3C5SB

Crystal structure of monoclonal fab f22-4 specific for shigella flexneri 2a o-ag
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
215
structure length
198
Chain Sequence
EVKVEESGGGLVQPGGSMKISCVVSGSNYWMSWVRQSPEKGLEWVAEIRTYYAESVKGKFTISRDDSKSRLYLQMNNLRTEDTGIYYCFLPMDYWGQGTSVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab F22-4 light chain
publication title Structures of synthetic O-antigen fragments from serotype 2a Shigella flexneri in complex with a protective monoclonal antibody
pubmed doi rcsb
total genus 38
structure length 198
sequence length 215
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c5sB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c5sB01
5ICXB 5JUEL 3MROA 5GSRA 3CSPA 4LAQL 4G6FB 5E2UL 2WBKA 3S4SB 3U82B 4KUZL 3U30B 1N26A 1UEYA 5D6CA 3B6SB 1T83A 2VLKD 3HI5H 2RBLA 4LP4A 1JPFA 3HG1D 1P84K 3DV4B 1YECL 1SHMA 2HRPH 5KSUB 1KTLB 4YXLH 4DFHA 1MCCA 3BKMH 3CGTA 4HCRA 5IIEA 2I26N 4F7CB 4JPWH 5DD3L 5C08A 2WBJD 3QCUH 3MRHB 4RMVA 4JANB 5CUSL 2E7LA 4KMTH 1QSFA 1RUPL 3AM8C 1FYTA 1MEXH 1Q94A 3S3PA 3PL6B 1NJ9B 1QLEH 5SV3A 3IFPA 2Z93A 5HHME 1G9EA 4Z78B 4GQPH 1E6OH 2HJLA 3U2SB 1DN0B 3V52L 3NN8B 4U6VL 4HK0B 4S1RH 4QXGL 3TEUA 4Z0XA 3KVQA 4UU9A 4XCYB 4P9ML 2XZQH 3A6OA 3L95B 4J6RL 3ARFD 4PB9H 5K9JL 5FGRA 5HYJB 3NABH 4UINL 2EDLA 1I1AC 5GS0L 3WLWD 3T2NL 3ELAT 2XIDA 5T3XL 5EIVA 2J8HA 4O02L 3IDUA 1MI5A 3SDYH 3RVTC 2V2TA 1JGEA 1HH9B 3O3UN 2X7LB 4UILH 1BQLH 3C60C 1WFNA 1JNNL 2AV7A 2DWEB 4BQ8A 2D0GA 4FP8L 1YYLL 4EBQL 1RHHB 4G9DB 2NX5D 5LBSH 5DHVB 1CGSH 2Z92A 3IFOA 4P2OD 4M61A 4HIEB 4XP5L 1IAKB 5D5ME 5B8CA 4FQHB 4OTXL 2IBGA 3RTQA 1MHHB 2B5IB 4HS3A 1HWHB 2FGWL 3GSWB 2WUCL 4YGVA 2ZUYA 3CJJA 4H5SA 1CS6A 5J6GB 5IB4A 3IXTA 4BH7A 3QHFH 3OKYA 4RGND 3LKSB 3OX8B 4ODXB 1P7KA 5F88B 4LDLB 3I75A 5BW7C 4IM8A 5GS1C 3QUXD 3AU1A 3BDYH 4TVSa 3VU2A 4EN3D 3X17A 1I9RH 4MNQD 3O3EB 1I8KA 5F9JB 1ONQA 3K8MA 1U95A 1G7HA 3GSRA 1K9TA 2N4IA 1IM3B 3CXHK 4Z8FH 4I77L 1P6AB 2J5LB 4ZS6C 4CMMB 4QRPA 5MEOA 1UACL 3EYOB 5DFWH 1UJTA 2HT3C 3C2SA 3L5XL 2BNQB 3CDYA 2VDQH 3S96A 3TT1H 4F7EA 4BSWB 4U1NB 4JG0L 3REWA 3SDCA 1ZVYA 4KDWA 4BZ2L 3RZCA 3WUWA 4NIKB 5GRWA 4Y16C 5SWSA 5DLMH 1DFBH 3MXWL 2BHZA 3B5TA 3GMNB 1DR9A 3LQAH 3ULVC 3QAZC 3UBXB 1BVKA 3EGSA 1DQJA 4KJQD 1MFDH 3QFJB 1OPGH 2IH3A 3HI1B 3QQ9C 1S9VB 2M2DA 1MFBL 4Z7VF 4HLJA 1YJDC 2EDDA 1YEKL 1QFPA 4MA3A 4YE4L 4TQEH 5GGTL 3ZT5A 3P30H 4ZPTA 5C6TL 3VGDA 5IKCA 3K46A 5CGMA 4N68A 5H35B 5JPMA 2HN7B 2YUVA 5DJXA 4OM1H 2NY3C 4G8GA 1KELH 2OBGA 3RDTB 4UV7L 2GTZB 1CWVA 2FO1A 4WUUE 4M1GL 5C3LD 5C0EB 1SM3L 5JDSB 2FX8H 4JHZA 1LO0L 4PJ8D 1KB9J 5FYLE 3GFUA 3EHBC 5MHSE 3KLAB 4U1KB 3X11A 3TN0B 3VXQA 4BM7A 2AXGA 1H3GA 3FHAA 1V8HA 2DM4A 3OB0H 2G5BB 4WEUD 3NIGF 1JGLL 1FRGH 4OIAA 3SKMB 1NCTA 5DMIH 4YHNB 5CEXA 1AGCB 3AM8A 5GGRB 5JQ6H 3WKMH 1S7SA 4WUKL 1PG7L 4ZNEA 1UCBH 2WW8A 3MRCB 1QKZH 2X89D 3TFKC 5GS0D 5DDHA 3PGFL 4ZSOE 3KXFE 2VUOA 3HNSH 4PP1C 4G5ZH 5FYJD 1BP3B 1N3NB 3HPLB 1XCQB 5DD0H 2ZCLH 2NNAA 5IF0A 3GBNL 1YQVH 3IJHA 2IMMA 2V2XA 4F7MB 2Y5TB 4JN2A 1J10A 4FZ8L 5L88L 4NZTH 4P4RA 3PABA 4RRPG 3O9WD 3IJSB 3UTQB 5ID0A 1IGJA 4CADB 4L29B 4NM8L 1I1AA 4R0LC 2NXYC 3WXWL 4X98A 1CFSA 1T20A 4WGWB 5I8CB 4R26L 3BW9B 1BOGB 1TJHL 5L2JB 1XZ0B 2P43B 3BPOB 1SY6H 1DDHA 2QQKL 1I7ZB 3HZVA 4L5FH 2Y4SA 1OTUC 4AENB 2EH8L 1A4JA 3I2CL 4PV9B 2ZZUT 3C60A 1KF9B 1V3MA 1UB6A 4PG9B 4Y5VC 1AR1D 5D2LA 1IC4H 3KJ4B 3ZTNL 3FO9A 3V79C 1QYGL 1KIRB 1ZVSA 3ESVF 5I8OL 4KJWD 4HPOL 1UZ6F 5SWQB 4Y89A 1ZS8A 3X14B 4G6AC 5F7KC 3R1GL 1T0MA 3BP7A 1NGWA 4D9QD 5A40E 2LAGB 1IGIL 1MPAH 1FNAA 1I8LC 5K9QG 5GGVY 3TNNA 1XGTB 4GAYA 1IT9H 1KG0A 4O4YH 4APQD 1AKJA 3GRWL 5ITBL 1CDUA 1U6AH 3DO7A 1IAIM 1MLCA 5JHDE 3NPZB 3MC0A 4I5BB 4EI5C 1HCFX 3OKKA 3O3BA 5BW7A 2BDNH 5GS1A 1KPUB 4YK4C 3VD4A 1EHXA 5F7EH 3DRTB 5CP3H 3BGAA 1BBJA 4LSSH 5JTWA 2J6EA 4FXGB 5DVOA 4Z7WF 3U4BH 4U1IB 5F9OL 3REVB 1F8TL 3EOBA 4MSWA 4FRWA 4ISVB 1S7XB 4KI5F 4NZRL 4IHOA 1KN4L 1S7VB 2V5SA 1KBGL 3PHQA 3U0TA 4OJFH 2P8LA 5IK3A 4L3EB 5I75B 2OI9B 6FABL 2VXUL 3WO4B 3SGEH 3RL1A 2P45B 3GM0A 1LEGB 3M17B 4YDVB 5HHPA 3CU1A 3R8BB 3QNXA 1OT1A 5JW5B 4PY8J 3O6MH 1F3RB 2IEPA 4UT7L 4HJJH 4N9GA 3ZKNC 5BVPL 4Y16A 3MLVL 1KFAH 2RCSH 4PRDA 5FXCH 4H0GA 4KK5D 3WD5H 4OIIH 4W4NA 1NCDL 3MNZB 1TVBB 3RWGB 1U8LA 3OJVC 3N1MC 5ELIA 4GG6B 1U3YA 3ABZA 3MMEB 2R0LH 3WFBH 1NMAH 2EE6A 1AHWC 1JN6B 3EO0B 1JYWA 5KJRL 5EOCL 2JJUA 3KNBB 5KBNC 2BY0A 2YN3A 3TCLB 4I0KA 4XNUH 5TE7H 5LAXB 3OAYK 3JUZA 1GPOH 2FL5B 2ESVB 4L9DA 3H9ZA 4AH2B 3TJEL 1AC0A 4HX1B 3C87A 5B39B 4JO1H 3TPUA 2DI7A 3DUSB 3GSUB 1S9XA 4L4VE 5FHBL 3TA3C 1R3HA 2PYEA 4DN4L 2B7DT 2EXWD 2P8MA 3STZB 5L0QC 2Z0BA 3V4VL 5F6HJ 3ULUL 1BM3H 3TVMD 4JFQB 1AXSB 2I24N 5CJOL 5FGBA 5HBBA 3DIFA 1RHFA 5MEQB 4OF0A 3S34L 4N8VG 4AEHH 2CR6A 2OZ4H 2EDNA 4LMQI 1C5DA 3WSQH 5IJKC 1GSMA 1B3JA 5HTSA 3T0BA 3CZFB 2YXMA 1CT8A 3TBTA 1T1ZB 1NAMH 4ESKA 3CFDB 2ZKHL 3OKOB 2NY5C 4QHUB 1J86A 3QG7L 4AQOA 3QQ3B 4LSQH 4OZHE 5EUOF 3V5KA 3VMOA 2A38A 4PRPB 5IMLA 4GRWH 4YH6A 1G0XA 4NQXB 1KULA 4DUWA 4R2GD 4R96B 3HE7B 4KQ3H 3UYPA 2BNRD 4P9HH 5DRXB 4R0LA 5C1MB 2DM2A 4GRMA 