3C5SB

Crystal structure of monoclonal fab f22-4 specific for shigella flexneri 2a o-ag
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
215
structure length
198
Chain Sequence
b'EVKVEESGGGLVQPGGSMKISCVVSGSNYWMSWVRQSPEKGLEWVAEIRTYYAESVKGKFTISRDDSKSRLYLQMNNLRTEDTGIYYCFLPMDYWGQGTSVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab F22-4 light chain
publication title Structures of synthetic O-antigen fragments from serotype 2a Shigella flexneri in complex with a protective monoclonal antibody
pubmed doi rcsb
molecule tags Immune system
total genus 38
structure length 198
sequence length 215
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c5sB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c5sB01
4B7IA 2Y7QA 5F1NB 4R3SA 5KOVC 3FJTA 1GGIH 4U7MA 1RZ8B 4KK5D 1AGFA 1UVQA 4A2MA 4HH9A 2IAMA 3RBSA 4NO5A 1MI5E 2OL3A 4LSRH 3PQYB 1BD2B 5IGXL 3TN0A 3RU8H 4L8BA 2ZSVB 1J18A 3TYGL 2ADFH 2R1YB 1L7TL 3KPNB 3B6SA 3T2PA 4LEXL 2FO1A 1B9ZA 5T33H 1P5UA 2HJFB 5BJTB 5HI5C 4YFEA 4BFIB 3O2VH 1A9BB 1QO3A 2OTWB 3QFDB 4XWOC 1BIIA 3UTTD 3SDAB 4HFUH 3DXAE 1IM9B 3RIAK 2BVOA 2DJSA 3KPRB 3VXQA 5F1IA 3TCLB 1P2CB 5CEZE 4D94A 3SDCB 1U3HA 1KLGA 2O5ZL 3C2AH 4ZXBD 3QCUL 5BMFL 3QXTA 3QUMH 3E6HA 3MLVH 2PW1B 5FYLD 3GSWB 2VRAA 3BKML 4P23C 1CE6A 5J1AB 4CVWA 4D0DA 1H3VA 3DVGA 3NIDE 2HTLC 4MAUH 4RDQG 4P5KB 4XMKH 1YNLL 1H3XA 5J13C 2ORBL 5C8JB 3X13A 3FB6A 4CW1B 1XGQA 3MLTA 2QSCL 3GDBA 1IZKA 3HHRB 4C56D 5CJQL 4WHDA 4Z0XB 5L88H 1I1FB 1NBZB 1YEEL 4JDZA 2SEBA 3VG0L 3T0AA 3J7HA 4NBXB 5J12C 1D7FA 4NYLB 4ONGL 4XCNB 1O5DT 1AO7B 4LSUL 2YPKB 5BRZB 2DIBA 1F90H 4CVXB 2VITA 1QBLH 5L2JA 2DYPD 4KAQH 7FABL 2OLDA 3PWLA 1N6UA 3HR5B 1MY7A 4GAJH 5GGVL 1T2QH 1XCTA 4HWEL 1AGCA 3ROLA 5GRJH 5C09B 3QUZC 2VJXA 4JN2A 4XPBL 3P0YL 5MP6H 4Y4KD 4MD4B 4XWGH 1P5VA 3THML 2XPGA 4OLEA 4OZFB 4PS4H 4PGBB 2ZKHH 1MCKA 4Y2DB 5EOTB 3BYYA 4J6RH 3R1GL 4CU6A 4RZCA 1I4FB 4G9FA 2VDQH 4LKXB 4ODHH 4BFBD 4Y5VA 4XXDA 5GGSB 4G5ZH 1I3GH 3BZ4A 3OJMB 3EDJA 1HHGA 2F19H 5F7LB 5KW9H 4CNIB 5CIPA 1QSFB 3WEXA 1U8OA 5MENB 4OF7A 5EBWA 4YAQB 1X9QA 3R06A 5C7XH 4QNPE 5EU4B 3VXSB 2PO6C 4JE4B 5FYKU 4L1HA 2Q8BL 5MI0B 4TNVF 3CZJA 2JTDA 1P4BH 3I6KB 4X8XA 2W0FB 4GRWH 1S7XA 5C07E 4XNYL 3EOTL 3EHBC 2D31A 1G6RL 3HNVH 3B8SA 1VA9A 4F9PA 1WAAE 4I2XE 2EE3A 1T1YB 5CFHA 4P2RA 3UC0H 1ZT7A 5E5UB 1S7SA 3P0VH 3G04A 2UUDH 2HJKA 3BIBX 4C4KO 2DMCA 4QRTB 5C0JA 5B38A 2DQGL 1EMTH 2P24B 4XP6L 4PJ7A 4XZUA 4UNUA 1UM6L 4GMTL 2DWEB 1PLGL 4LMQI 2UWEA 5H94B 3FB7B 1W2KT 4G6KL 4MA8L 1A0QL 1TPXB 3MUY1 4NT6B 1PQZA 4UDUA 5CEXA 1Z0MA 5TH2A 1J10A 5FGBC 1PX3A 3BP5A 4QXGH 3RGVC 2X2YA 3KYKL 3PXJA 5F6IB 1BD2D 3NZHH 4Y4HA 1MWAB 3QUYB 1NGQL 1FO0H 4KKLD 3A0OA 2G9HA 3QP3A 4U6VL 1GC1L 2VWEC 5IHUH 1SJEB 3QEHB 1WEJL 4WUUB 2GT9A 4CVZA 2GSIA 5D9SA 4OZIF 4MSWA 1UWXK 2R9HC 4JRXA 4N0CD 5D5MA 2VDPH 3D18A 5SV3A 1A9EB 1X6LA 4U49A 4XBGB 4X4YA 4DAGH 2V2TB 4HJ0C 2QQQA 4FTVA 1BGXL 1KPVA 1WSST 4OUUA 5ACLA 2EEBA 4A2LA 1HIML 2A74A 4JFHE 1JRHI 1UCBH 4OJFL 4KQ4H 3GSRB 2IALB 4Y7MA 1BBDH 2X89A 1IL1A 4HWNA 3QHZH 4NQCE 4QRPB 4K9EL 2E27L 5FB8B 1A7PL 3D25B 3AXLA 4YEFA 3Q48A 3WIFB 4MLIA 1LWRA 3DRQA 4PREA 1IGFH 3PE9A 2Q8AH 4G6JL 1VEOA 4YQXL 2V9TA 1I7UB 1CLCA 3DPBA 3WLBA 3EJZC 2ZZUT 4DK3A 4L29B 3OL2A 1UZ8A 1OARH 4J7RA 4JFFE 3T3PE 3V6OC 4ONFL 1VACB 3CH1A 1NKRA 5C07A 2VL4A 4YDVB 4Y19D 1F4YH 1SY6L 3H2WA 3RVUD 3WD5H 4HK3J 5CSBA 3U7YH 1YNTB 5K9QI 3GMMB 2BSTB 1UB6B 5DUBA 1XZ0B 4I2XA 4IJ3B 4NN6C 2X4SA 3MV7B 1S7TA 4JCMA 1IGML 5ILTH 3TIDA 3DV6B 2G60H 2JCCF 4K8RD 1QLRB 4M43H 4NRXB 3K74B 4LK4A 4KPHL 1GGCL 1Y6MR 4NUGL 4RMSA 3OKEA 4NQUA 4FQPA 1OAUH 3PWJB 1D9KA 2VE6A 1N26A 4KI1A 4CU7A 2XI9A 4MJ5B 2PYED 5JR1H 4WFHD 4NM8H 3QWOB 2O5XH 4HKBB 1RPQA 5FM4A 4NCC2 1D5XB 3L95B 3V4UH 1JPSH 1P53A 4HQQH 1P4LB 3UPCA 3MACH 3Q3GB 1MAKA 1ACYL 3X12B 4GH7B 2NY4C 5ETUB 1EV2E 4MAYA 1VGEH 1XGTA 5GGUA 1BQLL 3OG6B 4LAQH 4M48H 1OGTB 2Z8RA 1CD1A 1CFVH 1OSZB 1CFSA 3G5YA 3T0VA 2OQJB 2A6KA 4CMMB 1GJIA 1J0IA 4X7TB 4JPIA 4Z76A 1YMME 2VIRB 3BAEL 2VZTA 4X99A 1U0QA 3U1SL 3ET9F 2YD5A 1IGCH 1KFAL 1TQBC 2FB4H 3JUYA 5KSBF 4LQFL 4WI7A 1RU9L 3BESR 1PX4A 2VDKL 1RULH 3G6JF 3NMEA 3G6DL 2YN3A 4DGIL 3O2DA 3E3QE 3OF6D 1MCJA 5CJXC 3K8LA 4M6NH 2X1PA 1AQKH 1NCTA 1RHFA 1VKXA 5JDSA 1I8IA 4YHKH 1QA9A 4WI2A 5HHOD 4JY6A 2VLJD 4JGUA 1B4JH 3BT2L 1JNJA 1M7XA 4N68A 4QHKJ 3AMKA 5T3XD 1G7LB 4B50A 5CKAA 1J1PH 4XPGL 5F7KC 1AR1C 4X6FB 3R0MA 2H32B 2J8HA 4IOIB 2WSKA 5D1ZD 1F4WL 5B39B 1YEHH 1ND0A 5EULV 1KLUB 5C0ND 5KVDH 1FIGH 1IT9H 2NX5D 4P4RB 3ME0A 3V5KB 4NFDA 4ODVH 4HT1H 4I0PC 3U36A 3LRSA 4CVUA 1QRNE 4JR9H 3S3JA 1QNZH 3MLYL 3KPLB 4QRPD 5L6YL 4M9OA 4NP4H 5EORH 5L2KD 3KYOB 5D2NA 1T83A 3VXNA 5AZEH 3ULVH 5HYIA 4I3GA 1TTFA 2P7TA 3V0WL 2GUOA 4MD0A 5I1DB 4H8WL 5L7XH 2VQUA 4U1IA 5HYJB 4WY7H 5FYKL 2AAVA 3B5HA 4Q6IA 5HXMA 1HHJB 4Q2ZA 4UB0L 4Z6AT 3AROA 1U8PA 1OPGL 2AP2A 4U1NB 1AR2A 3F7QA 4V1DB 1EJ6A 1DQTA 2R29L 2ILLA 1IMHC 1J0KA 1FAKT 3I9GL 3BO8A 2DRUA 3O8XC 4PGEB 4Z7OF 2AGJH 3BEVA 4X7FC 5JLZB 1E4WL 4WENB 1I7ZA 3BN9D 3TH2T 4WI4A 3S88L 2IFGA 3UTOA 2BOCB 3HC0B 4OF0A 3H9HA 5C6TL 4OCNC 1A3RL 4QTIL 5J6GA 1T66D 