5JDJA

Crystal structure of domain i10 from titin in space group p212121
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
91
structure length
91
Chain Sequence
GAMETLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploration of pathomechanisms triggered by a single-nucleotide polymorphism in titin's I-band: the cardiomyopathy-linked mutation T2580I.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Titin
total genus 21
structure length 91
sequence length 91
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jdjA00
2NX5D 3VFNA 4LDOB 3HZMA 5IFJA 3CFKA 1WV7T 1LD9A 1FZJB 3ZE2F 3QA3A 2Q76B 2I60H 5L0QC 3MGTA 3KPPA 1MF2L 1U93A 1JWUB 1UWXK 1T3FA 1G6RH 2DQDH 2CSPA 3REVA 4H26B 5EDXA 5GHWL 1CE1L 3UO1L 2AABL 3C5ZB 3BX7C 3EO0A 5C08D 4WVRA 5H2BB 3VXSA 2AQ3A 3UBXG 4K23L 2Z4QA 4MD4A 4MJ2A 3QH3B 1MSPA 3CMGA 3QDGB 2H9GB 2DQTL 1G6RL 2DQDL 1WSST 3NCFB 3QIBC 3OJMB 4G43A 4KJQC 1TNMA 3QUYD 5JHDA 4ZQKB 1A6UH 15C8H 2VLJE 2H9GA 3BKMH 3VXRE 3WNKA 3FONB 2VWEC 2DJUA 1PKQE 2XT1B 1YC7A 3IJHA 4XX1E 1G9NH 4OIIH 4NRZA 4WTZA 4X7TB 3VXSB 2Z93A 3D9AH 1D5ZB 3G9VA 5FOJA 4OFIA 2E27L 5C0BE 3T0BA 2YPVH 3VCLB 1ZVSB 5E9DB 2X7LA 5ITFB 4PRDB 1LWRA 1XR9A 3DUSA 3S4SB 3Q6GL 5KVFL 4OM1L 4MXVF 1DQQA 4LCYB 4LEXL 2VDLL 5I18H 1UA6L 1HHIB 3VRIB 4QOKE 2X4OB 1RZJH 1R3JA 4EQ3A 4KMTH 5SWSB 1F58L 3IF1B 5E6IA 3GKWH 4U7SA 3MOBH 4NQDE 1P84K 4AIXA 3PXJA 2C3HA 2UZIH 5IBTH 3T0EB 1EXUB 4EIZC 5C1MB 2QQQA 2R1XA 4U1IB 1TZIB 1XT5A 2AEIT 4Y8AA 3DJ9A 2AW2A 2GEEA 4XBGB 4X99A 4NP4H 2MKLC 5KSBB 2NYYD 1VFBA 1SM3H 5D2NB 5JA9A 5HYSA 4JJ5B 4CN4A 4PUBH 4BM7A 4FQ2H 3WIHH 5JHLH 1PAMA 5CJBA 3U4AA 1B6UA 2HT2D 3D2UB 4KMLB 4F7MB 3DYOA 4AMKH 5TE4H 5DMJB 3O2WH 3TN0B 4PJDA 1RZ8A 1V8HA 2J8UA 2PETA 3IS0X 4MA7L 1ZEAH 3GO1L 3QXUA 2PYFA 4Z7VE 3SDDD 4X4XB 3C6SB 1TJGH 2EKJA 4RAVB 3JUYA 1XFPA 2X4SA 2Y06L 3H3KA 1CD9B 1L0XA 5D6CA 5DI8B 5LGKA 1UC6A 3IDIA 1NFKA 2YD2A 5F7UA 4QRPE 1BEYL 4PRBB 2GTZA 1MHCA 1GGBL 2PKDA 4XGZA 3O0RH 4G7VL 4AEEA 2FWOB 5DUPH 4XCFL 1ZLSH 1AGCB 4LVHB 5T3XE 4XPBH 4PJ5E 1S7SA 1K8DB 1IC5L 5L2JB 2UZXB 5H35B 4UT6L 4ZDHB 3CK0H 1J0HA 2ADGA 3HTLX 5J56B 1H8NA 4C54A 4ZSOA 5EOTA 5FFLA 4E0RA 3QG6A 4K3EH 5KTEH 3QUMH 4ZFZB 4MNGA 4ODXB 1RJCA 1LO4L 1MRCH 1KGCE 5D93B 3G6JE 3L5WB 1SMAA 3BKCH 2YPKA 4GKSB 1LO2H 3NN8A 4YIQA 5BMFL 4GXUN 5FGBA 4Z0XB 1GGTA 1KT2B 3C5SA 2HVKA 4JO4H 4JFFB 1VGEH 5DSCA 3CSBA 3AREA 4P59H 3K2UH 4QHNB 1MCEA 1A1NA 4XHJC 3UCRA 1L7IH 5F7EL 1UT9A 4OZGF 4TNWF 3K8MA 5EUOB 3VXMD 3DO3A 4OJFL 4YHYB 4LSTH 3DSFL 5ITFA 1T1ZA 1MPAL 1ZVSA 3PWPE 3O6ML 1HXMA 2DJ4A 1CD1A 3T4YB 5CINH 1JK8A 1YJDH 3T8XB 4EUPH 3MXWL 2ED9A 3FOLB 4GAYB 4UDUB 5AYUH 4OLVH 1H5BC 4TPRH 2IBBA 4Y5XB 3ZDZE 3SE4A 3TF7C 2WBJA 3FN3A 4Y4KB 3ARVA 2X1QA 5I19H 2FR4B 3BRGC 2JB6A 4BSVA 5F8QC 1OTUC 3U46B 2YUVA 3LB6C 3U0PB 2R39A 4JFXA 1BX2A 3LRSB 4JZJC 1FG2B 2GSIB 2I07B 3NTCH 4XZUA 1FNAA 3GBMH 3MV8B 3G6JB 4J3VA 5A1AA 4FZ8H 3BZDA 1OOAA 3W81A 2YPLE 1KN2H 3H0TA 2NY0C 3VMPA 4QGYA 5L8KB 2YWYA 3EO0B 2ZCHH 5DMIL 2OZ4A 5DD6A 3V4PH 3C09B 1FE8L 1DQLL 1DANT 4FQIH 2P8LB 4P4KC 1F2QA 1PJ9A 4LNRB 3C8DA 3KPSE 3LB6D 3X3FL 4ONHB 5T1LA 5DJYB 1FYTD 2ZG2A 4BZ2H 5DTFA 3QO1B 4S2SB 3K2MC 2BVYA 5EZOL 5EUOA 4JFDB 1MCKA 5T3XD 2K7QA 3OWEA 4R26H 5EZJA 4HFUH 3T1WA 4WHYG 3VRLF 1Z5LB 4POYA 1YQVL 1QBAA 2OJZL 5TJWK 1MREH 3VXOB 1G9NC 4J3UA 4ZTOH 3QUXB 3OAUH 3ARWA 1GZPB 1NAKL 1PY4A 5T5NF 3VI4E 1I7RB 4NFCA 4EDXB 3BKML 5DJ0A 2AEWA 1KULA 4KZDH 3QUXA 2GSGA 2ZUVA 4YDJA 3KPSD 3JTTA 4E41D 4K2UH 1JF1B 1E6OL 5C8JB 4GJTB 3BH9A 4ZUTA 2BERA 4HS6B 4Y4HC 1NUNB 1Z5LA 5JNYA 4O02H 3AUVA 4N8PA 5MERB 4GW5A 1ZS8B 4K55A 4F57L 2XQBL 4W4OC 1QYGH 3T77B 4U6HA 3KWWA 5J6HA 3GMPB 2F54E 1KFAL 3P9MA 3QXAA 1MI5E 1FFRA 1ZHKB 3WN5B 2XYCA 5E4EC 4RFEB 3FMGH 2NLJA 3M8OL 4TOYL 5C70A 5IB1B 1NPUA 1EERB 4KK9C 1ONQA 1LNUA 1HQ4B 1FV1B 4WO4D 1WFNA 2CLZB 3R1GL 4XX1G 3E2HB 4MJ6B 3N1MC 5E2VL 1FZOA 4JRYE 3TWCH 1BLNA 4MVBD 4P99A 3UPAA 4PD4J 4APQA 3GJEA 3LN5B 4P4RA 5HI3C 1KIRA 3PGDA 1MHHA 4BFIA 2P8PA 1KSRA 5GS1B 2X4PA 3EOTL 3L5JA 4NBYB 3W11C 4Z8FH 4XH2A 4CRPA 5I1GH 3QFDB 1NGWA 5FUOH 4NQEB 2DQJL 1VFBB 3KPOA 4P4KA 2LQRA 4S1RH 4LSDA 2JJTC 1G0XA 1S7WA 4GRLD 4LAJH 3OJDB 1BGXL 3DYMA 5T1KA 4Y4KA 5DVNA 3C5JB 3V8CA 2G60L 4Q0XL 2Y7QB 3QQ4B 1A7NH 1NKRA 4N0CD 3CZFA 3IKKA 1XGRA 1HKLL 2BVQA 5E95B 4PRHB 4JDZB 2DQUL 2R69L 3BP4B 5B39B 3GSXB 1G7LA 4Y1AD 3HAEG 2NYYC 2ADFL 3QJHA 4GKZB 4M7JH 3SQOH 2YUXA 1MJ8H 4F58L 4AG4H 1AP2B 4Y2DC 4EDWH 4YHNA 5L8LB 4WDIA 2R8SL 5HGBA 2DQEL 3AAZB 3ZKXC 1MI5A 3DUSB 4POZD 4O9HH 1WAAE 2NY1B 4M7LL 4MD5B 4NGHH 1UB6B 3FFCE 1IGIL 4IRJC 4PJIE 1I8IA 1TVHB 4HF5H 3LV3A 1QFWL 1ULVA 1SY6H 2A6IB 1MCRA 5DO2D 1S78C 1Q9WA 2XWBB 5I71C 2YSSB 1MCWW 2GJZA 2V17L 1ZLVK 4ODXA 1XIWB 1A3LH 3TNMA 1JMXA 1I7UB 3BYTA 3PHQA 2ADGB 1OAYH 4Q74A 2VDQH 1C1EL 3BGMB 4ODTH 2YA1A 1JYXA 2MNUA 5E9DD 1EBPA 4GRMB 4XVUC 3Q6FA 2R9HC 1NCAL 2EDXA 4U33A 5C0IB 4R4BB 4XXCC 1RPQA 3U9UB 1I4FB 1FH5H 5E2JA 3V5DB 4F7CB 5L2KB 1T03H 2GTZB 4HEME 4L4JA 4JG0H 3W2DH 2X40A 5JIIA 4L3EE 4OCRL 3VXNB 3ES6B 3MLSL 4GQ9H 2X5PA 4LRNH 4UT9H 5H94B 3V0VA 3MBEB 3RIAF 5F7YC 2D9CA 5IB1A 