3C5SB

Crystal structure of monoclonal fab f22-4 specific for shigella flexneri 2a o-ag
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
215
structure length
198
Chain Sequence
EVKVEESGGGLVQPGGSMKISCVVSGSNYWMSWVRQSPEKGLEWVAEIRTYYAESVKGKFTISRDDSKSRLYLQMNNLRTEDTGIYYCFLPMDYWGQGTSVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab F22-4 light chain
publication title Structures of synthetic O-antigen fragments from serotype 2a Shigella flexneri in complex with a protective monoclonal antibody
pubmed doi rcsb
molecule tags Immune system
total genus 38
structure length 198
sequence length 215
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c5sB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c5sB01
3OR6B 1R5IB 1IARB 1OAKL 3OR7A 5CEYA 4KC3B 1CXHA 2FNBA 3GUTB 2PXYD 1CR9H 4JFFB 2Z31B 3ZTNL 2HT3C 3LPWA 2A1WH 3I6GA 3T3ME 4JFZH 5FM4A 3QUYA 4WI9A 2Q87A 2AK4D 3CCHB 3JZ7A 3DV6B 1XF3A 3RWFA 3HMWL 5IQ9B 3MV9A 3NPSB 1NAMA 2XNAB 1R3LA 2VLJE 1LO3L 5SV3A 5D9SB 4KHXL 3UDWC 1J88A 3EJZC 4LRNH 1S9KC 5C0RH 1E4XH 1FO0H 3PWLA 4ERSL 1RZKC 2YRPA 5CKAA 1KFAH 3WEXA 4OF3A 3RI5F 4GUPA 1AGFB 3HS0B 1RUKH 1M05A 1SJHA 4X6CA 2AJZA 3MFGB 5EBLB 3ARDC 5SX5K 5ADOL 4X7TB 4DKDC 5GGSB 4U1IA 3SN6N 1FDLL 4OZFA 3QNZB 1MHEA 5DJYB 1U8HB 4L1DA 3BP6A 3C8HA 4FG6D 4UZGA 4JHWL 4AIZA 1KN4H 3ARBA 2ZNXA 4XH2A 4AG4H 5KVEH 3MRIB 1TCRB 1V3JA 3FQTB 4Y5XB 1HXMB 1HQ4B 3B2VL 4GRLC 3V5HA 4X98B 1OAYH 3Q6GH 4N5UA 4V2CB 4ZOCA 1JWSA 4P5TB 3L3KB 1PBYA 3DTXA 1PDKA 4AK1A 3OHXA 3DGCR 3GM0A 2A6JB 1DBJH 2X1XR 1S7WB 3IF1A 2GSGA 1UQSB 4JJ5B 5KANI 5DI8B 4K55A 3QG7H 4HLZG 3ARDB 5ESAA 1QHPA 4GSDH 2VDLH 4ZD3H 3AAZB 4KV5E 2Y5EA 1QSEA 2F58H 5HYJB 3G6AB 3S3JA 2WINA 1N6QL 4YFDB 4ONOA 3VXMA 4OFKA 4DQOH 4JPIA 4JFOB 5GSRB 4NQUA 5BQ7B 4KTEH 4Y16A 4HS8L 5KJRH 4GKNB 1YEHL 3MJ6A 3E6HA 3NFNB 4JFXA 4OF6A 3OJMB 4R90L 4GQ9L 2HG5B 3RU8H 4HAGA 4WHYH 5DF0A 1NC4A 5DZLA 2OYPA 3D48R 1UH4A 2IPTH 4PJDB 4CVXB 1LK2B 4BQBA 4XXDA 3CMOL 4L9DA 2IPUK 4NUJB 3WDJA 1BREA 4NFDA 1KJ3L 3TNMB 4NM8H 5JZ7D 1QD0A 1JGVL 1YEFH 3KPOA 4X9IA 4LSRL 4MJ6B 1CG9A 1S7RA 4PRPA 3KPLA 2XA8L 1GAFH 3BH9B 5I8CB 1FL3B 2P5EB 3CU1A 3O81A 4UOW0 4XWGL 4HIXL 4M48L 4E42B 1XGTA 4KRMB 1NEZA 5F3BB 3EO1A 1QPXA 5SWZB 4XB7A 1WC7B 1VGKA 4FABH 3PQYA 1YMME 3VFSA 4PJGA 4S2SB 3HG1B 1H8OA 5DD3L 1YPZE 4ONHA 4HULB 4WGVB 4QRQB 3W9DA 5E9DB 4PGBA 4L8SA 3B9EA 5DMYA 5L7XL 1V3MA 5C09B 4RFNC 2X4OA 4IS6A 1QBLL 1NGWA 4FQJH 1FC1A 2A77H 1SEQH 4PP1C 3EHBD 4ALAL 3EGSB 4PJFB 2GTWB 2IMNA 4NQCE 2ITCB 3OV6A 3LIZL 5LXGL 2ICES 1JI2A 2X9XA 5CINH 2R1YA 3VMPA 1W72L 3BQUA 5KVDH 4DVRH 1GIGH 3MV8A 4XPTL 4L3AA 5D1XD 4KTDL 4WI8A 1H3TA 1ZAGA 2AEQL 5BVJB 1U93B 3S34H 2R9HD 1IL1B 3CZFB 2X70A 4CN4A 2MQ0A 3STZB 3VD3A 1IAIM 4MCZB 3I9GL 5B39B 2VOTA 32C2B 4B53A 3SQBA 5DJAA 4EIGB 4NQCD 2HJFB 3LKRB 1P9MC 5FO8B 1CGSL 5IFAH 2WWMC 3BKJL 1QFPA 3D69B 2HFFA 1A7QL 2X4TA 4Y89A 3JWDH 5CGYC 4GRWF 3U4EA 4Y88A 1SHMA 2F54A 2VE6A 3VDBA 3VFGL 4H1LH 1JYNA 1S8DB 4P57A 4WTWA 2YD9A 5IT2H 1SJEB 5E8EA 1P6FA 2VDML 3IJHA 5C6TL 4ELMB 3AMKA 4KDTA 4M03A 4Z8FH 4LLDA 3LN5B 3TZVC 1J1OL 1MREH 2ZCHL 3HE6C 3FO1B 1OCWH 1AQKH 2EZ0C 5C0IB 3OKKB 2D7MA 4XBGA 5LCVL 4LSDA 2VLKA 4PY8I 3T1FB 1TZGL 3G6DL 5I8OL 2VLRB 1CXEA 1ZT4A 4WI2A 2V6HA 1F4WL 5ANMB 1TVBB 2D4FA 4XI5D 4HGWA 2W92A 2ORBH 2BY2A 2ZPKH 3BH8A 4NWUH 1T3FA 5EA0H 2CDGA 3QNYA 1A6ZB 2AXHA 3TCLA 2DI9A 4RGMB 4BH8B 2DQIH 4KRLB 2UZIH 5BV7H 1DEEB 4S1DC 4K2UL 4LVNB 3OQ3B 3CDFA 5CSZB 4XPFH 4LLWA 4WUUE 1N5AA 4XP1H 4U2YA 1W0WB 5DMIL 5E0QA 4OF7A 1HEZB 2VMFA 2W0LA 3IETA 1UWEL 4LQFH 1C16B 1A6WL 2K3TA 4KZEH 3KAAA 1M4KA 1P6AB 3AB0C 4J4PC 3VFUB 4AZ8A 4LARH 1T04A 4Z7UE 1I7RB 3TH3T 4D8PA 3GB7B 3OG6B 3BGMB 1NUFA 4KQ4H 4HBCH 1WEJH 4LHUG 3T2OA 4U7SA 3LV3A 4HJJL 1CFNA 3MNZB 1MY7A 3WMSA 4J3WA 3MC0A 4X4YA 1S5IL 2PO6A 1IGCH 1SVCP 4NZTH 4GMTH 4WUUD 4PB9H 3S88H 2EXYC 4LLUB 3RY6C 3VXPB 3HC4L 3OKEA 3BIBX 3FRPA 1XFPA 5F8QC 1TZIB 5KSAD 1CFTB 4JKPL 1V05A 2Z0BA 3RWGA 1HIML 1FFRA 3AB0B 1S7UA 3P9LA 4G8IB 5MENB 3F8UB 3CVHH 4NC2B 1OT1A 1RULL 3KYMB 3NN8A 3L3OB 5B38B 2F53E 2JJTA 3JTTB 5DEGB 1IC4L 2GFBB 1DE4B 4H0IA 1UH3A 1FYTE 1MCEA 1HWHB 4CW1A 1NDGA 1LNUB 4C83A 1G7LA 3MR9A 4QHLA 1S7VB 4P5MA 2VR4A 4HPOL 4YFEA 3IFOB 3FQUA 4GKSA 1T0NB 2HRPH 1HILB 1VPOL 3KNBB 3WFHB 1MEXL 3VXUB 3W39B 2VZ3A 4NQSB 4M1CC 3HUJB 3QIWA 4C58B 3LAFA 2AXFB 1A0QH 3K8LA 4I3SH 4JKKA 3TBTA 1MQKL 4PJHA 4ZPVA 4XPHH 4X6FB 1Z5LB 1DANT 1F3DJ 2R4RL 1D5ZB 1FVEA 4YNYA 1LEIB 5DR5H 3D39E 2Q7YB 3LKNB 5C0GB 1WUNT 1HDMB 4NKIL 4P59L 1Z3GH 2OI9C 4MDIA 3IJSA 4U1SA 4DW2H 1ZS8B 5IBUG 3I3BA 1MCPH 3BT2H 3VJ6B 3GMQA 2ILLA 1VSCA 3C60A 3SJVA 2XN9D 1X5KA 5J1AB 4F15C 4K7FB 1GC1H 1CI5A 1H3PH 1OP3H 2CLZA 4JKWA 4XVJL 3KYKL 3AMLA 4L29A 4U1HB 3UTSA 4YDKH 3D39D 4YUEH 2R2EB 3ZO0A 3RX5A 3T04D 4ODSL 3KPSA 4WUKL 5CD3A 2OZ4L 4HGMA 2XZQH 4MQ7A 4P5KA 4KMQA 1AHWC 5D96C 1CL7L 2FJGA 1Q38A 1ZLWK 2Y06L 3BAEL 1SY6L 3AS2A 3QDGB 1ZLVH 3GJFB 5DHYA 1E28A 5E8DL 1T03L 4YHML 1U8NB 4GG6A 3QUMH 1INQB 3MLUH 3OKNB 4HDIB 3ZL4H 3C5JB 3PL6C 3QIBA 1AFVL 3ARGD 4F15B 3RWIB 4DZBA 1YMHB 5DJCB 4RMQA 1GPOH 4QXGH 2Y6SD 3KYOB 1U92A 3T08A 2QHRL 