5JDJA

Crystal structure of domain i10 from titin in space group p212121
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
91
structure length
91
Chain Sequence
GAMETLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Titin
publication title Exploration of pathomechanisms triggered by a single-nucleotide polymorphism in titin's I-band: the cardiomyopathy-linked mutation T2580I.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 91
sequence length 91
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jdjA00
1EV2E 1RZFL 2C3XA 4PV9A 5KVFH 2BVQA 3OKLB 4HS3A 2IANA 5F6HJ 5LWYL 3RAJH 2Q76A 1OVZA 2DI9A 3T2QA 1UWGH 3BP6B 3VU2A 4YPGB 2ZOLB 2VXUH 5CGMA 4KZDH 1JPST 1AY1H 2W9EL 1A1OA 4DKFH 3ZHLA 3W9DA 2PXYC 4O4YL 5J12C 1YNTA 4H26B 1HHHA 2VYRE 3TJHC 3O6KH 4EQ3A 1C7TA 4ZQKA 1OQXA 5J56B 2R1WA 1QFUH 2IMMA 5DRWB 5DQDL 2MSPA 2WWMD 3IFLL 4CBPA 1BOYA 1MFEH 2YA0A 5F7DA 4XTRC 4LQFL 4GJTB 1A7RL 3TPKA 4Y8AA 3IDJA 4PJHE 4XHJC 2EKSA 1AHWB 4JY4B 5I2IB 4XNQB 1KEML 2FGWL 5I73B 1P4BH 2UVEA 5CSZB 5JPNB 1FC2D 4OD3L 4LCWE 3SCMB 4XB7A 2QQQA 2ZP0T 5MEQB 1U95A 5BJTA 3PWUA 4I48B 3DV4A 1PAMA 4L1DA 3N1FC 4M7LL 3U9UA 4KJPD 25C8H 4DKEH 4X4ME 4ZS6C 1P7KA 1FGNL 3BKML 4U7KA 5DC9B 3QIBC 3E2HB 4ELMA 1IM3B 3V6OE 1MRCH 4FNLH 2BJMH 2BVYA 2ESVA 3E3QC 3U7AA 3TVMD 4M6OH 4LNRA 5C0AA 4ELKB 3S8WA 2Y5EA 5SX4I 2P8MB 4YDLC 1R24B 4NO3B 4PJIA 4OTXH 4N8VB 5FGRA 3QSKB 5CLWA 1RZJH 4G9DA 1SY6L 3C8HA 4LHQB 1MY7A 3QCVH 3H9YA 1B0RA 5SX4H 4K94L 1UQSA 2AV7A 4J3VA 4XPGH 5DMIL 3RVWC 2VZ1A 2HWZL 3DLQR 3T04D 4M6NH 2C3GA 4LPUA 1IAIM 4R9HA 5HJ3B 4F7CB 4MAUL 1ADQA 3ULVC 1KENH 3D85B 2YD7A 1HYRC 1EEZA 2D7NA 2IMNA 4KAQH 1G9MC 3VXOA 3G5VA 4D8PA 5BOZG 1FL5A 3VXPB 1I85C 3AMKA 5HHXL 3U46A 4HUXB 1CK0L 1MWAL 5IKCA 4UINH 3LPWA 2JB5L 3QI9A 4IDJH 5IMOA 2NX5E 1MCEA 1SBBA 1KB9J 1DVFD 3O9WA 2E8YA 3O41A 3P3YA 3VFSA 1OAZL 4GSDL 1JP5A 5IB3A 3UBXB 1FE8L 3I6KB 1G6RB 3X11A 1S78C 3MV9D 5FUOL 4MD5B 1S7WA 2D0GA 3HRZA 1DUYB 1WEJL 3IKKA 2VL4A 2YUZA 5FM5M 1QBAA 1TJGL 4TULH 5T5NG 5C0IA 1A9EB 2IFGA 4NKIH 1CDUA 4MXWH 4GS7B 4ACPA 2QV2A 3OAYK 1KJVA 5BQ7B 2ARJQ 3QFJB 1J5OL 3S36L 4AT6B 3ULVL 3ES6A 2PW2B 4OGYL 4P5KA 5ID1A 1WAAA 1NUGA 4Y5YA 1HEZB 1RI8A 2P5ED 4H5SA 1E6JH 4AIXA 1G9ML 4ZFZA 2VERN 3VFGL 5E6IA 1CG9A 5HHOB 2VDOL 4UV4L 2EDTA 3GFUA 3VXTA 1FSKB 5EOCJ 3UPAA 5B8CC 5K9OA 3WN5A 5ADPH 3KS0J 3N06B 4M1CC 1JTTA 1YA5A 4D2NA 2FO4A 4N0CC 3BZEA 3RRQA 3P30L 4NO5A 1BFTA 1ZA3A 2CDFA 4XGZB 1FFPB 4DGVL 1KGCE 4X4YB 1WICA 3CMGA 5C08D 2ICES 4XCEA 4OBSA 1ZT4B 4ZUTB 5T1MB 2WZPD 2IEPA 1A2YB 1MIML 1J1XL 4I9WE 2ZSWA 4L4TB 3O3BA 2VLRD 3MNZA 4HMEA 5GS1A 5E2TH 4X4XA 3GK8L 4JPKL 5JMOC 2A38A 2VSDA 5B3JE 5TJWK 3T0EB 4M8QB 1MCQA 4Y89A 5DC0A 5IFAL 1QFWL 5FGBC 2WWKO 1ETZA 3HR5A 1I1AC 5JOFB 3EOAB 4ZDHA 5DUPH 3H0TB 4HIXH 4ENEC 3CZFA 1T03L 2BY0A 3T1WA 3T3PE 1PGRB 3RZCD 1MAJA 3OXSA 3X13A 2PN5A 3LPGA 3ZT5A 4HQQL 1HHGA 3GIVB 5FGCE 5GGTL 1ZLUH 3EYOA 3HHRB 1YEHL 1RMFH 5L88H 5D72H 5FCUH 3PP4L 4NJAH 4KV5E 1CGVA 4L4VB 1W72H 4JEGB 3FRUA 1I1RA 1K4CB 5IVZA 4FXKA 4FFYH 3BZFA 4K3GA 1ZSDA 3FKUS 4ALAH 3U6RB 3HE6A 1I8LC 3NAAL 4OZIF 3DX6A 5DHVA 3QP3A 3C6LB 4LCIH 4XBPB 4M00A 4L3CA 4NZRH 1IC4L 3S88H 3MREB 1BP3B 4OB5H 2VMFA 4TSAH 4DTGH 5CP7B 1MEXH 2EC9T 4ZUSA 1NLDH 1MVUB 2EDHA 4OCYH 5F8RC 3EIFA 3MV8B 2FBOJ 3IXAB 5IB1B 1T3FB 1MFCL 4PGJA 1EFXD 2NY1D 3TJEL 2JB6A 4KKLD 4UOW0 5TH2A 4U1KB 3I85A 4Y1AE 4PY8I 3THMH 3CFBA 4JO4L 5L0QB 2EYSA 3CSPA 4NNYA 3ZYJA 3DTXA 1P5UA 5DFVD 2O5ZH 5JQ6L 4XMLL 1YDPA 2B1HH 4JCLA 1JGLH 4XCNB 1ZLVK 4C56A 1G7MB 3WKNA 4XP4H 4QRRD 5EO0B 1FVEB 3BVNA 4U6XB 1INDL 3KXFD 4FMKA 2I07A 4UOJA 4YHIB 4OD1L 4K07A 3HI5L 3TCLA 3U7YH 4RAUA 1FL6B 1YJDC 2W0FA 3WSQL 1QRNB 4PJ7F 2I24N 2DQHL 4HKBA 1MSPA 3QO1A 1BQHA 4OGAD 4PGCA 3KPRB 1LP9A 1I4FB 3GI9H 4EI5D 3MRGB 3CC5B 3IDGA 5F6IC 2OR9H 3SKNA 4WFGD 5SWZE 4PREA 2RJMA 5C0DA 3QULB 2H3NB 1F4XH 3WLBA 4DWHA 4GBXA 1LEGB 2R0KH 5JOPE 4L8CB 3S98A 4NQEE 1RJYA 3MBEC 3GIZL 1J05A 3QXVA 4U1MB 1U8LB 3QUMH 5E00A 3TIEA 1TJHL 2VDRH 3AC0A 2ED9A 1MFDL 4N1EA 4WJ5A 5IW6B 2MKLC 4P48A 1KPVA 4UB0H 1Q0YH 1YJDL 3PL6B 1D6VH 2JELL 1T20A 2W9DH 3CDGA 3D69A 2ZSVA 2E8ZA 1U91A 2DIAA 3GUTA 3G5ZB 3QYCA 3REVB 5FKPA 3U83A 3D25B 3SDCC 1T04B 4BH7B 4HFWA 1Z5LB 2GY5A 5LBSH 2R8SL 1P4LA 2IAMB 5D7JD 4YEEA 5DRZA 3GGWB 1NGWA 4L8SC 5IEHB 5D2NB 4JM2A 1F4AA 4FZ8H 4PRPD 1LDPL 5TGBB 3UTOA 1MFAL 1TQBC 1CXHA 2JCCF 2CIIB 3GI8L 3RIFK 3QDME 2XKSA 4XP1L 4RZCB 1V5JA 3B2UD 3C8KB 3UP1A 3QDJA 3B9VA 5GZOC 5EBGA 2X4QA 4HXAL 4HWEH 1CGTA 3R4DA 2XY2A 5HYQB 4WI2A 2DLTA 1X4XA 1U2HA 2APVA 3LRHA 1CD1B 4LPWA 5I71B 3M1BB 3NZHH 5E9DE 4G8EB 5C1MB 4ODXB 4JGJA 5E99L 1GHFH 5FKAA 1G9EA 3HG1B 3ULUF 1JF6A 5DYOA 3MACH 2VDQL 2GJZA 5DD6A 1I8IB 2E6PA 4Y4HA 4YHKH 4LFHD 1T89C 1AO7D 4DKDC 3ARFC 5T5NF 4Q6IA 4XT1C 2JJTA 3TN0D 4JZNA 1EHXA 1NJ9A 5B38G 1MREH 1U42A 1AI1L 3MR9A 5CINH 1IVLA 3IJSB 2P24B 3SGEI 4ODVH 3V6ZA 5JXAL 4N5ED 4WHTA 4Q9RH 3GSWB 1RIHH 4YBLC 1DL7L 2OZ4A 3NA9L 2GT9A 3SGEH 4XNUH 2YD4A 4JDTH 1VGKA 1EPFA 2EDJA 1OW0A 3DPBA 4QOKD 1N6QL 4KUCF 2J8UB 3FFDA 4KU1A 3QZWA 3RWGB 4JZJA 4PGDB 3LKRA 3GO1L 3W9EB 