2C3XA

Structure of iodinated cbm25 from bacillus halodurans amylase in complex with maltotetraose
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
93
structure length
93
Chain Sequence
TDITIYYKTGWTHPHIHYSLNQGAWTTLPGVPLTKSEYEGYVKVTIEAEEGSQLRAAFNNGSGQWDNNQGRDYDFSSGVHTLADGRILSGTPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Carbohydrate-binding module
molecule keywords ALPHA-AMYLASE G-6
publication title A Structural and Functional Analysis of Alpha-Glucan Recognition by Family 25 and 26 Carbohydrate-Binding Modules Reveals a Conserved Mode of Starch Recognition
pubmed doi rcsb
source organism Bacillus halodurans
total genus 20
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03423 CBM_25 Carbohydrate binding domain (family 25)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c3xA00
1DBJH 4X7DC 1FG2B 3GKWH 5MEQA 5D1ZD 1YA5A 5D7JA 1CFSB 5FCUL 3BPCA 3QA3A 3QO1A 5JNYA 3FO2B 3OJMB 4P2RB 4XMPL 4MQTB 2C1PB 1PGRB 4XC1H 5BOZG 4N0FA 4MQSB 2AQ3A 1CD8A 2XNAB 4G43B 3OKOB 2DYPA 2B4CH 3F6IA 3AY4C 4FQLL 3RIAK 3DX6A 4ETQB 5AD0B 3ESUF 2ESVE 4Q2ZA 5EOTA 3ZKMD 1EEYA 4ZTOL 1IILE 1K5NA 1DQDH 2AP2A 1Y6NR 4ONHA 3MRPA 3BPNC 4ZPTB 2IG2H 1MIML 2HT3D 4TNWK 4HKBB 4UTBH 5I9QC 2HWZL 4JFPA 1X5GA 2HT4D 4NN6B 3VGBA 4Q9QL 3D69A 1OAQL 3G5YA 1U95B 2BVOB 1HKLL 3NFSL 5FYJH 1AXSA 1MWAH 4LK4A 5IGXL 4NZUL 4RMQA 4ZOEA 4HWUA 2A1WL 3DMMB 4LPXA 4U1MA 4YJZL 1UB6B 3D39B 1RK1B 5I18L 3SDAA 2H1PH 1X5IA 3OKNA 5CINH 5AG9A 1T20A 2P8MB 3K4DA 4TVPD 3P30L 2JIXA 5DJZB 3B9KB 3STZB 5EIIB 3VRLF 3P4OA 1S7XB 1FAIH 2NY4B 2IC2A 2RGSA 1CR9H 4IS6A 3PV7A 1HDMB 3QUXC 4HIJA 1I8KB 1MOEA 4FTVE 5KSAA 1FGNL 1J8HE 3LVEA 3OKKA 1P2CB 2OLDA 4G8FA 4HH9B 3P4NA 2R2HB 5D5ME 2VDPL 4QXUH 1CFQA 3QCVL 5IVOA 4MA3B 5JDSA 5DJ2B 3MOAH 1L9NA 4OFPA 2XTJB 5DUPH 3AREA 1XF4A 2AXFA 2R15A 3EFDL 4P48A 1Y6MR 4BKLA 3QI9D 3HKFA 4U6TA 5IESH 1S7WA 4OKVA 1F97A 1G9ML 1ZAGA 4JFXB 5E7FA 3SDDA 3N06B 4LARH 4NQDB 1ZSDA 2YSSA 2ZSWA 3DROA 4LVOC 5D71L 1I75A 5D1XC 5EUKB 1MWAA 4RISL 5I19H 1HILB 4PGEB 3CMOL 4YDVA 3QHTC 4LSVH 3QQ9D 4MYWB 4JZOB 3VFVA 1C5CH 1ZGLM 3A6CL 4OFYD 4YDLB 2D31B 3F7VA 4L3CA 3OKDA 4ZXBA 5IB5B 2AQ1A 1FO0H 3KPQA 4XPGH 3QUKA 4J3XA 3NACL 3IU3A 1UWEL 4GT7A 3AC0A 2I9LA 5D93B 1WAAE 3QIBA 2BY0A 2BJML 4XBEH 2VDKL 1AO7A 4JO4H 3BWAA 1GC1H 2BHZA 4L1DA 2H6PA 3DUUA 5H94A 2DRUA 2PXYC 8CGTA 1I85A 3ARBC 2QLVB 1CLZL 1W0WA 1X7QA 4NOBA 4Y4HC 5FUZL 1DVFC 2BSED 1HNGA 3G5VB 3SQBA 2N7BA 5B4MD 3WUWG 2OR9L 1MCWW 1QTYT 4U1KA 3SBWA 3ZT5A 1OAUH 3JV5A 4MXWH 1AGEA 3E2HC 3DV6B 1QQDB 4P4RB 4ZOBA 4H0HB 3PP3K 4W4OA 4WW2F 5CGYC 4KY1L 5TPWL 4W6XB 1G0XA 1NC4D 5I1KL 3RU8L 1U3HA 4EDXA 4GAGL 2R1XB 1UH3A 5K9KA 4TVPE 5B38B 2DAVA 2HFEB 5LGJA 1R3LA 2I26N 5D6CB 2DLGA 1PYWB 1S9XA 5ICYB 2DQEH 2HJLA 4M6ML 1KJVB 3D18A 4TUOA 4DW2L 3RX5A 3C87A 2DTMH 3K80A 4JKLA 4CBPA 1A7PH 5K9JL 1FO0A 2ED8A 4O4YL 3ZT6A 4PJ8D 1NANH 2EKJA 4H8WL 2V6HA 5DUML 2CMRL 1NGWB 3MMEA 3QT2A 3C60B 3QRGH 4JFDA 5DVMA 3RWCA 5E08L 3MO1B 1KLUA 1RHHB 1F2XK 2EO9A 4EVNA 4ZUSA 5KAQF 3QUYC 5ADOH 4QY8B 1CF8L 1J7VR 1U58B 4ZO9A 2GSIB 4PRPA 1EO8L 4OCRL 4G6ML 3MBEA 3BYYA 1IGTA 4NZRL 2LV4A 2BDNL 1BVKA 2VZVA 3X3GL 3ZDYE 1FN4B 3F58L 3NIFF 2IFGA 4TUKH 3BZFB 3UZQA 1A4JA 1HQRB 4MAUL 4NT6A 4X8JB 3QQ4A 2FD6H 1A5FL 4LLYB 1ZLWH 4M7LH 4AT6A 5GRZA 5EULV 1E27B 4X80L 5I1DB 5CBEA 1FVCA 4PJXB 5DDHA 1FL3B 1BLNB 5CS7A 4LSTH 1YN6A 5ID0B 1EEZB 1FFQA 5E4EC 5D7JC 2BRQA 1JMZA 1YJDL 5DFTA 2EDKA 4RX4D 5FGSA 5CFHA 5D7IA 3BKJL 1F4WH 4JANB 1FZMB 5FUCE 4WI8A 1FZKA 1LGVA 1A7NH 1SJHB 1OM3L 3SO3C 1EERB 1VEPA 2IAMD 3BDYL 4Z18A 1U6AL 3B9VA 4XB7A 5T1KD 3IFNH 3WLWC 1VEOA 3FFCB 5D2LF 1FORL 3G08A 5HGGS 2WP3O 1OAXL 2FEEL 5JW4R 2FIRT 2WIIA 2ZZUT 3L3IA 5MEOA 4Z78B 3GUTB 2H8PA 3MLTB 4JLRA 1HKFA 1MRDL 1MPAH 2GK2A 5I1HH 1ODAA 1QSFB 3AUVA 5ALBH 1F8TL 1FPTH 2C4FU 3MQIA 2HN7A 3RL1A 2ICCA 1Y18B 1FYTB 4R4ND 1AJ7H 3GMMA 1MREH 2AABH 5DS8B 5GGVH 3L7EA 2VQ1B 4UBDD 2DJUA 5DJXA 1JWMB 3EUUA 2EIZA 4Y89A 5ILTL 5I1IL 4OD2B 3SCMB 1KJ3H 3PIQB 1J5OH 3TT3H 3CVHH 3SDAC 3RWJA 1V05A 4YIQB 5MP6H 2VXUL 1FZJB 1JIBA 3BDXA 2DLTA 5I6XB 4UDTB 4R2GD 3MV11 4L8DB 3LH2H 5IW1B 1G0DA 3DJ9A 4MQXC 4IBLT 3LIZH 1JNLH 2J8HA 3FONA 5ELIA 3ZHLA 1EGJH 1T22B 4G6FD 5SX5K 5CHNB 5KSAC 4GSDH 2B4CC 1Q9WA 1P7QD 1GOGA 2R1WA 1I7RB 1X9QA 4ZUVA 3G5XB 3P40A 2D7TL 2LAGB 4PV8A 5FA3A 4NRZB 1JHKL 4F2MA 1U42A 4BSWB 1IZKA 4O5LL 4NQCB 4S1DD 4KXZI 4MB5A 4UAOC 3VGFA 5AZEL 3SJVA 2ZPKH 3WMSA 4M00A 5L2JA 3PL6A 3AREC 3T4AB 4X5XA 4NIKB 4G9FD 3R1GH 5CMAA 3SDDC 2NY1D 5FM4A 2XRAL 1BEYL 2ARJB 4W4NA 4X6DE 3NZ8B 2Z31A 4FZEH 2F74A 1D5BB 1U9KA 4S1RH 2QR0A 3NCBB 3O3BA 3FQXB 5HI5C 1X5ZA 3CVHA 3BQUD 5DI8A 1IGJA 4ZXBC 1QSEB 3MLXH 1IKFH 3KYAA 4UQ3B 2BX5A 4GJTB 4KV5F 3U9UB 3IFOA 1MCOH 5JXEA 4AYFA 1R0AH 3QIBC 1T0PB 4NM4H 2VLLA 2CLZA 5GGSY 2Z93A 5E8OA 4ZO6A 5TQ0L 2BVPA 1I85C 5DSCB 4LLMB 1EGJA 1N3NA 4ODVH 1NL0L 3MZGB 5J57B 2V5SA 2BCKB 4NC2B 5IB3A 1SVZA 4FQ1L 4KC3B 1MCQA 4APQD 3NFNB 4M8QB 4QNPE 3P9LB 3PDOB 1DANU 4NRXB 1W0YT 5EOCH 3SBWC 5FO9B 2GAZA 2P5WB 4I1NB 35C8L 5DEZA 4P99A 5FF6B 2WQRA 4W4OC 1F58L 1V3LA 3UTTA 3DIFA 4K7PY 1LO0L 3IJSA 2X9XA 3OJ2C 3MV9D 