1U8OA 1MY5A 3A6OA 3V52L 2H3NA 4QRUB 4TNVF 4XTRC 2FX7H 5DUPH 2OTWA 3IDMA 5EOQH 1N8ZA 3EOAA 1AHWB 2VDKL 1PSKL 1BF8A 3U30C 3UMTA 2IANB 5JR1L 2BC4B 1JGDB 1KLGB 2YA2A 4D0CB 3Q1SH 2BRRL 4ODHL 2ADGA 1CN4A 1BQSA 5IK3A 3V6FB 5I15L 3PL6B 4XP9L 4KRPD 3HAEG 4HUVA 5DUML 3ZDXF 1NMCB 5D72H 3C5ZA 3JWNC 1Q9LB 4X9FA 4Z95L 2X10A 3PWPB 1JZ3A 3V6OA 5HVGB 2ZUWA 4BYHA 2ED8A 4MSWA 2FBJH 2IC2A 4PRAA 4D3CH 3SCMD 1KACB 4N8PA 3K0WA 4Y2DD 5ETUA 1EO8H 3GMNB 3UZEA 4Q9QH 1MI5A 1T7WA 4QO1A 4HC1A 3RGVA 1S9VB 5DJXA 4NRXA 3HFML 4O2EB 1DSFH 2WP3T 1CF8H 1L9MA 4IRJC 2CR3A 3I75B 2F5AH 4NHUB 5H35B 3FL7A 4MAYD 4JRYB 4MD0B 4XP4L 1F2XK 3DUSA 43C9B 1WBXB 5BJTB 1KNOA 2WZPD 1G7JB 4HKXA 1SM3L 1Q9WB 1CXIA 4FQCL 5EULV 4JDZB 3PWNA 4ZPTB 2BVYA 1A7RL 3RNKA 2UVFA 3TVMA 4PRNA 5F7EL 2IPKB 2XWTB 1QLEL 4TOYH 2CRMA 4Y4HC 1SVZA 1EEYA 1MNUH 3UTTB 2FHCA 3VWJC 3X3GL 3B8YA 3N85H 4JAMA 5H94A 1KB5H 3ABZA 4YGVB 5H2BB 4JFEB 5D5MA 3CIQA 3KYNA 4CJ1A 3IU4H 2I9LB 3KS0H 3QP3A 3ZKSD 1IAKA 2ZJSL 5L2KB 1DN2A 3NVQA 4YBLC 5ESVB 1NMBH 3EO0B 3TV3L 3LCYA 5MEPB 1M71B 2A73B 1D5BA 1ORQA 2C4FT 5J12C 4JKLA 1OTUC 1BM3H 1MIMH 1GGIL 4XX1G 4Y4HB 2V5MA 5EORH 1GJIA 25C8H 1G6RH 2YPKB 3IB4A 3JV0A 4E5XA 5T33L 3PIQB 4OCRL 4RGOH 2B2XL 5HD8C 1UM5H 4L3EB 4LSSL 2P43B 1XGUA 3LKOA 5T1DL 3PJSB 3ZDZF 1NBQA 4JDVA 1JE6A 4GAGL 4OGZA 3I02B 3INUH 4UQ2B 1VHPA 3U1SH 1FL5A 5J6HB 1FL6B 5LGKA 1AD0B 1ZHNA 4X6CF 1ACYL 1XIWA 4Y4KC 1FFOA 5IBLC 3BP5B 1B90A 4XVUD 4WI5A 2BVUA 1HINH 3P77A 2Y36L 2ZCKH 1BBJA 2Y07H 5LQBL 4F58L 3W5MA 1Y18A 2B1HH 1E4KA 2YD4A 4GRWB 3TBVB 3EO9H 5DHXB 4PTTB 3KLAB 4X5XA 1NQBA 2WBJC 4HV8A 4U6YA 2D03L 4QOKB 3OPZH 1HNFA 5TQ2L 2VXVL 3T4YB 2AJUH 3BE1L 3QWRD 4FTVA 2AJXL 2DWDB 1OL0A 4M6OL 5EZOL 2Z4QB 3CLEH 1L0QA 4PS4L 4E41A 4MS8C 5T5NF 3GKWL 2XTJC 1I1AA 4NRYB 3RDTA 4Y4KB 3HB3C 1U41A 3I85A 3THMH 2CQVA 4IOIA 1YEKH 1FE8H 2UZXB 4LHUB 2ICWI 4PJ9D 3HZYB 2FJHA 4QGYA 2Q20A 1ZA3A 4XMPH 3L7EB 4OLXL 3MRQB 1V3LA 2CO6B 1DFBL 1FZKA 5JPMB 5DRNA 1LP9F 4W4OC 2DM7A 2GK0A 4XPBH 4P2RA 4YEEA 3UTZA 1B4JL 1M7XA 3PXHA 4N5ED 2E7HA 1RIUL 3O6FA 1TNMA 4RMSA 4G8GE 4NWTH 3RVVD 1T89C 4O02H 1V3KA 2P8PB 2J12B 2R29L 3BEVA 1AGEA 4Z78B 1J8HE 4QHNB 2EYSB 4JHZA 3STLA 3QJHA 3SE8L 1P7KA 5JLZB 3N1PC 1JHLL 2VZTA 2XTJB 4FQXA 3JWOC 1INDH 5IKCA 2HJKB 2IH3A 3I84A 4Y19A 2JLLA 1PX3A 2HJLA 1JNHB 1QQDA 4Z7VA 3BO8A 3V0WH 4XAKE 2AXGA 1MSPA 2AV1A 4IRSC 4DK6A 1GZPA 3JTSB 4JE4B 5D7JC 1IGML 3QYCA 5T5NG 3OSKA 3ZKND 4G8GD 5ID1A 3QQ4B 4ELKA 5JW4Q 3QO1B 5TDOA 4V2BA 3A67L 1MCOH 1EUUA 1KLUA 3MROA 5EDXA 2L4OA 1BEYL 5F96H 2DLGA 2QQKL 2VWEC 1LILA 3QBTB 3U7YL 2W91A 5DVOA 1N5YL 2NX5B 4PJGF 2YA0A 4XVSL 4FQQB 1B4RA 1NAKH 3K4ZA 1FFPB 1EEUA 2MPAH 3RWJA 4XAKD 4ZUVB 1HHHA 2IGFL 1M7IB 3WIHL 1RUAH 1MCCA 1R5VB 1U3HB 3FB8B 4YEFA 4P4KB 3O6KL 5ICZB 4K7PY 3SDCD 3QDMB 3H3KA 4N9GA 4GBXA 5IBUB 3GO1H 4HUUA 3JWOH 5E5MB 4NN6C 1NBZA 2OXGA 4JRXA 3HRZA 1T6WA 4U7KA 1Z9LA 4JZNB 5DS8A 5JOFA 3MCG1 5FUOL 5HGGS 5JXED 2DQHH 1ZTXH 3HCVB 4OV5B 4NHCL 2BSSA 2VLLB 4ZAKB 5KSBF 4JQXC 4R4BA 5EC1B 3P9MA 4NP4L 2LFGA 1I8KA 1CTOA 4R7DA 1QFUL 1UCBH 1XZ0B 4RNRA 4G8FA 1WV7T 4XXCC 3ES6A 1NEUA 2EDDA 4OD2B 1OGTA 5LGHL 3TIEB 3RBGA 1FFQA 2A1WL 2AJYL 1YN6A 4JFZL 1PJ9A 4K23H 2HMID 5GISH 1QFOA 4JGMA 3TYFB 3FONB 3R8BB 4DWHA 3RNQB 4LPCA 1QEWA 4JO1H 3IKKA 1HSBA 3H7LA 1YY8B 3MLTB 5IB4B 2DQCL 4LRNL 5D6DC 1UGNA 3C2AL 5CBAB 1H8SA 4OCNC 3QDHA 1FO0L 3L5IA 1KFAL 1NGPL 2VN4A 5EZJB 1SJXA 1YNKL 1OP3K 2CIIB 1PW3A 4DKAA 3DRQA 2KZ1B 5IGXH 1VFMA 2XFXB 4FFVD 3OKMA 3ALXA 3GSOB 1RUKL 3BEWB 5C07A 1XF4A 2DYPA 4ZG1A 1RI8A 2O93L 2FECL 1IBGH 5DHVB 1LEGA 3MBEA 1MWAA 4LP4A 1TETL 4PB0H 5J3HD 4JFFD 4JB9H 2Z31D 5HI4C 3NGBC 1KN4L 3BVNA 5KVEL 3B5TA 3HAEB 3QFDA 2VL5B 1OAYL 3CUPA 3Q6GL 1XF5A 3QPXL 3H9HA 4U6XA 2VERN 4M1DH 2NTFB 5EU3B 4I18C 1L6ZA 4X4XA 4NKQB 2JCCA 1RMFH 4NCDA 1CICA 1DBJL 1MCSA 3N0PB 1PZUB 4XBPA 4BQCA 3PDOB 3HC0A 5ITBH 3QG7L 3RZCA 2Q7NA 1CXFA 2ENYA 2H2SC 3GJFK 5DQ9A 5DK0A 3SDXF 1D5MA 3MNVA 3QO0B 4GKOA 5GS1A 3QA3B 1QP1A 2HKHH 3U0WH 3NGBB 2HT3D 3ZYOA 3ULVF 1G9MH 4KKAC 5ADPL 1L0YA 1ZXQA 1F3RB 5K93A 4DQOL 5M94B 5D93B 3DHMA 5HYJE 2B8OT 1TZHA 3NA4A 2PCPA 4KTEL 1F11A 4P5TD 1A3QA 3OKLB 4I18B 5KJRL 3TCXA 4M3JA 1K85A 2I24N 1UB5A 3F6LA 1DQDH 4OAWB 2BVQA 2FWOB 5ERWA 4AYFA 4F33A 4EI5B 3LB6C 2JJSC 5HYSA 3AREA 3ARDD 3MJ7B 1S9YB 3H0TA 5HYIA 1NCWH 3LN4A 4PJDE 1A6PA 3VG0H 1G7PB 4NM8L 5TDNB 3HNTH 5HYJD 3OJDB 2VXTL 4WCYH 1B3JA 2UY6A 2C3XA 3MRMA 3OB0H 5FYLE 1YEGL 5T1KA 3BWUC 2PKDA 1T83A 4K71B 5I1CL 4N9OB 3ULUE 3ZE0E 3MV11 1P7HL 8CGTA 4PLOB 4XRCA 3NIGF 1RZFL 2P5EE 4OLWH 2BSRB 1MJ8L 5DGRA 1V7NH 5CJQL 4FABL 3L6FA 2FYYA 1D5XB 2AEWA 5SWZE 3PV6B 1LD9B 3HNSH 1R3JA 5L0QB 4HCRA 4LPYA 4J8RA 5C0DB 3HG1E 3ZTJH 3L5JA 1FNSL 2NLJB 3HMXH 4KK6C 4ORZC 3DVNB 3FO0L 5E9DE 5IP4A 1CLCA 5FYLD 2W59A 1P53A 2NYYC 4HH8A 4LCWA 4I0PA 4CKVX 4JFDB 1NCTA 4L3CA 1KPUA 4H8WH 3RL1B 3QUYC 5CINL 5FHAH 2COQA 2P5ED 2EIBA 4PJFE 1KXVC 2BZDA 1GIGL 2P46B 3NH7H 4OKDA 5HPMB 2HH0L 1MIEL 5SWZD 5C3LD 5J57B 4U6VL 1EHNA 2BNQA 4OZGA 3GGWA 4JHAH 3HG1D 3H3BC 4XHJC 2Z35A 4RWYH 4NT6A 5BCAA 5JHLL 5DK2A 2E27H 5BRZB 3HKFA 4Q6YA 5E9DD 4BUHA 5DRXB 4MLIA 4U2ZA 5C09D 