4W6WB 4BSWB 2J6EH 2J8UB 2XIDA 1OAUH 3TN0A 5CD3A 1IGTA 3IXTA 3QXAB 3P9MB 4LPVA 5E94B 3T77A 2GI7A 3MRNB 1WWWX 1N5YL 3QNZB 1FSKC 2F8OA 1XF3A 2IALA 1EEUA 4R9HA 1YNTA 2HVJA 1JCKA 4QXGH 3M17B 2UZIL 4YX2L 1TZGH 4GRLA 5C0EA 5GGVL 5ID1A 2E6JA 1EUTA 3GM0A 4UMGA 1EHLL 3MBXL 1SEBA 3LV3B 1F4AA 3FB8B 5CFHA 2D31A 2SEBB 1OPGH 2ZCLH 4TSAL 3Q1SH 4U6YA 3PQYD 5IVXE 3O6LL 5BV7C 1J8HE 3ARFC 3FZUD 1EHLH 1MJUL 1FN4B 1NGPL 2P7TA 3HMXL 4TVPL 4PJFF 3KDMA 5JDSB 1BZ7B 4WU5B 4LU5L 5E2WH 5IT2L 3LKPA 1F6AA 3VD7A 4YAQB 4ZXBA 5KN5A 3IJSB 4GAJH 2OL3A 1MJUH 4HS8H 3S4SA 4WJ5A 4C56A 5DFTA 4O5LH 4EN3C 4NKIL 2MPAH 3WLWC 4PGDA 3UTTA 3RY5A 4R4FL 3ARDD 4LVEA 1MFAL 1NMAH 3HR5B 1IGJB 3RVXC 1UFUA 3QFDA 1T80A 2ENSA 4AIZA 4YHKL 1AO7A 2FB4H 1XGTB 2PYED 3F7PC 4NQCB 2HH0L 1H0DA 5ACZA 4KDVA 2BP3A 3CXDH 3WO4B 3UC0L 1EJOH 2XNAB 3RIAK 2WP3O 3VRJB 5K9OB 5D70H 2F8XC 1AE6H 2DLFH 5ANMB 5BOPA 4PGDB 1CFNA 4KAQL 2BSRA 2AK1L 3O4OB 3TZVD 5CLTA 5IEHB 3QUZD 3NIDE 1L7TL 1IAOA 4QXWA 4Y5XA 4JO4L 1ZHLB 4HUUA 3KWWB 5MI0B 2OTUB 1B0GA 4NO3B 3AS1A 5C08E 1PQZB 2GJ6E 5MERA 3ARQA 1KXVC 4NSKA 4WI6A 2JJVA 5D9SB 2GYSA 1XR8A 4P2OA 5DJCB 5CBAA 3RVVD 1MEXH 1M4KA 1T7YA 3MYJA 4KJPD 5F44A 5J57B 4UIMA 4RIRB 5CEZH 3NZ8A 4HSQA 1S7RB 4UT6H 4XB7A 1JUFB 4P57B 4QNPF 3PNWB 2E7LA 5I75B 4TN9A 3UROR 2ESVB 5CIPB 1I1FA 25C8L 5CBEA 1PLGL 1EHNA 4JG1H 1YUHA 4EUPB 1CLYL 4PR5B 4HKZB 4JM2A 1I1FB 4MDJB 3FQTA 3O6KH 2GITB 5C9JB 1YNTB 1G6RA 3ZTJH 2CDFB 1VB9A 3QG6B 2QLVB 2C3XA 4NHCL 5ANME 4MAYD 4FABH 2DS4A 5L2JA 2DLHA 2KZ1B 2BVOB 3VWKC 4J3XA 4OB5L 4HGWB 4F7TB 3V5HB 4NQDA 2LAAA 4N8VB 1CYGA 2ADFH 2Q3ZA 3ARFB 5BO1H 4YHOH 2A77L 5TF1H 4IHOB 1CQKA 3H0TB 4NO0B 3MLTA 2DRUA 4YBLC 4PJHE 4UT7L 3DUUB 2I9LA 4IIQC 5D7SL 5F96H 5BO1L 4MQXD 4RAVA 3HE6B 1N4XL 3TO4B 1LE9B 3GEWB 4KUCD 5EU3A 4MZ3A 5IJKC 4NZUH 2D7QA 2AV1B 3KJ6H 4IIQB 3AY4C 2HTKC 3EGSA 4FNLL 1LO5A 3N1FC 1ERNA 4NN5C 5DURB 1MUJB 3DGGA 1Q1JL 3H8NA 2A9NH 2VABA 4P49A 5GJSL 3QCVL 5DHXB 1QPXA 4PR5A 3MXWH 1IT9H 4WIQA 3ZT6A 3ARTA 1RFDH 4JM2D 1J1PL 5EIIB 4ZYKB 4JO3L 3ESUF 5D7LB 3VXTA 4HIEA 3GSUA 1P84J 5HGBB 4QRUB 3DV4A 5F1OB 1YY8B 3MCKB 5KN5B 3R4DA 5DR5H 2B0SH 3T65A 2CIIA 2OS7A 3CD4A 1ZLWK 3LKRB 4OBRA 1OTTD 5SWSA 4JPVL 1F90H 4OFYA 1I1AC 4JKWA 3PWLB 4XXDA 3ARZA 3JTSA 4XCNA 5TQ0L 3UTSD 5CSGA 2VDOL 2B5IB 2OTUA 3WFEH 3DBXB 3QWRA 4JPKL 4HIHA 2NX5A 5DJXA 2E7LC 2VZVA 3KYOA 2ZPKL 3V6ZA 4KHXH 3V7AE 1JFQL 4J4PC 5FO7A 1C16A 5H35A 3QYCA 5JA8B 2HJFA 3ULUE 2RFXA 2NZIA 1WTLA 4I13B 3IAQA 3QIBA 4G8FA 3PP4L 1KLUB 1GGIH 1H3WM 1K3ZA 3VGGA 4Z78B 3ULUC 5M95B 1UZ8A 5HJ3A 2PO6A 3ARDA 2YRLA 1WBXB 2FHCA 4G6ML 4KRPC 1F4XL 4YUEL 1WWBX 3NCJH 1BVZA 3GMRA 4JFPA 1EBAA 1DBMH 3MA7B 5FHAH 3GO1H 4LLWA 5DQJA 1RJLB 2OL3B 3O2WL 4FFYL 3GSRB 3MJGX 1DQTA 5GXBB 4U1HA 3PE9A 3SBWC 1YA5A 3T3PE 2D2OA 4XMLL 1T3FB 2QTEA 1A9EA 4X98B 4DAGL 4U1JA 3ZHLA 2FJGB 1VERA 4JVUA 3SQOL 1KC5L 4IBLT 3TEUA 4GUPB 1VKXA 3QA3B 1W0VB 4NWTH 2V2TA 5KVGL 1IZJA 1FIGH 3MJ7A 1ZLWH 3ZDXF 4OLZL 4W81A 1MY7A 1QLFA 3VI3F 4R7NB 3CSYA 1O7VA 3MFGB 4KV5F 3CH8A 2EYRA 5CJOL 4FQLH 4KQ3H 4PJIF 3VFPB 3OXSB 3QHFH 1A0QL 1FLRL 5KSAC 3B9EA 2AJYL 1U8QA 3B9VA 1BFTA 2VLRA 3N0PB 4WDIB 1WTGT 3JUZA 4YGAB 1JVKA 1NFIA 3MJ7B 5IFAL 4FTVB 4FQLL 4KQ3L 4ZUWB 2AJUH 2NXZC 1LEIA 3DRTB 4UIMB 1XIWD 3OZ9H 1JTTA 5T3ZH 3ARSA 3LS5H 3M45A 2BNRE 5IHLB 4LASL 3FAXA 1HEZA 3LCYA 5DWUL 1BAFH 3KG5A 3ES6A 5FUCC 3LN9A 3Q5OA 4G42A 1RUPH 4NJAL 4ODHH 2UVEA 3V4VH 4OV5B 3O4LA 5HVHB 3TVMC 4L4TE 1BFOA 3UTSB 4LOUD 3RJQB 5IEHA 3QR2A 4H0GA 4P9ML 5E8PA 1U3ZA 2IH3A 1BAFL 4UT9L 1BX2B 4NQEA 2V2WB 5E5RB 3TPUB 4XH2B 3RAJH 1QVOA 4TULL 1AFVH 5DHYA 5J6GB 4KC3B 4ZUUA 4G9DB 3VFTA 4DOHE 4M61A 3PGDB 1PG7W 5TQ0H 2GQHA 5IVXA 1OSPL 4G8EA 3E6HB 2IG2L 5T1MA 4GAYA 4RSVA 5D8JH 1NCCH 4MWFB 4DVBB 4M8QB 1PW3A 4LHUA 3MRRB 1JPTL 2LU7A 1IQWH 2Q8BL 2ESVE 3I3DA 4RFEA 2Z0BA 2Q76A 2WBKA 1H3GA 3D85D 1WLHA 4Q9BA 1N5AB 1DL7L 1FORL 5ERWA 4PJEE 4XCNB 3V5KA 4HJ0C 4O00A 5ILTH 2HTLC 5DUMH 3OX8B 3LS4L 3AGVA 3VGBA 1QQDB 1JGLH 4Y7MA 4J12A 3KLDA 4UUJA 4HF5L 5IGXL 2JTDA 5CS7A 1KT2A 3I3EA 2YK1H 3TO4D 3AS0A 4Z0XA 5MP6H 4LSVH 4ZMAT 5DC9B 3VI4F 4CU7A 2GSGB 4G5ZH 3MRIA 1A7BA 5DMGD 3IDXH 4YE4L 5F6HI 5ILTL 2ILLA 4FXKB 1YEDB 1UEYA 1IAKA 2VLRD 1U8JA 3QIWA 3NAAH 5FYJL 5GSRB 1U95A 2DJSA 4PJ9A 4LCUA 4JDTH 1NGPH 3HMXH 3W9DB 5I6XB 2FWOA 1H3TA 1NKOA 1BF2A 2W59A 5C0AA 2R0WL 4PJBB 5E08H 1NC4A 1MWAH 1KCKA 5DZOA 4QHMA 3X17A 4V2CB 1A6WH 3EJYC 3DRQB 4BZ1L 3ZT5A 3SJVE 5SV3A 2XQBH 4U6TA 5I1LB 1HQ4A 3QZWA 5IOPA 3KPTA 1R0AL 4OCSL 3VGAB 5LKNA 4HIIA 2XN9E 3FFCA 3TZVB 3O6FA 3LMJL 4PTTA 5DEGB 1UB5B 4P3DA 1WFUA 2ZNWA 2ERJB 5D6DA 4KZDL 5E99H 4JKPH 3L9RB 3EJZC 4HK3N 5LWYL 2ATPA 1KEGL 2FJHB 3D5OF 4L1HA 1FG2A 3LY6A 5CP3H 4NDMB 5IFHL 3EHBD 1MVFA 5C8JA 4JY4A 1KIPA 1I7UA 4RISH 3EYVB 1VESA 3KPRE 4MXWH 1MNUL 1XIWA 5I1DB 3MOAH 1MAMH 1U3HD 4GG8A 3CUPB 3V95A 1JGDB 4S0SD 1MFEL 4Y5VA 2FIKB 1MAML 5DD3L 3C60A 4U1LA 2Z31D 3SJVB 2W65B 3K4ZA 3VFOB 4L3CA 5GGTA 1XH3B 5INCB 2AXFB 4PJ5B 4OLEA 4U1JB 4NN6C 2DD8L 4LL9A 2GUOB 5MEPA 4X6DA 4JRYA 3B5GA 5CBAB 4MXQC 2YBRA 2BSTB 4HDIA 4RAUA 5BS0E 3AREC 4FQHA 3MRQB 4JZOA 4M7LH 