1ADQL 1QA9A 1U3HC 3EOBA 4QTHB 1DQTA 2E7HA 2AV1B 1ZLVK 4ZSOE 5L2KB 3V0WH 3O9WA 2A6IB 1RUPL 3QNXB 1KG0A 4PRIB 4KZEL 3JWDH 3RL2A 5DTFA 4R4FL 4HIIB 1K2DA 3SKOA 5E94A 1UXSA 5DD5L 5CP7B 1NC2D 2Z91B 5K59F 1CK0H 2DJ4A 4JO3H 3V7AG 1W8NA 4L8SA 1J1PH 5INDA 3BE1H 2EZ0C 4YNYA 2SEBA 3DNKA 3HE7B 1GHFH 4PY7B 1JZ3A 5DJCA 3CFKA 3RAJH 5I15L 3QAZC 1IEBA 1DUYB 3RJQB 3OKYA 2EKSA 2XKNA 4POZD 4MJ2A 2ZUWA 3CIQA 4OFKA 1R5VA 2DQCL 5MERA 3FOLA 2C1OA 4ELME 1UB5A 3B8YA 4G9FE 4XVJH 5DJ0A 3GO1H 4WFED 3MBEC 4LPVA 5SV4A 1T1WA 3IGAB 5HGDB 1IE5A 2AK1L 3LN5B 3ARGD 4WNQA 2E8YA 1HQ4B 4K3DL 2Z35A 3F7YB 4YHZH 5DMKA 1MEXH 5SWQA 4HK0A 1HXYB 1MVUB 1YEEL 3AMLA 3ZKXC 1YEDB 1U93B 5DUBB 1MHCA 2VE6B 1WFTA 4Y16B 3GMQB 3AU1B 3OGCB 3H9ZA 3GEWB 2DKSA 5B8CB 1XF2B 2CUHA 3ZMRA 2FO4B 1R3JB 4ZOCA 5IBTH 4D9LH 3L3HB 4Q9CA 3QDMA 3Q5YA 1U36A 5DHYA 1MRFL 3ARDA 1CLOL 3ZL4L 1J1XH 3G6JB 5J0BA 5E70A 3PWLB 4LLWA 2WK2A 3REWA 3OX8B 4I5BA 1WBZA 1AD0B 5HTSA 2F8XC 4KH2A 2X4UB 1YQVL 1SJVA 1D5ZA 5C0GA 2QQKH 5GSVB 2VAAB 1DCLA 2VLJB 3VA2C 4Y4FD 1IGYA 3V0VA 5C0DA 1EBPA 3HN3A 4NNXA 3BKYH 2Q8BL 4XBPB 4LSRL 3CFBA 1BQSA 4F7CB 2A6DA 3G9AB 3MV9E 3OXSA 4ODUB 2DS4A 1N64H 5HHNA 5BRZB 4RGMB 4M1DL 1BGXH 4ZO7A 4B0MM 1NMCC 3TV3L 1X3DA 1BQHA 4PTUA 5INCB 4X6CE 4OB5H 2E9WA 3BH9A 4MDIA 3U1SL 1KT2B 1T80A 4U1GC 4Y5XA 4Z5RA 4V2BA 3HC3L 4P5MA 3VXTB 1F4HA 3LSOA 3U7AA 4URTB 1AGFB 1K9TA 1CFBA 1JCKA 1RJZA 4CVWA 4WIQA 2VO5A 3GSNL 5I71B 3RZCB 4DK6A 1WBYA 4XC3H 4JFFD 3WN5A 4PJIF 4Y5YA 4FFVC 1G1YA 3GMOA 3EYOB 1KJ2L 4DZ8A 1ZTXL 4WFEE 2ICWB 4QHLA 5D1QB 4OCLC 2C3GA 4WV1A 1SYVB 1YYLH 4JPKL 4OZIB 4PRHD 1N4XH 5HJ3B 5FV2A 1E6JL 1J1OH 1RJLA 2QKIA 1S7QB 4P5TA 5GXBB 1MAJA 4XPBH 5GZOC 3V4PH 1OWWA 3BRFA 1FNLA 4YX2H 5DRWA 4G6JL 3VMOA 3I3BA 2IANA 2R29H 3PL6C 2BVYA 4KHXH 1O0VA 4ODTH 3W0WB 4HQQH 4I9WD 1GGCL 5EU7E 5ICZA 4X0KA 1SVCP 4TSBL 4LFHG 1QBBA 4NQVA 2DQUL 5C9JB 2HTLC 4WHCA 3Q3GA 3V9FA 5E8NA 5I8EA 1J87A 4UQ2B 1JGEB 4NZDA 1QP1A 1NCDL 3RVWC 5JR1H 3U9PH 3CFJB 5CILL 1VCAA 2V5TA 1D9KD 1ZVYA 4JR9H 5J89A 5DEGA 3MLUL 1F2QA 2GT9B 5JXEC 3E1F1 5E8EB 4FZ8H 4DN4H 2Y6SC 1YNTB 1U2HA 3HS0A 3MROB 1ZA6A 4PJHA 3DBXA 1U0QA 4UT6H 4PG2A 1BD2B 3VFGH 5I9QB 2C4XA 5C0ND 1CD9B 4OCYH 3QXTA 5GSRB 4NJ9L 4XPHL 1N0XH 2E27L 5DD0H 1Z0MA 2GY5A 3GB7B 5F1KC 3S35L 1K6QH 5GRUH 2Y06H 3MRMB 2KZWA 5FO8B 3VFTA 4GRLB 4BSVA 5KAQG 1BFVH 3WNMA 3G5ZB 4TOYH 1G7MB 5T1LD 5JZ7D 2QSVA 3QI9A 1DN0A 5L7XH 3WUZA 2NY5H 1N59B 5EZOL 4FA8A 3K4AA 3QDGD 4IIQB 5A3IC 3EO9H 3VXPA 1X4XA 5EG6C 5DQJA 1S78D 1NCTA 1U8NB 3LRHA 3VFUB 3L7FA 4R97B 3MREA 3O8XA 3O9WC 2IH3B 4JFFE 4OF0A 4BK4A 2E7BA 2GTZA 4WRLA 5MEPA 5I73C 1JN6B 3QUXB 5IBUG 3G6AA 3OKEA 3S96A 2HKFL 1D6VH 3L3DB 4L8SC 2Y9RT 2HJKB 3JV0A 4PRHE 1O7SA 2ZG1A 2MPAH 1BIIB 4TRPH 3O45B 3K0WA 4OUOA 4S1SL 5DHXB 4RQQA 3AS0A 4LCCA 3BPOC 4FQHB 4ONFL 1B9ZA 4I9WE 3GSXA 4LQFL 1KELH 3LZFH 3GM8A 3NIDE 2X1XR 5JDJA 5D1XB 5E2JA 1CGWA 3B2VL 2PTTB 2PYFB 4NYLB 4D2NA 3LCYA 5I1EH 1X6LA 5I1LB 5E1AB 3ZYJA 5C2BL 2FBJH 2YN3A 2UZYB 5EWIH 2VR4A 3C6LA 5GQBA 3J7HA 1KN4L 3VXOA 4DN3H 4AG4L 1LNUB 1XF5B 4GG6F 1TZHA 1J18A 4KI5D 1NCCH 3Q6GH 3UMTA 5J1AB 4UTAL 3BP7A 1LP9F 3JWDC 4ZTPH 3OMZA 4NQSB 3WCYA 2PXYB 1JGVL 3MRFA 3ARBB 1NKRA 4J3WA 1RZIA 4Y4HB 2VL5A 3ARDC 2V7HA 1DVFB 3TLRA 2OZ4H 4XPTL 4PJ8A 2Q86A 2XOTA 5C0AA 3MSPA 2X1PA 3A67H 3V6FB 4TSCL 3VE0B 1DN2A 4LF3A 3IDXL 3GSRA 3N1FC 4PJAA 2B5IB 3O6MH 4CUCA 3E2HB 3TBTA 4G9DA 4CMMB 5IQ7L 4F33B 4U1JA 2YXFA 3NCYP 3QDGE 3PABB 3UX9B 5CSZB 1KC5H 2OS7A 1IAMA 1ZEAL 1Q8MA 1UKSA 1CDJA 1EHXA 1OARL 1UYWH 3WV0A 3U0TB 5IMOA 3NMEA 4HMEA 4OZHE 5IHLB 1QRND 3CLFL 5KVGH 2PYED 5TE7L 3BP6A 4PBXA 5EORL 4R6UA 4Y5XC 4F37K 3INUH 1U8OA 3BD5A 3TPKA 3UP1A 1B4JH 3HNTH 4OV6F 5BO1L 4FQJH 5CP3H 4XB8A 3TYFB 3GJFB 2BSTA 1YUHB 1YC8A 4GKZB 4UU9A 5FDYA 1RMFL 3U0PA 5JORA 4Y7MA 4AZ8A 3TWCH 5KANG 1KBGH 1R5WA 4JGUA 1X5LA 1LE5A 3WN5C 2D3VA 1A7RH 3QUYB 1UT9A 2VABB 4P2QA 2YMXH 4YBHA 4Y5YC 2OZ4A 1TTFA 2IAMA 5LGKA 1QO3B 2BERA 2VXTL 4HUMB 5D72L 1INEL 3SDXE 4M9PA 5J4MA 5I1AA 4WV1C 5KZCD 1TTGA 2D03H 2X4RB 2WANA 4UNVA 1PKOA 3MV7B 4UV4L 1HINL 4P5TC 1H0DA 1XAUA 3UAJC 3BEWB 2XZAH 4LHUD 1AD9A 1I1AD 3P9MA 1KCRL 1CDUA 5MEQB 2XN9A 3T0ED 4KI5E 5D7JB 1KPVB 1DBBH 3BPCB 3QA3B 2EIBA 3QO1B 5JNYB 3TPUA 3SPVA 3QPXH 3BGFC 3SY0A 5DRXA 1MRCL 4N0FB 3LEVL 3ULVH 3TF7C 1FFRA 1XCTA 3C5ZD 3LV3A 1NFKA 1II4E 4JN1L 3SO3B 3WNKA 2DYPB 2WSKA 1JI2A 3MUHL 1J0YA 3OF6D 1RI8A 1AR2A 2CDFA 5I75C 3DX6B 3LHPH 4KK5C 1IGMH 1MNUH 5EO0A 5EZLA 4Q2ZB 1JGDA 5EOTB 5M95B 4M48H 1EEYB 3I6KA 1IC4H 5A2FA 3LKQA 1YQ2A 1K5NB 2FDBP 4ONHB 4EBQL 3MRPB 1SHMA 4K8RD 1NUFA 1P7QA 4PG2C 3W9EA 4AH2A 3EO1A 1CLYH 5HGBA 1IAIM 4LSSH 4OFDA 3T65A 4JFPB 1HIMH 1YY8B 2J2ZA 3LS5L 2MQCA 5TE6H 3W81A 3D69B 2NZ9D 1QRNE 3G5YB 5EU5A 3QIUB 2PYEE 5EU6A 5HDLA 1WIUA 3LMJL 5AAWA 1AXSB 5B39A 2ZG3A 1KOAA 2O26U 2YR3A 2M2DA 2VLKD 5KVFH 3RVTD 4OZGF 5TJWK 3SDAB 3OKNB 2NX5D 1T20B 4HV8B 5IV2A 1EHAA 2JIXB 1TCRA 3N1MC 3O8XC 1R3IH 3EDEA 3P4OB 1FNHA 2DQGH 3MTRA 1NKOA 3C8DA 2Z8WC 3EJZC 4JJHA 4P2YA 4IS6B 1KB5H 4PG9B 4HIJB 3NH7L 3F62A 5ETUA 2VKXA 1CU4H 5HHQA 3OKKB 3RX8A 4G8FB 1FDLL 3I3DA 3P4NB 4KTEH 5TF1L 1CFQB 4WI4A 1TETL 2X4SA 4JJ5A 