3NIFE

The closed headpiece of integrin iib 3 and its complex with an iib 3 -specific antagonist that does not induce opening
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
218
structure length
216
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alphaIIB beta3
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
total genus 37
structure length 216
sequence length 218
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nifE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nifE02
1FLRH 2IPUG 3HMXL 5F1KC 1CE1L 1LEGA 2DICA 4ZAKB 1DQJB 3JV6A 1F4XL 3GUTA 2YA0A 3UO1L 5C0DA 3TO2B 5C0CA 1PGRB 2BMKA 5ILTL 3SJVE 5FYLH 5ID0A 1BWMA 2NY3B 3U4EA 3WFEL 1INQB 4PYGA 3L1OH 4GBXC 3QXAA 3FHAA 3V6ZB 3QXWA 4IMLA 3WL9B 3CFIC 4D9QE 2IFFL 3DWTA 1IGIL 1A6ZB 4NHCH 4R7DB 4U7SA 5JA8B 5MEOB 3PG2A 4E5XA 4BH8B 4H8WL 5F1IB 4XMPL 5GIRA 4B7IA 2EE6A 2VDKL 2IMMA 3ARBC 3FQWA 1CBVH 1KPRB 1QSVA 5IESH 1ZLUH 1OT2A 2DBLL 1TPXB 1KGCE 4P0DA 1WFTA 3L5HA 3LN4A 4O02L 1BWWA 4KRLB 2WBWB 5BV7H 4LSSH 3U79A 1E4XH 5EBLA 5EUOB 4ORZC 2D9QB 5TQ0L 4PGDB 3ZTJG 5I16B 3MJ8B 1OPGL 5BV7B 1MVUA 3DMMB 1R5IA 5EPMA 4ESKA 2WBJC 3O11A 5JW3L 2W60A 4OZFB 2Q87A 1Z9SA 1X5AA 2Z92A 1OY3B 1U8MB 3JUYA 3D0LA 2EH7L 1EFQA 4NN5B 1RUKH 4Q6YA 4JREB 3QQ9C 1BZ7A 1K9TA 4I3SL 1YPZF 3KS0H 2I25N 1RVFH 4PLJD 1C5DA 2CR6A 5DRZB 1P7KB 1QFUL 4Y4HC 4X4ME 2NW3B 5CIPA 1FL3B 4F37K 3LKNA 3THML 1IC4L 5I1KL 5SV4A 1AKJB 3WFBH 4P2QD 5L7XL 2YK1L 5D7JB 2DTML 4CN4A 4YNYA 1LK2A 4ALAL 2QHRH 1QEWB 5DWUH 1CICB 3RGVA 5ERWB 43C9B 2Q20A 2R2EA 3LS4H 4J8RB 3HG1A 5MI0C 3RPKA 4P46B 4RGOH 3G5VB 4MQSB 4NKMA 4UT9H 1SJXA 2R1YB 2YPLE 4PJCF 3UTSA 1VESA 5JXAL 4L4JA 4WO4C 5GPRA 2ATPA 3R8QA 1CE6B 2VDPH 4CVXA 3X14B 3GSVA 3WHE0 3CVHL 3AMKA 3QNZA 5I1GL 3GHEL 1BF8A 3LDBC 4OI8A 4NZUH 1J0JA 1UVQB 2X4PA 2LU7A 4ZO6A 2EXWC 3L7FB 4U1KA 2C1PA 2CUIA 3SO3B 4LSRL 4L8BB 3MJ9A 4LPVA 4U6YA 4XP9H 4OGXL 3ROOB 3I50L 1D5XA 4PTTB 3MBXL 4OKDA 5ISZA 2B2XH 4FG6C 1EMTL 1RQ5A 5SWSD 1AGDB 4LGPB 4LCCB 4JFQB 1EDQA 1UJTA 1AJ7L 4HIIB 4R4BA 1AXIB 5KANG 1NBYB 2NY1D 3ME0A 5T1DH 4TUOB 4D3CL 5CAYB 1HE7A 4ZNCD 3H9SD 5IB3B 4HAFA 1JE6A 3GO1L 3BYYA 4CBPA 1INDH 2P5EE 1RU9L 1S5HB 3MLZH 4P99A 3GMLB 4WO4B 3UZQA 3UTZA 4LLYA 1S7TB 2F8XC 3I84A 1R0AH 1JK8B 5F7YC 5HHVH 1R5VA 3L3HB 3Q5YA 4UBDD 4UMGA 4KI1A 1CL7H 4A6YL 3H8NA 3C6LB 3MA7A 5IMOB 5SX5K 5ELIA 2L0DA 1B2WL 4YUEH 2ZUWA 5DJAA 1OGTB 4YDLB 3C5ZC 2HT3C 1CDCA 1ND0A 1RIUL 4BK5A 1QSEA 1BLNB 3M8OH 2BSTB 4L4TD 1BX2A 5KW9H 5IMLB 1H5BB 1LO0H 2VDLH 2YUVA 3MLSL 4NKIH 5DJ2A 3CSGA 3D3VD 4JM4H 2P8PA 4XVJH 2YWYA 1U8IA 2H26A 3UDWA 5C86A 4KKCD 3TZVD 3JTTA 4TUKL 5T5FL 4KJQC 3EYUH 4JM2B 3ZSTA 5DQDH 1WF5A 1A0QL 5FUCE 1FG9C 4O00A 4PJ7E 4N0CC 4HUVA 4F7MA 2FRGP 4PRID 3WEXB 2IBGA 3IVKB 1MFEH 4R3SB 1SVZA 4P4KA 1S7RA 2XT1B 5ID1A 1ZGLB 4H88L 4AQ1B 3JUZA 4RAVA 2CUMA 4Z7UA 4WWKC 5LGJA 1TZGL 3K4DA 3L3KA 2Q86B 2DQGH 4Y4KA 2DIJA 4R7NA 1FLRL 2DWDA 4XCNB 1A7PH 4Y4FC 3KPSD 4LCYA 4TTDD 5HYJE 1ZLUK 5I74B 5I8EA 1PJ9A 3C5ZB 2WUBH 2JCCF 4GW1B 1SMOA 5F96H 5FYLL 1AO7E 3MGAA 1T22B 2PXYB 3L1OL 2GSIB 3RZCD 1NCBH 5A3IC 2AXGA 5I6XC 2EYSB 2PW2A 4ZUVB 1C5BH 1MCQA 3KYOB 3T77B 4NHCL 1P84K 3VGAC 5FDWA 3Q6FA 3OR7B 3NA9H 1U3HB 1S9VB 4JFFA 4Z5RA 1CBVL 5GGTH 2FEDD 1MJUH 3PP3H 4M3KB 5IESL 3IXAB 3NIGE 3IDIA 1PFCA 3MV7A 4XNMB 4P5TD 3REWA 3B8SA 1NFDB 5BV7L 1FNGA 4LSSL 2ITCA 1RJYA 1E4XL 2JJUA 2D0FA 4JCMA 1R5WA 1U8QB 3DARA 3QFJD 3MROA 2QKIB 4PP1C 1LO5B 3EHBC 5LGHH 4F2MB 1NCDH 4TRPH 3PIQB 2WSKA 3EDFA 1EFXD 5JZ7D 3DUUB 1WUNT 3NIDE 3ET9F 3ULVC 1XF2B 3DUSB 4MLIA 1S7XB 5DJ8A 2VXSH 1RUKL 1LHZA 3O8XC 1JCKA 4TSCL 2AABH 5LVEA 2ATKB 1RVFL 1HHJA 5HY9B 3V5KB 3C60D 3WLWD 7CGTA 5C3LD 3HCVB 2WQRA 1V7NH 3VGAB 1KJ2H 5JNYB 5FO9A 1Z5LA 