5J6GA 1IMHC 4JFZL 4KGJA 4JB9L 4U1HB 1ZLWH 1WQVT 4MX7A 2VC2L 1KPRA 1YPZA 2HTLD 5CJOH 3MLSH 1AGFB 3OKDB 4JO2L 4MQXC 1NMCB 4NOBA 1P69B 4A6YL 4KHTH 4XVSH 4BELD 4D0DB 3IDNA 2YHGA 3P0YL 4FQIH 4YQXL 4F58H 1AP2A 5I17A 4RGOL 4OCRL 1M1SA 4PJCA 5GGVY 2LQRA 4K3DL 1JGVL 2AJUL 5ACLA 2X4SA 5ISZE 1WZKA 2VAJA 5J8OA 2Z8VC 4G6FB 1IEBA 2ATPA 5J1TC 1I3GL 4JFFB 4LBEB 5C07E 4CVZB 2UWEF 2ZCHL 3WDHA 3FT3A 1NC2D 3EDFA 5I1GH 3ZKNC 5CCKH 1FG9C 2VN4A 5IMKA 4LGRB 5IR1B 3CU7A 3ARBD 1P1ZB 4XXCC 2HFEB 5EULV 4NQSB 1BMGA 2BOBA 1XR9A 2R0LH 4YDIL 3P9LA 2CLRA 4R8WL 1LEIA 5D6CB 4OIBA 1NQBA 1H15A 3U1SL 3BJLA 4OQTL 3MV7B 1UXWA 5FA4A 4KUZL 1KNOB 5HDBF 3MJ9H 4UMGA 2H2SC 1M6OB 4KQ4H 5EBMA 1BZ9B 4FG6C 4Z77A 1DQQA 4UU9B 3NIDF 4KI5F 3ILQD 3N1PC 3BUTA 5HHMD 4E5XA 1SJEA 1N59A 5D1QB 4PGEA 3EYVA 2L7JA 2YBRB 1QFWM 3WHXB 1CL7I 3FO9A 4XCYA 3DX9A 1C08B 2BMKA 2DQEL 3OJDB 3D3VE 2OK0H 5DJ2A 5DJDA 1HINL 3QEQD 4BZ2H 4OZFG 2AJ3A 2XTLA 2VABA 3O3DB 1CF8L 4PJ9B 1S5IL 4QTIL 2DKMA 1CL7H 3RIAK 3SY0A 3HFML 4XCCH 1T5WA 3PE9A 3P40A 4DVBA 2WBJA 1F5WA 4J6RH 1J8HE 1QSFA 5AUMA 5BRZB 3BWUC 4S1SL 1N5AB 4RWYH 5DUMH 1OSZB 5ANMA 5DDHB 3P73B 5GSVA 1BQLL 2I9LA 3ZE0E 1UJ3C 4LFHG 3O6LH 3TA3D 1CLZL 5DSCA 3IRPX 2O5XH 3O4LB 3UTZB 1SEBB 1KLGB 4KRPB 2H8PA 5LQBH 3UPRB 2QR0A 2E27L 2KKQA 2BY3A 4PB9L 3U2SB 3OX8B 4D0BA 5C8JB 4GAJL 4YFEA 1MPAL 3QG7L 1S9YA 3ROLB 1QOKA 5D5MA 3UCRA 1F90H 1NEZA 1RUPH 1NMBH 4X5XA 4WFFE 5DJ0B 3O8XD 4MNQA 2OL3L 3DJ9A 4MB4A 1GGIL 1QVOB 1DLFH 4FFWD 3WL9B 1EHLH 4PJGE 5C09A 3OXRB 4LEOA 2B1AL 4F7TA 3KYKH 5GGQL 1KBGL 2Y07H 1CFSB 3NABL 4JR9H 2JJSA 2WBWB 4JFQA 1RK1B 4Y4FA 5CZXC 3QQ4A 1LK3H 1O0VA 5MHSD 3C09C 5CP3H 5FO8B 2XWBB 5JHDB 4YBQC 4I2XA 4I4WA 4BKLB 4OCSL 2FHCA 2WW8A 2B4CC 1FV1A 4Y4KB 4KRMB 1SYSB 2H1PL 4LU5H 3G6DL 1SQ2N 3KYOA 1YYLH 2C1PA 3E6HB 3BW9A 3MLZH 4IRJB 4D9LH 3FHQA 3DVNA 4JKWA 4NKMB 1WV7T 2NY3D 4X8JB 1U3ZA 5HYIA 2FSEB 2D9CA 4KVCL 3VFVB 4PLKD 5HHNA 1FYTD 2IH3B 3QRGL 3H3BC 1MJ7H 2NLJB 3MMEB 4FQJL 3EO1B 1D5IH 1K3ZA 1EZVY 4PRHD 3ARDD 3BN9D 3F8UB 2ENYA 4OCLC 4XRCA 1ZGLB 1LQSR 1M71B 4KRLB 3C6SB 4P4KD 1MCIA 2JJUA 4MD4A 5F71A 1AXTH 4OF8A 4U3HA 1JN6A 4R7NB 4RFNB 2WSKA 3BPNC 5IQ7H 4EUPA 4G8FA 4Z5RA 1OSPL 4P4RB 2X89A 4EN3C 2B4CL 2AJSL 1R3IL 4Z7WF 5KW9H 5L8LB 2B7DT 1JHKH 4JE4B 4UAOC 1FFNB 1U41A 2WWKT 2F53B 4AEHL 2GUOA 3RNKA 1VSCA 1F97A 1JGUL 35C8H 5DEGA 3JUZA 3PNWB 4XVUC 1ZE3C 5C0GB 5B39B 1A0QL 3L1OL 4JG1L 3QUMB 4YXLL 4JDZB 3EYFA 4HIHB 2DM3A 5C86A 3AMLA 3OF6D 3BDXA 3MLUH 2BNQD 3MRIA 3RWHB 5TE4H 3FCTB 5EIIA 1VADB 1IQWH 3B6SB 1OCWL 1NC4D 5C2BL 1A9BB 2NY6D 1JNNH 1T4KA 1AR1C 4YE4H 4LIQL 1QG3A 3EAKA 4Q9QL 3I84A 2IF7A 4POZC 5J3HC 3REWA 1UWXK 1QLFB 1FFQA 4LLDB 2QADB 4DAGL 4IOIA 2QSCH 3QO0A 4OCWL 1MH5B 3GSVB 3DRQB 3F7PC 1DBML 1Q9OA 2YD8A 4LLWA 4PY8J 1C5CH 4NO2B 3S37X 2MTPA 1H3UA 3GSQA 4U0RB 2W0PA 2FHFA 1CU4H 3IKCB 5M95B 1EO8L 3UJIL 1YECH 2QSVA 5JDJA 4ISVA 1K8IB 3FO1A 4PRBA 2HG5A 5BS0A 4LLMB 3UTPE 3LB6D 4MVBD 5FF6A 1DEEA 3BP7B 2H32H 5EPMB 3P77A 3NCYP 2HLAA 3WS6C 1CGXA 1CBVL 5GIRB 4Y19B 3DX7B 3TT1H 2LV4A 2X10A 4NPYA 5I1AA 4PG9A 4U6VH 5D1ZC 4IBLT 1A8JH 5FB8A 3WNLA 1I7ZA 2QHLA 4WNQA 5EA0H 3VGGA 4CVWA 4Z95L 4JLRA 3LOWA 3HE7A 4LPXA 3HMWL 3INUH 1YNLL 3PUCA 3DOSA 4NQDA 1AIFA 4PTUA 3MRJB 2CRYA 2OCFD 4BQCA 2C4FT 1HKLL 3ARVA 5FIEA 3O11B 1QACA 3ZO0A 1IEHA 1CIUA 4FABH 2R29L 4NSKA 5A16A 4DN3L 4NN7C 1PG7H 2YUVA 5CHNA 2OTUA 1D9KA 3AY4C 2ZCLH 4OZIB 5I8KL 3VXMB 4PR5B 1YY8B 2RFXA 2Y23A 2PTVA 5CGTA 5I19L 2DAVA 2FX7H 3BKYL 4MHHG 4Z0XA 5TDOB 1PFCA 1M7IA 3KLAA 1IT9H 4Z18A 4D94A 4JFPB 1EXUA 4I0CC 3O3AA 1TZGL 3ZKMD 2ADFH 5DT1L 4QGTA 2HVJB 1LILA 2D7TL 1IC7H 3P11L 4RX4D 1RZKC 4I0PA 1P6AB 2DWEA 3PWPA 5EZLB 2PYFB 1P5VA 1O7VA 4QRPD 4KZEL 5IOPB 4P2OB 1KTDA 5F9WC 4TUKH 2Y9RT 3NPZB 4O9HH 1GCFA 5C0BD 4OLYH 5LGJB 3WFCL 5ILTH 4QT5B 2XIDA 2DQUH 4NBZB 3CLEH 3GDBA 2PXYA 3EOTL 3GJFA 5KN5A 1XGRA 4FXLA 5KOVC 4PJ7B 2KPNA 1A6UL 3GKZA 3Q6GL 1U8NA 1Q9WA 1WIPA 1OM3H 1A7OH 3BIBX 3RWFB 5C0RH 5GISH 3NZ8B 4N9GB 3V8CA 2Z93A 1DDHB 1PYWA 1SY6A 2WUBL 2XN9E 3VGEA 3ZHKA 1K8DA 4GRWF 4XWOD 3D6GA 1JV5A 3OGCA 5A2KH 5DMKA 1RQ5A 4GXVL 3BPLC 1A3QA 1IGYB 5C7XH 2R9HD 1JE6A 4KPHL 3ZDZF 4Y16D 3SBWC 3QFJE 5CFHA 2VLJA 5HPMB 2XY1A 3BXNB 5JZ7D 5ETUB 4RRPA 1KJ2A 4P2YA 3QB7C 3W5MA 4LLQA 1DQJB 4HIEB 2YPLD 4M5YL 5KSAD 1GPOH 4XX1E 4GQ9H 4ZS7L 1BD2B 3TBWA 1MWAA 2XQBL 4QWWC 3QIBA 4H0GA 1NGYA 4U1JB 3KPLB 1FJ1A 4QF1A 2F5BL 5ENWA 1YYMH 4WI6A 3EFFB 3VW3H 3BDYL 3WE6A 4M7ZB 1S9VA 2CXKA 3MUZ1 1A6TA 3JWDH 5EN2A 5L8JB 3B5TA 5CJXC 1T1YB 2XQYK 2V7NA 3K4AA 5HGAB 5K9KA 4MCZB 4L4TE 1OB1B 1I8MA 1YNKH 5D93B 4LVEA 5FYKU 5F88B 1T21A 3PHOB 4EXPX 1CFTA 1QLRB 4BH8B 3RZWA 4N0FB 4G3YL 4G6AD 5DEFA 1GAFH 3CFCH 3SOBH 3PV6A 2I5YH 1G7QB 4KDVA 2RB8A 1J88A 4E41D 1CXIA 3HC0A 3MJ8A 3T09A 1Y18B 4Q2ZA 3BN3B 4CUCA 1TFHA 1I85A 1U6AL 3VXRE 5I1DB 4MDIA 2B2XH 3FFCE 3L3GB 2W60B 4M8VA 5SWSB 1FFRA 3F58L 1ODAA 3HN3A 2YN5A 1S9KC 3B8YA 4PJAA 4L4VE 3K2MC 2VQUA 5GGSB 1DP0A 2G9HA 1NLBH 5CMAA 1MFNA 2C3VA 3G6AA 2RBLA 2VE6B 2PYEE 1PZ5B 4MXVE 5TF0A 3AAZA 4M9OA 4CU7A 4PB0H 1VERA 3NCJH 1TJIL 4PJXA 3GMLA 3WEXB 1CD9B 2EE3A 5KS9F 1WUNT 