5JDSB 4UAOB 43CAA 4PY8J 3BESR 3VU2A 3AREB 4HF5L 4LPUA 4XGZA 1XF4B 5F88A 2BHUA 1MIMH 2UZXB 5TDPB 4BKLB 4DEPC 4LCCC 1S7WB 5GRVK 1S5IH 3W9DA 3T0EE 1FH5H 5E5UB 1PKQA 1SEBA 3SDDB 1C7TA 5T5NF 3CX5J 3CXHK 1ZSDB 2YSSB 3DROB 1OAYL 4AEHL 1CXLA 1MWAB 3WDJA 4EI6A 4YDVB 1OAKL 5C70A 1LO2L 3VFVB 1YY9C 2NY5C 3C6LC 3F7VB 4L3CB 3OKDB 4ZXBB 3PGDA 4YXKH 3KPQB 2VIRA 3QUKB 3IU3B 3NIGF 2I9LB 2ZUVA 3QIBB 2PO6D 2C3HA 1AO7B 2O5XL 3BWAB 4HS8H 4EOWL 3V4VH 2H6PB 3DUUB 4FHBD 5H94B 2QSTA 1PLGH 4LL9A 4HFUL 1KB5A 1CGXA 1W0WB 1A6WL 3RWDA 3W82A 1X7QB 2DLIA 2WUBL 5ISZD 3T04D 4OLWL 1WFUA 4XMKL 1J0HA 3CX5K 3HB3C 4U1KB 2VDPH 1CFTA 3ZTNH 3QCVH 3QSKB 3VXRD 1AGEB 4XAWH 1DL7L 3KHQA 3WS3A 3ARPA 2VLKE 2RIKA 5GS0H 3LQZA 5BV7L 1RIVL 5LWYH 1U3HB 4EDXB 3CXDH 2NX5E 4MJ5A 5K9KB 3BDBA 4YZFF 2JK5A 4RMWA 4KGLA 5LGJB 1R3LB 3RBGA 1A6PA 1S9XB 3HFMH 2HJLB 3CMOH 3UTSA 3D18B 3MPCA 4GMTL 4TUOB 4KROB 4KJWC 2J5LC 1T03H 2VH5L 5HDOA 1T6VN 1FO0B 2VN7A 3HC0A 5DVKA 1KSRA 4L4TA 1Q0XH 4N1HB 2DQTL 2IBZY 3FKUS 3DYMA 3MMEB 3QAZB 5CEXA 4EN3D 2BJMH 1EJOL 1JFQL 4JFDB 4LASL 3RWCB 5IMLA 1B2WL 1KLUB 4MJIA 4EVNB 3ZDXF 1UH2A 4ZUSB 4X9IA 4JQIH 1HSAA 3AM8C 2X42A 2A0LD 3MBEB 5CWSA 1IGTB 3WEXA 1HZHH 1BVKB 3QXDA 4YAQA 2M8XA 3O4LD 4PB9L 3V6BR 4BELD 1A4JB 4NT6B 3O6LH 3GJEA 4QGTA 3QQ4B 1Z9MA 4F3FA 4G8EA 5FYLD 4KY1H 5HI4D 4AT6B 2VUOA 5EZJA 5I1KH 3ZKXB 3TZVA 3CMGA 5CBEB 1FVCB 1T7XA 4GAGH 2AJ3A 3ZKNC 5DDHB 5L88L 3L3JA 1FHGA 1FZOB 1OT2A 1YN6B 4TNVF 1NGYA 5IW6A 2Y36L 3D3VD 1CVRA 3DGGA 3O3EA 3OR6A 4R0LA 2WBJA 1QSZA 4L3ED 4LIQE 1U8PA 1AXTL 5D7IB 3MOBH 2KDGA 2Z92A 3TN0A 4XCNA 4MD0B 1NAMH 5EU3A 4QWWD 4DW2H 2F58H 4OIIL 1FZKB 3QB7C 2ZCLL 1CZ8L 4O4YH 3WL9B 1BVLA 4N9GA 2CMRH 3PWJA 4TTDD 2F8OA 3B9DA 3VXRE 2N7AA 3VRLE 4KQ4H 4Y2DD 3G08B 3MLYH 5ALCH 1KCVH 5IVXA 2WIIB 3L3IB 5MEOB 1QKZL 2H8PB 3DYPA 1CF8H 4M02A 3CD4A 1EO8H 4ZS7H 1CGSL 4NZRH 2BDNH 2CK2A 1GIGH 3U6RA 1VACA 2J1KA 5DD1H 3RL1B 2HN7B 3TO4B 4KVCH 1U8HA 1X4YA 3UZEA 2F5BH 1QPPA 4IOIA 4UIMA 3L7EB 3H3PH 1JPTH 1NUNB 4U1GB 5FOBA 5KG9B 3B6SB 3KLHD 1U8KA 5DJXB 3ROLA 1KNOA 2EIZB 3I50L 1VENA 2ZNWA 4LSUL 2BHYA 3QG7H 3VD9A 4A2LA 4E41A 3RWJB 1VSCA 1E6OL 1GRWA 2A83A 3BKJH 3IETA 4ZOAA 5C0CD 3L3GA 1NAMA 3ULVC 4NHCL 3FONB 1EDQA 4Q58C 1OM3H 2Y5EA 1PDKA 2MKWA 2R1WB 3BDYH 3O4LE 4ZUVB 4WU7A 2YD9A 4PV8B 5FA3B 4Z7UF 3S98A 1FORH 4ONGL 4F2MB 4KJPD 5I8KH 4MS8D 1EMTL 2FCBA 5DJYA 4G7VL 3RVUD 5FYLE 4J4PA 1G1CA 1WZ1L 4BYHA 5L2JB 4ZD3H 3O3AA 3PL6B 3RDTA 3QDJD 4X5XB 2HTKD 4ZG1A 3D3VE 3WXVL 1JTTA 1M05A 4L3EE 4FQIL 2X09A 1MCIA 5CMAB 4TTGA 4DVBB 3WUWA 4L9LA 4X8XA 3ULUL 2Z31B 3U48A 4D0BA 2F74B 4DVRL 5DWUL 2QR0B 3IAQA 1JF1A 3O3BB 2KQNA 3WNNA 3DXAA 1UJ3A 3EOTL 1FNFA 4I13B 3C8KA 3NPSC 3CVHB 3V0AC 5DI8B 1IGJB 2CD0A 2X1QA 4LSPL 3T2NH 4NC1C 3QFJD 4LGSB 3IFOB 3T0DA 3L6FA 4AIZB 5DGRA 2VLLB 2CLZB 3C9NA 2Z93B 1RZ7L 5E8OB 2ZSVA 2BVPB 5B3JF 3WKNA 1N3NB 1RK0A 5ADPH 5IB3B 1HHJA 4YHIA 1CBVL 4O02L 1N6UA 4JKKA 5GIRA 3TP4A 5EA0L 5DA4A 3IXTA 2GAZB 3GZKA 1HXMA 2BY3A 3DETC 1ERNA 1X4ZA 2NR6D 3H42L 3UTTB 3DIFB 1BMGA 3IJSB 3RUGF 2AGJH 4K7PH 4CVXB 4YFLI 2Q6WA 1I3RA 1IT9L 4UOJA 1QA9B 3EOBB 3NCMA 1E4XL 2NXYD 2D9QB 2QHLA 3IFLL 3NIFE 4G6AD 2XRAH 3O9WB 3QXAA 4LPCA 1G7IA 1KG0B 1T66D 4YDKH 3IDIA 5FAAA 5C0CE 3RL2B 5DTFB 2OTUA 1J88A 1VHPA 1K2DB 3ARFA 4WTWA 3HUJA 5E94B 3SKOB 1UXSB 1T83A 1SY6H 1U91A 3RY6A 3U0WL 4L8SB 2VZOA 5INDB 1WCBA 1SEQH 4XPFL 3MXVL 2SEBB 4YNYB 1DDHA 2H2PC 5DJCB 1CTOA 2VUYA 3CFKB 1M7IA 4LDLB 1IEBB 1NANI 2GJ6D 2EKSB 1FAKT 25C8L 2XKNB 2RB8A 5C08D 3QDJE 2FWOB 3BPOB 2V2TA 4I2XA 1R5VB 5MERB 2I60L 3FOLB 2C1OB 4H0IA 3WJJA 2WQ8A 4MCZA 1UB5B 1KTKE 2X89A 1YPZF 4FQ1H 4P57A 2ZUYA 4IMLA 4WI3A 1T1WB 4KK9D 5C1MB 4RMVA 4HWEH 4IRZL 2W9EL 4WNQB 35C8H 2YA2A 4Z0BL 2Z35B 3H9SA 3S6CA 1Q0YH 5DMKB 1IM3A 1ZLSL 3UTOA 5SWQB 4HK0B 4MAYA 2WUCL 4YFDB 4KMLB 5GS0C 4U1NA 1I4FA 5HVWA 2DJSA 1M4KA 1G9NH 1CTNA 2WWKT 4NWTH 3TZVC 12E8L 3WFDL 1JZ5A 5FGCE 4OV5A 4HDIA 3ZYOA 4R0LC 3QWQB 1D3CA 2WBJC 4JG1H 2GUOA 3CH8A 5KSVA 3AXLA 3QDMB 4R4FH 5C0BD 4FFYL 7FABH 4I0PD 5DHYB 5HHVH 3TN0C 1AKJD 1SY6A 4BA8A 3UYRL 3ARDB 4X6EA 5E4IA 3NAAH 3PWUA 2DLFL 1F00I 1XEDA 3GMLA 3LRGA 4LKXB 3REWB 4I5BB 4PJGA 5GS2H 4GXUM 5ESQA 4BQCA 3OKLA 5C0GB 5E8PA 1EUUA 4I3GA 3RKDD 3TJEH 2CO6B 3V0VB 4RSVA 5C0DB 4NNXB 3SE9H 3CFBB 1TVDA 5DT1H 5F7YC 2A6DB 2VLRD 3OXSB 3MLSL 1KF9B 5HHNB 1FVDA 4GRWE 4PJ7A 2VRAA 4NQEA 1RJYA 2ZWLT 3C2SA 3EDJA 1BQHB 3DRQA 4PTUB 2XWTA 3CSYA 3BH9B 3KDMA 4CJ0A 4MDIB 3IKCB 5D7SL 5E2VH 3DTXA 4Y5XB 4Z5RB 5CUSL 4P5MB 3QG6B 3LSOB 5T5NG 1C5BH 3FO0H 4RMUA 1DLFH 1QR4A 1RU9L 2VZSA 5DO2C 4P49A 1RJZB 5ACZB 1AC0A 1WBXA 4UV7L 4YHKL 1KCSL 2GJ6E 3IB4A 2FEDD 1NBVL 3WN5B 5C08E 1UCBL 1MRFH 3CPLA 1C16A 3PJSB 4Y5YB 3ZL4H 1DQML 3FB7A 3GMOB 1TNMA 4DZ8B 4QHLB 4M1CC 5FUOL 3ZZ1A 2V2XA 4KV5E 4OQTL 4WV1B 1ZLUH 2K9UA 1WTLA 1CDCA 1RJLB 4X5LA 2QKIB 4P5TB 1MFBH 4WUUD 1WCQA 2ADJB 2B7DT 3TO2B 4J4PC 1QEWA 2FECL 4QT5A 3IDUA 4LSRH 2R0ZH 3C2AL 5DRWB 1L6ZA 2IANB 3RDTC 5FKAA 5KBNC 3MRJA 1AIFA 1D6EA 4BQ9A 4QRRA 4Y8DC 3O2WL 3FHAA 5A43C 2GJJA 2BNRD 4WU5A 3PP4H 3GBNH 2IFFH 5ICZB 4M1DH 4P59L 4X0KB 5CJBA 1Q9KA 3BGFB 3TV3H 1UCTA 5C0BE 5GRJH 4L9LC 5CEZH 