5I75C 4OAWB 3WFBL 5E4EC 1CG9A 4L29B 5I73B 4GKNB 3D25A 1OTSC 2AI0H 1J05B 1MHCA 1KJ2B 1T4KA 2QHRL 3U46B 1G9EA 2NY4D 5DWUL 4M03A 2BY2A 4P2RE 3WKMH 1PKQE 3LS4L 5IEKA 2X4RA 4FMFA 5GSVB 2MCG1 4I9WE 3IS1X 3GK8H 4Q2ZB 4MX7A 4APQB 4JLRA 5IOPB 5L2KB 4UDTA 3MJGX 2YD9A 4WHDA 4RGOL 1XIWC 1RPQA 4UT9L 1FRGL 1P1ZB 3CDYA 4MQTB 3ULVH 3Q48A 1BOYA 3D69A 4U1LA 4LP5A 2XZAH 2FO1A 4YXLH 1GC1H 1ZE3C 3KPPB 3NCMA 1T66C 2VDPL 1KTDA 2VZ1A 5TJWK 4UDUA 5D7KE 3OB0H 4E41E 4ZUTA 1ACYH 2NXZC 2XKSA 4NZUL 3NBNA 4MA7H 3Q3GA 4UQ2A 5B8CC 2KKQA 4GH7B 1ZHKB 2VLLB 1XR8B 5SWSA 4X4YA 2X4SA 1RJZB 3PWPD 4WRLA 4XP9L 5K59E 4G8FA 1J1XH 5BS0E 3VRLE 2P8MB 2B2XL 3VXSB 3WNMA 1BJ1J 4PD4K 1OM3H 4RFNC 4QOKA 4F7EA 1K3ZA 2EE2A 5FB8A 5DUBB 3CUPB 2VAAB 4WNQB 2FZ3A 2V9TA 5HYSA 3SDXA 4JHZA 2IALA 1FVDB 2ADJA 4Q0XH 5E6ZA 2Q76A 1E0OB 4P48A 3MJ7B 1I8KB 5T1DL 3FB7B 3K4AA 1S7VA 2NY5C 5IT2H 2DLEA 4U0RC 3TBSA 1S8DB 2OXHA 4I2XA 1INDL 4JKWA 1NFIA 3MLZL 1N5YH 4HJ0D 3WBDA 1R3IH 2DBJA 1R0AL 4QHMA 3GMOA 4G8GE 3T0EC 1HH6B 4OV5B 3A6BL 2QQQA 1CL7L 2P44B 1QLRA 3QRGH 1YUHA 4YUEL 1E4XI 4HS3B 1FCGA 2RHEA 3D3VA 2R0KH 4JHWH 4DVBA 3M8OL 2EDFA 5KW9L 5C0AA 3W0WE 2VDQH 4P2OB 1LO0L 2BNQD 2VDLL 3MACH 4NKIL 5E5MB 4PJ5E 4JM4L 3V6FB 5BXFA 4KVCH 2A73A 1S7QB 4XVJL 2K3TA 5J6HA 1OB1B 4LSUH 3WO4C 1BBJA 5ESQA 2Y72A 3HAEG 4G6FD 1R6VA 3EYUL 2OXGA 4HWEH 2J6EA 5DVKA 2YKLH 1TVHB 5DQDL 4MAUH 2VLKB 4OIIH 1UB5B 1D9KD 4TVPD 2PYEB 2OI9B 1JUFA 4LHJB 1HINH 1M7XA 1MFEL 1TFHA 4JDZA 5HPOA 5KSAA 3SPVB 1GXEA 2F58H 2ICWI 1U95B 4L4VE 4ODVH 1E6JH 1JWMB 2CJUL 1A4JA 4NNYA 4LHUB 5FF6A 2FECL 4J4PD 3JV6B 5CBEB 3GUTB 1MJJA 1OGAB 2DQGL 2X70A 3C5SA 4F37F 3TJHC 1JMZA 2BMKB 2J8UA 2QQNH 3PWVA 5ID0B 2MHAA 1A7PL 1KEMH 3PP3K 3QXAB 1FFNA 4OCSH 4IMLB 4KV5F 2FBJL 3GZKA 5F96L 1LDPH 1WFUA 3L5JA 5DS8B 4E5XB 2Y6SC 3CGTA 1NCBL 1FZKA 5GIRB 1JNLH 1YYLH 4MJIE 3FQWB 1C5BL 5HHXH 3DHMA 3FQRB 2N1KA 3RIAK 4DW2H 3LB6C 3NA9L 1IE5A 1CIDA 4P5TA 1QBMH 2UWEA 5GGTL 4WFGE 3LN4B 3QIUC 1MJUL 4N8PA 4WUKH 2W9LA 3QWQB 1FORH 3O3EA 4MXQC 5AYQA 4WI6A 4YDIH 1QPXA 1MVUB 1KYOK 1R5IB 1EIBA 1WIOA 1XF5A 5EPMB 3QDGE 4CMHB 3Q5TA 2DB8A 4Q6IC 5LGHL 5IW3A 1NCDL 4TRPL 1MCJA 1X6LA 3E6FA 4PS4L 1VB9A 1UB6A 2AXHA 1YMME 4MNQD 4R8WH 5CIPH 2VXSL 2AEQH 3C60A 1C5DB 2XN9E 2EIBA 4G9FE 2QTEA 5CIPB 2AABL 3QEUA 3LKNB 4WU7A 3DV4A 4FFVC 3PQYB 1QOKA 3BZEA 1QQDA 4QRPE 1S78D 4YNYB 1V7NL 4TUJB 2VKXA 1KJ2L 1A7BA 3RGVB 3OKLA 3HG1B 1H3XA 4YGAB 2AI0L 3IYLW 1JYWA 1A7RH 1ETZA 3OB0K 5C0BE 1TZIA 4RFOH 1PG7H 4NO3A 5MERA 1KG0A 4ZSOA 5JLZA 3WKML 1I7TA 3QEGH 3RRQA 2NZ9D 1N8ZA 5D93C 4PGBA 4NKMB 3GK8L 3OWEA 3UTSB 3S4SB 4GXVH 1IAII 2ATPB 1X4XA 4GQ9H 3CDCA 4X6DE 3OKKB 1CFVH 2K1MA 1DBMH 2XZAL 4LLVB 1HH9A 4YXLL 2AQ2A 1GC1L 3QNZB 3PHSA 3V7AE 1SYVA 3CDGA 4IRSD 3CX5J 3FFCD 3MJ9H 2X4PB 4W4OC 1CVRA 2EDYA 3BAEH 1H3VA 3BPOB 3INUH 1ACYL 1TJIH 3JWOC 4U1KB 3ZHKA 4CDHA 3NVQA 1A6TA 1IGFH 2EDDA 5IV2B 4HK0B 3E1F1 2FECI 1CDBA 1D5XB 3M45A 3FO0L 4XVUD 1DEEA 3K2MC 3RI5K 3BZDA 2W65A 3SEPA 2QL1A 3QULA 3CVIH 4QHUA 1YNLH 1J1XL 2F9BT 1V3KA 4OB5H 5FUZH 4R4BB 5E5UB 4KAQH 1FL5A 3PUCA 1OM3L 1NBQA 1X4YA 3FJTA 3EFDH 1T1YA 1MLCA 3OKDA 4I3GA 1EVTC 4Q0XL 1FPTH 2D7PA 3L95A 3MRFA 5EUOF 3UTZB 4LLYB 4IEFB 5IT2L 2FHFA 1CK0L 3QNYB 2H1PH 1R5VB 5IFAH 1N5YL 3X13A 1R3IL 3MA7B 1DUZB 3AB0C 1DDHB 5J11B 5E2JA 5DJAB 1N6QH 3QCUH 4XWOD 1ND0B 4GKZB 1JIBA 3QRGL 2PW1A 1BX2B 2CK2A 2VB5A 2BNQA 1J0KA 4YHOH 3ARWA 4JHWL 5DJ2B 3EYVA 3FN0H 2V9RA 2P8PB 5E1AA 1C1EH 3U9PH 3U0PA 3CSYA 1NANH 4X6BA 3U36B 1U8IB 2H26B 3EGSA 2VDQL 3JTTB 2VLME 1MIMH 1WITA 4KVCL 4YBHA 4NWTH 2IBZX 3KJ6H 4LSUL 5DA0B 5EO9A 4JQIH 3U9UA 2IGFH 3CD4A 3VRJA 1XCTA 3SE8H 4CJ1A 1SEBA 4HWEL 1JBJA 1D9KA 2VOTA 4PJIE 4ZS6D 1I85A 2OM5A 2YKLL 1HHIA 4XB7A 4HUVB 4F7MB 2HMID 