1MOEA 5ANMB 2H26B 3GI8H 1F4XL 2QR0A 1YMMA 3S36L 2Q6WB 1QO3A 5FDWB 4NQEB 1F3JB 3GMRA 1MAKA 2VDPL 3H0TA 4ZODA 4BSJA 2W9DL 3MBEB 3RIFK 4KKCC 1GZPA 1CE1H 3CFEA 1J8HD 4Y5VA 1OOAA 4J1UA 4X4YB 3HRZB 5EPMB 3P73A 4WU5A 5SWZA 3L3GB 2GJ6B 4N5EC 2ZNWA 4HUWA 4KTDL 3AVEA 3DSNA 3MRPB 5JW4N 3QEQA 2F54B 2NTFB 4BA8A 3UC0L 4LPYA 3EYFA 3OPZH 1CVSC 3QXAA 4UQ3B 4U2YA 1I8LA 3IDNA 1URLA 4XPAL 5HVFB 3OZ9L 5DFVC 1J9CT 2B1HL 4QOKA 4XC3L 4ZXBD 5CGYC 1D6VL 4HULB 1EFXD 1F3DH 3PNWA 1V3JA 1MJJB 3SGJC 3RPIA 2EDTA 4YNYA 4ZTPH 3T2QA 2OJEB 3RVXC 2FSEB 4EI5A 2PKDA 3S6CA 2AEQH 1S7TB 4PJCB 3WIFA 1GHFL 1VPOH 3NAAH 1BD2E 4I9WE 5D8JH 4EIGB 4DEPC 4X6EA 4JKWA 4RAVA 5D1XB 1NFIB 1CGUA 2OP4L 4M6MH 5GGSY 4O5LL 2E27H 4WJ5A 3S37H 3ZLQC 2ORBH 3QCTH 2Z91A 2HAZA 5IVNA 4E5XB 4ODSH 3VCLA 1EEUA 3P0GB 3MUJA 3U0WL 4W4OC 2FO4B 2X4TA 1TZHA 1AC6A 3CDGB 4UQ2B 4GXUM 3VFUB 3QHZH 5INDA 5DURD 2NY6C 2XWJA 3UTZB 2DRUA 1LEIA 2NY0C 1E27B 5I1JH 5JXAH 3KLSA 1UT9A 4NQCA 5AYUH 1A3QA 5D7IA 3KYKH 1BFVL 1DEEB 2IPUG 5I1LB 1MIEH 2DM7A 1X6NA 2DWDA 2NY2C 4KZEH 3KYNB 4LU5L 2AQ3A 2PF6A 2UWEA 4HK3N 4UZGA 2GK0A 2VSDA 4TOYL 5FOJA 5E2UH 1HNGA 4HDIB 5B21A 2BSSA 1B4RA 1AHWA 3AUVA 1EGJH 4X4XA 5ICZA 1AGEB 3T0EC 2NPLX 1FG2A 2AKRA 3MRRA 3ARYA 4LHUD 4M93C 3RGHA 4LVNC 4CN4A 2RGSA 1CXKA 5T1LB 1NCAH 5IHZA 4EUPH 1TJGL 1WIOA 4R9HA 5EOQH 3EYSL 4P46C 4ZS7L 5FKAA 5CUSH 3BXNA 3FZUD 4KI5C 4RWYH 4P23B 3IDGB 2Y5EA 3TA3A 4IRJA 1K4DB 1JMXA 3DXAA 4QRSB 3MLUL 4UNTA 4AEEA 4Y4FD 1F45A 5ESAB 5EO1B 5HYQB 5KVFH 2DQEL 2HVKB 2A77H 1RIUH 3WS3A 1HZHL 5D1ZB 5IVZB 2AJZA 3BT2L 4KKLC 1SBSH 3FONA 4FG6C 4LP5A 2VDOH 5IJKA 4GKNA 1MWAL 4J6RH 2DL9A 5IMKB 1AE6L 2AJXH 3MJ9L 5JMRA 4UINH 4BQBA 2R1WA 4GH7B 3GJFH 3JV0A 3M8OH 5E08H 1NSNL 4M8VA 5GS0H 4J3OC 5FYJH 1GC1L 1Z3GL 2GHWB 2NTSP 1MCOH 4PJHE 3IGAB 3BIBX 4G6KL 4ONHA 1ADQA 1GH7A 3TBYA 1NBYA 2LTQC 4BQCA 4Z7VA 4MA1C 3CUPA 4GAJL 1OTSC 4PJBA 1S9YB 4PV8B 1A7RH 2V7NA 5M95B 5C0NC 1YY9C 4D8PB 1ND0B 3VG0H 1MCSA 2IAMC 3C09B 1T04B 2VIRB 1H15B 1X7QA 2VMFA 1WAAF 4P57B 5CD5C 2VZTA 2J7LA 3N9GL 2F8XC 2FGWH 3QIBC 4FQQB 2I9TB 3KPPB 2H32A 5I1CH 4H25A 5CBAA 4NRXB 4NKOB 2BNQE 3WL9A 3V5DB 1H0DB 3VGBA 5KVDL 4NC2B 3FO0L 3INUH 5L6YL 2QSQA 3GBLA 4XNMA 5D5MF 5IBUG 2R0KL 2ED9A 5HSFA 5J06A 3QIWB 2AI0L 3O2DL 3VXSD 2C9AA 1U9KA 3BEVB 3D2UD 4U1JB 1YDPA 3SY0B 3HZYA 1JHTA 1RZFL 3PWLB 1IE5A 4GAGH 3SGJA 3FOMB 4ODUB 3FQUB 4A6YL 1DBBH 1TTGA 4JM2B 1BHGA 4XCNA 4JDZB 2VDKL 1G1YA 1UACH 3H3KA 2C3GA 2HH0H 2DKUA 1KN2H 3HB3D 3QFJE 4YXHH 3D25B 3ESUF 4PUBH 1KGCE 1IBGL 4HSQA 2VLJB 1N59A 3HZMB 4YHOL 3DROB 1W2KT 1XF2B 5I15L 3QXDA 4M4RA 2PXYB 4YHYB 3NIFE 1MCPH 4KQ4H 3PIQB 4GW1B 1WK0A 2DICA 4Q6IC 5DMYA 1A6VL 4W4OA 4L3CA 1FVDA 1T2XA 2J4WL 4FNLL 1BWMA 4OF8A 5ETUB 4TSCH 4XGZA 3KPRA 1T89C 5GGQH 5KW9L 2OL3H 1XGQA 1IC7H 2YUWA 1MFBH 2VLLB 2DJUA 3FT3B 2VXVL 4YE4H 3MRQA 4CL7A 4MNHB 3TYFB 4K3DH 1EVUA 2XZCL 5C0IB 3D6GA 3ZE0F 1N5YH 2ICEB 2B0SH 2PTTB 2UVFA 5L2KA 1J12A 2VLRE 4H8WC 5CAYB 4DWHA 1I7RB 1LK3L 1N0XH 5JNYA 4Y5YC 1TJIL 3RWDA 1A2YB 1CFVH 4LSDA 4NO3B 3LZFL 4ODBD 3V6FA 4KKBC 5DUMH 1LP9F 5I18H 3T0EA 4NWUL 2SEBB 5EZIH 1YEJL 4G3YL 4OD3L 1NBZA 4HS8H 4MQ7B 4NT6A 3TBSA 1K8DB 1PGRB 2HT4C 4M43L 4MAYC 1QZ1A 5I1IL 3LN4A 1JGLH 3LQZB 1ZT4A 2F8VA 4P46A 3MV11 3N1GC 2KH2B 3I9GL 1U42A 4JDTH 1AGDA 4UDTA 1OM3H 4E41B 1LHZA 2BC4B 3QNYA 2FR4B 1R3JB 4YAQA 4P3CL 1WQVT 3MRLB 5I76A 4N1HB 1YC8A 1L4IA 4F7TA 2L4OA 1Q1JL 1VFAA 2BSTA 1A1MB 3GBNH 1KCVH 2DIJA 1GGUA 1U8IA 1JWSA 2GAZB 2OQJB 4LSRL 3VI3E 3O4OC 1ZHNB 4CAGA 4DTGH 1I1FA 3Q6FB 2J3SA 3NA9H 4NM8H 1MCJA 3DUUB 1DJSA 1A3LL 1BFSA 1R3IL 4MLIA 2J8UB 3WXWH 2VISB 1VGKB 1YYML 3BSZH 4JZOA 1TJHH 3NCBB 2Q86A 5F6IC 4U6YA 5BS0A 2VDMH 4WEMB 3LKQB 3O6KL 2QQKH 1LD9A 1GGIL 2CIIB 3HS0A 5J11C 5DJ6A 1RY7B 3T1FB 1NH6A 1QYGH 1HEZA 3IKCA 1OAZL 3R06A 2IAMA 2RAMA 1GGBL 4X5WB 3EYQD 4HPOH 3C6LB 5FO8B 4Q6YA 1Q38A 2NW3B 3A67H 5FGCE 5C0AB 5K59E 4ODVL 4JR9L 3QIBA 4XNQA 4UUJA 2VXQL 4ZOEA 2HJKB 4LCIL 5DMGD 5JORA 3SDAB 1TVHB 3GRWH 1QNZL 4G9FD 3O45B 2O5XH 2AS5M 3TJHC 1OP3H 2NY7L 1CD1A 5GGSB 1W72L 1MCWM 2FRGP 4IRSB 2XACC 4PJFF 4J3VA 5FHAH 1E4WL 2X2YA 3KR3H 2EH7L 4YBQD 3D3VD 2NYYD 3QIUD 1FAIH 1FO0H 1PG7X 3QDMB 5BMFL 1F8TH 3RHWF 15C8H 1S3KL 3R8QA 2C1OB 1OF2A 4JREB 2CH8A 3QFDA 1MHCA 4PREA 4QRQA 4POUB 1QBML 1ZVHA 4Z76B 5EA0L 5DD1L 4KK9C 6FABH 2VXUH 2PTUA 4P4KD 4KAQL 1PG7W 1PX3A 1P4BH 3SPVA 4GG6E 5EUOA 5IHUH 4JFDA 4M6OH 4JRXB 4NN6C 3MRJA 3DRQA 4YGAB 4K7FA 3AREC 5F89B 5A16A 5SV4A 2CO6B 5FUZL 5C9JA 4M5YL 1K2DB 4UIKL 3O6LL 4PJEA 1FNLA 2F74A 4U33A 1BGXL 4IIQC 4YHIA 4OCWL 5CCKH 1BLNA 1X5XA 4Q6IA 1J0KA 2QQLH 2ESVE 4DN3L 3D18B 4G42B 4K94C 1NCDH 3OGCB 5CKGA 5T3XE 1OAKH 4U1HA 1T89A 2X4PA 3G5ZA 4GOSA 1G7IA 1KTRL 3PWUB 1Z5LB 1Q0YH 3PQYB 5J1TC 1Z0MA 1QFWI 2ZUQC 1NPUA 3MLPA 4ZFFA 1AI1L 4ZAKD 4HWBA 4MJIB 1MWAB 4HMDA 2C1PB 2P24B 2P5WE 4RMWA 5TH2A 1SJHB 3PXJA 3WUZA 3KLHD 5D1QB 3MX0A 4Y5YA 3NPSB 4OLYH 4HKBA 2ENYA 4MHHI 5HHOA 3P11H 2CSPA 1SJEA 3FN0L 1ZLUH 2MHAA 5E03A 4S1SH 3CFIC 5FHBH 3QDHA 1CIDA 4QNPF 3ARPA 3O4LD 4MNGA 4M3JA 2A74B 1AXTH 4N90E 4MAYA 3FQRB 3OR7B 3ULUH 3U7AA 5T3ZL 2GKIA 1I8MB 1JUFB 4PIRF 5CJOH 5EIIA 5L7XH 