4NQVB 3Q3GB 4M6NH 3VWJA 5E8NB 5I8EB 4PYGA 4RGNC 2CK0H 1X5KA 4LCIH 4TN9A 5HYSG 1UJ3C 2OTPA 4KQ3L 3WIHL 5I75B 3PHQA 4GXVH 3MC0A 5HXMA 3JUYA 5DEGB 1YJDC 2VXVL 3KYOA 2F19L 4HJJH 1OCWL 3O11A 4JRXD 2IPTL 2VDNL 2C9AA 3UC0L 4OCXH 5BW7A 3HS0B 2YD3A 4PJHB 1MAKA 3DBXB 2VLRE 5K59E 3WIIL 1J11A 4P3CH 1ZTXH 1NGZA 4GUPA 1AQKL 4BQ6A 3VFTB 4BSVB 4CJ1A 3BIKA 4Y5VA 3MCLL 1S9VA 1EA9C 3QI9B 1DSFL 1DN0B 2B1AH 2L4OA 1T7VA 3I9GH 5FFLA 3QFDA 4KJQC 3VXPB 1TJIL 3X14A 2J8UA 1UVQA 5DQJB 3L7FB 3MREB 3O8XB 4BM7A 5F7LB 5HYJD 4QO1A 1HH6A 1INDH 4HLJA 4R4BA 4NKQB 2GTZB 4GKSA 4XCYA 5MEPB 3ARFC 4NKIL 4HHAA 3G6AB 1T83C 4Z76A 3OKEB 2A77H 4NO2A 3S96B 4PGZA 3RY6C 4WCYH 4PJXF 2LTQC 4XMLL 1WZLA 3RWEB 2DDQL 2CLRA 1UZ8A 1C1EH 4B41A 5GGTH 2W38A 1QACA 4HFWA 2ORBH 4WUUE 2YA0A 3GI9H 2VDOL 4F7PA 3LKSA 4RQQB 3OAYK 1OSZA 4LCCB 3HA0A 5F97E 5D4QA 1ZWIB 1BQUA 3GSXB 1AP2A 3L3OA 3WJJC 5F7KC 4JY5L 1HI6A 3VXUD 1QG3A 4IOFC 2APVA 4ORGA 4P9HH 3QEHA 1U8JA 1KFAL 1K8IA 5C09D 4GQ9L 4PJ9D 1ZGLP 3X3FL 2ITDA 3C6LB 4H20L 4MAYC 1JRHI 1FLRL 1ZANL 5DJDB 4MHHI 3VXOB 2NY7H 5F7DA 5KSUA 2MTPA 1TZHB 3MXWH 3GNML 1EBAA 4YWGH 1QR1B 4U7SA 1MAML 4JRXE 5BVPH 1FE8H 3DX9A 3BP7B 3K3QA 4N90D 2EDOA 1RSFA 5D8JL 2OM5A 3MRFB 5C0IA 3D85D 4XBGA 2QHRL 1RZIB 2VL5B 2ZUQC 1T04B 2Q3AA 2QQNL 3CFEB 2V7HB 2HKFH 5IBLC 5FYKD 2XA8L 3FZUD 4PJ8B 1JE6A 2CLVA 2V5YA 5FECA 1P4LA 3GMRB 4LF3B 1JPST 5GGTA 3ARQA 3GSRB 4HUUA 4PJAB 2R9HD 3REVA 2HJFA 3TBTB 4G9DB 4DFHA 2W59A 4PJIE 3UJJL 5GS1A 1UM4H 3ALPA 1Q9OA 1YEKL 5EBGA 1CGUA 1T4KA 4GBXD 4G8IA 4U1JB 5DMYA 1QFWH 3KVQA 3P0YH 4D0CA 5GHWL 3BZEA 2EE9A 3QUZA 3VXMD 4NOFA 2FNBA 2IBBA 2FR4A 1NCAH 2BMKA 5IMOB 4RBPH 4X7SL 5HYJE 1IEAA 3SE3C 5LGHL 2CRIA 4LCUA 1VFMA 2R4SH 2CKNA 4PPTA 3IRPX 3BP6B 5C2BH 4DCQA 2J5LB 3AS3A 3QEGL 5JIHA 3MACH 5DVLA 1U8OB 5JO5A 1G9NC 4CDGC 3MGTA 5FA4A 3G04A 2XZQH 3L5WA 1MF2L 5D5MF 2BSTB 2EXYD 4UILH 4UU9B 5IHZA 5L9DH 3U0PB 1JWSA 5JORB 4KTDH 4RA3A 2W92A 3VCLA 4PJEE 1CXKA 3OZ9H 3V6OE 1EO7A 4OF3A 1XZ0A 1R5WB 3QCUL 1LE5B 2DI9A 4PREA 4MB4A 3CDFA 1IAII 5D70H 2XYCA 4F8TA 4P2QB 3RY4A 3Q6FA 2IAMB 3D9AL 2VYRE 4MA7H 2GJZA 1MFDL 1MFEL 1CFVH 3PQYA 3VXUE 1ACZA 4P3DB 3PXHA 4TSCH 4CVUA 5J56B 5I1AB 3IDYB 2AJXL 1DQLL 5C09E 1Z6JT 1I7ZA 2EDEA 2X1OA 2OBGA 3I02A 1H0DB 5IQ7H 4HJ0D 3QIWA 2R8SL 4P9ML 1DBJL 2YPLA 1AD9B 3GKWL 3P9MB 3KPMA 5AWNL 2XN9B 4N90E 2YRLA 3SPVB 4L4VA 3R8BB 4XC1L 5FHBH 3SY0B 3NABH 5DRXB 1I3GH 1VADA 3CLFH 4V1DD 4BH8A 2EC9T 4KPHL 2J6EH 2OK0H 3VWJC 1NEZG 4YR6A 1XCTB 5HHXL 5EORH 1JGUH 3LV3B 5FYKE 3S9DB 2B4CL 4JFEA 4DOHE 5BO1H 3MNVA 1VKXA 2VLMD 2CDFB 2R23A 1FL5A 4F57H 3QR2A 4M7ZC 5C0CA 1IFHH 5EO0B 3PWPA 5EZLB 4PBWD 1JGDB 3I6KB 1IMHC 2GY7B 3D1MC 2QADD 2IG2L 5BW7C 4UT7H 4IJ3C 3MYJB 4ZFOA 3ZSTA 4UTBL 4PV9B 1P7QB 3W9EB 5HGBB 4AH2B 3EO1B 2IADA 5ICXA 4H88H 3VXME 3T65B 3WFBH 3HAEG 2VXTH 4N0CC 1BPVA 4O2EA 3OG4B 3K7UA 5EU5B 5FYJL 5EU6B 5IB1A 5CZXD 1MWAL 1SMAA 4Y5VC 5B39B 3WYRA 2R2EA 4XI5C 1T7WA 5B3NA 4CADA 4JDZA 4XP4L 1N2RA 4LGPB 1URLA 1KCRH 1ZVSA 5CINL 1KXVC 3VW3L 4Z0XA 4OUUA 4U0RC 4XNUL 5D2LA 5IV2B 4HK3N 4ALAH 1DBKL 1TCRB 1FAIL 2YRZA 1MRCH 2J6EA 4Y88A 3MBXH 1CR9L 2C3XA 4LOUD 1GGUA 4C58B 1QBMH 5ETUB 2O5YH 2E7LA 5D7LA 3WFHA 5HHQB 4EI5A 3BGAA 3KAAA 4OGAD 3RBSA 4GW1B 4QXUL 1LP9E 2NPLX 2X4SB 3MOAL 4JJ5B 1OGAD 5DEFA 2FL5A 3EJYC 5DUPL 4EBQH 3CVIL 5F88B 1T21A 4XGZB 1YECH 5IESL 1ZHNA 4TSAL 3QH3A 2PW1A 1HHGA 1G6RH 2R1YA 5IB4A 3W9DB 1KYOJ 3VXQB 4Q74A 4LARL 1PKQB 1SEBB 3LS5H 1RUAH 3RWFA 3EGSA 4V1DE 2V2WA 5I19L 3LMJH 4LSVL 4EI6B 5IFJA 4KKNA 4N5EC 4NN7C 1TZIA 4PJFA 3ZHKA 1DLHA 2VLME 3NPSB 1FO0L 3KS0J 4XPGL 3PGDB 2VIRB 2FB4H 4XBEL 4EXKA 4G42A 5SX5H 3WJLA 1GC1L 3BHBA 3HI6H 1PVHA 2A2QT 3Q1SH 5E8DH 3RVVD 4XT1C 1NC2B 4GW5A 1KB5B 3RWDB 3NH7H 2KZ1B 2W91A 2EICA 4J3OC 5D96C 2NY3C 2JELL 2NQCA 2R2HA 3PWVA 2FLRT 4L8BA 1OAUL 2OJZH 1V7MH 5I1CH 5EZIH 1CCZA 4QOKA 2BSSB 4YGVA 1CT8A 1KTLA 1YNKH 5GS1C 3WS3B 2LU3A 4CDHA 3P0VH 1RIHH 1G6RA 1OTSD 2UWEF 5IHBA 4NNPH 3S36L 1A2YA 3RA7H 4MJ5B 3QUZC 4HUVA 4OZ4A 4Y0GA 4LP4A 2JK5B 4P9HC 4KZDH 1K3ZA 4JM2A 4AEHH 2IPKA 3EYVA 2DQEL 5FYKU 4JZOA 5E6YA 2DTML 1T89A 1QLRA 3BJ91 4FABL 3NBNA 1A7PL 4FG6C 5EH1A 2GFBA 3LD8C 4HWZA 1A4KA 1S7TA 3MUGA 1HEZB 1F3RB 4L4TB 1M7XA 5DMGC 4QHUA 5CEXB 5C0BA 3QRGL 1OGAE 4I0PA 1X44A 5I8CA 2EC8A 5IMLB 2BXZA 4YHPA 2DLEA 4MJIB 4HFUH 5EPMA 4P2OA 4IDJH 5ADOL 5CD5C 2ITCA 2YD1A 3E0GA 3G5VA 4U6VL 2DMKA 5CWSB 3WEXB 3KPSA 3L1OH 5ERWB 3HNVH 4M8VA 3QXDB 1RIUH 3EOYG 4TUKL 4MNQD 1JYVA 5DGQA 4X6DF 5J3HD 2FD6L 2XICA 3GJEB 1ZLVH 2IWGA 4JHAH 4F3FB 4G8EB 4LP5A 2M1KA 3VGEA 3QIWC 4YHYC 5EZJB 5BV7H 3TZVB 4K3EH 1JVKA 2AJ3B 1TFHA 3L3JB 4LSTL 4YHNA 5IW6B 4D9QD 3BP4A 3GSUA 3DGGB 3O3EB 3OR6B 4R0LB 4NBXB 1JL8A 5T3ZH 43C9B 1U8PB 4AIXA 2VNCA 3QDAA 4DWHA 2Z92B 3TN0B 4XCNB 5EU3B 1TQCC 3KJ6L 2G60H 3KG5A 3MV8D 1A7NL 1A7OH 4JPVH 4XWOD 3DECA 4OZGE 2RQ8A 4UOW0 3ZSSA 1BVLB 2XACC 1DEDA 3IFNL 4N9GB 3OGOE 3PWJB 5BXFA 3HZMA 4LASH 5IVXB 4W6YB 1J0ZA 1MPAL 2Y25A 2FBOJ 5I1HL 1FC2D 4Z7VF 1JZ4A 4XNZB 1IRAY 2H45A 3HE6D 5ALBL 4HG4J 4PRHB 1RUML 4L9DA 1FPTL 3U6RB 3FJTA 1VACB 1AJ7L 4PB9H 4KUCF 1U8HB 4MNHA 1MREL 3T1FA 2AABL 5GGVL 1I3VA 4OGZA 4MNGA 4IOIB 