2B5IC 4MAUL 1C8PA 4OIIL 5EOCH 4PREA 4P4KB 1S7RB 5J12C 5ID1B 4DCQA 5D6DA 4Z7UB 5LGJB 2D7TH 2V2WA 1HINL 3L3KB 1WC7A 1T04A 2JJVA 3QJFA 4Y4KB 5C9JA 3EJYD 5E8NA 4NGHH 4R7NB 4ODVL 2DWDB 1E6JL 3NCCB 1YEDB 2DM2A 4LCYB 3CU7A 4R2GD 1P6FA 2HFEA 4C56D 3DPBA 5I8EB 2W0LA 2QQNL 1IGYA 4PLJC 3IDYB 4YK4C 4CVUA 5IB2A 4RFEA 1KEML 1ED3A 2B20A 4OCSL 1A47A 2AXGB 1K2DB 2C4XA 3PP4H 1LDPL 1CQYA 3MLUH 2ZOLA 4RRPA 3DSFL 3D39E 4JQVA 3WN5C 5FDWB 3Q6FB 1JGDA 1CLCA 1JNLL 1YYLL 3T2OA 4JFFB 2X42A 5HHXL 4AJ0A 3MUJA 3TA3D 1YN6A 4DW2L 3T08A 1JNJA 2DD8H 3NFNB 1UEMA 3TP4A 5LKNA 1KJMA 3MV7B 2KDGA 1QBML 1IL1A 3F58H 3REWB 3V7AG 5TDPA 1KIRA 4WUKL 1FNGB 1GOFA 2ITCB 1BFVH 4M6MH 1R5WB 3NCBB 2D0GA 4GUPA 4NQUA 3ZKMC 4OLYH 3MROB 4YDIL 2AJXH 4PRAA 1WBYA 3D9AH 1JPFA 4JGUA 3F7YA 5ALBL 5B38A 1VEMA 5FM5O 2NZIA 4ZUSA 4MNQA 4PJAE 3X11A 2HKFH 3CIQA 3C8HA 3T0EE 5KAQG 5EZLB 4OCMC 4H1LA 1HHGB 4LQFH 4R8WL 3EUUA 2NMSA 3RTQA 4X80H 2AEQL 4KC3B 4Z9KB 1B6DA 1HHJB 1YPZE 2DMCA 4MD0A 3BP5A 4LLWA 4RSVA 5INCB 3T3MF 3V5HA 3VWKD 3WHE1 1SVCP 2A6KA 5FO9B 1Z5LB 4E0RA 1NMCB 4M61A 1MHCB 3BIKA 1J8KA 1T4KB 4JM2F 2NY1C 3MOQA 4FS0A 4OCLC 5IEKB 2X4RB 3MNWA 1A7RL 1RHHA 1FYTE 4MJ6A 9CGTA 1FCCA 1XGUA 1RIHH 3QEGL 4UDTB 5SX4H 2IAMD 3UYRH 3BOVA 4UBDC 3H7BA 1LNUA 1IT9L 4GXVL 3EOTH 3D69B 3NIFE 5GRWA 4U1LB 3OKNA 4PJCE 5CWSA 4GQ9L 3T0BA 4TTGA 1A3QA 4P2CG 4IRSA 1CFVL 4UDUB 5F89A 1DBML 1FO0B 2GTWA 3WFCH 3BD5A 5JW5B 4NSKA 4KK6C 4ZUTB 4Z78A 1UJ3C 4Z7VE 2AQ3A 3MJ9L 4UQ2B 3Q3GB 2NTSP 3JWNC 3BAEL 4RCAA 3TZVC 3INUL 1TJIL 1V05A 3MSPA 4NKOA 5SWSB 4D2NA 2IANB 4X4YB 4YHYC 3ARGD 2X4SB 5BZWB 1RAMA 1DCLA 4XCFH 1OW0C 2P43B 5IVZA 4G8FB 3FQTA 4WEMB 5I0ZA 4PFEA 1P4LA 3CH8A 1YNTA 4NFDA 5DGRA 3K8KA 4IMKC 4KKAD 4QOKB 3CVIL 3NCJH 2BVUA 1YNLL 1U8JA 1F00I 5FB8B 3IS0X 4OB5L 5FUZL 1J9CT 3ROLA 4KAQL 2FZ3B 4IHOA 5HYSB 3SDXB 2IALB 2ADJB 3EFDL 4WFEE 5DT1H 2Q76B 1NFDF 4LHQB 3VXPA 1S7VB 3TBSB 1FPTL 4I2XB 1NFIB 1YEHH 3P73A 3W81A 4TTDC 3M1BA 2D03H 3MZGB 1VPOH 3GMOB 2H1PL 1MREH 3EZ8A 1W0VA 5IFAL 1MFAH 4GRLD 1RZJL 2IQ9H 3RHWK 1CR9H 3RZCC 4KTEH 3RIAF 5FOBA 4G6AD 4MNHB 3D3VB 1N6QL 3QCUL 4D9LH 5F3BA 3QB7C 3STLA 3QZWG 1MRCH 5C0AB 4G42B 3F5WA 2VYRE 5F7MC 4YHOL 2E7MA 1JL8A 3PWUB 4S1QH 1K8IA 3FN0L 1HSAA 2A73B 5BXFB 1PZUB 1C1EL 5J6HB 2FEDC 2J6EH 3ZKXC 2IH1A 1BBJB 4LSTH 1CDJA 5ESQB 5GGVH 1MIML 1C5CH 2BK8A 1H3PH 1PG7W 4P5TC 3KJ6L 4YDVA 2WLZA 4JQIL 4FMKA 1TZHA 5ACZA 2IGFL 2ZP0T 3BQUC 1XGRA 1FYHB 3SE8L 5DK2A 5CD3A 1JN6A 2NTFA 5DHYA 4L9DA 4PJXE 3ZZ1A 5EIIA 1KOAA 1Q9LB 4WUUE 2X41A 5EOCL 5KSAB 1IGJA 3VFWA 3WLBA 3VFRA 5JZ7C 1JI2A 1A7OH 1A4JB 1JF1A 5FF6B 2D7TL 3UROR 4C56A 1MJJB 4CW1A 3BH8A 2VUOA 3KLHD 5DMKB 4W81A 2J8UB 4NGHL 2MHAB 2PETA 4FTVE 1IEBA 1FG2A 3PWNB 3GSWA 4WEBH 3LCYA 3UTTD 2ZSWA 2EIZA 2CIIA 1MCLA 2WW8A 1FZKB 3PP4L 1NPUA 1CN4A 3P9LA 4WHCA 3TA3A 3ULUC 3MLUL 4AM0A 5IJVA 4LFHD 4I0PB 1F58H 2NY4C 4HULB 1J1PH 1MHPH 4GKSA 1SQ2N 2PCPA 2VDMH 2UWEB 1CGVA 1WISA 3GSXA 2QADB 3MRNA 3IU3A 2DD8L 4ZTPH 2KZ1B 4YBLB 3O3EB 5HDLA 1A22B 1TQCC 1G6RB 1F4HA 4ODXA 3HKFA 1T0NB 3MGTA 1XF5B 1BFVL 4QXUL 1UKTA 4OLYL 5KG9A 2P42B 2HFGL 3MRIA 4I5BB 4MAYD 4ZFGH 1I1YA 2AJXL 4U1HB 4OZIE 3G6DH 1H15A 3OJMB 2Z31D 5EUKA 4KI5D 4XBPA 5I17A 3E6FB 3PXJA 2HKFL 1UB6B 1SHMA 5SWZA 3RI5F 3PGCA 3C60B 1OLLA 4JR9H 4DFIA 3GDBA 4AMKH 4LQFL 4BJLA 3I85A 1FZMA 3OTTA 1JPGA 2YC1A 3AS3A 4MQXD 3QEUB 4QRTA 4X80L 3DV4B 1ZS8A 1MJ8H 1JPSH 1VA9A 5CGTA 4NZTH 3DV6A 1IKFH 2R2CA 5F6HI 4NO3B 3ARPA 4ZSOB 2RR3A 5BVPH 4JRWA 1N8ZB 2IAMA 2BSRA 4GS7C 4PGBB 2YN3A 3G5XA 4NYLA 4FQXC 1HNFA 1NANI 1Y0LA 5F6IB 1MEXH 4HJ0C 1RIHL 5EOQH 1XAUA 2VQUA 4M7JH 3UYRL 1HEZA 4FFYH 3K1KC 1SJEA 4NBZB 3MO1A 3WS6A 1LEIA 1V7ML 3EOTL 3ZHDA 1FO0L 1H3GA 2LAAA 1A6UH 2DKUA 5CEZD 4ZYKA 1HH9B 