1OAZH 1NSNL 3Q6FB 4CADA 1A7OL 4TVPH 5IOPA 1A6UH 4HS6A 5DD0L 3UTTE 1LEIB 2E6PA 3QDMB 3CGTA 3CFCL 3JTTA 3GJFH 4K7PY 5IFJA 4PJFB 1P7QD 1NDMA 5FO9B 1JGEA 1UWGH 2VH5L 4WJ5B 5C3TA 3BX7C 1GGYA 3CFJB 3DMMA 2Y6SD 3FQNA 5EBLB 2NXYC 3S9DB 1RURH 1B2WH 2P42B 1E4KC 4OLYH 3TA3C 5ICYA 4L8SC 3MGOA 5FYLE 4OFVA 1ZXQA 4TUKL 1F11B 3U30C 1VFBA 1AKJA 5EZOL 2IH3A 2YXMA 4ZTPH 2NY1C 2BJMH 3ARDA 5FV2A 1VPOH 1T7YA 4C56E 3RUGF 1T5WA 1IC7L 1L6ZA 5JDJA 3DETD 1P1ZB 3DIFA 2W60B 4QHMA 1YEFH 4NQDD 1DE4B 2APTA 1MH5A 3L3HA 3L3IA 1BFVH 3KXFA 2XTJB 3NIGF 4HHAA 5GPRA 3WUWA 3JV4A 1OAXH 3IYLW 4E42B 3SKOB 4AY0A 4P3DB 2ZSWB 5D71L 1HDMA 2Y07H 1N4XH 2FJFB 5ENWA 1JYXA 2EDNA 4TSCL 2AK4A 4YGVB 1RSFA 1XGRB 3ZKSD 1QRNA 3FOMB 4HF5L 3KPPB 2GCYA 7CGTA 2AW2A 1DDHA 4HC1H 3H9SE 1UZ6E 5HGBA 2QR0A 1FZMA 5E5MB 5IT2H 3SO5A 2ZG1A 4O2CA 1YJDH 1JHKL 4RGNC 3HTLX 1JNLL 2JK5B 3W9DB 1KLFA 3GBNH 5ANME 3CVHA 5J3HD 3UJIH 2IAMC 2R0WL 4WO4B 2W9EL 3R4DA 5TE7H 4DK6A 4WGVB 1QLFB 1YJDC 3FFCA 3TWCH 3WYRA 4GBXD 5K93A 1TQCC 2N4IA 5HYQA 1RIUL 2AJYH 2NY6D 3PIQA 3OKLA 2P8LB 3ARUA 4HLZG 4LP5A 1BOGA 1J7VR 3D85D 3SKNA 2CUMA 4D9QD 1JBJA 5ISZB 2Z92A 1YC8A 3MA9L 1X5YA 2KBGA 3GRWL 4RNRA 1GSMA 1ZHLA 1U3YA 4PRPB 5EWIH 1MCPH 3GSVA 3W9EA 1BLNB 4X8JB 4E41B 5CGTA 2EIBA 3QNYB 5GSVB 3B3IA 4P9ML 4QCIA 2MOVA 3RZCD 4H20H 1WIPA 1SVZA 5HGGS 3QA3B 4JO2L 1IEAB 4V2CB 3OXRA 3ULUH 1Q9OB 1S5IH 5KVFL 5ESQB 5DA4A 3CMGA 1BPVA 1MFDH 3MCKB 2XZAL 3DHJA 4JDVB 4KK9D 4OCLC 3O3UN 2AJUH 4PJ9B 2YZ1A 3MLXL 2C4FU 4O58L 4DQOH 2BMKA 3ULUC 3I02A 3ZDZF 1Y18B 3LN5A 1KG0A 1FSKB 2UY6A 3RNKA 3IXTB 1AHWA 1G9MH 2CKBL 1V7ML 4V1DD 1A64A 2XWBA 5I73C 1KJMA 1MHCA 4HH8A 2UVFA 4HMDA 1BD2E 1QLEH 3NFNB 1CR9H 1G7HA 1G9MC 4EVNA 1NCBH 1FL6B 4M61A 1YEIL 5JUEH 2B2XH 5C0BB 2GK0B 4UT7L 5D7IB 4JFXB 4M5ZH 4YHZL 3EFFB 4BUGA 4ZOBA 2R15A 2EKSB 3RVXC 4XCFH 4G7VH 4UAOB 5HYSA 1GGIL 2YD6A 5EA0H 1WQVT 3JSSA 3KYMA 3VG9C 4YHLL 3WDJA 3H9SA 2BSRB 5ESAB 4HULB 2OR9H 5CIPH 1SMOA 3PGFH 3V6ZB 4TTDC 1DUZB 1IGJB 4LGSB 3CDGB 1HXMA 4PGCB 4F7EB 1P9MA 3DX9B 4FQXD 4AJ0A 3S97C 1WLHA 5T33L 3MODL 5ANMA 1JTTA 4UOJA 4IRJA 2Z8WC 1EO7A 5E9DD 4JGJA 2YD2A 1FNSH 3VI4F 3O3EB 3BFOA 3O2VL 4NNYA 4PJIE 4QXTA 3HMWH 1X4ZA 4F7PB 4HJJL 1N8ZB 1AO7E 3L9RA 1ZHBB 2VABB 2PXYD 4HFUL 1LEGA 4LLDB 3MROB 1OD7A 3N1QC 5DJ8B 3SE8H 4X4ME 4R8WL 3CXHK 4Y19E 3VXTA 1XF3A 2Z4QB 3HS0A 3CLFL 3G9VA 4MZ3A 1WBZB 5AD0A 5CEZH 1XGPB 3BWAA 4Y4FD 1HQ4B 5C9KA 1CTOA 2J2ZA 3F5WB 3VD9A 4DUWA 1WZ1L 4MAUL 1KTDB 2C1OB 4XMKL 3D69A 1KJ2H 4K7PX 4OBSA 1H3PH 3WFCH 5F7YC 3OGCB 4JCLA 3C08L 4OZHF 4N8VG 4GAYB 1FNAA 2HVJB 2FSEA 3E2HB 3HA0A 4U0RB 1FVCA 3DURB 1JZ7A 4LQ1A 1CGUA 3ZE1F 2VMFA 5F1NA 2PYEE 4R0LA 4WFHE 1RZ8A 2V5TA 1QBLL 1RIHH 4U1JB 1U8LB 4KUZH 2GJJA 4GAJL 3PQYA 1T2QL 1BD2A 1HNGA 5ICXB 3A67L 5GRJL 2ZSVA 3GBLA 5GGQL 5MP6L 2R1YA 2Q6WB 1NCDH 1DFBL 3KPNA 4XWGL 5LXGL 1UEMA 5DT1L 3DYOA 2YD3A 2ENSA 4PS4L 2HJFA 5BJTA 4GAFB 4BFIA 4E41D 4JVPA 5DK0B 3SDXF 3FZUD 2OTWA 3QFDA 4OGAC 4B5EA 4G5ZL 3CSBA 3SDAA 2VXUL 2G2RB 5KW9L 1IM9A 2QADC 5I1IL 1S9YB 1F13A 1YPZB 3ZYZA 2H3NB 5GS1C 3KPRA 2VAAB 3TCLA 1P2CA 3HPLB 2YD7A 3SDCA 1HQRB 3HI6L 5C7XL 2XIDA 2V5YA 1EHAA 2PW1A 3RWHB 4NJ9L 3GSWA 5FKPB 3ZKND 4P2CG 3QG6B 5J1AA 3EDFA 2IGFH 2NY3B 1ZWIB 4P5KA 3HNVL 2JJSA 5E1AB 5C8JA 2UVEA 4CW1A 5A2KH 3CVIL 2NXZC 2VDRH 4Z0XA 1D5ZB 1I1FA 1NBZA 2XA8H 5HHOE 3QCTL 5JXEA 3KJ4C 4WEMB 3RPIB 2B39A 2P5EB 2VLJE 4NYLA 5SX4H 3P0VL 4XCNA 1IEHA 4R90L 1AO7A 4WUUE 4GRLC 1X5JA 5BRZA 2YPKA 2AV7B 5T3XE 1H15B 3TO4B 4C55A 4CVXA 4XMLH 2I9LB 3N1FC 2DDQH 2IH1B 1EMTL 1TDQA 2YEZB 4IMKA 4PLJD 2WIMA 2H9GB 2OJZH 3HR5A 4PJAE 1R5WB 4ZAKD 1UWXH 5C09A 4N8PA 2FO4B 4LHUG 3TFKD 5F72S 5GZOD 1TJHL 2NX5E 3AS3A 5ADOL 4MD4A 2XQBH 1ZT1B 2FCBA 4OZFA 3ZE0F 4PGBA 4Y2DA 5EOTA 3ULVF 4HUXB 2KKQA 3PWNB 1I4FA 4QRPE 3AUVA 4LKXA 2QLVB 2WBWB 5HI4D 5K9KB 5GGSA 4K2UL 5D1XB 1JI2A 4LSQH 3LN9A 3B5TA 3NCYS 4CNIA 3PP4H 5GISH 4X80L 4D9LH 1LP9F 1QSFA 3QDGB 5MENA 2KPNA 2VDPL 4PJ8D 1VB9A 4YAQA 1OCWL 4TRPH 5EU4A 3VXSA 1P4IH 2VR5A 1JZ4A 4MAYC 5FM5M 1UWEL 3I6KA 2W0FA 3EDEA 3M07A 1AIFB 5DEFB 4GAGL 3WDIA 1UGNA 1F4AA 3B9EA 4CU8A 1CDIA 5CAYB 1JGLH 2I5YH 3AAZB 4PY8I 1T1YA 1NAMH 1U92B 2BVEA 3QHZL 3ZDYF 1G6RB 1RZIB 3O2DH 3BEWB 3L1OH 1A6PA 4WHTB 4XCEB 4TUJB 4RFEB 4RISL 4C83B 4QRTA 5K59F 2VLKB 3IETB 5D7JC 4HFWB 4RBPK 2AEWA 2P24A 3BQUD 4IRSC 1P7HL 4PBXA 1E6JH 5DVMA 1ZT4B 1FAIH 2DI9A 2IQAB 4NBYB 2DWEA 1KIRB 2FEDC 5H94A 3FB7A 3KLDA 4IIQC 5TQ0H 1B4RA 3HE7D 1P84K 1UXWB 3LIZH 3QEGL 3UTZB 2BOBB 5F7EL 4NT6A 1LQSR 3VFUB 3SE3C 4DGVH 4O02H 3U7YL 1KXQE 2BCKA 1FLRH 3Q5OA 1MWAA 1NC4B 3QUYA 4U2YA 1AY1L 5CMAB 4LVHB 1Q72L 2QSQA 3WUZA 5L9DH 4Z7VB 2FECL 4YBQD 1ZTXH 2W38A 1SJEA 3QEHA 4WUUA 5I71C 3PGCB 4M43L 1JV5B 2EO1A 4X9BA 4WFED 3RX5A 4XC1L 1G7IB 1REIA 4JM2C 1A9EA 4XBGA 5B8CB 2V2TA 1DJSA 3LQAH 2CLZB 1NBQA 5GRZA 3BZFB 1TLKA 2CRIA 1JGVL 3UJTH 4EKXA 2NX5A 1H3WM 3MACL 4FABL 5FCUH 1MRFH 3D2UD 4Y1AD 1OAKH 1OQOA 4L3EB 1T83C 4TUOB 2ARWA 3GSRA 2IALA 4FQHB 3J8F7 4RAHA 3VGAB 2VZ3A 4W4OA 4S0TD 3SJVD 4QRPA 3WXVH 5FB8A 3D25A 4L5FH 1VGEL 3H3KA 5KSAD 5TPWL 2EDDA 5F7FA 1QG3A 1I7UA 2E9IA 2BRQA 4L29A 5EZIH 3U7AA 5DVKA 3ES6B 