3HE7C

Crystal structure of mouse cd1d-alpha-galactosylceramide with mouse valpha14-vbeta7 nkt tcr
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
204
structure length
197
Chain Sequence
TQVEQSPQSLVVRQGENSVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD1d1
publication title Differential recognition of CD1d-alpha-galactosyl ceramide by the V beta 8.2 and V beta 7 semi-invariant NKT T cell receptors
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 41
structure length 197
sequence length 204
ec nomenclature
pdb deposition date 2009-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3he7C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3he7C02
3NIDE 5TE6H 2VXTH 3MLPA 3QXVA 3U0TB 1VFMA 1RJYB 2WBJD 2DL9A 3IDNA 4JM4L 2NW3A 3CVHA 1K3ZA 1FIGH 1I7RB 1F8TL 2NY6B 4FTVA 1QNZL 5EORL 4OZFB 1WBXB 2M26A 1CICA 4LRNH 4JG0H 3MRJA 5F6HJ 3U2SB 2CLVB 4AM0A 4DVBB 4K9EH 5IKCB 5K33A 2E7MA 4JRYA 4JG1L 1Y18B 4KK9C 2R1XB 2DLEA 5D6DC 3T3PE 4FQQB 1KEMH 3NFPA 3UYRH 1LILA 5D7LE 1U8QB 1WAAA 4D9RD 3VD4A 4G9FB 2Q8BL 1YEHL 1FVDA 3ARDB 3VWJC 1P7HL 1YNLH 3QCVL 5C0IB 4FXGA 3ULVL 3H9SE 4M9OA 4ZUSB 3MO1B 1EEZA 4NO5A 2BRRH 4ORGA 5DD1L 1G7IB 4FQ1H 3L9RB 3VRJA 1X6NA 3B2UD 4BUHA 2HTLD 4EZMA 3I75A 4KDVA 1N0XH 1S7RB 2VR9A 4MNGA 1J0ZA 2Y72A 3S4SG 4CRPA 4JN2A 3GBML 5F96L 4EN3A 3CPLA 5GJSH 4WTWA 3ZT5A 4Y1AA 3B5TA 2PKDA 2DD8L 3LS5H 4ELKA 1KEGL 1WIUA 1QFUL 4O5LL 3WKNA 5DFTA 2FLRT 1HINH 4K3JL 2B0SH 2IGFL 2YD1A 1RJYA 2QSVA 1ZA3A 4WWID 5GGSB 5MI0B 4XVUC 2DQEL 1T7XA 4FZ8L 1ETZB 5IB3B 4LLYB 3ES6B 5T1KA 1I7RA 4ZFGH 3G5XA 1S7UA 4ODTH 4OFPA 5L2JB 2IMNA 1N3NB 3EOAA 4MJ5B 2BVEA 4PD4K 3IDXL 3V6OC 1PD6A 1UWGH 4YUEH 5AUMB 1P2CA 1JV5B 2CLVA 4JFQB 3VMOA 4JZOB 3C09B 4FP8H 2GTWB 1FYTD 1Y18A 4JO3H 5DD6B 2R1XA 3ZYZA 4OLEA 3QXAB 4XGZA 2C1OB 3U30B 3EJYC 4LRNL 4JG0L 3LKPB 4G9FA 4PG9A 5AYQA 5FGBA 4AIZB 1CDYA 3O3DB 3ARDA 1OL0A 3O4LE 4J7RA 5C0AD 3LEVH 4ZUSA 3MO1A 1HHHB 2J5LB 2CPCA 5HPMA 1YN6B 5KAQG 1KEML 3L9RA 3UYRL 2IALB 1S9YB 3DX6B 3AU1B 3MR9A 4P4KC 5I8OH 5D1XA 4HXAL 4EI5D 2A38A 3KXFD 3P30H 2BRRL 1QBAA 3MRDA 4WDIB 3V5KA 4CMMA 1NMCB 5DO2D 5I1IH 1NSNH 2EO1A 3DHMA 1KCRH 3IGAB 2D31A 1JNLL 3ARRA 4YHNB 4ZAKC 2CGRL 1N0XL 4FXKA 1MCWW 5HSFA 3VFPB 4PJ7B 4EI6A 4RISL 5GJSL 1Y0LB 2BY3A 5GGSA 5C09A 1ETZA 4YBLB 4LLYA 3ES6A 5IB3A 2XTJE 3TYFA 5HI3C 4LDLB 1AIFA 4H0HB 1HINL 2ICEA 2B0SL 3RWGB 2BC4B 3PP4L 3TA3D 4QXTB 1HSBB 5BRZA 5JIKA 4JFQA 2DI9A 4JZOA 2IANA 1F4WL 4Y16D 1JWUA 4ZFGL 5E2TH 1JNHA 5DD6A 5GRJL 1R24B 3DGCR 5FO8B 3QXAA 1MPAH 2UUDH 1P84K 5D7LD 4G80B 3K80A 2C1OA 4U0QB 4PGZA 1JPSH 4R7NB 1X5YA 3BP6B 4LIQL 3GGWB 2VNCA 2JB6A 3NFNB 2F8XC 2JCCE 3H9SD 1UCTA 2GJ6E 1LO0L 4HBCH 5C3TA 4FMKA 4F7MB 3U4BH 2WWKT 3NGBC 2IBZY 1HHHA 4EDXB 1WWAX 1CDGA 2Q6WA 2BNQB 3GB7B 3I2CH 3V8CA 4P46C 4KK8D 5TE7L 4BSWB 1S9YA 4HG4J 3DX6A 1KT2B 4KDTA 3A0OA 3NPSB 2D0FA 1FO0B 3LEVL 4WI5A 3U46A 1XCQA 2Q86B 4L3CB 4F7CA 5J13B 2W65B 1EHAA 1BD2B 3NMEA 4K71B 5IW1A 3L1OL 3RFZC 3QUYB 1EAPB 1D7FA 3L3JB 4OLYH 4WI2A 3IDGB 5I8OL 4R4NC 2AJUL 4NHUB 3P30L 4KHXL 4RWYH 4WUUE 4NKQB 3MLRL 2W9DH 5I1IL 5FECA 3T0BA 2YR3A 3RWEA 4W81A 2ZUTA 3OB0H 1KCRL 1M4KA 3L5IA 4KRLB 5GS0D 4XVSL 3Q2CA 1W0WB 2W38A 2YPKB 4R0LB 3QISA 1BQUA 1FAKT 5TDPA 1DQQA 1ZGLB 3CSYA 5KOMC 4D0DA 1SYSB 4NQTA 2Q20A 2IH3B 5ILTL 4Q0XH 5JTWA 4P23C 3MUGB 1ZGLP 5FO8A 2GQHA 5DSCB 4G80A 3QIUC 1FC1A 3BP5B 1I8LA 4R4BA 2PCPB 4R7NA 1JWSB 3PGCB 3GGWA 1FP5A 3RUGA 2VDRH 3NFNA 3O4LD 1GGUA 3TNMA 2VXQL 5E2TL 4QTHA 5D6CA 1I85C 3D6GA 4UB0H 2VTFA 3LD8B 5ESAB 1MPAL 4EDXA 5FYJH 3WHE0 2AW2A 4GT7A 3X17A 3O8XD 2PW1B 1U8NB 1JPSL 3NIDF 4B53A 3HE7A 4BSWA 1RZJC 3BZFB 1KT2A 3C8DA 1D5IL 2IWGA 4UINL 4HBCL 3OR7A 4UT6H 3U4BL 3CFDA 2FO4B 2CH8A 2P8MB 4N9GB 1IC5H 3PWVB 2P24B 4FA8A 2J8OA 1XIWD 2W65A 1P6FA 2YZ8A 4BZ2H 1PG7W 3QPQC 3QZWG 1PG7L 1KN2H 5CAYB 3OKLB 4UQ3B 1TITA 3L3JA 3R0NA 4E41E 3IDGA 1AHWC 4LGRB 2CUIA 1ZV5A 1AXIB 2X42A 3PE9A 3RAJH 1B6DA 3FOLA 3MUY1 3QUMH 4UBDD 5FHAL 5HGAA 5HVWA 2XTJD 3VG9C 1T7ZA 2QADC 2VZSA 1LD9B 3H2WA 3T3PF 4L9DA 1EMTH 2ZZUT 4OLYL 4OI9A 1FNGB 1A9EA 2YPVL 2YPKA 4RWYL 5ADOH 1DQTA 2CK2A 4V1DA 2W9DL 5D2NE 1SYSA 5A1AA 1CR9L 1A14H 5SX4H 1JGLH 3MUGA 3K8MA 2WSKA 5I2IB 4Y4FC 5DSCA 3O2DA 5FDYA 4Q2ZB 5CZXD 3BP5A 1MHCB 1F4AA 4YPJA 1T89C 2PCPA 2YWZA 2VLJA 3PHQB 1JWSA 4NYLB 2GJ6D 3MC0A 4F3FB 5EFIA 1GGTA 3FZUC 4PGBB 3MGTA 4Q0XL 4TUJB 4ZFFB 3QO0A 4LVNC 4WNQB 4DCQA 4X99B 1U8NA 1BFVH 4OGZA 1G7LA 3UPAA 1YY8B 1RJLB 2MNUA 1CFNB 4RCAA 3QQNA 1R3IH 3HCVA 1OAZH 4PY7A 1WCBB 2FO4A 4UB0L 3Q5YA 3PWVA 2P24A 4PIRF 5FYJL 5FHBH 5EZOH 1OGAE 3OKLA 5FAAA 3JTTB 4N1EA 4Y5YB 2BHUA 5KBNC 4K8RH 4ENED 5J1AB 5DF0A 3SCMC 4UT6L 4Z78B 2AEWA 4OCMC 3ARFD 4WUUD 1JUFB 3X12B 1IC5L 3P0YL 4U6XA 3N06B 3HC3H 2H2PD 3S7GA 4BZ2L 3ORJA 3VWKA 5IFJB 1FNGA 1JHTB 5IVOA 5C6PB 4GAJH 3DO7B 3MUZ1 1I1AC 5IROC 4OGXH 1JIBA 4LSDA 3RAJL 4EKXA 1RVFL 3QUML 3CSPA 1DVFD 2DKUA 4P5TB 1EMTL 5J9PA 1K8IA 2IFFH 4NWUH 1WEJL 3OJMB 4Q97A 4MLIA 5DZNA 3X13B 5ADOL 4NSKA 5IMKA 4NYLA 1FZOA 4IJ3B 5IB4B 4Y4HD 4LCYB 4XCCL 4PGBA 1A14L 4ZFFA 4MB3A 4PR5B 1EEYB 1BGXH 4WNQA 1EZVY 1CCZA 3DTXB 5EC1A 4CVXB 