4Z0BH 4Y4HD 4XMPL 5ANME 1DQLL 1FYHB 3MJ7B 4PJAB 4AK1A 5TPWH 4FHBD 2A73B 35C8L 5HDQL 4X99B 2ZJSH 4EOWL 4WTZG 4HXAL 4KY1H 5D7JC 5E9DE 4Y19D 4F37K 5IW3A 2AK4A 2K7PA 2GJ6E 3TPKA 1OGAD 4Z77B 3BPNC 3ZE1E 4S1QH 1J18A 4MWFB 2F54E 3QUYB 1RK0B 5CD3B 4OGXL 4W6YB 2ADGA 2F5BL 1W0VB 1BFOB 4LLMA 1F4XH 3RVVC 3BEWB 4N0UA 4NKIL 3DV6A 2IQAB 4A6YB 1P7QB 3VFRA 1MCBA 1X6LA 2W9DH 4OZHF 3BP4B 3G6AB 2XA8H 4WI9A 3KYOB 3GBMH 1MCEA 2FHFA 5HGDA 4AIZB 1T2QH 4PJCE 4GW4A 1NFDA 4KTDH 5D7LD 3HLAB 4OUUA 4N8VB 2MJWA 1INEH 3WNKA 1F6FB 2R2HB 2OX5A 2Z31D 1IGMH 1MREL 3ZO0A 1P4LA 4FTVD 4PR5A 1G1CA 4LVOB 5EN2A 3QUKA 3LEYL 1AD0A 1NCCH 1C5CL 2VR5A 2YK1L 3QCVL 3LN5A 1MNUH 4QEGA 4TUKL 3D69B 2CJUL 5FKPA 3L3DB 1HQRB 3KWWA 5DC0A 3FB8B 2Q8AH 1KIUA 3RWCA 1EEYA 2EDBA 1RPQA 3QJFA 4OT1H 3WFCL 1F90L 1LDSA 3T0VA 5DJYA 4HIJA 3UJTL 1N6QH 3U0PA 3MV7B 2AK1H 3GSQB 2OP4H 2MCPH 4WFFE 5C08D 1C08B 5AYQA 3QA3A 1UB5B 4N5UA 2NY1C 1FYTD 1C7TA 2VLME 5CZXC 1K8IB 4Z7UE 5DJ2B 3AREA 2RFXA 3VFOB 3WHE0 5I2IA 1F2QA 4XI5C 1P53A 1T7WA 1XGYH 2XN9B 2IF7A 4YC2B 4IIQA 2VNCA 3S36X 4G7YH 2A83B 4IRZH 3VRJA 4RMTA 4JZJC 1HSAB 4JFFE 1ZEAH 4HH9A 4RCAA 5EWIH 3T0DA 1A1OB 4LARH 4LU5H 2OXGA 1FCCA 3TCXA 3L7FB 4QGYA 2OR9L 3MGOB 2RIKA 1HHJA 5DUPL 4OSUH 1CF8L 3P4OA 2AGJL 1HH6B 1MI5D 5EU5A 3ARDB 5BV7C 1NEZA 2AV1A 5IVXB 1MY5A 3L7EB 4X9IA 5D5MA 1MH5B 3F7VB 4PBXA 3WIIH 5IFHL 3VXRE 5E6YA 1QSZA 3RUGB 43CAA 5JPNB 4HGWA 2HTKC 5EU3B 1PD6A 4QTHA 4D94A 2JIXB 1FL3B 1QRNE 3DJ9A 1RIHH 4ZS7H 4N8CH 3KJ6H 3UJJL 3D85B 3QULB 2XPGB 2YMXL 4KROB 4NN5C 4O2FB 2DN7A 3CPLA 5MEPA 2COQA 2DQUL 3E6FA 3V5HA 3CH1B 1NCWL 1WZMA 1WWAX 3RWEB 1HYRC 4TULL 5HI3C 5DRNA 3OJDA 1ORSA 4RGMC 3Q48A 1WIPA 1K85A 1U92B 1SYSA 5MENE 4DVBB 3V0WL 3MJ8B 1RVFH 3CDCA 1UWGL 4OLVL 4MJ2A 3BJLA 3LRGA 3C5JA 1OTTD 3O41A 1DANT 1KTDB 5C07B 2IC2A 1RULL 4HJGB 5GRVL 1AE6H 1S7RA 1IILE 3L5WA 5D7JA 4TSAL 1UM4H 4QRPD 5J7CC 1T1XB 2WMPA 3QDJA 3U1SH 3M45A 3PP4H 1PDKA 4YHMH 3D87B 2M8XA 5CBEB 2WWKO 1IJ9A 4JKPL 5FM5M 3OAYH 3MGTA 4OAWB 1JYVA 4Y2DC 3MYJA 1G9NH 2H9GB 2P4AB 4LHUG 4X7EC 3SDCD 3RZCD 1FNSL 4N0RA 5JZ7C 4UOJA 3EDEA 4WI8A 3W0WE 4HC1L 5SWSD 3TO4B 1P5VA 4PJHF 1KPVB 2HFGL 3QWOA 4LDOB 4AL8L 1VADA 5HHQA 3I6GB 3TH4T 4HT1L 4PB0L 4FMKA 4FFZL 3LCYA 3D5OF 2JB5H 1A6ZB 4CDGC 3BZ4A 4TTGA 2W60A 4HKXA 2BNUA 4PTTA 1S8DB 5E2WH 3H9SB 2VLJE 3FO0H 2Q8BL 4HWZA 1W0WA 3OKDA 3NCMA 4F2MA 3FKUS 3S88H 2IG2L 2R0KH 1RMFL 3T0WA 5TE6H 4M4PA 4TN9A 3CSGA 4G8GD 4XXCC 3FQNA 1RZFH 2BOBA 3CFBB 3BKYH 1DE4B 2B4CH 1ORQB 2W38A 2DI8A 2VDKH 2O61B 5MP6H 1UGNA 4W81A 4XPBL 5MI0B 1J0HA 2VLKB 2DDQH 3DWTA 2ZUUA 4JFOA 3HG1B 2WP3O 5GRUH 2H6PA 2F5AL 5C0RH 3K3QA 5I15H 1J0ZA 2IQ9L 2CQVA 1IGYB 2WBJB 4LEOA 1ZHLB 2VDNL 3BP5B 4OZ4B 1YEDA 2D7MA 5ESQA 3VFGL 4HWEH 4OZFH 3VWJC 4ZSOA 3KXFA 4R7NB 4HIXL 5HPMB 3D39E 2XTLA 4LLUB 5BOZG 2D3VA 2RJMA 1CK0L 4NNXA 5DEFA 4P2QB 1NAMB 2J4WH 5IB2B 1JV5B 5EO0A 1JL8A 1U8OA 3QNZA 1U8QB 4BK4A 2BVUA 5IBUB 4DGVL 2ZG2A 5KW9H 1Y6NR 1G6RA 1HXMB 1X9QA 4B5EA 4KXZI 6CGTA 3MOBL 4JZJA 4PP2A 1S7UB 5CZVL 5GSVA 2WZPD 3ARFB 2BK8A 1AGBA 3DX7A 3VFVB 1I1AD 3BH9B 3LQAC 4DGYL 4JQXC 2BOCB 4JEGB 3NCYS 5IGXL 1T1YA 1U93B 5HDLA 4GRWF 3BAEH 3V4UL 1IAII 1BVZA 3DX8B 4NC1E 4QT5B 4AMKL 3B3IA 4P5MB 1D5ZA 3RVTD 4FOMA 5DA4A 2EKSA 3C60D 3LZFH 2LVEA 3VGFA 1RZKH 1YEJH 4PJIF 4PJFA 4MCZB 4KJYB 3MA7A 5KVGL 4DCQA 2YPLE 1KPRA 2YBRA 4J7RA 5KAQG 2NX5B 1GGCL 3MR9A 1AQDB 4HW6A 4P2OB 2FATH 3MRIA 1FN4B 2R1XA 1QTYT 1T2JA 1FV1B 5CEYA 4JZNA 4K9EH 3I9GH 2J8UE 1QR1B 3MV8E 1U8MA 5FYKE 5TF1L 1AKJD 5D96B 4XNZB 4P3CH 2AJ3A 1BQHA 4M7JL 2FIRT 3F6IA 4DKAA 4RGNB 1Q1JH 4LIQL 1V5JA 2Z9TA 2ATPB 3W2DH 4G80B 1TZIA 5DGQA 1E28B 1F6AA 4U0RC 3QUXB 4TYUA 4L4TE 4R97C 4EN3B 2GT9B 4MNQB 1PLGL 5EU6E 1QEWA 5C0AE 1R3IH 1HKLL 4U1MA 1MUJB 3G5YA 3WDIA 3HMWH 3VGHA 4NJAH 2HT3D 4UDUB 2APBA 1Z9LA 1A21A 5D4QA 5DVNA 1ETZB 2CUMA 3X12A 3L3OB 1HINH 1PQZB 3SE9L 4J3XA 4HFWB 2R8SH 5EU4A 4POZC 4Y2DA 5AAWA 3SCMC 2XI9A 5T5NF 1OAZH 3RFZC 4KHTL 5FGSA 1IKFH 5EFIA 4Y16D 1VFBB 5JW3L 4DKFL 1KEGH 1SBBA 5DQ9B 3EOAB 4LNRB 4ODVH 4JR9H 3BUYA 3ULVD 3QUMB 1GOGA 4NNPL 4D9RD 1J05A 1A14H 3OGOE 3LHPL 3BFOA 3EO9H 1DQTA 5JHLH 4UTAL 4LCIH 4QCIB 5E8PA 3QQ9D 4BZ1L 4DOHE 3NTCL 1N2RA 1QNZH 3Q5TA 4JRXE 3L3KB 2CDFA 2NY7H 4WW2F 2OJZH 3GSVA 4MXVE 5C0CB 3DVGA 1GOFA 5IT2H 1KJ2L 1KLUB 4HMEA 1EAPB 5K59F 2VUYA 2EH7H 1UC6A 2NY3D 4XXCA 5F8RC 5FB8B 4G8FA 4E42B 4BSVB 4PGDA 3VFMA 1FNGA 3IXAA 4U6HA 2CK0H 4PJ8B 3RIAF 3EHBD 3G5XB 3DVFA 1Y18A 2H2PC 2J1KA 2PYED 3V0VB 3H9YA 2D03H 1WBXA 3B9DA 4NPYB 5MERB 4F7PB 4FS0A 4GMSH 1RIVH 2VKWA 1CQYA 3E3QE 1R5WA 1FGNL 4OLZH 4XPGH 5DJ0A 1WCBA 4OLEA 4HCRH 4UIKH 2K9UA 2QJDA 4GMTL 3VWJA 4QLRA 4H1LA 2PR4L 3BDBA 5A3IC 4XAKD 3TFKD 3LSOB 3FT2A 3GDBA 4DN3H 4NO2B 1I3UA 1LE5A 4OZHA 4YO0B 1XCTB 4PP1D 2XNAB 4NQTA 4PTUA 2I07A 3MREB 4XCFH 4XBPA 1JGUL 4RGOL 1MCRA 4WDIA 5EC1A 5AAMA 1QVOA 1SVCP 3VA6A 3QJHB 1T03L 3MRDA 2EYSA 3GMMB 3VRLE 1A7NH 3HUJB 4QHKJ 5F1SA 3EJZD 4FQPA 2NXYD 3JTTB 4JQXA 4MXQC 4ZFOL 3GUTA 1YMMD 2Q7YB 3DSFL 3FOLB 3VFPB 2AEPL 2DTSA 5KS9F 1OTUD 2NY4B 4LOUC 1P2CA 4GG8B 2BX5A 1JGDB 25C8H 2BY2A 1GRWA 4OZFG 4MCYA 3F7YB 4YDIH 5CILH 2AXFB 