3DVIA 5CBEA 3GSQA 3DI3B 5CEYB 3TBSB 5IFAL 3B9AA 3V8OA 2BVPB 2N4IA 3BYYA 3NCJH 3I6GB 1FFNB 1JUFB 3UJTH 1KCUL 3ARBC 3TIDA 4JPKH 4XZUB 1MJJB 1NCAH 3MV9B 3QQ3A 3EYVB 4AM0B 2H41A 2CK2A 1FAIL 5IT2L 4KI5F 4GG6F 4YFLF 5IMMA 3IDGB 2QJDA 4NFBA 1AR1D 5CMAA 3BN9C 3G6JF 5F9WB 1KB9K 5TE7H 4PG9B 4LNVA 3IJYA 3WEXB 1WJ3A 4TTDC 4Z8FL 2CLRB 1NAMH 3EW3B 1IZJA 1M05B 2W38A 4X6CB 1MREL 4ELME 3RVXC 1OCWL 1AQKL 4U1IB 1VEMA 3KHQA 5ENWA 4TUOA 3BISA 4LDLB 1MHEB 2EDBA 2K1MA 1P4LB 3WIIH 5J6GB 5I1DA 3ZT6A 3BP6B 5F9OL 3BUTA 4ZTOL 4M62H 3HPLA 4AIZB 1ZLSH 3GSVB 3ARBB 4XH2B 5I6XC 5C08A 5KS9A 3S6CA 3VI4F 4F7CB 3OZ9L 1CGWA 5E70A 2WK2A 5FCUH 4DN4L 4IHOA 1JWSB 2VLRE 2UYLA 2ORBL 4NWUL 1P2CA 4Y16C 4R96B 5EA0L 5ANME 2EXWC 1XR8A 4X7FC 3OHXB 4OCYH 5KW9H 4A6YH 3G5VB 1IGJA 2YUVA 2CKBB 2DQIL 1AI1H 3IF1B 4FN0A 4XPFL 1FJ1B 2EDOA 4HIEA 2DDQL 4YIQB 5BXFB 1KSRA 2F8VA 5ESAB 3RUGF 1S7QB 4BK5A 4NBYB 1OTTC 5JDSB 4WTZG 5IMLB 1W72A 1O7SA 4FMKA 2ZG2A 4KZEL 1NC2A 1AY1H 1JTPA 3BXNB 4QXWA 2B39A 2WINB 2FB4H 2NW2B 2VLRD 1LP9B 3QDJA 4WI3A 3VU2A 5F97E 4KQ4L 4PRIE 2X89D 3LRSA 2OCFD 3U46B 3T3PE 2HYMA 1IGCL 4JFXB 2IQAA 4PB9L 4XPGL 3VGFA 5HDBE 2X9YA 3K3QA 4KPHH 1AKJA 1TVDA 3E1F1 4EJ1C 1VFAA 5KN5B 4HK3N 4NBZB 3GNMH 3HE6D 1Q9OA 1MJ7H 4JG1H 2QR0B 1MRCH 2VZVA 2EZ0D 3FQRA 4L8SC 3LN9A 2XACC 4LIQE 5E6ZA 2ADJA 4YWGL 4WRLA 3RQ3A 5A16A 1CG9B 5FAAA 5ICXA 1KV3A 2ARJA 4OIIL 1QYGH 4PRPB 3KPLB 2MQCA 5MENE 2LU7A 3EOYG 2CDEB 2W9LA 4LCIL 1N59B 3O2DH 2X1PA 5D5MF 1QFWH 1RHFA 1WISA 2HKFL 1FIEA 3BQUC 1R6VA 1G0YR 1K8DB 1KC5L 5ILTH 2YEZA 3E6FB 3EO1B 4HAFA 1UXWA 5HVHC 1VGKB 1JN6A 1F58H 2HRPL 5DJDB 4JN1L 1J9CT 4PJGB 4PLKC 1T20A 5GS0C 3MA7B 3WDIA 1A4KB 3CFEA 4PGBB 5DRZB 4L8SB 4KHTH 3VXUE 4POYA 1A0QL 1TLKA 4I3SL 1CGXA 4YHPA 2ZG1A 4J4PD 1F4AA 1G1YA 5MEND 1NGWB 1BZ7A 3FFDB 1PKQB 5DR5L 2B4CH 1YN7A 3WUZA 4JR9H 5EOCL 3G08B 4XNZC 1PX4A 2VKWA 4M6MH 2QSTA 4OCXH 5EOTB 1U8LA 3H9SA 3IDJB 5I66A 2XA3A 1F4HA 1NPUA 3MRDB 3OAYH 3TLRA 2CLVA 4HUXB 4XVTH 2ATPA 1X5HA 2UWEA 3AFLA 5KSBB 1WAAA 3VXUD 3O45B 4KDTC 3LSOA 5F1IA 1OSPH 3BP7B 4FQLL 5C0AA 3RHWF 1FRGH 1DDHA 4MJIA 3I6LD 3JV6A 5DJAB 1I75A 5DYOB 5SWQA 5C0EA 2HFFB 1FSKC 5FYLH 2X4TB 5HHPA 4J3TA 2XKNA 5EIIA 2W9EL 2XZQL 2G5RA 3ULUH 4S1RL 3WO3B 1NCNA 1REIA 1A7PH 3IKCB 4HQQH 2R2BB 2LVEA 5MI0C 5FA3A 1J1PL 5I0DA 2O61B 3NCYP 5E8EB 3C6LA 2A0LC 1QVOB 3GSUB 3QUML 3MLUL 3C8KA 1JYXA 3IJHB 1S3KH 4R7NA 3QDGE 4FP8H 2D7NA 2LTQB 3R0NA 4AEHH 2DIBA 4M1CD 4TSBH 1GPOL 2DL2A 4QXGL 3QNXA 4R0LB 2EDNA 3B43A 3DYOA 4XBGB 3PF2A 5SX4H 1FSKB 3U7AA 1T0MA 2GEEA 4MAUL 1HI6A 2VLKB 4ZDHA 4OCLC 4O2CB 2FX7L 3B9KA 3SO5A 2J8OA 1R3KB 4FZEH 1S7TB 3E8UH 5MI0B 4WHTB 1T3FB 5TE6L 3SE9L 2IANE 3QDGD 1MELA 3BW9A 3LOWA 4U31A 3F7YB 2PO6C 1KJ2B 1PQZB 2MJWA 4JO2H 1GCFA 5DMGC 4P99A 5FKAA 3ME0A 3MXVH 3O4LA 4G80A 4LLWB 3VE0B 5J8OA 1KN2H 3TJHC 4S0TD 1T1XA 2KDGA 1UEMA 5HHQA 2FBJL 4D3CL 4F37F 3PWPE 3SDXB 3V4UH 3CSYA 3QUXB 2N56A 4F80A 1KPVA 1EO8L 2PR4H 4WJ5B 3QCUL 5C9JB 3U83A 1T04B 4D8PB 4ZUSB 2JJTC 3VXSA 2IAND 4F8TA 3FFCA 2F5AL 1OGAE 3VXNA 5J89A 1Q0YL 5FGRA 5CSGA 3ZSSA 5TF1L 4LL9A 3V6ZA 5K9KA 2E7LA 2PO6B 3P4NA 4TNVK 3PL6D 3MLXL 4JRYE 1OOAA 3OKEB 5HPOA 4M7JH 1TQBC 3PWPD 3GSXB 2C3GA 4F7EA 2R0KL 4NZRH 1YJDC 3QIWC 3DECA 4NCC2 4PFEA 4ZOAA 2P24A 1KCSH 2NXYC 4F7MA 3QAZB 4XTRD 1NCCH 3N85L 3NCFB 3OB0K 1SQ2N 1VFUA 3VWKA 3UTTE 1BOGA 1Z6JT 2AK1L 4U1NA 3RZWA 1G7LB 2Q1EA 4C83B 4JRYD 3BJLA 1SYVB 4QHLB 3QRGH 4X6BB 4JFEE 4RMWA 1FQ9C 3EDKA 3FQUB 4GKSB 1TQBB 2RCSH 3C60C 5L2KE 1J0HA 3QSKB 1BFVH 4R8WL 3QXDB 5A3IC 3I3DA 4GOSA 2B7DT 1XGYH 3JV4A 1BM3L 5FYJU 3TBTB 1YQ2A 4ZPVB 2CSPA 1A22B 5D8JH 25C8L 4YNYB 1G6RL 3UTTD 4BZ1H 4U33A 2VN7A 4PJEA 1N2RA 4O58H 1UM5L 5GZOC 3QISA 5CZXC 4JFED 4GW5A 4L3EE 4MDIB 1FHGA 3ARFB 3IJSB 5JOEA 4I3GA 5HGBA 2IBZY 2RFXA 5L2KD 5HHMB 1EFXA 3INUL 4W6XB 3GMQB 1TQCB 3U1SL 4HK3J 3C60B 3SJVB 1PYWA 1NGZB 3QIBC 1CS6A 1ED3B 5T5FL 4NQXA 5IVXF 1DZBA 2YPVH 1JNLH 1R0AH 4LIQH 2NW3A 3U9PL 4FXKB 3UTSB 3D0LB 1DBBH 5JO5B 3ZZ1A 4Y4HD 1YNTA 2ZCKL 2E9IA 2FX8H 4D9RE 3KLHC 4ZUTA 4Z7OF 3EO9L 4L3ED 2ESVE 4XB8A 1F3DH 2FJGB 4GRWE 5IF0B 3OPZL 3ORJA 2JCCF 3OF6A 1AJ7H 2AJUL 2JJWA 3NZ8A 4GG6B 2ZUQC 3QIBB 4NCC1 4QOKE 5FUCC 5GGQL 2DJUA 3VGGA 1G9NC 3CLEL 3G6JB 3C5ZC 5HI3C 2KH2B 4NYLA 3V6OC 5CP3H 2KUTA 1OTUD 2R15A 4KZDH 3THML 1YEKL 3V4VL 3S35X 4L4VA 1UWGL 3VXRB 1U8OB 4D9RD 4OF5A 4ZNEE 1CGVA 4OBRA 3LD8B 4AQOA 4H20H 3S97C 3SOBH 1BBDH 5HD8D 3IDMB 3RGVC 3S36X 3EOAB 1CD0A 1K4CB 3EUUA 5I19L 3UPAA 3QEUB 3J8F7 1XR9A 4ODUA 4NWTL 4QOKD 4O02L 2EH8H 5F7FA 1I8MB 1JPGA 2ZSWA 2ZUQB 5L6YH 2FATH 1R3HB 5HVFB 4HUVB 1FVCA 5A2JH 4G6AC 3MV7A 3D5OF 1KBGH 4KUCF 1WZ1H 3O3EA 1INDL 1BFSA 2OBGA 4NOFA 4MSWB 5FFLA 4Y4KD 5IBLD 5B3JF 2BHUA 1VFBA 3KPQA 3RUGB 2AJSH 2XTJE 4EXPX 4LHUD 2D31B 5ETUB 3EYQC 3NCMA 5B4MC 4XC1L 3WFEH 2ICEA 4KY1L 1MI5B 4ENEC 3WXWL 4MDJA 5DJXB 4GQPH 3IVKA 1AGDB 4YHYC 4OQTL 4EVNB 3F58H 3SPVB 5E99H 2FZ3A 1ZSDB 3CXDH 4L4JA 1NBYA 3PGCB 4HLZH 2R2CA 2J88L 3WE6A 2RGSA 1ERNA 4UIKH 5F96L 1KNOB 5M7QA 3CDGA 3BD5A 2NZ9D 4PJAA 2F5BL 4MS8D 1NL0L 3TC9A 3PWNB 1NAKL 1A21A 2B0SH 2FL5A 2XTJD 2MPAL 4KVNH 3HB3D 4BFBD 1BAFH 4DEPC 1HCVA 