3HE7C

Crystal structure of mouse cd1d-alpha-galactosylceramide with mouse valpha14-vbeta7 nkt tcr
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
204
structure length
197
Chain Sequence
TQVEQSPQSLVVRQGENSVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD1d1
publication title Differential recognition of CD1d-alpha-galactosyl ceramide by the V beta 8.2 and V beta 7 semi-invariant NKT T cell receptors
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 41
structure length 197
sequence length 204
ec nomenclature
pdb deposition date 2009-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3he7C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3he7C02
2R1XB 3OAZH 4P46C 3QDHA 1N2RB 1NEZA 2FWOA 4KGLA 4XTRD 4XMLH 4H20H 3S34L 4R4FH 1KCSH 1YN7B 5LVEA 2H32A 2C1OA 3AM8A 1TXKA 3MGTB 4UAOB 3TBSB 1CL7H 4QNPE 3K1KC 4EI6B 3MRRB 2IC2A 4XC1L 4LRIC 4UTBL 4KRNA 3TIDA 4DGIL 4EI5B 2ARJQ 1CDGA 1X9QA 3T0BA 4JLRA 4ZNEE 3DVGA 2ZNWA 4MSWA 3GMRB 4JFED 4UT7L 1K8DA 1FG9C 1RULH 1MCIA 4CJ0A 5IFAL 3CPLB 1HHIA 1WV7T 1JNJA 1WITA 3Q48A 3DGGA 4BM7A 4I48A 4ZD3H 3MLWL 4N8VA 2J2ZA 1JYXA 2GTZA 4LASH 3PQYE 3WL9B 1A5FL 1EA9C 4MXVE 1ORSA 5JO5B 4GMTH 3BSZL 4RAUB 3QG7H 4MLSA 1D6EB 4LVEA 3VXNA 4L9LB 1YY8A 2EDLA 4H1LA 3EOBB 1H0DA 3B9AA 2X4TA 4DKFL 5D7IF 4WFGE 3U4EA 2LTQC 3S37L 1KT2A 3QDGE 4MD5A 1LMKA 2DDQH 4X4XB 1KLGA 1JWUB 3NFPA 5CEZE 3O8XA 3RWJB 3U82B 1BFOA 3QHZL 4IDLA 3UC0H 4U6XA 5BS0D 3PQYD 3UBXI 2FJGB 1U91A 1IL1B 1TLKA 1Y6KR 8FABB 5JW4Q 1XGPA 2BNQE 1DR9A 3QULB 4WUUB 1FL5B 1FL6B 3RNKA 3GSNL 4G43A 3ZT7A 5IKCB 4NRXA 1KN2H 4PJEB 1KXQE 3QIUA 2AJSH 5IEKB 3IXTA 1KEML 1IGML 4KKAC 1MRFH 5KN5A 5EU3B 3O41A 3QEGL 4IIQC 2Q6WB 4WFGD 4JY6B 5FM5O 3K2MC 1TETH 4HC1L 5BVPL 2O5XL 3HE6A 1XF4A 5KSBE 4R8WH 4MVBC 1HQRA 1YN6A 5BVJB 3QDGD 3OKNA 1F11B 4F3FB 1JGLH 1RZJL 1ED3A 1CGSL 4ZPTA 1F3JA 1A7PH 4PJFF 1NEUA 3BHBA 2P46B 3HI1B 2QBWA 5FGSA 1D3CA 1U0QA 1A3RH 5F9OL 5ADPH 1LO0L 2BNQD 3FFCB 4G6MH 5DHYA 5IFJB 2QJDA 4UIKL 1HDMB 4H8WC 2HJKA 1MEXL 4OZGE 1Y18B 1OQXA 2H6PA 2PYFA 4J1UB 4U1MB 5E6IB 4D9QE 4PRPA 5EDXA 3ARUA 4YQXH 1OAQH 1IAIH 1RD6A 4XCNB 4OZFA 4PBWD 4D2NA 2YA2A 1V3LA 3SDDD 1IEBB 1LP9E 4L8DB 4G6KL 5E1AA 5BCAA 3FN0H 3OAZK 4R7NA 4HIJA 1HOCB 1VKXA 2LE9A 2EKJA 3EJZC 3GSNA 2NX5B 3GMQA 4H20L 3S4SB 4R4FL 4GKSA 2ESVA 1KCSL 5DR5L 3WS3B 3DJ9A 3QEQA 4D9QD 1MUJB 5FO9B 3V6OC 1UWGH 3WJJC 1S9VB 3G5YA 4HC1A 3VI3F 1KBGL 2N7AA 5CFHA 2XG4A 1QVOB 3QEHA 3QFDB 3RI5F 3F5WB 4HUMB 5L0QC 4DZBA 4G8GA 5I0ZA 4Y88A 3AS2A 3MV7B 3CK0H 1RULL 5DK0B 4YHLH 4IMLB 4Z95L 2D3VA 4PJXA 5GGRA 3MRGB 3OKKA 5D9SB 5HYJD 1SBSH 4PV9A 2Y5TB 5E7BA 1BVLA 2W92A 3A6BH 2BCKA 5C0BA 1J1OH 4QGTA 2ZNXA 1GH7A 2OZ4L 1T1YA 4UNUA 1CICA 4MD0B 3HLAB 2DKMA 3DX9A 4TUKL 4X9GA 3QG7L 3ZTJG 4S0TD 4U3HA 4WWKB 4PIRF 4ELKB 5ALCH 3PV6B 5C0ND 2IANA 3BPOC 1IILE 3L6FA 4ZS7L 3WNKA 1NBZA 5GGTL 35C8L 2ADIB 1IZJA 1T22A 4LCCB 5D1QC 5FHAH 5I8OH 5HGBA 1MHCB 2DDQL 2IGFH 1H3UA 5AD0A 1KNOB 1Z6JT 3UC0L 4L4VE 4S2SA 4PJHA 1MFDH 4H25A 3C60A 2BVPA 4N0FA 3T1FB 4ENEC 1KN2L 4H5SB 4WHCA 5D71L 4HWNA 2EXYC 1VESA 3D6GA 3W0WA 3CFBA 3FT2B 3SGEH 5EOCH 1CDJA 1MELA 2JJSA 4Z76B 1XH3B 2EDQA 5JOFA 2ATKA 3LN4B 2APVA 1BZ9A 5C0AD 1JGLL 3T0XA 2F9BT 1A7PL 3LPGA 4L4VD 4YDVB 1A3RL 5ADPL 2EEBA 4HXBH 3BPLC 2FECI 3RZCD 3VA2C 3MX0A 3FO1B 3HG1B 4B5EA 1AR1D 4N9OB 2BNRB 4XMKH 2FYYB 5TDPB 3X3FL 1HXMA 4FTVE 1KCVL 3GO1H 4IDJH 5GGTA 4ZYKA 4YQXL 1A6TB 1OAQL 4KROB 1IAIL 5KAQF 4RIRB 1GZPB 2WANA 1KENL 4OAWB 5GISH 2Q1EA 2VN4A 3GJFB 1GGUA 1VERA 2IH1A 2VLKE 3FN0L 3SPVA 4F9LC 3O6MH 5T33H 5J13B 3M8OH 1EFXD 2KQNA 4FQHA 4AIXA 3SE8H 5MEPB 1U93B 2X1OA 3CFJA 1A14H 5H37H 3EYQD 3O4OC 5FKPA 1UWGL 4FTVD 5CILH 1RIUH 3DROA 2IAMD 4AEFA 4OSUH 1EERB 2VSDA 2FHBA 3L3JA 3WKMH 1CT8B 2IMNA 3VXQB 2AAVA 3GMPA 3T08A 2B8OT 1MLBA 1JBJA 4J4PA 2GTWB 3OAUH 4JZOA 3SDCD 3CK0L 5D2NE 4QXUH 1CN4A 1G1YA 2VLKD 4X7SH 4YHLL 5AWNH 2ICEA 3KYOB 1JFQH 5C0JA 2DBLH 3QPXL 4JO2L 4LGSB 5I1AB 3V0VB 4O2CA 4XPTL 1S3KL 3UTTB 3K4DA 5DJ0A 3QJHA 5HI4C 5BW7C 1U41A 4PLKC 5EN2A 5FV2A 5IJKC 5ALCL 3B8YA 1A6ZA 4HX1A 4HG4J 1FNAA 3WDJA 2XKNB 3P9WB 2D03H 5L8LB 1U8PB 1K4CA 1IMHC 5ILTH 3WKNA 5D2LA 4GH7B 1WZLA 1LDSA 5FHAL 4Y5XB 2NW3B 5I8OL 2IGFL 2VZ1A 1JYWA 5HYEA 3P73B 5HI5D 3O9WD 3MLZH 3GI9H 4M43H 2ZOKB 2DLFH 2NY3B 5EU6E 1RK0A 1MFDL 5CD3A 1Q9LB 5I8CA 4XCCH 2N1KA 1CFVL 2NNAA 4JPIB 4QRSA 2VL4A 3NFNA 1HILA 3SDDC 3C09B 1OCWH 5EOCL 3MUHL 4X8JB 5C0CA 4XP4H 4FN0A 2P43B 3MRJB 2WLYA 3WS6C 3L9RA 4OLXL 2D9CA 1QLFA 1AXSA 2Q8AL 1KJVB 2Y06L 1LEIB 3VFNB 4I0CC 3Q5YA 5EU6D 3IVKB 1FAIL 3ZDYF 2XV6B 4C58B 1OD9A 5JA9A 4KZDH 4O4YH 4HXBL 1DQJA 4XPGL 4Y8AA 2VKWA 3WFEH 3QO0A 4M62L 2FB4H 5F7HA 3UJTH 1MJJA 4ZXBA 1YUHB 5L88H 3X14A 4HUXB 4XMKL 1JPST 3WLBA 3GO1L 4IDJL 1OB1A 1RHHA 1FVDB 4X98B 5I6XB 5IESH 4TOYH 5DFVD 4X99B 3B3IB 2EIZA 1WFUA 3DX6A 3N1PC 3GSRB 3QXAA 1RZ8A 4MZ3A 1DDHA 4QRQA 1BLNB 3OKLB 2ZUXA 3H9YA 3O6ML 5T33L 1NSNL 3M8OL 3RX7A 5F6IB 5FDWB 4RDQF 3RHWF 4FP8H 4JQXC 4Y4FB 5I1KH 3DRTA 3D3VE 1F5WA 1I8MA 5C0NC 2X09A 4WGVB 2L0DA 2OR7A 3FO2B 4TSBH 1QSEE 4R2GB 2PYEE 1A14L 2QSQA 5I8KH 4QY8B 1CLOL 1RIUL 5D5MA 2VIRB 