2EKSA 1MHPL 4NJAL 2X4UB 1W8NA 4P5MA 3TA3D 4GAJH 4BA8A 4Z0BH 1EGJL 1JF1A 4JM4L 3Q48A 2DKSA 2OX5A 5E94A 3STLB 3CDGA 1R3IH 2IAMB 1GAFL 2V6HA 4E5XB 1AIFB 2R2HA 1MIEL 4FA8A 1CFSA 1ZEAL 1NAMH 5ADOH 2P43B 1QQDA 4YHKL 2R8SL 4M1GH 4U6HA 2YEZB 4JZJB 2HH0H 4AEIH 4PJDF 1QLEL 2HRLA 5I1GL 4M00A 2ZCKL 3GJFK 1ZE3C 3FFDA 1V3KA 3L95B 2O93L 3QUXB 4LLVA 5C07D 4G6MH 5CILL 4Z77A 4WU5B 1T83C 4BFIB 1CIDA 2EXYD 2GAZA 5E00A 5BXFB 4NO0B 4WNQA 3KPPA 3K8LA 2XZZA 3MRKB 3V5DA 3W9DA 1ZSDB 5T1KD 3NIGE 2VLJA 4NRYA 1WTLA 3Q0HA 1U2CA 1T21A 4CJ1A 3HZMB 3N1GC 4YBLC 2D2OA 2VLRD 2KQNA 4JFXA 2W60B 4L4TB 5IW1A 3C6SB 2NR6C 1RJLA 3OX8A 4XP4L 4YAQB 1XGYH 3ROLA 5K33A 5FEBA 5T1MB 3QWOB 4PY7A 4TUKH 5DJXA 3I84A 1CLOH 4UIMB 4NO5A 3U2SB 3TZVB 3VRJB 1W2KT 2BHYA 3FAWA 1Q1JH 1FCCA 1F6LL 2K9UA 1JVKA 5C08A 4R4FL 2G2RA 4OT1H 4EUPA 3ULUD 4P2OC 2WV3A 3FB6A 4XP6L 4H20L 4RFEB 2E9IA 2E27L 4NKIL 2O61B 2HT2C 5DWUH 1BWMA 3B6SB 2I25N 5BV7C 3QDGA 1TENA 4LPTA 1JNLL 3IKCA 4JZNB 1KLFA 2MQ3A 3BHBB 5GRXG 3V5HB 1ONQA 2HG5A 1RU9L 1A22B 8CGTA 4HWBH 2KBGA 4FQXD 1UKTA 4DEPC 4H26A 3FB5B 3LN5B 4NRZA 4E41B 5MHSE 4OCWL 4RDQF 4WEMB 1WFTA 1T89A 1MCOH 1YYML 1R0AL 1QFUH 3RY4A 3IDYB 3BH8A 3VXOB 4XH2A 3AAZB 2JELL 4QY8B 4V2CB 5D2LE 3WFDL 5I73C 1OAZH 5F89A 1KTDA 5FXCH 1A6WL 1XCTA 1J05B 1HKLH 2D3VA 1SBSL 4P9MH 4EKXA 3GDBA 5I17A 3IETA 4JKPH 2DL2A 4WW2C 2R2EB 4LVOB 1T7WA 4XAKE 5C0BE 1KTKE 5LVEA 1AXIB 3QUZB 2N7AA 1MCIA 5DQ9A 3UBXI 5DS8B 1B2WH 5IFJB 1D5MA 3ARDB 2SEBA 3BP7A 3FO0L 2V5TA 3QDME 4I2XE 3SDXB 2Y23A 4P5KA 3QIUB 4DAGH 3HC3L 1FO0L 5HHNA 1J0YA 2D0HA 1L0YA 5EIQA 4FFYL 4QRRE 4RX4D 5DXWA 5I8KH 3K4ZA 1U91A 4OZ4B 4MNQE 4CU8A 2J1KA 2Q6WA 2MHAB 