4IIQC 3P73A 3QQ3B 3RKDC 3ZSTA 1KCUH 2CLRB 3WNKA 2CKBH 2HJLA 3ZKXC 1CFNA 4U4BA 1YECL 4L3AA 4M7LH 8FABB 5K9OA 3CZJA 1ODAA 4Y5XB 1WV7T 1FNFA 5DWUL 5E9DE 1N8ZB 1JTTA 5EUKA 5C92A 3RY4A 1ZWIA 2WUBH 4G8EB 2FR4B 1KGCE 1A3RH 3C8KB 4E41D 3JTTA 4MJIA 4Y5YA 5E6ZA 4RGNC 1PQZA 1R3IL 3I6GB 3HA0A 3MBED 4MAYC 4S1DC 5J1AA 1OAZL 5DEZA 5F70A 2W9EH 1CFTA 1RAMA 1JUFA 1B4RA 1A3QA 4URTB 3ZL4H 3E2HB 1U8OB 2R2HB 1JZ6A 1QHPA 4ISVA 3QUXC 3HRZB 2B1HH 4K8RL 1C5CL 4BH7B 1G7QA 5HYSB 3DO7A 4MNHA 3DRQB 2DAVA 5L2KE 4GRLD 1IAOB 2OL3L 4K2UL 5EBMA 2JCCF 3FB5B 4P5TA 3WHXB 4FQCH 3ET9F 3GSWB 4X7TA 4N8VG 1T2QL 4GAJL 4S0SD 1OP3K 4EBQH 1YMMB 4O2CB 3X13A 1BPVA 2H2SD 4I77H 3IJSB 4WW2C 4Z7QE 5EU6E 4LCYA 1CS6A 4H1LB 3VG0L 1CBVL 2RGSA 2XKUA 4PR5A 1EEYA 4NWUL 4QRUB 5DTFA 1ZVHA 1LE5A 2X9YA 4ZO6A 1Z0MA 3QQ3A 5IVNA 4JFDB 1D5MB 1S3KH 3RY6A 3S96B 3S35X 4MMZC 1FLTX 1J8HB 1UA6H 2H3NA 5DK0B 4Y5XA 2Y07L 4GW4A 1QFWM 1LEKB 4JDZB 4LCCB 1OGAD 1VCAA 3U9PH 4G8EA 2FR4A 3VXNB 2Q87A 5I1EH 1I9JL 5HGBB 4YBQC 2EXYC 4HMDA 4KWUA 5D1QC 3I6GA 1I8IB 1OAKH 3F7QA 1IT9L 2IFGA 1G6RB 5HJ3B 4W6XB 1SBSH 2VWEE 3PP3H 3N1GC 2YRZA 3KPMA 4YGAB 2HH0H 1JF1B 2WUBL 1HHIB 1U8OA 2V5TA 1KLGB 5ID0A 5E4EB 2OQJB 3HRZA 5DI8B 3T0WA 1GGBH 4BH7A 2EDYA 4L4TE 1S9XB 2W9EL 3DETD 1IAOA 4NM4H 4RMWA 1D9KB 4HUUA 3ZL4L 4WY7L 4ZG1A 3TN0D 1QR1B 3QO1A 3WMSA 4ETYA 1J0JA 3GSWA 5C1MB 2B1HL 3RIAF 2F5AH 4KRPB 4F7PA 1FYTA 1YMMA 5IW6A 2EYSB 2G9HB 1T1YA 2BMKA 1HI6B 4O2CA 4K23H 1ZSDB 2QSCL 3IJSA 3MREA 3AM8A 3E6FB 35C8H 3QJHB 2EEDA 4MXVE 4JCLA 3GO1H 2EXWD 5JXEC 4DGVL 5B38G 2CKNA 4MXQD 2EDLA 3LRHA 4P5MB 4EBQL 3FQXB 2Y5TB 1KELL 5HHOE 3WIFB 3MZGB 4JM2D 1KJ2B 3SGDI 2KZWA 4QOKB 3SGJA 3VFTB 3UMTA 3VXSE 4TTGA 1OAXH 2A73A 3ISWA 5E9DD 3RNKA 4JVPA 5E56A 4XMKH 4WHTB 3R4DA 2GUOA 5E8NB 3W5NA 1KGCD 1NUFA 1BOYA 4LCCA 2NY6C 4NO0B 1F3JB 4RIRB 3KXFA 5C0RH 2PO6B 4RDQF 2WUCH 4HIHA 4U1GB 3EO9L 4GBXA 3BAEH 3S3PA 1UA6L 1BIIA 4JHWL 1G6RA 4MCYA 1C12B 3LQAH 1LNUA 5B8CC 4JKPL 4NJAL 3RIFK 3D39E 3NIFE 3U9PL 2AI0L 3G9AB 1FFRA 5I1EL 4EQ2A 4UTAH 4JPWH 5DI8A 5L2KD 1QSFE 2FIKA 1OAKL 1AXSA 5FM5O 1SBSL 3LCYA 1AI1L 1JPTH 4IMLA 3W0WD 1D9KA 5A2FA 3D2UD 3MOQA 3VJ6A 5J56B 1U2HA 3QI9D 1R0AL 4ZUWB 2ZG2A 1WFNA 3MRFB 4OZGA 2A6JA 5I74C 3GJFH 1KC5H 5DJYA 1CFSB 3WLWC 3BHBA 2YD9A 4Y16A 5INCB 2EYSA 1IQDB 2DQIL 2G9HA 5D71H 3VE0B 1HI6A 4NM4L 5EU6D 2AEQL 5GJTL 2QJDA 4FNLL 3VW3H 3QJHA 3J7HA 1NCWL 4PLKD 1EGJL 4IRJC 2IAMA 2D0HA 1NQBA 3DMMC 5F97E 5ANMB 2VDNH 2Y5TA 4K23L 1AD9A 3O11B 4QOKA 5E6YA 3VFTA 5DGRA 1FQ9C 2FEEL 3B4NA 3TJHD 5M7QA 4R97C 2YPLB 2P5WD 4UV7H 4PP1D 1F3JA 1JGEA 4TNVK 3V7AG 1SYVB 2CXKA 4MJ4A 2G75B 1JFQH 3EGSA 5D4QA 5C6TH 2ITCA 2OR7A 1YMHB 1EPFA 1CDCA 3RI5K 4MD0B 4E42B 3D18B 4Y0GA 1EDQA 3SGEH 3TESA 1VB9A 5C0RL 3CSBA 2OTPA 1MFCL 5GS2H 3MLXH 1U8MA 2VN4A 2WUCL 1HH6B 3H8NA 3QSKB 4L4TD 1TDQA 1TQCB 3BAEL 3U82B 5EZLB 4YDIL 1QBMH 5D9SB 2Z91B 2HKFL 3RP1A 2V5SA 3SE4A 3X11B 2W91A 1AO7E 1S78C 3S37X 4ZUWA 1I3GH 4FQLH 5A16B 4UTAL 1CFSA 4TSCH 4X6CE 1JYNA 3LEXA 5I76B 4JM2F 1JPTL 3VE0A 1J88A 2XXCB 2ZUVA 2EDTA 4ZPTB 1EFXD 1NUNB 4UTBL 3O4LA 1JE6A 1RIHH 4K7PH 1RUPH 5HHOD 4B0MM 4O00A 4JQXC 5D71L 3MRPA 4C83B 3I6LE 3VXSD 3CXDH 3RZCD 2AV7A 3VW3L 1A7RL 1A6UH 4HSQA 3SDAD 2YPLA 2HG5B 3WNNA 4OGAD 2VDPH 3MNVB 5H35B 4BKLB 1F2QA 3ETBF 1SYVA 2VDNL 4I48A 2G75A 5GSVB 1XH3A 3VFVB 4JRXB 4G6MH 3T0XA 4M4RA 1TETL 1TCMA 2XRAH 3NOIA 4MS8D 1MREH 3GEWB 1YMHA 3D69B 1IM9B 2R23B 2G60H 3D39D 4PJDB 4OZFH 4E42A 4UV7L 2A83A 4WFEE 4M1CC 1EJOH 4Y4KC 5L8KB 3FN0H 3CVHL 5C6TL 3KYMB 1QSFD 1HH6A 1U95A 4OSUL 5CSZB 2VSCA 5EZLA 2AXGA 1FNHA 4Z7QF 1FGNH 5EBWB 3TIDB 3VGBA 2Z91A 3X11A 1CGVA 3G6JE 1QBLH 2J4WL 3DGGB 3I50H 3L3HB 1H3TA 1UH3A 1FE8L 4YDLC 3PJSA 4KV5E 2X7LA 4K7FA 1QBML 4FABH 5IB5A 4UOW1 1CLYL 5I76A 1A02N 4ZDHB 1OTSD 4YZFE 1E4WH 2GYSA 3U83A 3VXTB 3K46A 1I3GL 1UB5B 2JCCA 4PJEA 3RPKA 3ARYA 4TSCL 4JFFB 1K3IA 1CL7H 3QUYC 2HJFB 3L7FB 5J57B 2NNAA 1WWBX 2DWEA 1JHLL 5B3NA 1UACH 2AAVA 1DUZB 1KYOJ 3CFJA 1UCBH 2EDXA 5H35A 3U0PB 3SO3C 2VERN 3HKFA 1AGCA 2VDOL 2LFGA 5ACZB 2YD3A 3D85D 1A6UL 4KXZI 3L3GB 4LGSB 1WIPA 2R23A 2VDPL 1DLHA 4NQDB 3SE8H 1TVDA 2BFVL 5JXAH 1JRHH 2DI7A 12E8L 5I8KL 3ARFA 4X4ZA 3HUJE 4G6ML 2ATPB 3QEQB 5IWLC 1TMCB 5AZEL 2WP3O 2XRAL 4PJIB 5CSZA 5E4IA 1DBJH 1AO7D 4OZ4B 3TIDA 1D5XB 5CEZE 4G5ZL 4MXVF 3KYKH 1WZ1L 3GJEB 5J4MA 3FN3A 4LP5A 1DVFA 4RWHA 3L3HA 1YYLL 4ZTOH 3P9MA 4POUB 3CVIL 5D7JB 1FGNL 1C5BH 1MRDL 1MHPH 2R29L 4FQXC 1QA9B 4CNIA 4HKXA 1CF8L 3KG5A 1DL7H 2BNUA 3I50L 3O4OC 5JW4N 3MV8E 5DFVD 2YMXL 1MCOH 4JFFA 5IMMB 4FABL 4U7MA 1H5BB 3BKYL 3I6LD 4Y2DD 5FYKE 1QZ1A 4QHMB 1E4WL 3KNBA 1QEWB 3S97C 1EX0A 2UYLB 4QHKI 1AGEB 3NIFF 4JY4A 1F4HA 3HNSH 2A6KB 1EO8L 4XVJH 3NCCB 3QRGH 4AENB 3U0PA 3B9KD 2R39A 3PQYA 1QLEL 5ACZA 1TJHH 1HYRC 3QZWB 1UACL 3Q1SH 4H0IA 4E41A 4WFED 3C5SA 3WFCH 3MBEA 1NAMA 1WTGT 1X5IA 4AIXA 4YHKH 5I16B 2FSEA 3F58H 3QYCA 4OCSH 5F8RC 5JLZB 1XR8B 3SE8L 3FOMA 15C8H 1D5XA 2BVOB 4NQEE 3BE1H 5JXAL 1FDLL 3QQ4A 2JJWA 1DBBH 3RBGA 3GJEA 3TC9A 3ARVA 5E6IB 2LU4A 5EDXA 4OBRA 3D3VB 2IG2L 1PKQB 2ZUUA 4B50A 2XOTA 4LSTH 2BNRB 5JR1L 2P8LB 1DBJL 4BA8A 3BVNA 1DUYA 