5EFIB 2V9QA 3NN8A 3IDYB 3MA7A 4WUUE 4GG8A 1DCLA 5B8CA 2IWGA 1BJMA 1ZOXA 2UUDK 1PW3A 1UB6B 5EBLA 4S1QL 4GKZA 3UYOD 3KYMB 1R3LA 4LCUA 3BMWA 4J3WA 3G04A 4WFHD 4F57L 2VUOA 1Q0XL 1F42A 3QUZB 3NIFE 1G7LA 1BFSA 5EC1B 4HUMB 1F45A 4JRYE 3NCFB 2CDGB 3ULSB 4FN0A 4OZFH 4WI3A 4TVPD 2G5BB 1RHHA 4ODWB 1X5XA 5CJQL 3D39E 4OLXL 4JN1L 3L7EA 2AK4B 1T0MA 5HDQL 1IBGH 3MRPB 3S35X 1T1XB 4IRZH 5HI3C 5HYFA 4FQQA 1NFKA 3PV7A 4TTDC 1EJOH 1EMTH 1FZOB 5FDWB 3W82A 1NL0H 3PDGA 5EZJA 3VWKD 2WQRA 4WI8A 5JOEA 5FGBA 4P2RD 1I1AA 2IPKB 5I9QC 3HCVA 5FUZH 2QTEA 1K6QH 3IGAB 5DMJB 5HY9B 3VWJD 1JZ5A 2J4WL 3WFEH 4Q9BA 1XGUB 2UWEB 4JFYB 4XMKH 3VXUD 3WFHA 3T8XB 2V7HB 2P45B 3GJEB 2IG2H 4JREC 4NBXB 1T66D 2H26B 2IBBA 4M3KB 3RKDD 3EKCA 5IT2H 4U31A 3MNVB 1NDMB 3EO9L 1KUMA 1P7QD 4KJYA 4XB8A 4GRWH 3Q5OA 3IAGC 4XAWH 4U49A 1XGPA 1I8LA 1RJLA 3MUHL 4YPJA 3TVMB 1TITA 2GSIB 3L5XL 3OJVC 3RDTD 3O6FC 1XGTB 3FN9A 5MEOB 4EDXB 1PJ9A 1QA9A 2NXZD 2OJEA 3IU4H 3MLRL 2X4OA 5L6YL 4HKZA 2C1OA 3E6FB 2GEEA 4WO4C 1MUJA 2X05A 3PWJA 4X99B 1GJIA 5M94B 3Q6FB 3PGFL 4QRUB 3R8BB 5IFJB 4L9LC 1HHIB 1VACA 3MLWH 3IT8D 4OZGA 2V6HA 5HYJB 2H32B 3DWTA 1A47A 2ITDA 1IGML 5L2KD 4FQXC 2IBGA 2CUMA 5DK2A 2A1WL 1YQVH 2GSGB 2F54E 4GMSH 4OCMC 3HG1E 4WFED 5DK0A 1DVFB 5T3ZD 2A6KB 3MRLA 1XR8A 5C0JA 2HRPL 3OKNA 3WLWD 1AD0A 4JFDA 4X6CE 5D6DC 3C87A 4X7EC 2AK1H 3CDYA 1KACB 4KVNL 4MJIE 4N0YH 1WBYB 1IGCH 5EU6D 4LAQH 1GGBL 2O5YH 2UYLB 4M43L 5K9JL 4BYHA 5GRYA 4R96A 3MUGB 2YA2A 1AJ7H 5J4MA 2W0KA 1AHWC 1JJUA 3NFSH 4OKVB 4NUJA 1A21A 2P5EB 2X9XA 3MBEA 3D18A 4WU5B 4UDUB 2V2XA 3FMGL 4M48H 1FP5A 2XFXA 4MNGB 4PG2C 3TBSA 1R3KB 1XGQB 1MLBA 1NCBL 1RY7B 4HWNA 3RTQC 3MZTA 3WIHA 3OKOA 4ZXBD 4X6DA 1UACL 3CSYA 3RU8L 4AENA 1XT5A 1PDKA 2G2RB 1OPGL 3G08A 3TNMB 3WFZA 1UM5H 4CNIA 5JHLH 3SQOL 5C08B 3SDCA 1KG0A 2J8UE 4MB3A 1AE6L 3P0VL 3BWAA 4GKNA 3BPCA 5DQ9B 2VLRB 4XP6L 4L8SA 1R0AL 1SM3H 1H8NA 3RL2B 5L9DL 4RIRB 3DRTB 4LP4A 3BKJH 1RU9H 5C0ND 4TQEL 3UTSE 2BNRB 3UYRL 5I8EB 4JHAL 1U8QA 4XMPL 4NNPH 1N2RA 4H20H 2G75B 3LEVH 1Z9OA 2PR4L 3NGBB 1M05A 1X5FA 5ALCL 5JLZB 2HT2D 3SE9H 1T80A 1HILB 5CD5D 1WSST 3SDXF 2JK5A 4KKCD 1J0IA 5DO2C 5EU3B 3GMOA 5IVNA 5D2LF 3H6JA 3LQAC 3S4SB 5IGXL 4F7MA 5EOCL 4JFFE 4KTYA 5INCB 4NQTA 1T89A 1FHGA 3H7BA 4Z7WB 2CMRL 2DQFB 4Z7UA 5IM7A 5B38B 1GIGH 4YAQA 2IADB 4F2MB 4NKOA 4K23L 3AFLA 4JFED 2XOTA 3P0GB 4PJHA 4JO3L 2PO6A 1IQDB 4YZFE 1SJVA 3CD4A 4GS7C 1E27A 1A1NA 4A6YA 1RZIA 1V3JA 4MAYD 2A9ML 4GRLD 5LG1A 3MLXL 1XF5A 2IQ9L 2Q8AH 4MHHI 1FPTH 1SYVB 4NKDB 2NY1B 3TBVB 1FSKC 4HWZA 2XTJD 1HQ4B 4TUJA 5E8NA 4HXBL 5FYLD 1L7TH 3MRDB 4X7CC 2FL5A 3NIGF 4P46D 4MMZC 4ZPTB 3GSXB 1A6ZA 3BKCH 1GXEA 3QNYB 5HD8C 5INDB 1KYOJ 3JV6B 1IE5A 5CUSH 3H42L 1I8KA 2MQ3A 3PHQA 4LPCA 1ZANH 4KMTH 3KXFB 4G43A 3UAJD 2J88H 2BSTB 1RURH 2G60L 4KK5D 4PRIE 1NAML 3U4AA 1K5NB 4ELMF 3WHE0 4CKVX 5C6WH 1LD9A 3T0EC 1OLZA 1W8OA 3L3JA 3RKPA 3Q5YA 3GBNL 1FBIL 2AJYL 3KPOB 3SN6N 2MHAA 2ENSA 4Q7DA 4K71B 4ZSOE 4EI5B 1HHJA 3EBAA 4JANA 4JRXA 2FD6L 4J4PD 4PJIF 5HHQA 4POYA 2WINB 3UZQA 2EYTA 3HAEB 3HC3L 1SBSL 4LSVL 3N85L 4U1NA 4Z8FH 2ICWA 2P5WE 5C0CD 2QKIA 4LARH 3I9GL 5I75B 3PJSB 1TCRA 5ADOL 2NX5A 4G9FD 2Q6WA 3SE8H 3FB7A 4YLQT 3O2DH 4C57C 4ZAKD 2FEEL 3VRLF 1DN2A 3QXDB 4XXCA 3TBTB 4JZOB 2FDBP 1B4RA 1JZ8A 2IQAB 4PPTA 2SEBA 1T6VN 2GTWA 1X5JA 2P42B 3MCKB 3T3MF 4CL7A 1MCCA 3FT4B 1HSAA 1UM4L 2PTTB 5E5MB 3QUKB 3SJVE 1S8DB 1X5KA 4JFOA 3TV3H 4NN6B 2D31A 1FNSL 2W0LA 3BIKA 5ICZB 4JKLA 3RPIA 5JHDE 1IAMA 1P9MC 4GMTH 5I76B 1FFOA 1I9JL 3KDMB 1KTKE 2DYPA 3BGMA 5EUOF 3QIUD 1DBKH 2CPCA 3FO2A 4OZFB 2BVOA 2I60H 3QFDB 2C7UB 2A9NL 5E2VH 5I16B 3HZVB 5L0QC 3H3PH 4HS8L 1HIML 3BP4A 1WAAF 4S1DD 4XCFH 1F6AB 2OL3A 3U36A 5H2BB 2D7PA 1WTGT 3IU3A 5GRZA 5DD3L 1HH6B 5A1AA 1UA6H 1JTOA 5C6TL 4TYUA 2CDEA 4FRWA 3L3OA 4WRLA 3K4DA 3CMOL 2A6IB 5T1DH 4LLYA 1Z0NA 5CIPH 5F1IB 5H35B 3ZSTA 3QEUB 5KVDH 2R15A 3BFOA 1AO7B 2VQ1B 4Q0XL 4NNXA 3CFEB 4BSVA 2AEPH 4PJBE 5H37G 3TGXA 1UJ3A 3TN0B 4R2GD 1O7SA 1UH3A 1OGAE 5EO9A 2Z91B 1C5BL 1NGQH 3CUPB 3LS5H 4NRZB 1A7PL 5HI4C 2CK0H 4PY7A 4YHPA 3KLHC 1S7VB 2D7OA 3W11D 1TDQA 3QHFH 4IIQB 4XNXL 1IZKA 4GRWB 4BA8A 2YK1L 2ZKHL 2X4TB 5IV2B 2CKBH 2R23B 4QHNB 4WTZA 4M7LT 5DC4B 4E42B 4Z0BL 1JHTB 1W2KT 4AEFA 4Y2DB 3CXHJ 4ONGL 1R3HB 4NHCH 4PRNB 4Z7NF 3C2AL 3PL6C 2OM5A 3BHBB 1NGZA 3KPSA 3LHPH 2AXFB 3MOQA 3P4LA 5LAXA 1OTTD 5HYSG 1RZ7H 1NFIA 5IVXE 5TFSL 2IAMC 3VXNB 1U8HA 4JG0H 4DK6A 1JNLH 3MUJA 1T7VA 4Y1AA 3SKOA 3SGDI 1TZHB 3BEVB 4X0KA 1AFVL 2DLFL 1F3DH 2BNUB 4G8IA 5T1LD 1BJ8A 2IANE 3EHBC 3QJFA 2R56L 3SGDH 1FGVL 1OAQL 4QHMA 4MLIA 4XBEH 2X2YA 3RWEA 5I71C 4QHKI 5IMLB 4PP1C 1F4WH 1ORSB 5DEZA 1EAPB 5C9JA 3GSNL 3OB0K 3U0PB 3QA3B 4YHOH 2PCPA 2VDNH 3BZ4A 1AXSA 3DXAA 4JPWH 3FRPA 4YNYA 3R1GH 1C1EL 4IMLB 4ZFFA 4EN3A 1MHEB 5I1KH 1DLHB 4PUBH 5DRXA 5HXMA 5HVWA 1FZMA 5L2JB 1DBAL 3GRWH 2YA1A 3BEWA 3RY5A 1MHHB 2HH0L 3DETD 2ZUTA 5E8DH 5HHVL 1JPTL 2WQ8A 5KAQG 1GVIA 5SWZA 3RVTD 1E4XL 4APQD 3RAJL 4G80B 3HI1A 3GMQB 3I3EA 2X1PA 1CICD 4AQOA 2VXUL 2HVKA 4NQEA 1AY1L 4MWFA 1E6OL 3ZKSD 4C59B 4RFEA 3VFUA 3X17A 4X6FA 5EO1B 1YEGH 4DZBA 2X4UA 1RK0B 