4EI5B 4QRPB 1D5ZA 1TJIH 5AUMB 2R8SH 2PYEB 4U1GC 5HY9B 5FA4B 5TF1L 4R7DA 5F9WC 3IJHB 2VKWA 2VH5H 3RX7A 5T1KB 5HXMA 5DHYB 2AK4B 2PTTB 3LQAC 1KG0B 4QHUB 4CADA 1FAIL 3KHQA 3FB5A 5TDPB 3RWJB 2BDNL 3LEXA 4U49A 4LSUH 4RGND 1N4XH 1SYSA 4PB0L 5KSAA 1JNHB 2BNUB 2EYSB 3HE6D 5EBWB 2RQ8A 1Z3GH 1HOCA 1P6FA 2X4PB 1JNLH 4BZ2L 1YMHB 3VMOA 2VLJD 1K9TA 5E8EB 3FTGA 3G6DH 4LSTL 1IM3A 3W9EA 1T4KB 2OL3H 2VDNH 4NN7B 4OV5A 1CGWA 3BZFB 4IRJA 4IJ3B 5IHUH 5ALBL 2IBZX 2ITDB 2OTPA 2FJFB 1G7MB 4WGVB 2YS4A 2CLVA 2CXGA 3WLBB 3ZE1E 3WS3B 1XCQB 4C56B 4P2RD 1ZHKA 3WN5A 1HH6B 4OM0L 5ALBH 4Z7OE 2C1PB 1PG7H 3QDJE 2F8VA 2A1WL 1FG9C 1TPXC 4GW5B 2Z91A 1N64L 4JJ5A 1JHKH 4G6FB 4KUZH 1JNNH 3O3EA 4HXBH 3LKRA 3V2AR 4NQUA 4LVHC 4MGXA 3T65B 2BC4A 4WI4A 5I0DA 1AD0A 1XGYH 2QADC 5J4MA 1EPFA 4TSCH 3QCTL 4OUUB 1X5KA 2C9AA 1ED3B 1ZTXH 4LCIH 3TBTB 4JB9H 4MNQD 5ESVA 4J2XA 3PWVB 4WEMB 1KGCD 1T0NB 4NN5B 4U1NA 4TTGA 2APXA 4LCWB 2F5AH 3HG1B 3S6CA 2DYPB 4LRNL 2QL1A 2FJGA 4PJXE 1JZ5A 2ZCLL 1KB5B 5JR1L 1D5MB 3RZCC 3WFCH 3EBAA 4QCIA 5F72S 1S7TA 1AXSA 2PTVA 3CU7A 4YDVB 1IGTB 3IXTB 2X2YA 4XWOD 3K46A 3VFUB 5IB4B 2UWEA 3GMRB 4JFPB 4I3RL 1Q9OA 5IW6A 4DW2L 2NTSP 1AC0A 4UILL 3RKPA 4RA0C 3GRWH 5D7JA 3CAFA 4K94C 2R23A 5T1DH 3KPMA 4O5LL 5C07D 1X5YA 4NP4L 3VXUB 3I50L 1DUZA 3T0EC 4V1DD 3MV8A 3X3FH 4XVSL 2AK4D 3QPQC 3WIHA 3QQ9C 2EXWC 9CGTA 4QOKD 3U46A 5CJXA 5TDPA 3LAFA 5J11C 1DE4B 4NZRL 1TPXB 2FYYA 4Z7WB 3RWIA 2CKBA 1FZMA 4KKLC 5C7XH 3DO7B 1PGRB 3TH2T 1MOEA 1QLRA 2YSSA 1EJOL 2WIMA 4W6YB 1UA6H 3PDOB 1DCLA 3TBVA 1P1ZA 3F7YB 4PLOB 5FA3B 5HBBA 1JK8B 5C07E 3ZSSA 1GHFH 1A6PA 5D71L 1T1ZB 2DL2A 1SJEA 4TUOA 1OARH 3QDJD 4PJ5A 3QEUA 5J3HC 5GGRA 4HC1A 3GB7A 1YY8A 4M43H 4UV4L 4HWZB 2Q86B 4N5EC 4RFOL 5JORA 1U41A 4ONOA 4KRNA 3SDXE 4LBEA 3ALWA 4UOW0 1HHGA 1RK1B 1MRCL 1WZ1H 2ZJSL 3MYZA 4HZAA 4MA3A 3R8BB 3RWGB 1G7LB 4IRSC 5C6TL 4WW1A 2A74A 4RWYH 1U8NA 1J0KA 1RZJL 5MI0C 2V6HA 4IDJL 4GG8B 1B0GB 4NO3A 5LCVH 3U7YH 1QLRB 3BDYH 4NFBA 1OB1B 2BVEA 1MQ8A 1IAOB 1EX0A 3U30B 4GQPH 1T04B 1S7WB 4JY4B 5JHDB 3IU4H 4PJ9D 5J9PA 1DBBH 3QG7L 2KL6A 3HPLA 2DYPD 4WWKA 2ATPB 3BKJH 4UTBL 3FJTA 3UBXB 4LHQB 5I8EA 3WIIL 1W72B 3MJ9H 1KJ3H 2NY4D 1U8MA 3CVHH 5DQ9A 4MQSB 3LZFH 2BJMH 1HYSD 4XRCB 1AR2A 1EO8H 3O6FB 4FFYH 4EN3B 4ZPTA 3UJTL 4GS7C 1M1SA 2CO6B 3RDTD 3DMMC 2R23B 4HULB 4H26A 2EE3A 4DJMA 4XNMB 1MFDH 2B20A 5C08A 2X4SB 2B1HH 2Y5TB 3ISWA 1D5BA 1UEMA 2HT4C 5BZDB 1KPVB 2Q3AA 4KJWC 1T2QL 1NGYA 3QQ3B 3BEWA 3GSWB 3L3KA 3AS2A 3CFBA 3WXVH 3N9GH 3WJLC 2VDQL 2OJZH 5C9JA 4KHTH 1RHHA 2DQCL 1OP5H 5DF0A 4Z7OF 5TH2B 4RGNB 5GQBA 2JCCE 4XPGH 4K7PX 5EA0L 1CR9H 2W0PA 5C09A 4LLMB 5E03A 4WW2A 1F13A 1ED3A 1K2DA 5I1AB 4YXHL 1JPFB 1JUFA 1F11B 2AJUL 2R1WA 3MRBB 4JFZH 2B8OT 4YXLL 5F9JB 4NNXB 4PRPB 5D7IB 2B4CL 2PO6C 2BVPB 5KJRL 2X4OA 1HSAA 2VJXA 2PXYA 3BP5B 4XVTL 1G9EA 3H6JA 4PJIA 4OCWL 5FKAB 4PJFB 1DBKH 5E4IA 1G1YA 4BSWA 4ZOBA 4JE4B 2CLVB 2VISB 4OZHA 3G6AB 1GGCH 4M8QA 3CC5B 4U2ZA 2WLYA 4M1GL 4OZGA 3P73B 4DFIA 1BFVL 1TIUA 4G80A 3JVGC 3BH8B 5D1ZB 3QI9B 4ZFOA 5EO9B 4PREA 2DBLL 4MLIA 4MA8H 3CDYA 5E8EA 1TQBC 1Q9KA 4MHHG 4OGZA 1IRAY 2RBLA 3B3IB 4LEXH 5AYUL 3FONA 4JEGB 2EEBA 1JFQH 2HWZL 3QDHA 5MENA 1M7DA 1Y0LB 3TJEL 5IBLD 3OB0H 4W70A 4X5LA 1X4XA 2HLAA 5DFVD 1KG0A 2NXYC 1T83A 4M4RA 1JPTH 4XMKH 3EDFA 3WUZA 3L5XH 3WS6C 3S5LB 4PIRF 1CQYA 4ENED 4WHTB 4FXGB 4O58L 3HNVL 1EV2E 5E6YA 4QGTA 25C8H 3MO1B 1WJ3A 3EO1B 3RVWD 3QB7C 5D6DC 4LLYB 5T3XL 4POUB 4NQEE 5DRXB 3ILPB 5EPMA 5MEQA 2YOCA 5IVXF 4LCCC 5IEKA 4C55A 3HZMB 5IFJB 4WW2C 3EDKA 4G9FB 4Y2DB 5F1SA 1AXTL 3MFFB 2NR6C 2H26A 5BV7B 3V0AC 5F88A 4XWGH 1CXHA 4XBPA 1U8QB 2Q7YA 4KI5C 5T3XH 5ESQA 2HVKB 2DD8H 1ZV5A 3NA4A 4HPOL 1MF2H 3F6IA 5DUPL 5TFSH 3BPOC 4YHIB 4M7ZC 3BRDA 3H42H 1QUNA 1FNHA 2VAAB 4JKPL 1OAZL 4PG9A 4LKXA 3D3VB 3QIUB 2ZCKH 4D94A 4DK6A 2DIBA 2AEPL 3KYKH 5D2NC 3MCLH 4GUPA 1UH4A 2Z35A 1YYML 4M5YL 2WBWB 5D7IE 3G6DL 5CEZD 1EEZB 4R3SA 3V0VB 4ZOEA 1R3IL 4HEPG 3CK0L 2NXZB 3MOAL 2AJZB 2HT3D 2X70B 1I8LA 1ZE3C 4KKBD 4NCC1 3MUGA 3OBAA 1CZ8L 5EU6A 3Q3GB 2EKSA 4I1NB 1S9WB 1IM9B 5L2KD 1S7QA 2X4QA 3F7RA 2GW5A 2W92A 5FV1L 3Q6FB 1F4YH 1ACYH 3MLUH 1EZVY 4ODVL 4Y0GA 2EDYA 4HT1L 4X6CF 1MLBB 3JV6A 2NLJB 4DUXA 3EYOA 3BZEA 1INQA 2VZ1A 4O2EA 2ATKA 1CXLA 1PD6A 2F74B 2DQHL 2E7BA 2GK0A 3G5VA 3QEHA 2G9HA 3D0VB 5E2TL 2OR9L 2UUDH 4XP4L 2HJFB 4P46B 1MPAH 1HI6A 4I0PB 4YDJB 2BOCA 4XP1H 2Z31B 5L9DL 4WI9A 4YFLI 3SJVD 1ZA6A 1HHKB 3PDGA 3SDXB 2VH5L 1E27B 5J89A 3GMMB 4LSPL 2VSCA 3TESA 2V2XB 5JPNA 1N7ML 3MLWL 4OCYH 4GLRI 1EO7A 2QSCH 2XN9D 3VG0H 1SY6A 5EORH 4QRTA 5CLWA 3MNZB 4PB0H 4MNQB 1TDQA 2GJ6D 3ZKMD 3SGDI 4YWGL 1CE6B 4Z7UE 1N59A 4ODUB 1P7KB 1QO3B 4GBXB 2F54A 5D4QA 3L3JA 1T0PB 2VXVL 4I3RH 4JFDA 2BVQB 4OIIL 3GKWL 4PJDF 4LCCA 2X42A 4NM8L 1MAJA 4NQVA 3P0GB 2P4AB 4QRUA 3EAKA 3VG0L 2DDQH 4TQEH 3FO1B 3DNKA 4GS7B 4HK0A 4OFVA 4OLXH 1WZLA 1OWRM 2CKBL 1N3NB 1ADQH 4AY0A 3QDJA 1QRNA 4MWFA 2BOBA 4KJYA 1UM4H 3DGGB 3RWHA 1NCAH 2IPUG 2B4CC 4XPGL 1IQDB 4XNYH 4Z95L 5C0BA 4ZTOL 3D3VE 4GSDL 3SDAB 1KIRB 4KKCD 3G6JA 3PHOA 5IMKB 1J86A 2VE6B 1WK0A 2V2WA 3TPUA 5K9KA 1ZA3A 5EIQA 1LP9E 3PGCB 