1ES0A 2NPLX 3KYKL 5BVJA 3FMGL 4FQ2L 2AEPH 4N1HB 5CBAA 3OHXA 3STZB 5H8DA 4ZTOL 1FO0H 3WNLA 4PGCB 4G6FB 5C0DB 1C5BL 1DBKL 1F90L 1MHPL 1OTTC 2ARWA 1DL7L 4QHMA 1WISA 1YN7A 2P8PA 2K7PA 3QFDB 2UYLA 1AGEA 3W9EB 4PG2C 4FMFA 1PGRB 1FYHB 4GAFB 4HWNA 4KUZH 2ATKB 2D03H 4AENA 4KKAD 5D7SH 1DEDA 4JFOB 4F15C 2R4RH 1E0OB 5DZLA 3P4OA 4U1LB 2MSPA 4GUPB 3HNSL 2AV1A 1C08A 4XVJL 1QP1A 1G7PA 3DNKA 5IB2A 3O9WC 4EXKA 4X6CF 2DQUL 4OCWH 4H26B 3NCYS 4I2XE 5C0JB 2GY5A 4RGOL 1TJHL 3HR5A 5E8EB 4NN6C 5CEZD 1HEZA 1XR8A 4XP4H 1DN0B 1CFBA 1J9CT 3LEYH 4YNYA 4YHKL 5LGKA 3CSGA 3QHFH 3KPTA 2AGJH 3D3VA 3TN0A 4G3YL 3F58L 2P8LA 1LO5B 5E8PA 1PDKA 2GTZA 4LQ1A 5CS7A 4N5ED 1JZ7A 3PUCA 2AXFA 5D2LE 3PL6C 1DBBL 3MV8D 4M8QA 1DP0A 1X5HA 2XZQH 5DMGD 2OP4H 1G1YA 4LSTL 1T0PB 4ORZC 1VDGA 1X5GA 4GW1B 4PGCA 5FYKD 2VLLA 2X09A 4P2RB 4R3SB 1W72A 3UTQA 4OLVL 1PSKL 3JVGA 3QFDA 2I25N 4WGVB 3TVMB 5F71A 1M7IB 2X70B 3E2HC 3W9EA 4XNXH 4A6YB 4LLQB 1FO0L 3D48R 4U1IA 2BY0A 3RJQB 1RY7B 1UM5L 5E9DA 4CBPA 2ZUQB 3RDTA 1H3GA 1QG3A 4J3VA 2BRQA 5KSVA 3TFKC 5GS1C 3VDBA 1IM3A 4WI8A 4NO3B 4GUPA 3G6JF 1FIEA 4KUZL 1NBYA 2D03L 5I6XC 1RURH 4Y88A 1YEKH 2RHEA 3BGFC 3TO4B 4J3OC 4KV5F 2R4RL 2I26N 1KULA 2ED9A 1IAMA 2H26B 5BS0A 4LCWB 3LKQB 1YDPA 2FGWL 1N6QL 2DM4A 4GLRI 4HGMA 5E8EA 4YZFF 2OSLB 4NQED 1MSPA 1EUTA 3QUZD 1HSAB 1DN0A 2LAAA 3FQNA 3L7EA 1CGSL 4ZUVA 4G8GA 1N2RB 5J1SC 4XBPB 3W0WA 5BCAA 3D2UA 4OCWL 5T3XH 3QA3B 2VQ1B 5EC2B 1XGYL 5M95B 4KI5C 3FRPA 4F57H 1KB9J 2A9NH 1UVQB 3N1PC 3O2DL 25C8H 3VXMA 3BIAX 1GC1C 1LQSR 5F7HA 4HFWB 4NCC2 4YAQB 2BSTA 5EU6A 3DHJA 2O93L 2NXYB 3RX7A 1QSEB 4AY0A 2E6JA 1A2YA 2X4NB 3R06B 2EIZB 5T1LB 1TXKA 5HHXH 5I1AB 4P2RA 1FZJB 5LAXB 1V05A 3RA7H 4CU6A 2XXMB 4JPVH 3L3OB 3EFFA 3KYOB 4HIIA 4LASH 4LLQA 5DRZB 4KZDH 3HUJF 2FX7H 5E4EC 5I75B 5C3LD 2VKWA 4YBQD 4YDKL 1RZGA 4NRZB 4XPAL 2AXJA 2P5WA 1YYMH 2PYFB 2AJVH 1G0XA 4NUGH 1HXMB 4YHZH 4PJGE 4XNXL 3ARGB 1G84A 4P5KA 4LVHC 4PUBL 1L7IH 1AD0A 1H0DA 4KVCH 4XH2B 5A43C 3P4MB 3TO4A 5ELIA 1SJXA 4XP9H 3C8HA 1MFDH 1ZHBA 3EJJX 3O6FD 4X4ME 2H26A 3LKQA 1JL8A 1K9TA 4RAHA 3JV5A 1YQVL 3P9LA 3RHWK 2VRAA 1J7VR 1HSAA 1MCSA 1JF5A 3D87B 3QG7H 4Q6IB 4V2CB 3UTTB 4OIIH 4XBPA 3A67H 4JFYB 3C6LC 3DO3A 4MVBD 5DMYA 1T2XA 2VQ1A 2I9LA 2EZ0D 5FUZH 2O5YL 4G8FB 1QD0A 1QFWH 3LRGA 3GMMA 2XZCL 3DROB 2V5YA 3H3PH 3FFCB 4HFWA 4S1RH 4YAQA 2XT1B 4TTDC 1MJUL 3MRBA 1QSEA 3PABB 2X4SB 5T3XL 2X4NA 4OZHE 3R06A 5E5MB 1Q9OA 2EIZA 2CUMA 4GKSB 4U1GC 3OKKB 4RFNB 5LAXA 25C8L 3MFFA 5I1HH 5CIPA 5KANG 4AL8H 5D1ZB 2BJMH 1CFVH 1ACYH 3MFGB 3ZHKA 1TPXB 5GIRA 3VXSA 1B3JA 1A1OA 3AS3A 2BSRA 1UZ8B 5DRZA 5DJZA 2YD7A 2VR5A 4XXCA 2AABH 2DLFH 3BJ91 5C0GB 3B6SA 1XGTB 4FG6C 1VGKA 4L3EA 1A4KB 3AREB 4IOIA 4JPVL 3OKDA 1HXMA 2C3WA 5F9WB 3MRKB 2FWOB 2YUWA 2FX7L 2O5XL 5KSUA 4XH2A 2CRIA 3P4MA 4DEPB 2C4FU 1A64A 2NY4D 2ZCKL 3DXAB 1YYML 1NUGA 3SJVE 3ESUF 2PXYC 4GW5B 2VZ1A 3LS4L 4ZFZB 4MNQB 2EICA 4NUGL 4YHZL 4HWEH 4KC3B 5EU4B 2EEAA 1BZ7B 1DQDH 4Y19E 4KVCL 3DURB 4Q6IA 1T22B 2DQGH 4XP9L 4OLWH 1XFPA 1W8OA 1OY3B 4NBZB 4H1LH 1MFDL 3WD5H 5F1OB 5GGUB 4DN4L 1D6VL 4XCEA 3S3SA 3IKCB 3GSUB 3ZHLA 3FL7A 3DROA 2OTUB 1NH6A 3QG7L 4Z7OE 3G6AB 4OFKA 3QDJB 4RDQG 1T6VN 3A67L 3PABA 4YHIA 1GC1H 2AKRB 5FUZL 4GKSA 5DRNB 3RVXD 3AY4C 2CDFB 4XHQA 3ULVE 1A1NA 1DTUA 4S1RL 3GK8L 1N5AB 3CNKA 3VFOB 3CZFB 4JZJC 4XNMB 3U4EB 2X1PA 4ZO8A 1L0YA 4APQD 1G6RH 3VH8G 3SBWA 1IAKB 1A5FH 1FVCB 5HI5D 2CDGA 1TQCC 5K9JH 3W9DB 5C0GA 4NC0B 3GSXB 2FJGB 5I1LB 1ACYL 1LP9E 5KS9A 4BSJA 1GGIH 1BX2B 3WDIA 2FBOJ 4HS6B 4QT5A 3Q3GB 2DIJA 1XF4B 3FT2A 4YPGB 4W68A 2BP3A 1CYGA 1CG9A 1F6AA 3B9VA 4X7CC 2DLFL 3EYOB 5GS3A 2D2OA 3PNWB 4GW5A 2KKQA 1NDMB 3UAJD 5DD5H 4MNQA 5EIQA 1FZMB 3V4VH 3BWAA 2B2XL 1UXSB 1M1SA 5D2LF 5KOVC 3NA9L 3DURA 1T22A 4JPIA 3K2MC 4PP2A 5BXFB 1U0QA 3O41B 3ZO0A 1QQDA 5GGUA 5DK2B 1WBZB 4J4PC 1IILE 4NRYB 3CJJA 2C3VA 4KPHH 5CP3A 1DQDL 5HVHB 2OTUA 1KJ2H 1YJDH 2Q3AA 2DQGL 3IT8D 3QDJA 2NY3D 3SDCC 3IAPA 2J6EA 1E28B 3WD5L 4JFXB 1T7VA 5HHNB 1T20B 4MA8L 4IRZH 4LSRH 1VEMA 4JJHA 4OCNC 3EIFA 1I7TB 1PG7X 4HZAA 5T1DH 4EXPX 1V7NH 2CDFA 5DUMH 1K2DA 4Y2DA 1N5AA 3VFOA 1HYSD 4XNMA 3U4EA 3GUTB 4PJ8C 1IAKA 5IQ9A 3F5WB 3QIWC 1FVCA 2CIIB 1Q1JH 4F9LC 1EHXA 4N68A 3RVVC 3GSXA 1ORQA 2YD4A 3BD3A 1CLCA 3B9EA 4RX4D 3ECBA 4PRHB 4HS6A 1G6RL 2DLGA 1A5FL 1OP5K 5I8CB 2FL5B 1IEHA 5K9JL 3X3FH 3SJVD 1U92B 3EYOA 1BWMA 3JV0A 4ZS6C 4HPYL 3TBWB 2X4RA 3PNWA 2GJZB 5BMFH 4IRSD 1NDMA 5D5MB 1FZMA 1U42A 3ZDXE 1MELA 4ZUTB 1UJ3C 2X4OB 1JVKA 4F33A 5ENWA 4D9LH 3FN9A 5B39B 4X4XB 2XWTB 5IFHH 2XKSA 5IVXE 3VXRB 1NBQA 4EUPB 5BXFA 1G7HA 4YBHA 3ALWA 4YXHL 2ZPKH 5CEYB 1REIA 5DD5L 5KG9B 5DK2A 1MRFH 2DQCH 5IHUH 3VFMB 1MUJA 1PVHA 1XMWA 3JWOH 4CKVX 5E08H 1TENA 3ZT6A 3GSQB 1W0YT 4LBEB 1XF5B 4HKJB 3HMXA 3DX9B 3HB3D 3NVQA 1LDSA 1YPZE 2VC2H 2DYPD 2JIXD 1E28A 1CK0L 3QBTB 3GNML 3MOBH 1HCVA 4LIQE 5HHNA 2MCG1 3EYVB 1BEYL 4X7SH 3ULVD 4KPHL 3WDHA 1CU4L 1E4KA 1KJ2L 1YJDL 1Z5LB 1BJ1H 4XPTL 1M71B 2ICES 3OSKA 4HC1H 4PJGF 4LOUD 5AZ2H 3V5HA 3FRPG 2Y36H 2XQBL 1J0IA 2RFXB 4H8WC 4YXLH 3GSRB 4IRZL 4LSRL 5ALCL 5J3HC 1V7NL 4OFYD 2APVA 3K8KA 3RVUC 3TIEA 3O6ML 2IBGA 2AK4E 4TPRH 