1KCLA 3QCTH 4UIMB 2EDHA 5FOBB 1BFTA 2NYYC 3ROLB 1KNOB 4LAQL 4U6HA 4ZAKA 2HYMA 1FL3A 3RFZC 5IB2A 1WFNA 1BJMA 1KJ3L 1J5OL 1BZ9A 3CVHL 2B2XH 4E41B 3AS2A 2VXQH 1NCWH 2ZJSL 5DFWH 1MI5A 4JFYB 3RTQD 3F7QA 4PRDA 2A83B 4FNLL 1VFOA 3MX0A 4HD9A 1IZJA 1NAMB 3LIZL 1JNLL 3GRWH 4YEEA 1ND0A 1EGJL 1YDPA 4XAKD 2JCCA 3M8OL 3QQ3B 4RDQF 3RVXC 3UROR 2E7LC 2ZCLH 1IJ9A 3MUZ1 1EHLL 1CZ8H 4EI5C 3R06A 3NIGE 4MNQE 4WU7B 3GSVA 1RVFH 2VISA 2MJWA 2IMMA 4ZNEE 3VDBA 4NUJA 5DJYB 2ZPKL 4HJGA 4HW6A 2XPGA 3CCHA 1R24A 1QKZH 2NXZD 4OIBA 3O3AB 3RDTB 4HC1L 1I1RA 2AS5M 2DLHA 1TJGH 3P11L 1CGSH 4D9QE 4XZUA 5MENA 3G6DH 1G7HA 2DMCA 1M05B 2CSPA 4DGYH 1FYTA 1FLTX 4KI1A 3W5MA 5GGVY 4ZFZA 3WUWB 4L9LB 1FNEA 4FZEL 1O5DT 3I75A 1NBYB 3UYOD 3M07A 2P42B 1MFAH 4S1RL 4KKCD 3KLAA 3MV8E 1JF1B 3UEZA 3I50H 2X40A 4FMFA 4LSUH 4OD2A 3DXAB 4M3KB 2C3WA 1UJ3B 5F70A 5HI3C 1KIPA 1IKFL 3C8KB 3MLXL 4K55A 1I3UA 1WWWX 3SDCA 1MCOL 2UZIH 2H32H 2EEBA 3L6FB 3ZT7A 4L8DA 4NM4L 3WJLC 2CKBL 2NY4C 3C9NB 3GRWA 5IQ9A 2W0LA 3U79A 4WI7A 2ZSVB 4K3GA 1GH7A 3BWUC 1HH9A 4ODVL 1OSPH 3LEYH 1RK0B 4NNYA 4NO3A 1HHJB 4YHIB 2CDEB 2HMID 4S0SD 5EOCL 2FLBT 5HHMB 3AAZB 4ONGH 5GIRB 3IXTB 1B0WA 2EYSA 1HXMB 3ZDXE 3IF1A 2XTJC 1YN7B 5JHDA 1WZ1H 4CNIA 4NUGL 4KKAD 5CLWA 4FQXA 5HPOA 2ADIA 4XVTH 1I3RB 5TGBA 4MXVE 4QGYA 3CNKA 2HRLA 3WXVH 1LO4H 3V0WL 3KPRD 2IMNA 1EZVY 3QXAB 1KCUL 1G7IB 3JWDL 5T33H 5C09A 4U7KA 3ULUH 2OTUB 4JM2C 4FFWC 3LPFA 3ARFB 4Y1AD 4DVRH 3HUJB 4M5ZH 4XAKE 4Y4KA 4RAHA 1CK0L 4JO3L 1WWBX 2HVJA 1U91B 2VMFA 1T89C 3BE1L 3BN9C 1WCBB 2HFGL 2LTQB 2AK4A 3EOTH 1OP5H 2O5ZH 4E0RA 3BIBX 1GHFL 1DDHB 1OB1A 3RAJL 2H32A 4RGOH 1HYRC 5IVZB 4ZFGH 4NO0D 1M7IB 2E6PA 5B21A 1MQKL 4IM8A 1MJJA 4YUEH 2W65A 4P2OC 4BJLA 2V2TB 3E3QC 4YLQT 3MJ6A 1H3PH 4XVJL 2FX9H 2D7NA 3GO1L 4MCZB 3VWKD 1UFUA 4P57B 4IMLB 4QXTA 1OVZA 1CQKA 3LKPA 5IROA 4TQEL 5FO9A 5EA0H 1IM9D 3UPRB 4PRNA 4PJBF 3RGHA 2CPCA 4YHZL 1MEXL 3H9SB 1GZQA 3CSPA 1IM3B 4MAYB 1UM6H 2DI7A 4U1NB 1I4FB 4GKNB 1IT9H 3OJVC 2EH7L 3TJHC 5E0QA 3ABZA 2DIBA 5ESVA 1U8MA 4G7YL 4HDIB 5FXCH 4JGJA 3KLDA 1A6UH 5IBTL 5AYUH 4D9LL 4X4XA 2JJWA 2PYEB 5KSVB 3AXLB 3FQWA 3LN4A 4JPIA 3MUJA 2ZUQB 4X6EB 3U0WH 3PWUB 3QISA 3GMLB 3W39A 3MXVH 4PJGB 4KKBC 4WDIA 5ESQB 2JB5L 3OKLB 2QQKL 4K7FA 4UOW1 1ONQA 1NUGA 5DVNA 5E8PB 25C8H 2R4RL 1G7JB 4PB0H 1HCFX 3T3MF 4M6OH 2CRMA 2D2OA 5HHOA 1EK3A 2APFA 1N64L 3BOVA 4OLXH 4N0UE 2EDFA 3SO5A 5JLZA 4HUWA 4GG6A 1FVDB 3KPRE 5KZCB 1KUMA 5J12B 3IVKA 1BGXL 4PJ7B 4Z7UE 1RJYB 3LN5A 4JB9H 1JF5A 5HD8C 1LP9A 2D7PA 2H3NA 4P2RD 4IRZH 5SWSD 3DRQB 4OB5L 4Y1AE 2ZUTA 2F15A 2XWTB 3CSYB 3X12B 3KDMB 2HT2D 4MVBD 3DTXB 3VG0L 5BV7C 1XCQA 2AJSL 3BP5A 4ZAKC 2VE6A 3OSKA 4HKZB 4YH6A 3AU1A 1A22B 1P5VA 3WFDH 5GGRB 1R3JA 1WBXB 4O2FA 1FG9C 4XC3L 5SX4H 1V3JA 2RBLA 3FN9A 4FFYH 3C5ZB 2P24A 3JV4A 5KSBE 4P23A 2WV3A 1C16B 2NY2D 3G6JA 4Z77A 4NJAH 4X9GA 2HAZA 3FB7B 4QRPA 4LEOA 3HZYA 2FJHB 4HS6A 1YYLL 3C5SA 5EUOA 2V2XB 2DQDH 1N4XL 4LSQL 4YE4L 5GJTH 4F58H 2MMXA 1J1OL 4U33A 4B50A 1K4DA 5DFVD 4XPBL 3FT2A 3V4PL 4X7EC 3FQTA 1H3XA 4YX2L 4EUPG 1QEWB 4N9OB 5B3JE 4N8VG 4ODUA 4QT5B 4KHXL 4ODTL 1OTTC 2FEEI 5KTEH 3WNPA 5FKAB 3MRJB 1AIFB 1D6EB 4HQQL 5ACLA 3DMMD 4QRRB 3EDDA 3D39D 3U7WH 4WU5B 4XP1L 1Q9KB 4HX1A 1BJ1J 3B9KD 3X13A 2Y1VA 2P45B 4AQ1B 3QXVA 4U1HA 3VWJB 1TZGH 4FXGA 1P6AB 1ZA3A 5JR1L 3RUGE 3U9PL 5CUSH 2CXGA 5CJQH 4B5EA 4MQ7A 4DKFH 4K3JL 3LOWA 4JR9L 5EN2B 4U1SA 3PHQB 3IT8D 3SDCC 4M7ZB 1RFDL 4KKLD 1H5BA 2AJZA 2AJVH 3A6OA 1F11A 1YNLH 1ZKAA 1FYHB 2Z9TA 1UCBH 2GYSA 2OR8A 1OTUC 1WISA 3VFGL 4KRPD 1B3JA 4MSWA 4OCYL 4OI8A 5EBWA 1P6FA 1NGZB 3K2UL 4GMSH 5DD0L 4C56A 5FUOH 4GUPB 4JREB 1DJSA 1K6QL 2FRGP 2Y06L 5GRUL 4R3SA 4P2RE 5SWSE 4NQDD 1BFVL 2Y5TA 3BIKB 1T7YA 4NCC1 4BFGA 4Y5VB 4FMKA 2MQ3A 5L7XL 3C2AH 1O7VA 2DQHH 1GYAA 1NLBH 4H5SA 3EO9L 2C7UA 2ZCHL 4FQXC 3QFDB 2K3TA 1YPZE 3CK0H 4MJ6A 3X14B 2J8UB 1UVQB 4S0TD 2CIKA 4P46D 1D7FA 1CD1B 1G7PA 1J8KA 5FIEA 3OB0H 4YFLF 4ZS6D 1HH6B 4R4BB 2X05A 1FBIH 4GKSB 2WW8A 3ILQD 4HHAB 1DFBH 5CD3A 4Y4KC 4Z76B 1J10A 1D6VL 1FFPB 4NO2B 2ENSA 2J3SA 3SDXF 2LE9A 2CLRB 1UZ8B 2R56H 4JY4A 4HFWB 2E9JA 5D7IF 2VDNH 3VH8B 3UC0H 2BNQD 4F7PB 1MCJA 1IGIH 1YEFL 1OSZB 1T0NA 1KELL 3D39E 3LZFL 4M7KH 2JJSA 1AP2B 4UZGA 3TBWA 5GISL 3S5LG 1HI6B 5A16A 2HVKA 4ORGB 3GIZH 5IROC 3FTGA 3QEHB 5I1EL 4PLKD 4JZJA 1U8JB 1K8IB 1OGTA 4NN7B 2FBJL 3SN6N 5F89A 5EWIL 3ZTJG 1N59A 3BW9A 2ITDB 3MCKA 4IIQA 4UI2A 1X5YA 1PAMA 4DN3L 4PS4L 1T1YA 1U8NA 3JVGA 5F7DB 1ITCA 5KSUB 1HOCB 1NCCL 2F9BT 2P49B 3DX9B 4X4YA 3ULUC 2P8PA 2WM0A 3C60D 5DZNA 5C0IB 2QL1A 4QRUA 2C26A 3TCLA 1A6TA 4ZUWB 4MD5A 2OZ4L 1WWCA 2F53A 5D96B 4OT1H 2NY3B 4Z7OF 4XMLH 3CAFA 5LG1A 3DX7A 2DDQH 3A67L 2CLVB 1MCHA 5FECB 1P4LB 1BF2A 3MLVH 1UACH 2WWMC 4NQDE 2EDLA 1PG7L 1NDMB 3O6ML 1FVEA 4DQOL 2J4WH 4GS7C 2HJFB 4AIOA 1JV5B 3LKRA 3MFFA 2VDOH 5GS1B 1HHIA 1Q9OB 4RDQG 1T4KB 3IKKA 4G8IB 1LEKA 2E7CA 3M1BA 4OLUH 3ELAT 2CUMA 4D0CB 1KC5L 2BOBB 4MX7A 3QUZB 1UYWL 1HNFA 1R3HA 4XNMA 2FR4B 2BMKB 2X4NA 4NYLA 1IEAB 4LCUB 5KVGL 1KFAH 4GQ9H 3R8QA 4Z7WA 2AJYL 3UBXI 4DCQB 1SBSL 5LXGH 4YQXH 4YBQC 1EAJA 3LD8B 1B4JL 1FLRH 1ZANH 5JO5B 3MGTB 5FA4B 2PR4H 3G04B 4RAVA 