3U4BH 5HDBE 3C2AL 3HE6B 1XMWA 4KY1L 4MA7H 3V7AE 4LU5L 1YC8A 3X14A 1R6VA 1KB5L 4UIKH 4NQSB 4PGCA 3SGDI 3IGAA 4JY6A 5DQJB 2BNQD 3GMRB 2JB6B 1JGVH 5ITFA 5SX4I 1I1FB 1YDPA 2HJFB 3NIDE 1J7VR 4LRIC 4YHYB 2P45B 5D1XB 4AK1A 3GSNB 1NCAL 2RCSL 4WU7B 5EZLA 4XNZC 3AUVA 4XBEL 4WTZA 5I76B 1VFUA 4NZUH 2NY0B 3RWEB 2VE6B 4NBXB 2AERT 1ZANL 3PWJA 3MV7D 2E9WA 4GOSA 2H2PC 4P3CL 4ZS7L 4DKAA 1WBYA 3I02A 2HVJB 4DKEH 5EN2B 3O4LD 4L9LB 2MCG1 2YR3A 1YMME 2WP3O 5JUEH 1G9MH 1ADQL 3E6HA 4HKXA 3VG9C 4GKNA 4X6DA 1F97A 2BY0A 1MIMH 1UCBH 1LD9B 2NR6D 1WIPA 2C9AA 4KZEH 4MS8C 4DZBA 1VSCA 1EXUB 4XPFH 4GRWE 3QIWB 4NQCB 5HYQA 2CLRB 4OZHA 4U7KA 3I6GA 2Q76B 4XMPL 3L1OL 1WFOA 3AMLA 4TVPL 2HLAA 5DZOA 2G75B 2Q7YA 5BRZB 1PEWA 1CD0A 4P2OD 4YDKH 1F8TL 5GSRA 4OCRL 1I8KA 5LAXB 4XTRD 2O5ZL 5C92A 1HHKB 2DD8L 4DWHA 4MXVF 5I74C 3HMWH 3RP1A 3IAQA 4D0CA 4OAWB 1RUPL 1QFWM 4H1LB 5CZKA 4D8PA 1OTTD 3ARPA 3I50L 3ALWA 2XRAH 2DYPB 3W9EB 2YD5A 1Q0XL 4QYOA 1IGCH 1S8DA 5TDPA 3TBYB 4PJGB 1CDBA 2XA8H 2GI7A 3FHAA 1F4YH 4ZOCA 2DQEH 5FECB 4PJBB 3L5WA 1UWEH 3GBMH 4X80L 1A1MB 2JJUA 5JHDA 3D2UA 3Q2CA 3S6CA 4BKLA 1MJJA 2OSLB 4HK0B 1HI6A 4ZPVB 1GC1H 3IDGA 3PQYD 3PWLA 2W65B 5E5MB 2EE3A 2H1PH 2GT9A 1I1YB 2NY5H 2YMXL 4WV1B 4PJEF 3OKEB 1FL3A 1SY6L 1M7DB 1BGXH 4OTXH 5HGGS 1LILA 4Y4HC 4AG4H 3MSPA 4QHLA 5FK9B 4BSJA 4GG6F 5C0RL 5J8OA 1KXQE 2NY4C 4G8GA 1ZGLA 3O2DA 3FQUA 4WGWB 3TH3T 5LKNA 3DUSB 1MJUL 1EFXB 2VITA 1SVCP 3IDJA 5HGHA 1N5AA 4ZFGH 3ULVF 3RGVA 4KQ4H 3T2QA 1PY4A 1MF2H 1G7LB 1V3JA 1YY9C 4RMVA 2P5WA 1Q8MA 1ZA3A 3H7LA 3BWUC 4HJ0D 3WIHL 3O0RL 4UTAH 2YSSA 4OV6F 3KPSA 1A7RH 4U1JB 3RVUC 3STBA 1E27B 2VC2H 1HQRB 5T3XL 5H37G 4XB8A 5HSFA 