1BJ8A 4NCC1 5F1NB 3C8HA 2R1YA 4QRUA 3M1BB 1I8IA 4R90H 2BCKB 5IOPA 3QEQD 1YN7B 4HLZH 4LCCC 5IMMA 2W0FA 4G6AD 2OTPA 3QR2A 4LFHD 5I8KL 3UYRL 3F6LA 3C6SB 3HC0B 3FO2B 3C5ZC 2AABH 3L1OL 4YWGH 1DQLH 5KN5A 2WINB 2YPVH 3ARBC 3HMXA 1VEPA 5DJ8A 4X6DB 4QOKD 3UP1A 4OKVA 1HCVA 2ZSVA 1OSPL 4APQB 2L7JA 4F57H 3MRNA 4CN6A 1ZSDA 1OW0C 1T7VA 3BWAB 7FABH 1I7TA 4EI5D 1BD2A 3E2HB 3ZE2F 1R6VA 2R29L 2V9TA 1EO8H 4YHPB 2IADA 1CU4H 3MNWB 4BUGA 5I73B 3BJ91 3EFDL 5LXGH 4JCLA 2MQ0A 5GZOC 1T5XB 1HIMH 1JRHL 2VQTA 4G43A 3VFNA 3IT8D 4ALAL 4UOW0 5GJSH 5GQBA 4ONGL 1QBAA 4J23A 4IDLA 3ZKXB 2ERJC 4YZFE 1MLBA 4NZUL 2DQTL 4OFVA 4I18B 3VFSB 1QLRA 1Q9KB 1R3KB 1FIEA 2WNGA 5HGAA 3SCMA 1LNUB 4PJXF 5DD5H 3F65A 3MXVH 1CVRA 2AEIT 3GB7A 3WLWC 4NQCD 2W9LA 4R4NC 1QFUH 1B88A 4JFEB 1MREH 4JPIA 3W9EB 3TO2B 3UMTA 2X4SA 2CUIA 2APTA 4MHHG 1B6DA 1D9KC 1B0GB 3CLFL 1MHEA 1TQCC 4LSVL 3BO8B 1L0YA 2X4OA 3IDXH 5T1KA 4I3SH 4R4BA 4XCYA 2XN9E 2CLRA 3IFNL 1GAFH 3BGFB 4QHLA 3QEHB 2EIZB 4XP1L 3O11B 4ZQKB 3FB5B 2IFFL 5CJ5A 1PSKL 3ES6B 12E8L 3H42L 3MRBA 3JV4B 3QXTA 3ETBF 4W6WB 5EOTB 3TA3D 1G7LB 4W70A 4IRJD 1NCBL 3R4DA 1KT2B 2DIAA 1V3LA 3DXAD 3IDYB 3PV6B 5GZNC 3F58L 2VN4A 1VKXB 1VCAA 4LQFL 3HPJB 3TVMB 5IVXE 2R2BB 4PLNC 1IAKA 2NZIA 4MJ6A 3GK8L 1KOAA 1MHHA 3CVIL 2OXHA 3LEXB 4N0CC 3NFSL 4GXVH 1Z6JT 1GIGH 1CR9L 1F11B 4O2EB 5I30H 4HUUB 2HVJB 4MQTB 2YEZA 4PJHA 4Z7UF 1YY8B 1FNHA 3RNQA 1IQWL 5C0JB 4MLSA 4UMGA 3T8XB 1KV3A 4IJ3B 4NQVA 1CGYA 2V2WA 3O3AB 1EH9A 5D70L 4HBCH 3UYOD 3CFJA 3GMOB 4WW2C 4ODHH 2V9RA 4FQ2L 1MAJA 4KH2A 2BNRB 1KEML 5C70A 3MODL 2IANB 3AXLB 2KBGA 4RZCB 1RZIA 2DMKA 3EYOA 3KYAA 3O8XC 4KKCD 5C07E 5BZWB 1UCTA 3WO4C 5E8OA 4GQ9L 3UJJH 5CEZD 1F5WA 4PD4J 1U91A 4OBRA 4ZTOH 3EW3B 1MFAH 2VSCA 3B9VA 4N5ED 2X70A 3QO1A 5E70A 1NCWH 1RD6A 1L7IH 3MLXL 1ZGLP 4LCCA 1QBLL 5BVJB 5F7YC 3QZWA 1G7MA 5EBMB 3Q1SL 5AD0A 3C5ZA 1JZ4A 4TSBL 3ARBA 3C2AL 3KPLA 4ERSL 4LLQB 5CGYD 1IAIH 1EBPA 3UBXA 5LVEA 4ZXBB 2AJUH 1EFXB 5EZOH 2UUDK 1OW0A 1TCRB 3RVXD 3QH3A 5AWNH 5I1KL 1HILB 1UZ8A 4M5ZH 1T21B 4NSKA 1UM5H 5IV2B 2OZ4A 2VABA 1KJ2B 1YN6B 2MCG1 2D9QB 2WV3A 4X7SL 4EI6A 1FZOA 4JKPH 2APXA 5C2BH 1ZE3C 1MQKL 1JVKA 5ACZB 1FFQA 5C0EA 5GS0C 1EMTL 1LILA 4HLZG 3TZVC 4X7TB 3MV9E 2Y9RT 3L3JB 2GTWA 2QKIB 5GIRA 4XP4H 3JWOL 3IU3A 2B8OT 3QWRA 2J12B 4AL8H 1WITA 2NY6D 3FMGL 4LPXA 2NY0D 4PB0H 4H26A 1J1XL 3KPRD 5DURB 4PJIA 4OZGE 1X5ZA 2YZ8A 4V2CB 3HG1E 2LE9A 3L5IA 4HUXB 4AQ1B 3WHE1 1NAKL 2Q8BH 4CGTA 4JG1L 2NY2D 2VLRA 4M00A 2IG2H 3WFEH 1UEMA 2I5YL 1AR1C 3BHBA 3ULVH 2FLBT 5L2KD 1D9KA 1D5IH 1UADC 4HUVB 5K9KB 2VAAA 3MRFA 5GS2H 4X6CE 2YD3A 3IDMB 4XMLH 3BZFB 2CMRH 4HGMA 4P2QE 3T0ED 4KJWC 2NW2A 1QFHA 1PX4A 2EYTB 5F3BA 1YJDH 4EDWH 5HVHC 3EZJB 2QV2A 2FYYB 1U2HA 3LKRA 4L29A 5EH1A 4U1GB 5T3ZE 2XRAL 1R5VA 1CXFA 4WY7L 2F5AH 1FIGH 3GNMH 1RZ8A 2OSLB 4P46D 2VE6B 4K3GA 4UIMB 4N9OB 5I1DB 3MBEC 3VFGH 1DUZB 4WGVB 3HNTL 1JWMB 4PG9A 3WUWG 4X9FA 5DTFB 4Z9KB 4LSTL 3ULUF 2H2SC 5T33H 1CK0H 4ELKA 5C0GB 1YUHB 2MPAL 5I74B 2YUZA 3VXUB 4GKSB 3S35H 3P4NA 5TQ2H 3GM8A 2MOVA 3V7MA 3LD8B 2NX5E 5CZVH 5A43C 1XGTA 2HJFB 3O81A 5L9DH 3CLEH 3PWPA 5E95B 4DGYH 2A9NL 2W9EL 3RBSA 1VGEL 1Q0XH 5KG9A 1MFNA 2MNUA 1IARB 5FK9B 1X5GA 5EBWB 5BS0D 4NO0D 3FT4B 3V4UH 4CVXB 4ZDHB 5J1AB 4RBPK 3IF1A 5CHNA 1B0RB 3DRTA 4RGNE 4IDJH 4WW2A 1OTSD 3RWIB 3TWCH 5C0ND 2CDGB 4MD5B 1YY9D 5D1XC 2IAMD 3V95A 1JCKA 1S7XA 3TLRA 4JPKH 3VFTA 3WE6A 1X44A 2QLVB 1RJYB 2CRYA 5GISL 3O8XA 3RQ3A 4FFVC 2ZPKH 5CD5D 4XRCB 3QIBD 4G8IB 3V7AE 2R0ZL 4XAWH 4NCC2 5E4EC 2Y7QA 2E6JA 4YDVA 1KCUL 2R0WL 3ARZA 4HIIA 5TF1H 3NIDE 3FFCE 5J9PA 5LWYH 4EUPA 3T77B 1S7QA 4P5TD 3BOVA 3FCTA 1WZLA 2HTLC 3ROLB 3E8UH 1RZ7L 2C5DC 5HD8C 4XB8A 5DK2B 4R4FL 2BSRB 1RUML 4GG6A 1FGVH 3ISWA 1W0YT 1FVCB 2B1AL 1RJZA 4JFDD 3U7WL 1DQQA 3TCLA 4LRNL 5F71A 2JK5B 5C0CE 1A3RH 1N4XH 1T4KB 4XXDB 2ESVA 1LO3L 4GSDH 4KHTH 3TZVA 3RRQA 4RFEB 1JNLL 1BMGA 1D6EB 1J1OL 4OGYL 3AAZB 2WSKA 4PJDE 5KS9A 5CMAB 1CGTA 2IFGA 4PJ9C 4UTBL 5HDBE 4ENEC 3STZA 5DHXB 3TNMB 2X41A 4JRYB 3EFFA 2FH6A 4GO6B 3NTCH 4HKJA 2DQHH 2P5WA 2BMKB 2JE8A 3NFNA 4MJ5B 1EJOL 3LKNA 3GSOA 4K7PH 1VACB 3FFDA 2VXSL 3DMMC 4JGMA 4PY7A 2QTEA 4YPGB 5HHOD 3B83A 3EZ8A 4NQSB 1UJ3B 4TVPD 4KKBD 2FEEL 1IEBB 4M7ZC 5I1EL 4XCEA 4EDXB 2HT4D 3L3IA 4OZIB 1JIBA 1H3PH 1I85C 4XVSL 3N0PB 4MAYD 5ANMA 3B2VH 2Q6WA 5FDWA 3EDJA 3QG6B 4WVRA 4JY6A 4PRHE 3QUZC 4PS4L 3MBEA 4ZUVB 4D9LL 5IQ9B 1QPXA 3S5LA 1ODAA 2FX7L 3EOTL 2PR4H 3O6FB 5E9DA 2CIKA 1FBIL 4ODWB 4X4YA 5EPMA 1U8NB 4JGJA 2GJ6A 4JAMB 4DGIL 5B3NA 3SKNB 4X8JB 4R8WL 1VB9A 3T4YB 1TTFA 4OCRL 2AK4D 5IR1A 1ZHKB 1HHHA 1OD7A 5IB3B 1GXEA 4UQ3A 5I9QB 1YNKH 2AJSL 1KJVB 2JELL 3OTTA 5JLZA 3CCHB 5J57B 3SDXB 2FHCA 4YQXL 3VW3L 3P0YL 3OXRB 1DANU 1N7ML 1NC2A 1KXTB 2KQNA 3LOWA 1E4XL 5I71C 1OAUL 2K7QA 3SJVE 4X6DE 2FJGB 2Z35B 1NGYB 1S7TA 4OV5B 4L8SC 1FFPA 2EZ0C 4DW2L 1EK3A 5GGTA 1ADQH 4WFED 4LLVB 4B53A 4LDEB 5HI5C 5D1XA 4Z5RA 1NFIA 1DBKH 3DHMA 1A6PA 3WJJC 3OJMB 1TLKA 3HKFA 2PXYC 4YHYC 3MCKB 1Z9MA 3M07A 3WDJA 5KSBE 3T4AB 1D5XB 1F58L 4HG4K 2A6IA 5INCB 1FFRA 5T5FH 3QPQC 1QP1A 5CEZH 3WKNA 2Z8RA 3BKCL 4UQ2A 1AJ7L 1OSPH 2H32H 4JE4B 1O0VA 3TJHD 3ULUC 