4EQ2A 4N0UE 4C4KT 3ARUA 3PWUB 3QDGA 1HIMH 4P46A 1C7TA 5AG8A 3ROOB 1JIBA 4EUPG 4CNIB 2R2BA 3UTSA 1AHWB 2X4RA 4O4YH 3JVGA 4OAWB 1X6LA 1KNOA 1YEJL 3FOLA 4UDUA 3TVMA 4HWBL 1BJ1J 1T03L 1V3LA 5AZ2H 2NY6B 3TH4T 3OR7A 1PX3A 4Z77A 5BRZB 1A22B 4XPHL 1UWXH 1U93B 4U7KA 3OAZK 4NKOA 4PLJC 1H3VA 3HZKA 5IB2A 2HKHL 4NUGH 5FGSA 4U4BA 3WFDL 3SDDA 4M7LT 2EXYD 1KJMB 5IESL 4OZIA 4QXTA 5I66B 2X4QB 4N8VG 4O2FA 1S9WA 4PJDE 1G7PA 1FNSH 5CHNB 3A67L 4MXVE 4DZ8A 3HG1D 5GGRY 4LASH 4DQOL 3EYSH 3S35L 5CGYC 3QUXC 1CLOH 1OWWA 3VFPA 3OXRB 3GMNB 4ESKA 1AJ7H 4S1QL 4RGOH 2Z35B 1EDQA 2WBJD 3PNWA 1SYVA 5DHVA 3RNKA 1CLZL 4ZD3H 5DD3H 2C3WA 2X89D 3IJYA 1S7RA 4JQXA 1I75A 3C87A 4ERSL 3PL6D 4OLYL 1YEHL 2R2HB 3HNTH 3MV9A 2VXTH 4DVRH 3QPXL 5DZLA 5GGUA 4TSBL 4F9PA 4EI6B 2P42B 3UTSE 4KUCF 4RGMB 3D0LA 1IBGH 5KVGH 4GG6A 3OHXB 4DEPB 3AC0A 3DVFA 5DJZA 3ROLB 3TIDA 5KW9H 1T6VN 5E8OB 4I0PC 4H88L 4Q7DA 4EXPX 3HAEB 5SWSE 1A6ZA 3LHPH 4AQ1B 1R24B 4Z78A 5KTEL 4FTVE 4NQCA 4PRNB 1GGYA 3BEVA 4Z7WF 3UPRA 4LNVA 2O61B 4CVZB 4KZEH 4Y4KC 2DQTH 1T2JA 4WV1B 5IFAH 1FO0H 4TNVK 4OLXL 4IDJH 2FEDD 3CVHA 3K4DA 1U3YA 3LHPL 1Q94A 1ZLUH 2ZZUT 3VGEA 5DJXB 4QRRE 2JK5A 1P7HL 1CE1H 3UO1H 5E2UL 5D70L 2DAVA 5IMKA 1QSEB 4L8DA 2ZSVB 4UNTA 1FDLH 1U92A 4GO6B 1F6AB 1QFWI 3DWTA 2ENYA 2YPLB 1MCBA 1BQSA 2VLKA 5CIPH 2X4TA 2OXHA 3BE1L 2NY6D 3QI9A 1RD6A 2N56A 4JRYD 2F9BT 2EDWA 5F89A 4EBQL 2N7AA 1RQ5A 3VFSA 4I4WA 2GFBB 4NWUH 2AK4E 5AYQA 4HMEA 1ZGLB 2EIDA 4YQXH 2Z92B 4MS8D 2FBJH 4KK8D 4U6YB 1CDYA 1CG9B 2D03H 3GSUB 4XI5D 5F1NA 2IADB 5INDB 3GJFA 1D9KB 4ZSOB 3BUYB 4XNZC 3VCLA 3VWJC 3S88H 4EBQH 5DLML 3H9SE 3PWJB 4YK4B 3QUKB 5IW1A 1GGCL 2XWJB 4PP1C 1I3RA 4WUUE 3BP6A 3JWDH 4L8CB 2AXGB 4IMKC 2XA8L 3WHXB 1XGUA 4HWBA 4R0LA 3MRNA 3TJHC 5T3ZE 5DLMH 2OXGA 2HLFD 2YN5A 4KTDH 1EAPA 4JQIL 3O11B 4HS3A 4UBDD 2XN9B 4G43B 3FQXB 1W72H 1C08A 5HPMB 5DGRA 5JZ7D 2A2QT 3CLEL 1AKJB 1NDMA 3CMOH 4PRAB 3WO4C 4YXHH 4NYLB 5LAXB 3BPLB 3H7BB 3NFSH 5IW3A 3UZEA 1RZIA 4RA3A 3G5VB 1K5NA 1IC1A 4K8RL 5I1CL 5C2BL 1U42A 3NCJL 2LV4A 5HYSB 2DQCH 1V7MH 3P4MA 5HI4C 5C0NC 2QKIB 3O81A 2R1YB 3ULVH 3STBA 3CFKB 1RU9H 1PKQA 1DQML 2HJKB 2D7TL 3KYMB 5KS9A 4PJ8A 3HR6A 3LKOB 2YUZA 3PF2A 1RZIB 4WEBL 3WFZA 5KANI 4NNYB 3FQTB 3SDAD 3OPZH 5DR5L 3MJ6A 3U2SB 4GSDH 5BZWB 2A6IA 3RRQA 2BNQB 4KROC 4L5FH 5HI5D 4HGMA 4D9LH 3QUML 4FQXD 3JWOL 3DPBA 1XF5B 2AP2A 4NKMA 3O4LD 4X0KA 4PJBE 1LGVA 4QRRB 3BD4A 2F53D 3BWAB 4ZAKB 1LK2B 3FOMA 4LKCB 1CDGA 1TJHH 3BIAX 4F57H 3K2UL 1R5VB 2COQA 4P46C 3NH7L 4AL8H 1CBVH 1PQZA 1CFBA 4WW1B 4JDZA 1AE6L 3WE6A 4NIKB 5I75C 2R0ZH 4X7SL 3OKNB 4ZO7A 5KSVB 3BD3A 1A1OA 4NQTA 1KENH 1MFEH 2BHYA 3ZDZF 4Y4FD 1I1AB 1ORQA 5D5MA 2AEQL 3VXQB 1L6XA 2NY2C 3MV01 2C3VA 5DRXA 2AJVL 4HUMB 12E8L 1I7TA 5B4MD 4CVWA 4P5TB 1G0DA 5FM4A 4R90H 2F53E 1M71B 4ONGL 5D7JC 3TA3B 1CGSL 5FYKL 4XNXL 2R56H 5DFWH 1SM3L 3EDJA 1U8LB 3OKLB 5E8NB 4HCRA 3WMSA 3ULVE 4WTZG 3L1OH 3VFVB 5I1JL 4F7EB 2OR9H 1A4KA 1IAIH 4O2CA 3P9LB 1KXTB 1NDGB 1G7JA 1FV1A 3GIZL 2BRQA 3IDNA 3U6RB 4NQXA 3QCUL 4HIXH 2EDEA 3GMPA 4XCCH 3B2UC 2AXJA 1F6LL 1WZKA 4RMVA 2ICWI 1DBJH 2VC2H 1LEKB 3O6LH 4P2OC 4M4PA 1TJIL 3JV4A 1A6ZB 2IBGA 1I8MB 4D0BB 4M48H 3RGVA 1PG7X 5CWSA 3K1KC 1KPRA 2D0HA 5C92A 3TGXA 2BCKB 2QSVA 2A73A 3HE7C 4G6AC 1RUAL 4FMKA 5FUZH 2BK8A 3C2AH 5F7DB 4TNWK 5ABDE 1CFTB 1NC4D 4YHOL 3G08A 3K74B 4WHCA 5FCUL 3O9WC 3RNQA 4I9WD 4LPCA 2NNAA 3BP5A 4PLKD 4FQXA 4M1DH 3TA3C 3UEZA 4NHUB 2IAMC 3MLXL 1GVIA 3THML 2DYPA 1HINH 2I5YH 4R0LC 1UM4L 2CXKA 1OSZA 4NCDA 3SGEI 2IPTH 4OFDA 5HDBF 3P77B 1IT9L 3IS1X 1U3JA 4KDWA 4PJ8D 4K71C 5FCSH 1NLBL 5KVFH 3BHBB 2RIKA 1PG7L 4U6XB 2Z92A 4YK4C 1CXFA 5KS9F 4PV8B 1HDMB 4K07A 1AGBB 4MLSA 3MXVL 2FX7H 5TGBB 1N6QH 2ZG3A 1JMZA 4I18A 4NO2B 5HHNB 1JNJA 4AEFA 1G7PB 1MJJA 1WAAA 2YPLA 3D9AL 5IMLB 1DR9A 2R0LL 4WY7H 2C4XA 4G6KH 2YEZA 3BESR 1OLLA 3QI9C 4LHUD 4K3GA 4P2QE 5GGSY 2VLLB 3K8KA 3VWKA 4PJXA 1R0AH 2XZZA 3JWOC 5BRZD 4OGXL 1NBQA 4S1DD 5C0GA 1RV6X 5A43C 3HB3C 3RVTC 3AS3A 1B6DA 1I1YB 1WVZA 5L9DH 5GGSB 1A4KB 1TZHA 2F53A 2VO5A 1AQKL 4ZPTB 2A9ML 3BIKA 1G7QA 4MX7A 3SE9L 3ZDYF 1FLTX 3M07A 3V4PL 4KRMB 5J1TC 3MGOA 3WFBL 4KK6D 2X1XR 2OMNA 4PRNA 1R24A 2IC2A 1MRDH 5IP4A 1CLCA 3MV8D 1LK3H 5IT2H 4X5XA 2M1KA 5ADPL 3FB5B 1ZEAL 4OCMC 3SDAA 2B2XH 4R96A 3G5XA 5IM7A 3GIVB 2HYMA 1SMOA 3BAEL 2YXFA 3JZ7A 1SBSL 4HQQL 5TE7H 4NUJB 3PWPB 4JZJA 1H3PH 3MLRL 4FQ2L 4IRZH 1K4DB 2W0KA 1E6JL 1BZ9B 4HUWA 3SY0A 2R2HA 1ZT4A 4XWGL 2R2EA 1FYTB 2L7UA 3FQRB 4X7DC 1FCCA 3SKMB 5INCA 3FO1A 4HCRL 3CFEA 4L3CB 3ULVC 3N1QC 5IM7B 3UYPA 4R96B 2AVGA 4KVCL 1G9ML 4LVNC 4ZDHA 1IVLA 1FYHB 2MQ3A 3H42L 2FLBT 4C83B 4PS4L 3F7YA 5FA3A 1NUDA 5D1XC 1K6QH 3WXWL 5FV2A 3WL9B 4Z7WE 3FMGL 1DQJB 3F12A 3O3AB 4L3AA 1Q0YL 4NQCD 1Q0XL 1UXWB 1KCUL 2X10A 1NFDB 4JFEA 2YD7A 3EYVA 5DD1H 3KYMA 5KS9B 1QP1A 2CO7B 2J88H 4LSSL 5ALCH 3ZL4H 3UAJC 1Y18A 3RTQD 1O7SA 3DX9B 3U7WL 1A6AB 5FOBB 2A6JA 4Q9QL 1RVFL 3L3DA 1NAML 2H2SD 1DANU 3HS0B 2XXCB 1AD9A 2KZWA 5DT1H 3TNNA 4EEEA 1XGQB 2NY3C 4M3KB 2FL5A 4P2RA 1KNOB 3QIWC 4J3SA 4WFEE 4ERSH 5I9QC 1D9KD 2RCSL 3TZVA 4NYLA 3DROB 5DQDL 5LAXA 4L9LA 1QBML 3S36X 