4Y5VB 3SQOH 3FO1B 5EUKB 4P5TB 3NPZB 1NCDL 1KCVH 1YZZA 3LDBB 3IS0X 43C9A 5HHOE 3TYGH 3CFCH 4YEFA 2AAVA 3KXFB 3U36B 3TN0C 1IT9L 4X4MA 2VSDA 3QDAA 5T3ZL 3VDBA 1GOHA 1YEJL 1JRHI 2XN9D 1VESA 3CH1A 4KPHL 3CLEL 5I15L 5L8LB 4U31A 3DX6B 3G6JA 1GRWA 4E0RB 1KJMA 2LAGB 1JMZA 3B5HA 5HGBA 1PYWA 3I3BA 2WBWB 4TQEL 4HDIB 2DBLH 2PO6B 1BBDH 1OT1A 5FKAB 4X7SH 4I0KA 4XNYL 3O6KH 3G6DH 1A1NA 1AGDB 2AXGB 3O3BB 1WAAF 1A2YB 5E0QA 4MS8D 3I6LE 5C8JB 5IHZB 5DT1L 4QXTA 1ZT1A 5IB4B 2VN4A 1W72H 4AEEA 4TRPH 3FB7B 1KULA 3DO7B 3D85A 1ZLVH 4P49A 4KH2A 5D96C 4Y4FA 1QPXA 5IVXF 2DDQL 2DLFH 1KNOA 1U3JA 2R0KH 1IQDB 4HKBB 1NC4D 5DQDH 3QUKB 4NZJA 2NX5B 3SGDH 3NFNA 3SDCC 1ORQA 1KIRA 3VGFA 2JLLA 4FQ2H 1O7VA 1AXTL 2NXZC 3MJ9L 4YO0B 2Y25A 5SX4H 1N4XL 3DBXA 4ODSH 5D7IF 4ZQKA 2QQQA 1AHWA 2F5AH 4JRXB 5CD5D 2XI9A 4FP8H 1NUDA 3F12A 4ZO8A 1BQLH 3JV4B 4K7FB 4ZFOB 4UT9L 1RK1B 1AXSB 4LLUB 5F9JB 2Y7QA 3E3QE 4YLQT 4UBDD 5EH1A 2K7PA 3D3VA 5CEZH 3UP1A 5HYFA 2Z31B 2IH3B 4U1SA 5TE7H 5J4MA 3QRGH 2E7MA 3IDIA 4CGTA 1S7UA 5I19H 1DQQA 3QHZL 1YQ2A 4E41E 1BF2A 3IDMB 4L29A 1X4ZA 4I9WD 2XTJE 5JOEA 4K7PY 1QSED 4LCWA 1Z0NA 1KFAH 4LKCA 4Z0XA 1HILB 4XWGH 3CSPA 3OKKA 2OR9H 2DTSA 4IOIB 4WI4A 4OD3L 4G5ZH 3EO0B 3FQTA 4POZC 3H9HB 3MPCA 1XCQB 4Z7UB 4Y4HD 2Y07L 3S34L 1EVUA 1YEKH 1YNKL 4HX1B 2NY4D 1KEGH 3S3JA 4N8CL 1ACYH 4EVNA 2VDRH 3WNOA 1A6AA 2DBJA 4MX7B 4MJIA 3FN3A 4ETYA 3FT2A 3T0EB 5EU7E 2RFXB 4JGUA 5C0CA 2J88H 1R5VA 1EK3A 2I9TA 2EIDA 4K9EC 5IQ9B 1H0DA 5JW4N 4NWTL 1L0QA 4HFWA 1NFDE 1YY9D 3MRDA 3ULVH 1PY9A 3O2DH 3ROOA 4IRSA 5L2JA 3GUTA 2JKXA 1I75A 4F9PA 1WBXB 2GTWB 4K3DH 4WJ5A 5F7WC 1U8HA 2R0WL 4C56A 2Y5TB 3BZDA 4HIXL 4XVUC 2BOBB 