4UZGA 1MI5D 1SYVB 5DMIH 3LPFA 4FQLH 4JG1H 3WKNA 1QA9A 3WFCL 1IAKA 5K93A 3QHZH 4HIHA 4DKDC 5SWQA 1A6TB 3R8BB 4P2QE 4HD9A 5DVOA 5KTEH 1NC4D 2CDFA 2VWEC 1DEEB 1RIVH 1U8KB 4FZEH 2W65B 4XCFL 5LAXA 3ARFA 2FR4A 4QHUB 5GGUA 3BPNB 2YPKA 2JIXD 1PG7X 1FL5B 1XCQA 1D9KC 1WWBX 3NCJL 4UNTA 4OZHA 1T1YB 4XNQA 3L5WA 4JFPA 4HLJA 2A74A 3B9KD 3LEXA 4UILH 5AD0A 2IPKA 5DT1L 4NFCA 5E00A 3L95B 5L2JB 5D7SH 1F6LL 5D6DC 4HZAA 4J4PC 2O5XL 1W72A 3VI4F 3K0WA 3S34H 3U1SH 1F6AB 1YEHL 5DK3A 3X13B 2D03L 4MHHI 1VPOL 2G60H 4O51A 4ZO7A 5GGVY 1MREL 3VFUB 2Y07H 1MFAL 3N06B 1CU4H 2IQ9L 1CR9L 4KTEL 2PW1B 4XMLH 4KROB 1KPVA 2DJ4A 4Z0XA 4D9LL 1KF9B 3EYVB 4Y19A 3U0PB 3CSYB 3I9GH 4NT6A 2OP4H 2GJ6D 1MRCL 3EGSB 4M1CD 3RWEA 1R3JA 3EYSH 1MCKA 1Q72H 1RUMH 4PRHE 5T1LA 5EU6D 4PRPA 3KDMA 2J6EL 4TVPH 3U9UB 1I7RA 1ZA3A 2QSVA 4LSTL 2E3VA 5GGVL 3VRJB 1CDHA 1C5CL 3DO3A 2P5WA 3JVGA 4QNPF 3EAKA 1SEBB 1H3PL 5D9SA 4BQCA 3I6LD 2ZUVA 2J8OA 4ZNEA 1PY4A 4PJEE 1HHIB 1NDGB 2B1AH 3RUGE 3H9SE 4HK3J 1G9NH 4EUPG 1CGWA 4WEUD 4DGVH 4PREB 2VN4A 4LVNB 1M05A 1P9MA 4DCQB 1HI6A 5J3HD 1RFDH 3NFPA 4RZCA 3MCG1 5F7EH 1WAAF 4FP8H 1WC7B 3HPJA 1QRNB 5E8NB 3DYMA 3HRPA 4OM1H 4E42A 3VFNB 2C5DC 1WGOA 3EZJB 2X05A 1CFBA 3MV9D 2EYTA 2HFEB 4J3OC 3DLQR 3N50A 3FAXA 1IGYB 3V4PH 4L4TE 4RFEB 3W11D 3CK0H 1XF1A 1J88A 3NCYP 3TJEH 1ED3B 2XRAH 1UZ6F 5IF0A 4KHXH 4WEBL 5SX4I 3F7VA 4JQXA 5EWIH 2VLRA 4FA8A 4KV5E 2ZOLB 3O45A 1OQXA 1S78C 3K81A 4UU9A 1JGDB 1K8DA 5L8JB 3G6JB 2CGRL 4YE4H 1ZLVH 1U6AH 4F8TA 1F58L 3GKZA 4PB9H 1TCRA 3TH3T 3ZT7A 2ITDA 1J1PL 1MHPL 1RK0B 1KJMB 2AK4D 2P48B 2VDML 1IMHC 2NZ9C 1IL1B 4L1HA 4PRIE 1NGQL 5TDPB 2QSCH 1KIRB 5CZXC 5DEGB 4ZTPL 1UCTA 3DBXA 1FNAA 4MAYA 4F3FB 5EZIH 2EH8H 3HB3D 4PRAB 2Z31A 1WBYB 1ZOXA 1JPFB 3F7YB 1F3JA 4H1LH 1MVFA 5B38B 4ZUSB 3KPSE 4ZFGL 1AGFB 3X11B 3ILPA 3G6DL 3QR2A 3ZYOA 1EHNA 4GOSA 2PO6C 4H1LB 2X44D 1QSFE 25C8H 1A6AA 5JPMA 5J06A 4YEEA 5EBGA 3U30C 1L9MA 3RTQB 3P3YA 2CO6B 2XA3A 1UWXH 5T3ZH 4JR9L 4XVUC 4L3ED 4MD0B 3BP5B 4LLWB 5F44A 4AMKL 3VGHA 3V5HB 3RU8H 4UB0H 4LVEA 2FHBA 2NY6D 4J3VA 4O2CA 5EO1A 2A6KB 2J5LB 3TNMA 4E0RB 2HLAB 2BXYA 3LHPH 3S5LA 4M61B 1MJ8L 1JPSL 3BIKB 2E8YA 4UNVA 1DLHA 5I0DA 4J23A 2R56H 4N8VG 2XWTA 2BC4A 3MNWB 1IKFL 4PJ8D 5E8DH 5DYOB 4CNIB 2APTA 2H32A 3BN3B 2EDXA 1XGUB 3QFJE 3WIFA 5BVPL 1DUYA 3RHWF 3DVFA 1W8NA 2BNRD 12E8H 3H7BB 1TVDA 1WZLA 3BHBB 1NC2A 5EOQL 2V7NA 1MI5A 2EDHA 4Z7UF 4BFBD 4M7JL 4FFYL 4IRSB 1FZOA 5F89B 3UTQB 1ZMYA 5I8OH 1A6UL 3G5ZA 4NSKB 4BFIA 4LGRB 1CLZH 1VGEH 4Z7WB 3O4OB 1RSFA 4Z78B 5DMIL 4FQLL 1NC4A 3QHZL 3ZT5A 1U8LA 5KVDH 4JKKA 4RGNB 3BDYH 3T4YA 5L6YL 2UVEA 3P30H 3ULUE 5KTEL 5IVZB 5I1AA 3FQTB 2MQ0A 3KPRE 4JFDA 1P4LB 4FZEL 5IROC 1YNTB 1ONQA 3T0VA 3H9HB 4ZS6C 4DZBA 3FB5A 3WNNA 1U8JB 5CUSH 1XT5A 3DRTA 1MCNA 2HMIC 3P4OA 3B9KA 3ROLB 2VDRH 5IFJA 4IHOB 2WM0A 5JORA 3C6SA 4X8JA 3SDCA 4OD3H 5C2UB 4OGAD 4UILL 3VXPB 4YHKH 4RMSA 5D7SL 3S6CA 2AW2A 3P73B 3FTGB 5EUOE 4DJMA 2Z8RA 5D7LE 3U1SL 3UZEA 3QWOB 3LQZA 5MEQA 1VENA 3HZYA 3QIBB 5FOBB 1M71A 2G60L 3SE4C 4OLEA 1QYGH 2Y5EA 4Q9CA 1CU4L 5F3BB 2GJ6A 3SHSA 3STLB 4XMLL 3F5WB 1AR2A 3PWPE 4XH2A 5EU6A 5IIEA 1K8IB 1HSAB 2GFBA 3GSRA 3MUGA 5GRXG 3I9GL 3Q1SL 2OP4L 2IH1B 1G7PB 3EYSL 1PZ5A 1Q72L 1RUML 4JJ5B 5T3XH 2O61A 1T83A 4YDVB 3V6OA 5T33H 3NABH 1RJLA 1TZHB 3QXUA 4TVPL 5ACZB 5CSBA 4TYUA 3VA2C 1ORQA 1XGRB 3U82B 4ZG1A 5DK2B 5CD3B 4RDQF 1JN6B 2NTFB 5DHYB 2VJXA 3WE6B 1D6VH 5F1SA 3VH8B 1OT1A 2B1AL 4NQCA 1NMBL 4R26H 5EIIB 5F9WC 5FHAH 2W1NA 5JQ6H 1G9NL 4DGVL 3VFWB 3WLBB 1ZSDA 3RIFK 2HT2D 1F3RB 1J7VR 1RFDL 4FP8L 4R2GB 2Q8AH 1G7IA 4CW1B 1ZLVK 1BJ1H 1T1ZA 3IJSA 4LVOC 4FQHB 1FG2B 3V4PL 3GSWB 1OHQA 5GJTH 3CK0L 2ZSWB 3TJEL 4MGXA 3VWKC 3QDMD 2XRAL 3EOBA 2EIZB 4KKNA 2CIIB 3QUYB 3MRMA 