5ESQA 1LP9F 1JUFB 1UG9A 4UQ3A 3V5HB 3KPNA 3LKPA 2J6EL 3LN9A 5HHMB 1QFUL 2NR6C 1S9XA 4L3EB 4NRXA 5HGBA 2I9TA 3QG6A 1MI5B 1R5VB 4HGMA 4OUUB 4P57A 4AL8L 1ZEAL 5TF1H 3QIWD 5KS9B 5EU4B 5C0AE 3KJ6H 5LXGH 1MFEL 3CK0L 3CX5K 5KVGH 1RZJC 2LFGA 2NYYC 5CAYB 3MROA 2OR7A 3QEQB 2BXZA 5MENA 4OSUH 1BOGA 1AGEA 4HF5L 5CEZE 1U58B 1FC1A 4LEXH 4RAHA 3JV0A 4YXKH 5FYJH 4OUOA 4ODUA 1P4BL 5IBLC 2VLLB 1F00I 1BZ7B 1R5WA 3IFOB 3AROA 4O58H 4ZUUA 3QDMA 5D7IF 1NMCC 3WUWG 2OI9B 1L0QA 25C8L 1LO2H 1X9QA 3PP3K 1QFHA 5MI0B 4DKEL 5IIEB 1V7MH 4JFHD 4DOHB 2AEIT 4FNLL 3TA3B 5E03A 4WENB 3WS6A 5E9DA 1X4YA 3QCUH 5K33A 1YN6B 1J0HA 4LVHC 3UZEA 5D1ZA 1HI6B 4RMRA 1KFAH 2CGRL 1U8KB 3CFIC 2VZSA 4JM2F 2J12B 4L8BA 4YHLH 1Z6JT 4U1SB 1RZJL 3G5YB 1G9NH 2QLVB 3ZE1E 2A6JB 2MQCA 2HKFH 3MRBA 1AXIB 3RVXC 5LGKA 3A6BL 3CVHH 4CMMA 3AREB 4M6NL 1RJZA 3QWRA 1T7ZA 3NCBB 1E4JA 4JAMB 3QQ3B 4K3JH 1A3RL 1BBDH 4UIKH 1KENL 3OKEA 3W39A 4JHWL 3H9SD 1N6UA 3PABB 3P4NA 4FTVD 4M7KH 4ZFOB 5DTFA 3L3DA 2R1XB 2Z0BA 3I6LD 4FZEH 3W0WD 5DRNB 3D0LA 3AY4A 3FB8A 3QJHA 1YEDB 2R1YA 3WIFA 2GJJA 3V7AE 3TO4C 4AG4H 1MAMH 3LSOB 3DX8B 1EX0A 1LE9A 2YR3A 3HS0A 5MP6L 4MJ6A 2KZWA 1N4XH 2D03L 2NY3B 4LHUB 4AYFA 4KHXH 4O51A 3RGVB 4TULL 5CBAB 3EO0A 4NQCE 2YSSA 1JWUB 1A1MA 4DK3A 4UI2A 5BVJA 5DA4A 2ICEA 4PJ9C 4PRHB 4TVPH 5F1NB 3PQYB 4GKSA 5E8PB 4Y0GA 4F9PC 5GGUB 3S5LG 4V1DD 4ZTPH 3TYFA 3QISA 4EBQH 4R4BB 1ZWIA 3MGTA 6CGTA 4CN4A 4QO1A 1MCFA 4IEFB 5ADPL 3HPLA 3G9AB 5DJ6B 3DNKA 5C0FB 5IK3A 4U33A 4U1GB 4GW1A 4RWHA 3V9FA 1QR1A 3FQUB 4WY7H 3ECBA 1H3XA 4FOMA 4G8GD 3WNMA 1YPZF 5DHYA 2GITB 4HS6A 1ZT7B 4IDLA 2O93L 3WMSA 5D7KE 3BESR 5C07A 3DURA 3P4MA 4XWGL 4HMDA 4RMQA 1LK2A 4UT6L 4OT1H 3AB0C 4TNVF 5E2TL 5IBUG 1N5YH 1AGBA 4XZUA 3CIQA 3VFWB 4L4JA 2X7LB 5DHXB 5IHBA 1NC4B 2VJXA 3SBWA 4I3GA 4PJCF 3STLA 1QBBA 4TVSa 1ZKAA 4OCXL 4NGHL 3VG9B 5D71H 5F7HA 5E2JA 1TQCB 5JW4R 3AVEA 5DUPL 4PJ5B 1RUKL 1WLHA 2VLKD 5F9JA 3SCMD 2CLZA 2EXWC 4RMSA 5IEKB 2F8XC 2A2QT 1NFDA 4U1LA 3ZDXF 4X5WA 4UDTB 3WO4B 5AG9A 1RMFL 4Y4KC 3LAFA 5J06A 1LE5A 1CT8A 1PD6A 1J10A 4IRJC 1W72L 4M7JH 4U6HA 1UC6A 3D0VA 1MIEL 1FVDB 1MCSA 4GW5A 1NMAH 5CJXA 1BBJA 4KKAC 3VXQB 4OI9A 1TZIB 2XNAA 4ALAL 3FONB 4C56E 1A6VH 2F5AL 5CEYA 4OIIL 2NY0B 4NZRL 5CIPB 2R2BB 2ZG1A 3EOBB 4XXDB 2DKUA 4TSAL 4DTGL 3CAFA 1ZLWK 2EXYC 1J8HA 1NLDL 4LPVA 5J9PA 4HJJL 1GZPA 4WVRA 5T3ZH 4OCYL 4GUPA 4LSRH 4ZD3H 3SDXB 3DROA 1FDLH 1DQDH 3FQXA 4NHUA 3QNZA 4X98A 3AGVA 5F1SA 5D2LB 1PQZA 3DVGA 3G6JE 4DGYH 3THML 4H25B 1JK8B 2GJ6B 3MLVH 1VGEL 3ZE2E 1YMMD 4P59L 1G7JB 2O5ZL 2KQNA 3O0RH 2GCYA 4HV8B 5DJ8A 1T83C 3W5NA 2X1XR 2Q76B 4HJ0D 2C3WA 3ZKXB 4X80L 3NCEB 2Z4QA 3LQZA 2W65A 1D7FA 3U7YL 3EUUA 5JXEC 2FX8H 1A1OB 2YD6A 3GMMA 3V5KB 3F7VA 3IDMB 2YXFA 3E8UH 4ZQKB 1S3KH 2R1WB 3HZYA 4FA8A 3GI9L 3RL1A 1UADC 3VFPA 4XVTH 1GC1H 1EO5A 2OR9L 5F7DB 3T1FA 3AM8C 5B3NA 2ZNXA 1DBJH 1WBZB 4HT1H 3CFKB 1AKJA 4TN9A 4QRPB 4NP4H 3FTGB 1KPUB 2Y06H 1WFOA 5C0BB 3QUML 1CR9H 1U95B 3DV4B 4HDIA 3QQ9C 4O2FB 3U9UB 3UTTA 1WT5A 4PJFE 2HTKC 5CZVH 1LNUB 4UB0L 1BEYL 1T22A 2RHEA 5D8JH 5E1AB 2R0ZL 1ZHKB 4OLEA 1Q94A 4ELMB 1Q9LA 2OZ4H 3QWOA 5I8CA 4RGNB 3IF1A 3MV9E 4OV5A 5DJYB 1KCVL 5H37H 5IBTL 3WBDA 1KN4H 1XIWC 3WFBH 3WJLC 1NBYB 3D9AH 3OR7B 5DVNA 4PJEA 1B0RB 4Y16B 4B0MM 1KT2A 4KDWA 2VUYA 1KJMA 1TTUA 4HWEL 2YKLH 5MERB 5K59E 3FB5A 5TDPA 1VB9A 4QTHB 3AU1A 1YEJH 4MNGE 1KJ3H 2YPLB 5KSAB 3OV6A 3TCXA 1IGTB 1WK0A 3NZHL 3ISWA 1IRAY 3VXOB 3G5VB 1JVKA 2XA8H 2NPLX 4OQ1A 1ZGLP 3KPPB 4RA3A 4W70A 5IKCB 2LTQC 3DECA 4P2QD 4X6BA 3QI9B 3SDDD 4LCYA 4JPIA 1NAKL 3O6FA 5F9OL 4YHKL 5FHBH 5FYLH 1BIIA 3BISA 5C08E 3C6LD 5IB3B 3RUGA 3VMPA 4PJDA 4M6MH 2MPAL 5EH1A 4WO4A 4QY8B 3K81A 1K9TA 5DQJA 1F3DJ 2HT4C 1MREL 5EUOB 3VMNA 1WFUA 2XZQL 3PWLA 5C0IB 3MOBH 5DR5H 3B8SA 1YEIH 4L9LA 1KCKA 5DD5L 1GZQA 3H9HB 2NZIA 4GG6E 3ES6B 1RIHL 1WIOA 1N0LA 4LKXB 4E41B 2UZIL 3OKLA 5E6ZA 5FYKD 1EGJH 2DWDB 4Y5YB 4FQXA 4OBRA 4U2ZA 3BSZH 3I2CH 4QHLB 4JDTL 1MCJA 2EEDA 3VXTB 4YHNB 5K9OB 3WN5B 4L29B 2VLME 1WFTA 4WUKH 4H26A 1A6PA 2A77L 4F7PB 2CDFB 3CVHB 5D6DA 3DGCR 1QRND 2Y6SD 4Z7OF 4PJ8D 4UBDC 4XCEB 3EYSL 3QXAB 5CJOL 4G6KL 3UJJH 5HDOA 3MLSL 5CEZL 2ZSWB 5T5FL 1U36A 3O3BB 2OJZH 1PZUB 2XYCA 3UBXG 3IETB 5F70A 4I0KA 1TLKA 3LKSB 4L8DB 4N8CH 4XPHH 4W4NA 4UILL 1UCTA 1AHWA 4JY4A 4WWKD 4R3SB 4XNQA 3TNNB 4Y5VB 4RMTA 4F58L 5JPNA 4XNYH 1EFQA 4PG2A 2XWTB 15C8L 1KF9B 4M4RA 3IJHB 2JIXD 5FOJA 5IW1B 3LKOB 5MEQA 4K7PX 1ETZB 1WITA 3RTQA 1E4KC 4ZDHB 3PDOB 3CZFB 5GS2D 1UZ6E 4G7YH 3GKWH 3OXSB 4YO0B 3FQRB 3BH9B 1IM3A 3I6GA 3HNSH 5CWSB 5CCKL 4ELKA 1IKNC 5CBEA 3EYOB 4ODHH 4M7ZC 3VFTB 1R24A 4N8VA 1L0YA 1UZ8B 3CDCA 4QRRE 4KK8C 1C8PA 3ARFD 5IVZB 4FXKB 3VD9A 2R0LL 5D93C 1MCHA 1F4HA 1C16A 2BC4B 3V4VH 5F1KC 3VWKB 1QSFE 4L3CB 1MFBH 4F7CA 5HJ3A 1M7XA 2YMXH 2AJVH 4P2RB 1NSNH 3JVGC 5GZND 4F80A 3D85A 3ZMRA 4KQ4L 4LCWD 5ANME 5EORH 1UKSA 1KEGH 3X14B 5IROC 3VWJB 4Z7VF 3VXPA 5D7SH 4HUXA 4U3CA 1U8IA 4WFGE 3HI6L 3MRCB 4F37F 5F3HA 1T7YA 1P4IH 5TH2B 4K55A 2OK0L 4XH2B 3S6CA 3L5HA 3R8QA 4BZ2L 3CFBB 4EI6B 3DTXB 4YGAB 1CL7L 3I6KA 1UB5A 4XCCL 4RFOH 2HRLA 5D5ME 4OI8A 3S3JA 1P7QB 4MD5A 