4JPVH 4NQDD 3RVUD 3S5LA 1MWAA 2FJHA 2IBBA 2XZAH 5IWLA 2VKXA 1U8PB 4Z95H 3HA0A 4WO4A 5FYLD 1UJTA 4BH7B 2YWYA 1H3PL 3RHWK 2A77L 1I1CA 5IMOB 1FVEB 3VXUA 1FVDA 3QPQC 3REWB 4P2QB 3TN0D 3TO4D 4KRMB 5INDA 1BAFL 4L3EA 3BGMB 5HGAA 1MFEH 1TMCB 3MBEC 3GSRB 3HUJF 1IGML 3OPZL 4UT6H 4Z7OE 3IXAB 5GGVY 3CFJB 4LHJB 3WD5H 5FUCC 4XNMB 3TCXA 3U46A 1WBZA 4PRIA 2AS5M 4KI1A 2ESVD 3B3IB 2VR5A 4Z8FL 4M62H 4PS4L 4QLRA 1CXHA 3ARFB 3TVMB 1S9KC 4Z76B 4Y19B 1BQHA 3DYPA 5F6HJ 3X13A 1DLFL 1QEWB 2NY7H 3CU1A 1SHMA 3UYOD 3OKNA 1JPST 1AE6H 1X4XA 1NBYB 3GNML 5ANMA 4FQLL 4ZOAA 1ZLUH 4KK8C 4OLEA 1MHCA 3K0WA 2X09A 4KJQC 3O41B 1ZLSH 5EIIA 3OR7B 4NQCE 2EEBA 1T2XA 4J8RB 3ZSSA 1G1YA 3A6BL 1FJ1B 4JLRA 3MLVH 1N6QH 1KACB 1LMKA 4XGZB 4HXAL 2ICWI 3SDCD 4UQ3B 1HHGB 5IW3A 4BZ1L 2NXYC 3IFNH 3EO1A 2NXZD 5BRZE 1IAII 3RAJL 1JNHA 3CIQA 1QSFD 1KIPB 3THMH 4CVXB 2OTPA 4RGNB 5F6IC 3DROA 1JGLH 3GSNL 3WO4C 5EDXA 1SJVA 3S88L 3OKLA 1JRHH 3VXSD 5F9AC 4MAYA 2YKLL 3OXRB 1YEFL 4NT6B 2A6JB 5IVZA 1YY8B 5E2VH 3DXAB 2FHFA 1K6QL 3L7EA 4LCYB 4I4WA 4AH2A 4CMHB 4JCLA 4PJGE 2WANA 2BNUB 5FCUH 1KN4H 1HZHL 2VXVL 5DEFA 4WTWA 3EYSH 1G7MA 3OKDA 4PJBE 2VLRE 2I9LB 3UCRA 4HUWB 4Y0GA 2VNCA 5DSCA 4TVPD 3OAUH 1LEKB 4Z7NE 1V7MH 2VN7A 2ICWA 4S1QL 4POZD 4EIZC 3AU1A 4CMMB 4JKLA 4YDJB 5SWSB 3O2VL 2IAMC 3ZKSD 4S2SA 1IQWH 3NFPB 4JY4B 3DO3A 4JPKH 5E08L 3DUUB 1WSST 1NGYA 4LKXA 1AI1L 3ZYJA 5EU6E 3P4LA 3HRZB 4Q9BA 3ULUE 6CGTA 4OKDA 3S4SB 2P8LA 5K9OA 2CO7B 1H5BA 3QUXC 3MLZL 5KANG 5IKCA 1M4KA 5LCVL 3H0TA 2LFGA 4HKJA 2GY5A 5ERWA 3N1FC 1ETZB 2VIRA 1CLCA 1BFOB 4DJMA 4PP2B 3HNTH 3F7VB 4WUUD 1MI5D 5CJOH 3MLTB 3MRHA 4XP1H 5GS0H 3FZUC 5AG9A 1HEZA 4XVUD 3IJSA 