1NGWB 2GT9B 3VI4E 2NY0D 1WZMA 4HXBH 4KMLB 5I8CA 1TZGL 3FONB 1Q1JL 4ELMB 1CDBA 1CXEA 2KPNA 4N0RA 3HUJA 5IBLC 2GJZA 5D5MA 4ZNCD 1SVCP 2KQMA 3OR6B 4P4RA 2X4OA 3IXAA 3MGAA 5DHVB 3CH1B 5B39A 4X4XA 3X3FL 4OZHF 4OF3A 1MCDA 2D3VA 3ARPA 4EUPA 5BMFL 4WHDA 3VFMA 1ZLWH 5CLTA 1J10A 3GSQA 4JFPB 4D9LL 2UZIH 2HFTA 3CD4A 4PJ9D 3DX9A 3JUYA 2DL2A 5D7IE 3TLRA 3FCTA 5C0CE 3C60B 1IGJB 3LSOB 1UH4A 5BW7C 1MRFL 2FJFA 2HTKD 3EYVA 4NN5C 2DQCL 4WEMB 1F11B 3JWOL 3PV6B 4NKDA 5E08L 4HX1A 2VUOA 3S3JA 2EC9U 4ZPVA 5I0DA 1JZ3A 4YC2B 4ZXBC 4CGTA 4OBSA 1WGOA 3U9UA 4JFEB 3H7BB 1NC2D 3GSRA 4FQJL 3MRGB 5ESQA 1EO5A 3SKUD 4WHYH 3GHEH 4GG8B 3TH3T 5C2UB 1IGFH 4KKNA 2GI7A 2Y36L 1DFBH 2YD8A 4LAQH 2FATH 3NZHH 4YXLL 2CRYA 2XI9A 3V6ZB 1VEPA 5EU5B 5C0AB 5D7KE 1LEIB 2BDNL 3WXVH 4P0DA 4D9QE 3ZKMD 4C57C 3BH8B 2NY2B 2OJEB 1N26A 4TPRL 2D4FA 4OCXH 4HXBL 4Z7OF 3HRPA 1CTOA 4P2OA 3KLHC 2NLJA 3CH1A 4OIBA 2B8OT 4HIJB 4EI5B 1U3HA 3QAZC 2WMPA 4QXUL 5E94A 2VABB 1D5BB 1S9WB 2APXA 3C2AH 3ULVF 1OTUC 1UWEH 3MLTA 3RL1B 3OJVC 4JFPA 4BK4A 1LVEA 2NX5E 4I0CC 5JHLH 2NW2B 3LSOA 4I3RH 4WW1B 4IS6B 1F11A 3PV6A 1LP9F 5GGRY 2FNBA 3BRGC 2UZIL 1DDHB 2X9XA 2ENYA 4U1HB 4HUNB 3BPOB 3T0EC 4KKBD 4DKAA 5JQ6H 2YSSB 3QP3A 4XC1L 4JFEA 4NO2B 5GISH 1CDUA 3D9AH 4PRNA 4Z18A 2X1OA 4O9HH 3KWWB 2XY2A 4H8WH 4KTEH 4GG8A 5C0BE 2AK4D 1OQOA 4GJTB 5D7LB 5FYJE 5FUCE 1CGUA 3AXLA 3DWTA 5B22A 1BZ9B 2Z92B 3KLSA 4NC1E 5EU5A 4DQOH 4M1DL 3GHEL 4ZQKA 1G9MH 2BSSB 3KYAA 2Z31C 1QPPA 2OJEA 3PHOB 1I7ZA 1DFBL 4RMTA 1WSST 2FATL 3NZHL 3T77A 1LO2L 3QWRA 3HC0B 1NJ9A 4LVEA 5SWZA 1CGXA 5ISZA 4XI5D 1HKLL 1VKXB 1ZA6B 1Q9KB 5MEPA 4YE4L 5CJXC 3ULUC 3DVFA 4LPCA 5FYLH 4K94C 1XF1A 2VABA 1D5BA 3IFLH 4QXGH 4FFYH 1FPTL 2APTA 4OCXL 4QHNA 5IEKA 5C0CD 2D4DA 1S5HA 3QUKB 1KJ3L 2VAAB 5DEGA 2E6PA 2ZUQC 2DLIA 2NW2A 1VADA 3BPLB 3DI2B 4WW1A 1UWEL 4QHUB 2YZ1A 5CP7B 5TPWL 1XF2B 4U1HA 1CN4A 2DQDL 5IR1B 3HI6H 3IDUA 4DGYL 4L29A 1CVRA 4NO2A 5JHLL 5MP6H 1F3DH 4PLJC 4LLUB 4XP1H 3TZVA 4IHOB 4WWKC 4DFHA 5BO1L 5C0NC 5D1XC 5FK9A 3ZDXF 2AK1H 1A4JA 4WU5B 1MIEH 2YWYA 4B5EA 2Q7YA 5GISL 3KJ6H 3K1KC 5IVXF 1BZ9A 3D9AL 5D7KD 3HZVB 5KSAD 4P3DA 1PZ5B 3OAYK 4O9HL 4OF5A 4D9QD 4W4NA 2FJHB 3ABZA 1WVZA 1ADQA 1ZLUK 3PHOA 4DWHA 5EIIB 1HH9B 1QLFA 2B7DT 4KROD 1CLZL 1YPZF 1AC0A 1RFDH 2NXYC 4RAVB 1Q9KA 1G9ML 4FOMA 1MCPH 2ADGB 1MWAA 1HWHB 3AVEA 2V2XB 3V4PL 1U3JA 3D1MC 3S9DB 1Z9LA 2EKSB 5AEAA 2NX5D 3U4AA 4Z95H 4OF6A 1A22B 1NC4D 2VDMH 1B0WA 1KIPB 2VAAA 4Z76A 5FYLL 1NGXB 3SDXE 1EH9A 1GAFH 2AJ3B 3C5ZC 3O3EA 1RMFH 5GZNC 1V7ML 4OLUH 3VI4F 1XF2A 3RWFB 3BEVB 3ARGC 3IDJB 4XPBH 5IR1A 5HD8C 5KANI 3KS0J 4TUKL 3WLBA 4JKLA 4KKLD 4NP4H 1QVOB 2NYYC 5H94A 5AAWA 3EDKA 4LLUA 5C0BD 4APQA 3HAEB 3NACH 4WEUD 3MTRA 5FYJD 4KDTC 5IEHB 5ERWA 2UWEE 1K4DB 4L4VE 1OD7A 3I3BA 3HI6L 4G9DB 1UXWA 4NKMB 4R2GC 5F7EL 5C9JA 2MHAA 3OGCB 3Q6FA 2GJ6B 4U0RC 1GCFA 5KSBE 3HZKB 3HZVA 4XP1L 4E5XA 1U3ZA 4TN9A 3MV7E 4WFFE 3MODH 2WWMC 4MMXC 3RWHA 2CDEA 2AK1L 2YKLH 3DIFA 1MIEL 1CXHA 4JFHE 4K3EH 1C7SA 4Y7MA 1I7UA 1HH9A 5GGQH 4DK3A 1YY9C 5D7IF 5LKNA 4RAVA 5GRWA 3S5LB 2BVQB 4HF5H 4KK6D 2ADGA 1H3PH 1S7VB 1W8NA 4ZNEA 5INDB 3JV4B 5F6IB 5D1ZC 2A2QT 5E8DH 2EKSA 2NY1D 2YC1B 4K94H 1KNOB 2ESVA 5BQ7B 4WUUB 4YFLI 3EJZC 5C07D 1MCPL 1GIGH 5D96C 5AG9A 4A6YH 1I8LC 1FHGA 1BFSA 3LN5A 3WNOA 1JWMB 1W72L 2E8YA 5F9WC 3IDJA 2YN3A 2ERJB 1T2JA 5FGRA 5T1MB 4DEPC 2WBWB 2I27N 3VCLA 1GAFL 3TO2B 2ENSA 5FGSA 5I71C 1BQHB 4OLUL 1FFNB 1E4XH 5HBBA 1K4DA 1P7QD 4XPBL 1SEQH 5J8OA 4G9DA 4PYHA 1BFTA 5CJOH 4PGJA 4NP4L 3OGCA 5CHNB 4OUUB 3HZKA 4OZIA 3ARBB 1JZ2A 2E7CA 2E7LA 2KL6A 4L1DA 3GZKA 43CAB 4N9OB 4R4FL 1DLFH 5GGTH 4G42B 4LSUH 4K8RD 5GXBB 1A6TA 4AIOA 4IRSA 4U7SA 4LPUA 1OSZA 5C9KA 1JHKL 3S5LA 4HKBB 2BVQA 1GRWA 3VMPA 4PJXA 3HG1E 2YKLL 5K9KA 5DJCA 4KQ3H 5JIHA 5T5NF 4K3EL 5INDA 5LXGL 1MCLA 3JV4A 5GGQL 5F8QC 1ZLSL 3BQUD 2YC1A 1KNOA 3RTQD 1DZBA 1NLBH 4ODHL 4X5XB 2I5YH 3OAUH 1H3PL 5HDBE 3LKSB 3D0LA 4GKNB 3FQTB 3QWQB 5E8DL 4QO1A 4XNZC 4ZUUB 1U8KB 1NLDL 3MV01 4P9HC 2AS5M 3BPCA 4MB5A 1GIGL 5D2NB 5GPRA 2QQQA 4YHYC 5EOCH 4BFIB 4IDJH 4DUVA 4E9LA 5JZ7D 2Z93A 1BQHA 3U1SH 2AJSH 4L4VD 5F1SA 3MRIB 1WWWX 4RZCA 4ZSOB 3RWDB 2DQHH 1A9BA 1FNEA 4WENB 3DSFH 3QG6B 1MFNA 5JPMA 5MENE 1HXYA 3MV7D 3M8OL 3I3EA 4KJPD 4OUUA 4LFHD 1FAIH 4WFFD 1UT9A 3ARBA 1HIMH 1QRNE 5JUEH 1E4XL 3RGVC 4M6AA 4JFHD 4OD1H 2NY5L 4F7EB 3LQZB 1SEQL 2MKWA 2R0KH 4UIKL 5CD5D 4U1SB 3T4YA 4G42A 3CFKA 1I3RB 1JGVL 4G6KL 4O2FB 5DJ2B 3VWKC 4KMTH 5FUOH 4GRWE 4HKBA 2Y7QA 3SDDD 3BH9B 3BZ4B 2J88H 1BVLB 2YEZB 1HOCA 4KJQC 1NEZA 2X4QA 1DLFL 5GGTL 4P59L 4LSUL 1ZAGA 2H8PA 2EDBA 5LWYH 1DR9A 2ILLA 2Q7NA 1RPQA 2YD5A 5F7FA 4H25B 3V4UH 5DMKB 4UAOC 3RWJB 4KK5C 3QWOA 2FCBA 2XQYK 1BBJB 4KQ3L 4CL7A 4PJ9A 2LAGB 3S34L 3BO8B 3LKSA 3F62A 3HR6A 4G6AD 1J11A 3QIBB 5SWQB 4OUOA 1MVUA 4YEFA 1PJ9A 1U8KA 4JPKH 3SQOH 4FFWC 5F88B 4TYUA 4Z5RB 4OAWB 4NQCB 4C56A 4PJCA 4W4OA 5C8JB 4ZSOA 3KPSE 3RWDA 4CUCA 5F89A 4HG4K 4UOW0 5H37H 1CWVA 5EOCL 4OM0H 4IDJL 1MJ8H 3IDMB 5HHPA 2AJSL 3I9GH 4HWUA 5JW3H 4ZOAA 3QDAA 4QHLA 1RK0B 1OGTB 3LQZA 5FGCE 4U1SA 1F2XK 1P5VA 3DSFL 4IBLT 1MVFA 5FM5M 4HT1L 3VFRB 4OD3L 2WBJC 