3TNMB 3BQUA 4RBPH 3WKML 2P8PB 4U05A 5I17A 5HHQB 4X6CE 1NUFA 3OAUL 1CFNB 1QO3B 3ZT6A 2GJZB 4L4TA 3BZFB 4QXUL 4X7SL 2WSKA 4PTUB 1N64H 5AWNL 4XVJH 4TSCH 1R0AL 4HS8H 2Y07H 1JFQL 3D3VD 1EEYB 4KU1A 2DBLL 5CD5C 1QSED 2PYED 2NW2A 3TESA 5LWYL 4ZPVA 3WJLC 4KDTA 3GMNA 2B1HL 2OI9B 3W5NA 4JY4A 3QUKA 2KQMA 5I16B 4H88H 4NIKB 5DJYA 5ICXB 5CGTA 4WHYG 4WW1B 1KTKE 4IRJA 3THML 3MNWA 3ILQD 2D03L 2Z31C 4UU9B 5HHOA 5CJQL 2EYSA 3EBAA 1PSKH 3BGAA 3RZCC 4OZ4A 1S5HA 5KVEH 5IHBA 1C5CL 3FB8A 4PG9B 4KHXL 1AR1C 3P77A 2NY1D 3T0AA 3GI9L 3UROR 1JMZA 3KXFB 2GJ6E 3H6JA 3O4LA 1JWSB 5T5FH 2G60L 4XCCL 4I0PC 1ETZB 4WHTA 1CU4H 1UXSA 4P23B 3NABH 4LQ1A 2PTTA 1R3HA 3QI9B 1B4RA 4XHJC 4F2MB 3JUYA 1PG7X 3V6BR 1N0XH 2MPAH 2FR4B 3ZE2E 4S1SH 2Z35A 5IR1B 1X5XA 5ESVB 3B6SB 1MCLA 2GJ6D 4PJAF 4G8IB 5HYSG 3BAEH 3LHPL 4MX7B 4KZDL 1MJUH 4KAQH 4O4YL 5DJDB 4HLZH 4X5WB 1MRCH 3WFEL 2FB4L 3B5GA 1ZSDB 1T1XA 4WO4B 4ZUUA 1FNGB 3QO1B 1F4HA 5DJ6B 3UZQA 1JNHB 5L88L 4PLNC 2VITA 4LLAA 5ITBH 4N0UB 5C07A 1NGQH 3EOTL 4J3VA 4U1SA 4AH2A 1NBYA 5DVLA 2IEPA 3NACL 2YR3A 1YMME 3FL7A 4TOYL 2FH8A 1LO3H 5D8JH 1FVEA 4KJPD 2P48B 3E6FA 2MOVA 5CJ8A 3EYVB 2YPVH 4FZ8H 5SX4I 4JHWL 3S7GA 3BZ4B 3AS0A 4LLUA 3MCKB 4FP8L 1LE5A 5I1KL 5IWLA 4APQB 4UINH 1QBLH 1AHWC 3T2NL 1I7ZA 1RIVL 5JOPE 1OW0A 5IB5B 2WQ8A 3BVNA 2ADJB 4NKIH 1NBVH 3QISA 5E03A 3KLDA 4NKDA 2ICES 2YPKB 2XKSA 3C8HA 5E1HB 4RBPK 1MCPH 2NTFB 5HHVH 5L2KE 3RGHA 4BSWA 4FQLL 4XVTL 4Q9CA 4YE4H 4Z7WE 1N64L 3IF1A 3DLQR 4XVJL 1MFNA 1RJYB 2DQUL 2RJMA 4TSCL 5FM4A 1Q9KA 3V5HA 2BDNH 2Y07L 5HBBA 3UPRA 1CFTA 3H9HB 4NO3B 4I13B 3EIFA 5JOPD 1CS6A 3UTZA 2F8OA 2NCMA 4C56E 2AEWA 5I1GH 3ABZA 4BZ2H 4AZ8A 1N7ML 4H88L 2E9WA 4GBXA 2Z92A 4CJ1A 1TVBB 3BW9B 2EDXA 2DWDA 1ADQH 2A73B 3O2WL 5L2KD 1L6ZA 1OY3B 1AGEB 1V3MA 1CFBA 4ZDHB 4TNVK 1OTTD 2O5ZH 1WEJH 4PJFB 4ZUVB 5KVEL 1OL0A 1X5FA 2APBA 3Q6GH 4J8RA 5T1LD 5IV2A 1MCDA 4EVNB 1S9XA 1MRDH 1VDGA 5CGYD 5HYFA 5T5FL 4C56D 1HK6A 1IEAB 3RX8A 4DEPB 1K2DA 5GRVK 3WIHH 5ICYA 4UUJB 5DSCB 2D7TH 1CU4L 5DFVC 1CXKA 1BEYH 2HT4D 3OJVC 3QPQD 5DEFB 4XP1L 1P6FA 5IW3A 3VXOA 4PJDA 4M6AA 4JAMA 4B53A 4F7CB 1EO8H 1N0XL 4LIQE 3ARYA 3HRPA 5TQ2H 3OB8A 3KPRE 1I9IH 2G5RA 3FOMA 1T80A 1JPGA 4HXAH 4PGBA 3TJHC 3OKEA 2AK4E 3BAEL 5IB4B 2J8UA 2VLME 5JXEA 1MJUL 4KAQL 2VH5H 3QP3A 5HVHC 3H9SA 3TVMA 6FABL 2WP3T 3G6JA 3ZSTA 1PG7W 3NA4A 3F12A 1U3HB 5ITBL 3O3DB 2ZSWB 3NFSH 3P11L 5DGQA 3IB4A 1NGXB 1AD0B 1P4IH 3MRHB 2D7QA 1KIPA 3CCHB 5DMIL 3KPRD 5A2JH 4PRIB 2AKRB 3K8LA 4Q9QL 1FFNA 2YKLH 1NMAH 3DO7B 5IF0A 5J1AB 4KDVA 4PJXF 2BVEA 2AK4D 3ARDD 3LN5A 5E2WL 2VLMD 4FZ8L 4YDIH 2HP4A 4M6MH 3QAZB 4Y5YB 5CP3H 1CBVL 4PRBB 3MV8B 2VAAA 1QBLL 1QR1A 3ILQC 3HFMH 4MDIB 5FA4B 4NKIL 3V9FA 3KPTA 4G6FB 1ZT4A 4YHIA 2K7PA 2EC9U 3DIFB 1MCPL 4P2QA 3QIBD 1RVFH 2R2BA 2VUOA 5HHVL 2NY1C 3LB6D 1KJ2L 4Q6IC 1UB6A 1FNSH 4MAYA 2XZQH 3HHRB 3CUPB 4YE4L 2BSTB 3PF2A 4MDJB 2HJLA 3KHQA 2BDNL 4PJHF 3BKCH 5EZLB 4C4KT 1FO0H 4O51A 4RMRA 5IVXE 3MJGX 3PIQB 2R2EB 1HNFA 1IRAY 1P9MC 2QSCH 1QFPA 4NKOA 5I1GL 2QQKH 4BZ2L 2C3WA 4I0KA 3OV6A 2Y6SD 3QB7C 3W11D 4H0HB 2DMBA 2GI7A 1MCWM 1YEKH 4URTB 1FNHA 4HFUH 2UWEF 1MCQA 1WTGT 2G5BB 4LKCA 2JJUA 3S96B 1AJ7L 2O5ZL 1WEJL 5F96H 4KV5E 1F42A 2C3VB 2ZCHH 5LXGH 1VSCA 1J0IA 3Q6GL 5IBUG 2R4RH 1QFWH 4HUWA 1IAOB 1MRDL 2ZOLA 3QHTC 2X4OA 1YY9D 2RGSA 5KSAA 5FXCH 3BMWA 1MJ8H 3F7QA 3BI9X 1LO5B 1F02I 1UZ8B 3G6DH 5GSVB 3WIHL 3GSUB 2YK1L 3TO4C 3VI4F 3MZTA 1D5ZA 2R15A 1JF1B 1ZWIB 2K7QA 4KJPC 1YMMB 3T77B 2RIKA 1KJ2A 4EUPG 3RVXD 1MFCH 3IDNB 1ZLWH 4Y2DA 1JWMB 1EO8L 3LKSA 3QYCA 5EU5A 4OF0A 5EIQA 2ERJC 1HH6A 5TQ2L 3R8QA 3SCMA 3HR6A 4Z7VA 3QDME 3Q6FA 4JFFE 4YHZH 2A9NL 3U1SH 4RSVA 1Z9SA 5CIPH 3R0MA 4GG8B 1J1PH 1FC1A 4JM2A 4S1QH 2VH5L 2YD5A 3STLA 1U95A 1D9KB 3DVFA 1I1AC 3IDMA 1MVFA 4LPTA 3HC4H 4MS8D 3TFKC 4KMLB 3GIVA 3MRMB 3NFSL 4WV1B 3QQ3A 2X1PA 3C6SA 2YPLB 3V8CA 3TT1H 3PXJA 4AM0A 4M3JA 4Z7WB 3JWOC 1JHTB 4IS6B 2C5DC 4NQDB 1C5DB 2BJMH 3CH1A 4C59B 2YKLL 4JFFD 1DBJL 5CWSB 4YHNB 4K3DL 1RFDH 4WEMB 4QXGL 4YDIL 3RJQB 2NY4C 3H7BB 4XI5D 1X5AA 3WIHA 3VRJA 1FRGH 5IBLD 3RIFK 5HI3D 3HFML 2X70A 3IDGB 1OGTA 4KRPD 4BKLA 1T5WA 1D6VH 2Q3AA 4NPYB 3CFEB 4P3CL 3JV4B 1OTTC 2M2DA 1UQSA 1N5AB 3HCVA 3CFKA 4P4KA 4MQSB 2FNBA 5J57B 4UILH 1RVFL 1WBXA 1CF8H 5D2LF 1EHXA 1FFOA 1JZ2A 1FNSL 4NUJB 2B5IC 3KPMA 2GSIB 2XWTA 1CD8A 4RFEB 3E2HC 1S7RB 3WO4C 4ZTPL 3TH2T 5DMKA 4Z7OE 3NMEA 1R24B 3QUXD 3BKCL 3QFJA 1A6PA 3QPQC 2PO6B 1FO0L 2X4QB 1G9MH 3IT8D 2VXVL 5T1KD 4IOIA 3F7PC 4JN1H 2FX9H 1XGTA 3OXSA 2QSCL 4OJFH 4YIQB 2UVFA 3QDJA 2EIEA 5FA3A 1RMFH 2QQKL 5KSVA 5D6CA 1TJGH 4C54A 2E8YA 2ZCLL 1T03H 1U3ZA 1VHPA 3FFCD 1YEKL 1E28B 1OTUD 4Y5VB 4M7LH 1T20A 1ZA6A 2QHLA 2P1YA 1CFQA 3C6LD 5GGRY 3RTQD 5CSZA 3ULSB 2VQTA 2Y7QA 5ITFA 4R6UA 3O0RH 4IOSD 5E00A 5EUOE 5F96L 3RL2B 1BQHG 3SGJA 4FQXB 4KZEL 3TN0D 1KULA 5LXGL 5CP3A 4ODWA 4X4YA 2AJZB 2R4RL 1QFWL 4P5TC 3WV0A 4OZHA 3D18A 4LVNC 2OQJA 4HZAA 3V5KB 2H8PA 2VL5A 3G6DL 3ZE1E 2EKSB 1KPUA 4KKBC 2HFGH 4XAKE 1VPOH 2OJEB 1ZLWK 2DL9A 2HYMA 4FQJH 3DO3A 4QHLA 5IHZB 4U1LA 3RGVA 4OKVB 2KBGA 3P0YH 2CKBL 4JDVA 4UDUA 1TNNA 2F74B 4HGWB 5BRZD 4J3XA 5F7WC 2GFBB 