5KSUB 4WDIB 5TE4H 4JZJB 3H3PL 3TO4D 4IHOB 2XV6B 3VXRB 1VACA 4P4KD 4OI8A 3FQTB 4J4PC 2UY7A 1IGCL 3K1KC 4YDVA 4PBVC 3WJLA 3WFZA 3KPSB 1E6OL 1YNTA 2QQKH 3GMMA 2BSTA 1UB6A 1MLBB 4MGXA 4OFKA 1DVFC 3MV7A 2YUWA 3V5HA 4UBDC 4D9QE 3EO0B 4KC3B 2E9JA 3DV6A 3RI5K 1DQJB 4PJDE 4KKAC 1QLRA 4NRXA 4WFFD 2ICEB 1IE5A 4I3RH 3O41B 1LO3H 3PWJA 2XZCH 3IJYB 3E3QC 2WIIB 1QBML 4MJ5A 4W6XB 2W1NA 3BH9B 5EOCH 3QWOA 3BMVA 2W0LA 4PJXB 3DMMC 4HKBA 1IEBB 4NKMB 1D5XA 3L95A 4U7SA 2FX7H 4HWBA 3WIIH 4P46D 2X5PA 4GQ9L 1P4LA 5D4QA 2LVEA 2EH7H 1NQBA 3H9YA 3Q3GA 4LIQE 1T6WA 3HI5L 3X12A 5GZND 4LDOB 2LQRA 5KVDL 3VI3E 1IT9L 5ETUA 1BJ8A 4OTXL 4ODVL 4V1DE 2ICWB 3WFBH 5DJXB 4JR9L 1QFOA 4NP4L 5EORL 1OSZA 5E8OB 4GSDH 1A4JB 5AZEL 2OQJA 5C71A 1U3JA 4Q9QL 1GL4B 3PWVB 4N9GB 3GSOB 5EU7E 4BK4A 4CMMA 4X7TA 2VIRA 1HE7A 3BE1H 1LDPL 4WEUD 1MCOH 1N5YL 2DM4A 2FJGB 2HKHL 3I75B 3DUUB 1ERNA 3ZKXC 5A16B 3CH8A 2X1OA 5D2LB 5I9QB 5CZXD 5FDWB 4AM0B 1PYWA 3MRKB 4U1GC 3QIUD 4KRPB 5JPMA 4P59L 2AGJL 3W0WB 3V0VB 4XP1L 1A6WH 1TIUA 2FBJH 4L9LB 4QLRA 4KMLB 4KK5C 5E24E 1E4JA 4ELME 3RKPA 1G7LA 2BP3A 4XNXH 4X6FA 2H32A 5HHXH 2BNUB 3LDBB 4IOIA 4YE4L 1JP5A 5E4EB 3OR7B 1A6UL 5B39A 5GGSY 4OLXL 5I76B 1NCWL 2CPCA 1D6EB 3P4OB 3WO4B 1KLUA 1NBYB 1SBSH 1LNUB 2YKLL 4F57L 4P4RA 5L8KB 3V5KA 4PJ7F 4XNMB 2UWEF 2X4UB 2Y1VA 4ISVB 4OT1H 1B2WL 1ADQL 4I18B 5J11C 5E6YA 3KPLA 5IVZB 1S7VB 1FG9C 3NIDF 4MXWH 5M94B 3KYOA 4JHZA 5DJCB 1RZKL 4ZTPL 2A38A 1MVUB 5FYLH 5CBAB 4MJID 2R2HB 4YUEH 4XAKD 3DNKA 4X6CB 5I1DA 9CGTA 3U0PB 3SGEH 3QXAA 4JG0H 3ZSSA 5HYJA 1LK2B 4D0BB 3NACH 3JWDH 3CX5K 3V4PH 1T3FB 1BFVL 1JUFB 1HHJA 1KIUA 3LS4L 4D3CH 5D5MF 2EE2A 4U1NA 4AEHH 4V1DA 1RVFH 3JWDC 2Y07L 5ALCH 3ZYIA 5JZ7C 5C0RH 5I1LB 4PGEA 2D4DA 3GMQB 3MBXH 4ETYA 5JLZA 5D93C 5DC4B 4DVBB 5E7BA 2W0PA 4WHYH 3BMWA 4HC1L 1T89A 4Z78B 2A77H 2BOCA 2V17H 2IBGA 3HC0A 4M6OH 1LDSA 1RJCA 3K7UA 4B53A 1BMGA 3T09A 4Z95L 4GMSL 5F9WB 5TQ2L 1INDH 1FDLH 4G8FB 4E41E 1HI6B 3Q6FA 4RRPG 2VDOH 4U33A 4BFEA 3N50A 1LEIA 3QDMA 3FO9B 4Y4KC 2P48B 3FTGB 5CBEB 3BVNB 4I9WD 2X9XA 3EOYG 1CICB 2DM2A 4PJFA 1RFDH 5FO9A 3V0AC 1C12B 1EEYB 3PXHA 4WJ5A 3CFJA 1KPRB 2NY2D 5EBLA 4UV4H 2BHUA 1UH2A 1V7NH 2Z93B 1F11A 4KTEL 2DQJH 4FQXA 4BZ2H 5INCB 1BX2B 1OL0A 1PVHA 3MXVL 5KAQF 4PRDB 3VXOB 4ZPTB 4MDIB 3LKOB 1P1ZA 2W60A 3RAJH 4Y8DC 4EN3B 4P3WA 5D7LB 3RVWD 4KKBD 4EXPX 3ULUL 2D0HA 1S5IL 3E6FB 4E42A 3C5SB 2V5SA 5D7IE 3SKOA 1MFDL 2IAND 3ALPA 4P3DA 2ZSWA 1JPGB 1OLLA 2AJUL 3DV4A 2FJFA 4YGVA 1QKZH 4Q9RL 1XGRA 3ARVA 3FOMA 4YXHL 3KPPA 3S35H 4N0FB 4OKDA 3U7WH 2ZPKH 2IQ9H 4KWUA 5DLMH 4HJGB 3ZHLA 4B0MM 1IKFH 2YC1B 3K4AA 1CR9L 3BZEB 5I75B 3EJYC 2EDEA 3H8NA 1NCBL 4PJCB 5E5MA 4M1GH 4R0LC 2VTFA 2ESVD 4Q58C 2E9BA 2JK5A 3W9DA 2WBKA 3OXSB 3BKJH 3VWJB 1QLFA 3RA7H 1WCBB 3DGCR 4QHUB 4PLKD 4G7VL 4KKLC 1I9JH 4BK5A 4JRYD 1OM3H 4KI5D 2P8LA 1NMCB 5EA0L 4H0IA 4KV5E 2VZOA 1K4DB 3MOAH 4JFDD 5ISZA 3HI1B 2YD4A 4RQQB 1PY4A 1VEPA 3PGFL 4N0CC 4OV6F 4KMTL 4PRPA 3SEPA 3FT2B 4S1RH 3O2WL 5ESVB 3SDAC 1BLNA 2R1XB 4X8JA 1S7UB 3C5ZB 5HSFA 4E41A 5JORB 4O5LH 5DMKA 1Y0LB 4N8VB 5D7SL 3AVEA 3QNYA 5GSVA 2J1KA 5C92A 4NNPH 4NGHL 1UG9A 3QA3A 4QRSB 1IEAA 1FNSL 3MLSH 1Q9OA 5ESQA 5F9OH 1BREA 3QXUA 2VQ1B 3ECBB 3HMWL 4JDVA 3MCKA 2ADJB 4AG4H 2NQCA 4YBHA 4PJ9A 2ICWI 4KH2A 4PB0H 1Y18A 1QR4A 5ELIA 4OCWL 2YD9A 3JV5A 3IXTA 3SE4A 4ZMAT 4ODBD 1N0XH 3WN5C 2JELL 2E6QA 1UYWH 4PRBB 5IR1B 3O81A 3QYCA 4LL9A 2EDQA 4XMPL 5CEZL 3NFNA 3N0PB 2CKBB 2EEDA 1FNEB 1FL6A 3C5JB 2VC2H 1WV7T 4HKXB 12E8H 2B5IB 1KJ2L 5IHLB 5C0BA 2GK0A 2VDLH 2ZUTA 43CAB 1ORQB 4WFEE 4YHPB 5D7IA 4JFXA 4XXCA 4OZFH 1LO2H 4UU9B 2BDNH 3MRIA 4XRCB 3EFFA 5SWZD 3ARQA 2EKSA 3MOBH 3VA2C 3ZT7A 4MWFB 2MHAB 3LHPH 4ZO6A 4DUXA 3IGAB 5C6PB 4K8RC 3ARXA 1NFDF 2Z31B 5GRUH 3TIEB 4Z8FL 2BSRA 4KUZL 5ESAA 3V6ZA 4S2SB 1DUZA 1IGJA 1BWMA 5DR5L 1ZANH 4M6MH 3CDGA 4PGCA 3ZKMC 4F7EA 1R6VA 3SJVE 1NCDL 3SKJH 3DX9A 1AC0A 1HWHB 3VGHA 4FQJL 1AFVH 1ZHNB 1NH6A 2VKXA 3O3EA 4X7DC 2CR3A 2GQHA 2UZIH 2I25N 4F7PA 2OYPA 2P5EE 5GGTA 1N8ZA 3CFIC 4EN3D 1ZHBA 2VABA 5CJ5A 1UA6L 2OSLB 4LLDA 4PRNB 4PY8J 3MROA 5DJ8A 5LVEA 4YHMH 3RY5A 4LHUB 1TXKA 1C7SA 4I13B 1K85A 4U6HB 5BV7L 2Z4QA 3SDYH 1I8MB 1WBZA 1MNUH 1XGPA 1KXTB 2DWDB 4UIKH 4P23B 5E99H 1HQ4A 3F5WA 1EGJA 2C1OA 3PL6D 1H3GA 2MQ3A 5HI3D 5F97E 4BQ8A 1CE1H 5I0ZA 3OGCA 4QXWA 1ZLUK 4WFFE 3PJSB 4GAYA 1T2JA 2HVJA 5J12B 3JWNC 1MWAH 3DURA 4ACPA 1FH5H 2D2OA 5EOQH 1UB5B 3VRIB 3HE7A 4XMLL 3S3SA 1LK3L 2A2QT 3FO1B 3LPGA 3DHMA 4LVOC 3MLWH 4UMGA 5T3XH 4U1JA 1KENH 1U8LA 5I1EH 2OJZL 5EFIB 5EC2B 1J1OH 3OB0K 5HVWA 5ICXA 3QUZB 1RJYB 2R1WB 4Z18A 4G3YH 1MCIA 2Q6WA 1EBPA 5J8OA 3QDAA 3QFJB 3D39B 5F3BB 2YWZA 2AJZA 5EN2B 2ZOLB 1NMBL 4Y0GA 5CSGA 3AC0A 5D1ZC 4Y8AA 4GG6E 5FCSH 2Q76B 5FECB 2NMSA 4LSQL 5C0NC 2G2RA 1S9YA 1YPZA 3K46A 4JQVA 3PP4L 3RHWF 2H3NA 5GISL 2VAAA 1CD0A 1S78C 1DQQB 1C5DB 2AEPH 3MRGB 4M6AA 3HPLA 4APQD 1JNHA 1HQRA 1CDJA 1P4IL 5T3ZD 1NANI 1DQDL 3WFDH 4PJHB 3RWHA 4C57C 4RBPH 5SX5K 5FKPA 1ZVYA 2CRZA 3QG6A 2V6HA 1ZWIA 4HIEB 5E1AA 3DUHA 1JGLL 3IFOB 4GRWB 1IBGL 1NAML 1D5ZA 4Z7WE 4Z7VE 3RPIA 3P73B 2P5EA 3L1OL 3ZO0A 5F7MC 5C0AD 4IM8A 3N85H 3W2DH 2AV7A 1H15A 