5DJ2A 5I1CL 2EYTA 5DUPH 3HG1D 5JUEL 3SDXF 2PF6A 3BZ4A 3KDMB 4OD1L 1BVLA 4ESKA 4QKXB 2J6EH 2R0KL 2X89A 3A6BH 4XWGH 4JRYE 2QKIB 3DUSB 4KMTL 3CFIC 3Q6GH 5FUOL 4L8BB 2DTMH 4HJ0D 2JF1A 2J88L 4J6RH 3TT1H 4EQ3A 1J18A 1WAAE 4NDMA 5IK3B 1X4XA 2XV6B 4DW2H 2UWEF 1CLOL 5ITFA 5LWYL 3QIBA 3HS0B 1CQKA 5SWQA 1IGYB 1DBAH 2XYCA 4NT6B 3OL2A 3V4UL 4MYWB 2EDHA 1KTDA 3GMLB 2VISA 1IZKA 3CDGB 3MV9B 4QRQA 5KSBF 3DJ9A 4LHUD 3MRQB 3MA9H 5F88A 5EN2B 3RY6C 5JPNB 1GGCH 4OAWA 4NQCA 4MNGE 5HYEA 3B2UC 5C8JA 4JZNB 2HTLC 1I3UA 2F19L 4JPKL 1N59B 5MEND 4Y1AE 4BQ9A 1MJJA 1C16A 1QRND 4QRSA 1N0LA 3O2VH 1MHHB 1MF2L 3E8UH 4ZYKB 2F54A 4P2CG 4AEIL 1V3LA 2OS7A 3PIQB 3EO1B 1OGTA 4BQBA 2GSIB 1PX3A 3MYZA 4P99A 5L6YH 5ICZB 3ROLB 1G9NC 1MJ8L 4RFOL 3UC0H 1RUAH 4KH2A 3HMXH 1TLKA 2P45B 4LLDA 2J12B 3Q5OA 4LDOB 1OD9A 4F2MB 4XRCB 1U3YA 1HHJB 4I0PD 5CKAA 4L8BA 1RZFH 2Y06H 2RAMA 1TJGL 5D7IA 3OAZK 3IU3A 2J6EL 4PJBB 3A6BL 2GIYA 4G9FE 4WO4D 1TNNA 5E03A 3U36B 4UT9H 3OB8A 4B7IA 3ZKQD 4XC3H 4HV8B 3MYJB 4U3XA 3CFCL 1ZMYA 3MV9A 3CDGA 4J6RL 3VFUB 1WLHA 3BGMB 1JMZA 3MRQA 4QRPB 4AMKL 2NTFB 4HWBH 1UGNA 5J12B 3IVKA 3ZDZE 3KPSD 1J05B 3L6FB 3QXUA 3F12A 3QPXL 5CD3B 4I5BB 1N59A 3GHBH 1T1XB 4EI5C 3VWJA 4TSAH 3MA9L 5IW3A 1MHHA 5KVFL 5IHBA 1HQRA 4RQQB 1EFXB 3MXWH 5DO2C 3WNMA 3CLEL 5FO9B 4EUPH 3FHAA 2IBZX 4P4KB 4AG4H 2AEIT 2F5BL 5JW4R 4GAYB 5ICZA 5JNYA 3IF1B 4P2QA 5SX5K 3OF6D 1BMGA 3NTCH 4KJYA 1CICD 1IGML 5HDBF 5E2JA 1RHHB 2ZG1A 4Z7UA 3QXWA 5GS2D 3RQ3A 4JRYD 3TGXA 5IP4A 5L6YL 1L7TH 5BRZE 5E24E 3BPOC 4ZAKB 3IDIA 4UU9B 5JHDB 1J86A 1KN4L 1QUNA 1HHJA 2F8OA 3ZTNL 3TA3C 3IXTB 5CSGA 3UC0L 2DDQL 5J7CC 3WEXB 1VGEH 2HT2D 2K7QA 3D39B 4BFGA 3B3IB 3HMXL 4Y16C 5E1HB 5F1NB 4PJBA 2VL5A 1DJSA 3BKJH 1MLBB 3V6OA 4R7DB 5JDSA 3UBXB 1S7TB 5FXCH 4HFUL 5FB8B 3MZTA 4WV1B 3VGHA 5B3JE 1RZFL 1IGIL 2E5EA 2FYYA 3EUUA 3BGMA 1FVEB 1G0YR 2NTFA 1AKJD 2GSGB 3QXDB 4OV5B 2QV2A 4UT9L 1J05A 4KK8C 5C0BA 1MJ7H 3RNQB 4EN3D 4Y1AD 5AD0B 4Z7WB 1ZVSB 3FQUA 1T1XA 4YXKH 4EIGB 4GRWF 3F8UB 3ARTA 5EIVA 3UROR 3NGBB 4TNWK 4WJ5A 4RQQA 5DHVH 4HD9A 4LLMA 4WEBH 2CLZA 1JPGA 2XZAH 2FGZA 1MFAL 2IPUG 3GHBL 2IC2A 4KAQL 3VXUB 4LSSL 4ERSH 4TSAL 2A9ML 4U6VL 5DVKA 4BSVB 3HMWH 1A6VH 4UV4L 3MXWL 3BPLC 1G9NH 4ONFL 4IEFB 4J3TA 4L4JA 3QUMA 4AG4L 1OAYH 5EU3B 3SE4C 5GS0C 3BUYA 4ZAKA 4UU9A 4OCRH 2IBBA 5GRUL 4DGIH 3RWIB 5F3BB 3FRUB 3FO1B 3NTCL 1JK8A 2RB8A 4JJ5B 3QNZB 4UUJA 5DLMH 3OV6A 5GGVH 4G9FD 3UTSB 4MD5B 1L7TL 5C07A 3ARDD 3MRRB 3MJ7B 1C5DB 4LNRB 4GKOA 4DZ8B 3UBXA 1S7TA 4TULL 1FNLA 4XPGH 4G8IB 4W70A 4HAGA 1AO7B 1NPUA 4YQXH 1IAII 2EIEA 2WLYA 4P23B 3S88H 4HUXA 3UTZA 3EYFB 4OV5A 4X6CB 2V7NB 3O8XC 2ZCLH 4HHAB 3RNQA 1QFHA 3GMNA 1XGUB 3DV4B 4M7ZC 1ZVSA 3HZMA 4M61A 3V0WH 1RUMH 4MDJB 3H6JA 5C6WH 3VFGH 4PB0H 2OI9B 1XIWC 4NNXA 1J1OL 1JCKA 2GITA 5D70H 3T2NH 1MJ7L 4P46A 4QCIB 4HGKC 1OB1B 3HC4H 3VXUA 3H9HB 3PWPA 4PJFA 4BSVA 4UBDC 2XTJC 2ED8A 2R0WH 4ONOA 1WAAF 2FECI 4PTTB 5IJKC 5CMAA 5DK3A 3G5ZB 4OV6F 5BRZD 1EERB 1I9IH 3B9KB 4ZOBA 5EU3A 1F4YH 4V1DE 1AHWB 1YEDB 4ERSL 4MQXD 4GG6B 4OFIA 1B6UA 3MLZH 3ZTJH 1A6VL 1NANI 5F3BA 3FRUA 3N50A 4GKZB 4HIXH 2EECA 5J1TC 1B4JL 3CX2A 2QADB 3VG9B 2YK1H 3RTQA 3F7YA 5HI4D 4HZLA 3UTSA 1UM4H 2VLJE 4XCYA 5J06A 1DBMH 4LNRA 1TNMA 3GIVB 1R3KB 5CZXC 1DANU 4DZ8A 2HRLA 5KN5B 4HCRH 5DQDH 1IFHH 4UILH 1SJEB 3CCHA 1RZIB 1IRAY 3G6JB 5DLML 1YC7A 4P23A 4TOYH 3C2SA 3EYFA 3UTPE 1N5YH 4Y4FB 4HEPG 5I1DB 3PG2A 2V7NA 5MHSE 3QIUA 4RRPG 3QH3A 4I18C 4Q74A 4WI9A 2DQFA 4R2GD 4XPGL 4MGXA 2UWEA 5KVGH 1XGUA 4U33A 3DV4A 3EDEA 4MDJA 3MGOB 3S88L 4XB8A 1KENH 1NGPH 1HE7A 2CKBA 2PETA 3WDJA 2ZCLL 1F42A 3KHOA 3V52H 3WUWA 1LK2B 3PXHA 1EZVX 3FT3B 4QCIA 3E6HA 1OB1A 1IGCH 1NGZA 5IHZB 3C9NB 4MD4B 5E0QA 1RHFA 4ENEC 4O02H 3V0WL 4MXWH 4N0FA 3ARFC 3VFGL 3IFOA 1OSPL 3GMRA 4UIMA 5DR5L 2H2PC 2XIDA 2GCYB 4HH9B 5D70L 3T2NL 4GFTB 3SDDA 3HE6A 1INEH 2AJXL 3LPGA 3QDHA 3BKCH 4BQ6A 1YEDA 2GJJA 3SCMB 4GG6A 4I8DA 5J11C 1OPGH 1DVFC 1CI5A 1XCTB 2J8UB 4MLSA 5JOEA 4MQ7B 5GRVK 4JO4H 4KTYA 1T0NA 1I9IL 1P7KB 3ZDZF 4OB5L 1I1AB 1TQBC 1S7WB 3S36H 1GHFH 4G6JH 5EOQH 1I1FA 5T3XE 1JPFB 2EYRB 4LNVA 1SJEA 4Y4HC 3GRWH 2LE9A 1X5LA 2YK1L 3HE7D 3K8LA 1IGTB 5FM8A 5TE4H 1UM4L 4ZOEA 4JR9H 4XHJD 1DBML 1N6VA 4Y4FA 2UVFA 5DUBA 5I1DA 5ID1A 5LVEA 2MKLC 2EEBA 2LV4A 1EHLH 3DX8B 3W11D 4Y8AA 4ZOCA 1T89A 3TH2T 4UILL 5DA0B 4NGHL 3HI5L 1B88A 4AH2A 3O3BB 1ND0A 4NQVA 3MV8B 3MMEB 1N5YL 4PJHB 4IIQB 2WIMA 1CDIA 2H41A 2GW5A 3SKOA 1LK2A 3QDMA 3ZKXB 1BVZA 4HS3B 1ADQL 2PTTB 1RD6A 5IHZA 3C9NA 4MD4A 3MBEC 1K4CA 4Z8FH 4JO1H 4LDEB 4LKCB 3T8XB 5FM4A 1OP9A 4GAGH 3TCLA 4JREB 3FO2A 3GMPB 4RGNB 3MRMB 4O02L 1OQXA 4X6DA 4MAYB 4GRLC 5B3JF 2FHBA 2ICWB 2ZOKA 4ODSH 1XCTA 2J8UA 4DZBA 3QFJA 1Q9WB 3A6OA 3P0VH 4PJ5B 4WTZG 5LGJB 4MQ7A 2VLJD 1FL3A 2R69L 3NABH 1P7KA 3QUXB 1INEL 5T3ZH 3K3QA 3BKCL 3X3GH 5A3ID 2OJZH 5IROA 5TDNA 4XMLL 1UB6B 1JPFA 2EYRA 3HAEH 1IC7H 2H2SC 4E0RB 3V5DB 3QUZB 4J23A 4L8DB 1F4XL 1HQ4B 4JO4L 3UXFA 1XGQB 4JANB 5TGBB 1S5IL 3UTPD 1ZHKB 3WS6A 3DV6B 5MHSD 3S36L 2HT4C 1MCKA 4LMQI 5EOQL 4WW2B 3KYNB 3FAXA 4CMHC 3MROB 1ZLWK 4PB9L 5T5NG 5TE4L 3O3BA 1OLZA 3E1F1 4PJHA 5JDJA 1FG9C 1KCSL 