5EWIL 4OF5A 3P9LB 1N0LA 3TA3B 4AM0B 5IJVB 4Y89A 3IXTB 5CP3A 2WWKT 2AK4A 4LLQB 2PCPB 2AEIT 4HFUH 4YE4L 1B0WA 1U6AL 3GSXB 3S97C 1ZANL 4PB9L 4PGEA 4HQQH 5JHDE 1BM3H 1JHKH 3ZKND 1T7VA 2VR4A 2IAMC 2QSCL 4EIZC 5HGAA 3SDXF 2X4QB 4ODXB 4X6CE 3MGTB 1UWXK 3RWJB 3HNVH 2LVEA 2DN7A 3CPLB 5KG9B 4PRNA 4Y88A 1D5BB 5EZIL 3SKNA 3HC3H 4TNVK 2DI7A 2EH8L 3PL6C 1H15B 1OD9A 5EUKB 4XBPB 4OLXH 5I17B 4PLKD 5SWZB 3PGCB 2J12B 1DLFH 5DVLA 4BQ9A 5GS0D 5DJ6A 2X1XR 3VGEA 4OJFH 25C8L 1HK6A 3ARGC 1EO8H 1FZMB 1KJVA 3HZVA 4NQDA 4JY6A 1NDMA 1JPGB 1IJ9A 3L6FA 4QRTB 1CT8B 2FBOJ 5T3ZL 1ZS8B 3MMEA 1UG9A 2AP2A 2MCPH 3RU8L 2F54D 2IQAB 3O9WD 4KKAC 1ZHNA 2VXVH 3FL7A 5C0RH 3LHPL 1CYGA 1IAMA 3VXUB 1D5ZB 4HIXH 3T0AA 3PF2A 1J1OL 4N68A 2R56L 2GHWB 2ZCKH 2BNRA 2BSRB 5E8DL 3G5XB 4OZFG 1HQ4A 2Z9TA 1Y6NR 5F7LB 3ZL4H 2VISA 5C08E 5KSBE 4MXVE 3ZYIA 4AK1A 2LQRA 4XVTH 1SJEB 1LEIB 4GRLC 4PGCA 3VFPA 4ZYKB 1ACZA 1JP5A 4RMRA 4G6AC 5B21A 5DEFA 3TFKD 2XY1A 3V8OA 4OZGA 3NTCH 5I8OL 2J8UF 1QA9B 1DANT 3UZVB 2I26N 4NWUH 1ZKAA 1CLZL 1EJOH 1VGEL 2MOVA 4HIHB 1LO2H 5SWQB 4JN2B 2M26A 3BN9D 5EFIA 1DR9A 5D1QD 3SKJH 1RUAH 4M00A 3QJHA 5F9DC 5K33A 3KPNA 4G8IA 3BDYL 3P30L 3ARFB 5LAXB 3X12A 2FR4B 2XTLA 4JRXE 5GGUB 2ICEA 1LMKA 3O2DA 4I1NB 3SGDH 4PJDE 2AJZB 1XCQB 5CJXA 4M1GH 4CN6A 4V1DA 4OZHB 2VSCA 5CUSL 4XNQB 3A0OA 2UWEF 3L5WB 1DTUA 4JFPB 2VDRL 5D2LE 1I9JH 2A74B 3LEXB 3RWFA 5I8CA 1W72H 4GRWH 5E00B 5FECA 1XGQA 3MREA 1OSZA 4OD3L 4DEPC 5HHMB 2M1KA 1OP3H 3MOBH 1U3JA 1W72B 4GRWB 4JPWL 4ONOA 4YHKL 4DN4H 5I18H 3KLHC 3MRHA 2G9HA 1NFDE 5B4MD 1P84J 4JY4A 2B4CH 2DQIH 4D9QD 3FFCE 4O51B 4PR5A 1I9RH 1NCNA 2L4OA 5F21B 3LKRA 2BY1A 7FABH 5EO0A 1KPVB 1QYGL 2D0HA 4Z0XB 4JQXC 1IC5H 5BRZB 4QEGA 4Y19B 4C57C 2YA2A 1TDQA 3KS0J 4QT5A 2EIEA 3HC0A 3RWEB 1R3JB 3D87B 1F45A 5DD1H 5T1LB 5KVFH 2Y4SA 4PRPB 3KDMB 5ESAA 1I7UA 1I7RB 1ZA3B 2I60H 3WFDH 4AIOA 5T3XL 2P5WB 3SY0A 4GAGH 5D9SB 3UPRA 5T33L 3NABL 4JDTH 2WWMC 1T89C 5FGRA 4M7ZC 4YC2C 2O5YH 3QNXB 4AL8H 4KTYA 1D6VL 4M6OH 4EZMA 3DX8A 4RMWA 1HI6B 1Z0NA 4R26L 3NFPB 4RZCB 5FHAL 1BVLA 2Z31C 4KI5C 3HPJB 5IEHA 3F65A 4LRIA 3MRLA 3NACH 4PJGB 3BZFB 2JB6A 1X9QA 3BYTA 3L5IA 3KXFB 2Q8AL 3BJ91 1ZVHA 2EYTB 4IIQC 3HUJE 1XH3A 4FQ1H 1CXHA 5ALCH 2EICA 3QDMA 1NEZG 5DRXA 4MQXC 5IF0B 5FKAA 2BP3A 3F7VB 3U7YH 5GJTL 4Y5VB 1EO7A 2VLRB 1MH5A 3O45B 4IM8A 1F13A 4UU9B 3QUKA 3WXWH 4NRYA 4HX1A 3QIWD 1PAMA 4KKLD 1TCRB 2EDKA 2ITDB 2LABA 2YPLD 4HFUL 3MV8A 4YBQD 1UKQA 3H0TA 2DQUH 2R4SH 1ODAA 3IETA 3PNWA 4ERSH 4HQQL 2I5YL 4XGZA 1BM3L 1JHKL 2VTFA 5IFHH 4M48H 2LU4A 2ED7A 4MAYB 5HDBE 3AS2A 1S9YA 3VXTA 3QFDB 4KZDH 3HNVL 4XP6L 5J13C 3HC3L 4U1JA 3ILPB 2WV3A 3ZO0A 1Z6JT 3S36H 3WUWB 4OLXL 4Y8DC 2VITB 43CAA 4HKXA 2DQJH 4LAJH 1A6AB 1J18A 5JPMB 1DL7H 2CKBA 4R97B 4TOYH 4D0BA 1DLFL 2EDNA 1FFPA 4NNXB 4OJFL 5DO2D 4PJBE 2F54A 4ZTOH 2DIAA 3QQ3A 3O9WA 1EO8L 4O2CB 5EO1B 3TNMB 4MA1B 5E6ID 2XICA 2MCPL 3S5LB 3VFMA 4NCC1 1PYWB 5EU7C 4Z6AT 2VXVL 1A9EA 5HGDB 3C09B 1WEJH 2H32H 3H2WA 1DLHB 3IKKA 5C0RL 4QXTA 3IU4H 3RNQA 1K3IA 1QO3A 3O4LA 4HF5H 2BC4B 2VKWA 4HIXL 5C09E 2H32B 3IDUA 3OKMA 5F7DA 1GJIA 3SDYH 4NZDA 4B53A 1DUYB 2ZCKL 4WY7H 1WFNA 4NJ9H 1O0VA 2KL6A 1CXIA 1QTYT 4IRZH 3HHRB 5BOPA 3ZL4L 1NC2B 5DFTA 4HUKB 4LVHB 5EU3A 1AHWB 2V7NB 3RL2A 5HYFA 4N0UA 2GY5A 4XVTL 1EEQA 1FZOB 3EOYG 1NLBH 5BJTA 4OLZH 2C3GA 2QQKH 3G5ZB 4X98A 3WDIA 4BFIB 5KBNC 3QBTB 2XXCB 3U48A 5D1QA 3NTCL 3HE6B 3SDAA 1IFHL 1OGAE 2NXYD 4NWUL 5GISH 1CI5A 3GIVA 1EJOL 4HJGA 3DXAA 1U8LB 4ODUB 3T3PE 3T0DA 1B0GA 3T4YB 4O5LH 3SKJL 1RUAL 3BFOA 3KYMA 1OP3K 4JFDB 3IDJB 1JZ3A 1CFTB 4KJYA 1G7HB 2P7TB 1T83C 5FCSH 1ONQB 3MOAL 5F1NA 1EBAA 1KBGH 1RZGB 3TNNA 1JYXA 4DZBB 2W0PA 3DRTB 3G6JF 1MCPH 1DN2A 2GJZB 3B9KB 4N9OB 5IFJB 5E03A 3RVUC 4CGTA 