2A38A 1VDGA 4P9MH 1FNLA 3ET9F 5LWYH 4LCIL 1QNZL 4QHLA 2EIBA 1G7IA 1CFQA 5ACMA 3KXFD 3U0TA 1VGKB 4APQC 1VFMA 1T22B 2E9BA 3O9WB 3RAJL 3DVGA 3BZ4A 4OCWH 2XTJC 4K7PH 2DQUH 1JNNL 4HXBL 1F2XK 3LZFL 3NIDF 1A7NL 4RZCA 1EIBA 2WV3A 3N06B 3SE3C 1XCTA 1YEHH 4H1LA 4EXKA 1AQDA 1NBZB 4LLUA 2D7PA 1TITA 4UINL 4XCEA 1ZVHA 2XWJA 3OKEA 3PWNA 3TBTA 3BXNA 5F1NB 4U3CA 1Z2KA 3MUY1 4ZUSB 1R3LB 3DVGB 4XCCL 4I8DA 1DL7H 5HYJA 3MC0A 4TSCL 5I17B 2R2EB 3MRIB 2UVFA 4L9LC 3T3ME 1SY6L 1RZGB 1G7IB 2GFBA 5HDLA 5IQ7L 1U8PB 4B5EA 2YZ1A 1NCWH 4MMXC 3QRGH 4MA1C 4X8JA 3PWPA 4UT7H 3PABB 2AGJH 2Z93B 4HPYH 1CGVA 1FNFA 2V7NB 3HI6H 3LKNA 3QWQB 3CGTA 3P9WB 4NRXA 4N90E 5TPWL 4P2RE 5ERWB 4FFVC 4YXLH 1P7QA 1T1WB 2OI9C 1PEWA 5MP6L 1GGIL 2QEJA 1Q1JH 1H8SA 3FHAA 2GSIA 2IMNA 3KYAA 1EEQA 1NUGA 2HA1A 1SBSH 5TE7L 2XRAL 3DV6A 2AI0L 1FH5L 1JP5A 4C4KO 2QHRH 4WV1A 2Z9TA 1FIGL 5HGDB 1MVUB 3IDYC 1HNGA 4PYGA 5C0JA 1B4RA 4DGIH 3C8KB 3HCVB 4BQ6A 4CVZA 2R0LH 3DETC 3ZLQC 1A5FH 3K7UA 4ZO6A 4QLRA 1X5LA 5FYKU 2I27N 2J6EL 1HIML 1CVRA 2IFFL 2PNDA 2GK2A 4KWUA 3OAUL 2BNQD 4QY8B 3GDBA 4Z7VF 1JHTB 3FN9A 3ROLA 3TIDB 1L9MA 4NBXB 2XG5A 2XPGB 4BH7A 2F5BH 4JO2L 4LPYA 1AGFB 4Z7UA 3MJ8B 1IGFH 2EDOA 4UQ3B 5GS0D 5HD8D 3B6SB 3RL2B 3KXFE 5I0ZA 1BZ9A 1MQKH 1YY9C 4P2YA 1KENL 5CILL 5FKPA 3K4AA 4JPKH 3U9PL 3WNLA 4XVJL 3H9ZA 1IEBB 2J4WL 4RFOH 2J8UE 5C0AD 2VQ1A 3PQYA 4U31A 1X5JA 4JRXB 2MHAB 2E9IA 3S35H 2YHGA 5JIPA 1HSAB 5D7KD 3IETB 1ZTXL 4OF6A 3SDYH 4B41A 3FQUB 1AI1L 1R3KA 2BXZA 4QEGA 3T1FB 1A1MB 2FIKA 4FFWD 4XBEL 4X4YA 5BVPL 1RUKH 3HC3H 1REIA 4H1LG 5IESH 3BSZL 1HILB 4HCRH 4XAWH 1FO0B 3BWUC 3HZYB 1QSVA 4WI3A 5IMMA 4GT7A 2YKLH 4HKXA 1LDPH 4HIXL 4Y5YA 3TN0D 1YNKL 5FHAL 2IGFH 2HMID 2YKLL 5D1QA 4TUJA 4Y8DC 4G7YH 1Q9LB 3F6LA 3J8F7 5CZXC 3P4LA 1UWGL 1CFSB 5EU6D 4ZFFB 1K5NB 1VFOA 2A0LD 3ZKNC 4Z7NE 2CR6A 3S4SG 1IL1A 2R56L 5HYQA 4H8WC 3QDGD 4E9LA 4KGJA 2CD0A 3S5LA 3DECA 4WFFE 5BZDA 4LARH 2OSLB 3V6OE 2BVTA 1KB9J 5J1SC 4OKVB 2G75B 4JREC 1MHEA 5L0QB 1V05A 4FXLA 1GOGA 4Q9RL 1UWEH 3O11A 4HS3B 1A3QA 5HJ3B 4LARL 4LSUL 4BYHA 1KJ2A 2P47B 3SKNA 2WUBL 1JGVH 2IPKB 5IVZB 1P4LB 4I3SH 4IMKA 2C1OA 2B5IC 3PV6B 2D4DA 3TA3A 5C0FB 4TVPE 1HWGB 1F8TL 4M5ZL 4P2CG 5EO9A 3SGJC 2C4FT 3RKDC 1DBAL 5MEOA 3KPQB 3NH7H 4K8RD 3IETA 4R2GD 5FO7B 4LQ1A 5DK3A 4C58B 3HC0A 3E1F1 1ORSA 5GSRA 4DFHA 4LPWA 4HK0B 4WFFD 3O3BA 1QSFB 3E3QE 1GAFH 3RQ3A 3OKNA 4OT1H 1T2XA 1VA9A 4NC2B 1I9IL 1WUNT 1TCMA 2B4CH 1QHOA 5B38G 2A74B 2RCSH 1MWAA 3KPQA 1JHKL 5EU4B 3IKCA 4OQ1A 4LSPH 2UY7A 1T5XA 3T3PF 1VACB 4JO1L 1AFVL 2XPGA 4BH7B 4DGYL 3VXUE 1LEKA 4XP1L 1X4ZA 3BQUC 4U1KB 3SCMD 4K9EH 1HSBA 4IS6B 1HE7A 4OSUH 3MRGA 5KVEH 2VN7A 3UTOA 3UZQA 2FH6A 4D0CB 3GSNA 4WU7B 1JZ6A 2D4FA 4X5WA 3SE8H 5I71B 5K9QG 5E1AA 3RBSA 1SQ2N 2WWKO 5CILH 2F58L 5JIHA 5D8JL 3TBWA 1IL1B 1MUJA 4DEPC 5H2BA 2NY1C 1MCCA 2VDKH 5BV7H 3UPRB 4ZG1A 1R3HB 2NW3B 5JO5B 4G9DA 3VFTB 4JCLA 3UTZA 2EO9A 1MCHA 3IFNL 4F2MA 4O2EB 3TCXA 1YEFL 3EYOB 3BZEB 5C0GB 4RFNB 2DTML 4LPXA 1KPVA 2BY1A 2KKQA 5C08B 5F9WB 1KCSH 4XNMA 2GKIA 2NPLX 1IJ9A 4MQ7B 4P0DA 4IHOA 4L4VB 3BSZH 3VXMA 4FP8L 1AKJA 4PRAA 1OAQH 3QO0A 3RX8A 1FL3A 1W72L 4LU5H 5E2WL 5GS0L 1TJGL 3HPLB 1C08B 5HPMA 1NCTA 1ZMYA 5I17A 1JWMB 1D6EA 4OTXH 3TO2A 2AI0H 4CJ1A 2Y23A 5CCKL 4ZUSA 2JB5L 1O5DT 1JN6B 4WWKC 4CBPA 5JHLL 3O41A 1SYVB 4QKXB 3DX6B 4QYOA 1BM3H 3MR9A 3GSNH 3KPSB 2DQEH 4MDJA 4X9FA 2EECA 2R0WH 3HN3A 1A6VL 2W0FA 3UYRH 4LP5A 3DX8A 3PWVA 4IM8A 4Z5RB 4FMFA 5DVMA 4GKNB 5EN2A 3VXMB 2FATL 4OZIF 5IB5B 4NKDB 4PJEF 5FAAA 3UJIH 3VFWB 3UTPE 1F4WH 4DTGL 1GYAA 3HI1A 4QHLB 4I3GA 5EPMB 1CU4L 3ABZA 5MEQB 3JWNC 4L29A 5DJ2A 2QR0B 5F7MC 4JFYA 4XTRD 3V9FA 3RTQB 4MNHA 4XVJH 1JTPA 7FABL 1UH2A 2QSQA 4PS4H 3C8KA 4FG6C 3BT2H 2DTSA 1INDL 3DX9A 3LN4A 4MXWL 2VL4A 1NDGA 2EC9U 4DN3H 2NX5E 1U8HA 1MELA 1TVDA 1M7DB 1UXWA 5CMAA 4LQFH 2CDGA 5EG6C 4IS6A 1X4YA 4RWHA 2NW2B 5ISZE 1BWWA 3ARGA 4N0FB 3SKUD 3OJVC 4CW1A 1DUZB 1BQHB 1RULL 4JY5L 4AEIL 3CVHL 2Y5EA 3RWHB 3QIBB 3ORJA 5I76B 2VDPL 2R29L 2EDBA 1H3PL 2DI7A 1OF2B 1I3RB 4U0RC 5FDWB 3JWDL 2CGRL 4YR6A 1QRNB 1AR1C 2X9YA 3U79A 3G6AA 3NABL 3SKOB 3VFWA 3G5ZA 4GW1B 3DBXA 4WCYL 3KVQA 3QPXH 3O8XB 5EN2B 1FYTA 4WTWA 4JZOB 1GRWA 5IUSA 2DL9A 3PWLA 2GT9B 2WINB 1LP9A 3C6LC 4I77L 1AQDB 4PTUA 5ADOL 4LMQI 1VFAB 3MMEB 4X9HA 4FNLH 2NZ9D 1OAKH 1IEAA 1EGJA 3QCUH 5DMYA 3ARGC 1I9JL 3QDME 1UVQA 1YQVH 3FB6B 3FQWB 5BCAA 5T3ZL 1NCBL 3B2VH 1OGAB 1FVCA 5IROA 4U1LB 1CN4A 2VR4A 2UY6A 1NFDF 4BK5A 5EO1A 1OAKL 3MLUL 3T0XA 4FQPA 5EUOE 3MBEC 4DGVH 4XPTH 2AJXL 4RNRA 3X13A 1MFNA 5E5MA 1X5AA 3U2SA 3SPVB 2OQJB 2A9NL 4LIQE 3STLB 6FABL 5I16B 5I1DA 4YXKH 3T2PA 4K7FA 4A6YL 4FQCH 2Y9RT 1TMCB 5I30L 5I66A 1IC7L 5DVKA 4Q2ZB 5D1QD 3TNNB 1CTNA 2NY3B 1ETZA 3G04A 2FX7L 5D71H 4PJXB 1NMCB 3RGVC 4YEEA 5E8OA 4FZ8L 3B8YA 1G7MA 3IFPB 4KRLB 4Y4HB 5JW4Q 5K9JL 4LVOC 4GMTL 5ENWA 4LSRH 5GGVY 1YMMB 4V1DE 5BV7L 1IM3B 5DJAA 1AHWA 4NC0B 2ADJA 4D0DB 3ARFA 2J8HA 3OKKB 3ECBA 4D9RE 4C83A 2YN3A 1HOCB 4NQDB 5JW3H 1AQKH 4QF1B 4OQTL 3QCTH 4BFEA 5ISZD 1KTLB 5J9PB 3PGFH 1SJHA 2IAMA 3BGFC 5FA4A 2IQ9L 3OJ2C 1RUKL 4G6KL 3RU8L 1P4IL 3OGCA 5E6ID 4Y1AB 