1QLRA 1WZ1L 1J10A 1HK6A 1AGFA 3QIBA 2GYSA 5KW9L 3FT4B 1JPTL 2C4XA 5T1LA 1T2QH 2FRGP 5D6DC 1IGYB 2V17L 3QXAA 5D9SB 1F02I 2R1XB 4M7LT 2FWOA 3NCMA 1SJHB 1RD6A 5DD3H 4ALAH 3OR6B 4KUZL 4K3JH 4A6YH 2YPLE 1SEBA 4ZODA 1NGQH 2NZ9C 3MBED 3QNYA 3Q6FB 1A14L 4GRLA 5EC1A 3MRNB 5L8KB 4WEBL 4GAYA 2GSGA 4IJ3C 4U7MA 5F93C 1IGTB 3C5ZB 4BJLA 4OCYH 2BXYA 2AV7A 1RSFA 2CH8A 3SGKC 2O5YH 4YHLH 5L9DH 4JFEB 5T3XD 2XT1B 3NBNA 3RUGB 5D6CA 2JK5A 1KUMA 3BKCL 5DJZB 43CAB 1PBYA 3O3UN 2B4CH 4K8RC 1QHPA 2FZ3B 4KK8D 2IGFH 1KPUB 2IQ9L 4KJQD 3MV8D 3QEGH 4RAVB 3CLFL 1OW0A 3MJ7B 2BNQE 3U4EB 2JIXA 3SOBH 4KROB 3B8SA 4HJGA 4XCFH 3VJ6B 2IFFH 2NXYD 2ZP0T 1A7QH 1GCFA 1J8HA 4KAQH 1R24A 5GS2D 5TE6L 2EIEA 1TJHL 3BESR 4OCSH 3QUZC 1KTLB 1FFNB 2A83A 2W9DH 4EOWL 4HUUB 4OFVA 5E8DH 1INDL 3ARDC 3ARVA 1NMCB 1YQVL 1RUAH 3I9GH 4YZFF 1F3DH 1WC7A 1FFPB 2OBGA 3PGDA 4NC1C 1FGVL 1JV5B 1CT8A 4BQBA 9CGTA 3B4NA 3O4LE 4PJHB 1Z9OA 2ORBH 5ALCL 4OGXL 3OB0K 2V2XA 1UWXK 5LGKA 4Q9QL 3VI4E 2X4QB 2A1WL 5MERB 4HF5H 2K1MA 1FE8L 2X4TA 4FMFA 4HC1A 5EBWA 5EUOB 5FOBA 3SQBA 3KJ6H 4PJCE 1OSZB 3MA9L 3MRRA 4P9HL 4O02H 1CXEA 4WFHE 5IM7A 1YNTB 4YUEL 1MFDH 4HMEA 1BFSA 4PY8J 1JTTA 4LVNB 3U79A 4GW4B 1QRNB 3MV11 3VFNA 2IF7A 1NLBL 3LH2L 4Z7UE 5ESQA 2LU3A 4FG6C 1ZTXL 1XH3A 3UJJH 1S9WA 3H3BC 4YHYC 3TBWA 1DLHA 4UUJB 1CBVH 3V4PH 3QQ3A 4RWHA 3QUXD 1HXYA 4ODXA 2NY0C 3OBAA 4V1DB 3VFRB 2VLJD 1IAIH 5DFTA 2W9EL 5FOJA 5KVDL 4FFZH 1QPPA 1MHHB 1CD1B 1VGEL 4L8SB 1NAMB 3T0EE 5GGUA 3MGOB 4L9LC 1GVIA 5IR1A 4QOKA 3W5NA 3FZUD 2EDHA 5CGYC 1YPZF 2CDGB 5EZOL 4GMTL 4P57B 3C6LC 3P4OA 1P4LB 4XPAH 4R2GC 1CR9L 4LVHB 5E99H 3DI2B 5C0JA 1ZT4A 1RK0B 3JXAA 4OF7A 5EOCH 3PQYE 