1W0WA 4IDLA 4M1GL 4OQ1A 1WBZA 4FABH 3VU2A 5J3HC 5JORB 4QTIH 1TQBC 3TF7C 3DUHA 3SDCB 2H3NB 3SJVA 1I9JL 5FM4A 3UBXB 5B3JF 1W72L 4MCZA 5HYJD 5DVMA 5HDOA 1E27A 1FNLA 1IM9A 3LPGA 3RKPA 1AO7D 3MOBL 3HE7D 4DN4L 6CGTA 5I18L 3W11C 5CFHA 2B4CL 2DQIL 4ZQKA 2UUDH 3LQZB 4U6TA 5MEQB 3HZYB 5JOEA 2A83A 1M71B 1H8OA 1HXMA 1I9RL 1QLFA 4LIQE 2P8LA 1CVSC 2BVPA 3CX5K 4KDWA 7FABL 3TVMD 2F8OA 2DWEA 1HYRC 5JOFB 2KZWA 4XH2B 5EU6B 1IC5L 5IIEB 3MUGB 2AV1A 2C4FU 3RX7A 3VXMD 1PZ5B 2Z4QA 5DD1L 4FXLA 2WQ8A 5KVFL 1OWRM 4B41A 5GS2H 1RJLB 4X8XA 4RMUA 2I60L 1K4CA 3WFDL 3PQYE 1ORQB 4QYOA 5DJCA 1KB5A 3JWDH 4GAGL 1K5NA 4NZJA 4NPYA 1BZQK 2JKXA 4JDTL 4QNPE 4M93C 5LJYH 4NQCB 2O5YL 4X99B 3BWAB 4NN6B 4AL8L 5I1LA 3MR9A 2DLHA 3O0RH 4H5SA 1ZSDB 3NH7H 4M6OL 5IK3B 5GGSB 4LOUD 3SDDD 4HV8A 4XNZB 4XI5D 1G9MC 4GRMA 2GIYA 4J7RA 1G7IB 3NACL 1WAAE 4X4MA 4LSDA 2QJDA 1PQZA 4Z76A 1T1ZB 3IJSB 3S88H 1CXLA 1Q8MA 3EO1A 2DM7A 4U33A 4QLRA 3B9DA 1ZLWK 4FQ1L 5ALCL 3AM8A 5I1JH 2NY6C 4Z7WF 3EOBB 5CP3H 1H8SA 4MMXC 3SCMD 3U7YL 3CX2A 3K8LA 3MRMB 5IBTH 1UZ6E 4Q97A 5FO8A 2FX7H 3PDDA 4BKLA 1N26A 1T7ZA 5GRUH 2FATH 3MLRH 5KJRH 2YPLA 1UH4A 2AK4B 5IBUB 4YFEA 3IFNL 3H6JA 3WXWL 1GYAA 4NO0D 4PJ8C 2YSSA 4LSQL 4OF7A 4K7PY 5GGRY 3VFSB 4Y1AD 3BGFB 3IKCA 2IMNA 1BD2E 3BX7C 1FAIH 4QRSB 5GHWH 5HI5D 2DQUL 2R4SL 5HGAB 3ARZA 2HTKD 3HI6H 3BE1H 4MJ2A 1G9MH 4ERSL 4LHUG 1XR9A 1DVFD 5IFHL 4M48L 5D7KD 4OCYH 4RWHA 3U2SA 4E41D 4PRNB 3SKNB 2CKNA 1UEYA 4KRPB 4PG2A 1ITBB 4KZDL 3LN9A 2PTUA 3SGDI 4X4ZA 2NY2D 5FGCE 2F53B 2A1WH 1XFPA 4QY8A 3S36L 5DJ6B 2FJGA 4YHIA 4ZDHA 2DQJL 2HTLC 3WCYA 1DL7L 5BS0D 3HZVB 2H8PB 1KJVB 4NQDB 4ELME 4JY6B 4TOYL 1NDMB 4DGIH 5J89A 3L6FB 2DI8A 3S3SA 1YN7A 2HLFC 3VG9C 4ZTOL 1EPFA 3UTPD 1U8NB 4HCRA 2I07A 5M95B 4LLDA 1JPST 1ZHNB 1I4FA 1DBAH 2P5EA 1U9KA 4D0CA 1WT5A 1JGLL 1Q9WB 5DUMH 3IU4L 2VZSA 2EKSA 4OGAC 2ADFH 4HF5L 1IQDA 5H35A 4WWID 1F11A 4LK4A 1KLUA 1HQ4B 1T3FA 3GHBH 5D1XC 2VISB 3KYAA 5J6GA 4WY7L 4NJ9L 4UAOC 4IRZL 4KI5E 5CSZA 3TYFA 3VXNA 4X9BA 4GW5A 5FGBC 3VFPB 4HG4J 2ADGA 4P9HC 5DEFB 4YDJB 1NLBL 5E24E 3W0WD 4W4NA 1GZQA 4OLZL 1VFUA 2QQKL 3E2HB 3RKDC 3FB6A 5EFIB 2JJTC 2YR3A 4AH2A 4U05A 5GISL 4DKEL 5CJOH 3QJHB 3O2DH 4PJ7A 3RA7H 1UYWH 1ES0B 4JVWA 3IFLH 1OP9A 4N0RA 1VERA 4O5LL 4F7PA 3ARRA 3V0AC 3T09A 2YRLA 1KBGL 5A2FA 2CRMA 1P69B 4V1DB 4ZFZA 1MCPL 2UUDK 3S4SG 2Y36H 3RWFB 1NGWB 4Y5XB 5CS7A 3W39B 2HT2C 5HYJA 4PRDA 2ERJC 5FECB 3F6LA 4QTIL 1XGQB 3MREB 4I8DA 1OSZB 4X7CC 1AO7A 5GJSL 4KK5D 8CGTA 2AJVH 3MRHB 4LRIC 3D1MC 3SGKC 3TWCL 3MNZB 5CEZE 4JY4B 4HUWB 4P23A 4RGMC 3ZHLA 3MXVH 4PR5B 3KYNA 5D1ZB 4HBQA 3QEHA 3VFTA 5IP4A 4POZD 3D85D 1MOEA 3IAPA 4EDWH 3LKRB 1EERB 5TE7H 4HIEA 4MJID 3TVMA 5EO0B 1N7MH 4LL9A 5CHNB 4FG6D 1Q9KA 1ULVA 4LPTA 4WFGD 4Z95H 32C2A 2VXTH 3CFKA 3O3AA 4B5EA 3N1GC 1JGEA 1LDSA 4RISH 4WI9A 3FRPG 1RZ7H 1I7UB 1T21A 5DD6A 5ESAB 1A8JH 1IKNA 3HAEA 5EU7E 5DI8B 1L6XA 1CD0A 3ZKNC 3V8CA 4JN1L 3UPRB 1KC5H 4JO3L 3MV11 1TNNA 2HP4A 4LEXH 4EOWH 3LKQA 3JWDL 4MVBD 3SDDA 4NHUA 2ZUXA 1H3TA 4WI3A 3VCLB 4G7YH 1BVLB 2W07A 4V2CB 5IEHB 1NGYA 3O0RL 3NH7L 1JNHA 3MRLB 3R0MA 1RK1B 4LFHG 4WW2A 2HT3D 2JB6B 4PLKC 2XN9D 4JEGB 3SGJC 2W0FA 5GS0C 1LE9A 4G9FD 1XH3B 3LY6A 3S88L 2H2SD 1JGUH 2YD8A 2CXGA 3QDMB 5DRXB 1G7QB 3DX9B 2VLJB 3TIEA 5FKAB 5GS1A 4HWBA 4KJQD 4ZOEA 1MH5B 4C58B 4P2RA 5I1JL 1PKQA 4EKXA 3O9WC 4EN3A 1XF3A 5JXED 3QUKB 1HILA 5IBTL 4NO0A 4NRYB 2FX7L 3EFFA 1HZHH 5GRUL 5DQ9A 4KKBD 3T04D 2FATL 3MLRL 5AAWA 4IRJA 5KJRL 1KV3A 4NCDA 3I6LE 2IANE 4R90H 1AR1C 3MV8B 5D72H 3D2UD 3ZLQC 3H0TB 5C2BH 3ZTJH 3IETB 3PNWB 1VFMA 5FYKE 4AEFA 4XGZB 4OZHF 3BPLB 3AY4C 1FAIL 1MCHA 1WQVT 4E41A 5GHWL 3HI6L 3BE1L 1S9YB 1G9ML 3VXTB 3OMZA 1YJDC 5DD5H 5GS0H 4OCYL 1M7DA 2ARWA 3B8YA 1MELA 