3TO4A 2AVGA 2I9LA 4RA0C 1X5AA 2IH1A 1QFPA 4CN1A 2YEZA 4MA1B 5EU6B 4Z7NF 1EAJA 1TCMA 2H9GA 3QISA 4PJEF 5DEGB 1MHPH 4EI5D 1R5WA 2FO4A 4GKNB 3P11L 5DK2B 3S6CA 3EZ8A 3IJSB 1BQHG 1JHLH 1IAIM 3NTCH 4PD4J 4DGVL 3OKDB 3QJFB 5I2IB 4O02L 4PJGE 2ARJQ 3RGVB 4HZAA 1T66C 3IAGC 1ZT1A 1MJJB 3BI9X 1N6VA 2BK8A 1XIWD 3BISA 4UUJB 1RK1B 2R0LH 4OD3H 4HUXA 4XBEH 5L9DL 4M8VA 4PRID 3PWNA 1KCUH 3ILPB 5K9KA 1ZTXL 3STBA 5D1XA 2CK2A 3U82B 4OB5L 1JNNH 1JZ8A 4MJIE 2IFFL 5CEYB 2YWYA 3QDGA 4XAKE 3KDMB 1U9KA 1KN2H 2ZG2A 5F8RC 4TOYL 2P5WB 3VXRE 5IW3A 3B8YA 1OGAB 4WU7B 3CSPA 4K3EL 4LHUD 1INEL 5GRYA 1AIFA 5DEFA 3LEYL 4LLAA 2DJ4A 3ARPA 1QHPA 5DS8B 3DETC 1IGIH 5KOMC 1R5VA 3AAZA 4BZ1H 2CDEB 4C58B 1G6RA 1RZIA 3WXVL 4Z7QF 3BEWA 4WHTA 1UZ6F 1DSFL 4TUJA 4XCEA 4RFEA 4C83A 4QEGA 3TH4T 5FGCE 3KPQB 2VLKA 3IETA 4HFWA 4M93B 1JWMB 1YNKL 3SGJA 1QTYT 3T08A 4DGYH 3UTSD 5DD5L 5IB4B 4I1NB 5EZIL 4ODSH 1ZT4A 3V4VH 2IQAA 1IARB 1KIRA 25C8H 3VFOB 1UXWA 4PJXE 3ARYA 4G7YH 3UTZA 1GHFH 1XMWA 2BOBA 2JB6B 4I9WE 1PG7X 3VFUA 3MLRH 5DURD 4OZGF 2QQKL 4FG6C 3SOBL 5I15H 1HYRC 4ZOEA 1XF5B 2H32H 1NC4A 4NN6B 5CMAA 5L8LB 5J3HC 4Z7VA 4PR5B 4LCWD 1A6AB 3WS6A 3VMPA 1KCLA 3PGCA 1JV5A 1CVRA 1OAYL 4DN4H 1CD8A 4LRIC 2WM0A 4GBXC 5B4MD 4I3RL 3GHEH 3KHOA 5I66B 1H5BC 2NY6C 3V7AE 1G7IA 1HCFX 4WW2C 1ZEAH 4LPTA 4WI9A 4Z0BH 5HHPB 5B8CA 4NZUH 5EOCL 3JV0A 2CLZA 3WNOA 3BZFA 3BRGC 3G5VB 1N7MH 1YN7B 1CGSH 2FX7L 5F88A 3WIIL 2IANE 5ERWB 1M05B 3EYQD 3ZTNL 1RUKH 4L3EA 4TUOA 4ZTOL 5EU3B 4N5ED 4FQHA 1A5FH 4S11A 3RZCC 4LIQH 5C2BL 3R8BB 3WFBL 5E8EB 3GI8L 5FUZH 1FZOB 4KK9C 1CDHA 4YO0B 4R7DB 3LRGA 2CRMA 5DFWH 3CSYB 3QSKB 2ESVE 1NUFA 3ES6A 1LD9B 5KSUA 4FQ1H 2KQMA 4TPRH 4BA8A 4NOFA 4JZJA 2F53D 2F54D 1T21B 4IHOA 1TNMA 3VXRA 1MF2L 3FQTA 4B41A 4Z9KB 2Z35B 3KPSA 3MRNB 1C5BL 4I4WB 1MLBA 1T89C 4JRYE 5EU7C 1SY6A 4MLSA 1I9RH 3U0WH 1X5GA 3UZVB 1KEMH 1B3JA 4NHCL 4QOKD 2OTPA 3EO0A 3DUSB 4FQCH 1DQJA 2WBJD 2AXGB 2YN5A 2ICEA 1TJIL 8CGTA 1FVDB 1A6WL 4WI3A 3O41A 2V2XB 2FBJL 5IW1A 3IJYA 2WIIA 4KHTL 3GSNL 3OKYA 1LEKB 3BH9A 1MFCL 4XNXL 1PSKH 3F7VB 4HDIB 4PJXA 4FXGB 4WVRA 3S36H 1IEBA 1F8TH 1X5IA 4X6CE 3B9KB 3LKPB 1Q94B 3MXWH 5ITBH 3PWPB 5HVHC 4FMFA 2VSCA 2DF3A 2WLZA 5ACZB 3D9AL 4O4YL 2P5WD 4HIXH 1X5ZA 4FQXC 3HE6D 1SQ2N 1SBSL 3E0GA 4ZSOB 2JIXB 5FYKE 4D8PB 4DZ8B 2O5YL 4IS6B 2ICWA 4I0PB 1DP0A 1F3JB 4OT1L 3IXAB 5DJXA 2BNRB 3O3DB 1AE6H 2PXYC 1YYLH 5E8OA 3T65B 1A4JA 5FYLL 4N9GA 3PWVA 1X5KA 3GSOA 3MJ6A 3ARFD 3VGBA 4PY7B 4N1HB 1I1RA 1ZSDB 2F5AH 5AYUH 3NCBB 4Y4FC 2FJGA 5SWZE 3REWB 3I75A 3DUUA 3SGDI 2XOTA 3K81A 5A16A 3V4PL 3IFLH 5CD5D 2VUOA 3JBG7 5D2LA 2XFXB 1FFPA 4D3CL 3T0DA 5DQJB 5FDWA 4AM0A 4WI5A 1A22B 1O7SA 3PG2A 5HDQH 3VXMB 3MRKA 4OUOA 5ALCL 1A14H 3O8XB 5C0RL 4UTBL 2OJEA 3W0WA 1VDGA 3V0VA 4JG1H 1RZGA 4Q9CA 1J1XH 1AXTL 4L9LA 4ZODA 2V17L 3QXWA 5GGVY 1EEZB 5FUCE 4NQTA 3S37X 1F58L 4KJPD 5GS3A 1FPTL 4OF8A 5HHNB 4DKDC 1INDL 2A0LD 3F6LA 3T3MF 2BNUA 4KDVA 2VDOL 3ARED 2L0DA 3OR7A 5IMOB 3TZVD 3NH7H 1U8IB 3GI9H 5HY9B 5I76A 3QQ9D 4QTHB 4BM7A 1WWWX 4P2QB 5D7LE 3NCEB 1YA5A 4HX1B 1D6EA 1KGCD 3DRTB 3P4OA 3C6LB 4K3GA 1NBYA 1UXSB 1LNUA 1WTLA 4PB9L 4U1MB 4AT6B 3OKMB 3MBEB 4XNMA 5KTEL 1EO8H 1MAML 4RFOH 2NXYB 2X4UA 4ISVA 4UV4L 3TA3B 1V7NL 4I18A 5IVZA 1S7VA 4WEBL 3U30B 2DL2A 2EYSB 1X4YA 2ICWJ 4KY1H 3VFNB 2NY1B 1MVUA 4KROB 5CBAA 2R2HA 1B0GB 1MOEA 1OP9A 2XNAB 5IF0B 5BXFB 4X6CA 3GMLB 1FC2D 2VDMH 3U0PA 3IS1X 3RAJL 3CZFB 1LK2A 4D0BA 3ZKNC 4X6BB 3NCJL 3UJJH 2X4QB 2C3VB 2YHGA 3INUH 1T3FA 1JUFA 1C1EL 1DBAH 3GO1L 3TC9A 1N59B 5GS2H 4AZ8A 1JCKA 2ERJC 1BQSA 5AG8A 5DVNA 1QKZL 5I1LA 3GMQA 1BZQK 1DBMH 2ZPKL 4DVBA 4OLUH 5IFAH 2QBWA 3JVGA 1KYOJ 5B3JE 4Z78A 1YMHB 4HWZB 2P46B 4XXCC 1IKFL 4OM1H 3MUHL 1BZ9B 1W72L 2RJMA 4UAOC 2Y7QB 4ESKA 5F7HA 5IJKA 1QHOA 3P9LB 3MO1B 4G8FA 1HI6A 4Q74A 4ZAKC 3FAWA 2APFA 3TFKC 3FO9A 5GZOC 3P2TA 1MFBH 4U6TA 2C5DC 5CBEA 5FK9B 3BVNA 2HFTA 1CICA 3HNTL 3BKJL 4QYOB 3RA7L 1C12A 1TQCB 1EEYA 2I9TB 2D9QB 1KPRA 1I9JL 1NEZG 5IMMB 4PRHD 1EHLL 5T3ZE 1OM3L 3U6RB 4PJBB 5LWYL 4UNVA 3O6LH 4U1SB 5EBMB 2Z93A 4MNQB 3EYOB 3FB5B 1DANU 5GJSH 4FN0A 5INCA 1BX2A 4PJ8C 5TDNB 3HZVB 2EZ0D 3MJ9L 1A21A 5AG9A 4PRDA 3VXOA 1AGDB 4O5LL 3UYOD 4PYHA 4ZPTA 4FFYL 4MDIA 3LKOA 2CD0A 4PRAB 3QHTC 5F1IB 5C0AE 3VFMB 3F6IA 4EN3A 4WHYG 4TNWK 5D7LA 1EGJH 3JUZA 4ERSH 1YEGH 3E6FA 1MREL 3C5SA 3HMXL 1J8HD 5IESL 1NCAH 2NR6D 5JHLH 2YUZA 3Q1SH 1JPGA 5IVNA 5IVXF 3TCXA 1UKSA 3X13B 1IZJA 2X09A 5A3IC 4N0FA 2XZZA 1IC4H 2YUXA 1N0XL 5I73B 3N1MC 2GK2A 4HJGA 3IDMB 1P69B 3BQUC 2B4CH 1X5XA 2YC1A 3BZEA 4Y88A 5T1LB 5F71A 4YDKL 2VC2L 3HE7C 4TTGA 12E8L 4JO3L 4MQ7A 4TQEL 2B4CC 1HEZB 1IAOB 4UQ2B 2VDLL 1MLCB 3OXSA 4NQEB 4ZUTB 4HUKB 4I8DA 4LDLB 3VWJA 1LO2L 1WCBA 2CRYA 1IJ9A 4K8RL 3HN3A 3TYGH 4N0RA 4QHUA 3MOBL 3QI9D 4HK0B 3FAXA 4LEXH 2E7LC 3LHPL 3C6LD 4H25A 2BVTA 2IBZY 3VG9B 3MBED 3RDTD 3V6BR 1K4DA 3NN8B 6CGTA 2P8MB 3HI1A 1AJ7H 4RQQA 2FGZA 4XXDB 3HUJE 1CS6A 3FT2A 1U8JB 4GQPH 1LILA 4M6ML 2R1XA 5ESVA 1S7UA 3EJJX 5JORA 4NWUL 4PG9B 1Y0LA 2LV4A 3GRWA 5MEQB 4N8VA 5EBWB 3WNMA 3VCLB 4GXUN 3QPQD 4QRSA 1AFVL 3IF1B 3MFFB 1MI5B 2O5ZH 2FIRT 4LVNC 3QCUH 5BMFH 2VQ1A 4FMKA 5E8PB 