1DUYA 2V2TA 3GHBH 4J6RL 4KQ3H 3LS4L 4P5MB 3BVNB 1B0WA 1OTUC 2EH8L 2R0WL 2YPVH 4RWYL 3RDTB 5DUML 3ARXA 3QFJA 4R90H 5DGRA 3TCLB 4RAUB 4AT6A 2NXZB 2PW2A 4ZFGH 1FO0L 3RVVC 3T0XA 3C5SB 1OAKL 3QO1B 1HEZA 2D7QA 2AVGA 3QDAA 2O5XL 2J5LC 4PGCB 5EIQA 4D9QE 3NFNB 1D5ZA 5HHOA 4I2XE 2H2PC 3IDYC 2XZAL 4HCRA 1WWWX 4U7SA 2EC9U 4ZNEA 4EUPH 4PRPE 4L5FH 3MCLH 1KCUL 3OTTA 3LV3B 1HXYB 4ZNCD 4PREB 1X5IA 2WLZA 3WKML 1F90L 1RUPL 1NMBL 5M7QA 4X4YA 2VXQH 5L2KB 1OAYH 3ZKND 4ZUTA 5AZEL 1A2YA 1WZLA 2ZUSA 3ROOB 4L4TA 4WGWB 2EZ0D 5IB4A 3KYKL 4KTDH 1U9KA 4ZUVB 3AS0A 5D7IB 2B0SH 1LK3L 3K8KA 1FAKT 5IB5A 4OM1L 1T20B 1XAUA 2FX9H 3O3EA 4YXHH 3CDGB 1UYWL 2ZSVB 3D69B 3ARSA 5GRWA 3T0EA 3GUTB 4QRSA 5FKPB 2UY7A 1H3VA 4OLWL 1T2JA 4HUKB 5FO9B 4X9GA 1VEOA 3EOAA 3OZ9H 1P4LB 4MLSA 3H0TA 4LCCB 5DRZB 3MLZL 1NGWB 4D9LL 5CKAA 4FG6D 4JM2B 43C9B 2ADGB 1F4YH 1OARH 5GS0L 3GIVA 4G7VH 5DUBB 3L3IA 5ICXA 2DQCH 3MYJB 4G6FD 4HFUH 3TM6A 4EVNB 4RISL 3QDJB 1VEMA 3ULVF 3VMOA 2X4QB 1J9CT 2DQTH 1D5IL 4HPOH 4L4VA 4KJPC 5E5RB 3K2UH 1A7NH 4ZXBB 4I9WD 2PYEA 3I50H 1B3JA 1AXTL 4ODSH 3U6RA 4QOKE 3TVMC 2E5EA 5DYOB 5IQ7L 4XBPA 1W0VB 5DD6B 4OV6F 3TP4A 1RUQH 2PETA 2W1NA 5CP7A 5KW9L 1P9MA 2EDXA 2HJLB 2P49B 3RX7A 5C6PB 2QSTA 1IGIH 4WUUA 3MV8A 1MJ8H 3IXAA 2R39A 1T3FA 3U0TB 3U0WH 4JZNB 2HLFD 5E08H 4NYLB 2AI0H 1WJ3A 1F8TH 2YD9A 5E70A 3GBMH 2WM0A 3QPQD 2BK8A 3MLUL 3V6ZB 3L3KB 2ERJB 4JRYA 4WHTB 3JBG7 1MCPH 1RZFH 4P23D 2A6DB 5BS0E 1G7MA 3FN3A 5EO0A 1MJJB 2GT9B 5LWYH 1FVEA 2GKIA 4R7DB 4U6XA 1UXSA 2YPKB 3OG6B 4YHIA 1JZ2A 4J12A 1F2QA 1DVFC 2OMBA 1JGDB 1FL6A 1QYGH 5JW4M 1CXLA 3FFDB 5BRZD 3QZWB 3SGKC 4Y4HC 1ND0B 3KPRA 4CJ0A 4JQIH 1N0XL 1I4FA 5DQDH 3MRGA 3CC5A 1TVDA 1YPZB 3DI2B 4L1HA 3RWCA 2EDOA 4HZLB 4MA8H 5AAMA 1YECL 5D70L 3QULA 2H3NA 3U4EA 4KRPD 5A40E 1LEGA 5I1CL 4L8CA 3OKMA 4MAYB 5TE7L 4GRLB 4CW1B 3MRQA 2FGWH 3HMXA 1SJHA 5I17B 3CZJA 2W92A 3I75B 4U1MA 1U8LA 4NJ9H 4PJCB 2XTJB 4PGBB 2HFTA 4M93B 4N9OB 4XP9L 5E95B 5TQ0L 5EUKB 3PL6A 4P46B 4RA0C 1IEBB 4QRQB 2RQ8A 1IAKA 1FGNH 2H9GA 3GJFH 2AGJL 3G5ZA 3REVA 5HYSB 3D25A 5GGRA 1T04A 4BH7A 1Z5LA 2QQKH 4X8XA 4E0RB 1YEFH 4JZJC 2IAMA 1NDGA 1ITCA 1JFQH 5E4EC 3GGWA 2BOBB 5D2NA 1CQYA 3PIQA 1JI1A 4KFZC 4MNHA 3PWPE 3QH3B 1B88A 4P0DA 1UVQB 3CXHK 4FABL 2CIIA 1FCCA 4NC1C 4DZ8B 3P9LB 4K94H 2X4NA 4XAKE 2UV3A 5DMIH 1LEIB 4RMVA 3C8KA 4JVWA 3OSKA 5JOPD 4MA3B 2ZCLL 1H15B 5FA4B 1UXWB 5F7KC 5C3TA 4MAUH 5HYQA 2I26N 2FX7L 3RZCC 1CD1A 3M1BA 4W6WB 4G8EA 4HSQA 5EBMB 1IT9L 4ODXA 5C0CB 3N1MC 3HG1A 4G9FB 4U6YA 3JV4A 2ADFL 1SJEB 5JQHC 1N59B 4LNVA 1MWAH 4J3SA 4HC1H 3HUJB 2D0FA 4TRPL 5I8OH 3DX9B 3VRIB 4WTXA 1IC7L 1T0NB 4POZD 5FCSH 3IDIA 2EYRA 5DJDB 1U0QA 5FGSA 4I77L 2AJ3B 4GSDH 4OZGF 5LCVL 7FABL 3TLRA 1MRDL 2ARWA 1FE8H 3WNOA 1JWMA 4MJIA 4TUKL 1W0WB 1WEJH 2WBJB 3SKJL 4O9HL 1TJGH 2VLJE 4OZHE 4M03A 5KBNC 5MHSE 3IJSA 4DCQA 2V5MA 4J8RB 1J5OH 3QDGD 3S36H 1WC7B 5GSVB 1VEPA 3GSWA 4OGYH 4BM7A 3VI3F 2NY1C 4HGKC 3QIUB 5DSCB 3VFGH 2BDNL 3DSFL 4KKLC 2VDOH 2H8PB 5FK9B 1A7OL 2QR0B 3BX7C 5C0RL 3JWDC 2XPGA 5LJYH 1G7HB 2V17L 1SVCP 2J8UA 4H88H 2D2OA 3CFDB 5I1IL 2HN7A 3RWGA 2VN7A 4D3CL 3N9GL 4PGDA 1CXFA 1FYTE 4NKQB 3STBA 3W9EA 1NEZB 4DGVH 3HB3D 4UT7H 4U1HA 2QADD 1WZ1H 4BFIA 2FJHA 3WUWB 1IKFH 1MIMH 4ORGB 5C09B 3UTSA 1FNEB 3AS1A 3L9RA 3NTCL 1WWAX 2BOCA 3GK8H 3B2VL 5AG8A 4JFQB 4F33B 3B9AA 3QQ4B 4D0DA 5E4IA 3QUXD 4OGAC 3CH8A 5ALBH 3HLAA 4EI5C 1YYML 4RMWA 5HPOA 3JWDL 1X5LA 3BW9B 4PP2A 2EC8A 4JFFA 5F7MC 4LBEA 1S7TB 4UV7H 3UBXI 4R26H 2NCMA 1G84A 4IRSD 5GGTH 4YC2C 3MO1A 2GFBB 5IR1A 2BNQE 1P1ZA 1YEHH 4PJAE 2HFEA 5GRJH 1LO3H 1N64L 4CVUA 3PP4H 2CKNA 1GAFL 3BRFA 3SOBL 3CJJA 3EZJB 3C60C 1G6RH 2Z31D 5JTWA 3VXSD 2VZUA 5FA3B 2FR4A 1GGTA 5DD0L 4PJXE 1SEQL 5CS7A 1JN6B 5D6CA 4EUPB 2HFGH 3MV7A 3O2WL 1QUNA 1IC4H 1EHNA 4Z5RB 5HGDA 5GXBB 2VDKH 5D7JC 3TO4A 1M6OA 4K2UL 2DTMH 1BZ9A 4W4OA 4UU9A 2GUOB 3VXMD 5D1QA 5ISZD 1MQKL 3OKYA 3TJEH 4PJHF 3DARA 3WHXA 5T1LB 1C08A 1NLBL 3W2DL 5EOQH 4FFZH 3OJDA 3KG5A 5F3BB 3S34H 4PB0L 4PJ9A 3NCJL 3S5LB 5JQ6H 2EDKA 4BUHA 5D1XD 6FABL 2V5SA 1T4KB 4PRIA 1FNGB 5FOBB 4GAYB 1INDH 3UROR 2B5IB 4GAGH 4YFLF 4OD1H 2IBZX 3IFNL 3NH7L 3HI5H 4P3CH 1S7QB 3REWB 5DDHA 5DJAA 3QO0B 2DQHH 3ARGD 5ACZB 4QWWD 3UTZA 3O4LA 1SEBA 1I1CA 2P5WA 4APQB 1RIUH 1KLGA 4B5EA 3NPSC 3UPRA 5IBUB 3GSQB 4QRTA 4ONHA 1W72A 2X4RB 3OX8A 3F7YB 5C8JA 2XXMB 1HZHL 4N5EC 3ROLA 3FO1B 4PRBB 3RX8A 3CPLB 4IIQC 2EDYA 3D3VD 2HG5B 4LVNB 5DJ0A 4K7FB 5B39G 5FF6B 1B4JH 3EYUL 1QVOA 4FQCH 2E7HA 1B0GB 1EMTL 2HT3D 3OXRA 2BVUA 4OCNC 5C2UB 4PG9B 5ACMA 3ZYOA 3B4NA 3SJVA 1CFSA 1MFDH 5GGRY 1FNHA 1I7ZB 4XHQA 1K6QL 1RK1A 1AQKL 4XNMA 1VFUA 4K8RL 4LL9A 4S1RL 4WNQB 1H5BB 2JELH 5FO8A 2XWBA 5JHDA 4JLRB 3WFEL 4DFIA 3HE7B 4BKLA 1VPOH 43CAB 4M1DL 4XMKL 4NQDB 2HTLC 1IM9D 4CMHB 5JDSB 4Y4KA 2EDDA 3JWOL 4GXUN 1ZA6A 2IG2L 5FYJU 3C08H 4IRJA 4MB5A 5E1HB 2P8LB 1YY9D 4NKMA 5IT2L 3EGSB 4JVPA 1LDPH 1MFAH 2FSEA 4ETYA 3TWCL 3VFVA 4XAWL 1TVHB 4XP1H 5FYKH 4I3RH 5DD1L 3X3GH 5I1JL 2IH3A 3OAUH 3RIFF 2OTUB 1D9KB 2NLJA 4WW2F 3MMEA 3EO1A 1A14L 1YMHA 4JN2B 4O02H 2BSRA 4YGVB 2RFXB 3Q3GB 3IU4L 1JHLH 4P5TD 1ZGLA 