4X7DC 5E5MB 2IH3A 1FO0A 1NC2B 2W0FB 4YHZL 4M03A 3U1SL 1IGYB 3W9DA 1KB9K 3Q5OA 1J1PL 3NCFB 3G9AB 1BZ7B 2MJWA 2OCFD 2X6MA 4WJ5A 3PJSB 2BOBB 3PNWA 2SEBB 3QIBC 3SDAD 3HC4L 1AQKH 1NGYB 5D5MF 1WWAX 3IJYA 4XAKD 2QQNH 3HRZB 3BESR 4M6NH 1FVCA 5D4QA 3E3QC 2ZCKH 2CDEA 3RVTC 3RWFA 3G5XA 3TT1L 3KWWB 4QOKA 4R4BB 5CJBA 1F3DH 4TUOA 5DQJA 2K1MA 2BY2A 1NLDH 5F72S 1T21B 4YZFE 5FUCE 1QRNE 1CWVA 1T1WB 4JEGB 2Y6SC 2WZPD 4YFLF 1FZMA 2COQA 3W11C 2P7TB 5HYSA 4DGYH 4EXKA 1FRGL 2GSGB 3SJVE 2EYRB 1QRKA 2VLRA 3PWLA 5JLZA 3DMMB 1ZHKA 4I3SH 4JRYD 1T7YA 4ZSOB 1NMCB 2VN7A 4KK5D 4M02A 4L8SC 1EXUB 1AKJB 5DJCA 2AJVH 4PJBA 4UILL 3VG9B 4EDWH 2ZUQB 1SYSB 2CKBA 1CF8L 4R90L 5HY9A 3DRQB 5HDLA 4QHNA 1PG7H 3NIFF 5D1XD 1QRND 4CMMB 2P5EE 5CIPA 1KPVB 4U1NA 3Q5TA 3AREA 4O58L 4R3SB 3HUJA 2NXZB 4DN4H 1F4WH 1AD9B 2ORBH 3ME0A 5KSUB 4HSQA 3NIGE 4U2YA 3MRLA 1G9ML 3ARGD 3SJVD 3HE7B 4JN1L 3VDAA 4RMUA 4OJFL 3V5DB 3FO9B 2MKLC 4F57L 5HDQH 3QRFM 1ND0A 1RMFL 5GS0D 4QTHA 3BUYA 5FB8A 4XVSH 4NRYA 4MB5A 3SE9H 1T83C 4L8BA 4M7LL 4EN3D 2AI0L 4UQ3B 4FQPA 1BFTA 1TTUA 1G7QA 5F7KC 1TZIA 4LPVA 3B2VH 3OJ2C 3QDMB 3J7HA 3JTTB 3BJLA 2P5ED 5EA0H 3CX5J 4PJAB 4HV8B 1NGPH 2FWOB 1NEZB 5ESAB 1IC5H 3D39D 3MLSH 4MS8C 1G7JB 5HHMB 3PWVA 4NM4H 3ZKND 3HAEH 2H32B 3KLAB 2C1OB 1M71A 5TPWL 4XNQA 1XF5A 2IPTH 1M6OB 3FRPA 4U7KA 4KVCH 4X4ME 3TH4T 2VDRH 5F3HB 4LLQA 2DI9A 2HFGL 2OMBA 4DVRH 1K3ZA 4XNZB 4WFEE 2XQBL 3DVGB 3GSOA 1IKFL 5IHUH 3JWOH 1ORQA 5CEYA 4XB8A 4H26B 3P0YL 1E4KA 4XI5C 1E4JA 4HZLA 4NM8L 3GKWL 4I48B 3BKYH 3FO0L 1JGEB 1UKQA 3OR6A 3UBXA 2WAHA 2Z8WC 3OR7A 5A43C 1BVKA 1OLZA 5CLTA 3VFSA 1B88A 5GGUA 4MJIA 1J5OH 4LEOA 4PBXA 2LU7A 1KPRA 3FQWA 1GZQA 5D93C 2ARJA 5DA4A 1YY8B 4H1LB 2I9LA 1H0DB 2VLJA 2QQNL 4U1GB 1HEZA 3AY4C 4WFED 2ZCKL 3ULVC 2IBZY 4DK3A 3RWDB 1GPOH 3DX8A 3F7YA 2ILLA 4P59H 5I73C 4N9GB 1EHLH 1KT2B 3QUXC 1Q0XH 4MD5B 3ROOA 3T0EE 5C09A 1KLGB 1DQLH 3MFFA 5CMAB 4UTAH 5L9DH 3NFPB 3TPUA 4ODVL 3UDWC 1T3FA 1CR9H 4CDHA 4U6XB 1OP9A 15C8L 1S5IL 3PWUA 1U91B 2W60A 4GLRI 1FYTE 4YBQC 2Y25A 3WDIA 2DIAA 4EXPX 4W68A 4CU7A 1OAXL 4RCAA 4DGYL 1WISA 4NRXB 1OTUC 2E7LC 2VR4A 1FIGH 2CRZA 3C6LC 3IXTB 1P53A 1A7RL 5KN5B 4FRWA 4LFHD 4ETQB 3PDOA 2P5WA 4I3SL 4ISVB 5E6IC 2ED8A 2A0LD 3SE4C 1CDCA 2GAZB 2AJVL 4CVZA 5K59F 1HQRB 1YYLL 2A6DB 5IEHA 4EDWL 3T0ED 4QCIA 4XXCA 1F3JB 2FZ3B 3AB0B 3LEXB 3FCTA 3BHBB 4JG1H 4RRPG 1ZV5A 4X4ZA 5FOJA 1FYTD 1YA5A 2FGZA 3CDFA 4I18A 2ID5A 4DN4L 1PKQE 2VISA 2ORBL 5L7XL 5DUML 3BP7A 4Z0XA 3MUJA 4JPWH 2PYFB 4PRPB 4LP4A 5HDQL 2AQ2A 5I2IA 3SE9L 1FHGA 4QRUA 5I1CH 3K0WA 4F7EA 3MO1A 1NJ9A 3FOLA 3B2VL 1KB5H 3RKPA 3BZEB 1G7PA 1K8IB 3O3AB 3JVGC 5EA0L 2MNUA 4KUZL 4HIJB 3SDAC 1MQKL 1IC5L 3MLSL 1IAMA 2FO4A 2J8UF 5T3ZE 4W81A 2ESVB 4NM4L 3PWJA 1DJSA 3QEQB 3S3SA 5L8JB 3MRIA 2IPTL 2W0PA 4P57B 3U0TA 1XR9B 3G5YB 3G6JF 3OKOA 4LLDB 2EIDA 4KVCL 1LHZA 1B0GB 3QEHB 2W0LA 1GGTA 5MEQB 4DVRL 3V52H 4PYGA 4PV8A 5F21B 4DZBB 4WU7A 1MF2H 4G8GB 4X7TA 5DVNA 4TNVF 3OKDB 2HT2D 1ZHBA 4WUKL 3L5WA 5T1MA 1HH9B 4RQQA 5GGRB 3QHFH 2GK0B 1G9NH 1TNMA 3VWJA 4L1DA 5T3ZD 2NZ9C 1IAKA 2BCKB 1R5IA 1AIFA 3JV6A 4KK5C 4PY8I 4HBCH 2R9HD 1J5OL 1QFHA 3VXPB 4IMKC 4CVWA 1RU9L 3QXVA 1MCBA 4BFIB 1TPXB 3L6FB 5EO0A 4K2UL 5FUCC 1HHJB 1DFBH 2X41A 5D1XC 3FN9A 1NBZB 1CG9A 1E6OH 4PJ8A 5D1ZD 1T7ZA 1GPOL 4EUPA 4P59L 5ID1A 5J7CC 2J3SA 5K9KA 1Q0XL 4LLMB 5HGBB 5EUKA 2QEJA 4U7SA 3W82A 2A83A 1DQLL 3KPOB 2J8HA 4O5LH 2V2XA 5L9DL 1FJ1B 4YDLB 3C2AH 1DBAL 3HAEA 4HJGA 4PJHB 2CPCA 1RJZA 1V7MH 4KTDH 4N0FB 3LD8B 3X11A 1I85A 43C9A 1FIGL 3VD4A 4GW5A 1BBJA 3UCRA 1OGAE 3IJSA 1MPAH 5ENWA 4J7RA 1QOKA 3ARVA 3CIQA 2UWEB 3C5SA 1XZ0B 5JOFB 4BZYA 1QR4A 4EEEA 3AXLB 4KROC 1BZ9B 3LY6A 3VE0A 2A9MH 2GUOA 2QLVB 3ZKNC 4NHCH 3S35X 2XTLA 1E4XI 4ZUTA 4JG1L 2IALA 2XG5A 4BYHA 1KCUH 2F53E 2VSCA 3GKZA 3VD5A 5DJXA 4GXUN 2IFFH 2VR5A 4UT9H 3PL6A 3BIBX 3K2UH 2CSPA 1IGCH 2I25N 2DQEL 1HXMB 2PCPB 4PJGE 3ARRA 3OPZH 4DZ8B 4AY0A 3MNVA 1OAKL 3ARBD 5I1CL 1RUAH 3I02B 1UJTA 4YR6A 2DYPA 4MCZB 2VZSA 3QA3A 4R0LC 4YHKL 1XMWA 4ODUA 5C71A 3OGOE 1MIEL 1TJIH 5CZVH 1A9EB 4Q9RH 3U83A 2IH1B 3DWTA 1F97A 3SPVB 4Z7VF 2F53D 2P8LB 3AAZB 4DQOL 5KVMC 3SGKC 4GO6B 2NY6D 2JELL 2D31B 4JM2F 4LK4A 1NUNB 2EDOA 1AI1H 3MV9A 3VWKD 1DN0B 4ZODA 2V2TB 3O2DH 4P2YA 4WCYH 5DUBA 1CE1L 1SY6L 3BPCB 3UPAA 2AXGB 2XWBA 1TCRA 4BH8A 3L3JB 3V52L 3ULVH 3S8WA 4J3SA 4F15C 3O3BB 1MF2L 1MLBB 2DTSA 3FHAA 3EW3B 2GY7B 4JZOB 1VADB 2EDYA 4JB9H 5L2JB 1Z0NA 4WW2B 2N7BA 1HINH 3WIFA 4Y5XC 3NIDE 1G9NL 3RY6C 5C0JB 5FGBC 1P7QB 1QA9A 2VLLB 4GG6E 4MD4B 1RJCA 3MRNA 3AROA 4DFHA 2X4PB 1NFDA 2A0LC 5F88B 5SX4H 3WHXA 2RR3A 2IPKB 4HBCL 4ODXA 4CADA 3QJHB 4LLWA 3T0EC 5LKNA 5EN2B 4NZUH 1T66D 4HX1B 3VFGH 1YC8A 1G7IB 3LEVL 5GJSH 1OM3H 2VR9A 3RDTB 1K4CB 3VXRB 1DFBL 2AABH 3OJDB 5F89B 3NCCB 5EB9A 4XAWH 4QTIH 1UJ3B 4JREB 3ZKXB 5FKAB 2H1PH 1ZLVK 1XF3B 3C2AL 3VFPA 3BD5A 3BGFB 5CBEB 3LAFA 1KJMA 2W38A 4NQCA 3IDYB 5EIIA 5CD3B 5DA0B 3IAQA 3F6LA 2FHFA 3T65B 6CGTA 4PJCB 4KTDL 1SY6A 5BV7B 2CUIA 1IARB 3UO1H 1HILB 2DM2A 4KI5F 3JWDH 3DYMA 1MPAL 5B4MD 3B83A 1UEMA 5C0CB 2APFA 4DAGH 4UQ2A 1JL8A 5EOCJ 4W6XB 3ES6A 2J5LC 4Y0GA 2D7MA 1RZGA 4JKMA 