1OAUH 3TFKC 4U1JB 3MV9E 3VXRE 4GRWF 3OX8B 3VRIA 2FNBA 2CKBH 2X6MA 5A3ID 2XTJB 3ARBA 3EYQD 4HKXB 4NQXA 3UBXI 2A1WL 2Z0BA 5BS0A 4XVSH 3BN9C 5T1MA 5D8JH 2CKBB 4XTRD 1MFBH 5D1QC 5I2IA 4D0BB 5CBAA 4IJ3B 1FFPB 4K3JH 1CGSH 3QQ3B 3O9WB 1JTPA 5CGMA 4DGIL 3HMWH 1TIUA 4LARH 2N7AA 5EC1A 3VFMB 3I6GA 1X5FA 1VACA 2C3XA 3E6HA 3FQNB 3RWIA 1SMAA 1DBAL 3RNQB 1G6VK 4MHHG 3O4LB 4O2FB 4OCXH 4GO6B 5GSRA 4P4RA 3HZKA 3QCVH 4PP1D 3EHBD 2R0ZL 3OKMB 5DUML 4G8GA 4Y7MA 5EH1A 1KCRH 4ZUWA 2V6HA 1SM3H 5F7DB 2O26U 1P5VA 3V79C 3QUXB 5B4MC 1I8LC 4N0FA 2AK1H 3VWJD 4K7PX 2NW2A 3GHBL 1KPUA 2WUCH 3RL2B 4N0UB 4PJHB 1C12A 3W0WA 3KPOA 5BJTB 1L4IA 4PJGF 4PJ5A 1F4AA 4X98B 1BPVA 2RQ8A 4PRBB 1MCBA 1QG3A 4J3XA 4L3EE 2ICES 3SDAB 4XRCB 3NZ8A 4HJGB 3DXAB 1S9KC 5EBWA 5HHPA 3MA9H 1B0GB 1OTSD 5IMKB 2XI9A 4U3CA 3MNVA 5CJOL 3KYMB 2Z8SA 2EDBA 3O2DL 3EKCA 3RA7L 1UYWL 4KJYB 4MNGE 3IFLL 5F1NB 2UYLA 3TNNB 3ZDYF 3BD3A 4ZOBA 4L4VA 4LNRB 1WBZB 3IAQA 3S98A 2Y36L 3SJVB 5I9QB 3FOMA 4U2ZA 3WNKA 1EBPA 1RZKH 3JBG7 3QEQB 3BH9A 1E27B 1IM9B 4YIQA 2GQHA 4JFYA 2AJVL 5JDSA 3MX0A 5JIKA 1QFOA 3D85A 5DA4A 1P7QA 2UZYB 2A2QT 4MJIA 1D5IH 2CK0H 4QRRE 3FO2A 4ZQKB 2X09A 4Y2DC 2HJLA 3MXVL 3D39D 1HXMB 1QLFB 1KIQA 5C8JB 2P8LB 2BVPB 5CZVH 5LXGH 3GEWB 5CMAA 3RWGA 4EDWL 5TE7L 5JIHA 2F5AH 2DWEB 2DDQH 2YD2A 1F8TH 4WV1A 3BP7A 4XMKH 2CUHA 2IPUK 4U0QB 3QIWC 3OAUH 4Y5YC 4KKLC 3T1WA 1BQUA 4Z95L 2Z4QB 2VXTL 2Z35A 3D5OF 2C4FT 1KB5H 4YBQC 5GZND 5F7KC 4RISL 2CH8A 3QDGA 2IH3B 3ORJA 4ENED 1I1AD 1JHLH 3LSOA 3U7WH 3AU1A 4QYOB 4YZFE 1JF6A 1K5NB 4OFIA 4NPYB 1KC5L 4P59H 5T5NF 4WI8A 2XKNB 1I1RA 4EOWL 1YMMA 5I1LB 3MR9B 3ZE1F 3WIIH 3P2TA 3BPCA 1WZ1H 1IEHA 5FUOH 2XN9A 2XIDA 4GRMB 4G7YL 2BSSA 3X17A 3MRGA 2YUXA 4G9FA 5L0QC 1T7XA 1PQZB 4Z76B 1KEGH 3QISA 1NUDA 4HT1H 3EO1B 2FLRT 4OCRH 4QRPA 2JLLA 3ES6A 3FT2A 3BIAX 5DO2C 1KTRL 4EI6A 1JGUL 2R2BA 4ZUUA 5JXEA 2GK2A 5E6IC 1J8HD 5C0BA 3W9EA 4L8SC 2DMKA 5FO8B 4BKLB 4L5FH 3RVXC 4NQEE 4ONFH 1A1OA 5L8KB 5KZCB 3TN0C 1X5JA 2YPLB 5TE6H 1HZHL 4F15C 3QA3A 1FNSH 2YSSB 4X9GA 4X6DA 1F2XK 2UV3A 3DGGA 5GGQH 1NBVH 4YHZH 2FWOA 4R90L 1URLA 1UH3A 1A21A 5D72L 2LV4A 1BEYH 3BEVA 3IB4A 5C2BL 1M6OB 1MRDL 2R8SH 4D8PB 2OTWA 2VXUH 1FFQA 1XR9B 2GT9A 3U2SB 4IOSD 1T0MB 1HXYB 2X1WL 5DD5L 3TPUA 3ELAT 1BQLH 4KWUA 2VXQH 4NM8H 5GS0L 1WIPA 2B8OT 4PTUA 1OAUL 2QEJA 3LQAC 4UQ3A 2D7NA 2C26A 4NC2B 2CKBL 3SGEI 2NXYC 4TSAH 2R69H 5TQ2H 2WBKA 1GAFH 2FJGB 4ZDHB 4KK9C 4PJ9D 4XVSL 2BVTA 3OXRA 5D8JL 4HCRH 1MFBL 4NN7B 3JSSA 1GOGA 1JZ4A 4K3JL 4M43H 3L3DA 4AEEA 1YN7B 1CGSL 4FFZH 1G0YR 3O81A 4Y0GA 2I07B 3QIUD 4LLDB 3HMWL 4NQSA 4C83A 1SBBA 1DEDA 1HHKA 1I4FB 3DJ9A 3BP4A 4WFED 2P5EB 1TCMA 4D0CB 1YA5A 5C0IA 4K71B 1BQHG 5K9KA 4UT6H 4OCXL 1NGPH 1JI1A 4MQ7A 5H35B 1IGCH 1AI1H 3QCVL 3GGWA 3GSOA 1T3FB 5INDA 1WICA 1KCRL 5D4QA 3B2VH 3L3JA 3M17A 5J6GB 3HE7C 2ZUSA 5GZOD 3P0VH 1HWHB 4J3UA 3O8XA 3TYFB 3NGBC 3VXNB 5FYJE 1U2CA 2EDQA 3KPMA 2WUCL 2ADGB 2BX5A 3RDTD 5F72S 5KN5A 3ZE0F 1GZQB 4WTWA 3ZDZF 2ZCHH 3CFDA 4QGTA 3TVMC 1FNEA 1QRNE 1VEPA 2VSDA 5DZLA 3V5DB 1QFWI 4U6VH 4FZ8H 2VABA 3FB6B 1HIMH 2DJSA 4LP4A 1Z9OA 5B3NA 5TPWL 4AH2B 4ZFFA 1J0YA 3RFZC 4PJIA 4K8RD 1C16A 4PJ7B 3MA9L 1GHFH 2OR9H 4FOMA 4F7PB 1N6VA 3MRCB 4M1DH 2PN5A 5HGHB 1IAOB 1XIWA 3R06A 4LU5H 4ZFZB 2DKSA 5CJBA 2ESVD 1D3CA 4EBQL 3G6JE 4R4FH 5HYJB 4LOUC 3ZDXE 3T65A 4XI5C 4HFWA 1ZT7A 5MEPA 1E6OH 5HVGB 2EDJA 5FO7B 4RAHA 1RZKL 3LD8B 4X7TA 1N2RB 1LO3H 4P23B 3D39A 4UI2A 5CP7A 1A9BA 3KYNB 3VFTB 5D7IE 1D5IL 2CK0L 3JTSA 4WTZA 4HIEB 3SCMC 5GS1C 3AREB 1Q9KB 5CZVL 4HGMA 5LXGL 2MKWA 2X1PA 2F5AL 3QZWA 3RBSA 5HSFA 2DDQL 4KJPD 4P5KA 3HAEH 1F8TL 4GJTB 3O3AB 1GGTA 4XMKL 2HT4D 4UTAH 2K7PA 1IGTA 1EAPA 1T21B 3OAUL 5DD6B 3QCTH 3HAEB 5KS9E 1KB5L 1MQKH 4FXKA 3NPSB 