5F8RC 3CX2A 2NX5E 4PRNB 5KOVC 1RUAL 3HC3L 3R1GL 4D2NA 2VQ1A 4DGYH 4MMZC 2CGRH 1EEYB 1RZ8B 1ZK9A 4N0RA 1EAPB 3JWOL 1MAMH 1ZGLP 1IAOA 5KSVB 3L5WB 4MXQC 4M7LH 5H94B 3QDME 3VDAA 4Q58C 2P7TA 5D5MB 3D0VA 2QEJA 1VESA 4OI8A 3VRIA 1IAKB 3TBYA 4ODWA 1IM9B 1ZTXL 4ODVH 3DETC 1NGYA 3O6LH 3WNNA 1Z9MA 4OZGF 2NX5D 1ORQB 2XRAL 4XC3L 2VWEE 1JIBA 5IEKA 1WZKA 5GGTH 4DEPB 2VITA 5IBTH 5IB2A 1HE7A 1YEJH 5IIEA 2ZSVB 3DX9A 5I8EA 4P2OC 3EYFB 1XIWC 4O51A 5EWIH 1H3UA 1U3HD 4PJIF 1KULA 1T1WA 1VB9A 3T0DA 1KIQB 1R5WB 2ICWB 4P4KD 4YDIH 1UEYA 2AI0H 1CE6B 3QDMD 5H37G 4X6DA 5ISZB 5F88B 4DK3A 1CDCA 1U8IA 1I7UA 1E4KC 4K23L 4RMUA 5IMOA 5GISL 4LHQB 4PGDA 3H42H 1EO7A 3LRGA 2X1QA 4HKBA 2JE8A 3EDJA 2GY5A 3WIFA 1FL5B 3NAAH 3FT3B 4ZAKD 5HYFA 2CXGA 4WU7A 5DD0H 2A6IA 4JM4L 5IGXL 3RFZC 4RIRA 1I1AC 3VDCA 4P2OB 4YHKL 3RDTC 1DQML 1T66D 4JDTH 1OP5K 3P77B 1TJGL 1EA9C 2X4QB 2FX9L 4OGAC 4PB0L 4W81A 4NDMA 2V7NA 3OGOE 5BZDA 4IDJL 1EZVY 2OL3B 2DJSA 1Q94B 1NANI 1C08A 4U6YB 3OJVC 3GBNL 4I77H 4FTVB 4NQTA 3WIHA 2YWYA 4MJ5B 3SKJL 4LGRB 4TNWK 4M7ZB 4ZSOE 5DJ8B 4AEIL 2YN5A 2KZWA 1I1AB 3U7WL 3P4LA 4FQXC 3RDTB 4P4RA 4IOIB 3BD3A 3KPMA 2XTLA 1J5OL 4O5LL 4FFZH 4ZYKA 3U0WL 3D2UA 1FZKB 1IQDA 2DQFA 3Q48A 4U1LA 4HWBH 5DRNB 2GK0B 3UTZB 5DSCA 3ZLQC 1ADQH 2EC9T 4JFPA 1WFOA 5T1LB 3BI9X 3BEVB 3MJGX 3QJHB 4BFGA 3SGEI 4OFPA 2W60B 3LDBB 1DQDL 3WHXA 4X4ME 1WTGT 5E1HB 1EH9A 4NSKB 1IGYA 1EDQA 1JZ4A 5IKCB 1T22B 1DLFL 2ZOLA 3ZDXE 4UNUA 2HJLB 1QQDB 3IDYB 3BO8B 3V7AG 3FHAA 2AV1B 1GZPB 5I1GL 1IGIL 3ARXA 3DX7A 2W0PA 3HNTL 2IF7A 3DARA 5IHBA 2C1PA 2P45B 4GBXC 1HCFX 4WCYL 5JNYB 2G60H 5EN2B 4QRTA 4G6FB 5ID1B 1D9KA 1JK8A 5FUZL 3M17B 4DFIA 4K07A 3M8OH 1FO0A 1V5JA 3RIFK 4ONGL 1S7SA 3IU3A 3IFNH 4M9PA 4M02A 1UZ6F 3P11H 4UDUA 4WW2A 1KLUB 4OLWL 4TSCH 2VXQL 1N4XH 5IVNA 3FT2A 1MJUH 1HHKA 4AQ1B 4NNPH 3MRRA 1CQYA 1F02I 1I1YA 1RZJC 2BOCA 4XX1E 2PNDA 4EI5D 2H2SD 3ZKMD 4M5YH 5AZ2H 3CLFH 5DTFA 5IQ7H 1MCLA 4FXLA 4N0YL 2Z8VC 4U1KA 1P4IL 3BKCH 3FO9A 4PYGA 2P1YA 1JF1A 1QBAA 3S98A 3WCYA 4I4WA 4O2FB 4HUUB 4KKAD 2BRQA 1J0YA 2QQNH 5KOMC 4NN5C 1I1CA 5FHAL 4G7VL 5EBWA 4PJ7F 4JFDE 1MHPL 3NH7L 5I17A 4BH7A 5JOFB 3P0VH 2NR6C 2BSSB 2UWEF 5IVZA 1ND0A 2F15A 4R4BB 1WAAF 4D9LH 3IDXL 2MFNA 4LKCB 3QUZA 1I8KB 2E27L 3QUKA 4WDIB 4RNRB 4WNQA 4Z7WE 5DJZA 2VXUH 5HHVH 4ODTH 5BRZE 2V2XA 1EVTC 3ES6B 3MOQA 4G6JH 1J11A 1OGTB 3MBEC 4RQQB 5I2IA 3NCJL 1A4JB 1X4ZA 4I5BB 4JFDD 4NN5B 5EO1B 3UJTL 3REVA 1E4XI 4MQSB 4PIRF 3L5HA 1TMCB 4P48A 5T1MA 3MLRL 1QEWB 3HI6H 1OWWA 1LE5A 3E2HC 5CILL 3MV9E 3ZDZE 3D85B 4RISH 1JNNH 5JHDA 1CICC 2AVGA 2FECI 5FO9A 2VDNL 5TE7L 1HSAA 4X8XA 1YNLH 4YZFF 1AC6A 3OKMB 1NAML 5IVXB 5BRZD 1X7QA 3V5DA 5DUBB 3VGHA 4F3FB 5AG9A 3P4MB 5IB1A 4KK6D 3V4PL 1L0XA 3UEZA 3NTCL 4APQA 4XWOC 4X6CE 5GS1C 3MBEB 4M93C 1MWAB 1VADB 4G6ML 4X9BA 4M62L 1CZ8H 4MA8H 1UH2A 3SO3C 2NMSA 2Y9RT 2HP4A 3NFPA 3O2WH 1RUPL 3B2UC 3KDMB 5I1LA 3PDGA 3MRLB 3GI9L 5FCUL 4Z0XB 1XF5B 3RGHA 1F5WA 3UBXA 3H9HB 3MV9D 4LFHD 4U6XB 1IFHH 5AUMA 5SV4A 3SKUD 3CFJA 1IGFH 4P46A 3E2HB 4QHKJ 2IMMA 4K8RD 5KW9L 2JCCB 2NY2C 2QADC 1CICB 4HIJA 1AI1L 1I8IA 4RA0C 4XMKH 3HC0B 5D1ZA 3WFBH 3EYSH 4CVZA 2X4PA 4TVPH 4DVBB 5E2UL 4OFYD 5DQ9B 3AREC 2H32B 1MCWM 1WZMA 2HFGL 1Q1JH 3KJ6H 5GS1B 4LDEB 1AY1L 2JB6B 3SO3B 5GRYA 1XGRB 3TT3L 2FB4L 3ARBD 1H0DA 4I2XA 1T83C 1F11B 2A2QT 1LP9E 3N1GC 1ZT7A 1JMXA 1RZIB 1UB5B 5ITFB 1QHOA 2RIKA 3BN9D 3RKDC 1K4DB 2BVQB 2I9TA 2BVOB 2NTSP 5A40E 3GIZL 1AGCA 3GNML 4JG1L 3QR2A 1MJ7L 5F7MC 1MRCL 1EEZB 3RVXD 3CK0H 3L3HB 4HWZB 1HH6A 3LN4B 3C08H 3MRNA 2IFGA 2OSLB 3DXAA 4H1LA 1QSFA 2FR4A 2Q3ZA 5DHVH 5IHUH 1X9QA 3NBNA 1IC7H 2X1WL 4KAQH 4J6RH 4QWWC 4I0PC 3SE4A 4OSUL 3MRMB 2AS5M 5FB8A 3FT4B 4GXUM 5T1KB 3UBXI 1UG9A 2D0GA 3F7QA 3O2DL 1QFWL 5EU6A 5FYKU 2R0WH 3X13B 1I85A 3MREA 4XRCB 3DURA 4N0UA 5ILTL 2XZAH 4POZC 4EI6B 4X80L 5FOJA 3GK8L 5DWUL 4Z5RA 2ZOKB 1FG2B 2PTVA 2DQUH 3ECBA 2WP3O 3IFLH 1F58L 2FYYB 3L6FB 2OP4L 3HNVH 2VLME 4LAJH 4QHUA 5IM7B 3A6BH 1I7TA 1JZ6A 1R3JB 4LNRA 1F42A 4KHTL 1OTTD 4J8RB 4NZJA 4PJGE 4YXHH 2V9RA 1LEKB 1CFVH 4J3XA 1KLFA 3OJ2C 4I0PB 5E2VL 4PRPD 1CFSA 3D25A 4JR9L 1KJVA 1MF2H 1PKQE 4M6ML 4OCXL 1Y0LB 4NKDA 5HJ3A 4XNUH 2WIMA 4DAGH 4W70A 5GIRA 4OZGB 4LLMB 3GGWB 3VFOB 2Z35B 4NT6B 5E4EC 3GKZA 5DK2B 3TBWB 5E5RB 3QHZH 5KSBE 4JO4L 5EZIL 3DGGB 4Z6AT 3GSQB 4PJIB 2CRIA 2VLJA 5I74C 3FQXB 3RVWC 5CWSB 1EMTH 3G9VA 3W82A 3VXOA 1A6VH 4HWNA 4KK9C 3ULUL 4WHDA 3TIDB 4X5LA 3ROOB 1XGPA 5I1HL 3QQ3B 3GRWH 5MP6H 3UAJD 2EDLA 3FN0H 3SEPA 4CADA 5BS0B 5IMMB 2ZCLH 2DJ4A 3B6SA 1E4WH 3GZKA 5DDHB 1X44A 4PLKD 3IJYB 5GS0D 4AEHL 1FLRH 3CVHA 3DX8A 2VKXA 2BCKA 3SQOH 3V6BR 2K9UA 5D7SH 1AIFB 4M00A 3QXUA 5DGQA 4F7TB 1EV2E 5DFWH 2FD6H 5ENWB 4TUOB 1V8HA 4RMTA 3RAJH 3BRGC 2IPUG 43CAA 3SDDB 2IG2H 3HPLB 5MEQA 4WWKB 3G5YA 2VLKE 1FZJA 1BVLA 2XWBA 4IHOB 3E8UL 3VA2C 2UYLB 1NBVH 3IT8D 1E27B 4TUJB 1XR8B 5GHWH 2V2TA 1FGNL 2AV7A 4AH2B 4XCYB 1MH5A 4R6UA 5C71A 1KT2B 4JVUA 3MXVL 2GITA 1YC7A 5I76A 4YDJB 4JO3H 4HIEB 3BDXA 3OGCB 2FH8A 4PBWD 1F45A 1OARH 3T4AA 3RA7H 5LVEA 3UJJL 1U8QB 3UC0H 1W72B 4LAQH 2PR4L 4QXTA 3B3IB 4QRPB 5EB9A 2VLKD 3EFDH 3X3FL 3SDXE 4DGIL 1JZ2A 4P3WA 1T2XA 