1MCWW 4KU1A 5C08D 3QIWC 2Y1VA 4O5LH 4PJ7B 4X6CA 3FB8B 4NP4H 3QI9C 1MVUA 3CZFB 3JWOH 1Y6NR 4NKQB 3QDGD 1F4HA 2NZ9D 4HKZA 4P4KB 4J1UB 4IMLA 4DGIH 3IXTB 3D69B 3UJTL 1KLGB 1H9VA 1UM6L 2EXWC 4C83A 4IRJB 4ODUB 2OLDA 4JANB 3EFDH 4L8DA 3UTZA 5BCAA 5F7LB 4ODBD 5IROA 5IHLB 4IMKC 5ECJE 3IFPB 4BYHA 5MENA 3IB4A 1RIUH 5CKAA 4KVCH 2VR9A 3SE9L 2CDFB 3WFBL 3SKMB 1EZVY 1OF2A 4Y4KC 1T22B 5D1ZB 3N0PB 1CICB 3DURA 1XGPA 1GH7A 2EDXA 4XNUL 5I6XB 4CNIA 3U9UA 4LP4A 3KPTA 3E1F1 4MNGA 3AGVA 1JPGA 4UDUB 1B0GA 4X6EB 4WV1C 25C8H 2IG2L 5I8CB 1CE6B 1F11B 5ACLA 3FQNB 4XNQA 3T1WA 1P53A 4JJ5B 2RBLA 3LQMA 4JRYA 1T7XA 2WIMA 3T65B 1I1AA 4HZLA 3LS4H 3MRMA 4AQ1B 4IRZL 1ZLWK 5FYJH 2XN9E 5DJCA 3QEQA 2AEPH 4RGNE 3ARDD 3RWGB 5CGMA 3QO0A 2OP4L 1I7ZB 4N9GB 4N5EC 2FGZA 5E5UB 3EJZD 2GJ6A 1CQKA 4XVJH 2FEEI 3WIFB 1ZS8A 4HGKC 5KAQF 3K80A 4JB9L 5JXAL 2IPUG 4JHAL 4PJXB 4QHNB 3QCVH 3UZEA 5FM5O 4R90L 3WV0A 2W0FA 1A6UL 1P84K 5I1EH 2YA2A 2FX7H 4D9LL 3U30C 4NGHH 4LSTL 3A6CL 5CBAB 1MCKA 5AAWA 2QLVB 4KMLB 3EGSB 3SCMC 4D0DA 3BIKB 4NOBA 3TCLA 2QQLL 5KN5A 1ODAA 3BPCA 4FG6D 1SJEB 1HIMH 4YQXH 3TNMA 1KTRL 3LDBC 2LU4A 4FQJL 1HHJA 4L1DA 1IAOB 4LLAA 3UYRL 1BOGA 4DQOL 1X5HA 3BKYL 1ZWIA 2DLIA 3RL1A 1XR8A 2XPGB 5DA0B 4DW2L 4U0RB 5EU3A 4DTGL 3U0TB 3ILQC 1L6XA 4KQ3L 2HJLA 3HMXA 1YYLL 2HT4C 4GKSB 3G5ZB 5E6ZA 2PO6C 3ES6A 5D70L 5AWNL 1BD2A 1I7UA 3MTRA 1TCRA 3TEUA 2V5YA 5CGYD 3VFVB 3O9WC 4GKOA 1JF1B 1N7MH 3C6LD 5IBLC 5ALBH 4LBEA 5E94B 4P9HC 4DK6A 1SVZA 1JWMA 4R2GD 5GRJH 1TDQA 1T0NB 4GMSL 4U6XB 5JW3L 2F54E 5IW6A 4I9WE 3ARZA 3DGGA 1F4AA 1QSEE 3CVHA 4Y4FC 3EZ8A 4NRXB 3O2WH 3OAYH 3EYVA 3D0VB 3FT3B 4QRPB 5JHLH 3ZT6A 4G6JL 4XPBH 3QI9D 