2A9ML 1U8NA 3L9RB 5AG8A 1X7QA 5I6XC 1HSAA 4LF3A 1QLFB 1R3LB 3VI3E 1IQWL 1OSPH 1YEEH 3ZKMC 3DV6A 1AGBB 4TSAL 3MOAH 1DQJB 4G9FA 1WFNA 5F6IC 4L5FL 4OZHF 4PREB 3QO0B 4UT9L 4Y4FC 1PBYA 1UM6L 3K2UL 1IGCL 4P5MA 4R2GC 4KDWA 2R4SH 5BXFB 3WLBB 3P3YA 3OPZL 1OB1B 3MUY1 1FC2D 5GGSB 2J88H 3ZL4H 1SBBA 5SWSB 2GW5A 1A2YB 1RUAL 4O2EA 2H26A 2C7UB 3RL1A 2R0ZL 1Z9LA 3LQMA 3QXAB 2R23A 3HNVH 4MQ7B 2HTKC 2Q7NA 1RZ8B 5CZVL 1BIIB 1IC4L 3MA9H 4B41A 5CJOH 2R1XA 4UOJA 4GRWH 3PGCB 1N2RA 4OLZH 1I8MB 2YSSB 4P9HC 4P2OB 2XI9A 4G8EA 2WBJD 4W4OC 1GSMA 1YN7A 1AI1L 2CLRA 5FYKH 4MNQE 5GHWH 4Z18A 5JW3L 3CSYB 3O2DL 5D5MB 1RUKL 3MRRA 3KPSE 3DI2B 3WEXB 3BKMH 4ZO6A 4EI5A 2NY2B 2NXYD 5EFIB 2J6EH 3OX8A 3FT4B 5I17B 1F90H 2LU4A 4ZOEA 4NYLA 3ORJA 3VD9A 3GMRA 1PJ9A 1ZLSH 5FIEA 4L4TB 5FK9B 3CPLA 3FTGB 5CZXD 3GMLA 4LSRH 1HINL 3B4NA 1H15A 3PGFH 4IRZL 1OAUH 4XPHL 4P2RB 5HYQB 3SKNB 2NW2B 4MNQD 1S7SA 1Z0MA 2PXYA 2CR6A 1OGAB 3TYGH 1FN4B 4JFDA 5JO5A 3KPSD 3GMNB 3HN3A 3QUKB 1UM5H 5DJYB 5TJWK 1UZ6E 4L9LA 1RHFA 2VDQH 3CVIL 3EOBA 4P23C 4IRJB 4CRPA 4OCNC 3MNWB 5GJSL 1OM3L 3QI9C 3VW3H 4HWBH 25C8H 4PJBF 4E41E 4N5UA 2AJ3B 4P0DA 4YHMH 3RWGB 3X3GL 2E27L 5ADOH 4WTWA 3BPNB 4OZ4B 4WTZA 4XAWL 1XGYH 5I74B 1KC5L 4X4XA 2YS4A 3T4AB 3FB8B 2H1PL 3RWJA 1JE6A 3GJFH 3HUJF 3I85A 1OSZB 2FJGA 3V4PH 3O4LB 3GSQA 1FH5L 4J3UA 2BK8A 1MCOH 3ARZA 3O2DA 3QULA 3U7AA 1FL5A 3LMJH 2IQAB 2F54E 4C57C 5IKCA 4WHTB 1CE6A 2EDHA 1FZOA 4FOMA 4PJEA 1EMTH 1UXSB 4WI5A 3UO1L 1L7TH 2PTTB 3AVEA 4WO4C 5IVNA 1A6VL 2BOCB 5EU3A 5TF0A 2XOTA 2QKIA 1BFVL 3RUGE 2ICWA 3ZDZE 4DAGL 3ULUE 1RURL 3LQAH 1F11A 5KJRL 2A1WH 5EZIH 3BWAB 5F1OB 5CEZH 2K9UA 5DZOA 4I8DA 1YEEL 2OK0H 1MI5E 3MOAL 1JZ6A 5IFJA 2X7LB 1CD0A 3GGWB 4Z8FH 1T1XB 4ZUUB 4APQC 2HT3D 1Y18A 2XZAL 4OIIH 2R4SL 3ZDXE 1P2CB 2DQJL 2WIMA 1EAJA 5EO9B 3ULUD 3ZL4L 1WZMA 1NBYB 4XCNA 2RHEA 1HE7A 5FYLE 5C70A 1J1XH 1IEBA 3E6FB 3HNVL 2O61B 4LARH 3H42L 2I9TA 4ZFZA 3ISWA 1MI5D 3MA9L 4Q7DA 1TQBC 3SDXE 5CJOL 4NBXB 1HOCA 1YEFH 1H3WM 1RUQH 3C8KB 4S10A 4JFOA 2NX5A 1LE5B 4OLZL 1U8OB 1T66C 3HZMB 4WI6A 3V6FA 1QBML 4Z7UB 4QKXB 3CNKA 5GHWL 3BVNB 3OQ3B 1MUJA 1EVTC 5F7DB 3BKML 1XIWB 3BO8B 1NKOA 1QVOA 2J6EL 1UEYA 5K9QG 3QFDA 4JVPA 5FYLD 2B1AH 2VZVA 3F5WA 3HNSH 4NO2B 4GMSH 4AG4H 2A6IB 1ZLSL 5AAMA 4IMLA 4LSRL 1UG9A 3CAFA 1A7OH 4CDGC 4OD2A 3TZVD 1OAUL 3UPRB 3SDYH 1CFTB 1ZLUH 4QRRE 4JHAH 4LCYA 4WENB 5HPOA 4KHTL 2NQCA 4DWHA 1FFRA 4Q0XH 4HUKB 1AO7E 4MD0A 4P49A 3TYGL 3VFRB 3BDBA 4Y4KA 5F3BB 4WWKA 4ELKA 3PV6A 2VDQL 2EE6A 2Z92B 1I3GH 3D69A 3TYFB 3VW3L 4HWBL 3NZHH 1DANT 3CDGA 1EH9A 4LCCA 1C1EH 5ADOL 5E95B 1PLGL 4J2XA 1XGYL 3NVQA 4KKCD 1YMHA 4HCRH 1OVZA 3GJFK 2I5YL 1S9XB 4ZQKB 4CMHB 3EUUA 3V4PL 2EDBA 5E8PA 3LKPA 1AO7D 1MCOL 2JCCA 4LHUD 4X9FA 4LCWE 3T1FA 5ICYB 3N85L 1MAKA 4H5SA 1EMTL 3EDEA 5DURD 1QUNA 1H3PH 2J6EA 1L7TL 1RZ7L 1N6UA 3FT2A 3VMOA 5GGQH 5C0IB 3D25A 4KC3B 2WUCL 4Z78B 4Z76A 4JAMB 1Z3GL 4JFEA 3LQAL 2MCG1 3FQTB 3LN4A 2H9GA 5GZOD 4KTEH 5EZIL 3VG0L 3ARFD 3ARQA 5CEZL 4JDTH 3IYLW 4PGBB 2DQTH 4G7VH 4YDVA 4PJ5D 3HMWH 2HJFB 2GEEA 4P9HH 1K5NA 4PY7B 4LCWD 1JZ5A 2NXYC 4OFYD 3FO1A 4Y5YC 3QAZC 4Z8FL 3H9SB 3TVMB 1KEGH 1JNLH 4OIIL 5TDPA 1MQ8A 1X5YA 4LLYB 3CFIC 3ZYJA 4OFPA 4HWBA 4ZNEA 4KRLB 3B9KB 5E8DH 1A6TA 1T2JA 4PRDA 4TVPH 5CHNB 4Y16B 1DE4B 1GZPA 4NKMB 4OAWA 1J1XL 4LARL 1DEEB 3UJJL 5EBLA 1P6AB 3GJFA 3PHQA 3TEUA 1J9CT 3LN5B 1LO2H 1CD9B 2GKIA 1YEFL 2XY2A 5FUOL 2E9JA 2X4UA 1D5IH 2VAAB 3QUZD 3U9PH 4PJ7B 4HEPG 5TE4H 5I1DB 4GAGH 5MEPA 2CK2A 1KTRL 4KH2A 4PP1C 1JCKA 3CLEH 1Y6NR 1PW3A 4LMQE 1IM9D 5FYJH 1MCSA 3ILPB 4P2QB 2VTFA 3QDGA 1K6QL 3MC0A 4JRXE 1A6UH 2B1AL 3HNSL 5J11B 1F00I 4GMSL 1UB6B 3R1GH 1J8HE 4MAYB 4HMCA 5J56B 5D7KE 2MTPA 4R96A 2ITCA 4HWEH 2KUTA 1C7SA 3KYOA 3S35H 2NR6D 1ZLUK 2EDJA 3QZWG 2F54B 4O51B 5I1AA 4JHAL 5D72L 2K3TA 1SJXA 3CX2A 3MR9A 4OCRL 4NKOB 1P4LA 5I66B 5MEOA 2IPUK 4MXWH 3AMLA 4N0YL 4EJ1C 1KUMA 5KSBA 3OG4B 1I3GL 2VDPH 2XKNA 3KHOA 1J8HD 3NZHL 1W72L 2BMKB 5D7KD 1C1EL 3NPSB 5HHPB 5T3XH 3P73A 2HT3C 3SO3B 4G6JH 4HUWB 2ZOLB 2X4OB 2ZOKA 3VFUB 1WZ1H 4OZGA 4LRNH 1YEIL 5E4EB 1Q9LA 4FABH 1U8IB 5JA8B 3IETB 1D5MB 4JPIA 1HCFX 1D9KC 4FHBD 1FZKA 4TUJA 4BZ1H 1H3PL 2OTUB 1ITBB 2EDDA 2XPGB 4K7PH 43CAA 1O7SA 3U36B 5DDHA 1KJ2B 4XP6H 4X6EA 5IB1A 1MCNA 4ZFGL 1LP9A 2YXFA 3IU4H 3PGDB 4PJ9D 4YFDB 5A40E 4X6BB 2BSRA 1QLRB 3SCMB 4Z7VB 3Q6FB 5F9DC 4JDTL 3VFNA 3IFOB 2DQTL 4G7VL 1A7QH 3IVKA 1HN1A 4OLYH 1NGZB 5DK2B 1YEDA 4JM2B 4N1EA 2DQGH 2G9HA 4RMWA 3S88H 2YD7A 2GITB 3STLB 4RX4D 4ACPA 1U95B 4NQEE 5C0RH 3AGVA 3IDMB 3EDJA 1DBKH 2FEDC 5DJ8A 4AQOA 4GFTB 4UV7H 1AGFB 3BH9B 2IG2L 3GIVB 3C6SB 1W72A 5E8DL 4QRPE 1FVDA 1HWGB 3D1MC 1UCBH 3TZVC 5I30L 4JQIH 4K8RD 2KDGA 2NY0B 2FJHA 1ZK9A 2NY5H 1QP1A 3BZDA 3GSRA 4YUEH 5J8OA 2L7JA 1XF2B 4QRRB 3FFDA 1BLNA 3OKLA 1LO2L 2ZUSA 1VACB 2XWJA 5FYKU 3VRJB 1NFDF 3FO2A 4NN6B 3F58H 1LEGB 1C16B 2X70B 4K71B 1OGTB 4XWGH 4BKLB 5ICZA 4QY8A 1T5WB 3O8XD 2VIRA 2P44B 3TNMA 4OUUB 4QRPD 4LGRB 4R97B 5FYJL 4KKCC 5FM5M 5IJVA 3MOQA 5ID0A 1YEGH 3RU8H 4Y5VC 3QIUD 3RP1A 5D6DA 3KPMB 4FA8A 1UACH 2GJZA 3BZFA 5AG9A 4OB5L 3NGBB 3DECA 4HWEL 3HE6D 2DKUA 2VDKH 1NCTA 