1OF2A 2CRMA 2XY1A 4IIQA 5MERB 4CVZB 3STLA 1EHLL 3VGFA 5JOPE 2J7LA 1SMOA 3BDYH 4HS3A 4K7PY 1T0MB 2PTTA 4NUJB 3GSVB 2XPGB 4EVNB 4J3XA 4J12A 3IJHB 1HZHH 2A74B 3HPJB 1R3HB 1ZT4A 2P49B 1IZJA 3TEUA 3GMPA 1U58B 3K2UH 1NCBL 5GHWH 1UYWH 3DETC 5DJ6B 4JO1L 4Z8FL 3SGKA 3V0VB 4ETQA 3D25A 1IQWH 3TN0C 1T04B 1Q9WA 1YMME 1JN6B 1V3MA 4XAKE 3MA7B 5TQ0L 2MOVA 1FNSL 2D9QB 3QUXA 1M7DB 4KGJA 1C8PA 4I2XB 5CWSA 1NAKL 5T3XD 3T2OA 4ODSL 3GJFA 1LDPH 4E0RA 4U05A 5EWIL 3P0VL 3V5DA 4XAWL 1HQ4A 1KG0A 1NCUA 3REVA 5C08B 1XGQA 3U79A 4JHAH 3NABL 2IH1A 2EXWC 1ZHKA 4G7YH 2F9BT 5T3ZL 4BZ1H 4MXQC 3DV6A 3PDGA 5BJTB 1J8HE 5CZKA 3IU4H 3MCLL 5DJ8A 4JM2C 1IC7L 4D0BA 4WW2A 3KYNA 4PRPB 5DVOA 2JELH 4DFIA 5D2LB 1T21B 1BM3H 3M17A 3GI9H 4N1CA 3EO0B 1KYOK 5EO0A 1KJMB 1LO3L 3FB8A 5I17B 1DQMH 3VRIA 5MERA 4M03A 5ADPH 2GAZB 4CVZA 3BN9D 1OLLA 4LGPB 4XT1C 4LCIL 3GSVA 4UNUA 5E7BA 1P4BH 2IPKA 3HPJA 1R3HA 3WFEL 2Z8RA 3OF6A 4OJFL 4P5TD 2WNGA 4WI3A 3G9VA 3BDYL 5D1QA 1BLNB 3O3AB 3G08A 1A47A 3I02A 1A3LH 2OR9H 3H42H 1H8SA 5GGSY 1KXVC 5B8CB 4PRBA 3MNZA 4OZGE 1EK3A 4MSWA 1HZHL 4NHCH 5C7XH 1CD1B 5DQ9B 4NRXA 5IJVB 3QI9C 2CK0H 1JN6A 1RIUH 1IE5A 2IQAB 5CBEA 5ETUA 2NY4B 3K2UL 4LF3B 3LOWA 4OT1H 3BMWA 1UYWL 1BBDL 2YXFA 2KH2B 2C4XA 4NBYB 2R0LL 4KFZC 5HPOA 3MQIA 5DURB 3I3DA 3AC0A 5C08A 4Z7NE 5I74B 2PTUA 7FABH 4PLKC 3RJDA 3H3KA 4QOKE 5HHVL 3QEGL 5SV3A 1JGUH 2QR0B 1AKJA 1LDPL 1LEGA 4XXDB 4PRPA 1K8DA 4WU7B 3TJHC 5DRWB 4JHAL 3EYSH 4BZ1L 5JXEA 1E6JL 1KJMA 3G6DH 4IRJB 5I17A 4PP1C 5JOPD 5FCUH 3DMMB 2GAZA 2KZ1B 5HVFB 2D9CA 2VWEC 2JELL 3U0TA 4WIQA 2OXGA 1BM3L 4UDUB 4R97B 4XCFH 4LKXB 4Y5VB 4M43H 2NY5C 2P1YA 3U7YH 2Q76B 3T3ME 4NM8H 5TE6L 1KTLB 2OTWB 4OZFA 2VXTL 1WBXA 3O3AA 3U2SA 2C3HA 4DVBA 5B8CA 5IKCA 4LFHG 1FIGL 3WUWG 4PJGB 2A77H 3BRFA 5HHME 3ZKND 1YMMD 4JKMA 3QB7C 4XAKD 3BUTA 5E1AB 2EE2A 1NGQH 2IQAA 5J12C 2NMSA 1XAUA 4FQQA 3UPCA 1A3LL 5FF6B 2R4SH 2GFBB 1U8QA 4LF3A 1EXUB 4U1NB 4PLNC 3DX7B 4BH8B 4K9EL 2UZXB 3UZEA 4KQ4H 5C7XL 1K6QH 5C0IA 2WK2A 1CIUA 2CK0L 1RIUL 1R5VB 3RKPA 1KCVH 4OQTH 1G7IA 5B21A 1J8HD 4GS7C 2B4CH 3TNNB 4OT1L 2H32H 5JW5B 4KTDH 5KTEH 2X9WA 2YPLE 1DN2A 1YNLL 2OBGA 5T33H 2W9LA 3RZCC 1S7RA 4NQXB 2P48B 1FORH 1XR9B 4GOSA 3SDAC 7FABL 1MCHA 4GBXD 4FQ1L 4OGAC 3MUJA 4PV8B 4NPYB 3EYQD 2HJKB 1H9VA 4IRJA 3DMMA 5AG8A 3IDYC 1FL5B 4MS8C 4PJAB 3RPIB 3T2PA 1MCNA 5HDOA 3JWDC 3TBTB 3EYSL 5FDWB 3G6DL 3LS5L 4LKXA 5F44A 3IS1X 4MA3B 5FCUL 4QNPE 1KPRB 2VUYA 5L2JA 2WP3T 1N3NA 3PWLB 4MJ5A 1KTLA 1D9KD 1QO3B 2OTWA 2EDOA 5DD0H 4S1SH 4RMQA 5AUMA 4WV1C 4XCFL 1JV5A 1G1CA 3EHBD 4DKEH 2GTWA 3MLUH 2VJXA 2EDKA 5C70A 4N8CH 4Y4KB 4YLQT 4ODTL 4NM8L 2OMNA 3O6KH 2W0FB 3SJVB 4X6FB 2FBJH 1UWGL 2GFBA 4YUEL 3LKPA 2BVUA 4AIZA 3AMLA 4FP8L 3OJDB 2A77L 1OTSC 2IAMD 3O3DA 4PJEE 1IEAB 3L3DB 4JO3L 1UKSA 5D93B 4Y19B 3OBAA 2OM5A 3UCRA 1MAMH 3T04D 1R5VA 5DT1H 2F74B 1BECA 4QOKD 2W92A 1YN6A 4YDLB 1GOFA 2R4SL 3GSOB 4POZD 3V6BR 4LCUB 2IALA 3AU1A 1I1YB 4KQ4L 3OZ9H 1K6QL 4NO0D 4CADB 3DSNA 2CR6A 3SBWC 2I07B 2PO6D 2LVEA 4WDIA 1GPOH 2E7BA 5JA8B 4ODVH 4PV8A 2B4CL 2DYPB 4X0KB 5L8LB 3IGAA 1YUHB 3S98A 1NCCH 3B2VH 4JQXA 4M5YH 4YHNA 4EOWH 4PJAA 4XP6H 2IPTH 5HDLA 4X4YB 3EFDH 3CFEB 4JY6B 3VFPA 4PJ7A 4LHUG 1Y0LA 5EA0H 3TBTA 3ZZ1A 1UEYA 4Q6YA 1NSNL 2V2TB 2EE3A 1OCWH 3DI3B 4MA3A 4PGDB 3SO3B 5A2LH 1MOEA 3RWGA 3OKOB 4WVRA 4OM1H 4YK4C 1BJMA 2BC4A 2C7UB 3P77B 4B7LA 1LP9B 3INUH 4QXTA 3VDCA 1HSBA 3KPOB 5HHMD 5IF0B 2C1PB 2CO6B 2BHZA 1HILB 1RULH 2NY0B 3QHZH 1LWRA 4KZEH 4Y4KA 1QKZH 1R24A 4OLXH 1WBYB 1FFPB 3LAFA 4NQUA 4JKKA 3NCBB 4X6FA 4S1SL 2BCKB 2I60H 3BP6A 3CFBB 2WW8A 1KB9K 5FKAB 3OJDA 4DKEL 1IEAA 3VXPB 4F7MA 4JFFE 4N8CL 2CSPA 3MLWH 1B90A 2EH8H 2OI9C 4I9WE 3O6KL 5F21B 4MWFB 5DFVC 2FBJL 2BNQA 3GB7A 2YPLD 2MTPA 3V95A 1D5ZB 1QSVA 1CE1H 1RJZB 4Y2DC 1I1YA 4KY1H 2VN7A 4FQXB 2BK8A 1FG2B 1FO0A 2Q86A 4R6UA 4L3CA 5DT1L 3O4OB 2QSTA 3DYPA 1BD2A 4ZODA 3PQYE 5IBUG 3I2CL 2YXMA 3OKYA 3QUYA 4X0KA 1EAPA 1YUHA 1X6LA 3B9KC 3R1GH 3OZ9L 4NHUA 3DVNB 4F37F 4OZGF 4JY6A 4H5SB 5CJ8A 4ODVL 3QEQE 1HWGB 2V2TA 4R26H 4PJIE 4PGDA 1NC2B 5IG7B 4M5YL 1JYVA 2EH7H 2ED7A 3OKOA 1W0WA 3QJFB 4EOWL 4R0LA 4XP6L 3EFDL 1KUMA 4KKCD 5DD3H 3KPOA 5EA0L 1T7WA 1ZGLA 1CXIA 1OCWL 2IH3A 2HP4A 4Z7NF 5ICXB 3E0GA 1WBYA 1FFPA 2VL4A 5IWLA 4OM1L 3VD3A 3SOBH 2ICCA 2BCKA 3INUL 5DYOB 5F7KC 1HNGA 1OP5H 3PGCA 5EU7E 4JQVC 1AP2B 1U8JB 3CFBA 1RULL 5FYLE 2HN7B 2W0LA 1BJ8A 1AXTH 2F53B 2BVPB 1JYXA 3TBSB 1QKZL 1IJ9A 3U6RB 5ESAA 3T4AB 5IVXB 5SWSB 2PW1A 1NCAH 2I60L 1MCBA 3MLYH 1E4KC 1D5ZA 2VDRL 3BZFA 1RJZA 2XKNB 5I18H 4FQXA 2O26U 4LSQH 1VHPA 3MLWL 2P8MA 4N9GA 4FQHB 2EH8L 1YC8A 4KVNH 5IIEB 3O3UN 3T3MF 3AS1A 1IM9D 4UQ3A 4P48A 4KKAC 5DMIH 3VXQB 4HS8H 5EUOB 3DVNA 2FD6H 5HGHB 4EEEA 1GZQB 2VIRB 4H5SA 2B39A 1UM6H 4S11A 1L4IA 5IOPB 1LD9A 1KN2L 1A1MB 2E8ZA 4X7FC 3VGGA 4F15B 3S35H 1A7NH 5C2BH 2DMBA 3QJFA 4OFDA 4MZ2A 3WJLC 2WM0A 2UZYB 4Z6AT 4OIAA 3D3VE 1PKQE 3HI1B 1QFOA 2BNRE 3O9WB 2PYEB 6FABH 2C3XA 3G5VB 5I2IA 2YUZA 2F8VA 1NCDH 4Q2ZA 2V2WB 1MHCA 5LCVH 3PHQA 1PEWA 1U8JA 4NN6B 1RZKC 4F3FA 4JFFD 1A6WH 4N5EC 4OZFG 4TUJA 2HVKB 4I9WD 1JGLL 2D7MA 1MIMH 1MCWM 4X99A 5DMGC 3SOBL 5SWSA 