3HNVL 4NN5B 4PJAE 4WWKC 4F15C 8FABB 1KSRA 1AHWC 1K8DB 3P4MB 1T04B 4PG2C 4X4XA 1I9EA 4PLOB 3P9LA 4D0BB 4FTVE 4JFZH 5IB2A 3Q6GH 2GFBA 5F21B 1OAKL 2EXWD 1AH1A 4O51A 3EDFA 5KOVC 4I48A 4TPRL 4UOJA 1LGVA 5I1CH 5JIIA 4LPVA 1D9KB 1CGWA 5LQBL 1MCPL 1Q9WB 5D4QA 5C0DB 1GZQA 2ITCA 5IW1B 5JHDD 3OX8B 3QZWG 3D2UD 1CCZA 3GMPA 4ETQB 4Y4KD 1WFUA 3PV7A 4YGVA 2A73B 1WEJL 4Y88A 1P2CA 5JZ7C 3BDXA 4JFEE 1VCAA 3VWKC 1RZJH 2BC4B 4NO5B 5I1LB 4DFHA 3RUGE 1ZHLB 2P24A 4HWNA 3WDHA 1AKJA 3LIZL 4JFQA 3L3KA 2VXUL 2G2RB 1NANI 1J5OH 1X5ZA 3CFBB 5FYLE 1P84J 4JFYB 4L4VB 3OL2A 5I66B 4LSQL 5C0AB 3C08H 1BJ1J 4P2RA 5CP3H 1BHGA 5DUBB 5I8OL 4OZGE 5E4IA 3RWCB 3R06A 1N64L 4HS6A 2AQ3A 1LEIA 1JMXA 1S7VB 4ISVA 4HS8L 3T4AB 4J12A 2AABL 4YHIB 4YXLL 1BFTA 1OM3L 2FHCA 5AEAA 4N5ED 3V95A 3DRQA 1UM5L 4RMRA 1TETH 4PRBB 1XR9B 4NBYB 3O6LH 5JW4M 4FABH 1DL7L 4H25B 3BH8B 3KPSD 4TYUA 2N56A 4H8WL 1NUGA 5TDNA 4D9QD 5F7EL 1NCUA 5GRVL 4PJHE 2X40A 5IWLC 1NGZB 1NCCL 4X9GA 4G8IB 2UYLA 4WO4C 1TVBB 5IEHB 4F7EA 1CS6A 4M02A 5I17B 1MSPA 5C9KA 1HH9B 1FBIL 3BDBA 3SCMD 5JORB 1AD9A 1U92A 2CLVB 2A6DB 2E3VA 2P8MA 3EOAA 1Q0YL 5IB5B 2R4SL 1XIWA 4KXZI 1FORL 2MKWA 3TIDA 3BP7B 1AR2A 3RU8H 4U6YB 4GJTB 3WJLC 5FO9B 3B9VA 2VZSA 3VFOA 3ZSTA 1FGNL 2Z91A 2ZUWA 3FTGB 4F57H 5J13B 2HT4D 2XWJA 1N0XH 1MFAH 3VXSE 1S7WB 5JW4R 4WFFD 4M03A 4MJ5A 3O9WD 3TVMC 3VXRE 1EHLL 4KTEH 2J5LB 2E8YA 2Q20A 5IBLD 3RIFK 3ZDXF 2NMSA 3JTTA 3MXVH 3UZVB 4NZDA 4PGCB 2BVUA 2V7HA 5GQBA 4HC1L 1AO7A 4H88L 4JR9H 4JREB 1RIVH 3D85D 1UZ8A 5DJ8A 4G8EB 4XP9H 4Y4FD 1BX2A 1D6VH 1YEHH 1CFVL 3QEUB 4TVPE 3UBXB 2F53A 2OQJA 2FB4H 3EUUA 5TDOA 4PD4J 1PW3A 3N1MC 1MCBA 1G7PA 4WWKD 4EUPG 4DUXA 