5DMKB 5DS8B 5JW4M 1EEYA 4RWYL 1DUYB 7CGTA 2HWZH 4OFKA 4IOIB 4M4PA 4X6DB 3U48A 3OXSB 5JIKA 4GLRH 3JZ7A 3WFCH 4L3EE 3UTOA 5KSVB 4MXWL 2CH8A 2DBJA 5D6CB 1U3YA 1VB9A 3QNZB 1MHHA 1GGCL 5GZOC 1A3LL 3S37X 4PRNA 2Q20A 4WW1A 1FGNH 5CJXC 3ARFC 1ZA6B 2HRLA 4NRZA 1R3JA 2VDPL 4UU9A 5CSZB 2YBRB 1BBDH 2Y7QB 4GW4B 5DZNA 5ITFB 2KZWA 7FABH 1XCQA 5E00B 5J89A 1KSRA 2EC8A 2JB5H 3DHMA 4XRCB 3I3EA 5T3XL 1HSBB 5C6TL 4JJ5A 1EFXA 4ODWB 4PG9A 4X4YB 4YWGL 3C2SA 4G6JL 4YFLI 5FM8A 3SOBH 2CLZA 1JN6A 4Y1AE 3QQ4A 1WZ1L 1NC4A 4LRNL 2XQYK 3D18B 2NYYD 4OZHB 3V0WL 4FABL 4FTVA 2H8PB 4MLIA 1ETZA 2IAMA 1L9MA 2VC2H 4LU5H 4HUNB 1KPUB 1LK3H 5IBTH 2R1WA 2APXA 1W0YT 1FE8H 4K7PL 3LZFH 1FZJA 1X5GA 5LCVL 3D0LA 4XP6L 5C0BE 4HKZB 4F2MA 3SO5A 3QEQD 1EJ6A 3FB6A 3RGVB 3SDCA 3ECBB 1BPVA 5HPMA 5EC1B 2VLKA 3IU4L 4JDVB 1PYWB 1O7VA 3FZUC 1F3RB 5ESVA 3B6SA 1FQ9C 3FMGH 1XR8B 3QQ9D 2IH3B 4OLEA 1DVFD 4Y1AD 2HFEB 2IANE 4NOFA 3W9DB 4OLYL 2DQGL 3K8KA 2JIXD 3S88L 4D9LL 3BEWA 4ORGB 2XN9B 4X5WA 3WN5A 5C0RL 1KB9J 4N8CH 1JNHA 2WWKO 3IJYB 4JRXB 4UV7L 3TA3B 5DFWH 5DRWA 5C0BD 3QIWB 1T1ZA 5GGVL 1I3RB 3O6LL 1CICD 2DD8H 5D2NA 1UCBL 5LJYH 2FATH 2NR6C 3CXDH 4E9LA 4JQIL 1EPFA 4GJTB 4KKLD 4YUEL 2IAND 3O9WA 3EYVA 1JZ3A 5ELIA 2X05A 5J4MA 1G0DA 3N1MC 3L1OH 4F58H 1X4ZA 4WI4A 5J9PB 1MIMH 1FZMB 1ZT1B 5HYSB 4JFHE 2NXZC 2ZUUA 5IB3A 1ZA3A 3DOSA 3F58L 5IB5A 1EO7A 4XWGL 1MCJA 2VLRB 4HGMA 4PB0H 5JLZB 3PWPE 4N8PA 5ISZE 5HJ3A 2YPKA 5DJCB 4JKLA 3C60D 4PJBB 2NTFA 1P4BL 2A6KB 4IRSB 1YEJH 2CKBB 1JV5A 3SKMB 3H9ZA 1YEGL 3RU8L 2IF7A 3W0WD 4DKDC 4QHNB 3T0DA 2GCYB 3REWA 3IAPA 1UACL 4M1CC 3WFDH 4U1NB 2AQ1A 3AREB 2H2PD 3HUJB 3D0VB 5E8EA 4QHKI 5I1EH 3IRPX 5MERB 3H9HA 4NO3A 1GGBH 4WEBH 4DKEL 3AM8C 2XTJB 4WDIA 1OP5H 4DW2H 4UB0L 4JO4L 3WFCL 5ISZD 1ND0B 2PF6A 5IW6A 3BUYB 1WFTA 1R5WB 1TVDA 4NRYB 3BW9A 2HMIC 2WNGA 4CAGA 3MODL 5HVGB 1AGEA 1FORH 5IVZA 1G7QB 3RI5K 5K9OB 4XNZC 5CLWA 1BBDL 5F7UA 4ZDHA 2JB5L 1E4WH 4NWTL 4XBPB 1TITA 1GOGA 1NCAL 4XNXL 4NQEB 3SOBL 4EVNA 5HD8D 1WT5A 1E4XH 3RVVD 3DVNA 1KGCD 1XF5B 1AGDB 4X5LA 4HK3N 1OPGL 1IEAA 3K4AA 4CNIA 1IC7H 4UUJA 4UDTA 5DSCA 2VC2L 4LU5L 5I19H 2VQUA 4K8RC 4I2XE 5E2VH 1V3JA 5IBTL 1FE8L 3P9MA 5EZOH 3LZFL 3B9DA 5DEFA 1OAZL 1WC7A 2CKNA 2ZG2A 4U1GC 3GSOB 5AYUH 1I7UB 1ORQB 5CEYB 4AEEA 2DMKA 2DIBA 2X4NB 1HYSC 4CW1B 2APWA 4JY5L 3ZE0E 4OD1H 5CJ5A 1NAMB 2WMPA 4YHYC 3FMGL 3D2UB 3D3VA 4NBZB 3ROLA 3RPIA 4X7FC 3O8XC 1QSEA 5IB4A 2PYEA 1YEHH 4J4PD 3LDBC 1BVKB 5DHXB 5GGUB 3EJYD 4NHUA 1GIGH 2EICA 1W8OA 1KPRB 4N8CL 2ARJB 2R39A 3MJ8B 2RFXB 3QIUC 5GS3A 2VLJB 1U3HA 2BHYA 3O3DA 1L0XA 5DVOA 4X6CA 1AD0A 4DTGH 1DEDA 2I60H 3DX8B 2UY7A 3HE6C 4WEUD 3MRHA 1NGWB 4NQXB 4LIQH 3I3DA 2PETA 1N6VA 3ROOB 3CXDL 3CCHA 4CN1A 3MFFB 3K7UA 4FMFA 2AKRA 1DQQA 1ZKAA 2Z93A 3DO7A 1F3DJ 3EFDH 4JZJA 1BF8A 1CTOA 5J1AA 5C3LD 4OF5A 4OV6F 3GSXB 3PWUB 2W60B 3L1OL 3IDIB 1PX3A 1MIML 4L3EB 2W07A 3NTCH 1FPTH 3VXSE 3OXRB 3BXNB 5C08E 5FA4A 5FYJU 4PB0L 2MHAA 3IKKA 3VFWA 5I15H 1CDYA 3DIFA 4CVZB 5IEHB 3L3OA 2B7DT 3GIZL 3D9AH 4Y4HD 5DMJB 1SM3H 4NJ9L 1BQLH 1HHKB 2EO1A 2IBZX 3FCTB 1MCCA 2DJUA 4GRWF 3WFDL 4YAQB 2BSTA 4MDJA 5C0CD 1KG0B 4FFWD 3ARSA 4L29A 4FFVD 1VFAA 1P1ZA 2AGJH 3A67L 1GGBL 3VXSD 3O45A 3PIQA 3MCLL 4WEBL 2JCCF 1GOHA 3BP7B 4Z0XB 1OP5K 4LPCA 4RFOH 1WWBX 2YC1A 5CP7B 4AENA 3GJEB 1T89A 2VXTH 4NN5C 3MRKA 5C0FB 4FFYL 1FNLA 1JGDB 4F7EB 5ANMB 1FORL 2G5BA 1NJ9B 4ZXBD 4E5XA 4PGEB 1RZJC 1G7PB 2LABA 2AV7B 1E4WL 5L6YH 4LKXB 2VQ1A 1IT9H 1CZ8H 5HDOA 1UVQA 4K3JH 5F7LB 4NT6B 1IAOA 3PWJB 1E4XL 4QNPF 3KGRA 3FAXA 5TDOA 3H3PH 1JK8B 4GAFB 4P48A 1LO5A 1UZ8A 5GSVA 1CICC 5GRZA 5C6WH 2JB6A 5E2VL 5I19L 2DQDH 2JJWA 1Q94B 1JF1A 5EZOL 4JFYB 3O6FD 1YMMA 4EOWH 4PV8B 4X7EC 4X7TB 1TPXC 4RNRB 5AYUL 2HRPH 1JWMA 4QRTA 5DXWA 4K3EL 2QR0B 3CGTA 5T1MB 4OD1L 3BQUD 2PTVA 4U1IB 3TBVA 3GUTB 1AR2A 1R5IB 4I3RH 4MXVF 1HKFA 4GG8A 5IBUB 3JV6B 1YEHL 3PWPB 3C60C 4P46D 5B39G 1GIGL 3RNQA 1CK0H 5M95B 2W0KA 4AIZA 3ZZ1A 4WV1A 3LS5L 1CG9B 2E3VA 2Q76B 3MLUH 3C5ZA 1BX2B 2JJSC 2H2PC 3WNLA 4EUPB 5JHDE 4EKXA 5ID1B 5EC2B 4Z7WA 1JHTA 4LIQL 2V9RA 2KL6A 1AP2A 5EORH 1C5DA 3QRGL 2CUMA 3MREA 4XXDB 5CWSA 1IGTA 3N06B 2E8ZA 1RJZB 5HHOD 1EAPB 5J12C 2RAMA 1PZ5A 2BVYA 4C56A 4NOBA 3NTCL 1FPTL 1KCKA 5CAYB 3X11B 2H32H 5D70L 3BT2L 5E08L 1BBJB 2Q8BH 1A4JA 4NZJA 5KSBF 3CFEA 4HIEB 1NAKH 1N5AA 2YA0A 5I15L 3CMGA 2B39A 1QQDA 2VKXA 3LV3B 4HT1H 3VE0B 1TDQA 4FQ1H 1SM3L 5HD8C 3WFHA 3RVVC 2QSVA 2V17H 3X13B 4OD3H 1U92B 4ZUTB 2E6PA 2IALB 1Z2KA 3LIZH 2B20A 2PKDA 2ZKHH 4QHMA 4XBGB 5C07E 3M07A 1R24A 3MUGB 2BRQA 5DJXB 4B0MM 4OZGF 1NMBH 2PO6A 3RHWK 2X4QA 3PL6B 1KN4H 4LFHG 5ALBH 1MOEA 4RFOL 4GRLB 4YIQA 1CGYA 4Y19B 4XZUB 3IFLH 4RGMC 3TCLB 3QUYB 3WD5L 2VXTL 5JORB 5C2BH 1E28A 1Q0YH 1LP9F 4O00A 3WUWG 4ODUB 5CUSH 5E5RB 3KPRA 3ULSA 4HUVA 3U4AA 1L0YA 3RRQA 4J4PC 2AK4A 3ARDA 3BEVB 3EJYC 3MLRH 5BQ7B 4FQXA 5C07D 1JF5A 1H8SA 1QSFE 4K55A 1IT9L 5TE7L 3JV5A 3Q0HA 5IMOB 4S1RH 1Q8MA 3H3PL 3DBXB 1TZGH 4XNYH 5I1IL 5DUBB 1TFHA 3O81A 2EEDA 4JZNB 3O3EB 1DL7L 3MA7B 1TCRB 2MSPA 4UTBH 2DQDL 4BH8B 4FQIH 3RFZC 4HDIB 5D7JB 4JPVL 5GS1B 1A1OB 5JXAH 3Q3GB 3PDDA 2WQRA 3FT3B 2O26U 4PG2A 4OKVA 