2LE9A 3ECBA 4NKQB 3UTSE 1PGRB 2ADJA 3BKMH 3FO0H 4KFZC 1WGOA 2PNDA 3I3EA 4MB5A 1ZLUH 3MJ8B 3P3YA 5C70A 5E4IA 2QSCH 5LKNA 4YHML 1GAFL 5CJQH 5KSAC 1F45A 4C54A 4PRBA 2ICCA 5IR1A 5F3HB 1FVEB 1MNUL 4UIKL 4CDGC 5E99L 4LSUH 2CKBA 3DXAB 4OLZL 2ICES 1FNEA 3C5JA 4F9LC 3TO4C 1IQDB 3VFWB 4HKXA 4U6XB 3T77B 5I30L 1X4XA 2GI7A 4FQIH 4JO1L 4LCWE 4NN5B 3QFJE 3D39E 4P4KC 3MLUH 3OB0H 1RV6X 1CE1L 7FABH 4POZD 3KYNB 1MPAH 1L4IA 1EEUA 5GGVH 43CAA 1ORQA 3EYUH 1SHMA 4YHPA 3RKDD 5I1JL 1KJ2B 1JHTB 4UU9A 3VXUD 3QIWD 4XRCA 1GH7A 3P0YH 1FE8H 3LEXB 1FH5L 3TVMD 2DTMH 4MWFA 1B90A 2MHAA 5LQBL 3THMH 2ITDA 1RUPL 1CVSC 3IGAA 3ZE2E 5T3XL 2Z31A 1KENL 1T5XB 3R1GH 2X10A 3NIFF 4DOHE 5AUMB 3TIEA 1J1OL 3OB8A 3ZT5A 1JPFB 4S2SA 1PDKA 4E5XA 1FBIH 3SDDD 3U4EB 2VUYA 4MNQD 3TGXA 1F6FB 3O3BB 5EZLB 1D3CA 2EC9T 5D1QD 5C0CD 3WL9B 1ZHNA 5SX5H 3P9MB 3E1F1 4P46C 4JO4H 4UQ3B 5DMGC 1MRCH 3EOAB 5GZNC 1T20B 1F3DJ 4WFGD 5I6XC 4XNYH 3EOTH 2D7TL 2QADB 2OSLA 4PRNA 5DQ9B 2F53E 3VRLE 5GS1B 4Y2OA 1U8QB 4XVTL 4LHUA 5E8DH 5EU6E 1BQHB 4U6HA 1RHHB 4YEEA 4X7CC 3BJLA 4OZFG 1I8MA 3F62A 2OP4H 4HGMA 2DWDA 4P23A 2DKSA 3FONB 4PJFF 2AV1B 1TVHB 3SGJC 2DQGH 1ZGLP 2RCSL 4QOKE 2KDGA 4CJ1A 3LMJL 4WHCA 5JNYB 2NXZB 1EZVY 1PLGH 3PJSA 4G6KH 4NC2B 3QH3B 4GRLB 3N85L 2GEEA 4I0KA 5CZXC 1UB5A 4KJQD 3VRIA 4HBCH 3KYKH 1BBJB 4NKDB 5F7UA 3FO1A 4M7JH 1AH1A 1NGQH 4LVHC 5EIIB 4U6VH 5EFIA 1GC1H 1MHPL 5EC2A 2P5WE 3BOVA 2WUCL 3QUZA 1RJYA 2R1WA 1OGAE 1UH3A 3VRJB 1S7RB 1UC6A 3QFJA 2XN9D 3D39A 5F3BA 3IKCB 5I8CB 5JW4R 4LDEB 5EN2A 2HYMA 5AEAA 3CXDL 4JJ5B 2R0LL 3U79A 4L4TB 4XBEL 1CDBA 1BGXH 3PV7A 1KCUL 1GPOL 3T2QA 2Q76A 1GIGH 1I9IH 4N1CA 5FECA 3UCRA 4F37K 2J7LA 1UEYA 1HIMH 4JN1L 1VESA 1JYWA 4PJ5D 4OJFH 3GIVB 4XTRC 1ZGLB 1DQQA 1C5DA 4ZNEA 3MRGA 2EEAA 3F58H 3T0ED 3VGAC 5JW3L 3JTSB 4K9EH 2E27H 5EUOF 4PJHA 1ZA3B 3TBTB 4P2OB 2X1WL 4NUJB 3ZDXE 3GUTB 1J11A 4K9EC 4XB8A 4HIEA 4JRWA 3G5YB 1CD9B 1ED3B 3IFOA 3ARGD 3EYFB 4G8GB 4R4FL 5I17B 4XX1E 3P73A 4U1HB 4ONFH 4EXKA 4LLUB 1RMFL 2LU7A 1SY6H 4BYHA 3VMOA 5D7JB 1NAMB 1KB5L 1T4KB 2HRLA 3O6FD 4LLYB 4DGYL 4IRSB 5EU6A 1FV1B 3QDHA 4NQCB 4DKAA 5EC1B 4IIQB 5DEGA 4GKNA 2PTVA 3LKSB 5DK2A 1GHFL 3IJSA 1KGCE 5LAXB 5IV2B 2I07B 2L7UA 3P40A 5LGKA 1RY7B 3OKDA 3QJFA 5I2IA 5FGBA 4NUGH 3RGVA 1BFOA 1MJJA 3KLHD 1IC1A 4M7KL 4O2FB 3FQXB 4UUJA 1RK1A 3A6BL 1J0JA 3QAZC 5TDOB 3LEVL 2WUBL 3S5LG 2Z8VC 2EDXA 4JFFB 3ILPA 2ENYA 5I71B 5LGHL 2JLLA 4J3OC 4KRLB 4X6DF 5CEYA 3O9WB 2NY2C 3D48R 3KDMA 4JM2B 4JPWH 1I9EA 5CP7B 2HTKD 1UACL 4G6MH 4NZUL 2P5WA 1MFEL 1W8OA 4LARH 1WITA 3CD4A 2WV3A 3EDDA 1BQLH 5F96L 1OGAA 4WU7A 3GK8L 5JHDD 1R3LB 1RZ7L 2HFGH 3LV3B 1RUKL 3EYSH 1S7QB 2NY0D 5DS8A 4NQVB 1NC2D 3DYMA 2CDEA 4LIQL 3U83A 4KKBC 3L6FB 3U1SH 1N6QH 1KFAH 4RDQF 1RU9H 2A6DB 5FUZL 2VDKH 3KPQA 1GRWA 1JWMA 4JDTH 4OSUL 2OK0H 3KYAA 4DGIH 3QQ3B 3G6JB 2HP4A 3HLAB 5IB4A 1K4CB 4DUVA 4TPRL 5ADPL 3VFOA 3DX8B 1WWAX 2C9AA 4M7LT 4NPYB 3V6OA 2QQNL 3HKFA 5IQ7H 4KJWD 5CHNB 3KPTA 3PWPE 5E2JA 1XF5A 1WT5C 2YOCA 3EO1B 2WP3T 4PRHE 4YFLI 4YC2B 4F7CB 1DVFB 4HUVB 1CIDA 1I9RL 4XPGH 1YMMB 3U0WL 5HDOA 1KEML 1UKQA 4PR5A 1F4XH 5DI8B 1A6AA 2L7JA 4R96B 4WWKB 1F4WH 5D70H 1FYTD 3TO2B 2BNRE 5K9JL 2J88H 1SBBA 5I66A 2M26A 2DLIA 5JW4N 1T0MB 3VD4A 3BPLB 2AJXH 2JJTA 1MUJB 3WO4C 3K2UL 3AREA 5IFJB 5HHPA 5FF6B 1GZQB 4A6YH 3S36L 1J5OH 5H2BB 1F8TL 3G5VA 4NOBA 3STLB 5FV1L 3MXWL 5ICYB 1YN7A 5ITBL 1J8HE 3MLYH 1EZVX 5ERWA 1M05A 5L6YH 4BH7B 2GKIA 4HIXL 5EU3A 5JPNB 5LGJB 2E8ZA 1EJOH 1HYSD 4CKVX 3GHBH 1GYAA 5F70A 5E8EA 4JPVH 4U31A 2EC9U 1FZOA 3CFKB 4MB3A 5DZNA 5FYKH 4NKOB 3T8XB 2LVCA 4MJ2A 4YO0A 4UOW1 1OTTD 2DQIH 3CSYA 4UB0H 5KZCD 1DBKH 1ZVHA 1LD9A 4MNGE 4E0RB 4RAUB 2FJHA 3U46B 2R29H 3DOSA 1T21A 1P6FA 3I9GH 4CAGA 5EIVA 3QZWG 2AQ3A 1AXSB 3OPZL 4RIRB 3U48A 1X5HA 3BP4B 1E4WH 2Z35A 4LOUD 4QHNB 3ESVF 3MRNA 4L3CB 3JWOH 2PF6A 5BZWB 3HNSH 3MRFB 2VZVA 4KZDH 4I4WA 3JVGC 3O6MH 4JKPH 5KS9E 3WO3B 4BSJA 1YPZF 1LE5B 3B9DA 2DI7A 5C6TH 5BO1L 4HS8H 4QTIH 4F7MB 1NCUA 5BQ7B 3JWOC 1NSNH 2Y23A 4U1GB 3TPUB 3H6JA 3DUSA 1A14L 1A7OH 5T5FH 3OKNB 3BP6B 4ZUUB 4P5TD 2VNCA 2AXGA 3MRBB 1WC7B 1KC5H 1FVDA 4YH6A 5JMOC 1Z3GL 4GRMB 2V2XA 2BFVH 3CFCH 4N0UB 5SX4I 1DBJH 3QWRA 2DB8A 4NKIH 3O3AB 2BVYA 1UT9A 5HDBE 1LO4H 2UZXB 1LEKA 2VH5H 3T4YB 1DEEB 3F7VA 4HDIA 5D7KD 4FXGA 3B9KA 3LKPA 1O0VA 1Q94A 5DMIL 2EDBA 3PWPA 3DI2B 2CKNA 3GSNB 3NH7L 5HHQB 5ACZA 1T0PB 5INDB 5A2FA 5EZOH 1ORSB 3OKKB 4OQTL 5FUCC 1PZ5B 1NAKL 3NA9H 1NCNA 2FRGP 4ZSOA 4H88H 3HPJB 2JIXA 2EDHA 3OTTA 4D8PA 4DZ8A 4IS6A 1EO8L 1IC7H 4I0PA 4ORZC 4NZRH 2CR6A 1F3JA 4YR6B 3PABB 3IXAA 3UTTB 5J11B 2BNRA 4OFDA 2VKWA 3FRPG 2UYLB 4EN3C 1H8SA 2J6EL 5BW7C 1CFNB 4KY1L 2FBOJ 4RMRA 3UPRB 4RRPA 1OD9A 5IG7B 4PY7A 4MQTB 1JWSB 3QEQD 4ZXBB 2D7PA 5DRXB 4Z77A 1ZSDA 4TSCH 2Y5TB 2VDML 3D3VD 4HF5H 2CGRH 4KRNA 1OAQL 1AQDB 3MREB 2W65B 3WNLA 3VXUE 4OBRA 3REWA 3GSQB 3MQIA 1OF2B 3PL6C 4OV5B 3INUL 5HI3C 2QQLH 1NEZB 2XFXA 1CDCA 4X9IA 3RVTD 4C56B 4RA3A 2PN5A 5DQJA 1NPUA 5JW4Q 3VXMA 2R69L 3O8XA 1JHKH 2EECA 2RGSA 1JNLH 5D93B 1DBML 3CFBB 5DJAB 1YY9D 4QRRD 4MNQE 2N56A 4RGOL 4OM1L 1EEZA 1ZLWK 2DYPB 5HHNA 4HGWB 1I85C 1NMCC 5IMOA 5IEHB 1U8IA 