5HHVL 5FKPB 5DEZA 3TFKD 4DWHA 2EC8A 1YN7B 2E8YA 2CJUH 3I6KA 5AWNH 5I1HL 5IB3B 1BECA 2IADA 1T20B 5EUOF 5F88B 5D2NE 1MI5B 2JIXB 1QR1A 3C2SA 4Q6IC 3ARXA 3DX7A 3V79C 1WIOA 1NANH 4G9FA 4Y2DA 5HHVH 2O5ZL 5GRJH 2FX9L 3O8XD 1ROWA 5KANG 4P48A 1QA9B 4ZXBD 1J18A 2FZ3B 5CWSB 2PXYC 2QHRL 3BP4A 5B39A 3PP3K 5L7XL 2WWMC 1QLEL 3BPLC 2VDML 3HZVB 1A0QH 1KB9K 4PBWD 5EIVA 5C0JB 4XCFH 3MREB 4V1DB 1HHKA 1ZLSL 4OFPA 2HFGH 3BOVA 4TTDD 5JXED 1OP5K 1I1YA 1N0LA 4JRXE 4U0RB 5DRWA 3TWCL 3DV6B 5K9OA 1DSFH 4D8PB 3HG1E 2VTFA 4F7EA 1NGWB 4G8EB 2FJHA 1EK3A 3QHTC 1U8LA 3OKLA 1JF5A 5GS1A 2WUBH 2P8PB 4UIKL 5C0BB 1KFAH 3NFNB 3SDYL 1HCFX 4KVNL 5ITBH 5ICYA 5D1QB 4YNYB 5D5MF 3MROB 2BOBB 4L29B 3HLAB 2QV2A 3EOBA 1OTSD 1OTSC 3CC5A 1P6AB 1HDMA 2R15A 4Y5YB 1C5DB 5GRWA 4JAMB 1N3NA 5GZNC 5HHPA 3ZKQD 1NC2D 4BUHA 1WC7B 4WJ5B 3HZYA 1R5IA 2DI8A 1CI5A 4YDVA 2M26A 4YBQC 5IB3A 5JLZB 3DX8B 4JN1L 2PN5A 3FO0H 2X9WA 1P7KA 4ONFH 1KJ2L 1BQLH 4HIJA 2P7TB 2V5YA 4TPRL 4JDVB 3S3SA 1QZ1A 2NNAB 4CKVX 1E4WL 5F7EH 4Z7UF 3VD5A 5KJRH 1V3MA 5F8RC 2B7DT 1JPFA 3PQYB 3G08B 1DVFA 1N8ZB 1E27A 3D48R 3WKNA 1D6EB 2BY2A 1RJZA 4KY1L 4Q9CA 3FL7A 2D03L 1KTLA 4MCZB 3WFHB 2A73B 3ARBB 1AC6A 5F3HB 4RDQG 4JFOA 1E28B 5ID1B 1QG3A 3PIQB 1I85C 4Z7UB 4J6RH 4D0BA 1FE8H 1DQDH 3OX8A 2R0KH 4JN2A 3QIUC 3WKMH 1A02N 3IT8D 4JLRA 3O6FD 4M7KL 2F74A 1ZLUK 4PYHA 2ATKB 1N5YH 2V2TB 3HS0A 4FQQB 4R4ND 3QBTB 3BPOB 3F65A 3WS3A 4WEBH 5A3IC 3SQBA 2XKUA 4XPTL 3NTCL 3S3PA 4PLNC 5C07B 3SDXF 2FSEA 4IRJB 1J0IA 5T1MB 5FB8A 1EHXA 2EKSB 1BQUA 2VLJA 1X5ZA 3L5XL 4OCRH 5DUBA 2XRAH 5DQJB 4PJCB 4N68A 1HKFA 2X70A 3OF6D 1I9RH 2Y36L 3FRPG 2QQLH 5HHQB 3I85A 5E1AB 4PJEB 3VMNA 5IKCB 1DQLH 5CGMA 3FO9A 4WU7A 1L4IA 1S7VA 4MB3A 3MRGB 3ARDB 4JGJA 3I75A 1X5XA 3IVKA 3VXQA 4BZ1H 2HG5B 1ZGLP 3WN5C 4EOWL 4GMTH 3GJFH 3QIUA 2IQAB 5EC1A 1MCPL 2FCBA 3LKNB 1UACL 1UCTA 5TDNB 4X6DE 1IEAB 2XZCL 3FT4A 1S3KH 5LGJB 4OCSH 4WO4A 3CLFL 4RMTA 3U4EA 7CGTA 1IMHC 4PTUB 3P73A 2QQNH 4F33B 4HJGB 3QDJB 4CU8A 5DYOA 1M6OA 4KKAC 3KYOB 3HRZA 4FQ1H 5FF6A 1JGEB 4HWNA 5E24E 1NANI 2AXFA 2ZP0T 3HC4H 4CMHC 3O3BB 5C7XL 5D1QC 1NFIB 3G9AB 2IQ9H 4KTDL 1N26A 5GZND 4L4TB 1CDUA 1P4BL 1N59B 4ODUA 3MBED 4PJHB 5I18L 4F15B 4MAUH 2VIRB 3DXAB 3G5YA 2ARJA 1RUQH 2VWEE 3EOAA 1RMFL 4DQOH 2ZSVA 3CSPA 3TBYA 3GMMA 3BIKB 4R7NA 2E3VA 4HIEB 2CRMA 3C5JA 4OF7A 5HGHA 4N9GB 4TOYH 5IHZA 1FFQA 3TC9A 4P4KB 5TH2A 4CDHA 3W0WB 4EVNA 1Y0LA 3ARBD 2RAMA 2XKNB 4MSWA 4TTDC 3V52H 5JXEC 2Y6SD 3BO8A 2X4NB 2R4RH 1MEXL 3NMEA 5CD5D 3NPSC 2C5DC 1FRGH 4NZJA 1L9NA 1MI5D 3K8LA 4ZFFA 4HLZG 1DBML 2WWMD 1AD9B 2AV1A 4IIQA 3VXUA 5GHWH 4CL7A 1U8OA 1PYWA 5DRNA 3IDIB 5HYSG 3TO4A 1LE9A 1MLBA 1V3KA 4HC1H 3QG7H 4F9PC 1EHAA 1KLFA 4ISVB 1GGBH 4OBSA 4PV9B 3ILQD 3IDMB 4XRCA 1F4WL 4Y5XC 5FKAA 4YZFE 1HHHA 3MPCA 4WENB 4KZEL 4X4ZA 2EDDA 4UU9A 1NAMH 1EH9A 3LDBB 1Z9LA 3FRPA 4LLVB 3MV8E 4NNPH 5ALCL 1NL0H 4LCUB 2APVA 5F93C 1AXIB 1LDSA 1M7IB 3QFJB 4Y19E 2MHAA 1T0NA 4Y16D 2ERJC 3I3BA 2R1XB 3QHFL 4FG6D 5I1KL 1WBZB 3HMXA 1ZGLA 4WCYH 3VXOA 1NFDE 2LE9A 4B0MM 2Y07L 3DIFA 3C60C 3PHSA 5JDJA 3BE1H 3LS5L 4JZJB 1HHGB 1S9YB 4NM4L 1AGFA 1T89C 2OL3L 2VDNL 4NN7C 1MHPL 4OF0A 5KSBF 1SVCP 3K1DA 5F7HA 4EOWH 2W07A 4LHUG 3IFOB 1NH6A 3O2DH 4RIRA 3VDCA 1AIFA 2NY7H 4QWWC 4YZFF 5IB2B 1D5BB 3CFDA 2Y5TA 2P8LA 2FJFA 2BY3A 5SX4I 4YHZH 2V5MA 1JYWA 1B4JH 4NWUL 3BZFA 4OF5A 2EZ0C 2ICCA 2ZCHL 3WEXB 3WKML 8FABB 3W9EB 3TBWB 1DVFC 4LLDA 1HKLH 1OQXA 5ID0A 1YMMD 3ULSA 1YEJH 3X14B 1I1CA 1QVOB 4RMWA 4ACPA 4WY7L 4HFWB 4N0RA 3VRJA 1W0WB 5EU3B 1GC1L 1RZKH 2RJMA 35C8L 5I15L 1YEKH 3LRSA 5JW4N 5JXAL 4QHKI 4UILH 1CL7L 2FHFA 3ZTJG 1HSBB 3N9GL 3IFOA 3F62A 1H0DB 1CD0A 2I9LB 2AK4A 2PTTA 4JKKA 5HPOA 3D85B 1FFOA 5JPMA 4M7ZB 2DMKA 1D5IL 4J6RL 4MJ5B 5AWNL 1M7XA 3D0LB 3C9NB 2Y36H 4ZFOB 2FGWH 4KQ4H 4EI5A 4QRQA 5EO0A 1CGYA 3C6LD 3MV9B 4GAGL 4WUKH 4PV8A 1CGUA 3VH8G 2IBZY 4ZNEE 3AM8C 4ZOAA 1U6AL 2Y1VA 4HWEH 2F58H 1BIIB 4PJFA 4QRRA 1FGVH 3ILQC 1MREL 4H20H 4LCCB 4Y88A 3PP4H 1OAYL 5SWQA 1AR1D 3MRPA 3WXWH 1KB5A 5MEOB 5FCUH 1YECH 4XNYL 1NAKH 2JJSC 4RZCB 1L0YA 2BNQA 5IBUB 3UX9B 4ELMB 5FO9B 2EH8L 1J5OH 4FA8A 1CXKA 3L95B 3BD5A 4JRWA 5C0BD 5HDQH 3CXDL 3T4AA 3TM6A 3RWIB 1VGKA 5C09B 3LEVH 2IMMA 1AD0B 2R1YA 2OSLA 3U1SL 2HKFL 5C0EB 4PJAA 1LEGA 5EBLA 4ZFOL 4RBPH 4NSKB 4XPBL 2Z91B 5AZ2L 3BQUB 1IAIM 4ZAKC 3WD5H 4NC1E 3R06B 3RBGA 1MHCB 3QQ3A 2YMXL 3QAZC 1YJDL 5D1ZC 1QTYT 2E6PA 4BH8B 4TUJB 1QKZL 4NQDD 5ITBL 1N2RB 5A16A 1NUFA 5I1EL 3VRLE 3HC3L 4PD4K 1N6VA 4A2MA 5SWSD 3LRHA 2NY2D 5B38A 3MJ9A 5IVNA 1HZHH 1ZA3B 3VXNA 3Q3GA 3VFVA 4Z0BL 3TBYB 1H8OA 3NA9H 1U8MB 4JVPA 2VXUL 4MJID 1P9MA 2A9MH 3UBXA 2AEQH 4YHML 5KSBA 1LDPL 4EVNB 4I18C 3P2TA 3RY6A 1IGML 5IW1B 2VL5A 4YEFA 5K59E 4KGLA 5DJ8B 3BUYA 4LSQL 4UDTA 3ZE1F 1PVHA 4F37K 2NY5H 2VQ1B 2VAAA 3S37H 4C59B 3IDJA 1S9XB 4G7YL 3QRGL 1FC2D 1BWMA 2Y25A 2F19H 4LRIC 4LPTA 2R4SL 2OK0L 1VADA 1FNEA 3UP1A 4Z18A 4XXDB 5EWIH 3P4NB 4K3JH 5F89B 4A6YA 4PGZA 2K3TA 1CLYH 3ARBC 5JOPE 2F19L 3QHZL 4NUJA 5IQ9A 2VLKB 2BHUA 1NQBA 1QFWM 3MRFA 3MRJA 3VRIA 4HBQA 5F21B 4JPWL 2VYRE 4X0KB 1NSNH 5GGRB 4QY8A 2JJWA 3P40A 5I1CH 3ILPA 3W39A 