4ONGL 3I3BA 4HGWA 2F74A 1QSFD 3WIFB 3SN6N 1BQHB 4JREC 3MLWH 3B9VA 1QA9B 3D85B 1NC2A 5E5MA 2W0FA 4DUVA 1H3TA 3GBMH 4I3RL 4LGPB 5C08B 4AT6A 3BGFC 4AEHH 1A5FH 1NFDB 1BZ7A 3BSZH 4ODXB 4LLWB 4NDMB 3EJZD 4NNXA 1CK0L 5J6GA 5AAWA 3DYPA 3VRIB 2M1KA 5A16B 3VCLB 5HVFB 3MLUL 3SE3A 1DSFH 3KWWA 1BD2E 4FFWC 3S9DB 2YD2A 1UM4L 1NKRA 5H94B 1MWAL 4HWZA 5JDJA 1GGIH 4GBXD 2CGRL 1EEQA 2X40A 1KJMB 4M5YH 5DO2C 4NQCB 4PJDE 4XVUC 2DLTA 4NFDA 4LSSL 3EFFA 2P7TA 2X89A 5C0EA 3QXWA 2BRRH 2XXMB 4P4RB 3SY0A 1F6AB 1BFSA 1KEMH 2EYRA 2VAJA 4ZXBC 5E70A 3DMMA 4ZAKB 4LVOB 4ZSOA 1NAKL 4I5BA 2QADB 1EXUA 1BD2D 1WSST 4LL9A 5IQ9B 3ES6B 4HT1L 3FQUB 4YK4B 2NTSP 1MFAH 3DNKA 1BOYA 4FQ1L 1HSAB 3DRQA 1NFIB 1JHLL 5CS7A 4CMMA 1G9EA 1EEUA 1NLBH 3DV6B 5F9OH 4M7ZC 3LIZL 4R3SA 1CXFA 4V1DE 1IKNA 2ZKHL 3DARA 1QHPA 5D1QD 5JZ7D 1AD9A 1A4KA 1NMBL 5KSUA 1SHMA 3HE7A 1MEXH 1KXVC 4P5MB 1UENA 3V5DA 2CLVB 4HGKC 4U1JA 1S7XA 3IFLL 3VGGA 4HQQH 2DLHA 2MCPH 1V5JA 3BQUC 3PV7A 5C2BL 4O2EB 1Q0YL 4UQ3A 2CRIA 1MWAA 3LCYA 1XGUA 1RJLA 4WI9A 4JO3L 3QDMA 1LO4H 4JFFA 2LV4A 3JTTA 4W6WB 1DP0A 1WVZA 1C12B 3MLRL 4V1DD 3RJDA 4PJAA 4HV8A 1DCLA 5ESAA 1A3QA 3TV3H 1G7JA 3EKCA 3IFPB 1ULVA 1N3NB 4G8EB 1TMCB 5GS2H 2N56A 5DR5H 3KLAA 2CLRB 5DVMA 1DUZA 4S1RL 4TTGA 5TH2B 1TZGL 4XNYL 4AIOA 1M6OA 1U58B 1CGTA 1KBGH 4KDTC 4RMQA 4G9DB 4XGZA 4PD4K 5JHDB 3OX8B 4FQIL 5F3HA 4MA8H 4YEFA 5JPNB 1ZHLA 4IRJC 3O6KL 4TYUA 4NYLB 5JXAL 1HZHH 1J0ZA 3PG2A 4H26A 4Z95H 2LTQB 1MAMH 3GMLB 4NC0B 1H15B 2Q3ZA 2EH7L 3UTSE 5D96B 2EH8H 3QWQB 1JGEA 2VO5A 3GBML 3AS3A 4X83A 1UYWH 5T1KA 5BS0E 1S9WA 2OZ4H 1S7SB 2C4FT 4AEHL 2PXYB 4TN9A 4ODTH 3OBAA 4C83B 3MFGB 4JFDB 2H2SC 4TUKH 2DAVA 5I1JL 1J0JA 4ZS7H 2AW2A 4JN2B 3RTQA 2R29H 5GGTH 4RMTA 2MQ0A 3RWDA 3IAGC 4IIQB 1DSFL 5C92A 35C8H 3NA9H 4N9GA 5DC0A 1PX4A 3NCJL 4N0RA 3UTSD 3FQRB 3TN0A 5CMAA 5CEXA 1GGIL 2W9DL 5IHLB 4P5KB 2CRMA 4JO1H 4M5YL 3TWCL 4CN6A 3GSQB 3HPJA 2ZUVA 2BRRL 4QT5A 4XWOD 5F8RC 1CE6B 1FZOB 5D71H 3SBWA 4YNYA 2DM3A 3MCG1 4FFZH 4IHOA 4ETQA 4ISVA 2QKIB 2J4WL 5KSAD 2ICWB 3L5XH 4GQPH 2XICA 2GAZA 2A6DA 3ZO0A 5EUOA 5HI4D 1BQUA 4PR5A 4XP9L 1MFAL 3KPNA 4PLKD 1FV1A 5LQBL 2FZ3A 3Q1SH 2EDWA 3LEXA 1ACZA 2ZJSH 1NLBL 5LGKA 1A6AA 3WUZA 4PRAB 4HMEA 2V5YA 1A7NH 1HIML 3OSKA 4Y2DD 1DQDL 4NO0B 4RGNE 5IWLC 1S7WB 2M8XA 4MCYB 4LDEB 3ESVF 1OW0C 3X3FH 1IFHL 1KCVH 5GS0L 4HUUB 2VWEC 3LEYH 3TM6A 4HQQL 4JM2D 2MCPL 3BYYA 3T0VA 1R3KB 3VXMB 2KH2B 4MMZC 1I9RL 1KENH 2FJFB 4NBYB 1FIEA 3BZEA 2IJ0C 1LO4L 5L0QB 5FO8A 1K8IA 3O3AA 4AMKH 5MP6L 2I9TB 4ZFZB 2D2OA 1J88A 1HHHA 4OLVL 4A2LA 1F13A 3BP4B 4JFOB 3HZVB 5HYJE 1II4E 4RGND 3TV3L 3MROA 5JTWA 1BHGA 1HQ4B 4PJIE 2E7MA 3V6FB 1XAUA 3KYNA 1B4JL 1QPPA 4P57A 1XR9A 5BV7H 4OBSA 4LLDA 4D0CB 2PW2A 1QKZH 1B0GA 1ZT7B 3RWEB 4GUPB 5MEQA 2ATPB 4X6CF 4GBXC 4MA8L 1KLFA 1BP3B 3UZEA 1KTLB 3TT3H 3BPOB 1HZHL 3OKDA 1WBZB 5E9DB 3MBEA 5DJZB 2IFGA 1M7IB 1MAML 5A1AA 1HH9A 4KI5E 4XCYB 4OD2B 4P4KD 2GK0A 5JUEL 2EH8L 3QPXH 4JO2H 4JGMA 4M7JL 3ARGA 1UYWL 4LCYB 3SJVA 4I4WB 4XPTH 1S3KH 4ODTL 4CMHC 4YFEA 3QXUA 4JQVA 4Y4KB 3N9GH 4JG0H 3VXPA 5JOEA 1DBMH 4BFIA 3QFJD 4EN3A 2P4AB 5SX5H 2IBGA 4P3WA 3D69B 1HHJA 4W70A 2R29L 3FRUA 4PRHE 3CDGB 1EZVX 1N59B 1MHPH 3NCEB 3NA9L 2P5EA 3QDJD 1G7MB 5E94B 1I3VA 3AC0A 4KI5D 4LLMA 5JZ7C 1BJMA 2FD6H 5C0AE 4GRWB 1YMHB 3KPOA 3IDXH 5BZWA 4MB3A 1FJ1A 1TTGA 4GS7C 3SHSA 4JO1L 4R26L 2IBBA 5E8PB 3GRWL 3LKPB 1ZEAH 2JCCB 5JXEC 1CFVH 1JHKH 5D7LE 1VEOA 4KK8D 2ENYA 2CK0H 3BPLB 5GRUH 4G3YH 3TVMC 5CD5D 4FFZL 4KKNA 3JUZA 3D25B 3ZE2F 4K7FA 3L5XL 2UWEA 4PRHD 3V0AC 1JPTL 1I1YB 4JFEB 1XZ0A 1Y6MR 2FDBP 3AXLA 3ZYOA 2H9GB 1ZVHA 4OLXH 4KXZI 4YGAB 2P42B 3CFCH 3Q1SL 2Q8AH 2Y06H 3RVUC 2A74A 2Z31D 2ZJSL 1N6QH 1B9ZA 2B4CL 1F2XK 1FAIH 1UT9A 2OZ4A 4K7PY 3TH3T 2W1NA 1WWWX 1A7NL 1WFOA 2ZP0T 5GRYA 4XPGH 1K5NB 5D7LD 2ADGA 4QOKE 3EYFA 4M62H 3SKOB 3CSPA 3BYTA 4DGVL 1BJ8A 4ZFFA 1YJDH 4UOW0 3RWHA 3W2DH 4OGXH 2PCPA 1E6JH 4DZ8A 3LEYL 4PRDB 3VH8G 4I0PD 3FQNA 3U0WH 3I02A 1YECH 4MCZA 3PP3H 2Z8RA 4X9IA 1MLCA 3LKOA 5J11C 5KAQG 3MRBB 5EBLB 1A9EA 1HHGB 1I7RB 3PHQB 4MAYC 4XHJD 4AMKL 3PHOB 5BS0B 3PQYB 2WWKT 3GRWA 5EZJA 1NSNH 4OI9A 2P8LA 3AAZA 3WHE0 5TQ0H 2X4UB 2D31A 4QOKD 5GGVY 3C9NB 1P84K 1J05A 1DN0A 2V2TA 1CLOH 5BV7L 3BPCA 3T3ME 2AXGA 1QKZL 2XYCA 3JTSB 3UYRL 2PW1A 1BWWA 3QDGB 1CDUA 3O3BA 4OF3A 3KJ4C 3TT3L 4Z7WF 1KXTB 1VADA 5L2JA 5AZEH 4WW2A 4R96B 2ITCB 5GIRA 4XWOC 1QEWB 2BNQB 1R0AH 3AUVA 2NMSA 1P7QA 2VLLA 3V79C 5T3ZL 4MD4A 3VGEA 2HTLC 1BREA 5LWYH 5MEOB 2X4PA 3MR9B 5LGHH 5KSAC 1P4LB 5F88A 4LAJH 2IPKA 3MYJB 2B1HH 1OT2A 3N9GL 4JG0L 5KSBB 1IE5A 3LOWA 2YD9A 3V7AE 2D4FA 1DBML 5SX5K 1BVZA 3THMH 2MQCA 1G7IA 5J3HC 3VXRA 3RDTA 2J1KA 5CJQH 5JR1L 3SDDB 1MHPL 4LPXA 3OJDA 4Y2DC 5F89A 3IRZA 4GSDH 5LG1A 2FD6L 1UJ3A 1C5CH 5FKAA 1PKQA 3IDXL 4KHXH 5JW4N 1XF3A 3SCMC 2OL3L 2E7BA 2H3NB 5CBEA 3BX7C 5KVDL 1FGVH 4ODSH 2ZUYA 1ZHNA 4OZGB 4D9RE 2G60H 5ESQA 3S98A 3T65A 1HI6A 4PJCA 1ZEAL 4JM2C 1JHKL 1RZIA 5HGDA 2NLJA 3LSOA 2CK0L 4TUJB 1FZKB 5GRUL 1OAYH 3WE6B 4G3YL 43CAB 5FDYA 2DQHH 5DDHB 2JF1A 4X6EB 5IB1B 1ITCA 1LP9B 3BOVA 2C3XA 3K4ZA 4RGNC 1ODAA 4PFEA 1S78D 4FMKA 2BSRB 1WCBB 5HYJB 3CFCL 