4HLJA 3UYRH 1HH9A 3WKNA 1SMOA 5DMJB 3IAQA 3ULVE 1RZGB 1T2JA 3LRSB 3Q5OA 5J9PA 1F6AA 2A0LD 3BMVA 4R9HA 2IALA 4K8RH 2DQJH 4K94H 4ZFFB 2IQAB 1QUNA 4HKZA 3O4OC 2Z91A 5CKGA 3OX8A 4PJAF 4M7JL 3GSRA 3VXQA 1VFAB 5FIEA 2EEDA 2X1OA 3WN5B 4LSPH 2VR9A 3TPKA 3LRHA 2HT2D 1JGLH 3VXTB 2QHLA 4IIQA 3QUXD 1CGTA 1A1NA 1TVHA 1RVFH 4J3VA 4EQ3A 1B6DA 1I9JH 1QRNE 3PHQB 5A16B 5ICXB 3WL9B 4C55A 5JMRA 2ARJB 1NCCL 2P5WA 3IDNA 3ULVD 3QUMA 1YMMA 1BF2A 5IHZA 1D3CA 1YPZA 1LO2L 4WO4B 3LEVH 1MFEH 3NFSL 4MNGE 5FGCB 3X11B 4RAVA 3QRGL 2PO6D 5KTEH 3MRJA 2PW2A 3O4OB 1E6JH 2CKBH 3NIGE 3TJHD 4PRHB 4TQEH 4NQCA 2UUDK 4YR6A 2XOTA 1SYSA 2FIKB 4N8VA 4WU5A 1N7MH 4DOHB 3CFEB 1FAKT 2OJEA 1HHJB 4JQIH 3VGAC 1XGYL 5J11C 5CEXB 4YHPB 3MLYH 4G3YH 1ZLUH 1QLFA 2BJMH 4NIKB 2ATKA 1KIUA 4BZ1L 1YN7B 3FB6A 3IXAA 4O58L 1T1YA 1JZ8A 1QKZH 3DMMB 2P8MA 4JLRB 3Q5TA 1WBYA 3TO4B 4F7PA 4HS3B 2NXZB 5F44A 4MLSA 4OUUB 1U8LB 4PJ7B 5I66B 1INEH 1ACZA 1P7QB 1UA6L 4WEBH 4WENB 3EJJX 4MMXC 3LKSB 3C6LC 1NH6A 3M1BA 4FZ8H 3W5NA 3G5XA 1UM6L 2OMNA 2UWEB 2PUQT 4QGTA 2RHEA 4FQIH 4KUZH 3LSOB 1CD1B 1ZEAH 3SJVE 1R0AL 5D71L 3VGAB 3DI2B 5E1AB 5C0AB 5J11B 5C8JB 4MJIB 1MVUB 3JV6B 2E6JA 1F6LL 3IAPA 2X4NB 5CIPH 5I1IL 1FORL 4Q9CA 2E8ZA 5C0EB 3UTSE 3N1MC 4ZO7A 3RTQC 2XKNB 5EIIB 3VFMB 1FIGH 3B9KC 2F9BT 3CSGA 4WI7A 3KVQA 4NFCA 3H9ZA 5EUKA 3GI8L 4NGHH 5FA3B 4CDGC 3ARFD 3I3EA 4XPAH 1DUYB 2WV3A 3C6LB 1AJ7L 5HHMD 3GBML 4S0SD 5DLMH 3TPUB 4MNQE 4ZS7H 4R4ND 3HI1A 4GW4A 3C60D 3SJVD 1BQHA 4M8QA 3Q5YA 4KI5E 1OTSD 3VI3F 4GG6E 4B41A 5FYKE 5I1EH 5E2TH 5A3ID 1K6QL 1LK3H 2XWJB 1C5DB 3QNXB 3G6JE 4KZDL 1DTUA 3P0YH 8FABA 3HR5A 3UTSD 3GDBA 1KB5A 3JSSA 2NY7H 3VFTA 1T0MB 2E3VA 1F4YH 3MGOB 1HI6B 3KPSD 3RTQB 4H20L 3EOTL 4X8JB 4ZDHB 3VXRE 4YHNB 4NO2A 3B9KB 4GKZB 5C6PB 5GZOD 2RR3A 4J7RA 1JPSH 5CZXD 2NPLX 1BGXH 3H2WA 2G2RA 4YDLB 5IW6B 3SKOA 1OF2A 3VI4E 2IFFH 1G7QB 5I1AA 1F3JA 2E7LC 3RP1A 4KI5D 2FATL 3QIBD 4M6NH 4N0CC 5C9KA 1F2QA 2DQTH 1FN4A 2NY1C 4JVPA 3W0WE 2IQ9L 5BMFL 2XN9B 5FUCE 2I60H 5DFVC 1KTLA 1OP9A 4NNYB 4ESKA 2EKJA 4FQ1H 4JFHE 3S3PA 3KLSA 1I3RA 4KKCD 3S8WA 2AJSL 3V6OE 3VXRD 3GSWB 1BFOB 3CSYB 4X7SH 1MHCB 3L3GA 1G9NL 2QSQA 3WFEL 4RWHA 3RUGE 3IFPB 3OXSA 4HG4K 3KLHD 4L4TA 1KIRA 4ZS6C 3FMGL 4X5WB 4WY7H 4X6EA 3VXSB 3O3AB 1F8TH 2VIRA 3CMGA 3DSFL 3F58L 2C3HA 3VWKC 3K8KA 3MJ8A 1EHLH 1RK0A 5E99L 3VXNB 4OGYH 1HKLH 3CXDL 4S1SH 4P2QE 4EBQL 3V6ZB 1TJHH 5T3ZH 3MMEB 5K9KB 3OXRA 2NY4B 5F6HI 4JFHD 2O5YL 3C5ZD 3EYOB 2F53A 3JUZA 1FGVL 2B0SL 1JP5A 4KVNL 2ZUYA 1FYTA 3VH8A 1MFDL 2BMKA 1QG3A 2DTMH 1UWXH 4DGYL 1I9IH 4F7MB 5CJBA 3KPRA 3VRJA 1MI5D 5LWYH 1MQ8A 1MAML 3CAFA 2JKXA 3HI5L 5C0JA 2DBLL 3VWKB 4P9HH 1I9EA 2WQRA 1BOGB 1UKSA 5GGRY 2E9WA 3WUWA 3TA3A 5E2WH 3OL2A 2VZOA 4HFWA 4ONFH 5SWSA 4HIHA 4JRWA 5D5ME 4UDTA 3UCRA 1GH7A 4ODVL 2CXKA 1KJ2H 4H88L 2XXCB 1U8PB 4IMLA 1ROWA 4KRPB 1QPPA 3CFBA 3D39A 1JZ7A 5C92A 4MB5A 1TXKA 2H26A 5C3TA 4XNXH 1YEJL 2J1KA 1WBZB 5IEHA 3AXLB 5EWIL 1U8KB 5B4MD 1FYHB 4LEOA 4UU9B 4MA1C 2AI0L 3TWCH 4ENED 3GMRA 5GQBA 1NMAH 3LKQA 3NA9H 1RV6X 3ULVH 2MKWA 5C6WH 3H42L 5ISZE 3ARGA 4HMEA 5ESQB 2YBRB 2GK2A 1SEBB 3HZMA 5HGBB 3BKMH 4YE4L 3T65A 4J3UA 5EO9A 2NY0C 4Y1AA 2BP3A 1IM9D 1J0KA 1VENA 4WV1A 4YAQA 1RJZB 5DVLA 4NQXB 5IUSA 3LEXA 5L8JB 4XNYL 3S9DB 1B2WH 2NW3B 1C7TA 4UUJA 1NLDH 3WFZA 1FZMA 3UJIL 4PJ5B 1CFBA 3TGXA 2P44B 4MA1B 3QB7C 2FSEB 5ISZD 5DXWA 1UB6A 1NCDH 3I50H 3BFOA 4HZAA 1YA5A 1AQDB 3T0BA 2BHYA 3MUY1 1JPFA 4RAUA 2XY2A 2X4UA 3MLSH 2NY0B 1ODAA 3NZ8B 1SJVA 4I77L 1KELH 4FTVE 3QCVL 4NPYB 3K4DA 3VFNB 2J8UF 1LO4H 5IW1A 2HVKA 2UZYB 3WV0A 4OB5H 4P2OD 3SDAB 3IGAA 3S35H 1HXYB 3X14A 3UYOD 1VGEL 4FFZL 4HXAH 4OUOA 2ARWA 4FXGB 1NCBL 5DURB 4V1DA 4HWBL 4MAYA 5MEOB 3S36H 4IOSD 4U7MA 4PD4J 4OKVB 1A6UH 3VFPA 4CN1A 3GMMA 1XR9B 4ODUB 5ACZB 3CFKA 1JPGB 2VNCA 1UXSA 4WVRA 2ZSWB 4FTVD 3BWAB 1J0ZA 3VD7A 1FVCB 4PV8A 1U0QA 3MV7B 3UBXG 2PW1B 3AROA 4D0DA 2YPLA 2I07B 1JGEB 3O3EB 2GIYA 4TSAH 1I1AD 4Q6IA 4QTHA 3RDTD 2E7BA 4HT1H 4NM4H 3KPQB 5AZEL 3WLBB 4J12A 4G5ZH 1QA9B 4OGAD 2D2OA 4HFUH 4PJ8B 3WJJA 2EDJA 1ULVA 5E8NB 3FQNA 3IVKB 4QF1A 2G60L 1BIIB 2DQDL 4W6YB 1UADC 5K9JH 3M8OL 1KIPB 1TIUA 5J13C 2E9JA 1U95B 4MD4A 1TJIH 4BK4A 3P11L 4RCAA 4YLQT 5T1LD 4KJYA 4TSCL 4J1UB 3QQ9C 1N4XL 1WCBA 2EIEA 3CDGB 2YN3A 1MJUL 3PV7A 3I6KA 4NNPL 5MHSE 5FYKH 3QG6A 1MUJA 4PJAB 4DTGH 5CD5C 4HZLB 2FL5B 3PWVA 2PTTA 3LEYH 3O9WB 4FQXD 5DC4B 1RIHH 5AZ2L 2GUOA 5CEZL 4UAOB 2AERT 1PFCA 2VQ1B 4PJ9B 3LQMA 1EHAA 3OKOB 2QQNL 1IAOB 4G6FD 3KJ4C 3KPPB 4JG0H 4XCFH 4G8EB 3QEGL 5JA9A 1VERA 3ARTA 4H1LG 4XMLL 5T3XL 1EX0A 3P4OB 2Z93B 3TBYB 4CDHA 3WDHA 5MHSD 4ODWB 3QQNA 5DMKB 1NGYB 2FGWL 2DLIA 1ES0A 2F19H 5IEKB 4NKMA 4UTBL 5AD0A 3DX9B 5I8EB 4TUKL 4O51B 4MA3B 5BOZG 1ZLUK 3K74B 3PP3K 4EOWH 1RZJL 5D7LA 2C7UA 1C5BL 4X7EC 5KVFL 3ELAT 3QWRA 4XNMA 4PGDB 2YKLL 2H2PD 1CDJA 3FQWA 5HHNA 3PGDA 3MLVH 1DLHA 4LSTH 3O11B 2BNUA 1BZQK 4NJAH 5I75C 3GIVA 4MNHB 1A6TA 1QLRA 5D2LA 2OJZH 4NQDE 2ITDA 1T0PB 4QY8B 2APWA 4RISL 3WIFB 4LPTA 1IEBA 5DD5H 3CPLB 1N0XH 4WU7B 4JANA 2A6IB 3MODH 1YNLL 3RRQA 1RHHA 4RMRA 1PEZA 1ZA6B 5BVPH 4NQVA 3HZVB 2O5XL 4OI7A 2KQMA 5KSUB 1QO3B 2Q76A 1RZ7H 