4U49A 3L5WB 2DICA 4J3VA 2GHWB 3RQ3A 3S8WA 5L8LB 5IHZB 3LY6A 1JWSB 5EBLA 5FGBA 3FFCD 3VCLB 2BNQE 3EHBD 4PJDA 4PREB 4X83A 5ITFA 3KPOA 2YMXL 4P23C 3G9VA 4PYHA 3Q6FB 1MCRA 2GJZB 4RIRA 3PQYB 5KN5A 2D7OA 5HYSA 1QSFD 2MWCA 1LVEA 4Y2DB 1OLZA 5CZVH 1T2QH 3PNWA 4X4MA 3O4OB 4F9LA 1RPQA 1I7ZB 3I02B 4F33A 3NN8A 1YEKH 3H3KA 4U7MA 3QIWB 1Q72L 4JGMA 4YHYB 4N8CH 5GHWH 1I1YA 2YPLB 5J6GA 4PBVC 1XGPB 3KPMB 3CDCA 4LDOB 3SCMD 1DBBL 2QSQA 3QPXL 4WFFD 3QNZB 3U83A 4L4VB 2ZUSA 5LGHH 4Z95H 1EFXA 1B90A 1VADB 3S37H 4BH8B 1NFIA 3EYQD 3ULVL 1TQCB 1CN4A 4YR6B 4ZO8A 3B3IA 1OT1A 3QEGH 3EZJB 4XP5H 4JFEB 3TIDA 3R0MA 4DUVA 2OMNA 1MF2H 2ADGA 1VKXB 1A3QA 4GOSA 4LLVA 2R23B 3LHPL 3RTQA 1FL5B 2EE6A 3RZCC 1MNUL 5C0CB 1H5BC 1MCPH 3PWPB 4M48L 1IC4L 2VR9A 3AGVA 4LOUC 4NQCD 3V8OA 4I3RH 5IFHH 3B2UC 4ZFOB 1CLYL 3GDBA 4LSSL 5IBUB 4PJXE 2VWEE 1HIML 5ICXB 1F4YH 5ESAA 5D1QC 3SDYL 1JPFA 5TE6L 4O2EB 2AJXH 1DEEB 4Y19A 1J0KA 5B22A 5IB1B 5DMIL 2FGWL 4NZTH 2P46B 2ZOLA 5T1MB 2R8SH 5CJOL 4WEMB 1L9MA 2EXWC 4YDJA 4CADB 4JDZB 4RMTA 5KVFL 1N2RB 4IRSD 3F7RA 5AWNH 4NBYB 4IEFB 5F72S 1ZVSB 4Z0XB 1KPVA 4OUUB 1QSED 3UJIL 2NY0C 3HI1A 5D2LB 4KGJA 3FFCE 1PX3A 1R3IL 4LVNC 3U2SA 2FATL 5C6TH 3K74B 2DQGL 4HH8A 4KPHH 4YK4C 3T2QA 2EDYA 1KB5L 2VZ3A 3BKML 5HHXH 1HN1A 5I30H 4YXLH 3KYNA 3M17A 1CU4L 4PP1C 2GITB 5D7LB 3WFHB 4EI5B 1QSFE 5F6HI 3GI8L 4MWFA 3V2AR 1HHKA 4KTEL 3OJDB 1NMBH 5DEFB 2P5WD 1AQDA 2FL5B 1PY4A 5JUEH 3O2VH 4TULL 1T21B 1TPXC 3LDBC 4R96A 4IMKA 1ZHNB 1S5IL 3QH3B 2PW1B 1HHGB 2R1YB 5IB4B 1FH5L 5D6DA 1YY8A 4OCSL 4PTTA 2JJSC 5C0FA 4WFFE 3TT1H 4DGVH 3RWFB 3EGSB 2YKLH 4XVUD 3QIUA 5L2KD 4GRLC 4WTZG 4TPRH 4PRID 1BF8A 1C8PA 3HG1A 4NN5B 3QP3A 2V2WB 5IFJB 1GPOH 5KVEH 3CU7A 1TZIB 6FABH 4PJFB 1NCBL 4XP4H 5C6PB 1DLHB 4IIQC 2DTSA 4YXKL 3VW3H 1LDPH 4HV8A 1ZE3C 5JOFA 1OWRM 2G5RA 1QBAA 5KS9A 2XI9A 3JVGC 4XNUH 3HE7D 4R97C 2Q7NA 4NRYB 1T2XA 1DBKH 4G42B 4HS8L 3W11C 3BRGC 3V4VL 3BHBB 1A3LH 3HCVA 4NQCE 1PLGL 1C7SA 4GW5B 4PG9A 3DVNA 1XH3A 1GL4B 3E8UH 3NGBC 5J7CC 3QUMH 4JHBA 5GZND 1FJ1A 3DRTA 7CGTA 3EDKA 4ODHH 3D0VA 3PWVB 5ITBH 4L8BB 3ZTNL 2YPVH 4HULB 3BX7C 1XGRA 5ENWA 4QOKB 2P5EA 3WFCH 4K23L 4XAWL 1V7NH 4W68A 4YGVB 4BFIA 3VXSA 1CT8B 1KTLB 2ICES 3CVIH 4RFEA 5TDPA 3FRUB 5GS0L 3RPKA 4TSAH 2BY1A 3F8UB 4G8GA 5LWYL 3WNOA 1G6RB 3N9GL 3DWTA 3CXDL 5L0QC 1A2YB 4HMCA 3B5GA 2DL9A 4HT1H 1QSEE 3U7YH 4G80A 4Y16D 2IGFH 3HAEH 4HUVB 4OZ4B 4RAUA 1YEIH 4PJ5D 1A14L 3PGFL 3IDNA 5HYEA 4JM2B 4WWKA 2IPKB 4H25A 4QF1A 3HFML 3EYVB 3OAZK 5I74C 1UXWA 5IKCA 3MJGX 4RBPK 1QLRB 4HZAA 1T03L 3QYCA 2GFBB 3QWOA 4HWZB 1A4KB 3LEXB 1S7TB 3K8KA 4HUXA 3ROOA 3MUGB 1Q0XL 4I77L 2AI0L 4QHUB 4C57C 5C0BB 3EFFB 2P5WE 4I0PB 5FGBC 5I8CB 1G7QA 1QBLH 2VLJD 4YHPB 1PSKH 5EPMB 4JQIL 4P2OB 1NEZA 1AE6H 3ZE2F 3TFKD 2ITCB 3OWEA 3QUMA 4XCFL 4ZDHA 1FFOA 1HZHL 2JELH 2JE8A 5IMMA 3KPSB 5BRZD 1TNNA 5JMRA 1VFBA 3SGDI 5L2KE 1BOGB 1WJ3A 2KL6A 4PRIE 1LEIA 5E9DD 2B5IC 4JKWA 3O6LL 5JA8B 4F9LC 5SV3A 4KWUA 2E9BA 4PJHF 4ODXA 3H0TA 5ECJE 1T6WA 5C0JA 3S36H 3Q0HA 1IVLA 1MFCH 3F65A 2RJMA 1PX4A 4YHNB 3HAEA 2V7NA 3BP4B 3GSUB 4G5ZH 4GQPH 5SWSA 1Q94A 4BUGA 3MOBL 1N0LA 2OCFD 5J1TC 4J8RA 5J11C 4FP8H 3WS6A 1NAML 2F58L 4XHJD 3Q2CA 4JQVA 5F1SA 4FABH 2K1MA 4DGIL 3NZHL 5D2NE 3WO4C 2VB5A 1JUFA 2L7UA 3BT2H 1U3JA 3AVEA 2H9GA 4KQ4L 3MLYL 5BXFB 3HZMB 5ALCL 1KCVL 1UGNA 1Z0NA 3LB6D 1XGQA 2AW2A 2Z8VC 5DK2A 4ZS7L 2UYLA 4U6VH 4IRJA 2DN7A 4KK6C 1GIGL 1UH4A 1OP9A 4KK8C 32C2A 5DD1L 1CYGA 4KVCL 4PJ5E 4MNHB 3T1FB 5DJ8A 2F5BL 3FQUA 1ZHBA 1GGBL 3O6FA 2BVTA 3H3PL 4MNGB 1JPTL 2BFVH 5I76A 3QEQA 4PFEA 2NY6C 1ITBB 3CSGA 5DC4B 5BV7B 4MXQC 4U6HB 4ZAKB 4PJCA 1F90H 1FZOA 1H8NA 3QG7L 4KVNH 5IB2B 1BZ9B 3QPQC 2VSDA 1MI5B 1A1OB 2JJUA 3FQRA 4PRDB 4TYUA 2VLJE 1IQWH 3RGVA 4JZNA 3SKMB 4MD0A 4Z7NF 3ZHDA 1D5IH 3KJ6H 1ND0B 4XRCA 1YDPB 1JYXA 1BD2D 2JCCB 2F8VA 3WL9A 2EDNA 5BRZE 1F6FB 4OBSA 1I8IA 3R06B 5KW9L 5E9DE 3U4AA 3GSVB 1XF3A 1EEUA 4JAMA 5I8KL 4WWID 4GAFB 4H26A 2VISB 2F54A 1VFAA 4NUJB 2MHAA 1U8IA 4HJGB 4EXPX 1RUQH 2XPGB 4I0KA 4ZD3L 3CCHB 1R24B 5BVJA 1W0VA 3VD5A 4QRSA 4PGJA 3V52H 4IMKC 2CR3A 1T5XB 2YZ8A 4XZUB 5MENB 4D9RD 4N0RA 5D6DC 4LDEB 1RUMH 1G7HB 1MCFA 1W8OA 5K93A 3TO4A 1LILA 5E2UL 2W60A 3HMXL 3KXFD 4ZFZB 1FNEB 3QIUC 1HYSC 3I75B 1HCVA 4CMHC 1LHZA 3BZ4B 5KG9A 3B6SA 3KLAB 3JTSA 5F7EL 3IDJA 2LU4A 4LAQH 3QUXD 1EPFA 2UWEE 4P46A 3T2NL 1KIPB 3SDCB 5CIPB 4OZIE 5E6IA 4S2SA 2ZJSH 4KUCD 5HDQH 4FNLH 2AVGA 1B88A 1J86A 4XTRC 1ZOXA 3DPBA 3VGHA 4X6BA 5IQ9B 4I4WA 1K85A 5I16A 1HH9B 5IEKA 4XNXH 2YS4A 1EO5A 5ADPL 3M8OH 2P48B 2OTWA 4FQPA 4NNYB 4NO3B 1EHLH 4GRWF 5EOQH 4HXBL 3VI3E 3PHSA 5HVFB 3DVGA 1P1ZA 4LHUG 5D1XD 3TVMA 1ZT4B 2BNQA 2EYSB 2YOCA 4BSJA 2P8LA 3GSWA 2WMPA 3IF1B 4JRYA 5JHDB 2CDGA 3DV4A 3MRNA 2AGJL 4K7PL 4CNIB 4HC1H 3AFLA 4FQXB 3F12A 3E6FB 2ADIB 2GKIA 3P11H 5TGBB 3H7BA 3QQNA 4S1QH 4RRPG 3CZFA 4DVBA 1N26A 4YDKL 3BISA 4PUBH 5C09B 4PJ9B 4WWKC 1ZMYA 2PXYD 1SY6L 3ARBD 4Y4KB 5KVDH 1BD2E 2HVJB 4Y4HD 1SEQL 4U3CA 3EBAA 3SGEI 1DVFD 2AK4B 4E0RB 1OB1B 4HGWA 5IJKA 2H32B 2KBGA 1NBZA 4AIZA 5A2JH 4YO0B 1I9IH 1TCMA 2Z4QB 4AL8L 2CKBH 2XIDA 1OAZH 2W0PA 3S97C 1MJJB 4MZ2A 4J6RL 5CGYD 2W65B 5FEBA 4KDTA 