2DAVA 4WFGE 4Y4KB 5HY9A 4QTHA 4P2QA 1MFBL 3EGSB 4DW2L 4HX1A 1F3DH 3DRTA 2Q7YB 3C6LA 2HT3D 1UXSA 4X7EC 4U1MA 5HVGB 5C08D 3OKMA 3RVVD 4AT6A 3MBEA 1XR9B 2FHFA 3H7LA 4EOWL 3M8OH 4FRWA 2BSSB 3TA3A 4DTGL 2R56L 5EH1A 1T7ZA 3OV6A 3TV3H 5KVFH 2EYSA 1Z2KA 5T3ZH 3NPZB 3ESUF 3VFNA 3ARZA 2BY0A 1D5IH 4MXQD 5FA3B 5FO7B 1FN4B 1ADQA 2VXVH 4APQC 1OVZA 1B0GA 5IF0A 2XNAA 5BXFA 3GMLA 4H5SB 3CZFA 4YWGL 3UO1H 2CKBH 4LPCA 1ULVA 4X6BA 3AU1B 4CN4A 2X4QA 2C3VA 1MCWW 4UINH 1MIEL 3MUZ1 3RWDB 3RBGA 1N59A 3IB4A 3Q1SL 3OAUL 4IRZL 4BQ9A 1YEIH 3I84A 4LCYB 1YUHB 3OAYK 1WBYB 1IC4L 2VSDA 1Q9WB 3NABL 3L3KB 1S7WB 1YMHA 4HWZA 1U93B 3HC3H 1BZ9A 4QWWD 2EDTA 3P9LA 1BFSA 3MO1A 4HC1A 4R0LB 4EI5C 2HTLD 3ROOB 1BQUA 3O4LD 4YHLH 1IRAY 1W72B 2Z31C 3L3DB 1LO5B 1MIMH 5FK9A 4PJ5E 5E00B 3BIAX 4RX4A 1XIWC 4QYOA 3UYRH 3QO1B 2I9TA 1T03H 5IMMA 3UP1A 5JMRA 3PUCA 3U6RA 4PJBA 3MODH 4KJYB 5EBMA 4U1SA 5F6HI 5IBLC 4NQSB 4MNQA 2EIEA 3U4BL 4XB7A 3EYOA 1F2XK 3FB5A 3QXVA 5DC0A 2HMID 1AJ7L 4HJJH 3TJEL 3C8HA 5TDNA 4YX2L 3HZVA 2H2PD 3K1DA 1AGDA 3BDYL 4M4PA 3K8KA 4PRAA 1E0OB 3VFMA 4LLQB 4R8WH 1JTOA 1PG7W 3ARSA 3IRPX 3CLFH 4YDLC 4CDHA 4JPKH 2MNUA 4ONOA 3F8UB 3FO0L 1WZ1H 1FFQA 2D0FA 1NMAH 1K9TA 2BVPB 1CTNA 4PJXF 3I2CH 4KHXH 3WN5B 3C08H 5L0QB 2O61B 4PJIB 3WV0A 4XAWL 3IDMA 2CIIB 3KJ6L 1X3DA 4KQ3H 3TT1L 5DD3L 5T1LA 4K55A 1JVKA 2XTLA 2HFFB 4FQIL 3IRZA 3MLUL 1HEZA 4Y19B 4OAWB 1IAOA 4UQ2A 2VDNL 1MPAL 1MLCA 4ZUTA 4NQEA 2K1MA 1BJ1H 3EYUL 3A67H 3IU4L 5GGQH 1FE8L 4KK8D 4HK0A 2DTML 1DFBH 5T5NF 3G6AB 3H9ZA 3K80A 5LXGH 5DT1H 1M4KA 4Y16D 3WFHB 3NN8A 5JHDE 5B4MC 1UJ3B 2P8MA 2QHRL 1FORL 1ZV5A 1BIHA 1U8JA 2VXUH 1FBIL 2PYEB 5D2LF 5I1IH 5EBGA 4PG9A 3CC5B 5MEQA 3ETBF 2RBLA 1I1AD 3L7FB 1CF8H 3VCLA 3ZMRA 2N1KA 3HI6H 3IF1A 1ZAGA 3MFFA 1MI5A 1T22B 5DD1L 5MHSD 4JO4L 4AL8L 1MRCL 3MRLB 3EYQC 3SGDH 4HW6A 3FQWB 5E8PA 4NJ9H 4M03A 4B7LA 4XP5H 4N5EC 5EO0B 2XKUA 3ALWA 2H1PL 5IBTL 1RUQL 1R24B 3MJ8A 4JANA 3C60D 4JM4H 3RPKA 5HGHB 3CVIH 1IQWL 5E8DL 1KELH 2VL5B 2P4AB 1O7VA 3QCTH 1CFBA 4WV1C 3RJQB 4HJ0D 5F3HA 1FVEA 2OP4L 5GHWH 4R90H 3DXAA 5DD6B 1RJZB 3VFWA 1IQDA 1S8DB 1MAJA 4U6XA 3T77A 4OZIE 4FNLL 4LPWA 2DLGA 4O9HL 4CMHC 4MA1C 5B3NA 4K23H 1HHKB 2QSTA 4MYWB 2GTZB 3KYNA 4RWYH 1FYTE 4L4TE 3SGEI 3QUXD 5FOBB 1KJ2A 1JHTA 5LBSL 4UIMB 3RNQB 2XXMB 2VLRD 1FFNB 3LEXA 1TJHH 5DQDH 5ADOH 5JA9A 3MLZH 3VFVB 3LVEA 1T6VN 1GCFA 2BY3A 2QTEA 4HBCL 2BCKB 4LVOB 3S7GA 4KKCD 4M7JL 2WBJC 1RJLB 1HH6B 3FCTB 2DQDL 2ED9A 1T5XA 3EJZD 5HHOB 3H42H 5JQHC 5AUMA 2VLJB 3PDGA 1JPFA 4K2UH 2AJ3B 1CG9B 3L3JB 1BHGA 3D0LB 4RGMB 3U4EA 2X4NB 3GMNB 4PGJA 1J05B 2GJ6D 3O3BA 5EZLA 4X80H 3SE9L 5DJDA 5DHYB 2MKLC 1DZBA 5HYEA 4JY5H 5IMLB 3DLQR 3WL9A 1BAFL 3P9MA 5D1ZB 1OCWH 4UQ3A 4PJAB 1XAUA 4G8GE 4J3XA 3EOAA 2CO6B 2VB5A 1T20A 4PYGA 3V5DB 1GIGL 1I9IL 1UWEH 5HGAB 3HE6C 4JFQB 2NX5B 4GAGH 1EHXA 5I1HL 1DBBL 3VD5A 2WAHA 5DQ9A 3BD5A 2J8UF 5GS1A 4J2XA 3T4AB 4JHAL 1U8QA 3HG1D 1BQHA 3RWGB 3F58L 3SGKA 1RHHA 3P0GB 5L2KB 5D96C 3GIZL 4F2MB 1A7NL 4BZYA 5FOJA 3EW3B 4RISH 4N8CL 3FONA 3ARFC 1A4KB 3OG4B 2JCCE 4LU5L 2AV1A 3S5LB 1TVHA 4M93C 3S4SB 4D9RE 1A7RL 2FIKB 3WLWD 5JNYA 1A1NB 1AI1H 2JE8A 3RJDA 2NY4D 3QEGH 5F7EH 3NA4A 4CN6A 4QO1A 3IS0X 3QH3A 4GRLA 1J9CT 1D6VH 1QSED 3WJJC 2CLVB 1EFXD 2IADB 4LP4A 1BBJA 1GGBH 4NKDA 5D7KE 4HKZB 1WAAA 4QY8B 3V6FB 3WXWL 1AY1H 1QFWM 1KXVC 1Q72H 5EIIA 5JOFB 3V5HB 2HVKB 1ITCA 1WIUA 2DBLH 1I3VA 3WE6B 1QACA 3VRJA 4XC1H 1S7RA 4TSBH 4MB4A 2A0LC 5I8CA 3IKCA 4OFYA 1CXKA 2JJTC 4JJ5A 4U2ZA 3AREC 4L4TA 1I7TA 4WU5B 3QQ9C 1SJXA 5IB5B 2DICA 1JGVH 2X05A 2Z0BA 4FA8A 1P7QB 4FABH 5KSBE 3GIVA 2X42A 2Z91B 4PJCF 1ZGLA 3RY4A 3G6JE 5SWQB 4JPWL 3D3VE 5AZ2H 1XR8B 4WTWA 3JTSA 4G6ML 5DTFA 2EE6A 4LARL 1ZA3A 3TBTA 2V9QA 4P2OA 5E94B 5TPWH 4Y5YC 4NUJA 3GUTA 2FR4B 2Y9RT 1FHGA 4XHJC 3LKQB 4R26H 4GO6B 2R4RH 3L3OB 2HFGL 5JW5B 4X4XB 3MUGB 1ED3A 3EYSL 5E2UH 5MEOB 5DO2D 4D0CB 3EYFA 4G8GA 3H3PH 5I17A 4NQDB 4QRRE 4U1HA 4F58H 1N6QL 5FHBL 4LLUA 3NAAH 5D7JA 1NAMA 1E6OH 3DVIA 1T4KA 2YPLD 4JDTL 2OK0L 4LLYA 3A6CH 4QGYA 1BFTA 4IRSA 1FV1A 1VENA 4NQCA 5TFSH 5EC1A 3B2UD 1KB5B 2FX9L 4IIQA 3VWKB 1PYWB 1SEBB 2HFEB 3LKSA 3Q2CA 5JPMB 4HXBL 5IQ7L 5LAXA 5IV2A 4TNWF 3SE3A 2I07A 2J3SA 3BD4A 5C08E 5C9JB 4J3SA 3ULVD 2HRPH 4O2FA 5E6ID 3FQXA 1IKNC 2XACC 1QBMH 3MV8B 3MV9B 5TDOA 1I8LC 1U58B 1KTRL 4U05A 4I77L 4JFFA 5KSVB 1GXEA 4HWUA 4ENED 3LQZB 1F4XL 4CUCA 1MQKL 1OY3B 3B9KC 5E1HB 1WUNT 2LAGB 4GQ9H 5D70L 4GBXB 3RIFF 2J88L 1EUTA 2YPVH 3HI5H 3QJHB 4K3JH 2ID5A 1H5BB 2NY6B 3O9WA 2H26B 4LF3B 4QRUB 4WW2B 4JM2A 2AJXL 5CP7A 2EYTB 4G80B 4H1LG 1Q0XL 3D85B 3QZWB 1PAMA 4OTXH 3OMZA 2GTWB 4FQ2L 4A6YL 1LMKA 1T2XA 1J5OL 2IPUG 4PJDB 1ZLSH 1IGTB 5IVOA 1RQ5A 1R3LA 3MJ7B 3BPOC 4KZEH 2EZ0C 4PP2B 3LRHA 4Z7OE 3LSOB 3LV3A 5I19L 1S7QA 4S1QH 4Q9QH 2ZCKH 4NQVA 1EJOL 3RZCB 3PDOB 5I0DA 1Z9MA 4ZFOL 2MSPA 3GHBL 3MRMB 3L6FA 3CLEH 4GXUM 1LDPH 1RK0B 4JPVL 1N5YH 3QXAB 2A6DA 3V2AR 2NR6C 2PETA 2XWJB 2HKHH 5D8JL 2D3VA 3M1BB 1CDGA 4MDJB 3QQ3A 2DQIL 3G6JA 4FFZH 3HLAA 4N0UE 1K4CA 1DBKL 4JFED 3DX7B 3O4LE 4HUNB 3DX8A 4NPYA 4FP8L 1W0WB 3L7EB 3QDJD 1MCWM 4J4PA 4P59H 1CQYA 5CHNA 4XP1H 1QFWL 2IEPA 3JWOL 3HNSL 2VZ1A 