2ZKHL 1YC8A 2GAZA 4L9LB 5IVXE 2KKQA 4HK0B 3SGEH 3FRUA 4MXWL 1IKFL 1I3GH 4NDMB 5FDWA 1S5HB 1HNGA 3O2WL 3OG4B 5F6IC 1YEDB 5BZDB 2DLFH 3UZQA 2MHAB 3LS5H 1JYVA 4UT7L 2LV4A 3F12A 1HN1A 1KJMA 2R4SH 1IFHL 4Z7OE 5I75B 1IGFL 5FO7B 4QNPF 2NZIA 3W9EB 3HZKB 2NR6D 4UQ3A 1A14L 2R2HA 3D85D 4QCIB 1BD2B 3MCKA 1DQQB 5HTSA 3HMXA 1J05B 2E6PA 2JCCE 3WFBL 3EYSL 5J56B 4TVPL 4N68A 3EJYC 2NY6B 3MUJA 2O5ZH 2AKRA 3HUJF 4X9GA 3RWDB 3VW3H 1Q1JL 4G8GA 1S78C 1LE9B 3MBED 4ZYKB 1EVUA 5D70H 1J8HA 4XGZA 4D0BB 5LBSL 4XCEA 1IQDB 3NZHH 3BPCA 2AABH 4QRSB 1A9EA 4OLUH 3L5XH 4OLYL 1T1ZB 5EBMB 4H25B 1D9KC 3T0VA 3OKYA 3H3PH 3H7BB 4RRPG 4WW2C 1DP0A 4ZO9A 3WHE0 3BZFA 3L1OH 1CICD 2JIXA 2EIZA 3WHXB 4PUBH 1R24A 5DRWA 4MCYB 1IGYB 1JHKH 5H8DA 4AY0A 5J0BA 4XWOD 3C08L 4LASH 2VDOH 4QTIH 3MV01 3DX7B 1JWMA 4GW1A 4DZ8A 3B2UD 4KAQL 3C5SA 4RX4A 5I73C 1XMWA 2RB8A 1MFAH 1JK8B 5JXEA 4CUCA 1M7DA 1FO0B 2OL3H 3MUZ1 1A5FH 1S7SB 3IU3B 1XF2A 5A1AA 4Q0XH 5TPWH 3D9AH 5EIQA 2AQ1A 1WIPA 3QXAA 2NY2D 4BSVA 3FT2B 3HLAB 3NCCB 2DQUL 1HHKB 3IFLL 3LQAH 2F74A 3MRRB 3FKUS 3HNVL 4EDXB 4BQ9A 1CT8A 2BOCB 3A6BL 3M07A 5D2NB 1BJ1J 4KUCD 3QUZC 4OTXH 4GMSH 1DVFB 4L8CA 2CJUL 2B5IC 3FB7A 1NUDA 5DTFB 4YXHL 1CXLA 4KK5C 5EO0B 2VABA 1V7MH 1W2KT 1JF1B 1CFVL 3BZ4A 3JV5A 4H26B 3S5LA 4I4WB 1ZE3C 4G42B 5B8CA 5GGRB 3MNWA 4A6YA 4L5FL 5EH1A 5T1KD 4HCRL 5KG9A 5FYJL 5EBWB 3EAKA 1X5XA 1X5YA 1OSZA 1HQRA 2BY3A 2G75B 4FOMA 3MA9H 4BH7B 4JY5H 1XCQA 4HKJA 1IVLA 3VD4A 5L88L 4DKEH 1FV1B 4F2MB 2L0DA 3RKDD 4QRRB 2DICA 4JFYA 2R69L 3OR6A 3X12A 1R5IA 4UNVA 3DPBA 5EU7C 2Y5TB 3QUZB 1C12A 3CC5B 3S3SA 2EO1A 4KKLD 2B5IB 3GUTA 2WLZA 4OZGE 2Z31A 2V17H 4UI2A 1NUGA 1I9RL 2DIJA 4LMQE 4WNQB 5DJ0A 5E7BA 2BFVH 4YXLL 3G04B 5EIVA 3T0WA 4RBPH 4APQC 3DV6A 5LGJA 4ORGA 2DLTA 1DQJB 1EMTL 5I2IB 5INCA 4QWWD 4YHIA 4I0PD 4PJIE 5D9SA 3VRLF 1UM4L 1F90H 4EKXA 3ZT5A 4GRLB 4KK8C 3GRWL 3RWCB 5MP6L 5F1SA 4POZD 2GHWB 4P46C 1NKOA 4CNIA 4F9PA 1ZOXA 5EBLA 1E4WL 5D7IE 5JHDB 5BS0E 4NOBA 1J87A 3KPNA 3MRBA 1FLRL 5D1ZC 3SGJA 3R8QA 1UACH 4BZ2H 1X7QB 3M45A 3V5DB 5IB1B 1EGJH 3U9UA 1CBVH 3O2DA 1TCRA 3FQTA 4APQB 1KPRB 4Y5XA 1HXMA 1HQ4A 4X98A 2EDQA 3A6CH 4P5TA 5IB3B 2EDXA 4P3CL 2XQYK 1RAMA 1EJOH 3UBXB 3GBLA 1S7WA 1CE1H 1NBVL 4QXUL 2D7QA 4PV9A 4Z76A 4JJ5A 5DI8A 5BS0D 4P2YA 4HIJB 4ZTPH 4LRIA 1I8IB 3FN3A 5DEFB 5EUOF 4KTYA 2G5BB 2EH7H 1NSNH 4FFYL 5D1ZB 1IAIH 3V7AE 2J8UB 3AAZA 1JF6A 4QEGA 3TT1H 4GLRH 1TITA 4M7KL 3JWDC 5JORA 3RA7L 5F72S 2VR5A 1ONQA 3NACH 4LAQL 4JFOA 4WI6A 1HHIA 4W68A 1L7IL 4NO0B 3SDDD 4RSVA 2JJUA 1FNGB 4UBDC 2FJFA 4WWKD 3SE4C 5C08D 4QRPE 3UYRL 4PREB 1UFUA 5IG7B 2AJVH 1MRFL 1C8PA 4KMTH 4M61B 4AIOA 1I85C 3DRTA 1L6XA 3CFDA 5GRXG 5IJVA 2DQJL 1KTDB 4XP6H 4RZCB 1M6OA 3MCLL 2I9TB 1KCVL 1RUQH 1NKRA 3HE7A 1JGLL 1QFWI 2E6QA 3VG9C 4OV6F 1FL3A 3DXAB 4H1LB 1QSFB 4RFNB 5IJKA 2V9TA 4QRPD 2R1WA 1YEIH 4NNXA 3F6IA 1ZWIA 2XQBL 4OLZH 1WZLA 3DX6B 4LBEB 5DVKA 4ZMAT 3TNNA 1KEMH 2VC2H 1WC7A 3LEVL 1JJUA 4KKNA 15C8H 3WSQH 5BV7C 3O8XC 3DURB 4OD3H 2CO7B 4KFZC 3DVFA 4HHAA 4S2SA 3T2NL 4K3JH 1N6UA 2W1NA 4IBLT 4Z5RB 2IJ0C 3OAZH 3W2DH 5C2UB 1I7TB 1P1ZA 3D3VA 1DBAH 2EDYA 3QULB 5J4MA 1N7ML 4JVWA 2UY7A 3EGSA 2GTWA 2QKIB 4JQIL 4PRHE 2ZNWA 1IKNA 4M4RA 2CIKB 2H32H 5MERA 5GRJH 3GJEA 1G0DA 4DOHE 1CK0H 4OZIF 3IS0X 5M95B 1X4XA 4WEMB 3MLPA 4AMKH 1CFSB 1QKZL 3LHPH 4AENA 1RU9H 4OI9A 4TULH 3O8XB 4GRMB 4WO4D 1INEL 4NKDB 5HJ3B 4C57C 3QHFL 1WK0A 3NABH 4OBSA 5BO1H 2GSIA 4OT1L 1U93A 5BVJA 3QCTH 3HR6A 4PJ7E 3CZFA 1RPQA 2V2WA 3STZA 2D3VA 4MCZA 4NO3A 4MVBC 32C2A 3MQIA 4H0GA 4KUZL 5B39A 4PRHD 1YYLH 5HHXH 3LKRA 4OZHA 5FO8A 1A3LL 3MZGB 1ZEAL 2ZUUA 2MCPL 3TZVB 4UIMB 1WAAE 2IH1B 4PY7A 3HE6B 3ARSA 3EYUH 1OQOA 4KI1A 1EIBA 4L1HA 2VLJB 3HMWH 4KVCL 5CUSH 4MJIE 1IC1A 1K2DA 1S8DA 4G9FB 1LO3H 1C7SA 1FIGL 3VD5A 4KHXH 3DMMD 5ID0B 4Q2ZA 3TO4D 1DR9A 2A83A 3QIUA 2NXZD 1A7OH 3SGKA 4ELMA 1P7QD 4CADB 2YK1L 4ZS7L 1RURH 2P4AB 5ADOH 5SX4I 1MFCH 3OKKA 2JELL 1RUMH 3DX8B 5JZ7C 5H37H 5E2TL 3T1FA 4JHWH 5C0AD 2CMRH 3P0YL 1A47A 2X4RB 3S7GA 1I3VA 1U9KA 4MJID 4YZFE 3B2VH 2NY7L 2YZ8A 2X89A 3PNWB 1VFOA 5F93C 4LSVL 3F7VB 5MEQB 1A6ZA 3IXTB 5HYQB 3WHE1 2XWBB 3BRDA 5DJ6B 3RVTC 3R4DA 3L3IB 2W0KA 2X4SB 1GC1C 5CSZA 1MCWW 2IFFL 3C6LD 2Z92B 4I48A 4M6NL 4YHZH 2DQTL 4OLVH 1GHFH 1C16A 2GITB 2WIIA 3DUUA 1NDMB 4FQ1L 1LO5A 3VFUA 5HYEA 1A2YB 5IR1A 4M8VA 4MB4A 4PRIA 2XN9E 5GS3A 1N6QH 3BGMA 4YPJA 2VDPL 4IIQC 1HHGB 1G7IB 3HRPA 3MLZH 3RTQD 3K46A 2ICCA 1AO7B 4HS8H 3B9KD 4YXKH 4R26H 1F8TL 1Y6MR 1HH9B 4OLEA 2B1AH 4GG8A 4GQ9H 4LLUA 4MJ4A 3VXPA 4OGYL 5L9DH 1TJHL 5T3ZL 1DUZB 1NFDF 1TZIA 1CFTA 2R9HC 4HKZB 3CMOH 1T5XA 3GSRB 1FVDB 3QEQB 5EOCJ 2APXA 1KJ3H 2EYRA 5MENA 5ELIA 1JGVH 2Q8BH 4KJPD 4LSRH 3STBA 3L3OA 2XA8H 5B38A 1DBML 3JTTA 5DEGA 2DTML 5FECA 2GFBA 1DE4A 4EIZC 4BUGA 1A1NB 4XWGH 5JIHA 1I9IL 1EBPA 1U6AH 1KG0B 4U1JA 3WBDA 2CUMA 2P5WB 3IDNB 4QYOA 4ZUUA 3VXSD 2KBGA 3QUMB 2EIDA 2VDQL 1YMMB 4P9HL 5IHZB 5TQ0H 3IFOA 3L7FB 5CLTA 1T0NA 5DA0B 1HILA 1JTOA 4ONFL 3WFHA 2OI9B 3VXUA 5CP7B 4N0FA 4RAVB 5CP3A 3W39A 1WFNA 4TRPL 5GJTH 5F7DB 1CDHA 4CU6A 2PW2B 2BHZA 2NY4D 2AXFA 3UTOA 5L7XH 2APBA 5DFVD 1Z5LA 5HDQL 1N26A 1QBLH 4AL8H 