4G9FB 2DQCL 1EA9C 4PRIE 4IBLT 4OI8A 3SKJL 1IEAA 5DD6A 3CVHL 5D93C 2P7TA 2QSCH 3IFLH 3D3VB 3QIUB 3MCLH 5EIQA 3DVNB 4ELME 2HFEB 4Z95H 5HHNA 4JFEE 4WEBH 3MLWL 3IETA 5HHMD 4Z7UA 4OZFB 2O5YL 2VO5A 2XICA 2R56L 2PCPA 3ZKMC 5DJAB 1DLHB 1HOCB 1MHPL 1CFQB 3ARED 2EC9T 4FQXC 5DZLA 4PBWD 1D7FA 1G7PA 2F53B 4MJ4A 4ZPVB 3N50A 1I9IL 4JFFA 5DO2D 5T1LA 3ROOB 1JZ6A 2EE2A 3BVNA 4CVZA 5T1MA 1B2WL 3VG9C 4IOIB 1QSEE 1K4DA 3T65B 4X6FB 2WAHA 4YZFF 1X4YA 4K8RL 4PJ9A 3W5NA 3IJYA 3DVIA 2D0HA 5DJDA 2C4XA 1WCQA 3SQBA 4PYGA 3AGVA 1RZGA 3V8OA 3CLFH 2X4UA 4C56E 1M4KA 2C7UB 1ZV5A 5FOBA 4LSVH 1JPSL 3VXRA 1WEJL 4MVBC 2X4NB 4RISH 5FCUL 2DQJH 1CDBA 1QRNA 4OD1L 4RFNB 3PWJB 1KSRA 5TDNB 3DMMA 5TGBB 1RUQH 2CGRL 3D0VB 1D5MB 4FQJL 4NRYA 1EBAA 3K7UA 2J88H 5H2BA 1EX0A 3GRWA 2FJFB 1NL0H 1ZA3B 1ES0A 3HZKB 5J6HA 1BJMA 4HUNB 3U6RA 3UROR 3W82A 5FYKU 1OQOA 4JQIH 5KSVA 3N1PC 3U7YL 1NCBH 3VXNA 3PHSA 5MENA 4LIQE 3HR5A 1CDHA 4S10A 2XKSA 3O4LB 1I85A 4NHUB 1VENA 3F58H 3R0MA 2GY7B 4ZUWB 4LQFH 3IVKB 2CLVA 3QUZA 1H15A 2VC2H 1ZGLA 1EEZA 4GFTB 4Y4HB 2IANE 5C92A 5DI8B 1OGTA 1X5HA 2Z8WC 3NFSH 5BJTB 5IB1B 4S1DD 3HB3C 4PGBA 1CR9H 3OG6B 4HF5H 1ZGLM 3KPPA 3DGGB 1Q9WA 2ZOKA 4NRXA 4M9PA 1XF5B 4Y19B 4AT6B 1WIUA 3UTSE 5E8DL 3G9AB 1ZOXA 3WDHA 3IDJA 1OGAB 3G04A 1KCLA 4MDJA 1P69B 2NLJA 2ITDB 4XP9L 2EDJA 5JR1L 2H41A 4XHJD 3W0WA 3PWLA 3RA7L 32C2B 3RVVD 3QEUB 3QO0A 3BPCA 4XVTH 4WI7A 2ITCB 1HDMA 4O2CA 5E8EB 5CJQH 4L8SA 4Q0XL 1UKTA 2OS7A 4UOW1 5EBLA 3VH8A 4ZO7A 1SEBB 3OR6B 4RIRA 1HNFA 2W65B 1TITA 2PUQT 1RURL 3DROA 5ALBH 2MWCA 3F12A 5J89A 3FB6B 3WJJA 1F00I 3HI6H 2PXYA 3MLXH 5D7LB 5AEAA 5AUMA 4X4MA 3DPBA 4QY8A 3PWNB 2GSIB 1XF3B 2PETA 2FHBA 2YC1B 1B9ZA 1ZHBB 2X4QA 4WUUD 4A2LA 4YXKL 3E6HB 3KPMA 4CKVX 3RWFA 2ADJA 1CE6B 3Q1SH 2Z31B 4TSBH 2CLZB 2G60L 4QRRB 4ZOAA 1N64H 4N8PA 5FYLD 1I3GL 3MROB 5DQJA 5GSRB 1G84A 5MHSD 3C5SA 3GO1L 1HK6A 3NCJL 3ZHLA 3UTTA 2VQ1B 4DAGL 4HZLA 4NUJA 4XCCH 3FT3A 4NUGL 1T1WA 3E3QC 4HKZA 4ZFZA 5D6CB 4PRNA 1JPFB 4OCYL 1F4AA 1UM6L 3JXAA 2AJYH 2YPKA 2ICEA 1P7HL 1ACYL 3BPLB 3D39A 4TNVK 3N1FC 1XH3A 1MQKH 5IIEB 3CFCL 1DEDA 5C08B 3BN9C 2NY1D 4M1DH 1A2YA 1KC5L 5DK3A 1QSFB 1HN1A 5CZXD 3KXFD 3SEPA 1GC1C 4I0PC 4M02A 3WYRA 4KC3B 5C0FA 4N1EA 2Z93B 1DL7H 3O0RH 4FQXA 2Y25A 4F58L 2HJLB 3GJEB 4XI5D 1NGXA 2VZ1A 2RR3A 1WTLA 2V17L 3TESA 1NC4A 2XTJE 4FXKA 2DKSA 4UU9B 2H1PL 2ICWA 1FZMA 1M7XA 2BC4A 3ECBA 1MVUA 2LV4A 4LHJB 3MRLA 4OLUL 5LCVL 4XZUA 4KDTC 2IPKA 5IBLC 3QDGE 3VMNA 4UNVA 3ME0A 4OZGF 4X9BA 3EJJX 2HLFC 4WI5A 2GAZA 3EYQC 2V2TB 1CL7L 1JGEB 2YPLA 4ZNCD 2GCYA 2YS4A 2AV7B 3QUYC 2OYPA 4I2XA 3VXUE 4HWBH 2HTKD 4AIXA 3PDDA 4DVRH 2YHGA 2VISA 3MV8A 3CX2A 4K3EL 3IFOB 4M61B 5B8CB 4X6CF 4WWKB 3RTQB 2F9BT 4JPVL 4TVPH 4HS3B 1HXYB 4P59L 4LLWA 4CU6A 4LCWB 3EYUH 4H5SB 3T1FA 5DZNA 5HI3D 1ZANH 1YQ2A 3IXTB 4BH7B 2WIIA 5IB4B 1MCWW 2IBZY 4Y1AE 4L4TA 4ZUTA 1P7KB 5FO8A 3VDAA 4J4PC 1VEOA 5ID1A 1G7JA 3I75B 5EU6A 5C0AA 3MRGA 3AU1B 5D7KE 4XH2A 3KS0H 1RFDL 5E7FA 2X1QA 4K3JH 1KIPB 3WEXA 1I8KB 2XY2A 4QO1A 1ONQB 5C3TA 4OFDA 8FABA 1U95B 1G7HB 3GSRB 3VA2C 3O45A 1G7QA 1HE7A 4QRPB 3P9WB 1IC5L 2CKBL 5D9SA 4J3SA 5DT1H 3HCVA 5FO7B 3CVHB 1FAKT 3F8UB 2R69H 4HEME 1OD9A 3VD3A 4Y2DD 2BFVL 2KZWA 3KPNA 3LS5H 4DK6A 1P1ZA 3REWB 2C1OA 4NKMA 3SDCB 4HIHA 5JZ7D 3DX9A 3NZHL 3RZCB 3WUWB 3MLRL 3OQ3B 5ACMA 5SWSB 1VDGA 5C7XL 3S97C 2BRRH 1J0IA 4JRXA 1DBML 4BFBD 5I1GL 2UZIL 1BVKB 3EGSB 3HAEA 4HAGA 1DQJB 5C6PB 4HFUH 4ZAKC 2IH3B 3QHTC 2OTWA 1KENL 4U7SA 4C54A 1QLFA 1A64A 4JB9L 1FSKB 4NYLA 3EYVA 4MA3B 3TH3T 4K9EC 4GKZA 4ZPTB 4G42A 1BJ1H 1L0QA 1RZ7H 5IKCB 3OGCA 5JPMB 5DJXB 4G8GB 1INQB 1ERNA 3GHEL 4UNUA 2JCCE 4NDMA 3P77A 1L7TL 3RX7A 4L4VD 1NGZA 1KCRL 3RX5A 1V7NL 1NCUA 2E8ZA 3J8F7 1BEYL 1Q9OA 5FUCE 1CGWA 1T22A 1WZ1L 3MLZH 4K7PY 3MFFA 3SO3C 4JRYE 3X11B 3QRGL 2AXGB 5JDJA 4OGZA 5FUOL 3MJ9A 3G5VB 3UO1H 2VOTA 3CU7A 5BCAA 5JXEC 1LO3H 3RKDC 2BERA 4C4KO 5CEXB 1NBQA 4I0PA 1S7SB 5JIIA 3VFWA 1LVEA 1T7YA 4OCSL 4RX4A 1J1OH 1SJVA 3BZDA 3C8KA 2A9MH 2A74A 4UTBH 4W68A 4XX1G 5DDHB 4G7VH 4PY8I 3OR7A 4OCLC 2K1MA 3SO5A 4RAUA 4JKMA 4ZO9A 5IF0B 2V2XB 3MTRA 4O58H 3UZVB 2MKLC 4JN2B 2C4FT 2DL2A 1A9EA 2XWBB 4U0QB 4P4RB 3P0VH 3RL2A 3PABB 4OFYA 3BQUD 4PJDF 5ID0B 1IGJB 5IG7B 4POYA 4X99A 4F33A 4DZ8B 1I1AB 2UUDH 3W81A 4OF5A 4X98B 4KDTA 4B50A 1T20B 1TQBB 3B9KC 1CGVA 2H45A 5DR5H 2Q20A 1WBYA 1CYGA 1DDHB 2FX9L 2C26A 3TBWA 3HZVB 3GSNH 1JMZA 1A4JB 5F8QC 4TTDD 1UB6B 3QUYA 3O2DA 1A9BA 5CD3A 4WHCA 1CFTB 1ZVSB 5ISZE 4D0BA 1OLLA 4A6YA 2IQAA 4PGEA 4PFEA 1ZS8B 4QWWC 4DQOH 3C08L 1FPTL 2N7BA 1T0MB 5D2LF 1G9ML 3BP7B 5IW6A 2FX7H 3K2UL 2VH5H 3EOTH 3KYOA 4XNYL 3OXSA 1FBIH 2YSSB 5EU7C 1IFHH 3TNNB 3EJYC 1KG0B 5DJCA 1C12A 1AKJB 1MCNA 2Y06H 1MJUL 3EKCA 2WP3T 3DO7B 3DTXA 1DQDL 2FD6H 1BD2D 4I9WD 5KTEH 4J4PA 1UQSA 1YEIL 3GIVA 3OKKB 3O3BB 2R2HA 2IPTH 3FRPA 3IU4L 5IBTH 2R9HC 1R0AH 1BBJB 2DBJA 3EO1B 4JY4A 4GBXC 5I1HH 3EOBB 4MSWB 1TCMA 2GIYA 3IS1X 4IHOB 4BFIA 5C0DA 1E4XH 3PHQB 2W1NA 3U0TB 2P8LB 3FB8A 5IK3B 2HYMA 2NCMA 2WIMA 3RL1B 5JOFB 5ALCL 4POZD 3SCMD 5HHPB 2CD0A 5D72H 4CW1A 4WHYH 5DGRA 4Q9QH 1JF1A 2FBJH 4LSPL 3QNXB 5FM5O 5GGRY 2DLHA 2UVEA 2X1PA 