1YY8A 1RJLA 5CJQH 4D0CB 4U6TA 3P9WB 3KHQA 1WCBA 3PL6B 1RZJH 3PQYD 3FJTA 2FZ3B 4QNPF 5C0CB 3PGDB 1RUQH 4OLZH 2YRPA 1BFVL 3HTLX 1NCAL 3CLFH 4JREC 3LB6D 3BSZH 3MLYL 5MEOB 3QCTH 5I18L 1X5KA 3VXQA 3MXVH 4LSQL 5IMOB 4YWGH 4Z78A 1WF5A 3N0PB 5HGHA 2AP2A 3X12A 1GZQA 4P57B 5JA9A 4KVNL 3QEQD 1INQB 5FHBL 5EZOL 4HUVB 4PG2A 3HFMH 3NCFB 2HMIC 1ZS8B 5IFJA 2VZVA 1A1MA 5BS0E 5IM7B 1EA9C 1JHTA 3DYOA 5DMIL 2X5PA 4HS8L 1U91B 4MB4A 2FD6L 3JTSB 3PWNB 5GS1B 1GOGA 1X5JA 4P2OC 4OF7A 3RL2B 1UM6L 4PJEF 3HC3L 4IM8A 4WFGE 4PRAB 3FT4B 3QUZC 4G8GE 1LHZA 3W0WE 5I6XB 5D7JD 3HI1A 3BGFB 3O9WA 2PYEA 3G5VA 1WICA 1JGDB 5C2BL 4OGXL 3VXME 3WFDH 2NCMA 3LKRB 5FYLD 1NCTA 5IB4A 1H3UA 5F7WC 3WJJC 5IMLB 2HVKA 2IFFL 4KROB 6FABL 5EULV 3DTXA 4P2RE 2HT4D 4CVXA 1X5FA 5IV2B 5CILH 2VDKH 2CLRA 5LCVL 1PBYA 4XVTH 1ZK9A 3EYUH 1ZKAA 4UQ2B 5TF1H 8FABA 5DS8B 1DQJB 4GSDH 4DKFH 5IVZB 4L8SC 3VA6A 1BGXL 3P4NB 1I4FB 3EOTH 3SY0B 3PL6A 1N8ZA 2FZ3A 5DJXB 2P5WE 1KCUL 3F6IA 3C8KA 1RIVH 2CKBL 4NNPH 2BVYA 5CJQL 5D8JH 5SX4I 3SKMB 4M7LL 5KVEH 5IMOA 4HUVA 1OARH 4OLZL 4YIQB 1NKRA 5I19H 2R2HA 3CLFL 1A3RL 1KF9B 3E3QE 1KCLA 4HKZB 1JP5A 2ADJB 3QCTL 5HYSA 4WI6A 4CU8A 3DRQA 3MXVL 3O6FC 3PWNA 5GS1A 5L0QB 32C2B 5E6ID 3FB5A 3OXRB 1OWWA 4PRAA 3D3VD 4UOJA 3WHXA 2BNRD 2BERA 4LVHB 2HFEB 4L9LB 3FKUS 2R0ZH 3T08A 3C08H 3NCMA 4LEOB 4MVBC 2IADB 4XPHH 4BZYA 1R5WB 2ZG3A 2EZ0C 3U7WH 2EIBA 4X9HA 4P9MH 3T0DA 1S7SB 2CJUH 4FQCL 5I8EB 4H1LA 2VXVH 1QSEE 2QHRH 3LMJH 4G6FD 5IHLB 2HLFD 5IMLA 1T5WB 3GKWH 4QRUA 2MPAH 4JB9H 2P47B 1VERA 4YJZL 3C6LB 4JFDA 1D5MA 4M5ZH 1Q72H 4I77L 3QQ9D 3S96A 1J8HA 4UQ2A 5DK0A 5DS8A 1DQJA 4P3WA 3BW9B 5IVZA 4NNYB 3S37H 3RDTD 1I4FA 1LEKA 3SY0A 3WYRA 4JDZA 4NZRH 1FL6B 4YFLF 4LP4A 4PJIF 5CILL 3B43A 2XTLA 2VDKL 3VXNA 1S3KL 3HZYB 4L3EE 5HGBA 2I9TB 2WANA 4XVTL 3SKMA 3SKJH 3EYUL 1TZIB 3DBXB 5TF1L 2XNAB 1I8IA 4GSDL 2M1KA 5EZJB 5HJ3A 3EOTL 4XNYH 3WIHH 3FQWB 1JF1A 1VPOH 5BS0D 4ONHB 4YIQA 1A6PA 1HHIA 1KLGA 1RIVL 3SEPA 2OQJA 5D8JL 2NY4C 2VKXA 3W5MA 5KVEL 5EO9B 1S9XA 4U1MB 1X5XA 4WFGD 1QPXA 1IBGH 4G8GD 2HH0L 1ZT1B 4F58H 5CUSH 4N0CD 1KB5H 4G7VH 1QR1A 1NFKA 1P7QB 2BVTA 4XP5H 1RU9H 3BP7B 2QQKH 1GGBL 4C54A 5CINH 4UZGA 3VXMD 4QTIH 2CMRH 5BV7C 2IADA 2PXYB 1NUDA 1B9ZA 3BEWB 1ZSDA 1MI5B 1S7SA 2E9JA 3R8BB 3UDWA 3OAYH 3E6FA 3KJ4C 3T2QA 5JW4Q 3WKMH 3KR3H 1T5WA 1I8KB 1G6VK 4NC2B 4P2RD 1ZLUH 2F5AL 3C08L 3GI8H 4P5MA 4U3CA 3FQXA 2XWJB 1U8LB 2OL3B 2DIBA 3C6SB 3OJ2C 3O45B 3WIFA 3U7WL 1KJ2A 3TVMD 4LLVB 3T65B 2CJUL 3RVXC 4DUXA 2XN9B 35C8L 2QHRL 5FKPB 4OCYH 3GO1L 2MPAL 4JB9L 4WHTA 1HCFX 1ZHNB 4Y5VC 4KU1A 1MCQA 5E8NA 4NO0A 4RIRA 3ZHDA 4APQC 3L5XH 4M5ZL 4X80H 1Q72L 2PO6A 5HI5C 3S4SB 1I75A 2I9TA 4QY8B 5KS9E 1B0GB 5I30H 2X4TB 2XNAA 3HNVH 1OAXL 5EZJA 1C12A 1ROWA 3UP1A 1BF2A 3TO4D 4XMKL 1H15B 3FQWA 3LN4B 4MA7H 4JZJB 5LQBH 4XMPH 3EOBB 3NCYP 4MNQE 3SKJL 5EO9A 3LQAL 5GZOD 2ITDB 2Y6SD 1OT1A 3UAJC 4MAUH 1U8HB 3I6KB 1ZT1A 3LPWA 1Y6NR 3MRFA 4JPWL 5AYUH 5KSBB 3MV7B 3V0AC 5BVPH 3VFNB 4WTXA 5INCA 1AR2A 1IQDA 2VLRB 5E99H 3VA2C 1JZ8A 1IBGL 3BEWA 2ZJSH 4F58L 5CUSL 1MI5A 1QSED 4G7VL 3QDJE 4NZTH 1VSCA 4XP5L 1GOHA 1RU9L 4YDVB 5T1LD 1KPUB 1VFOA 1KC5L 2QQKL 1I8KA 5T5FH 3VRLE 5CINL 1TVHB 2NY3C 1H3VA 2CMRL 5CEXB 3TPKA 5F7MC 5ANMA 4DUWA 3C6SA 3O45A 3O11A 1NFIB 4HGWB 2XN9A 3OKEB 2VXUH 3V7MA 3WKML 5F9JB 2ARJB 1M6OB 1OM3H 3GI8L 1ZHNA 1HYSC 3SDCB 3RY5A 4L3ED 4HC1A 3DRTB 4QY8A 4LLAA 1B0GA 2X4TA 4J3WA 5BOPA 4OCYL 4HEME 4MD0A 3D18A 4XB7A 3VU2A 2FX8H 3LN4A 4FFVD 2AERT 5DQJB 4JZJA 3THMH 5ICYB 4PJ8B 1JFQL 3L5XL 3WUZA 5GSRB 2FEEI 3QIWB 3EOBA 4NZDA 1KTKE 3A6CH 3U7AA 1UQSB 5I30L 1Z0NA 1ZVYA 4Z77B 4IRSC 5D9SA 4LRIC 2R2CA 5D93C 3GSNB 1B0RB 3GIZH 3MLXL 5A16A 1QOKA 3GMOB 1EAJA 5K9QG 4XNQB 5DHYB 2RCSH 2GK2A 3VFNA 1ZOXA 4WRLA 3G5YB 2VLRA 3TPUB 2DBLH 3BIKB 4RGMC 2IEPA 3RX5A 1QACA 1UJ3B 1VFBB 2A0LD 4YDVA 4ZPTA 4YFEA 5F3HB 4FQLL 3PDOB 1IL1B 5AYUL 3HB3C 2PW2B 1X3DA 1XGPB 1ZANH 5CEXA 2VSDA 3KPRB 3HG1B 1FGVH 3CK0H 3QDGB 4C83A 4J4PA 3VXOB 2R56H 4HGWA 3ULVC 4O2EB 4DOHE 2VITB 4X8XA 4JY5H 5F9JA 2ARJA 2CIKB 2HG5A 5KVDH 1F02I 2JB5H 4LOUC 1JI1A 1JJUA 1RIHL 4K7PL 1RUPL 4RAUB 3AMKA 3MNVA 4BKLA 1WT5C 3QEHB 5GSVA 5KW9H 1Z9MA 3ARED 3N85H 4V2BA 3VFVA 4JFZH 4JRXA 1K5NB 1WFTA 3CXDL 2P5EB 3DRTA 3RVWD 1KLUB 2VXUL 4R8WH 4PRHE 1Q94B 3D69A 1IM9A 2X05A 4PJDA 5TQ2H 5A2IH 3WS3B 1FV1B 2NY0C 4PJ8A 4MNQD 4QWWD 3KYMA 3QR2A 4F9LA 5D5ME 1MREL 2LVCA 4LHUB 4MJ6B 1N4XH 3L3KB 2G60L 5EBWA 5I1KH 4HMCA 4N0UB 4S2SB 1ITCA 1EJOL 3OKMB 3GSNA 3THML 3DGGA 1B0RA 3FN0L 2FH6A 2D7OA 2EDQA 4GXVH 1YNTB 1BQLH 5DHYA 1FFQA 5D72H 2NR6D 1LK3H 3BIKA 5L9DH 4ZDHA 3W82A 3QDJD 3I85A 1QBLL 3VXTA 5HYSG 1UJ3A 1VFBA 3GIZL 4FFZH 3W39B 1MLCB 3H7LA 1UB5A 3LKOB 3VFSB 3S8WA 2PR4H 4PJ9C 1NEUA 4KHTH 2RCSL 1ZHLB 3LY6A 2HJFA 3L7FA 1HDMB 3KPRA 3SGEI 5A2JH 2DBLL 3QDGA 4DN3H 4I1NB 2HTKC 1M05B 4O2EA 1EHNA 4GO6B 3FB7B 1DUZA 4HQQH 1AFVH 4NKIH 1Q0YH 4M93C 4MCZB 1CL7L 4RAUA 5BZWB 3QEHA 3DOSA 4H1LG 1FGVL 1RZ7H 3CK0L 3TV3H 1FJ1B 5HYJB 1K5NA 2R56L 4NN5B 4JY5L 3L3GA 1Q94A 3TBYB 1UCBL 4J8RB 4WO4B 4EJ1C 4ZXBB 2G2RB 4NQDA 3FB6B 2QBWA 4ODXB 4F9PC 4HUMB 2MQ0A 4QEGA 4ELME 2OK0H 4K07A 