2APTA 4XNXL 1LEIA 4DCQA 3T0EA 2OJEB 1AXTL 1I1FB 5JUEH 5C0GA 4RDQF 5LXGH 4KQ3L 2A74A 4XI5C 5TGBA 1QLFB 2ATKB 3U79A 4ZS6D 3EDEA 2ADIA 4XPTH 4CBPA 1SBSH 3VWKD 3VJ6A 4Y5YA 4G43B 5D96B 4Y4FA 1EERB 4JZOB 4K7FA 1EUTA 3T8XA 2AEQH 2A6KB 5D2LF 4ZUWB 3KXFB 4PJBF 3M1BB 3G5XB 3RL2A 3PE9A 3I9GH 4U1HA 4IRZH 4LLQB 1CGSH 3BKJH 3CGTA 4P23C 1J8KA 4BELD 3F62A 2YD8A 3RPIB 2OQJA 2PYEB 1BX2A 1NJ9B 5GGVH 4PJ5E 3QPQC 4UOW1 1YZZA 4H0HB 2ZP0T 4NZUL 1H9VA 1U8NA 5IMKA 4JCLA 4L8BA 3OKNA 4TVSa 3U30B 4EZMA 4RDQG 2VRAA 5DVMA 3RWIA 5ALBL 1MFNA 4MQXC 3AM8A 3MLSL 5TF0A 5GGUA 5DJCA 2VH5L 5HI5D 1J1OH 5I1JH 2ZCHH 3L3DB 1KELL 2YD5A 4GW4B 2E5EA 4HD9A 1ITBB 5LCVH 4Y8DC 1LO4L 4P23B 4QRUA 1AGBB 4JY4B 5A2KH 2DQEL 3MRCB 1TZGH 5JMOC 3G6DH 5BZWB 5I8OH 3HR5B 2GT9A 4PJ5D 1F4WH 4KH2A 2IANA 4HXAL 1GVIA 2DD8L 5FK9B 1KLGA 3UO1H 3ISWA 3C09C 5JQ6L 4PP2B 1I4FB 3S36L 2GCYA 3V6FA 1YUHB 4IRJB 4K2UH 1Q0XL 2OTUB 2IAMA 1DQTA 2BNRB 5GGTA 2NY0D 3OF6D 2LAAA 5FHBH 5GRZA 2EE9A 2F8OA 4OM0L 5FA4B 2EE3A 1FNLA 5EUOB 1A6WH 1JWUA 5JDJA 1OAUL 4JGUA 3ZHKA 1BJMA 1G6RB 1KTLB 2XZCH 5CZKA 1TENA 4HT1L 3MV7E 4ZFGL 1I3RB 3SDAD 1OGAA 3P30H 2BDNL 4EUPG 2HTKC 4G5ZL 3L3GB 3BD4A 2GJ6A 4HFUL 4JQVA 2WUBL 3C09B 4L4TB 4HJJH 5DURD 1KIRB 3VWJB 4X6EB 4JRYA 3NCBB 4JN2A 4MD0A 4U6HA 1JFQL 1S5IH 1XT5A 43C9A 5K9JL 1WBXA 1DN0A 5BJTA 3MJ8B 1G7JA 1GGCL 2CK0L 1FH5L 3HC4H 1J10A 1K8IA 3TA3C 1XCTA 1W0VA 1T7ZA 3TFKC 3R06A 4C56B 3OXRB 4OCSH 4YBLB 3VMNA 2NY5H 1RFDH 1VEOA 3OWEA 2VB5A 2O26U 1HIMH 3MV7D 2XWTA 4MWFA 1WITA 2F53B 4H5SA 3SY0A 1FPTH 1ZVSB 3UTTA 1ZHBA 1G84A 1RIHL 5J12B 4HX1B 5ICYA 3VH8B 2BMKB 5TFSL 5F1NB 4YGVA 5H2BA 4PJ8D 3BSZL 4JFEA 3KPRB 3PABB 2QTEA 4PGEA 2X05A 5FOBB 2JB5H 1A3RL 1KB9J 3BIAX 5KANG 3EO0A 1MCHA 4HUWB 4KGJA 1M71A 3ARGC 5SWSB 4G7YL 2I5YL 4UDTB 3ULSB 4JPVL 2YA1A 1JVKA 4WV1C 2IADA 2D9QB 4JPWH 1VCAA 3BUYB 3O9WD 1HWGB 2H26B 5AEAA 2YPKA 2DI8A 4LFHG 4LLYB 4HWBA 1P84K 5E2JA 3QJFB 5IEHB 4L3EA 5DC9B 3QEHB 4PTUB 4OZIB 4NKIH 1ADQA 2N7AA 3PJSA 4OF0A 5IESL 4P9MH 3MBXL 4AT6B 2X5PA 4ODXB 5JQHC 1J0JA 1GRWA 2AJ3B 35C8H 3LKQB 1AH1A 3I02A 5AYQA 1OAXL 5J6HA 5JW5A 3MLVL 4NO5A 1K3ZA 2WBJB 4OZFG 4NJAL 5LAXB 1AD0A 5EO9B 4Y1AB 4BSJA 4XVJH 3UPRB 1VA9A 3KYKH 4M5ZH 3BP5A 4YAQB 1N0XL 5SX5H 3U36A 2X44D 3MODL 3LEXB 3MUGA 4ODSH 2HTLD 4D9QE 2ESVA 2OZ4H 3MO1B 3MZTA 5BVPL 4HUKB 3TYGH 1U3JA 1FZMB 4OF8A 1RZ7L 4YH6A 4OJFL 4PTTA 2A6DA 1CL7H 3FOMA 4M43H 4K9EH 3BAEH 1SY6H 4GAYA 4QOKA 1JPTL 1Z0MA 4MAYC 2PYFA 2EYTA 1U2CA 4HPYH 3T4YA 4N8CH 4NQEA 3Q3GB 3O3DA 3LS5L 3ZDYF 2DWDA 1AFVH 2DM2A 3SKMB 3VFRB 1JPFB 2Z4QA 2X4UB 1U8MB 1NLBL 3BIKB 4RFEA 1UJ3A 1EO5A 2GJZA 4NRYA 4ZNEA 4D9QD 1YYMH 2QHRH 1EJ6A 4LHUA 2APFA 3SBWA 5IW1B 2HVKB 3L7EA 1BD2E 3IYLW 3T77A 4DUWA 4Q6IC 1GGTA 4JREC 4XCCH 2AQ3A 1GSMA 3IGAB 4QLRA 5JPMA 1IT9L 1QR1A 3VI3E 3X14B 2X7LB 5JR1H 5D70L 1X4YA 4IRSB 4MXVF 3WJJC 5CCKL 1GOGA 3NZHL 4V1DB 5D7JB 4Z0BL 2BRRH 2DAVA 2P8PA 1QSZA 4ODHH 4OLUL 3L5XL 4Z78A 4IOFC 5JLZA 2R39A 5DUMH 5C0CB 3H3PL 4G6KL 1UXSB 3WFDL 3L1OL 5E8PA 4R3SB 4TPRH 1BD2D 1JNHA 2YPLB 4X0KB 3JTSA 3GMOB 4OCWH 4QTHB 3C6SA 2BSTB 5DVNA 2NY6D 3ULUF 3V0VB 3HFMH 4DFHA 2H6PA 1NEZG 3QQ4A 3VGEA 4QTIL 1ZGLB 4CAGA 3FQNB 3ZHLA 3BDYH 4QF1B 4UT6H 1CR9L 3LY6A 4XP4H 4NN6B 1MFAL 2W65A 4WHCA 1A5FL 3W81A 1DANU 4TNWF 3F5WA 4JFFE 1QOKA 3UROR 4FQCH 2NX5A 4KJYB 4U1MA 5C0FB 1X5IA 4FQQA 2D7OA 1WCBB 1A7RH 4ZUVA 1NFDB 5D7KE 1M7IA 5F7EH 3H8NA 1R5VA 3I6KB 4CU7A 1U3HA 1MCNA 3FB8A 1MUJB 1QLEH 1E4XL 5C0RL 1CGYA 3PWVB 2PTTB 4P4KA 4UTAH 5ICZA 5IFJA 1LVEA 4OTXL 5FKPB 4GMSL 3QDMA 3X3GH 1G9MC 3EOBA 5D2NE 5JPNA 1PZ5B 3UZVB 1S78D 2VISB 3Q6FA 3RWHA 2HVJB 4JZNA 2YRLA 5JIKA 3BN3B 4AG4L 4OGXH 1X3DA 4OV5A 5CFHA 3DOSA 1RK1B 4ZAKA 1G1CA 2BOBB 5D7KD 4DKFH 4U4BA 4PGZA 3ARZA 1ZLVK 4PGJA 4DKEL 3SKNA 1TTGA 1GGIH 1ES0B 4OZHF 4EN3A 4NKMB 1A7BA 4QRRE 5AD0B 1DVFD 1A1MB 2V17L 2UV3A 4OCRH 4ZFOL 4LPWA 4LSSH 2BFVL 3QXTA 5KZCB 2HA1A 3TYFA 3RIFF 3NCEB 4HUMB 1F00I 3DWTA 5IW3A 5T1DH 5J1TC 2V5SA 4XCNA 3PWUA 2VDLL 2HT4C 4GSDL 4N5EC 5D7LB 4ZD3L 2HN7B 4LKXB 3V5KB 2F58L 1YY8A 3MLTA 1JV5A 1UZ8B 4XNMB 1RD6A 3FQWB 5CBAA 5E6IA 3PGDB 1F6FB 1DLHB 2M1KA 2Q6WA 1QRKA 1MCRA 4LEXH 2CIIA 3GIVB 2XFXA 1Q8MA 5D2LB 3GSOA 4PJBB 1IEBB 3EJZD 4QRRD 2GY7B 3BEWA 1F97A 4JANB 3QFJB 5DHVA 3RU8L 3QUZD 1AXSB 1RHHB 2AQ2A 2V7HA 5LQBH 4F58H 1UACL 4BZ2L 4OZ4A 1N3NA 2IPTL 4NKOB 1EGJL 2DM3A 4H8WC 3HAEA 1CD8A 2GAZB 1EXUA 3RWEB 4NC1C 3TO2A 5GZNC 4HUNB 3FRUB 3LQZA 5FDWB 3AC0A 2NTFA 1YEFL 1WGOA 4ZSOA 2AJXH 1E6OH 1EJOL 1GAFL 3GMLB 4M6OH 1KJMB 4GRLD 3CXHK 3P3YA 3L9RA 1CE1L 5EZOH 4PS4H 2QV2A 3L95B 3GKWH 3IRPX 4UQ3B 2R2HB 4EUPB 4ZTPL 5JHDD 3MCKB 3U4BH 3ZKXC 2CDFB 2EH7L 1B0GA 1IAIL 3QA3A 2AKRB 2J8UE 4APQD 3NACL 3VGBA 4PJHF 1J8HB 4XCEB 5F7LB 3FRPG 4X83A 3BPCB 4FQJL 2A77L 1SEQL 5C09E 4X4MA 2DWEB 5DFTA 3MRPB 5JXEC 2AJVL 3DBXB 5GSVB 5KVDL 2L7JA 4EI5A 4DVRL 3ET9F 1I1RA 4HSQA 5I0ZA 4WFHE 4UV7H 1S7XA 2JIXB 3K1KC 3MJ7A 1X5ZA 4XP6L 3X17A 1S9YA 2EIZB 2WAHA 2N7BA 1CDGA 5DRWB 5D1ZD 1CVSC 1JTTA 1MFBH 3VCLA 3S34L 3OJDA 1OLZA 2HMIC 1T2QH 3GRWA 4N1EA 4U0QB 1OW0A 3A67H 3CH1A 3OR7B 4GW1B 4DZ8B 1NGXA 4NO0D 1MVFA 1T7YA 3C5SB 3DXAE 2BSRA 1QSFE 