2FHFA 4D9RE 1NUDA 1REIA 2YK1L 3JV6A 4QRQA 4LPYA 3B9AA 4QXTB 3LKPB 3KXFE 4HWEL 2DM2A 3DHMA 4PRNB 4XH2B 1G0YR 1Q0YL 1F13A 3PDGA 1GZQB 3T2OA 4HC1A 3VFWA 4CVXA 4NUGH 3X17A 3D2UD 3WXWH 1G9NL 4Z7VE 2YA1A 4NWTL 4R9HA 1ZS8A 1KENL 3IJYA 4LCWA 5ESVB 5I0ZA 4K71C 1U8MB 4JG1L 1KCUH 4QHMA 3HPLA 4X4XB 2BOCA 7FABL 3FQWB 5J06A 4XNYL 5HHVL 3CC5A 3SE4A 3LN4B 3WS6C 4YBLC 4KROC 4JPIB 3NAAL 4NM8H 3QUYD 3T3PF 4MJ4A 4Z6AT 3CFCH 2IQ9H 3DLQR 2HFGH 2XQBL 3TA3A 3W39B 1A21A 3OAYH 4WDIB 3QXUA 4ENEC 1H15A 4PLOB 4GS7B 1GC1C 3BO8A 4K7FB 1ONQB 3TJEL 2CKBA 1NAKH 1MQKH 1M7DA 3SE9L 5JQ6H 3MV7D 2FWOA 1XF1A 3B8SA 5DURB 5DT1L 3N1GC 3A0OA 3SKUD 5HHOB 1ES0A 4P4KA 4O9HH 4R26L 5JLZB 4HUWB 1F4XL 4GG6B 4IRJC 1FFNA 3BFOA 5C7XH 3IVKB 2ESVA 5D7JD 5JOPD 2A73A 4TQEH 1LP9B 2H3NB 1RZFH 3ARWA 3MNWB 4K7PX 1LEGA 3O6FC 4MA1B 5E2VL 4NFDA 2NTFA 3V4UH 2VDQL 2P43B 1C5BL 1GZPA 1XCQB 2FJGA 3BP5B 3FO0L 4M1GH 1DLFL 2EH7H 3L5IA 2DYPD 4OIAA 5GGRY 1UWGH 4G7YH 3WLWD 4O2FB 1DUZA 3VA6A 3VH8G 1IBGL 1LO5A 2V5MA 4HBCL 1HWGB 3RGVC 3L5JA 2P24B 3JV4B 2RR3A 4P23B 4ZUTA 4PLNC 1QFUH 1AGBA 3KYKH 4Z77B 3EAKA 2V9RA 4LKXA 1IC7L 1NLDH 4QRPB 2XV6B 4LEOB 3HZYB 1CICD 4HS6B 3C5SB 1A9BA 5EUOB 2JB5H 1MHPL 1I9RL 1U8QA 3VDAA 4KMTH 4W81A 1C5DA 2IJ0C 2ID5A 1CVSC 1K4DB 1MFBL 2QADB 3FT2B 2R4RH 2W0KA 3FQTB 4QKXB 5HYIA 1PBYA 1WTGT 2R0ZL 4FS0A 4FTVA 4L5FL 3DSFH 4O51A 1J8HA 3WD5H 4QRTA 1M6OA 4WO4A 1DP0A 4B7IA 5T3XD 3PP4L 5D5MA 3GBNL 2IFFL 4Q6YA 3SDAD 2AXHA 2CXKA 3TO4C 4HX1B 5EC2A 5GRJL 2JIXD 5CEZL 3X13B 4HIXH 4M6NL 1XIWA 5DF0A 4U1HB 5DRZA 3IKCA 4FXGB 4MQXD 1VESA 1L0YA 3TNMA 1ZA3B 2CK0L 3QG6A 1NFDF 4YHLH 5D1ZA 4LCIL 3VG0H 2AJSH 2DWDA 4MQ7B 5KSAD 4TVPH 3NCYS 4GXVL 3CDGA 4ACPA 4POYA 5ACZA 4U1SB 2FHBA 4JEGB 4BUHA 3GFUA 1XT5A 3KR3H 4HJJL 3SOBL 1AXIB 5E6IC 1S9YA 1H5BB 2AJZB 1K4CA 4QHKI 4Z7QE 1F11B 3MV7E 4OCXL 2AV7B 3WSQL 3PJSA 1A47A 1E4WH 4P3CL 3MJ7A 3ARED 4MSWB 5EBWB 3UXFA 1NGQH 4C56B 2EE2A 1RHFA 5JOPE 1WAAA 4QXGH 4RWYH 3NFPA 4JDTH 4LSQH 4YE4H 3SDDD 2GK0B 3FAWA 3O41A 1NDGB 4R3SB 3TIEA 4M5YH 2Y5TB 3MRRA 2ADJA 3TVMC 2BVEA 5FYJD 3TO2A 3VFPB 1J0IA 1XGYH 2B1AL 2R0WL 3UJTL 3I9GL 4H5SB 5HI5D 1P4BL 2C7UB 4MJ6B 4ZXBD 2EYRA 1GGIL 2CIKB 2NY0B 4XP1H 3C09C 4LVNB 5JW4Q 2DF3A 3UDWA 2H2SC 3SKNA 1G7PB 5IFAL 1INDL 3QIBD 2Z31C 4PJEF 5E1HB 4PJBE 4YK4B 4LAJH 2H41A 4XP6H 4AMKL 5DR5L 3V7MA 5CD3B 2A77L 3T4YA 3DARA 4JPWH 4WCYL 4K3JH 2Y4SA 1K8DA 2AXJA 3UTQA 4GXUN 5ANME 5DJAA 1C1EL 5IJKC 5GGTL 1RFDH 4JY4B 2ORBL 1J9CT 4WI9A 2G2RA 1OP5K 1WF5A 1Q9LA 3GI9L 2UUDK 4QHNA 4NDMA 5E99H 1TPXB 3LDBB 2HLFC 5A1AA 4ODWA 4PGCA 4X9FA 1T0NB 5T3XE 5D2NA 4KDTC 3K2UH 1U3HD 3TBWB 1P7HL 3ET9F 1GCFA 5A16B 1J12A 4P9HL 2HVKB 4WHDA 1IQDB 2VQTA 3FTGB 4JFOA 1NH6A 4I48B 3JTTA 2EIDA 4JZJB 3U82B 1OGTB 3T3ME 5F89B 3BW9B 2CRZA 3MCKB 4RZCA 4EUPH 2ZCHH 3CJJA 2VWEC 2NY7L 2EZ0D 1T1YB 3OKMA 3MXWL 4JFQA 4MCYB 3S34L 4YWGL 4PJ5A 1CL7L 5BVPL 1FE8L 4UUJA 4X4YB 1H3UA 4NP4L 1E4XI 2P8PB 3PG2A 4JFDD 4OFYA 4OCWL 4QRUB 3SE4C 1FGVH 2Q3ZA 3NGBB 4JHZA 3TCLB 1A6TB 4MD5B 4OLYL 2F53B 2HKHL 4WTXA 3VGAC 3RWEA 4FRWA 1KV3A 4PRPD 3TA3C 3DX7B 3MBED 5C92A 2VL4A 4M4PA 4ZFFA 1FVEB 4Z9KB 3MJ8A 5A2KH 5FYJE 3MRHA 3JXAA 1UM4L 3LKRB 5GRWA 3MFFB 5BMFH 1HHIB 1QFWL 3P0YL 1LEKB 1YEFH 1ZWIA 3M1BB 5L0QB 2WLYA 3SEPA 4HMDA 4MX7B 4P4KC 3UTPD 1CXEA 5GISH 2UY7A 5I17A 1NCAL 5CJ5A 5E9DA 5GRYA 3MRIA 1R3HB 4XNMB 5TQ2L 5IT2H 1MHHA 2X4NB 4L8CA 4NZJA 4NKDA 2R4SL 5I74B 2K7QA 3C5JA 1NC4A 2HLAA 3U4BH 4Z7WB 3ARYA 1YEGH 3AS1A 1TLKA 3MACL 4EUPA 3OPZL 5DJDA 2V9TA 4HGMA 3SQOH 1MLBA 4G3YL 1X6NA 4N8VA 2XZQL 4CVZA 4PS4H 4RAVB 1ORQB 1QR1A 3FRPG 4UILL 3N50A 1DE4A 3CX2A 5L9DL 2OX5A 4KTDL 4NPYA 5EBLB 5TFSH 3SGKA 3OZ9L 3WFEH 4PJDB 5D70L 1KIQB 5ITFB 3KPOB 1T04A 3CFEA 5IP4A 4ZFOL 2UWEA 3ILPA 1XFPA 2EDBA 4MA7L 3CDYA 1CFVL 2W0FA 1KXQE 4RIRB 3GMRA 1F3JA 4UIKL 5KN5B 5HYSB 1OP3K 4ZQKA 1PG7H 5FV1L 3RNQA 2ICWI 2X4OA 4DQOH 3PNWB 3KS0H 3DX8A 1CXHA 2R0LH 5IK3B 5F7FA 1B6UA 3NN8B 3PXJA 2D7QA 2J88H 1I1YB 3S35X 5J6GB 1MLCA 4RA0C 4WO4C 4HPOL 3NTCL 3T0VA 4I3SL 1AR1C 4PGBA 5FHBL 1L7IH 3NABL 1AGCA 2CIIA 5J11B 1I3GL 1M71A 2OJEA 4JFDE 4PRBA 1EFXB 2KH2B 2J6EL 1LK3H 2OK0L 1XIWC 1NFIB 5EIQA 5I1JH 4NGHL 2AJYH 4PLJC 4YFEA 1JGUL 3B3IB 1SBSH 5KJRH 1PEWA 1Y0LB 4FFVD 3BD3A 4PRPE 3ZTJH 5D1ZC 3TIDB 3WO4B 1P4IH 2ADGB 2VZTA 3CFDB 4RX4A 1MJUH 4RNRA 4LLVB 4F57L 3RTQB 1IFHL 4X6DA 3X11A 3ZE1E 4N0YH 5GZOD 3HUJF 1QPXA 4UT7L 1A0QH 3SJVD 1C12A 3KPNA 4X7TA 4H88L 2O93L 1RJCA 3UTPE 3WFBL 4OAWA 5ESAB 4P3DA 3ARTA 5T1KA 3F5WA 1TJHL 4M3JA 1JPFB 3DSNA 3K46A 3ZKMC 4Y19B 5D7IE 2HTLD 3VMNA 2G75B 2ZOLB 2HT3C 2NY6B 1Q72H 1KLGA 4HWBH 1I1FA 4YDJB 3RVWD 2HT4C 2XWJA 1G7LA 5F1OB 2P7TA 2FECI 1I8LA 1UQSA 3QEUA 1AI1H 4ALAL 3HI1B 3H6JA 4J3SA 3S5LA 3U2SB 2N1KA 5JXED 3MBXL 4C83A 2Y6SD 4B7LA 3N1QC 1QBML 1CGTA 3KYNB 2O5YL 3M17B 4Z7VA 3OB0K 5CP3A 3R4DA 4S10A 3T08A 5C0RL 1OF2A 4ZSOA 4MWFB 1HHKB 1FL6A 5I66A 1QNZH 1P69B 3LPWA 2OXGA 1AQDB 5DQDH 3MYJA 1YECL 4PV9A 4R96B 1G6RL 3UTTD 4Z7OE 3JWOL 5A3ID 3H9YA 4PJGF 3SDYH 5C0FB 4PTTB 1RUAL 1GVIA 1CFNA 5C3TA 2R0KH 3O9WD 4CMHB 3HG1B 1H9VA 4N5UA 5DMIH 2FGWH 3QI9C 5CJOH 3AMKA 4ELMA 4G9FA 1B6DA 5CGTA 4M7JH 2FB4L 1QLFA 