4KKNA 3KLAB 3SE4C 5E99H 2ADJB 2R4SH 4R7NA 1GGUA 3RI5K 4Z7VB 4JPVL 3ARBC 1AGDA 1CDCA 2VDQH 4HH8A 1D6EB 4P4RA 4PJBA 3AXLB 4TSCH 1I1FB 4GO6B 4JY5L 2E3VA 1EBPA 1FFNA 3MLWL 3ULUD 1I9EA 4MS8D 2F53A 5D9SB 3H9SB 1QPPA 3BQUD 3PNWA 1T83A 2VOTA 1KTDB 5B3JF 3QUMA 1YQVL 3W0WB 2L4OA 2C4FU 2YPLE 4JDZA 1AI1H 1S7SA 4HBCL 5SV4A 5SWQA 5TE6L 2IPTH 3RWHA 3DVFA 1NPUA 3FCTA 3KNBA 5JXEA 2QQNL 1VADA 1FG2B 4X6DE 2PXYB 3B6SA 3GJFB 5J12B 1XGRB 4FQPA 5GS2H 3ILQC 1DL7H 4CN1A 1CFNB 1IZJA 3T3PF 5HHPA 3NA9H 3V0WL 1WCBB 2DLEA 4M62H 2LU4A 4U1IA 3O45B 3LD8B 2RCSL 3PF2A 3T0DA 1QLFA 2BRRH 1YEEH 4LAQL 3ZL4H 3AM8A 3KGRA 3SDAD 1MH5A 3GSVA 2IFFH 3DRQA 4KV5F 5IVXA 1JV5B 3OGCB 1DEDA 3GO1H 1RFDL 5I6XB 1HH9B 1OAXH 4KK6D 4KY1L 1QSED 1QFOA 4V1DB 4JFZH 1UCBH 4JB9H 2GW5A 2BVTA 4UQ2A 1LVEA 4KUCD 4OKDA 3IKCA 2OI9C 1ED3A 3A6CL 4OFYA 3QUZD 2EDLA 1K8IA 4KMLB 2VO5A 1HSBB 2XRAH 4LLMA 1RZGB 1ZLSH 4G6JL 3BP7A 1UM5L 3TBWB 5EPMA 3P0YH 5IQ9A 1MWAB 3TA3C 2ARJB 3QIBB 4G8GB 4YQXH 4AJ0A 1FJ1B 4YFLI 1CTNA 4QF1B 5IB2A 4QXTB 2YRZA 5GIRA 4Y19A 3DX7A 1H0DB 4OCRH 2AK4D 1ACYL 1Q9KB 4K3DH 4XC1H 5L8KB 1D5XB 1DANU 4WI9A 1X5GA 4GH7B 1S9VB 5EN2B 1SM3L 4NT6B 1XIWA 2EDQA 1I3GH 3WJLA 4Z7UE 4B7LA 5J89A 2EIZB 1EEYA 3S37L 2ZCHH 3O8XC 5I30H 5DS8B 1I8MB 3DMMD 4MA7L 1MRFH 1FLRH 4H20L 3LEVL 2XKUA 4X7FC 1BECA 3SE9L 4MQSB 3ALXA 2VLKB 3VFNB 3QUYD 2N7BA 3MJ8B 2GYSA 1CGWA 1RIVH 5HSFA 4QNPE 1L6XA 3UTPD 2IH1A 4OZIA 4OQTH 3ET9F 1NEUA 4PR5A 1YY8A 4B53A 4KJQD 2DM7A 4WFHE 3FO0H 4MDIB 3BUYB 4KJWD 1EUTA 4RCAA 1RUML 2HAZA 4FQLL 4JFPA 4ZUWA 2RIKA 5CSGA 1FAIL 2OP4H 1GIGL 2NY3C 3ESUF 3VGDA 3I02A 1X7QB 2HVJA 4PLKC 2G9HB 3UPCA 4MXQD 1U8OA 2DQEH 3MUY1 1QZ1A 4OF0A 1S5HA 1EBAA 3CVIH 4KI5D 1HINH 3AAZB 3ARDC 3BN9C 5EZLA 1CF8H 1S5IH 4QTIH 2F8VA 3RFZC 1R5IA 4P4KC 5DMYA 5IOPA 3GMLB 4P2OA 4JGUA 4I18B 1KJ2L 3RIAF 4JKPL 4KROD 1ZHNB 4J3UA 4YR6B 4S1SH 3NN8B 5HYJD 4RGMC 5KSBB 3CFJB 4QT5A 5D96C 2WP3O 4EJ1C 4JRXE 4U1GC 1TXKA 1P84J 1YMMB 5EBLB 2J1KA 3VXUE 4YHYB 3UEZA 3LMJH 2VXTH 5IHUL 4MA1C 1EEQA 2VAAB 1CLZH 3Q5TA 1XF4B 3HNVL 2O26U 5KTEL 2O61A 3RWFA 1U8MB 1HQRB 4NQVB 2E27H 4N9GA 1U3HD 2J88L 2YRPA 4PB9H 4GAJH 1RHHB 1RZ8B 2BFVL 1MPAH 1RURL 5I15L 1QO3A 2PW1B 4ZYKB 4JDVB 2W38A 1CLOL 1IGYA 3L7EB 3M17B 2NY6C 3T0WA 1R6VA 4AMKL 1GGIH 3HRPA 4FQQB 3BXNA 4YDJA 1RSFA 3VG9C 4YHZH 5ETUA 1K85A 1TQCC 3MJ9A 4HKXB 1DQJA 2VZVA 4HIEA 1E4KA 3HCVB 4LARL 3X12A 2Y25A 1JTPA 4DUVA 3SE8L 3KPLA 4OLZL 4IM8A 2EIBA 3WO4C 1IKNA 3FT2A 2Z92B 3IFPA 5DLMH 2AV1B 3IVKA 4ETQB 4U05A 4MDJB 5FV1L 1M7DB 5GHWL 5T1KD 4AEIH 4ORZC 4HK0B 4NQCA 3LB6C 4MCZA 4MVBC 4KJYB 2XN9D 4KVCH 4UTBL 3TV3L 5D7LD 1RJLB 4P2CG 3ZTJG 1QLRA 4BH8A 4N0FA 2BX5A 3MRRA 3BT2L 3JVGA 2BNRD 2XQYG 1FO0A 5C0EB 1G7QA 1TPXC 4YBHA 3T0VA 4Q6YA 2AERT 5IROA 1Y18A 1I75A 1OGTA 4HW6A 3CSGA 1MUJB 4AZ8A 2R4RL 3VI4E 5EU6E 1OD7A 1ZHLB 5I1DA 1II4E 2I60L 1OSPH 3K1KC 5GJSL 2FATL 3BJ91 4NM4H 1KCSL 3T77A 3S96B 1KTLA 3EDDA 2AJSH 4DQOH 4R4ND 1REIA 3L3GA 2W60A 1VACB 5JA8B 3MLTB 1OWRM 5GRXG 5SWSA 4AEHH 4OZGB 5HD8D 4OF3A 1G0DA 5GGSA 1BM3L 4YXLH 5DK2B 3ZKXC 4LSTL 1RUAL 2VE6A 4QXUL 1PZ5A 4P2QB 5T1DL 3SDDB 3WCYA 3MRLB 5CP3A 1MLCB 2AEPL 3T4YB 3WEXA 4JFDB 5C2BH 3KPSE 1MJUL 5EFIA 4D9RE 2CLVB 1QKZL 1AGCB 1QLEH 4Q9QH 3LEYH 2VZTA 3WD5L 1CXEA 4N8PA 1UB6A 3MSPA 4DAGH 2ED8A 3VXRD 4OCWH 3KYMA 4R96B 3C5ZD 1XF1A 1FCGA 4IHOA 5JO5A 1DBMH 1CDBA 3FFCD 1BPVA 2CKBL 4LGSB 5EC1A 4DGIL 2CDGA 3ULSA 2ZCKH 4MQTB 1A7QH 2JTDA 1EO8H 4ODWA 1SJXA 4NHCL 3UJIH 4R0LB 4AH2A 4TNWK 4BSJA 4UNVA 3DO3A 2Q86A 5C9KA 3MRPA 5CD3A 4NFBA 1T1XA 4QCIB 3RVUD 1NCWL 5FDWA 1FZOA 4LIQE 5KSUB 4PJ8B 3SDCB 3MV01 3K46A 1RZ7L 4ESKA 2H41A 3BWAB 1A5FL 3DXAE 4N0UE 1HCFX 3IXTB 1DE4A 2MFNA 4XWOC 4JFEE 5HY9A 1L6ZA 2DDQH 4Z95H 3G6JA 1TQBB 2R9HC 3HC4L 2AEWA 3OWEA 4WWKB 4Y16C 1XGUA 1YNLH 2N7AA 4JFYA 1UH2A 1P2CB 5JZ7C 3T8XA 3TIDA 1FZJA 2V7HA 2JIXB 5ESVB 4LOUD 2A73A 4PD4K 2H26A 3KHQA 1HKLH 4XBEL 1M05B 3OGOE 2AAVA 4LP5A 5KSAC 1L4IA 1PG7X 1NDMA 4HBQA 3S35L 5FYLE 4DN3H 7CGTA 3ZE0F 3D39D 3TVMA 1Q1JH 2GSIA 1ACZA 2VDNL 1JYNA 4F7MB 2E7LC 5J1SC 4PUBL 1XGTA 2XKNA 4EDXA 1UENA 5E2WH 1ITBB 3H7BB 2QQLH 3ARFB 5MENE 5E8DL 4X99A 1VFAB 4J3TA 4YAQB 3U9PH 3LRSB 3JXAA 4LLAA 1MCDA 1D5BA 4OLUH 1JRHI 2D7TH 4PJHB 3JSSA 4G6AC 1HHIA 4JFXA 1A6WL 4KK9D 4PJGF 1T6WA 1A1NB 4I3SL 2AJZB 1U8JB 4LCWB 1YEGL 1JRHH 2H32A 4UNUA 4YBLB 4KZEH 1UH4A 4PJFA 4DUXA 2GSGA 5TF1L 3VFMA 2AXJA 3WIHL 3Q2CA 2ATKB 4HWZB 3KJ6L 5LXGL 4S2SB 5KVGL 3WFCH 1DVFA 3D2UD 2A6KA 1G9NC 1VHPA 4OSUL 3GSOA 2KDGA 3HUJE 3EOTH 4WIQA 1A6ZB 3SGKA 4YXKL 1CWVA 3NACH 1D5MB 3L5WB 3MV9A 2AS5M 1T2XA 5EU5B 3S4SG 2AABL 3UC0L 4LF3A 2Z9TA 3H2WA 2UYLA 2HFFB 2WUBH 3K8LA 3EJYD 1LO2L 4GXVH 2PO6C 4OKVA 3V79C 1QPXA 2OS7A 1WZMA 2P5EA 1OF2B 4U3XA 4Y5VC 1LD9B 4MNGA 3IS1X 1XF2B 1R3KA 1OP5K 1XGQA 2PUQT 3RNQB 4DFHA 1HHJB 4JANB 1JCKA 1WWCA 4KMQA 5EBWB 4YHLL 4M5YH 2F54D 1NUNB 4ZG1A 5EDXA 1TCRB 2Z8RA 4Y2DD 4I8DA 2CUHA 5C08A 1F3JB 2M2DA 2VR4A 3CVHL 3V0VA 2F5BH 3QR2A 1S7UA 4BK4A 5JW3L 4K3JL 2VLRA 2RGSA 4UIKL 3SO5A 5F21B 1NCCH 3STZB 2SEBB 4M7KL 3FN0L 1HSAB 3I3BA 5BV7H 2VNCA 3T0AA 1BFOB 1UWXH 4FZEL 4EDWH 3MRHB 