4PJ7E 1IAKA 1LO4L 4BZ2L 3F5WA 1FYTA 4O00A 2IC2A 1WUNT 4RIRA 5DRZA 4I3RL 3RTQA 4OJFL 3BGFB 4XMLH 1S9YB 1W72B 3BDYH 3R1GL 4JRXD 4MAYC 3D3VD 1WITA 2PF6A 1CIUA 2WQRA 4M7KL 4OFPA 2D7PA 5I1AA 5CINH 3H8NA 3DSFH 3M17A 4DN4L 4X6DB 2HJKB 1T20A 2X4RA 3NA4A 3V52L 4RBPK 1DBML 5GHWH 4JDVA 2LTQC 2HT3C 5KSBA 3MRJB 1MI5E 3LVEA 2HVKB 1KELH 4KDVA 2DN7A 3QUMA 1LEGB 2ICEB 5FYJU 4B50A 4LCWD 2HN7A 1C1EH 5IMKA 3VWKD 4CMHC 4GW1B 5K59F 4NKOA 3STZB 4KZDH 1LO2H 2M8XA 3MOAL 4K3HA 1FG2B 1MFBL 5ILTH 3MV9A 2QSCL 1JUFA 1DVFA 1J86A 1NMAL 4W4OA 5HY9A 5EB9A 5GRUL 1S9VA 1S7SA 5FFLA 1TJGH 1M7IB 4U1NB 5GSRB 3FRUB 2AXFB 1C12A 1BIIA 2EH8H 1I8KB 2MSPA 1YMHB 1X6NA 4JKKA 5JOPD 3D0LA 4ZUSB 1A4JA 4D0CB 2WIIA 1FNEA 3DJ9A 4HAGA 4MJID 5J56B 3WFZA 5FO7B 1PZ5A 3BX7C 1ZVYA 4XXDB 4U2ZA 5DI8A 3MRGA 3NCFB 3D39A 4OGYH 5F1KC 4GRMB 4MYWB 1LE9A 5EU5A 3U0PB 5MP6L 5EC2B 5ESAA 4PJ5D 3W0WB 1CFQA 4LSDA 3NIGF 5FUCE 3NACL 2FSEA 4IRSD 4NDMB 2Q1EA 3G5XB 5DZLA 5EO9A 3CX5K 4JO4H 4MD4A 2B0SH 1QFWI 4JVUA 1T66C 4C56D 1YEEH 4NPYB 2L7JA 2BMKA 1CLOL 2V9RA 5AYQA 3UPAA 1IGFH 2EE9A 4PJEB 3IDGB 4ZNEA 1U58A 2VDML 1Q1JL 1SMAA 3BD5A 5ACZA 3VGAB 2WMPA 5FB8A 3ARGB 1I4FB 4GG6B 3ARWA 4WO4D 4PJXE 1MREH 5GGSY 1UC6A 5D2NA 4Y5YB 1A4KB 1NBZA 5IB3B 4JHBA 1NMBL 3QXDA 4K23L 3RNQB 3RVVC 2EYTA 4UQ2B 3VXUD 3ZKXB 1EJOH 1JK8A 4D3CL 3BQUB 1I8LC 2H2SC 4HWZB 3MV8E 1MCFA 3FQUB 5TGBA 3EYQD 4L3ED 5FA3A 3BW9A 5J1AA 2E5EA 4GRLC 5JA9A 4XNXH 5ID0B 1NANH 2G5RA 4HWBL 1EEYA 1S7QA 3S36X 4YX2H 3EJYC 5C0FB 2WBJB 5TF1H 4KDTA 5CZVH 2BFVH 3VRLE 4NN6B 4APQA 5KJRH 2PN5A 3MUGB 3C5ZC 2H6PA 2DQFB 1FL5B 3O3EA 1EEUA 1IFHL 4YNYA 4H8WC 4LQFL 3FOLA 2VLKB 3SKOA 5EA0H 2X41A 3BN9C