4GAFB 3QBTB 5IESH 4Y16B 3TBVA 3HHRB 4JO3L 4PRDB 3PL6D 5H94B 5C71A 1ZTXH 5ESVA 1NUNB 2AQ2A 1EHAA 3QI9C 3QAZB 5LQBH 1JHLL 1U8LB 3BKCH 2QQNL 3QEGL 4ZAKA 5E2TL 5HYSA 1SEQL 4LLYA 3LMJH 1L6XA 3AB0C 3L6FA 4U49A 5EORH 1MRCH 4HS6A 1A6UL 5KSBF 4L9LC 2F53E 1HSAA 2GI7A 3ULVF 4NJ9L 3KGRA 1EAJA 3MLSL 2VQUA 4JY5L 2NY3B 2GJZB 5M94B 5FYLH 4NP4H 4Q2ZA 2DQDL 2EICA 1NEUA 2MKWA 3MGOA 5LGHL 1PYWA 1X5IA 1OP9A 4RBPH 5H37H 1FORL 4WFHE 2H2PD 4J2XA 3TPUB 1S9XB 5BO1L 4RMUA 5IVXA 1R3HB 3X3FL 3KPOB 1DSFH 1FDLH 2P8MB 4ELMF 1FLRL 1I9IH 4LCUA 5JXEA 1FL3A 1NMBL 1GZQA 1QD0A 5A3ID 2CXGA 3DIFB 5EZLA 1B2WH 2XPGA 1NDGB 4D3CH 2A2QT 5F7NC 1GCFA 5GHWH 1MJ8L 1C5DB 4G6JH 5D96C 4XNZC 3RWEA 3FRUB 1AY1L 1CT8B 1LDPL 3HC3L 3TBTB 3ZL4H 5E0QA 4P48A 1DCLA 4GJTB 3RAJH 3MOQA 4DVBA 1A7QL 1CLOL 5IMLB 1WEJH 1G6RH 4WO4C 4WENB 2GW5A 3GMPA 5F96L 4EZMA 2FNBA 4MXQD 1IQDA 4R0LB 2ARJA 2NXYB 4GRMB 3BD3A 3ZTJH 2CGRH 3B9KA 2QR0B 1YMMB 1QO3B 1T1XA 3GMRB 1UA6L 1CLYH 3CNKA 3H0TB 5HDOA 1KUMA 3UBXI 1W72A 3CFEB 5A1AA 1FJ1B 4Y5VB 4OLWL 2FH8A 4NKQB 4Y19E 1NFKA 5SWZB 3P73B 4WU5B 1DN2A 3G08B 4ONFH 4HUWB 5J1SC 1TNMA 1OP5K 3QEQB 1AO7A 5IVOA 5CSBA 3QPXL 4OI7A 2KUTA 4U4BA 5E94B 3C5ZD 3QXAB 2EDOA 3ARBD 3IDNB 1UYWL 5ITFA 4QOKB 2D7TH 4XBEL 3PNWB 4MD4A 2ADFL 4MA8L 5F70A 3V6ZB 1YNLL 3RPIB 3AS0A 4YHKL 3FAXA 3CMOH 4YNYB 3SGKC 1KGCD 3BE1L 3FO1A 4EI5B 1U8HA 1A4KA 4GUPA 4S2SA 4E0RA 4YK4B 4OFKA 4XC1L 3WIFB 4FQLL 4HQQL 1VA9A 1L9NA 5GZOD 4YX2L 1NEZG 4YPJA 4GBXA 5ILTL 4J3TA 3DX6A 3MV9A 4RAVB 1CLZL 3RA7H 1A7OL 2ZCKH 4QRRE 3D9AH 4XNXH 3BYYA 1R24B 1MJ7L 4WJ5B 5E8NB 1MY7A 4L1DA 2Z91B 5DUBA 4ODTH 4LVHC 3HNVL 1OP3K 1EV2E 3VCLB 2DM3A 4WHDA 1NDMA 2VL4A 1V7MH 4OZGA 3QWRD 2X4TB 1FZKA 1TZHB 3GMQA 1F13A 3PP3K 4NFCA 3RU8H 5ADPL 2FWOB 5INDB 2R23A 2XWJB 1LEIB 4LBEA 1NMCC 5E99H 4NQCB 4RFOL 4R4ND 4AEIL 2VLRD 4YXKH 5IM7A 3OKLB 1U3HB 5CP7B 2DWDB 1AQKH 4X6CA 3SQOH 3QI9A 4P2QA 1QSFE 2UWEB 3WNPA 4Z7QE 1D9KD 1I3GH 1JV5A 2GK0B 2VZUA 2FIKB 5B4MC 2JJWA 5D7IF 4JO2L 1X4ZA 3NCJH 2BSSB 1AHWB 4L9LA 5FYJU 4NUGH 1RUAL 3MPCA 1FG2B 2AKRB 2UWEF 3DURA 1YEFH 3VXOA 3OKNB 4L4JA 2HKHL 3SKOA 2VYRE 2O5ZH 4P99A 2BOCA 5ABDE 4LF3B 5J3HC 2EE3A 4WHYG 5IHZB 4JLRB 4LPUA 3CFCH 3PHOA 2W59A 4QT5A 2NY4C 5FKAB 3BXNB 5KSAC 3O3DB 1JFQH 3D0LA 3DECA 4UT6L 1BZQK 5TE4L 4XPTH 4OB5L 3TA3B 3U46A 4EXPX 5GZND 2BHYA 3VJ6A 5L0QB 1Z0NA 1CBVL 4FABL 2CPCA 3TP4A 5DHYB 1CG9A 2R2EA 4G6MH 4C83A 2AJZB 4N0CD 5IQ7H 1XFPA 3NBNA 4H1LH 4C58B 2H1PH 2YA1A 3LV3A 4GKNB 1ZLUK 3V4PL 3PWPD 1NLDL 5C0BB 4OLUH 2R1WB 4U1LA 3KPSA 5JA8B 1YNTB 3ARSA 4LCWE 5HY9A 3WBDA 2KDGA 3LH2H 1ZLVH 1FL5A 5H37G 1DBAH 4U05A 4WO4A 4ONHB 3TBYB 1NBYB 4Z7VB 4WI6A 4PJ7F 2GT9A 3CUPB 1C5BH 5KVEH 2V7NB 2E6QA 3OV6A 3UZEA 3DUHA 1MUJA 3O8XD 4TUJA 4FZEH 5GRZA 1X7QB 3K8LA 1ETZA 1N5AA 3MOAH 3L3OA 3FFCA 1I3VA 1L9MA 3PDGA 4PJBF 4P59H 3LRSA 1CFBA 3X3GL 4HFWA 2Y36L 2H32B 4H25B 5CBAB 4Q9BA 2NR6D 2AJVL 4X9GA 3WL9B 4JHAL 3IKKA 2ILLA 1E6JH 4S0TD 4NRZA 3SOBL 3EOAA 2EYRA 4GS7B 1YDPB 3HZYB 2ATKA 3HMXH 1NUGA 4XMKL 5DXWA 3Q5OA 1E4JA 4NN7C 3ZTJG 3SGKA 1M6OA 3NGBC 3LKPA 3TH2T 1F42A 4YDJA 5DMKA 5F9WC 4XCNB 3VMPA 1PKQA 3WNOA 3LAFA 1JPST 5C0CA 4K23L 2IH1B 5DQDH 3UJIL 5FGBC 4MB3A 4KMLB 5I0DA 2ZG1A 4DEPB 4UT9H 1N59B 4E42A 3BGFC 5FA4A 3QXDB 1KB5L 3MQIA 2ESVD 4M8QA 2P46B 4F15C 4PJDA 4KVCL 1WBZA 3T08A 1XIWC 2AP2A 3TZVD 3NCFB 3GSXA 4K71C 5T3XD 1LO4L 3P2TA 5DYOB 3RWHA 4PRBA 3WIHL 3MLRH 1JE6A 2CXKA 3BZEB 2ZCHH 4U7KA 4XVJL 4L3CB 4KHXL 3LIZL 4M6AA 4NPYA 5MERA 1FVDB 3IDYC 1DBMH 3FL7A 2NY6B 4GW5B 2NY0B 4XGZB 3EJZC 1DVFC 3KPRB 1T66D 5F72S 1BQHG 1XGQB 3EDDA 2P5WD 2EC9U 3A6CH 2YZ1A 5EC2A 5LKNA 4ETQB 2H8PA 1I3RA 3HE6B 3U4EA 3BI9X 3MRQB 5CIPA 1YPZF 5JMOC 1JP5A 4YHZL 5DJZA 2AXHA 3GHEH 5L2KB 4HD9A 3WXVL 1L7TH 2BJML 5JNYB 1V7NH 3Q3GA 3RWDB 4IJ3C 3AS2A 4N90D 3T0EB 1TETH 4P3DA 3V6FB 5I8EA 2ID5A 3V6OC 5DS8B 4M7KL 5DWUH 1NBZB 3QRGH 4PRHA 4LVNB 3TBSB 5FUOH 1OL0A 1CDYA 4FQCL 2Q7YA 2CRIA 2HFFA 3LN4B 2P5EB 2JCCF 4NO5B 1C7SA 4Z7WB 5IHBA 4TRPL 1MCLA 1ZT4B 4P46B 4MDIA 3MBED 2F58L 5KSAA 1ZK9A 2OCFD 2D31B 1A0QL 2XXMB 1T6WA 1AGDB 5E9DD 5C86A 4UDTB 2D7QA 2IMNA 3QNYB 4JRWA 5BRZA 2H2SD 2GJ6D 4YAQB 2IGFH 5I76B 4WFGD 1C1EL 3BESR 2BCKA 1AFVH 5DEGA 4FFYL 5GGVL 3BMVA 4KTEH 1TDQA 1VFAB 2MQCA 1A6AA 1JK8A 1U8IB 4PJGE 1JWSB 3C6SA 1S5IH 3FO2A 4HC1A 4JM4L 2P47B 3IB4A 1I1FB 5DSCA 3SJVA 1FC1A 3OAUL 1VESA 3N85H 1NC2D 1FE8H 2EDFA 2I60L 4LL9A 4NQDE 2BXYA 4JZOB 5CINL 1DBJL 4U6YB 2CKNA 2Q86B 2FX9H 1LD9B 2BXZA 4LSUH 5DJ6B 4MA1B 1MF2L 5KSBA 2UY6A 5T1DL 5D1XD 4IOSD 1HEZB 3IKCB 3R06B 1Q8MA 1CLCA 4FFVD 1QA9A 1BZ9A 1ZLSH 3LS4L 3VI4E 2XZAH 3QIBB 4H1LG 4UUJB 1EERB 1S9WA 4PRIA 4KGJA 1HI6A 1WVZA 1VFOA 5JORB 4OUOA 1I9JL 3NMEA 1Z2KA 4JHBA 3FTGA 3RVWC 2DQGH 1OSZA 1FNEA 2VITA 5F9AC 3RZWA 2HTLD 1CD1B 1DUYA 4ELMA 1YEIH 4WFFD 5HD8D 4OF6A 2Q87A 4YDKL 4OLXL 1K6QH 2VN7A 4IRJC 2VLMD 5IB5B 3GIZH 4F8TA 4MX7A 3BYTA 4M7LL 2YD4A 1B0GA 2KPNA 1JPTL 1MHCB 4PREB 4QRQB 3BO8A 1IZKA 5FFLA 4D9RE 1RUKH 4LK4A 4QTIL 3SPVB 3MLYL 5EUOB 4JFDB 3DRQB 1JHKH 3ARVA 4K7FB 4U1GC 3ARTA 2XTJC 1F4YH 2YKLL 3JV6A 4JFFD 5T1LD 4OGAC 5C9JB 3THMH 1QSEA 4X7DC 1MIML 1XIWA 2F74B 3G6DL 5J12C 