5GQBA 1R3LA 1WAAE 2NY0C 2PUQT 3UJIH 1N6QL 3G08B 3LHPH 4D9RD 4LHUG 1AGBA 4XPAL 5EU4A 1YEDB 2G9HB 1S9YB 4O9HH 4PREA 5C0GB 2DF3A 4U6HB 4ZNCD 5DJ8B 5C09E 4ELME 1W0WA 1YJDL 4K71C 5BXFA 3W2DL 4OGXL 3VFOB 5J0BA 1E6JL 1I75A 1W72B 5GGSA 5ACMA 4GOSA 3EOTH 5D1ZA 4UNVA 4ORZC 3U0WL 5SWSA 3NACH 4P4KC 1A2YA 3IS1X 1YECL 3PP3K 4MJID 2C7UA 1MCEA 2FJHB 3P4NA 4MQ7A 1PY4A 5AYQA 5B22A 2F19H 1BIIA 2OL3A 4F7PA 3FFDB 5JQ6L 1B3JA 4W4NA 1FFQA 2P5WE 3P4MB 1L7IH 5DRNB 1H3VA 2UYLA 4JHWH 2XWJB 4L1HA 1FG2B 3PGCA 2YXMA 5TQ0L 4D3CL 3CLFH 2YSSA 4P2OA 3T2NH 5LBSH 5M7QA 1RIVH 5C09D 1FP5A 5ICZB 3CSYA 3V4UL 3TJHD 2YD6A 4GAYA 4MQXD 2VYRE 3WEXA 1I7TA 2BC4B 4KI5C 3FQXB 5EFIA 4KY1H 1G1CA 5IJVB 3ZTJH 5DT1H 3FT4A 5IROA 4WRLA 4YPGA 1NCUA 5ID0B 1S7TA 4Z0BH 5C0AB 4ERSH 1QFUL 3CVHL 4FQLH 5EBWB 2MWCA 4XVTH 4BFGA 2VE6A 2FX8H 4L4VB 5FK9A 5AZEL 3FTGA 2P5WD 4LSUH 5EWIH 4KK8C 5IVXF 2DQUH 3SGJC 4ZG1A 1JPSH 2C9AA 4P2RA 3DURB 3RZCB 5HYQA 2OP4L 3SKNA 3RPKA 1K4DA 4U0RB 5LGHL 1OGAA 3L7FB 1FN4A 1EJOH 5I1LA 3BIAX 3A6CH 1MHHB 1N7MH 3GNML 1A22B 1KYOK 2CXKA 4PRNB 3ARBA 2WV3A 3O2WH 4NRZB 3MRDA 1R3JB 4UV4H 5C1MB 1D7FA 2AJ3A 4KV5F 4MMXC 1XCQB 1UCTA 2FBJH 3BDXA 3RWGA 5CSGA 1UC6A 4AQ1B 4GSDL 3KVQA 3RGVC 3WNOA 4JM4L 4UOW1 2F53A 4U33A 4JJ5B 1EFXB 3T4AA 4CVUA 2CLZB 1JN6B 3PXHA 2EDNA 1NL0L 1OSZA 1FGVL 3QQ4B 4ODSL 1NC4B 5B8CA 3G5ZA 3VWKA 3OHXB 3WFBL 1F45A 3ZMRA 4FTVB 5SWZE 5TGBB 4WNQB 1A0QH 2IQAA 5AZ2L 2IAMB 4LNRB 4X8XA 3HC0A 2PN5A 1OAYL 5F93C 2R1WB 2BOCA 2DQHL 1FZJB 1TIUA 3H0TB 3WHE1 4XP1H 2UUDH 3D0LB 1RZKL 2EDRA 3CVHA 4KUCF 3VFMA 2R56H 4WU5B 3FB6B 3SDCB 5HPMB 2VLKB 3WNMA 1YQVL 3BWAA 3L95B 1VFBB 2FLBT 3UJIL 5D7SH 4U1HB 5TDNA 1LQSR 2DLGA 2FBOJ 5MENE 3STZA 5IFHL 3P0VH 4ONFL 5SWZD 1Q72H 3BEWB 3WN5B 4O9HL 2X7LA 3GGWA 3I9GH 6FABH 3IJHA 3TO2A 2W9LA 3LKQB 3VWJD 1AHWB 3T04D 3P11H 5DRWB 2ICWI 1P2CA 3QXDB 1T1ZB 4M6OL 2FL5A 5I0DA 5EO9A 2FGWL 4IOFC 3QCTH 3DXAE 5D2NB 3A6OA 2ITDA 2BZDA 4HS3A 3TO4D 3KNBA 3KPPA 5DMIH 3QNYB 1A64A 4OFDA 4Q9QH 1T5XA 3P9LA 3L5HA 2O61A 4GG6A 4J6RH 3O9WB 2F19L 2EIBA 4JJHA 3NCYS 4PB9L 5KS9E 2XY1A 2OLDA 5MEND 1B6DA 1SJEA 5E2WH 1L7IL 1TJHL 4PJ8D 3AREC 3C8KA 1CBVH 1N8ZB 3CLFL 1U8OA 2VABA 3HZMA 1NFKA 5IB3B 5INCB 1DBBL 5LBSL 1ZA3B 3P30L 4Z7UA 4N8VG 1X5JA 3VDCA 3EYSH 5F7DA 5HJ3B 4U6YA 4NUGL 4BUHA 2CDGB 1XIWA 2AP2A 3BO8A 3DXAD 4AJ0A 4KY1L 1I1AD 5DT1L 4GKOA 4XCFL 4NO2A 1JV5B 2ICCA 4Z0BL 5BZDA 1KJ2H 4ERSL 3W9EB 3TFKD 5HGHA 2A6IA 5ETUA 3T3PE 2FX8L 3REWB 4GRMB 4WHDA 4BH7A 2G2RA 4Z7OF 5EU6B 4LSUL 1CI5A 3VXUE 4H0IA 5EWIL 4LNVA 1CDIA 5E8EB 5DGRA 1RSFA 1JPSL 4EZMA 1S7UA 3IFNH 2R1YA 4R7DB 5JW5A 1H3XA 1BJ1H 4U3XA 4K9EH 1SVZA 4QWWC 2BY1A 2ZUWA 4WDIB 3VFRA 1EJOL 1HXYA 4Y2OA 2UZYB 5IW6B 1URLA 2LVEA 2NY4D 3A6CL 5F3BA 1CQYA 1S78C 5DYOB 2YMXL 4J3OC 1VFMA 5C0DA 2P24B 3TYFA 5IVZB 4UV4L 5EUOF 3BH8A 3MV9E 1AJ7H 2FBJL 4NCC1 3KPLB 3VXUD 2HKFL 4NNPL 1E4KC 2VXQH 2FX7H 4HK0A 3MV11 4FXKB 3AU1A 3BD3A 4MJ6A 3NCYP 4ZQKA 2WBJA 2DYPD 4M3KB 4N5ED 2HKHH 1G9MC 2FIKB 3DVNB 3P40A 4LSVL 3Q2CA 3QH3A 5BOZG 4H0GA 1A0QL 4CNIB 4UDTB 2QQLH 2YK1H 3VGHA 3P9MB 2EECA 5HVHB 3ARPA 2UUDK 5C0IA 2CDFB 3PABB 1WC7B 5CSBA 2M26A 4Z78A 3MV9D 2X4RA 2R56L 3UTQA 5EO1A 2AXFA 3FQTA 3EO9H 3ALXA 3MLTB 2DN7A 4OM1H 4OZFG 3D3VB 3ROLB 1IQDB 3RPIB 2A9NH 3KS0H 5D7SL 1QSEB 2C26A 2PYEB 5K33A 3VDBA 2HJFA 4MQXC 3P0VL 1Q72L 4G8FB 4PY7A 2CIIB 3KPSA 4NHUB 1MCKA 3VJ6B 3I9GL 4WI8A 4JANB 3BN9D 2C4XA 4P5TD 4LLYA 3GBLA 1EGJL 4X6CB 3B9KA 3ULUL 3QCTL 5CHNA 4Y16A 4YZFF 3KPQA 1DE4A 4NKMA 5F6HI 5F1KC 3WDHA 4KKBD 2E9BA 1DLFH 1DQQB 5F7EL 2N4IA 2Z93B 4XXCC 4JZJB 1DBJH 1DEEA 1J7VR 4J6RL 4XB7A 2NY1B 4K3DH 3E3QE 4Q6IB 2OYPA 1G7HB 4QXGH 2F5AH 1KELH 2JJTA 4J23A 2W91A 3T2PA 4HULB 5GRJH 3OL2A 4I18C 4LSPH 4PJ7A 1U3JA 4GKZB 5I1DA 4P3DB 2VDOL 4OZIE 1U8QA 1P5VA 5SWQA 4P3CH 2MHAB 1RK1A 5KANG 3VFWB 32C2B 4NQCD 3EYSL 4GW1A 4E41A 2OTWB 3ILPA 3L3OB 3EO0B 1AGCB 4G9FE 5B3NA 4PY8J 1NUDA 5FYLL 3VH8A 2V7HA 1W0VB 4WHYH 5CINH 3PE9A 2HAZA 4YLQT 2GJ6B 3RVTD 5E8OB 4ZTPH 4HS6A 3ETBF 3NIGF 2CIKB 5M94B 3NZ8A 4LP5A 1OARH 2X9WA 3IFNL 2F54A 4KK6D 1VFAB 4L29B 1P1ZB 3O45B 1ES0B 2VXVH 3L3IA 4K9EL 3O11B 5I66A 1KTDA 2YC1B 2YHGA 2Q7YB 4AENB 1CXIA 5A2LH 2I26N 3RUGA 1EGJA 1YPZE 2VOTA 2ZCLH 5E0QA 3ZHDA 5HHXL 3MRKB 4G9FD 4E5XB 1NCNA 1XGRA 2BMKA 3DX7A 1D5XB 2X5PA 4NC1C 4KI1A 1DZBA 5H35B 3B5TA 1MI5A 2VQ1B 5HHPA 5I18L 2GJJA 4KZEH 2VXQL 2FX7L 5JHLL 1UVQB 2ERJB 3QCUH 1J0YA 3SQBA 3VWJC 2R69H 2AJYH 3VFUA 5KZCD 2HKHL 5TDOB 3QZWB 2A77H 2XKUA 1U8IA 1M7DB 1Q38A 4G5ZL 4OT1L 4I77H 5IMLA 3IETA 4FQCL 4BSVB 3OF6A 1D5MA 2QQLL 2JB6B 1BGXH 5DJ2B 2OTUA 2XPGA 3U36A 4DN3L 4IJ3C 5DD6A 1CCZA 3W81A 1GHFH 4UI2A 4EIZC 4QRTB 3T0WA 2V5RA 4HJJL 4PJ8C 5FO7B 1JGVH 1G6RL 3EO9L 3PGDA 2CKBH 3STBA 3SDXA 5DRZA 4X6BA 3BJ91 3TBVB 4OM1L 4EI5D 1QLRA 2Z4QB 1GVIA 3IFOA 4KK9D 3TGXA 4EQ2A 5F9WB 1NGZA 2EEAA 5DK2A 3LKRB 1INDH 4FNLL 2GITA 3RNQB 4XPBH 4LSTH 1I85C 1U6AL 1AGFA 3BH9A 4AIZB 5L2KB 5FHBL 1G84A 3BGMB 1LD9B 1GC1H 5B3JF 3C5ZB 4WUUE 2HN7B 1AP2B 1FSKB 4HH9B 4ONHB 1JI2A 4LVHB 4PJEE 1DLFL 4WW2F 5I9QC 1J11A 1Q9WB 2YOCA 3MREB 5T1LB 3RY5A 3RVWD 1XF2A 1IGTB 4QRRA 3ULVE 2B5IB 1KELL 