4FMFA 5CZVH 4OLZL 3O6MH 5B8CC 3JWDL 3BGFC 4FQHA 2ED9A 1OWRM 1BEYH 2UVEA 1M7DB 3QUYB 2QQKH 3WSQL 1TFHA 15C8L 1XF2B 4WFHD 1XF3B 3RWFB 1D5XA 4OD3L 3ARRA 3PV6A 1NAMB 4AIXA 4Z77A 1R3LB 1XH3A 5C0DA 2F74B 3KYAA 4YBQC 5C0BA 3PWLB 1DBAL 1MLCA 1QACA 5J3HC 4GUPB 1ZV5A 4Q74A 1MHHA 5I71C 2EC8A 1SJHB 2AJZB 2J3SA 2PETA 5GRJL 3RL1A 2VABB 3DXAD 1QSFD 4OZFB 2EO9A 1WICA 3S5LB 3CH8A 4MZ2A 4AMKL 4PP1D 3BGFB 5FUOH 5HPMA 3LHPL 2RAMA 1VEPA 2WW8A 5FCSH 5KG9B 2V9QA 1Q72H 3PWJA 3V5HB 3RBSA 5FF6A 4Z7WA 2ZPKL 3GSNH 1YY9C 3QCTL 4HKJB 3DTXB 5BRZA 1T5WA 4F9PC 4O9HH 5DRXA 5K59E 3TEUA 4JFYB 4Z7QF 3X12B 1UJTA 3SHSA 1YYLL 2UZIL 5HHXL 5BV7L 3TBSA 1C12B 2GSGB 5LGHH 2DMBA 3D18A 2BVPA 3SGJC 1I7ZA 4XP1L 5I71B 4GH7B 2AJYH 5JTWA 1FFNA 2DMCA 1JUFA 3EYUL 3GHBH 3T09A 5DJ0B 5D1QA 2DOCA 4LQFL 5LGJB 1BJ1H 1CU4H 4Y5XC 4XZUA 1MJJA 2BSED 4ORGB 2WUCH 2VTFA 3EYVA 5CUSL 2WWMD 5INCB 1P4BH 4S11A 4AM0A 4EQ2A 4YHIB 5F7YC 4P5TC 1ZLWH 1QSEB 1IEHA 4LARL 5CGYD 4OD1H 1CIDA 5I6XB 2DQCH 3IDGA 5F7UA 3VXMB 3C2AH 1A7OL 3O8XD 4G9FE 4JPIB 1HOCA 1NGPH 4HBCL 1WEJL 1YNKH 4PG9A 3ZT7A 4Y16B 4BJLA 2CLRA 5C2BH 4CNIB 4WTXA 2VL4A 3VFVA 1RURL 4OFYA 1DJSA 3E6HB 4LRIC 4NZTL 3RJDA 4GMTL 1MFCL 3S88L 3KPNB 3MRBB 1P4LA 2JF1A 5J6GA 1RUML 5AYUH 1TETH 1D6VH 1NC4B 4ZOBA 3TZVD 2B4CC 2CMRL 3FTGA 3GSVA 3U9UB 1CFQA 4XXDB 4F7CA 5HGHA 2VLJD 5F9AC 2K7QA 3QPXH 1WCQA 2CR6A 4O4YH 4CMMA 4R96A 3KPOB 3CVHL 4G9FD 1KXQE 1S7RB 2FO4A 3G5VA 2CKBA 4Z76B 4PV9B 1PG7W 1U58A 3QH3A 4HH9A 3BJ91 1FJ1A 3PHSA 4YIQA 5BXFA 1XGTB 3ZE1F 4BSWA 1NEZB 2G9HA 1S7QA 4YHZL 4MVBD 4OLVL 5JDSA 4QNPE 1GHFL 5IMLA 4S1DD 4LDOB 3PQYB 1RZKH 3VFSB 3BXNA 3HE7C 4ONHB 5JORB 3W9DB 2NW2A 1Z0NA 4YDVA 5ADPH 3ULUC 1ONQB 1LP9A 4WGWB 1HHIB 3U0PA 5IJKC 3MLZL 3HUJE 2OR8A 2X4OB 4IS6B 4KJQC 4XPHL 3LH2H 4KMLB 4OFDA 4YXKL 3U46A 2FJFB 4R26L 5IOPA 2ZUVA 3I6LE 4URTB 4U05A 4IMKA 3HN3A 1AO7E 4LGSB 2B1AL 2R1YB 1G6VK 3BQUB 2OXHA 5L9DL 1Z3GL 3DRTB 3TM6A 2ERJC 5KN5A 1TTUA 3CFDB 3MV8B 4DW2L 5IJVB 2QR0A 1MCPL 3U0TA 3BP4A 3BT2L 1M6OB 2GW5A 5HVHB 4LVHC 2EXYD 5CIPA 3U6RA 1GC1L 3HE7B 1KUMA 2Q8BL 1H3PL 1LHZA 2VXTH 3QEQE 3HPJA 2X70B 3DIFA 1IKNC 1YEGH 2CDEA 5F7KC 1N59A 3D6GA 5F7NC 4PY8J 5I1CH 5AWNH 4YDKL 2R1WB 1U6AL 4YUEL 5CGTA 4NNXB 1K8DA 1AO7D 1MCJA 1RZFH 1ZWIB 2R0LH 3E6FA 1MJ8H 3U4EB 1GZQA 3RVTD 3TNNB 2C3WA 4XNZB 2P5WE 5TQ0L 5CJQH 2F54B 2VE6B 1AR1C 5DJDA 4PD4K 2ERJB 4HHAB 4ETQA 4HJGA 4CGTA 1QBMH 3MA7A 5GJTL 1A4KA 3CX5J 4P57B 5DRZA 4XNQA 1U3YA 4LVHB 1RJLA 1MOEA 3ZL4L 4GAFB 1FNSH 3QEQD 3FO0H 2LU4A 2KPNA 1P1ZB 3D3VB 5GRWA 4AL8L 3FFDA 1PKQA 4LLDB 2CUIA 5JUEL 4S1QH 5MERB 3GJEB 3G08A 4LSQH 3GHEH 5EOTA 1DCLA 3IDJA 4K7PX 2P5WD 4UOJA 3MRDA 1SBSL 2HH0H 4HUXA 5DUPL 3BESR 1MIEH 4AENB 1YMMD 2Y72A 5EOQL 1ZT4B 5HGDA 4U6VH 1EHXA 2GTZA 3QIUC 4HGWB 1CD9B 5KSBA 4MB3A 3SGKC 3O45A 2GSIB 3BH8B 2YD7A 2CDGB 3QNYB 5JHLH 3Q1SL 2XZZA 2V2WB 3BP7A 3TCLB 5JW4R 4K3EH 4NO3B 4BKLA 1UKTA 3KXFE 4IRZL 4OZHB 3KG5A 5D72L 2BERA 5DYOA 4M1GH 4BQ6A 1N5AB 2NNAA 5E8OA 4PY7B 3IETB 1KCUH 2XI9A 2D0FA 4Z7VF 1ZT1A 2DRUA 3IKCA 5GGVL 2R2BA 2PYEE 3WNMA 4Q9QL 1K2DB 2O61A 1KENH 4Q7DA 1FAIH 1H5BA 1QVOA 4Q2ZB 2LABA 3GSUA 4RGMC 1DSFL 3W11C 2A83B 3QIUB 1CF8L 2LU3A 4LVNC 3VRLE 4O00A 3LV3B 4NN7C 1CFNB 3KXFD 4X4YB 5I1JL 3K80A 4R0LA 5A2IH 1JNJA 1JYWA 5F9OH 4ZTOH 4O2CA 3DHJA 2PYED 1R3KA 2VQUA 2CRYA 3OZ9H 1S7TA 3RWGB 4DN4H 1S7UB 4WHTA 3P9LB 4TOYL 3UO1L 1MNUL 3NN8B 5L8KB 3F7YA 4MQTB 1KJ2A 1PQZA 3Q2CA 3AUVA 1KB5L 3AS1A 3VE0A 4NN7B 3FAWA 4CW1B 2DDQH 12E8H 1NDGB 3IU4L 2YHGA 3MR9B 5FHBL 1TNNA 1H3VA 4I48B 4P5MB 2YOCA 3REWA 5EPMA 2BNRE 1NMBL 3SDXA 2WIIB 3O2VH 3QUXA 3DUUB 3CZJA 2WLYA 4WJ5A 5C9JA 4P23D 2RQ8A 2XZCL 1LO5B 5IR1B 5EUOE 4PRIB 4QHMA 3QIWB 3P30L 4I13B 4B50A 4ZUSA 1L9NA 2ZWLT 2DN7A 1MIML 1PKOA 4PJHB 3QPQD 5EORL 5E6YA 2NXYB 5F3HA 3VD9A 4YK4C 5B3NA 1FVEB 1WTLA 4RGOL 4L4TE 4XPGH 1KYOJ 4GG8B 4IRJD 4MQXD 1X6LA 2BNRD 1Y6KR 4Y5VA 2XY1A 3GSXA 2A9MH 3EIFA 2Z9TA 4U1SB 3ILQC 3UX9B 4OCSL 4IM8A 2NY5L 1RFDL 3ZYJA 3D1MC 1JRHH 4PLNC 2V2TB 3VA6A 1QRNA 1T5XB 3QHTC 4C56E 4OM1H 2EYRB 4HBQA 3MRGA 1FPTL 4P0DA 4YWGH 4OIIH 3T0EC 2CLZB 4MNGA 3ESUF 3IDIA 4LCIH 5FECB 4YX2H 4L29B 3WXVH 4PJXA 2HKFH 1HINL 4U1JB 4YK4B 4L4TD 1KC5H 2AGJH 2WWKT 4QYOB 3KPSB 2Y07L 2JB5L 3VWJD 5HVWA 5CD3B 1SYVA 4X6BA 4ZUUB 5IB5A 2B1HL 3KPRE 4B7LA 4UINH 4MQ7B 4P5KB 4Y5YC 2WNGA 4MD5A 4ZQKA 4JJHA 4Y4FC 3QXVA 4JN1H 4N0FB 1T80A 4FQ2H 4C56D 3QXDA 5DHYB 3MRFA 1E28B 5SWSE 4XP5H 2MOVA 3SDYH 4JPWL 2F53D 2WM0A 4DZBB 5DQJA 3T0EB 4DCQB 4YO0A 1HKFA 1A6AA 2HTKD 1FYTD 2YRZA 2A74B 5EOCH 1T21A 1W0YT 2C26A 1U92B 1FE8L 3WD5H 4B0MM 5TGBB 1UYWH 3KPRD 4P9ML 2H3NB 4XMPL 3ARFA 5CJXA 2ADIB 3F65A 4OZIE 35C8L 2APVA 2OTWB 3UTPE 4Y5YB 1N8ZB 4IJ3C 5J1SC 4PBVC 1OAQH 1NGZA 4XPBL 4Y4FB 3TA3D 1ZHLA 1ED3A 3FAXA 4PRBA 3TFKD 5SWSD 3T8XB 3AM8C 2C5DC 2R1XA 3MACH 4FQLH 2ADGB 4LSUH 5J06A 5IK3B 2BX5A 3RL2B 4M5ZL 4FXKA 3D0LA 4Y1AE 5JO5A 5IV2A 4TTGA 3C5ZB 5IWLA 2W9EH 3TYGL 2OQJB 1BX2B 4PRAB 4S1RH 3TVMC 2I26N 2FEDC 4M43L 4GXVH 1X5GA 3KWWA 3V0WL 5CGMA 4K9EL 3UTPD 4MNQA 1J1PH 5IF0A 4HPYL 3RGVB 4N8CL 4NRXB 1CDBA 4IJ3B 5IMKB 4WTZA 4L8BB 3ZYZA 2SEBA 1NMCC 2WBJD 3G6JA 2IAMC 2L7UA 1