3CK0H 4YHIB 4OQTL 4Y4KC 1BLNB 4DUVA 2JTDA 4P23D 1AIFA 4Q6IB 3T0AA 1G7LA 4JDVA 2WBWB 2E9JA 2R4RL 2ZOLA 4C56A 5EULV 4PJ9D 2HLAA 4ENED 2OR8A 3OKEA 3S98A 4PJEF 1INDL 2I9LA 1DVFA 1UXWB 3QEGH 4L8DB 4U1HB 2DBLH 2X4PB 4H20H 3G5ZB 3VXRD 1G7IB 3MACH 4KJPC 2WLZA 3VGAC 1F11A 1QRND 1RV6X 4ZFFB 2E6PA 4HUUA 3DMMD 4DZBA 2DQDH 4MA7L 5LGHH 5F7DA 4Y5YB 3NACH 3T8XA 3L3HA 4O9HL 4HKBB 1SJEB 3V6OA 5GJTL 1P5UA 4Q9RL 1KJMB 2X1WL 3PGCB 4R3SA 5MEND 4XVUD 4IMLA 4J3WA 5F97E 4X7CC 3RWJA 3X3FH 4MNGB 5C09E 5IEKA 2XQBH 4RAHA 3GGWA 4WCYL 1MAML 4J8RB 3AXLA 4MAYB 4WNQA 1IGCL 3QUZD 2DD8H 5FYKL 2N56A 3VWKC 5EIIB 1B90A 2BVPA 1A6TA 1MRFL 5FECA 1QUNA 3NH7L 3UTPD 5FF6B 1MRDL 3UTSA 4LGPB 1XGPA 2DYPB 3P4LA 5F7WC 4ZD3H 2VKXA 3FN3A 2XT1B 3B2UC 5SWZE 4EQ2A 1BOYA 2AK4B 1J5OH 4V1DE 4QHNB 5SX4H 3TIEA 3QIWD 4FQ1H 4XPFH 3O4OB 3G6JF 4YEEA 4NKDA 3CX5J 3IRPX 1IM9B 4IOFC 5JW4Q 4XPHH 3W0WD 4BFGA 2ADGB 4CMHC 3JWNC 3ARGB 2K3TA 4JM2D 3O2WH 1UH4A 4N0UB 3W5MA 4NOFA 3DV6B 1UA6H 5F6IB 2A6KA 3VFRB 4PG2C 2EZ0D 2QADC 2XXCB 4QXUL 3HI5L 5J11B 1NANI 4DKEH 1LO2L 1KJ2A 5F9DC 4OLWH 5HI5D 1I1RA 5HGDB 4YXLL 3BKML 3N1QC 1UH2A 5JUEH 4JPWL 1KB5B 2PXYD 3QCUL 3KDMA 4LAQH 4OUUB 4KMTL 1K4CA 2QHRL 5HJ3A 3BN3B 4X7TA 3L3JA 4AJ0A 2QKIA 3QPQD 4KUZH 1P4LB 5IW1B 1QLEL 4B7LA 1U36A 3ZYZA 4RNRA 4HPYL 4PR5B 3T09A 2YRZA 1XGUB 5FUCC 1NFDF 3QUKB 1AD0B 1E6OL 1BECA 4OM0L 4XBEH 1XR9A 3ULUD 1YECH 2ADFH 2Q7NA 1QR4A 4S1RL 3UTTD 5F1IA 5FKPB 3KWWB 5DD3H 4ZUSA 5HYJE 2DI9A 3RWCB 2FECL 3QJFB 1RUPH 3WFHA 4MZ3A 1M1SA 5IEHA 5DJYB 4HIJB 4HV8B 1Q9LA 3TIDA 3D39D 5E7BA 2OM5A 2ICWI 4UAOC 4OD2A 3QA3B 4UB0L 3C9NB 1WICA 4YBLC 1WISA 3I6KA 3V52H 4Y5XC 3SDYL 3ZKMD 4U6VH 1REIA 4QXGH 1CGXA 4XT1C 1CTNA 4NN6B 1D5BA 4P9MH 4JVPA 4AM0A 4FQXD 3AREB 5K9JH 4KRPC 5HVGB 1QFOA 2X05A 4ZFOA 5I2IB 5LBSL 4PJ7A 1N8ZA 3CC5A 1NC4D 4IIQB 4UIMA 5CS7A 3T2NH 4Y4KA 3BRDA 1AGFA 3VRJB 4B0MM 4KK8C 5T3XH 3QZWG 4O02H 1ULVA 3QDGA 4HH9B 2NXZC 2G75A 1JNNH 5TDOA 2GUOB 3QHFL 1D3CA 3CAFA 4FP8H 4N0FA 3UBXG 1CQKA 3NFPA 1HHJB 1YYLH 1EFQA 4EBQH 3VXUA 3P4OB 3OMZA 3Q2CA 4MVBD 4GKSA 5EU5B 2YPLD 1CXEA 4XP5H 4KK6D 1NEZB 4OTXH 2AV1B 4QF1B 2ZUQB 4HJ0D 4F3FA 5I9QC 1F97A 5ENWA 5D5MB 4HUKB 2WUCH 2C4FU 4Z8FL 4Z7QF 3MV8D 1ZA6A 4QTHB 5FYKD 1CDGA 1JNHA 1OAYL 5C0BE 1QHOA 2ED8A 4UT6H 4LKXA 2CDEB 4P5TC 2VDQL 4Y1AA 5TE4H 3TT1L 2WK2A 3CPLB 2VR4A 5MEPB 3E6FB 3V5HB 4PRAA 4AZ8A 5DRNB 3OJDB 1ORSB 4L4TD 1WF5A 3U48A 1SYSB 3VWKA 5BQ7A 3ZHKA 4I77H 5EU6D 4XRCA 5DLML 5C0AD 1DFBL 3O41B 3L5XH 1NLBL 1K3ZA 5E6IC 4PGCA 3JWOC 1MFDL 1OPGL 1NLDH 1S7RB 3L5WB 4L8BA 5D7JB 3K8KA 5HGHA 4JG0H 3QDJB 2Z4QA 5JO5A 4U6XA 3BPNB 3P30L 2D4DA 2EDYA 4BZ2H 1ZWIA 3W39A 5J13C 1KELL 5FIEA 3MXWH 4KZDL 3NIGE 3MGTB 1YPZA 4PD4K 4I4WA 2FX8L 5IJVA 4PG2A 5ERWA 1OCWL 5C6WH 2Y6SC 5F3HA 4UI2A 1CZ8L 1FVCA 3ARUA 3GHBL 2NQCA 4YBHA 4BKLA 4JJHA 1YEKH 1U58A 4JRXD 5GGTH 1VADB 2P1YA 4JQVC 5HHQB 1LP9B 5C6TH 3H6JA 3LPWA 1BF2A 2Y36H 1FRGL 4XXDA 1U0QA 3VXMB 3BP6A 3BZ4B 4UV7H 5DMIL 2W60B 4HKXB 2BNUB 4M1GH 4G8EA 4PTTB 5JQ6L 3WKML 1W0WB 1SM3H 3OKDB 1LO0H 2JCCA 1UCBL 1QKZL 5T5NG 2KZ1B 3RP1A 2PYFB 1FVEA 1JWUA 3FQNB 3HNSL 1TVDA 2BOBB 4G5ZL 1HHIA 5DD0L 2ZCLL 4JRYA 4XHQA 5HI4C 1YQVL 1TPXC 4EIZC 4Y2OA 4NZTL 4LVEA 4K23H 4MJ5A 3CSBA 4JFHE 1FQ9C 4JFOB 4WUKH 1PG7H 3DI2B 1VACA 1XF4A 1TXKA 2P49B 2XZZA 4HHAA 2H6PB 5D1QD 1U8PB 2CR3A 3BN9D 3PGFH 1SY6L 4KVCH 4KU1A 1M71B 4L5FL 4Y5XA 2NY1B 4JFPA 4LEOB 3SHSA 1YEDB 4I0PD 3DYMA 1IEBA 4ZSOB 3IDIA 3KXFB 4RX4D 1DLFL 1GGTA 3OF6A 4KGLA 3WIHH 1IC4L 4FZ8H 5L88H 5DEFB 3LIZH 4NNXB 4RMQA 2EECA 3T0EE 1OP5H 5EO0B 4P2RB 1U8OB 3QWQB 4R26H 1G6RB 2HRLA 4MXWL 4EUPG 4YIQA 1HQ4A 4NO0A 4JZJB 1MPAL 4PP2B 1UG9A 2G5RA 4OFYD 2P5EE 4Z7WE 2EH8H 1NKRA 3I2CH 5GSVB 2D0FA 1IT9L 4O4YL 1AGBB 3DX7B 4KI5E 43C9A 3ZTNH 5IBLD 1U6AL 3T4YA 1T1YB 3JVGC 3WXVH 5BXFA 1ZHKA 2HLFD 5I8OH 3B3IB 1D5ZB 4ORGA 5BV7B 5F7EL 5ISZA 3F5WA 1C8PA 4LCYA 3MLTA 3QUYD 3R1GH 3WLBB 3U4BL 1IGIH 4PJFB 3PGDA 3ILQD 3MA7B 4DCQB 2EIBA 1KPRB 1WZKA 2DOCA 4L3EE 5IMOA 2YBRB 2AW2A 4OJFL 5ITBH 3K4DA 2Z35A 3MRIB 2R1XB 4OV5A 3V2AR 4JZNB 1A0QH 4P5TA 4NN5B 2EXYD 3AY4C 4Q58C 3PP3H 4NZDA 1FFNA 1E0OB 2AJ3B 1C1EH 1LO5A 3ARRA 3O6ML 4RGMB 5F9OH 3PDOA 4Y7MA 4HJJL 4J4PD 4NZRH 4U6TA 2A6DB 1KN4H 1D5XA 1KFAL 2MMXA 2RCSL 1KBGH 1TZIB 2DLEA 3WD5L 2B20A 5EZJA 5AZ2L 1FLTX 5E6IA 3U36A 4U1MB 4OBSA 1FP5A 5JIHA 2R0LL 5DMJB 3G5YB 3WFBL 1NMAL 3SDDC 5DO2C 1DBJH 4UT7H 3X12B 1AP2A 4PJGF 5BVPH 1ED3B 3MLVH 4QHKI 2X4RA 5JOPE 4XNUL 5TE7L 3DVNA 5EU4B 3QQ4A 4Y2DB 2HWZL 5J0BA 5JW4R 5E1AA 4HMCA 5GRVK 3O2VL 5EFIB 4GRLC 4JO1L 2LU7A 5DJAA 4U2ZA 3H9HA 3KPQA 2EO9A 2OK0L 2P8PB 3BUYB 3S5LG 4JQVA 1R5IA 5KJRH 5EOCH 5CSZB 2XN9D 3L9RA 1YMHA 3P4MA 1N2RB 4JVUA 2VZOA 2CDFB 2F8OA 3GSVB 1J8KA 3TJEH 4AEHL 4X0KA 3WSQL 3T65A 2JJTC 7CGTA 2BVOA 3RJDA 1T5WA 1NAML 1PKOA 4G8FB 4DN4H 4PGDB 4L8CA 4PRPE 1NANH 2Q76A 3V4VH 1I7UA 3VFMB 3ZSTA 1FNGB 3IXAB 4U6HB 5E1HB 5J4MA 1ZXQA 4WTXA 4KQ3L 5E6ZA 3D1MC 3S34H 4P9HL 4NQEE 5LG1A 4S1DC 3QT2A 3G6JA 3MV01 1PZ5A 1PAMA 1R5WB 5J8OA 2YKLH 5DJ0B 1PY9A 5B38A 5JXED 1AD9A 1WCBB 1M7DB 3RKDD 1A1NB 1MIMH 2DLTA 3W9DA 2ZKHH 3MRMA 3TGXA 3T3PE 4RQQA 3QG7H 3VWJB 