4KZDL 1U8MB 2OX5A 3O6ML 4JKPL 1Q0YL 4KK6D 3EO1A 4MXVF 4F7CA 4HUVA 3NFSH 1DVFA 2XY1A 2D03H 1YMMA 4HS8L 3BPCB 2F5BL 3V7AG 2AXJA 5DI8A 1KT2B 1HINH 4ZQKB 2EH8L 3RUGE 4YE4H 5T5FL 4R96A 4WWKA 1TZGL 2QL1A 4OLXH 3TO2A 1KC5L 1CLZH 3QI9C 1NCWH 4F15C 2BFVL 4UZGA 1T0MA 1DBJL 4NKIL 1MUJA 1VERA 3C6LC 2YKLH 4F57H 2BXZA 1GZQA 5FF6A 3NIGE 5J06A 1LO4L 3UAJC 3MBEC 2X1QA 2MFNA 2X44D 3W11D 5H2BA 3STLA 1ADQH 5HVHB 2P45B 5C08A 2OBGA 2PTTB 1FCCA 3O0RL 4RGND 4BH7A 4FQXB 5JPNA 5LGJA 1NUNB 1MCNA 1RZKH 1UCTA 5EUKB 4ELMB 3ZL4H 3NA9L 5E9DB 4KROC 3W5NA 3MA7A 3QPQC 4H88L 2NY7L 3TN0D 3SKMB 1KULA 3ARBD 4NZRL 2EIZB 1RZKC 5ICZB 1A6TB 3CFKA 5LJYH 3IFPB 3PDDA 4NKOA 3T8XA 3WKMH 2PXYB 3EBAA 5IHBA 3QHFL 4R4ND 3LS4H 1Z9SA 3RL1B 4GJTB 4U6YB 4E0RA 4RAUA 3GNMH 3DV4B 3U46A 4OCXL 2WWKT 1MJ8H 1XCQB 1LHZA 6FABH 4JFYB 1EVUA 1YDPB 2CGRL 1AXSA 2WQRA 4RIRA 4Y4FB 3BP4A 3V7MA 4QHNA 2NW2B 4L3CA 1ZLWH 3B43A 5BZWA 3MRFA 4L8DB 5CD3B 3VWKD 4NFCA 2QQLL 1NGWB 1LE5A 5TE6H 3CUPB 1U3HD 1M7DB 3ZTJH 2AQ2A 4Z95H 4GMSH 4F7MA 4POZC 2ZCHH 1MJ7L 3FOLB 4NO2B 5BQ7A 5TQ2H 5BCAA 1CXFA 5F1OB 3TPUA 1IC5L 3UBXG 3RKDC 3W39B 3MV8D 3OKNA 4X5LA 3BP6A 4ZUUA 3MV9D 3D1MC 4PJHF 3MRBA 1WC7A 3TVMC 4NZDA 4GRMA 2AI0L 5IEKB 2F8VA 4N0UA 4MS8D 3O3AA 2K7QA 5DZLA 3T4YA 1DEEA 4GRWF 1OHQA 5F6HJ 5MHSE 4YBLC 3B9AA 5I1CH 4F8QA 1CGVA 5DJZB 3CCHB 1NLDH 3ZDZE 3IVKB 3GSNA 5HHQA 3SDDC 1YEJL 3ILQD 4KTEH 5INDA 5IUSA 1ORSA 1J12A 3OKKA 1SJVA 1PZ5A 5D1QC 3MXVH 3HPJA 5E6ZA 5T1DL 3M8OL 3TM6A 5EOCJ 5DMKB 2XWTB 4BQ6A 1BWWA 4YR6A 1SEQH 3PABA 3UTTA 4CL7A 2FDBP 5JQ6L 4EIGB 2UYLA 3TV3L 5T3ZL 2ATPB 1CLOH 1CFNA 1BM3L 3KGRA 3RTQD 1D5IL 3UPRA 2VXVL 5IG7A 4G9FD 3VFPB 1JWSA 1OSPL 2OZ4L 2BSED 4ZXBA 3OAYH 5DRXA 1CGYA 4Q9RH 2Y5TA 5DDHB 3TJHD 4YXHH 1AQDA 3MREA 2W65A 5AWNL 3U0TB 3UO1L 2VLRE 3GSQA 4UT6H 2HAZA 4S1SH 1OF2A 1S3KH 4OV5A 4UINL 1NEZA 4UV7L 4C56A 3TBSB 2ERJB 1R5IB 1MCEA 3C09C 3CFBA 5DJAA 4KJQC 4UDTB 2GJ6E 5EG6C 3DYPA 3VI4E 3VGGA 2COQA 3HC3L 4P2RD 4TN9A 3MRIB 2DYPA 2YMXL 4HUWB 2PTUA 4ZAKB 4HGWA 4P57B 4OIIH 2DQHH 5IEHA 4LASL 4Y4KA 1MIML 3EGSA 2HH0H 2Q7YA 3K2MC 4KMTH 1Q1JH 1A1MB 3O2WH 3UYRL 2OS7A 1XR9A 4ZO7A 3HG1E 5IB3B 1T03L 4PIRF 5D7SH 5HDLA 2BSSA 1QQDB 2I60L 2YRLA 4NGHH 3AFLA 4JZOB 1F00I 4Y4HD 1II4E 1I1AA 2IF7A 5FO7A 4BSVB 4OZHE 5FA3A 1FN4A 4PJ8B 4LCUB 1NUGA 3T0EC 5E5RB 1R3IH 4OCWH 4PGZA 3ZE1E 4H5SA 1YECH 3ABZA 4JRXD 1XGYL 4YZFE 2FX8L 1QSEE 3AU1A 4PFEA 2JELH 2ARJB 1CYGA 1MCRA 2WINB 4JPKL 1I1CA 4XMPH 3RWDA 1L9MA 4FTVD 3ARGC 1CXHA 4HG4K 2ZCLL 1NMAL 2FZ3B 4LCYA 4NN5C 3I2CL 4KHXL 3JZ7A 5TGBB 1YUHA 3L5HA 3PHQB 1WBYA 4HIIB 4I3SL 1Q9WA 1GGTA 2X89D 3X14B 3O6FC 3L3KA 4C4KT 1S7WA 5IMKB 1U93A 3BQUB 1NFIB 2F74B 3LS5H 2IPTL 3SDXE 4KQ3L 3QIBB 2BRRL 4HGKC 5CWSB 3HE7B 4MVBC 3QUXA 2CO7B 5F1KC 3ROOA 3SKUD 3IFNH 3WNKA 1FNLA 4XVJH 1W72A 3L3DA 1LO5A 4WTXA 5F9JB 1G1CA 1KACB 1EVTC 1NFDB 3NCMA 4Z8FH 5E00A 2PR4H 3QULB 5DR5H 2H41A 1U36A 3QO1A 5J89A 4EUPG 5C07D 3HCVB 1MEXL 1W8NA 1LO0H 4FQJH 2AJZB 4KJYA 2DQUL 1MVFA 4NQSA 5H35B 4P3CL 5F21B 1VGKA 3MMEA 3I6LD 4MD5B 1YN6B 2HTKC 3KVQA 5JW4M 3CMOL 1UA6H 1OB1B 3FHAA 2DMKA 1CF8L 3UXFA 3T0XA 2PW2B 3RL2B 4LLQA 4DKEH 4MA3B 1KCKA 1JNHB 3MJ9A 3DJ9A 4NN7C 5BV7H 4LVNB 1D9KD 1FYHB 4M7ZC 1QVOB 3SGKC 4Y1AB 3D2UB 3MR9B 1EK3A 1KJVA 2NY0C 4XP5L 2PKDA 3SJVB 1Q9KB 5BV7C 2BVPA 1I7RA 5JOPD 4JM4L 3HMXA 3H7BB 5I8OL 1NCCL 5KSAB 1KCSL 3WN5A 3ZE0E 1KELL 3WS3B 2O61A 4PJIA 1KNOB 2IMMA 1PJ9A 2CIIA 3JV6B 5HGDB 1FG2B 5GHWL 1IGYB 3OKOB 4MAYD 1LK3H 4KDWA 2HFFA 2Y72A 4X4MA 5DUML 4P4KB 4KJWC 2IG2L 1U2CA 4K23L 4OAWA 1LP9E 4Y19A 1EFXA 4RWYL 3PV6B 3TBWB 4LPXA 1OW0C 4KTYA 1FL3B 1G7QB 5JIHA 4L4VB 5DQDL 4GW4B 3PHOB 3G6AA 3MLZL 1F2QA 1NMBH 1VADB 5DA0B 3WFHA 1PKQE 3QB7C 3IDXH 1UJ3A 3H42L 3QEUB 5MERB 3DGGB 4TVSa 5T1MB 2H6PB 2D4FA 5L2KE 3U2SB 3ZDYE 5DMJB 4JFPB 3VDBA 5CP3A 4EZMA 2PYEA 3BHBB 2EXYC 3CC5A 2F8OA 3L7FA 5K59E 4JY5L 1IM3B 4P46B 3C8KA 1T22A 3MRLA 4IMLB 1DQDH 3FQWA 2FATL 1TTGA 5EO0A 4P2OC 5I6XB 2LU3A 4K3DL 4JFEE 1HYSC 3LN4B 1N5AB 1R24A 3QCVH 3CXHJ 3QDJE 5HGHA 5FA4B 5DC9B 2FGWH 1R5VB 1IBGH 2CXGA 5F9AC 2VL5A 4GG6B 5C0EB 1MFNA 5BS0B 4N0YL 1OTTC 3U9PH 2LU4A 3OWEA 1G6VK 2CLRB 4PTTB 3MNZB 5DD6A 1RJZA 3QUKB 3HFMH 1S8DA 2ATKB 3FRUB 4LGPB 3RZWA 2C3GA 1FRGL 1HHKA 3QIBD 2GTZA 4LOUC 3S37L 1AI1L 2MTPA 5I1AB 1NGZB 1WWCA 4PJEB 3GKWH 5FOBA 4DWHA 3P11H 1KB9K 4UIMA 3OF6A 3RNQA 1FFNA 5CJOH 1HXYB 1D6VL 4HBQA 3VFVA 1GGBL 2DLTA 3QIUB 3SQOL 4OF3A 3MSPA 3RWCB 1RJLA 4P5TC 1HH6A 3FCTA 4Z7UF 4Z7WB 5HHOA 1FNHA 2VLJA 3EOBB 2AJ3A 5GJTH 1CG9A 3L3JA 3D0LA 1SMAA 2DBLL 4OB5H 2X4NA 3GMNA 3NCFB 5FM5O 3U9UB 1J05A 4XH2B 4I0CC 2IFFH 5I18L 1RZJH 4TSBL 3O9WC 1KIPB 5DHYA 1U8HB 4AEIH 5IMLA 3B2VL 5CLWA 5D1ZA 4TOYH 4QHLB 1A3QA 4PJAA 2FL5B 2M8XA 4ZUWB 4F33B 4NQDE 1RZJC 3V5DA 5HGAA 4G6FD 4K3EH 1INEH 4JFQA 3LEYH 4R2GD 5F88B 4PJGB 4WNQB 5FYJD 3T4AA 3QRFM 1EPFA 5AZ2L 3RWGA 5DHXB 3DECA 5L2KA 1OTUD 4KMQA 4F2MA 1DSFH 3LQMA 2OXHA 3DMMD 2MQCA 1A4KA 4MJIB 3S5LA 1YNKH 1MHHB 4R26L 1EDQA 2R4RL 3S4SA 1ZOXA 2FIKA 4LSVL 5DD5H 2DJUA 1IAKB 5E2UL 4FHBD 1X5FA 3MV8E 4PJBF 1AKJD 3MV9E 1A1NA 4PLOB 3RWJB 3GBMH 2NYYD 3I3DA 3ARDD 1UADC 2VERN 4F58L 3STZB 