2F5AL 4WFFE 1PZ5B 1JGUL 1VACA 4C56B 5GRJL 3R06A 4LSPL 4XNUL 4Q6YA 4OLUH 2R8SL 1LEGA 1C16A 3PL6C 1GYAA 1INQB 1A4JB 3TBYA 3QUML 4F8QA 1T04B 1JNNH 4OUUA 4BQBA 1WIPA 2EYTA 2RB8A 3BRDA 4WUUD 3G6AA 3FFCE 1QQDB 3GB7A 5E2UL 3GM0A 4R90H 3WFHB 4N5EC 1U8JB 5CINL 1FFPA 3ULVD 4WFFD 1CDHA 4O58H 3OWEA 4QHMB 5ACZA 1NAMH 3GZKA 1OARL 5DS8A 2DICA 5FF6A 1DUYA 4X6DA 4PJCF 3PHSA 3WNPA 4V2CB 5DEGA 3MBXH 4D94A 3EYOA 4F57H 3DSFL 4YBQD 4LVNB 3QNZA 3G5VA 3NCBB 2AV1A 2NX5E 2AI0H 4ZOAA 2R0LH 3KPRB 4HUVB 2YBRA 4U4BA 5DHVB 4OTXL 5J1TC 4GW4A 5IP4A 4OCYH 5E6ID 3B5HA 4RZCB 2AK4B 3ARDB 4XRCA 4A6YL 1HSBA 5BRZE 1VGEH 3BN9C 4POYA 3QCUL 2DI8A 3QUZA 2R69L 4ZO7A 2AJYL 2B0SL 5C86A 2VB5A 5BJTA 1HNGA 5TPWH 3RWCB 3TLRA 3BD4A 2A77L 1IM3A 3MLXL 4HIIB 3QUMA 1CLZH 3MV7E 4I77L 4MQTB 1KIQB 1F4XL 1BGXL 4JKKA 2NX5D 3QIBB 4LLVB 2G75A 1MREH 3MRQA 2XQBH 1X6NA 1IKFH 4HKZA 1GHFL 5EBGA 4OM0L 4NQVB 3ECBA 1JGVL 1OF2B 5EC1A 5DF0A 2J12B 1PYWA 3UYOD 4C4KO 4NM8H 3GKWH 4DOHE 1XR8A 4HWUA 3FO0H 4O02L 2HFEA 2DQIL 4AT6B 1ZXQA 3W5MA 4OZIB 1INDL 3MV7D 1U8MB 3RIAF 4ORGA 2XN9A 2EDTA 3JXAA 4YHPA 4NNXB 4XPBL 3FB7B 5DQDH 4LSTL 5J6GB 1C08B 5J1SC 1B2WL 2F15A 5HTSA 1WLHA 4JRXA 3TA3A 5ERWB 3REVB 1A21A 3QIWA 4JRYE 1J8HA 4FZEH 1GC1L 4LVOC 5FYKE 1I3RA 2GT9B 2QADC 2O5YH 3TBWB 4MA3B 2KKQA 5F8QC 4A6YA 1KFAH 4KK6C 4HWZB 4WWKD 2X4SB 3V95A 3DUSA 1G9NC 4ODVH 3OB0H 5IVXB 3C8DA 5EG6C 3EDFA 15C8H 1S5IH 3GEWB 4UIMA 5EOTB 1QBBA 5J9PA 3EFFB 1ZT1A 5DUPL 1OAXH 5C0EB 1KJ3L 2AVGA 5CCKL 1CYGA 3SY0B 4OLUL 1E27A 4WGWB 3GSVA 1A7RH 2NZ9D 4AL8L 4XCEB 4I5BB 1JNNL 5FYKD 2XACC 3X17A 2UY6A 4OGZA 1ZVYA 3SGDI 1YYLH 2A6KA 4IRSA 2YUVA 1NCDH 2Y1VA 4PJ9A 3HI5H 3SKMA 3HG1E 4WFHD 2JJVA 3QEUA 2AEIT 2GCYA 5MI0C 4ZUSB 2F58H 2BNRE 1NCCL 4JDZA 4OCLC 4MNGE 4LCUA 4FXGA 3L5JA 3D0VA 3MJ9H 1EDQA 1NAML 5E6ZA 3D39E 5MERA 3UTPE 4RX4A 1A4KB 5L7XH 1DQMH 5DUMH 2DKSA 4PJGF 1VEMA 4YXLH 1NDMB 3MBXL 4NC2B 5H37G 4E0RB 1R3IH 3CXHK 1TCMA 3DGCR 2HLFC 4UAOC 5MHSE 4U1JB 5IW1B 1S7XB 4K3GA 1R5WA 4K94L 4HPOL 3ZTNH 5F9JB 4EI5C 3HG1D 1MWAB 2R0LL 1XGUB 3MLYH 4KK9C 1RJLB 5K9OA 5KW9L 4JFFB 4OCYL 3S5LG 2BNRD 1MFBH 4EUPH 1ACYL 4KUZH 4XBPA 1MQKH 1VGEL 3MLPA 4KROD 3UTPD 4KXZH 4NQEA 4FQQA 5D96C 4MAUH 4RA0C 1SQ2N 1DUZB 1AGDA 4KRPB 1CTNA 1CLZL 2PXYC 5MHSD 4F7MB 1T7WA 2A2QT 4QRPA 4XGZB 1UWXH 3JWNC 4L9LC 5F44A 4NZTH 1MREL 5D93B 1ZHLB 3RVWC 5K9QI 5EPMB 2QQQA 4KPHL 4PD4J 1I7UA 5GSRA 1PVHA 3UTTE 5HSFA 4WUKH 2X4NA 3NIDF 3ZSSA 4CW1A 2C1PB 5GRWA 4GG6F 5KG9B 1NAMA 3U0PB 5I73B 3D2UA 3QUXB 2F8VA 3S3PA 4QHUB 5T1KB 1S9WB 4Q2ZB 1RUPH 3VD7A 5CEZD 4Z7UF 4NGHL 3R0NA 5DQDL 1RU9H 3MJ8A 2RFXA 3K80A 4K2UH 3C6LB 3RTQB 4KQ4L 4FZEL 4ZO9A 3TIEA 3U2SB 3UTTD 1B0WA 1NGWA 2O5YL 4RMSA 4NQXA 4ZTOH 1KFAL 3TN0B 5CEXB 3OB0K 1DBAH 4HIHA 2R2CA 3GSXA 1X4XA 3HPJB 3IDIA 1AQDB 4L3EA 4QT5B 5GGSY 1Y0LA 4YNYB 3OXRA 3BXNA 3BRGC 2GY5A 5ACLA 3T09A 1QNZH 4IHOB 4XMLL 1QSVA 1ZGLP 2NY3D 3IGAA 5E8NA 2LAGB 2V5TA 5EUOB 1CL7L 4E42A 4PR5B 1NCDL 3KPNB 3HI5L 5BRZB 1FV1B 3EHBC 1DN2A 1GOFA 1HHKA 5CBAB 1UGNA 2B2XH 1DVFA 2F58L 4Y1AA 1YNTB 3L3HB 3G9VA 1A6AB 4YAQA 3EGSA 5A3IC 3GSWA 1KG0A 3MJ9L 2LU3A 2JIXA 1M7XA 1GJIA 1DQML 4Z7QE 4PYHA 3SDAB 4YXLL 2DQEH 4ZD3L 3JWDC 1R3IL 5CP7A 3GJEA 4LASL 3VRLE 4NQSB 1LEKA 3ZTNL 1OAKH 4OFVA 4J3TA 5C0FA 5C9JA 3KLHC 1JGDA 4GMTL 5JMOC 4YHKH 5ANMA 3MLYL 3MMEA 3HR5B 3DI3B 2JE8A 1H5BA 4PGEA 5KVFH 2V7NB 4DOHB 1MIEH 3FKUS 5FO8B 1TVHA 1MFBL 2AV7A 4LKXA 3PP4H 2UV3A 3BDYH 1HHHB 1J10A 4DQOH 3HNTH 5F1SA 3MJ7A 2JELH 3KDMA 3S36H 5CKGA 3MROB 2EO9A 3N0PB 4NT6A 1SMAA 3I50H 4XH2A 4MAUL 2V2WA 3KYNB 3NN8A 1S8DA 1P5UA 1JK8A 4YBLB 3ZKMD 1CE1H 1SY6H 3U7WH 3IDJB 3VD3A 4JRYB 4CUCA 1FLTX 2PW2B 3B2UD 5F7YC 1KCRH 1UWXK 4Y4KC 1Q94A 4WWKC 4Y4FD 5A2KH 3V6ZB 3JSSA 4JFYA 3LH2H 4NZTL 3U46B 5DQ9B 5EH1A 4RNRA 3GMOA 4R2GD 2AJSL 4LAQH 1HCVA 3J8F7 5IG7B 1XEDA 3MBEB 1MRFL 4U31A 5D1XB 1QRNB 4Z7NF 5E2JA 2QR0A 1TETL 4LCCC 3MJ9A 4U1IA 3GUTA 1A1NA 4R8WL 4B7LA 4TVPE 1FYHB 1A6WH 4XTRC 2ZPKH 3ARGB 3HS0B 3SJVB 2OM5A 2HTKD 1RUPL 4PJ7F 2JK5B 3PWPA 1UZ6F 5ISZA 3P2TA 5DVKA 2EC9T 4G6ML 4EN3B 3LEVH 3K3QA 4M00A 3KXFE 2Q76A 1J0KA 3FRUB 4KMTH 1BX2A 3G04B 5I1HH 1PZUB 2P5EB 5EC2A 4MNGB 4ZTOL 3MPCA 4HKBA 5FYJE 3D39B 1FNEB 4TVPD 5BZWB 4XXDA 4NQTA 5FGCE 1C7TA 1REIA 2DQFA 1EAPA 3ZKSD 2VZ3A 4BQCA 5E24E 4HLZG 2CR3A 3ELAT 3H8NA 3RUGF 1QNZL 4ZOCA 5B39B 3ZDZF 3ULUF 4HIEA 5HDBF 3KXFD 4K7FB 1NC4D 4DCQB 1EUUA 4X6FB 4QXTB 2HVJB 3LV3A 4J12A 4JVWA 1A9BB 2FHCA 2YUWA 4NWUH 3CDYA 5FYJD 4P23D 3X13A 1U92A 2A74B 1EO5A 2B2XL 1IQWH 3QI9D 4R0LB 3F65A 4CGTA 4TSAH 5JIPA 4N0UE 4NQUA 4XBGA 4F9PA 5J13C 3QJFA 2ADGB 3MUGA 4TTDD 4X0KA 5F1NA 4L5FH 1H3GA 1J0HA 3EYFB 1U9KA 1E0OB 3OKYA 4M9PA 4I2XA 1UM6H 5T3XE 3ZDXF 4ZFFB 4N0CD 1SBSL 1GRWA 4GRLA 3RWHB 3A6BL 1KACB 2IADB 4Y19A 4XZUA 1J1OL 3EZJB 5BOPA 3TCLA 3QUYA 1UXWA 3FQNB 5JORA 2UZIH 3HI6H 3LQAC 3LKNA 2R0ZH 4OQTH 4WO4D 1MLCB 3LKOB 5KVFL 5SV3A 4U7MA 3SDXF 4F15B 1IC4H 3PP4L 3BEVA 3BDYL 4BQ8A 5EZJB 5BQ7A 4POUB 3HNTL 1BECA 3A0OA 5D7IE 3S36L 5IMOA 1EFQA 3I50L 2HVKB 2OSLB 1ZMYA 2E9IA 3H3BC 1J05B 5T3XD 5JW3H 3DBXA 4K7PX 4CVXA 1RUKH 4JZNA 3U7WL 3O3EA 3VGAB 1P84J 3F62A 5KBNC 3FONA