2Y07H 5JOFB 5KS9B 3UJIH 4PD4J 4Z7UB 4PJ7F 3TBSA 3HI6L 2FATH 4U6YA 3MGAA 3HCVB 4X7FC 3Q1SL 5E8DL 3QQ9C 5FHAL 1NSNL 3DO7B 3KPPA 3SJVE 5JXAL 3BKMH 3DVNB 1XH3B 2VSCA 3BUTA 4QTIH 3BQUA 1IARB 3EYSL 4PRAA 3NCEB 2AEPL 4LLUA 4DJMA 3GSOA 1FJ1B 1UM5H 3DRTB 2JLLA 3E6HB 4GW1A 3D0VB 2MOVA 3GI8H 4JKPL 3WNLA 2XY2A 2OJZL 3QZWG 1V7ML 5I1CL 5EZIL 4XPAL 4X98A 2K7PA 4D3CL 2DM4A 4HXAH 1SYSA 1XGRB 5ENWB 2WWKO 2P5EB 4BFIB 4FQQA 1YNKL 1JPSL 5FUCC 2FX8H 3VXSB 4J1UB 4RFEB 4TULH 1Q38A 1RIHL 3P0VL 1S7UB 5LQBH 4NNPL 4G8GB 3VXQA 4HBQA 3RA7L 5F9OH 4APQA 1DTUA 4CW1B 4GW4A 5B4MC 3DYOA 3N85L 4OCSH 1ZHLA 2XG5A 2Q87A 4C4KO 4G80B 4PD4K 5FCSH 5JA9A 2OR7A 5ABDE 4RAUB 4KZDL 3IDNB 2YD2A 4WWKB 4H25B 4QF1B 4XVSH 5CJ8A 3QDMD 3VRJB 1UXWB 3B83A 3O6KL 3MV9A 1IGFH 4OSUH 5IKCB 1NMAH 1NCBH 1MHEA 3ARDD 3CLEH 3LS4H 2IPUK 3QO0A 3RX7A 3QWOB 2DD8L 1GAFH 4J12A 3RHWF 4CL7A 4HUXB 3ROOB 3MR9A 3I6GB 1UADC 3HNSL 4P5KA 5K9QI 3EIFA 4X6CA 3N1PC 3BGMA 1NC2A 3SGKC 1G7QB 3IS1X 4XXDA 4IDJL 2GTWA 3MNZA 3UTTE 1NEZB 3BMVA 2EDJA 3QUMB 3EYFA 2BRRL 4ZDHB 1FFOB 4PJ8C 4LGRB 3L1OL 3HNVL 5IMMB 5J13B 4M7LT 1RIUL 3BKCH 5F6HJ 1VFBB 4I18A 1LEIB 2BSSA 5IOPA 4Z8FH 4JHAL 4K23H 4TNVK 4ODXB 3H0TB 4B53A 3N9GH 4K3EL 3GHEL 4QEGA 5C0JB 2VXSH 5T3XH 2XZCL 2X7LA 1AFVH 3ARGA 3HAEB 4K71B 2V7NB 4PP2A 3I84A 5T3ZL 5SWSB 1Q1JL 1Q94B 1ACYH 4CRPA 1A14H 3PGFH 3GK8H 4J8RB 5DK0B 4YBLB 2EDWA 2G60L 1BIHA 2KPNA 1A7OL 4JPVL 5IR1A 3VGDA 3HTLX 2D0FA 1YPZB 1HEZA 2J8UF 1AHWA 3IAGC 4I77H 2FO1A 1JUFB 3QJFA 2NW3A 2AI0H 2H9GB 4PJBA 1F02I 3ECBA 5F8RC 2DI8A 2NY2B 4P5TD 5FM5O 1DQQA 5CJXA 3T8XA 1XGQB 3UAJD 1ZK9A 4BZYA 1YMMD 5DK2B 4XCFH 2UYLB 2IAMC 2IAND 3ESVF 1CICA 4MXVF 1UEYA 4IRJB 3BSZL 5ANMA 5ERWA 5LBSH 5KOMC 32C2B 4Y4FA 3IDYC 5LAXA 3O0RL 4LCYA 5DJ8B 1H3GA 1VGEH 3QDME 3QCTL 1ZHBB 3FQUB 3O6FB 4O58L 5I76B 3QEQB 3VFNB 1JZ7A 2CUIA 1JWUB 2VC2L 4PJCB 3N0PB 3HI5H 2B2XL 4R90H 5F9DC 4JDVA 2VXQL 4NQXA 4R4NC 1I8LC 1NCWL 5F9WC 2VDMH 4A6YL 5LKNA 43C9A 4KK5D 2X70A 1NCUA 3EO0A 3FQRB 3ZO0A 4UBDC 3RGVB 4JZNB 5F44A 2IH1A 4WTZA 3GRWL 4FQCH 1GXEA 3M45A 1ED3A 3ZE0E 2FYYA 4XRCB 4K94H 5ISZE 1X5HA 1T1XA 4DGIH 3NZHH 2IBZX 3MRLA 4OD1H 4OZFG 4OQ1A 1I8IB 1RVFL 5C8JA 1WGOA 1UA6L 3DGCR 1XF3B 4R2GC 4JFFA 4JAMB 5HBBA 4H26B 2F54B 1CDHA 1VFAB 5JW3H 2MHAB 1U8IB 3RIAF 4KRPB 1MJ7L 1QFHA 2HFFA 5HGAB 1Y6KR 5BVJB 1W0VB 3K81A 1TJGL 4QRSB 1RZJH 4PRHA 3G6DL 4Y8AA 4DGYL 4OGYH 2HFTA 3D25A 4ERSH 3FN0H 4TNWF 3RNKA 4NCC2 2OL3H 5HVGB 4S1DC 2W60B 3O8XD 2ZUUA 1MFAL 1GGBH 3JUZA 1XGUA 3EJZD 3JTSB 3ARXA 3IDJB 1QUNA 1J0JA 4WY7L 1EV2E 1LD9A 4P46B 2O61A 2NY1C 4WGVB 2D0GA 2UZIL 5L8KB 4JFYA 5E6IB 4S2SB 2LU7A 3CU1A 1WC7A 1A6AA 4NHUA 2X6MA 4X6BB 4I4WB 5JW4N 4ISVA 4QYOA 5I16B 1YMME 1OSPL 5FYKL 5CEYA 2IANE 3LEYL 3QQ3A 1D9KA 1MUJA 4XX1E 5IEKB 1T0MA 3BQUC 1JGLL 2OTWB 3RPIB 1JBJA 5KW9H 2Y23A 4WEBH 1JZ6A 4R7NA 3GHBL 2JKXA 5FK9A 4BH7A 2UY6A 3DVGB 1P1ZB 3GBLA 3TVMB 4OTXH 2BNQB 1JYNA 2P8LB 3GSWB 4YDIH 4MA8L 5C2UB 4JRYB 2CDGB 3DV4B 3ARUA 3MRNB 3O81A 3ZE2E 4XVTL 1YY9D 3F12B 3C6LD 1EX0A 1EUTA 5SWZD 3MGOB 4APQC 4LMQI 3H7BB 1LO4L 1U3YA 3QJHA 3C09B 2OL3A 3CZFB 5T33L 5E2UH 1QRKA 3HMXH 1NBYA 5T1LA 1WLHA 4ELKA 5IHUL 4M5ZL 5KSBF 3HC4H 4PJHE 4LHQB 1FP5A 3LKNA 3QDGA 5F7EH 1MCDA 4K2UH 1CG9A 3PWNA 2DQFA 2O5ZL 2ZKHH 4HGWB 5C0AD 4RGOL 3HB3D 3VFMA 4ZFGL 1NBZB 4OZHA 1NEUA 4EIGB 3P4MA 4YUEL 4BZ1L 1WWAX 1BJ1H 1BQLH 2ZCKH 1H3PL 3QHFH 2FX9L 2IALA 3TH2T 1OD7A 2CDEA 3JV6B 4QRQB 1JNJA 3AAZA 2V5RA 4HXBH 1SJXA 4I18C 3NCJL 4POZC 4Q97A 1YN7A 1UM6L 3D0LB 4KJWD 4LNRA 5F8QC 3VFWB 1PW3A 2C4FT 1ZS8B 3SDXA 1CLCA 3B9EA 3IJYB 2E8ZA 4LCWB 1A6UL 3ARGC 1V3KA 2DM7A 3HMXA 5AYUL 4QHMB 5E2TL 3HPLB 5HDBE 2M26A 2VDLH 2BOCB 3BH8A 5C07D 3CC5B 3MA7A 1QSVA 1UZ6F 1X5XA 2LFGA 2CR6A 3WIFA 4P2QD 3VGAB 3B5TA 3TA3B 2ADFH 4NKOA 3L5XH 2NMSA 5EU7C 5IVZA 1AHWC 5MHSD 2WAHA 1GOHA 1I7TA 1H15B 3WKMH 3VRIA 3STLA 3BO8B 3WE6A 2P44B 2CKBB 4AL8H 4KJYA 1M7DB 4PB0L 4Z7NE 4J6RH 4M6OL 1M1SA 3S4SG 1JF6A 1ETZA 4AENA 5CJXC 4HCRL 5SWZE 2DKUA 4OLXL 1ES0B 4P4KB 2FZ3A 4C55A 3ZKND 2YK1H 1CICC 5D7KD 4HZLA 1FFNB 4JB9L 2XN9D 5TE4H 2ESVB 5F96L 3K8LA 4PR5B 2A73B 4Y4FC 3UPRA 3HRZA 5T5FH 1LEGB 2UVEA 3WO3B 1PY9A 4F9PA 5HVHC 2NTFB 4Q0XL 4GKNA 1GZPB 2FJGB 3QFJE 1KENH 4NO5B 5C0AE 2YD5A 1KN2H 4CU8A 1QRNA 1RZ8A 3IDGA 1DUZB 2PYEA 4PJAE 3ETBF 4J7RA 1LO5B 1D5XA 2AAVA 1EAPA 4XNYH 4E9LA 1ZV5A 3GSQA 3IXAA 4NJAL 4ZUTB 2ED9A 1AGBB 1FRGH 4PJFF 2D4FA 3NVQA 2XQBH 4ZMAT 1IAOA 2DQDL 5ID1B 2Q8AH 5GJTL 4F58L 1A9BB 2HG5A 1U8QB 2EDRA 1C5DB 4PIRF 4LU5H 1G7JA 4X9BA 5EU6D 4K8RH 4ZUUA 4DUWA 4FTVB 2CQVA 5KTEL 2WZPD 4O51B 1J8HB 4XNZC 4QRTB 4R26H 1X5FA 1M6OB 1S9WA 4WO4B 2WLZA 3U7WL 1F4XH 1DANT 2DOCA 5F1NB 5D5MB 3D87B 1WEJH 2E5EA 1CWVA 3PGCA 5EC2B 2HH0L 5C07E 3VXNA 3FOMA 3WBDA 5I1GH 3X12A 1XIWB 1TZGL 3MRGA 4LHUA 5DRZB 1TVHA 3ULVD 1I1AA 4P2QE 3TNMB 4YPJA 2VDQH 4IRSB 5CJQL 5D1ZB 4DKFL 2B20A 4HKZA 3T0EA 2DWDB 3A6BH 5CKAA 3KJ4C 5GGRA 3CDGB 5MHSE 4HEPG 2A9ML 3PDDA 5BJTA 3AB0C 4UNUA 2AJVL 1IBGH 1S9YB 4RRPA 1YNLL 1B4RA 1K4CB 4JM2F 3C5ZA 4HBCH 3MZTA 3OF6A 3MJ7B 4K94C 1IC7H 1D9KC 1CDIA 5D7KE 1JPGA 4GMSL 3WHE0 2FJHA 3FHQA 3UBXG 4K9EH 2XN9E 5DA0B 2LVCA 3QXWA 1S3KL 3DUSA