5C0ND 3ULUL 4M48L 4JPWH 3QJHB 4GKZA 1U8KA 2P5EE 4AH2A 4NJ9H 4PP2B 3O6FC 2ID5A 3MGOB 1IC5H 4LFHG 5HHMD 5C0RH 4RMQA 3FT4B 4FTVD 4X7TA 3FCTA 4WHTA 5DD0L 3QEHB 4KHTL 2VLJB 1OM3H 4MNGE 4GRWF 3S96A 1YMHA 2J6EA 2CKBB 3BEVB 5J6GA 1LMKA 1DLHA 3OJDA 3OV6A 4ZSOE 3VI3E 2HG5A 3KPRB 4Q6YA 5D7SH 1OGAE 5SV4A 4P3CL 4GXVH 3MNWA 3VE0A 4JO2H 3RL1B 1E4XI 3TYFB 1YY9D 3I9GH 1WITA 3KLHC 5FUCE 1LILA 5IWLA 1ZT1B 1JL8A 3OHXA 3BQUD 3V4UH 1CXEA 1MJJB 4APQB 4QRPA 1PDKA 2IFFH 5D1ZA 2AJZA 5GRXG 4MD0B 3BW9B 5IW6B 4JDTL 4YBQD 3QNYB 1OP3K 3TPKA 4MB4A 3TJEH 1OSZB 5J8OA 1KTKE 3RGHA 1X6NA 2VZTA 4JZNB 1GIGL 3PIQA 3C60B 5JNYB 1JZ8A 4I2XB 2HP4A 5MEND 3QUKA 3ARBA 3ULUF 3OXSA 5A3ID 1YZZA 4JREB 4WFHD 5B22A 1CICD 3RNQB 3CXHK 1YEDA 3O4LE 3O9WA 2XXMB 3SE9H 4F58H 2CUMA 2DM4A 2NMSA 1ITCA 4HQQH 1LO3L 2FEDC 3HLAA 1CLOL 1DEEA 3LDBC 2FGWL 2LVCA 4OF8A 4G8GE 5GPRA 5EOQL 2XV6B 4UAOB 4X98A 3EO1A 4EI5D 2N4IA 1AKJD 1G7HA 2J8UF 4MQTB 5ADPH 4JPIA 4F3FB 2A0LC 3VXUD 5T1DL 4L8DB 3GRWL 4FXGA 3FFCB 4EI5C 1NEZG 2PXYD 1IKFL 5J1AA 2JK5B 2GTWA 4BJLA 3MRRA 3QZWB 5IOPB 3X3GH 1UM5L 1A3LL 3PJSB 1FL5A 5DRWB 3CXHJ 3OKMB 3KPOB 1KN4H 1JRHI 4LLQA 2P5WE 4G8IA 1WBXA 1QSZA 4KDTA 4PJHF 4ODTL 1MFAH 1NMAL 2O5XH 2CQVA 1A6WL 1W72A 1M71A 5C0AE 5T1KD 3CDFA 3CFCH 5JMRA 4U0QB 5E6IC 3IAGC 2AJYH 5B3JE 2XA3A 1G1CA 1I8LC 1KCUH 1FL5B 3H9HB 3SO3C 4QHUA 4CADB 5KSUA 4OZHB 4FQ1L 1UJ3B 3OAYH 1IAKB 4R7DB 5FHBL 2P49B 4YDKH 5KSVA 1LO0H 4YDLB 4ETYA 1RI8A 5DWUH 4Q9QH 3FQRA 2V17H 4HV8A 1DBAH 5BRZE 4ZAKD 3T4YA 4XPAH 1BZ7A 4WU5A 4Y1AA 1RK1A 4U6VL 4WV1C 1QQDA 3BKJL 3HRPA 5HTSA 1MCLA 4PJGB 3DRTA 4OM0H 4OZFG 2Q20A 2I60L 3DV4B 3MBXH 3H3BC 5HHXH 4WUUA 3INUL 5MENE 4HGKC 4PY7B 3GUTB 4JFFA 2DQHH 1T21A 5FYLD 4JR9H 4PLJD 3CFIC 3VFMA 5IK3A 2KQNA 4Z76B 1RY7B 5GGQL 2DI9A 2R29H 3L7FA 1QACA 3INUH 1J05A 4ZXBC 2YPKB 5HSFA 2FX8H 3WHE0 1YMMA 2B1AL 4P23A 2Q8AH 1BF8A 1T5WB 1C8PA 4I48B 4XCYA 4Y1AE 3EGSB 5F7KC 4I77H 4YGVB 3ULVD 3UTPD 5EZIH 1OLZA 4XNUH 3HI5H 2X1OA 4PRHD 2G5RA 1IGCL 1YEGL 2FDBP 4HJJL 4NKOB 4CN1A 3MBEA 2R69H 4OGXH 4ZO9A 3GGWB 4NOBA 2OP4H 5FYJU 5FM5O 1YEFH 5HHNA 2H3NB 2DMCA 3U9UA 3V5DA 1PZ5B 5D5ME 2CPCA 4NC1C 4GXVL 4HGWA 4UNUA 5DXWA 2EDQA 1MJ7L 4QOKB 3TBSB 1KJVA 3FQXA 1EEYB 4TRPL 3MNWB 4YHLH 1RZ8B 2VE6A 4FTVA 4NQCE 2ICWB 1S7TB 1NC4B 5C0RL 3S96B 1DVFD 3T0AA 1G6RB 2J2ZA 1CICA 2RFXB 4G8GB 5JW5B 3O6MH 4JO3H 4KU1A 5D72H 3T8XA 2ZUXA 1C16B 4Z76A 4RX4D 3MUJA 1TENA 4FQXB 4PRPD 4S1DC 2AJSL 4WI7A 5BVJB 1SVZA 4MA3B 1U2HA 3RWGA 3GJFB 4U7MA 4GG6E 4OI7A 4L3ED 4B50A 4XBPB 4PY8I 2CDEB 4OUUA 4RGNE 1KYOJ 3ARPA 3T0EA 4APQD 3MV9E 2FEEL 3QT2A 4JANB 3NZ8B 4KI5E 5IEKB 2QQNL 1KPUA 2OM5A 3MRDA 4KAQH 3GM8A 3QP3A 1NAMA 3P30L 5JOFB 2NY2B 3AROA 3GSXA 1LP9B 4G3YL 5D1ZD 5IWLC 1D9KC 1NGXB 3MRKB 3P4NA 5AZEH 2PW1B 4ZFGH 5FEBA 2Q7NA 3D39D 2VNCA 3Q5TA 3ARGB 4X80L 3TLRA 4LLWB 2CDGB 1XR9B 3T2NL 3SGKA 2F5BL 4ZD3L 3U6RA 4YC2B 5I2IB 1CF8H 4WRLA 5EIIA 2ED8A 3NA9L 4KMQA 3ZE0F 4DVBA 4ONGH 4HUKB 3VD4A 2NZ9C 3PQYE 2QSTA 3TA3D 4AYFA 3U1SH 3EYSL 2EDHA 3FTGB 2ADIA 1A7PH 4BFIB 1CFVH 1IGMH 4J8RA 5F7LB 4G8FB 1XF1A 3KXFA 4ALAL 3AB0B 2EIZB 4Q58C 4G6AD 1U8HB 1I1RA 2FBOJ 3MRLB 1A7PL 3VH8A 1YNKH 3UTTB 1RSFA 3HHRB 2DM7A 2FEEI 4MNQE 4HX1B 3B8SA 2NX5B 2NY5C 1JPGB 1PSKL 4FABL 3GMQB 1WZMA 4UNVA 5CD5C 2AEPH 3QWRD 3RTQA 1H15A 3NPSB 4X6FB 2ZOKB 1G6VK 2A77H 3AFLA 4WI2A 1IE5A 3MRBA 2VLKD 3LQZA 5BJTB 2VXVH 4U1IA 3HKFA 5GS1C 2AXHA 2CUHA 1K8IA 1FAIH 3QDMD 3TO2B 1JGUL 5IMOA 5D7LA 3VXTB 5FYKD 1JWMA 2HJLB 4PGCA 1BIHA 3L3OB 5L7XH 2JKXA 5CINL 1RJYB 2DICA 4NPYA 5LQBH 2QADB 3V6FB 4XTRC 4HC1L 2DLEA 4ELKB 5JHDE 1RHHB 4JFHE 4AK1A 3S8WA 4N1CA 4M02A 3VD3A 4MQ7A 1F3DH 4P57A 3LQZB 5BJTA 3QO1A 4S2SA 3VD9A 1KIPB 1JZ2A 3PP3H 1UCBL 4BZYA 2YPVL 2HRPL 3EW3B 5CSZA 4LIQL 3P4MB 1KBGH 5IBLC 4HXAH 1C1EH 1FDLL 2XFXB 4F8TA 5DGQA 4RMRA 3QI9D 3ALXA 4J23A 2BHZA 3BJLA 3GSRA 2A83A 2Q8AL 3ZMRA 4HAFA 1TCRA 1IAIL 4CMMB 1CGTA 3VWJA 5D7KE 4OCYL 2CH8A 4WWKD 5JHDD 2YD4A 4AENB 3MLSH 4GQ9L 1RUMH 4FFZL 3V5HA 3ULVF 3C60D 1IC7H 4KXZH 3S9DB 3BPCA 3R8QA 4S1SL 2BVOA 5E0QA 1JJUA 4FHBD 4PJ7F 4KROD 3CDGA 5EU5A 3NIFE 4HG4K 4CN6A 1A3RH 5TF0A 4I48A 1QSFE 2Z4QB 4MD4B 4XCYB 2ZNXA 1IQDA 5JUEH 2FX8L 1UZ6E 4W4OA 4AIZB 2PYEA 4PREB 2ITCA 1GC1H 3C5ZA 3Q1SL 3IKCB 2FRGP 4GRWB 5F6IC 4HDIB 4RAUB 4K8RH 4PJ9B 3KR3L 2BSTA 3LS4H 2YC1B 1I8IB 3GUTA 4LP4A 3UTTD 1UG9A 4MD5A 1RMFH 2XWTA 4AMKL 4M3JA 3NCMA 1YPZE 1KC5H 3IJSA 3JXAA 5MHSE 2BDNH 5CKGA 2PW1A 3MRJB 3L3JB 3MRHB 4N8CL 3L3IA 4WTXA 1MRDL 2X6MA 2VDMH 3RZCB 3RU8H 4DKEH 4P2OB 1E0OB 4HS8L 3N1PC 2EDKA 2CIIB 2YA2A 1E4KC 5HYJD 4OZIE 5JW4R 1P1ZB 3ZKND 3MCKA 1EUUA 1FSKB 2VITA 4MAYA 3SGKC 3T0VA 3HUJF 1RURL 3WS6A 1FZMB 4XVSH 5B8CA 4X8XA 3BAEH 3SCMC 2Y6SC 4WW2B 1I9JH 3GBLA 2YC1A 5EOTB 4E0RB 2LFGA 4P3CH 4YE4H 4ZUVA 4EJ1C 1S3KL 5I8KL 2Y4SA 3CFJA 1DQMH 4XHQA 2EEDA 4F15C 1P7QD 4MJIA 4PP1D 4UU9B 1X3DA 1XF2B 1C5CL 1YQ2A 1XF3B 4PJFE 2DQJH 2MCPL 1WCBA 2WK2A 2HH0H 2JF1A 4ZNEA 1FBIL 2X44D 1LO0L 4X6BB 4R2GC 1EMTL 5DJZB 3GI8L 4LLAA 4R4FH 3MLTB 1U8OB 4PB9H 1EJ6A 1JHLL 3B43A 3OTTA 5CJ5A 4F7PB 3D39B 4RWYL 1FVEA 3GGWA 1I9IH 5I8EB 3CX5K 1IM9D 4PB9L 