4GG6A 3VWKC 2D31B 2G75A 3LKNB 1LEKA 3RWJB 2FB4L 4G3YH 4I5BB 1INQB 1KIQB 2Y5TA 2VDMH 1MAML 1JF1B 2VQTA 4WW2B 1FFOB 1CGSH 1DUZB 4GW4B 3RZCA 3VWJC 2F8OA 2ZZUT 4WI7A 4HUWA 5CJ5A 4FQ2L 1ONQB 2NXYD 4KHXL 5EU3A 3KPMB 4WW1B 4BZ1H 3FO2B 1N8ZA 3EDKA 4FHBD 4AQ1B 5F7NC 4OAWB 3HAEG 4OLVL 3LY6A 2P7TA 1T66C 5GGSY 4TVPL 1T2QH 2DQFA 3RKDC 4NZJA 1J86A 5B38A 2ZUQB 5ESAA 2OL3B 2IADA 2C26A 4ZTPL 2OTWB 4LMQI 4EBQL 2CDEB 1A3LL 1IQDA 2I27N 4NCC1 4N68A 3RDTC 4BFBD 2F58H 1CDJA 3TZVD 3ARPA 5FUCE 1QRKA 4WY7L 1SYVA 4POUB 3MRMB 2E7MA 1UJ3B 1EFXA 5I66A 1NFDE 3TBVA 5KG9B 3MRDA 4PY7B 5FGCB 2FECL 4OT1L 4L3ED 4OFPA 2VL5A 1MI5D 4S1QH 4ZPTA 2Q7YB 4CU6A 5KSVA 3GSXA 4G6ML 3QNYA 2AP2A 2JKXA 4P23B 1IGJA 5INDA 4TPRL 1U3JA 3JV6A 4M9PA 1MF2L 3LPFA 4QRRA 1NGXA 3EYQD 2R69H 5D71L 3KXFA 1QQDA 1LHZA 3DUSA 3A67L 2NY5H 1GOHA 1ROWA 2BSTA 5I74B 3FAXA 2A74B 3V52L 5CJQH 3PGDA 3QEGH 4JN1H 3WLWC 1NGZB 5HDQH 4NO0D 5EZIH 3MBXL 4X7DC 3KPOA 1XH3B 4EI5A 3P9MB 1NFIB 2WINA 4LCCC 2D4FA 1GYAA 2BVEA 2NZ9D 3PJSA 4Y1AB 3SKOB 3ULUH 2J4WH 3SKUD 4GFTB 4UT9L 1DSFL 3QXDA 1RULL 2FJGB 2QJDA 3FZUC 1UGNA 3QJFB 4EOWL 4YK4C 4JZOA 5AYUL 3V5DB 3C60A 4ZXBC 1KSRA 2IPUK 4KC3B 5T3ZL 3MCKA 3ARED 3EO9H 3UO1H 5E5MA 4ZD3L 3QUKA 1MCOH 5C9JB 2EEAA 1S8DA 4ERSH 1FDLL 1GC1C 3BPNB 4WHDA 2PCPB 2HJKB 3BZ4B 1AXSB 3CH1B 4YNYB 2P47B 3GSUB 5CGYD 5I76A 4DGYL 4EN3B 3MLVL 5D7JA 2Y36H 4OD2B 5DRXB 4UAOB 3QBTB 1AD9B 1IILE 3O0RL 4PRPA 4ZO6A 5C0NC 4H0IA 2P8PB 2EDFA 3PGFH 4OZFA 1T7XA 4KWUA 4HIJB 1DN0A 2C7UA 5EOTA 4LHUD 5I16A 3B9DA 3HZVA 4NQEB 2DD8L 1XZ0A 3B83A 3F7RA 2FX8L 2HT2C 3RGVD 5A3IC 2R2HB 5CD5C 1F6AA 3UTTE 2GI7A 5J6HB 4PLJD 4ONFL 1LDSA 4LRIC 1JYVA 5H2BA 4KKCC 3SEPA 3BGFB 3OR6B 1EERB 1IGMH 1DQLL 1HH6A 3E8UL 1S3KL 3KPNB 2A0LD 2FH8A 3ZTJH 2I9TB 5HGBB 3GSRA 2VDLH 4CVXA 1H3TA 2A1WH 2B8OT 3PQYD 5ITFB 4BQ6A 2A6IA 3VDAA 4RAVA 5F1IA 3DGGA 4PRDB 3ZDYE 1NBVL 3UJTH 1AO7A 3MROB 2HRPH 3BDBA 3RP1A 2BP3A 1BOGB 3MPCA 2FLBT 3LN5B 4WTWA 3TN0A 1BVLB 4ODUB 5HGHB 4PJEE 3L7FB 3B9KD 3CUPA 2Y06L 1NKOA 2J3SA 1WWBX 4FTVE 3QDMB 4OFKA 5TPWL 3VGFA 1R3JB 4M43H 1BZQK 5CZVL 3I6LE 3QDGB 4IIQA 4MAYC 2H6PB 3HZMB 4GRLC 1F58L 4GRMA 2X4TA 3PDDA 2R23A 2DM2A 3VG0L 3LVEA 3FMGH 1WIUA 2GIYA 2XTJC 1T1ZA 2LAAA 4XVJH 4E42A 1NCBH 1JHTA 4QOKA 1HXMB 1R3HA 4PRNA 1CFQB 1UACH 3MOAL 4L8BB 4P46C 5H94B 1KN4L 3WFBL 4BFEA 2PKDA 1OPGH 3RUGE 2DIBA 4PJDE 4JY6A 4PJ5D 3SQOH 4CMMB 3GB7B 2P43B 3P0VH 3QEHB 3UAJC 3VXNA 1OGAD 1HYSD 1Y6MR 4NQXB 4V1DE 4KK5C 3OJMB 4MXVF 1TZHA 3BEVA 4JM4H 4Z78B 5L9DH 5GS3A 3ZKQD 4Y7MA 3GMRB 3DHJA 4RBPK 2DICA 3CDFA 2OXGA 5AWNH 2XA8L 3QUXB 4TQEH 3UYRH 4NN7B 2UUDH 4K9EH 2R1YB 4J4PC 2PR4H 5I18H 4C83B 5FYLL 4HGWA 4DW2H 5J1AA 5IMLA 1LE9B 4XI5D 1FN4B 4XC3L 2NY0D 3SE4A 1UFUA 3U30C 3O6MH 4IRSB 1NC2A 3QRFM 3U0PA 3QA3A 4O51B 4ZAKC 1CDIA 4WDIB 3ARBA 3NFPA 5IGXH 4IMLA 3MOBL 3MXWL 3NIFF 5DR5L 5F96H 4MD0B 1MHEA 3EO0B 3MNWB 5BVJB 5CZKA 4E9LA 5L2JA 3QXTA 2CMRH 2Z31B 3VXSB 2Y72A 1MHHA 3U4BL 4F9LC 4GKSB 4YHMH 2V2WB 3RHWK 1EGJL 5F7WC 3KYNB 2GJ6D 4LVOB 1FYHB 1EH9A 4G80A 3GMQA 1RJCA 1U92A 4YIQB 1VFBA 2VLKE 3MGTB 2I25N 2IC2A 3LEXB 4OGZA 5DMGC 1QBLL 4X7TB 2IAND 4WUKL 1VFOA 4Q97A 4OIAA 2A9MH 1V8HA 3ECBB 3WS3B 5HVHC 3QIUC 5ISZB 1R5VA 1BGXH 1VESA 4HS6B 5DHYB 3S3PA 5A2IH 5F72S 3IJYA 5EU4A 3RWDB 1URLA 1N7ML 5C07B 2AXGA 3DSNA 3JTTA 4HXBH 3P4MB 4HH9A 2NY2D 5TQ2H 1JI2A 5DWUL 3QEQA 1OP3H 2ZPKL 4S1DC 1Z9SA 4N8CL 4XPHL 2Y4SA 4LHUG 4XZUB 3VH8G 3QPXH 3HKFA 3Q1SL 5BV7B 5D1XB 3MGAA 5B22A 2VLLA 2LU3A 5ITBL 4LSSL 3STLB 1BZ7A 1N3NB 1V3LA 3LN4B 2VISA 3IFOA 2OTPA 3MJ7B 3MX0A 3F6IA 1ES0A 1V3MA 2G60H 4LASL 2X1WL 1DQMH 1NAMH 4G7YL 3GKWL 1V05A 2CLZB 4QYOA 2X4PB 5KSBE 3ARGB 5BXFB 4R2GC 1TENA 3TA3A 3GBNH 3HNSL 1UEMA 1ZHBB 4XPTL 2AJYH 4U1LB 4XBGB 1JPSH 5T33L 4HG4J 2NNAA 1C7SA 3ILPB 1HI6A 3OPZH 2DLGA 3EFDL 3L5IA 1CT8B 3HC3H 3W11C 4U1SA 2FEEI 2ESVD 3N85H 3UYPA 3WNKA 3I9GH 4X6EA 5C0AD 1BBJB 5BO1L 3D3VB 2WIIB 4LPYA 4RGND 4LHJB 2XNAB 2F74B 3O8XA 2BCKB 5F7YC 5GPRA 4C54A 2VWEC 1LO5B 1RZKL 4DVRH 2RR3A 5CEZD 5CEYB 3VJ6B 2C4XA 4LDOB 4UZGA 2GTZB 4JAMA 2YMXL 3QQ3A 1CZ8H 2XA3A 1J8HB 5EORL 3ARQA 4HULB 4OZHA 2X1QA 2FCBA 4HWBH 1UM4H 4ZFOA 4UTAL 5D7SL 2R1XA 5FUCC 5DRNA 3ZT6A 4X6CF 1FNSH 1OTTC 1IM9B 5HHOE 3F62A 4CN6A 2DF3A 4ZNEE 3DVGB 3LSOA 3TBYB 3DX8A 1J0KA 2JF1A 5DJXA 1NBZB 5FECB 5ID0A 5F7FA 1H3PH 4MZ3A 2GCYB 3QI9D 1K2DB 4RFOL 3RA7L 3O9WD 4D0CA 4X7SL 2NW2B 4PTTB 4KQ3L 5CBAA 1FYTA 5FYJD 5I1EL 2FZ3A 4HS8H 2V9RA 4PRHA 3ARDA 3EJZD 2VIRB 5F1NA 2JCCB 1BVKA 4PJGB 1KN2H 4ZFGL 1UM6L 4P5TB 2COQA 4P4KA 5E8PA 1F6LL 1JPGB 2XICA 4IMKC 2OXHA 3F7VB 3C9NA 5DD3H 4R4BA 3PWNA 3T0EE 5C6TH 3HZYB 3Q0HA 3V4UL 3CMOH 1K4DB 3SPVA 2J8UF 1U8PB 4FP8L 4P9ML 4H1LG 4NZUL 5C0FA 3CSBA 5E6ID 3FQUA 4Q0XH 5FAAA 4Z76B 1KELL 3S9DB 3DETC 1JZ3A 3V6FA 1SMOA 3QAZB 2VXQL 3BQUB 3RVTC 2GITA 4APQC 1ZT7A 4LRNH 3O4OB 1C5BH 3GMNA 2D9QB 1UT9A 3HAEH 1A7PH 1CICC 3C5JA 3MLYH 2UVFA 3OF6A 2YC1B 4HDIB 2QL1A 1H8OA 4EIZC 3L6FB 2BNQA 5F9AC 1X6NA 4QHUB 2B0SL 1C5DA 1NC4A 4YXHL 1DFBL 2ZKHH 1MELA 1P84K 1F11B 3OJ2C 1FIGH 2OBGA 3QIWC 3MA9H 3QWOB 1KB9K 3KLDA 4BSWA 5DK3A 4Z0BH 1NBQA 1EO7A 3OZ9L 