1CE1L 4H1LB 4WWKC 1JZ7A 3FT2B 5HHVL 3FB7A 2A6JA 3R0NA 1LE5B 4OZHB 1UVQA 1CFNA 3WMSA 4ZYKA 2YR3A 1JNJA 4PTUB 3LKOB 1BVLA 4XHJC 1FFOA 3ZDYE 3S36H 5EC1B 3OPZL 2VDPH 4ZO6A 1QVOB 1QFWM 5DI8A 4JFYA 4OIBA 3P9MA 1A5FL 4M1CC 5HHXL 2RHEA 3VXTA 3GUTB 3B9KD 3JVGA 1FH5L 1RK1A 5E00B 1I75A 4AT6A 4YEFA 1P2CB 4XBGA 2AERT 3UC0H 2P48B 1VPOL 4MCYB 3H3PL 5D8JL 2ITDA 4M6NL 3GMLA 5BOPA 4XPAH 5L8LB 3OZ9H 2R1YB 3NZ8A 4M6ML 5JOEA 4NC0B 2B1HH 4XC3H 4WCYH 5IOPB 1D6VH 1AO7D 3VE0A 4QWWD 4KKNA 2E27L 3S37L 2XWTA 5IMMB 2W0FB 1IGCH 5FYKH 4ODSL 1OQXA 4BH8A 3AY4A 5KN5B 1CXIA 1KCKA 3EJYD 5DJ8B 4BZYA 4OKVB 3QHZL 1GHFH 5EG6C 3ZT7A 4QKXB 3MRNB 3ZDZE 1ZSDB 1I7TB 5I1JL 5JXAL 1BD2B 1MCQA 1YA5A 4WU7A 5GGUA 3KYKL 1EHLL 4O5LH 3N06B 1MIEL 3E6HA 2IADB 1X5LA 2R9HD 4U0RB 1HHKA 5KZCB 2HG5B 4R97B 2CLZA 1IEHA 4QRRA 2Z8SA 3QUML 4GBXD 3MV9D 3U0WH 4K8RC 1T0PB 3QYCA 4G43B 3VFNB 3HFML 2UYLA 3WHXA 5FA3A 5F7UA 3MFGB 3SDDA 2VQ1A 3CFKA 3LB6C 1EGJL 2GY5A 4QXUH 8CGTA 1LO2H 1BFVH 1MLBB 1IL1A 5E5MA 1QLRB 5HGAB 3SCMB 1PW3A 3VD5A 3FQXB 1MFCL 5LGJB 1NCAL 5I16A 3DBXA 5EOQL 1HKFA 5L8KB 3QB7C 3GB7B 4TOYH 5A2KH 4GRLA 5EUKA 2QHRH 3GSNA 4RWYL 1U3ZA 5I1AB 4JPIB 3QI9D 4P2QD 2NMSA 4HPYH 2V5RA 2X4SB 4IS6A 3GJEA 5SX5K 3HAEH 5KVFL 4OM0H 3ZYOA 1MHEB 2A77L 1RIUL 1BX2A 3PJSA 1SBSL 5T3ZD 1RSFA 2X4OB 1TJGH 4ZUUA 5T1KB 4R4BB 3EYSH 2VDOL 3S7GA 2LU3A 3LVEA 2JJTA 1OLZA 4CVWA 2CLRB 2AJXL 4D2NA 4QHLB 3MUGA 3M8OL 5E08L 3MLUH 1H3XA 1TQBC 5FYJL 3MUHL 3MRKB 1ZLWK 1WAAE 1MCOL 4UB0H 3JSSA 3MRBB 2YD7A 2DQEH 5I66A 1HZHH 3BT2H 2BVEA 3RI5F 3X13A 1A7RL 3VH8G 5IFJA 3Q0HA 2PW1A 3RNKA 1MWAH 3VG0L 2X5PA 3MJ9H 5A2LH 3GKZA 1NSNH 1T0NA 4WI4A 4MJ6B 1KNOA 4WWKA 1SYVB 4DUXA 3VRIA 1GC1H 2GITA 1Z3GH 1HXYA 4LCWA 1CIUA 3CSYA 4G6KH 1OT2A 5I1CL 1R3LA 4PJHB 2YEZB 4QRTA 1Y6KR 4GAJH 3KPSD 1WWCA 3RNQB 2WUBL 4P5KA 3LDBC 3INUL 4NQVB 5EO9A 4WO4D 2V2WB 3MJ6A 1J0YA 3MO1A 5JA9A 3CFJB 5HGBB 5B22A 1KIPA 3GEWB 2C3VA 3N9GH 4GAGL 4U1SA 4M7LT 1DBBL 1RZIB 1LK2A 2FJHB 5KANI 4X6BA 2HH0L 2Y72A 1WC7A 1KN2L 3ZHDA 5I6XC 4BJLA 1EXUB 5KVDH 3FFCD 1OAYH 3FQTB 5DC4B 4NGHL 4YXHL 5E8OB 5L6YH 4TNVF 2ZSWA 1S7WA 1EIBA 1U91B 4PUBL 4WUUA 4PJ5B 5FO7A 3CVHA 2AI0H 3O2DH 3QDJE 2X70B 3QO1B 1QQDA 3P9LB 3AROA 1FHGA 3KYMA 1MCPL 4LCCB 4KQ4L 3QZWB 4A6YH 1G7MB 5AD0B 3C5ZB 4WW1A 3ARBB 3NVQA 3KPLB 3UX9B 1NLBH 3ZE0E 4Q9CA 4J3UA 4TSCL 1OB1A 1IBGH 2V7HA 1FL6A 4YHOH 5GGQL 3QH3B 2OL3L 5CWSA 1IC7L 3VXPA 1UKQA 1LP9E 1M05B 4NNYA 5C0CD 1UZ8B 1LMKA 2IALB 4NSKB 2HP4A 5C8JA 3VXME 4LPVA 2VABB 2JB6B 4K3DL 2VL5A 3ULSA 1A6VH 3T3ME 1N5YL 4EI6B 2B0SL 1INQA 1FZOB 4KZDH 4QXTA 1N0XL 4FNLH 1CFVL 4X9HA 4LGRB 5DUML 5I18L 4MQXC 1TNNA 1OCWH 1I4FA 2ERJB 2GTWB 2PO6C 4GRWB 3NIFF 5EZIL 1CZ8H 5GIRB 3GHBH 4HS8L 3UDWC 3IU3B 3DI3B 2VXVH 5BZDA 4ZOCA 3BQUC 2GFBB 3G5VA 4H26B 2XZCH 1BIHA 2D9CA 3RGVC 4PJIB 5FV1L 4E41E 4P2YA 4JDTL 1LK3H 4HK3J 2WLYA 1FZJA 1M7IA 1TJIH 1OM3L 2VLRB 4AIOA 3I85A 4NWUH 1BQUA 4TTDC 4JJ5B 4G3YH 4OD3H 3BHBB 3NCEB 2ADIB 1D9KB 3PWVA 5B4MD 1TQCB 2XY1A 2VAAB 3MRFB 4M43H 1KCVL 1X5JA 5I17A 5I1IH 2NW2B 5F3BB 2XWBA 4DTGL 4P2RE 2LU4A 1U8KB 4WV1C 3WFDL 2QSTA 3LKRB 4PRHD 5IG7A 3NA9L 5JHDA 1WUNT 4DZ8A 1R5VB 5J3HD 2GSGA 1UWEL 3T04D 3BSZL 1LE9A 1CICC 1RZ8B 2NY4D 3WFZA 2VDML 5KSAD 1H8SA 4UBDC 4MMXC 5BRZD 1DLFH 4LSRH 4MD0A 1CFTA 4LKCA 4PJGA 4ELKB 1XEDA 2GQHA 4BELD 2JJVA 2ZUSA 4EJ1C 3HAEG 1J11A 1A3LH 3OKMA 4PJFE 3A67L 1YYMH 3MZGB 3P4NB 4MXWH 4ZMAT 3O6KH 4NQDA 3U30C 5A2FA 1ACZA 3SJVD 2PW2B 2YSSA 1GGIH 1B6UA 4O51A 1K3IA 3VI3F 4HG4J 3PWPB 1RI8A 2O5XL 5KG9B 3UPAA 1GGBH 1X5AA 4DKDC 5FHAL 3IF1B 5CHNB 3KR3L 3QDME 3LEVL 2WM0A 1BIIA 3GI9L 4WW2B 1HHGA 1FAIL 1FO0L 2GJJA 3PL6C 3EO1A 5FGCB 15C8L 2VXQH 5I19L 4A2MA 3VFTB 3WE6B 5GS2D 2EDQA 3SN6N 3O8XB 4YR6A 1KYOK 1P4BL 1W72H 5DRWA 5IHUL 4M6OL 5JOFA 1CXHA 4PRID 1E4WH 1A7BA 2Y7QB 2G2RA 1IGTA 4HIIB 1ZT7B 1CDIA 5TDPA 5J9PB 2MFNA 4X8XA 5DA0B 4EUPB 3FAWA 5BMFH 4L4VA 1S7QB 1S3KH 5CCKL 3FCTB 2QQLL 4JFED 1QBMH 5H94A 5EA0H 1U3HC 2JLLA 5DD1H 5AZ2H 4KAQH 1OAKL 3PQYE 3A6BL 4R7DB 1HSBB 4NFBA 3NCCB 5FUZH 2XKUA 1Q0YL 3TT3L 4M5YH 4ACPA 4EVNA 3O6LH 3H7LA 1S5HA 2BVQA 1BGXH 2Z8VC 4MJIE 1ITCA 4OCWH 2B5IC 4R6UA 4QNPE 1RJZB 3BIAX 1WLHA 1EEQA 3FQWA 2Q1EA 1DQQB 2FZ3B 2GJZA 4GG6F 2DQFA 1A6WL 1QSED 3GJFB 2HWZH 1XIWD 1NGQL 1BPVA 4OLYL 3TZVB 1T3FA 3O2VH 3P11L 2PO6A 5FO9A 2BSED 3J7HA 2EE9A 4C56D 5KS9B 4S1SL 3UDWA 2OK0H 4TUOA 3KPOA 3MSPA 1AXTL 1BZ7A 3O9WB 5DK0A 4KI1A 3BQUA 1AI1H 5AZEL 1DVFD 3RGVA 4AG4L 2X9YA 3EFFB 1P6FA 3MZTA 2J5LC 5L7XL 4PJAE 4Z0BL 4Y0GA 2A1WL 4HKJB 4X5XA 1XMWA 2P5WB 4CNIA 1NDGA 3BKJL 4KRNA 4Z7OE 3NFNB 1UXSA 3NCYP 5TPWL 1LEKA 5ADOL 1G9MC 3LKNB 3FN0H 3FRPG 3GSOB 2ZJSL 1JPGB 3FFDB 3FRUA 3MNVA 5IROC 4KY1L 2W0PA 4PY7B 3BIKA 4KFZC 3E0GA 4X7FC 1IAOA 3JWDL 5C09A 3STLA 5T3ZH 1RZJL 4S1QL 2QBWA 5HVHB 1OAXL 4WV1A 4XMPH 2CRMA 4XCEB 4LRIC 1RJLA 2VZVA 3L3IB 1P9MC 2IAND 4CDHA 2EDHA 4X5LA 5HDQH 35C8H 1XGRA 4PGJA 1CICA 3BH8A 4KRLB 4JFXA 4EOWH 4HXAH 1KLFA 3BGMA 4JY6B 2CKBA 2XA8L 3S5LB 4LLDA 1FJ1A 3GBML 2CIKB 5E9DB 3UTSD 3I02A 1H5BB 5HHVH 1EDQA 4V1DA 4QYOB 1T2QL 4BSVA 4WHTA 3G08A 1MCHA 5ICXA 1OWRM 4I0CC 3RDTC 4OGXH 2F5BH 3S4SA 5IR1B 5HYSG