2XFXA 2EIEA 4P46D 5E7BA 1HNFA 2ZSWA 2VXTL 4DVRL 2Z8WC 3W5NA 1FN4A 4NM4H 3VJ6B 3VFRA 3GK8H 4MMZC 1ES0A 3GHBL 3RNKB 1OP9A 4JHWL 2R4RL 5B8CB 2GITA 7FABH 1SJVA 2OJEB 3X12A 1CLZH 4OZGE 1E6JH 3OXRA 5JMOC 3CH1A 1BGXH 5KW9L 5C0DA 3V6FA 1T7XA 3SKJL 4EUPA 1EFXA 3MJ8A 5DUML 2EYRB 4I0PD 1U58B 3TN0C 4RDQF 4Z0BH 5GISH 4TSBH 4HWZA 1MFBH 2W9LA 4QXTB 3QFJE 4Y19B 5T5FH 2P1YA 2CGRH 4ONHA 5T1LB 4PJ7A 1CCZA 4FZEL 1CK0H 1CICC 1S7UA 4PG2A 1DSFL 1IARB 1D3CA 5D96C 3U4EB 5CEYB 1ZK9A 2Z8SA 3U30C 3DO7A 4HUUB 3QIUD 5EU6E 2VXSL 1MIMH 5T5NG 3NZHL 4B53A 3DARA 4M61B 1I4FA 5L2KA 4DZBA 5CEXB 2V7HA 5EBWA 4RAHA 5DS8B 1FJ1B 4KTEH 3MLYL 5EA0H 5F70A 2EIZA 3IDUA 2DTMH 5KBNC 4BQCA 1FNGB 1P7QB 1T1WA 3QAZB 4KPHL 3QEGH 5HD8C 5GS0C 4X4ME 1KLUA 4QT5B 1GJIA 5M94B 3HCVA 5SX5K 2GJZB 1OW0A 5IIEA 3KLHD 2JELH 4PP2A 1ZHNA 4O02L 15C8L 3V4UL 5LBSL 3RGVD 4JRYB 1XZ0A 1BQLL 1IKNA 1J1XL 4HXAL 1QOKA 5IB4A 4XAKE 3KHOA 4Y4FA 3PDDA 4YHNB 3BXNB 3VXPB 3A6CL 1P5VA 2PW2A 4KK8C 4H25A 4XPFL 3TT3H 4P3WA 4DGYH 3P0YH 5DSCB 2FGZA 4PJCF 1J1XH 3SHSA 2NY6C 4A6YB 4Y5VB 3NIGE 1JF1A 5D2LB 1JGDA 1KJ2H 2ZUQC 5EBGA 5KVEL 3UPCA 3D69A 4BA8A 1RJZB 2MWCA 3GHEL 5ICZA 4N5UA 3EFFA 1FNSL 3PWNB 3U0TB 3ARGD 4M6AA 3O45B 5BVJA 3WFCL 2VL5B 4QTIL 1SEBB 1J0YA 5L6YH 1HK6A 1INEH 4HWEL 4MCYA 1XCTB 1QFHA 1YJDC 4GRLB 4PGEA 5IJKA 3UMTA 1GCFA 1XAUA 3L9RA 4NUGL 4JPVH 4NM8H 3WFBH 2Q6WA 1BM3L 1A6TA 5H37H 5DJYA 3NFPA 5EOCJ 3IDYB 2YD5A 4M7JL 4YPGA 1JPST 1GIGH 2XY1A 4M62L 5TPWH 4JAMA 4XT1C 4RGNC 1F4XH 1MJ7H 3VH8B 3I50H 2L0DA 2UWEF 4LSQH 4OZHE 1UYWL 3ZKMC 3QUMB 1OCWH 5EU6B 3DROA 3DRQA 1M05A 2G60H 4HUVA 1KIQB 1UZ8B 2XOTA 4U6HB 3T04D 4J8RB 4YH6A 1MCPH 1J11A 3JWDC 1ZT1A 3U83A 3WUWA 1XF2A 1A4JB 3B5HA 3TFKC 3GZKA 4X99B 2WW8A 1MFCH 5K33A 3MQIA 1PFCA 2DKUA 3PHQB 4K3DH 1RZKC 3QIWB 1FFPB 4M5YH 1QSED 4DZBB 1NFDA 4P23B 1QLEH 5HYEA 4F8QA 1EFQA 1MQKL 1DFBH 2EH8H 3EOAB 3MRQA 3S37X 4HUWB 3QDMB 3SY0B 1NGXA 4Z7VA 1H3UA 2V9TA 3RWCB 3F5WB 3GSQB 3RZCA 4M1DL 1KTDA 5J12C 3RTQC 2XZQH 1QA9A 5BMFH 1KCRH 3LPWA 3QULA 4LIQH 3VW3L 3U9PH 3V6OA 5F3BA 4JGMA 1ITBB 4PPTA 1HHJA 3IGAB 5JQHC 1FZKA 4DCQA 3RI5F 2H1PL 5D1XD 5KOVC 4HG4J 1YYMH 1GZQA 3F5WA 1BJ8A 4XMKL 3BKCL 5C0DB 5DD6B 4P2QB 4YHMH 1XGRB 4HV8B 2DM2A 3DURB 4XP9L 4G8GA 5I9QB 3V0WL 1PLGH 1UM6H 3O4OC 4X6CA 4NRYB 1FFOB 1I3GH 3KS0H 5JPMB 4ZUUB 2FYYB 5F9OH 2HFEA 5DJ8A 3CDGB 4IDLA 4XZUB 3I75B 3IVKB 43CAB 4YDIL 2OK0H 5HHOA 4LCWD 3FO9B 2Q87A 2NY7L 2QSCL 3T0DA 2D0FA 2FR4A 4IJ3C 2YEZB 4I5BB 1N7MH 5I74C 1W8OA 4DUVA 3GSOA 4PJCA 4PRBA 2NR6D 1WQVT 1P69B 4Y19D 2BNRA 5ELIA 3KPMB 3IB4A 4M9PA 5T5FL 5DI8A 5B38B 2IFGA 3U0WH 3OKMA 1ZKAA 4GAFB 4F7TA 1HXMB 4KTEL 1HXYA 1AGBA 3PL6B 1JE6A 4PBXA 1EO8L 3S88L 2OTWA 3MGTB 1ZWIA 1BD2B 1B9ZA 3CLEH 3CMOL 3RVWC 4A6YH 3IRPX 4PJ7B 3RJDA 3HUJA 3NFPB 2E7CA 5JXAH 4PJIB 4QRPD 4B7IA 4KDTC 1JZ7A 1T5WA 1A7QL 1ZS8A 4DGIL 2VDRL 3BQUA 2EZ0D 4MJIE 1J5OL 3W9DA 4MA1B 3WNOA 5F6HJ 3RPKA 4RNRB 5JXEA 1QSEE 3BH9B 4HJJH 4QWWD 5CBEB 2CJUL 4PY7A 2VERN 2NY0B 1I7ZB 1IKNC 2VDLH 4ODWA 2E7HA 2AJSH 1Q38A 1UVQB 4P5MA 4M1GH 3VFRB 3JWOH 3MA9L 4P9HH 4RQQB 1BPVA 4ELMA 4JDVA 1W0VA 2LABA 2W60A 3W0WE 1VEPA 4XP6L 4L5FL 2H32A 3MMEA 3RGVB 1YPZF 3IXAB 3RZWA 3B5TA 1JPSL 1FVEB 2M2DA 3VXPA 3GSWA 5LJYH 3GMQA 1OAUL 1NGYB 4P9HC 2XZCH 4M03A 4Y16C 4QRRD 4YFDB 2A6DB 2VZOA 4LHUB 3PL6A 4K3HA 5DC0A 5ANMA 4KV5E 1JWSB 4N9OB 3HUJE 4O2CB 4NQSB 3E6HA 2HFTA 5ACZB 1RVFH 3TVMD 3WIFA 5FK9B 5IR1B 1ZGLM 3BFOA 5I1IL 4HWBH 3PGFL 4DN3L 3TYFA 3AU1B 3OKOA 3FT2A 3QXWA 3HE7D 3IFNH 3VE0B 1P4BH 3GNMH 2XY2A 4HK3J 2F5AL 3X14A 4AQOA 1XIWC 5C6TH 3V52L 4X6CB 5DRZB 1FAKT 2H6PB 5EZLB 4LHJB 1RZFL 1AO7D 1F3DJ 1U8IA 1MJ8L 1CDBA 4JPIB 4F3FA 4OI8A 5D2LE 3LSOB 3RDTB 4HUXA 2H32H 2W9EH 5EH1A 5CAYB 3KPPB 1TVHA 2HT4D 4A2LA 4KRPB 1AIFB 3FOMB 4LKCA 3X3GL 1KPUB 1VPOH 5D1XA 3LQAL 5E5UB 1LEIB 4RFNC 3RDTC 3L7EB 4X6DF 1DQQB 4LCYA 4L8SC 3QEUB 2J12B 2VB5A 2EDFA 4FFWC 1V7NH 2ZUWA 2ARWA 4NPYB 3QDMA 1UGNA 3D18A 5B4MC 3CUPA 1JRHL 2MMXA 4YIQB 1K3IA 1TLKA 1AO7E 1SEQH 3OGCB 2OJEA 1G9MH 3M17A 1LK2A 1TNNA 3ELAT 3GRWA 3CSYB 4NRZB 4JVWA 4PJGE 5HVHC 4PJ8B 3QXDA 4Y4FC 1IAMA 3KNBB 5GSVA 3UTTE 5CZVL 2HKHH 2QKIA 1CGXA 2VDRH 1K8DA 4KKAD 4C56E 4LLVA 3AU1A 3BGAA 4PJEA 5TDOA 2IH1A 2DQFA 4AENA 4PGBB 4YO0A 3OKKA 5HVGB 2ADJB 3LIZH 1KOAA 1TCRB 1X7QA 3H9SD 1M05B 1J0ZA 1NCUA 2A83B 3O2DA 3VXSE 1D5XA 3MA7A 2BSED 5ENWB 5D7JB 1PKQB 2HJKA 5J3HD 2DIAA 3B83A 3QEQD 3BIBX 5BS0A 5I1LA 5FHBH 1WIPA 3EYFA 4K2UL 3MRLA 1IFHH 3VA2C 4BH8A 5J06A 4FQQA 3LKQB 4JFQA 5AAMA 4YGVA 3OKDA 4N1EA 3VFNB 4MHHI 3SDAC 4URTB 5SX4H 1OSPH 3SGDH 3V8OA 2B0SL 4RMSA 4K8RC 4PGEB 2FECI 5K59F 2WIIA 5H8DA 3W2DL 3P0YL 1J87A 1U36A 2C26A 3DVNB 4JO1H 4LCWA 5JQ6H 4OIBA 1LQSR 3QQ9D 5HI4D 2D3VA 4K23H 1BP3B 3I6GB 3BP7A 4R4NC 4FXKA 5CJQL 1FVCB 3BMWA 1INEL 1I7RA 1N6UA 1GZPA 1T1XA 1GPOH 1KJ3L 1NSNL 4U1KA 4H88H 3N85L 4HLZH 3DUHA 3SE8L 5IHBA 4I0KA 5IQ9B 1S8DA 3C6LA 5FECA 3EZ8A 2LU4A 3HPJA 4KUZL 4K3JL 1HHIA 1CL7H 1RUAH 8CGTA 3RX5A 4HH8A 5GS0H 4HKJB 4YWGH 2HLFC 3RY4A 3QQ4A 4UTAH 3SDCA 2VRAA 4I2XE 5KAQF 1MCJA 5FO8B 4MA7H 3FFCD 3UJJH 3LQMA 3J7HA 4YHKH 1BMGA 3QUYB 4CVXA 5FYLE