3CDCA 1ZVSB 3NAAL 4H1LB 4KU1A 4K94L 2CLVA 3RVTC 5DJ6B 3S34L 3MCG1 2IADA 3SOBH 4ZO9A 1KCRL 3A6CL 4HKZA 4OZGB 4QY8A 3V6FA 2OI9C 1IILE 1LE9B 4YC2C 1G7JB 2OCFD 4L4VD 3KXFD 1URLA 3IDNB 5TFSL 2R39A 4XNQB 1YY9C 5JOFA 3MCLL 1CT8B 2HVKA 3BUYB 2OR7A 5LCVH 3HZMB 2HG5B 5FGCB 4WWKC 1OAYH 3WE6A 1FNFA 2AK4D 1L7IH 5I8KH 3KPMB 1QRND 2HRPL 2CIKB 5IW1B 1DL7L 3ULUF 2K9UA 3BPLC 3IKKA 4OLVL 3CIQA 3QAZB 1FC1A 1CU4H 4WU5A 4XVSL 3EZJB 3EO9H 2EYRB 3WDHA 5IB5A 4WGWB 4LCCC 5DHVB 2HT3C 1P7QA 3RY6A 3RVVC 1D5BB 4G9FE 5ITFB 3ZTNH 2YPVL 4ZTOH 4K3JL 2AABL 2NY2B 2Z91A 3RWEB 5SWQA 4ODWB 1XR8A 4GW5B 5C2BH 4NNXB 3FFCD 1I1YB 2FH8A 3GI8H 1ZLSL 4J1UB 4MXQC 5E94A 4XX1G 2FR4A 4R6UA 4KZEL 3LKQA 5BS0D 2CK0L 3L3OA 4GKSA 5JW5A 2P43B 3ARBA 3FT4B 4X4XA 3MUGA 4S1QL 2ZCKL 5FKAB 5MEOA 5HHMD 4D0CA 4NQDA 5J0BA 3CLEL 1MF2H 1ODAA 1AXIB 2IANB 4OFPA 5I8EB 2EKJA 4P2RE 1C5BH 3CK0L 4NSKB 2QKIB 4FFZL 1WTGT 4JKKA 1P84J 1FFPB 1RUML 3RIAF 3HAEH 2W07A 1KB9J 1KB5A 2BXYA 5EU5B 4NHCH 1IAIH 3VWKA 4GKZB 1SEBA 2HFEA 1RUAH 4PJ7E 2X9WA 5FIEA 1CL7L 1BEYH 2UWEE 2OJEB 1TJIH 4QWWC 5C9JA 2AJVH 3AM8C 1RZGB 1R3JB 3LKRB 2ESVB 4FXKB 4KHTH 1V3JA 3MV8A 4Y5XC 3GB7B 3MV9A 3NFSL 2DN7A 1YZZA 1U58A 2D03L 3GSNH 3AMLA 5K9OB 1MFCH 5E9DE 1CFTB 2Q7NA 5KSVA 4MHHG 5GS0D 1K2DB 3LQZA 4ZPVB 1HINL 2VXQH 2A9NL 4U1KB 2VR9A 1CK0H 2R0ZL 4LRIA 4GBXA 5JZ7D 3D9AH 4JQXC 4O4YH 1CLZL 3QJHA 1H5BA 1FZJB 2H26A 2B0SH 4JRYB 4LF3A 4QRUA 4WW2A 4BELD 3WCYA 1XF1A 1MFAL 1MJUH 2E6JA 2EYTA 4G80A 2MQ0A 3D85A 5FO8B 3S98A 3QZWA 2MWCA 4JRXE 3VH8G 5DZOA 4JFDB 4JZNB 4YFLF 2O5YH 2GTWA 5D5ME 4HIHB 3ZHKA 5CKGA 2HMIC 2CJUH 4PJDA 5FGRA 2K3TA 1IGTA 3R0NA 3CPLB 3MJ7A 4FTVE 2H2PC 4PP2A 3LSOA 4A6YB 1M71B 1EIBA 5EDXA 3UBXB 3OJDB 3H9SD 3RZCA 5DWUL 3PDOA 3ZL4L 2DQTH 5BZDB 4HKJB 2O93L 4ETQB 4XGZB 3MRMA 4P49A 4ZXBC 1XT5A 3RTQA 3NFPB 1R3HB 1RK0A 3C6SB 2XWJA 3BGFC 4ZFOB 3K4ZA 3M1BA 4JAMB 5DJ0B 4MDJA 5E8NB 3WKML 4IRJD 5F44A 1DQLH 2BHZA 4PG2C 3DX7A 4QGTA 3GNML 1W0WA 5DYOA 1MJ8L 3L7EA 5H8DA 3ZSTA 4KDTA 6FABL 4UTBH 2HA1A 2A1WH 1GOFA 1WFNA 4HEME 3I50L 1U8MA 1AXTH 1WJ3A 4KUCF 4KXZI 2ADGB 5CSZB 2IJ0C 4GS7B 3K8MA 5JXAL 2EE9A 4ZS7L 5TE6L 4R7NB 4HXAL 5E56A 1F58H 3BPCA 1G9EA 1FPTH 2ZCHL 4K3HA 3FRPA 1FNGB 1WF5A 4JLRB 1KT2A 4QRQA 3OQ3B 4YIQB 3VW3L 4ZQKA 4RWHA 4HK3N 2NTSP 2XY2A 3MTRA 3I6LE 5SWZB 3TNMB 5GXBB 4KK8C 4LPYA 1FFOB 5FHAH 2HKFH 4OCRH 1NUDA 1YEDB 4PB9H 2FEEL 4Y16C 1C5CL 3N1PC 4HV8B 5KTEH 4QNPF 5GSRA 5HHVL 1MAMH 3EJYD 5I1CL 3AB0C 3E8UH 1BOYA 1NLDL 4OCMC 4ZDHB 4RFNC 2PTTA 4WEBH 2ZG3A 4AIXA 1YQVL 2GSGB 1I1AC 5F7WC 4ELMA 5EUKA 5JOPE 4Q0XL 5E9DA 1WAAF 4GLRI 4ZFZA 3PQYD 2W59A 3EUUA 3SKMA 1TTUA 3S35X 1K6QL 3FHQA 3WFEL 1V3KA 3S96B 2EIZA 3TF7C 2QEJA 1A6TA 2AKRB 5ICZA 1SEQL 2OTUB 4OM0L 3IFPA 1S9WB 3NCJH 2PXYA 1L6XA 1CLOL 1C1EH 3RL1A 4HCRH 5E2VL 3C60C 3GO1H 2MPAL 3VDCA 4U6YA 1G84A 1OQXA 1PW3A 1HKLH 1U91B 1XCQA 4JFYA 2CXKA 1TVDA 3IJHB 3SDAD 1YDPA 4XI5D 4CRPA 1IM9D 4Y4FA 2NW2A 4J3WA 5CD3A 4L8DA 3M45A 4UT6L 3KPRD 4P9HH 4S1SL 3PL6B 1S3KL 2X40A 5JIKA 1NGWA 3SDCD 1J0HA 3CUPA 1M7DA 3DTXB 5A2LH 2H45A 5DGQA 1W72H 3FOLA 4NO2A 3UZQA 5E08L 4LRNL 3SY0B 4P9HC 2XZQH 3WSQL 3W39A 3QUXC 1CXEA 1ONQB 2BX5A 4MQ7B 2C26A 5CLTA 5IEKA 3HNTH 1VCAA 3BDXA 1NGPL 3H3BC 4KKCC 4LFHD 5JXED 1A3LL 2R23B 1EHLH 1AO7D 5FUOH 4FFWD 5BRZD 5LWYH 2OMNA 2DQHL 4H25B 4OIIL 3CCHA 5DJZA 3IVKA 3IU3A 2O26U 4F80A 3WBDA 1G1YA 3FKUS 2Q86B 4P48A 2HH0L 3QRGH 2GY7B 2KL6A 4WW1B 5HD8D 3S3PA 1Q1JL 3CU7A 3MJ9H 1CQKA 5C09D 4F8TA 1XGUB 1EUUA 4FFYH 2XWTA 4HMCA 4OQTA 3UTQB 5A43C 3MPCA 5C0FB 1ZA6B 2ATPA 4Y2DD 1F42A 1MREH 1QPPA 3KHQA 3ZTJG 3EKCA 3HMXH 3KNBB 4EDXB 5IESH 4NCDA 4AYFA 4APQB 3VFPA 5D2NE 1U6AL 4NDMB 1R3IL 2J6EA 3HZYA 3SO3C 5DDHA 4JY4B 4HUMB 3T3PF 3ZKMD 3CX5J 5IVXB 4LCIL 4EBQL 1YECL 4TULL 3U0TA 5A2JH 2J4WL 3AGVA 1QSFD 5KVGL 5MEND 5JOEA 5L0QC 1NBVH 4EUPB 1NFDE 2VAJA 5KANG 2C4FT 3WLWC 3VXSD 2LFGA 4JM2F 2YA1A 2X41A 4GKOA 3TP4A 3TBSA 5CZVL 1R5IA 1GZPB 3OJVC 4UI2A 4YDKH 2FD6L 4JO3H 4TQEH 3KLAB 2HT2D 5C0AB 1XFPA 1K8DB 3RVUC 1KBGL 4P0DA 1ZHKB 2VZSA 4UDTA 5B21A 1UFUA 5IB2B 3LS5L 2RFXB 4K8RH 1MCCA 3DSFL 4HUWA 4EI5B 4ZAKA 4P57A 1X5LA 2ITDB 1KIQB 5CP3H 3IFNL 4XVJL 1E27B 1ZS8B 1UJ3C 1JGUL 1HSBB 1W0YT 1Y6NR 3BUTA 1ES0A 4Y1AE 4U3XA 5FYJE 1XIWB 2FHCA 2PR4L 4E5XB 1A1MA 5C0GB 1DLHB 2APVA 5IB3A 3GEWB 4NWUH 4PRIB 5M95B 3FO2B 2AK1L 4OF5A 4NWTH 4XPFH 1JPST 4IOSD 1QQDA 1LO0L 4KGJA 4YHOH 1HH9B 4JZOA 1CWVA 3TBVB 3QUYD 2CH8A 4J8RB 4NJAH 4BSVA 4LHJB 4PJ8A 1WVZA 4IEFB 3QPXH 4LCUA 4W6WB 5TF1L 3O6KL 4WUUD 1GAFH 4DKEL 1IFHH 4ZUSB 4YDLB 2ARJA 2EDLA 4OI7A 2WINA 3UBXI 2UZYB 3HUJB 5TF0A 4EDWH 5DO2C 4OLZH 1QRKA 2MKWA 4L4VE 3KXFE 2FHBA 5I30H 4X5WB 2FZ3A 4JO1H 4Q97A 4YPGB 5TGBA 2WNGA 3PHQA 4HIIA 1QFUL 3ELAT 1VFOA 2KZWA 1S78D 4NHUB 2AK4E 3X14A 1NEUA 5IMKA 5I1JH 3BQUA 3UTSB 1NFIA 2F74A 1Z0NA 2IC2A 1S9KC 3BPNB 3QIBA 4ZOAA 3B2UC 5IWLA 5CWSA 5LQBH 1RUPH 4PPTA 3VFGL 3RX7A 1ZE3C 3UTPD 5DURB 4OIAA 5F9JA 1NFDA 3ULVC 2YUVA 3LH2H 5E6IC 3QULA 4S0SD 1QFWI 4RGMC 4OD1L 1RZFL 4JREC 1F3RB 2E7LA 4OLWH 4LCWB 4ENEC 3FFCE 2HLFD 3HCVA 1MSPA 3QQNA 1N64L 1SM3H 5H35A 2ITCB 4X5XB 5CS7A 3I85A 3IDXL 3BKCH 4ODTL 2EDKA 4W81A