5C0EB 4JFZL 2ATPA 3QEQA 2DLTA 3KPLB 4PJIA 1KJVB 4M62H 3OKNB 3M1BB 3TM6A 4RMVA 4R8WL 3LDBC 3UX9B 3ZKMC 4OZ4A 2X6MA 4N0UA 4TVSa 1JRHL 3OKMA 3CC5B 4PRIB 2VYRE 4JM4H 4M02A 1EVUA 1QNZH 1N4XL 4M7JH 1QRKA 1G7JB 5EORH 5D7JA 3S36X 5I1KL 1QA9A 1MCIA 3CXHJ 4M6OH 1W2KT 5FGCB 1WZLA 3W39A 3CVHB 1MLCA 4JDVB 2YBRB 5DEFB 1MFEH 1XZ0B 3IB4A 4FTVB 3QAZB 5IMMA 1ZHLA 1H5BA 1LK3L 2Q3ZA 3GBLA 5KS9F 5L9DL 1CICB 3ZDYE 1M05A 2EDDA 1QEWA 2Q8BH 4AM0B 4JFEE 4FFZL 4LPVA 4JRYB 1YEHH 3UEZA 4KHTL 4KKBC 2A6KA 1MCOL 2DKMA 4HUWB 4X6EB 5DD1H 4DN3L 5HYJA 2EIDA 3NFPB 5LG1A 4PRHD 4QHKJ 4LHJB 3FHQA 3B8YA 3QZWA 1FVDB 1AFVL 4J8RA 3MJ8B 2ZWLT 3T0EB 1Q0YL 2G2RA 4ZXBA 4FXGB 3FB6A 4ODXA 1MCFA 3QRGL 1EEZB 3GBMH 2MCPH 4ORGB 2LQRA 3ARUA 1KLFA 3VRJB 5I16A 3OKNA 5DC0A 2CRZA 2XA8H 3Q1SL 5JLZA 1CL7I 3ZYIA 2IGFH 4MNGB 3WFCL 2BVOA 4JN2B 5SWZE 5ISZE 2C5DC 2OK0L 4PRIA 4ZS7H 3CPLB 4EN3B 3VRLF 4Y1AB 5E6IA 1SQ2N 3IETB 4LVOB 3RIAK 1KCKA 1PKQA 4XI5C 4ELKB 5IQ7H 2BNRA 1G7JA 4OCSL 2Z31B 1YEFH 4LMQE 3IDXH 15C8L 2JJSC 3BE1L 3UJJH 3ULSB 3B83A 3B8SA 1UJTA 1ZA3B 1H8OA 3BOVA 5T1KB 4JDVA 2YBRA 5DEFA 3STZA 1XZ0A 4YHOH 4M7JL 3G5XB 1S7UB 3EOAB 5C0DA 1JRHI 1ORSB 2Z8SA 4WCYH 4M6OL 5F7UA 1P2CB 3AFLA 2AEPL 4BJLA 1MFEL 4HUWA 2V7HB 2ZSWB 2ATKA 4XGZB 4WGWB 4X6EA 4JFOA 4PG9B 1X5ZA 4U1LA 3JZ7A 4QRRB 3MJ8A 3OAZH 4HXAH 3T0EA 2HMID 1L0XA 5F7LB 5DZOA 5D7SL 5HPMB 3AS0A 4H26A 5KSAC 5B4MC 5C0JA 4P2OD 3MR9B 4WWKB 1JNLH 3BISA 5D1XB 2CGRH 1U3HD 3MNWB 2FEDD 4M6NH 1U8IB 3MRDB 4KROC 4RISH 2MCPL 3V5KB 4CMMB 4GMTH 1FSKC 4KDWA 3IETA 2D31B 1AC6A 4LK4A 1W0VB 2XA8L 3BN3B 1LO5A 4MZ3A 3LKNB 1JPST 2Z31A 4XP4L 4FXKB 4N8VB 3DUHA 3PP4H 3ULSA 4EI6B 2O5ZH 4ZS7L 3LEYL 5C09B 3JV6B 3C60D 4WFHE 3BZDA 1F4WH 3BP4B 3QHFL 3TYFB 2AGJL 5IQ7L 2X4UB 2NXZD 5GRJH 1AIFB 5CJXA 4GW1A 1HNFA 3P0GB 2ICEB 2YUVA 1YEFL 1ORSA 4R3SA 5SX5H 1Z9SA 3UJJL 4JFED 2XG5A 4LIQH 4BQ8A 4I3GA 5BRZB 4MA1C 3MLSH 2IANB 1F45A 3TVMA 1M7IA 2X70A 2XZQL 1LO0H 1JWUB 2OP4L 4YHOL 4A6YA 1JNHB 2V7HA 2ZSWA 3CAFA 3GM8A 4KKLC 1ZE3C 4WCYL 5D5MF 2N1KA 3C5ZB 3T1FB 1HHKB 5TE7H 2JB6B 5L0QC 4NO3A 5FUCC 1V3KA 1EO7A 4QRRA 3WN5C 3L5HA 4L9LC 5L7XH 1Z3GH 2NY2D 3CMOH 4ODUB 4NC1C 3AB0C 1T1WB 2Q6WB 3L1OH 2MMXA 3VGDA 4LCWA 2HKHH 4WWKA 3QWRD 4NBXB 1FC2D 5ALBH 2OSLA 5L88H 2AJUH 5SWZD 5ISZD 1PW3A 3MNWA 3U46B 2VLKB 2QEJA 4KHXH 1RURL 1XCQB 4P3CH 2LU7A 1YEKL 4F7CB 1U8IA 4R2GB 2O61B 1SJVA 5E95B 3MLRH 1J12A 4C58B 4U0RB 1N2RA 5IW1B 2HT3D 3LRSB 4ZNEE 2GY7B 2VQTA 3EW3B 3QA3A 5EC2A 5GGTA 1W0VA 4KK6C 4F80A 1T83C 3EDJA 3KVQA 4WHYG 3LKNA 4XVSH 1UVQA 5KZCB 1QSZA 4N8VA 5MEQB 2JE8A 4M6NL 3RIFF 5DJ0B 2ESVE 5I0ZA 2VMFA 4GMTL 3JV6A 5FECB 2NY1C 1CT8B 4K3HA 3RWEB 3BP4A 5EH1A 4Z0BH 5FV1L 4RSVA 5ILTH 2X4UA 2N7BA 5T1LA 4F57L 5I1AA 2A9NL 1FZJA 1MY7A 5B38B 2O5ZL 5TDPB 3SPVB 1DQQB 5K59E 3CSYB 3T09A 4D0DB 2DBJA 3L3OA 5T3ZE 2EDRA 3KYOA 5FO7B 2VXQH 4ELMF 3CIQA 3TZVD 4JGJA 4N8PA 2Q8AH 5HHXL 5D96B 1NFDB 1FZKB 1CGWA 4NRZA 3C5ZA 3T1FA 1HHKA 2R2EB 3RA7L 4R4BB 1NCNA 5DJAB 3RUGB 3MLSL 2PYFA 5HY9B 2EO9A 2B1AH 1D5IH 3TNMB 4UINH 1KOAA 4LASL 4QTHB 5D6CB 3ARGA 4KZDL 4OZIE 4ODUA 1PG7H 1T1WA 3HE7B 5I71B 2AJVL 1KIRB 1MAKA 3JBG7 4Z7VB 3OR7B 4HWZB 1MNUH 3CFDB 2VLKA 1L7IL 1A0QH 5L7XL 1Z3GL 1CFQB 4K8RC 2O61A 5FHAH 3CMOL 3UTTA 4PJXE 4TNVF 43C9B 3LRSA 4JFYA 4JHZA 4QF1B 1R6VA 2HKHL 5ALBL 3ZDYF 5L88L 4G8FA 3F6LA 4HLZH 2YPVH 1EBPA 4P3CL 4CU7A 5MEQA 3RI5F 3FOLB 4WFHD 3FFCA 2R9HD 2Z0BA 5DJ0A 5HGAB 4OIIL 3BQUC 3LV3B 1CT8A 1O0VA 2UVEA 3RTQC 1CR9H 2L7UA 2X4SA 5E5MA 1A9EB 1QFWL 3OKKA 1O5DT 4NCDA 5B38A 3H3PL 2D0GA 5D1ZA 3SPVA 5F1IB 4V1DB 1GSMA 1GXEA 4QLRA 3WFHB 1PX4A 4Z0BL 5FO7A 4TVPH 1UZ8A 2QQLH 2W07A 1AR1D 1DQLH 1NFDA 3BJLA 1FZKA 5I1HL 2R2EA 4AL8L 1XGTA 5JZ7C 2VLJB 2BJML 5DJAA 1IMHC 1CFVL 1A4KA 3AREA 5HY9A 4R90H 5EFIB 3MGTB 4XNZB 1EVTC 2VR4A 3QO0B 3MRKA 2FWOA 2Q8AL 4DCQB 1E6OH 2AABL 1I8MB 4YHYB 1T1ZB 5FCSH 4KJPC 4PFEA 4XWOD 3DXAA 1G7LB 8CGTA 1F6LL 4ZFZA 1KIRA 2B1AL 3HCVB 4Z7VA 5EU4A 4HWZA 4PY7B 5I73C 1BZ7A 5CD5C 3DPBA 3JXAA 3P0YH 1CFQA 4PPTA 43C9A 2NZ9D 4QF1A 4TUOB 3SDDC 2EC8A 3CDFA 3HE6C 4HWEL 3RGVB 3MJGX 3IKCA 5K9QI 4U1KB 1MNUL 2Z8WC 2ESVD 3GSUA 1A0QL 1RVFH 3DVGB 4U6XB 5DC4B 3G6AA 3QXTA 1T66D 4OLWL 4P2YA 3SE3A 3LV3A 2D7NA 3VWKB 2AKRA 1D6EB 1WEJH 5DRNA 2YD2A 3ARQA 1U8PB 4M7LT 4G6AC 5F1IA 5T3ZD 2ORBH 4XCCH 3CZFA 3WFHA 3QNXB 2GEEA 5J9PB 4N5UA 1GC1L 1K8IB 4I13B 4UAOB 1MCCA 4C56E 3W9DA 4PJCE 1K85A 4K3GA 2P7TB 1ZGLM 2ZUSA 4ZSOE 4NSKB 2FJGA 5I1LA 5IMKB 1FZOB 3VD5A 1F58H 1YECH 1BX2A 3MJ9H 2JTDA 1QFWI 3Q3GA 4YPGA 1XF4A 1XT5A 4TVPL 2QQLL 5DWUH 3ME0A 5EC1B 1BVKB 1DQLL 2VZOA 3P73B 4LPTA 1I8MA 4CN6A 1T1ZA 3IJYB 4ALAH 1RSFA 2HJLB 3VFWB 4R90L 3KLAB 1GGIL 4NWTH 2HVJB 5K9OB 1UXSA 3ZT7A 3CDYA 2Y5EA 5EUKB 1E6OL 4Z0XB 1ZWIB 2E6QA 3IRZA 2DOCA 2VXSH 3PGFH 3O41A 4MJIB 4TUOA 1C5CH 1PQZB 4J3SA 4QXWA 1WBZA 3RGVA 4NRYA 3V4VL 3Q5TA 1YA5A 4U1KA 5DA4A 1CFTB 3B9AA 2OL3H 4K2UH 3DVGA 4XCNB 3C87A 2WBJB 3SGDH 3ARXA 1JF6A 4JFXA 4ISVB 4HJ0C 1T2QH 4XBGB 1G7QB 1D6EA 1T20A 4MNHB 1V8HA 1I7TA 1U8PA 2DJSA 2KQNA 5EBMB 3BT2H 3CH8A 3QNXA 3VG0H 1CBVH 3GUTA 4X7TB 5I9QC 1ZXQA 5CGYD 3F5WA 3WS6C 2CIIA 4R9HA 2BSED 4NQCE 5T1DL