4OGXH 2DQJL 1HKFA 3IF1B 5BW7C 4OV5B 1PVHA 3C2AH 3SDAB 1H5BC 5IEKA 1I7UB 3MV8E 1OAUH 1QSEB 2VH5L 2JE8A 4ZO8A 5EU7E 3ZSSA 4CMHC 4HX1A 5I0ZA 5T3XE 3QHZL 5DVOA 1RAMA 3L95B 4HPOL 5FYKE 4YZFF 5KVEL 3K2UL 1FVDA 4JREB 1A7NL 3B9EA 5D7KD 2VXSH 3VXQA 1TZIA 2DLFH 3NCMA 3FONA 4ODSL 5CILL 1RPQA 5JW5A 1LO0H 1WT5C 2D7MA 1I9RL 1P53A 2R56H 5CIPA 4ZO9A 1I7RB 2R2BA 4X6BB 4XXDA 4LCYB 5F9DC 4JPIB 4LLVA 3VD4A 1KXVC 1ZS8B 3HE6D 1HCVA 5I1HL 2LVCA 3LDBC 4RDQF 1QRNE 3SDXA 3GSNH 5E08L 1F8TL 3KPRE 4MSWB 5DQJB 3DMMB 4L3AA 5FM8A 4JKKA 4LK4A 3KWWB 5D2LA 3RJDA 5F7EL 2XWJB 4H25A 1JK8A 3SE3C 3VE0A 1E4XI 4GLRI 3FJTA 4HWUA 4NC0B 1G7JA 5GS0D 2DBLL 1MCPL 4HV8A 5E8OB 3PWVB 2HH0H 2X41A 2CKBA 3QUYB 5HHVH 1JPTH 1E4XH 4GLRH 4FQXB 3RPKA 5I1LB 4HUNB 1E6OH 4TUOB 2Z35B 1QYGL 4C56D 1IEAA 1FL3A 4JHZA 5JUEH 3V5KA 4P3DB 3IDMA 4JVUA 2VB5A 2J6EH 4JQIL 5AYQA 3GHEH 3VD7A 1AQDB 4AL8H 1ZEAH 2FWOA 3LD8C 3T2NH 5IJVB 3FQTA 3WXVL 1GGYA 1KCRL 4MA8L 3CK0H 4RX4A 4YJZL 1L0XA 1FZKB 1UWEL 5BMFL 4LKCA 4JQXC 1WBZA 1Z3GL 3MJ6A 1BF8A 4HF5H 4K94C 5D2NE 3TH2T 3CFKA 5I6XC 4QRPA 3FTGA 4HUUB 1I3UA 3FOLB 2BERA 1JWSB 1KPUA 1SMAA 4KROB 2ZNWA 4GBXD 5C0BA 4NJ9L 3V8OA 3FQWB 4F8TA 4O2FA 2VITA 3RTQB 5C92A 1LNUA 5E1AA 2YD1A 1FRGL 4R6UA 3F12B 4M61B 4NDMB 1ZHKA 1KB5L 3TFKD 3I6GB 2QQKL 4R4FL 3V7AG 4WGVB 5CBEB 3ARRA 1YEFL 4YDVB 1KV3A 1JFQL 3OKKB 1U3HB 2AJXL 3M45A 2NY7H 2CGRH 5DJYA 3GRWA 3UDWC 1OT1A 4XPFH 1NBYA 2DI7A 3OR7A 4IOFD 5AD0A 2BSSA 4Y16A 1ZV5A 3AS2A 3A6BH 1C16B 4JM2D 5MERA 2PTUA 4QTHA 1A3RH 1PKQB 5I73C 3CXDL 2BHYA 4NRYA 3P9WB 2YPLA 5EWIL 5KSAA 1IGTA 3SCMC 3OAZK 4JHWH 3QDJD 8FABA 1RVFL 3DI3B 4O2EA 3HZKB 4WCYL 5GSRB 4PJBF 3KPPA 2FH6A 3H9ZA 2GHWB 1U8IB 4HC1L 4X4ZA 5I8OL 4HEME 5F3HB 2E7LA 3E2HC 3LQMA 3UZVB 5MP6H 5T1KB 2CIKA 1UB5B 4QY8A 2D03H 4Y4HD 1E28B 2XN9B 2V2TB 2NW3B 5EUOA 5D7LB 2OR8A 4NZTH 5KVMC 1FNLA 2FIKB 1YZZA 3MRKA 4UIMB 3H9HA 2VKXA 4LSQL 1IL1B 1NAMB 4ODTH 1I9IH 3BRGC 2B39A 3FB6B 4LKXA 4E41A 1FH5H 2DWDA 4I18C 2J2ZA 4QHLA 4TSBH 2A83B 4YUEL 1D5ZB 3MLPA 4J1UA 4YHNA 4LSUH 1J1OL 4L29A 3C8DA 1KLUB 3GMPB 4FQ1H 4H88L 3JWNC 5IVXF 1DR9A 4F7PA 2FGZA 3BD3A 5IF0B 4YHYC 2FBJL 1ZK9A 3CVHA 1BIHA 4UT7L 2ZUUA 1WZ1L 4Z7QE 3QXAA 2HP4A 1NCAL 4HJ0C 1IKFL 1I1YB 4LGPB 4XWGH 3LKQB 4HPYH 2EICA 4UT6H 1CLYL 5IB4B 1VKXB 4M1GH 1BAFH 2MKWA 3OB0H 3IETA 3LKSA 4KDTC 4L8DA 4XPBH 2HMID 4CADB 4R3SA 5IB5B 3TNNA 4PS4H 4Y5VA 3O3EB 3KHOA 2VXVL 4QRSB 5ALBL 2XWTA 5IW1A 3IJHA 3LKOA 4NGHH 4OCXH 1XFPA 3MV7E 5GJTH 4YX2L 3PDOA 1CVRA 1RUKH 3L3HA 4YDKL 3VXRB 4Y2OA 3CNKA 4UV7L 4YO0A 3SQBA 2MCPH 3FQRA 4R26L 3C5ZB 3LQAL 3BH9A 3JTSA 1BQHG 3BO8A 4FFVD 3ZYZA 2VLMD 5DJCB 5TDNB 3FFCB 5CWSA 3L3IB 2NY4D 5ICXB 3V7MA 5JNYA 3TYGH 5GRJL 1LO3L 1RD6A 3BH8A 3VFOB 1JGEB 3VCLB 1XGYL 2DQGH 5JORB 3VFTA 4MJ5B 4WI4A 2YXMA 1G6RL 1UZ8A 2OSLB 1MIEH 3FQNB 3R06A 2PYEB 4HJGB 3SKMB 4NQUA 1PX3A 2BC4A 3V95A 1BFVH 2EH7L 2Q20A 4AIZA 4K7PL 2F5AH 2HFGL 5FO7B 1T1WB 4OIIH 3VWKA 3OB8A 1YC8A 5BRZE 3TPUA 1I3VA 4P2RA 2VDKL 3G5XB 4HZAA 4P49A 2DTML 2AQ2A 4HJJH 3X14A 1TETH 2R2EB 4WUUB 3VWJA 3DO7B 4N90D 1EA9C 4F7EA 4NCDA 4X9HA 1JMXA 4HCRL 3D87B 5E24E 2EDNA 5HI5D 1AC0A 2VZOA 5EZOL 1IC5L 3MRCA 3O4LE 3VXUA 5EOQL 4FFZL 3PP3H 4XH2A 5IHZB 1XCTB 4HIIB 1VGEH 1IGFL 4WV1B 3S34L 4HMCA 4EI6A 4P59H 1Y6KR 4JRYB 5JR1L 1BREA 1ZVYA 3ETBF 1P7QA 4ZTOH 1A6AB 1J1PH 4PYHA 4P5MA 3D39B 4AM0A 2YN3A 1UXSB 2OQJB 3KPQB 2WUCH 1CFVL 4GAGL 4X80H 3RDTA 3SDDC 4F15B 4P3CL 2WBJD 4QXGL 3IDXH 3C6LC 1QSFD 3C5SA 1EZVX 2EDEA 4ZPVB 2CK2A 3ZE1F 5MEPB 3NFNA 1RIUL 3TO2B 2EDRA 4GKOA 4WHYG 1LWRA 3CCHB 3RWCB 3LV3A 1PBYA 3FOMB 1HXYA 2WAHA 4PLOB 2FJFB 5EU7C 1ZVHA 2DJSA 3U4EB 3QQNA 4Y5XB 2FNBA 3OKMB 5L2KA 1B4JL 3MRQB 4FQCL 1PSKH 1Y0LB 32C2A 2W9LA 4HHAB 4H8WC 1SJHB 3ROOA 1J0ZA 3KPTA 4O5LH 1QNZH 1CDGA 3C60D 3D2UB 4MNQD 4NWTL 4R0LC 4ZUVA 5D7IA 1BEYH 5EC2A 3T4AB 5C09D 2OMNA 3GSNB 1IAKB 2R0ZH 2H9GB 1VPOL 4NBYB 2FYYB 3P4OA 2Y6SC 1LO4H 4PJ8C 5GGRB 3TT3L 3QCTL 4Y4FD 5FO9A 4H1LH 1ULVA 3KR3L 1U2CA 5CJ8A 2X6MA 4LCCA 1S7XA 5AZ2H 1NDGB 5EU6A 4D9QD 2F19H 5IMMA 3C08L 1KCVH 5IBTH 2Z8WC 3QZWG 1HOCB 2DL9A 3PIQB 4MNHB 1DQTA 2ZJSL 2ADGA 43C9A 2EECA 5DZNA 2F53E 3E1F1 1SVZA 4WWKC 5T3XL 3ARTA 5DUBA 2GAZB 4WEBH 2X4NB 3MYJA 5FYKL 4I3RL 3X3GL 4EVNA 3OAUL 4M5ZL 3U82B 3QDGE 2MQ0A 3LH2L 3NCCB 4H8WL 4O02L 3EZ8A 1Q72H 4YWGH 3LIZL 4ZXBA 3HA0A 1JHLL 2F54B 1OTSD 3BAEL 2CJUH 4U6YB 2R4SL 3JV4B 5D4QA 3BP5A 3T65B 1W0VA 4DN4L 3W81A 1S7RB 1NAKH 4X6CB 4TSCL 4PBWD 2HJLA 5F9OH 3IDIB 4K8RD 4RQQB 4Q9CA 2EYRB 3DBXA 4NM8H 4JJ5B 3U0TA 2X89D 2MPAH 1JWMB 4MJIB 3WXWH 1X5YA 3ZLQC 4NYLA 2M26A 5D2NC 3MCG1 2XZQH 3GNMH 2Q8BL 5J11B 1IFHL 2BSED 1JPFB 5DD5H 2OLDA 2IPTL 4DCQB 5GZNC 1IAOA 3L3KA 2IGFL 3MGOB 3HMXL 2A6DA 4FXGA 4LRIA 2CD0A 3DIFA 2UZIH 3SO3B 3MZGB 5GRUL 3J7HA 1MJJA 1N6VA 1YN7B 2NXYB 4R7DA 4M62L 1XCQB 1B2WL 1PLGH 2YPKA 2DQIL 4Y19E 5DURD 2XPGB 3V6OC 1JGDA 4FQHB 1BLNB 2BRRL 1YEEL 1ORQB 1KIPB 4P99A 3RWIB 3ZL4L 4JO1H 5DI8B 4M6AA 2HJFA 3MC0A 2HN7B 2IFFL 2A77H 4Z6AT 1ND0A 1E4WL 4P9HH 4N0UA 1OAXL 1UCBL 3BRDA 4JFEA 4BFIB 2DQDL 2FJHB 3EYSH 5L7XH 3VXSE 2BVPB 4G6KH 4WU7A 5F89B 4HZLA 5CEZH 5KVFL</