5E94A 5T3ZE 3LRSA 2HTKC 1JHLL 3U7WL 2O93L 4PJAA 3KWWB 1DVFC 1MCIA 3LKQB 4JO2H 3WFHA 3T0EA 4P59L 3SDDB 5JUEH 2WP3O 5DC4B 2YOCA 2NLJA 1MCRA 3WIIL 1NGYB 2NY2C 1JNHB 3WFZA 1MCSA 3NMEA 4Q9RH 1WZ1L 4WW2B 1YPZA 5EIVA 4F7TA 2PTVA 1QFHA 3ABZA 3IT8D 4PBWD 2FIKA 4WDIA 4HWBH 1KEGL 3ETBF 4CKVX 4HT1L 4CVWA 4OCRL 5IVXE 5BOZG 3PHOA 1RHFA 3TIEB 2X4TB 5MP6H 1ZHLA 1CGUA 2DM3A 2E9WA 3MYZA 4P2RB 2P45B 4EN3B 4WIQA 3BVNB 2ZSVA 4Z7WE 1HILB 3GBLA 1FYTA 1A7QH 1F90H 1ZA6A 1IILE 4NO0B 4C54A 3EFFB 4L5FL 4YXKH 4ONFL 4PJFE 5DQ9B 3A6CH 4IRJB 5KSVA 2OBGA 3I6KA 4KJWD 1U36A 2QBWA 4RGNE 4MXWH 5TE6L 4I48A 4PJCA 1FNSL 2ED9A 1TETH 5DJZA 5GGQL 3CH1A 2GITB 1NBVL 4YHZL 1N0XH 1A64A 1BEYL 4E41B 3SQOH 3MLVH 3QUZD 4GLRI 2R8SL 4OZ4A 3QAZC 4GBXB 2VXUL 4U1IB 4Z7VA 3GSUA 5HYEA 3O6FD 1IAIM 2Y06L 1M7DB 5F9OL 1A6WH 3VRIB 2VXQL 4NM8L 2LFGA 5CKGA 3ARBB 1G84A 4NQXB 3AFLA 3QXVA 5BS0B 1NCTA 4TSAL 2QQLH 3MBED 2R69L 5TQ2L 3VJ6B 1GAFL 3S7GA 1TENA 3QI9D 3K3QA 2BVOA 3QIUA 4J3TA 5CCKH 1EUTA 3C8KB 2UZIH 2DYPA 3P4NA 2MPAH 2ZWLT 4LCWD 4FFZL 5EC1B 3I6GB 3M07A 1VACB 3E6HB 2CLRA 4HZLA 3BUYA 2V7HA 2WBJB 3RL1A 5IW6A 3AS0A 3ZKMD 5HVHC 4G5ZH 4P4RB 3HZKB 1LP9E 1X3DA 1CFSA 4Q6IA 1UA6H 3QQ4B 2AAVA 3I02A 1CDGA 5HYQA 4ZUWB 4G8GB 3TBWB 4JRYE 1BIIA 1NGPL 4KK5C 2ENSA 1IGCL 3FZUD 4YO0B 4L9LA 4DK6A 2A77H 1B4JH 2X5PA 4N0FB 2NW2B 3UJJH 1KPUB 3ALPA 4F80A 2DQHH 1JHTA 3OR6B 5EU5A 3P0VL 3RDTA 1JGVH 1U3ZA 3D6GA 3KPOB 4ZS7H 4POZC 4Y4HB 4PJ5B 4WI4A 1FC1A 3DVGA 2EEDA 1BFTA 3GJEB 4O4YH 4PRHD 2ZCHL 2H9GB 2XWBA 3NZ8B 1NMAH 5MI0B 4U6VL 3LKOA 5EBWB 4M9PA 4FZ8L 5HHPB 1HIML 4WV1C 4Z0BH 2MQCA 4JG0L 3DIFA 3MNVB 4G7VH 4PJXA 4MJ5A 4XT1C 4LBEA 4AEIH 1GHFL 2OR9L 5DHXB 1F42A 2UYLB 4WUUA 4KVNH 2P4AB 4JFHE 4LMQE 5JO5B 4L4VB 2W38A 3UMTA 4MVBC 5CD5C 5IHZA 1KT2A 3MC0A 4LU5L 3RGHA 5I19H 3CNKA 2Q7NA 1P2CB 5GRVK 5MENE 4LSPH 3FOMB 4R4FL 3LDBB 4FTVA 4HUUA 4LRNH 4OFYA 1E28A 4HBCH 4W4OA 4XCYA 2X1QA 4YIQB 1BFSA 1E6OL 4KK6D 2R1XA 5E2VH 4JFYB 4WENB 4PP2B 1S7WA 5JDSB 3D85B 1P7QB 1AD9A 2H2SC 3IAGC 3ARDC 2MKLC 3FO2B 5I1DA 2BCKA 4K94C 1LO3L 2CDGA 3JV5A 2ICCA 4WCYH 4Z8FH 2HJLB 4C4KO 5J9PA 1AD0B 1KIQB 3K8MA 1RULH 3LRHA 5EZJB 5D5ME 5CMAB 3RWGB 2FB4H 4EI5D 3TPKA 5JXEC 5GRVL 2HN7A 3QG7H 2DQDH 5I76A 5GXBB 3B9EA 1NKOA 3BP7B 3TBTA 3X3FH 2X7LA 5IHUH 4KKBC 2ZUQC 2XXMB 2ORBH 3GMNA 2Z35B 1JFQH 4UTAL 3QDGB 1QVOA 1ZVSB 4MDJA 4X0KA 3QCTL 5GQBA 3LSOB 3S35X 2PR4H 3AU1B 3VE0A 3OB8A 3B83A 4PGZA 4OZIA 5MHSE 5IJKC 1MQKL 1UCBH 1FC2D 5FV2A 5ICZA 2OMNA 2O5ZH 4W6WB 3BW9A 4NDMA 4JO2L 5E9DB 5AYUH 4EUPA 1YMMB 1JTOA 3J8F7 4OIAA 3FT3A 4HHAA 4ZPVB 3VXUE 5JUEL 3BPCB 1AY1H 5E56A 1X7QB 2XN9B 1PLGH 2BSSB 1QSFD 1CLOH 2PKDA 4K94H 4QO1A 3MRGB 4S11A 1ZEAH 4LLUB 2FO4B 3EYQC 4C59B 2X9XA 4Q9RL 4HC1A 4N90D 4XTRC 4PJHF 4QRPB 3ES6B 5HHOE 1JTTA 4HWBL 4XZUA 4LGSB 4EI6B 4MZ3A 4F7CA 1JWUA 3IF1A 2I24N 2EE9A 4YFLI 3FONA 4OFKA 4JFEB 5MP6L 1I1FA 2Y7QB 2LVCA 5C0BB 3W9EB 4NJAH 4OUOA 5B39G 5A40E 1DP0A 3VXME 1PD6A 3WYRA 4AEHH 4OI9A 2BZDA 2IWGA 1A1OB 3PGDB 3QO0A 3FFDA 2W59A 3BQUD 4QHLA 4U6XA 1A7QL 3E0GA 1F90L 1B0RA 2FX9H 4XBGB 1IM3A 4YXKL 3QA3B 3CFJA 3A6CL 1HN1A 4Z7NE 4WWKB 3DGGB 3OPZH 3VH8G 2XY2A 2FWOB 2A6IA 1X5LA 4MXWL 4JANB 3BEVB 1TETL 1FZJA 4Y4FB 3VWJC 4YHNB 5F7UA 3HR5A 2OTWB 1YEEH 1N0XL 5CEYB 4YDKH 3F7QA 2GT9B 3SQOL 3MLVL 4TN9A 2G5RA 3DYPA 1CFQB 3TPUB 3VG0H 4JFOA 5I6XB 1DN0A 4P2QA 3OGOE 4ZAKD 4PTUB 5AUMA 5M94B 4HXBH 1RZ8A 4L1DA 4UQ3B 3VD7A 1A6WL 5HHME 2CLZB 3WN5A 3MBEA 3TYGH 2HJFA 2NY3D 3EO0A 1AFVH 3QI9A 1R3KA 3ULUD 3V0WH 3KPRD 4OIBA 2QQLL 2FJFA 3L3DB 5C7XH 3QWRD 4X5WA 4L8CA 4NQSB 4C83B 3MRJA 2OQJA 5CCKL 4OLUH 2UZIL 2CMRH 2VZ3A 1HHKB 2MPAL 2Q6WA 5J56B 4BQ8A 5FM5M 5CILH 5BRZE 4WU5A 4HGWA 4Y1AE 4X5XB 1DQTA 3R1GH 2BSED 5K9KB 4AT6A 4KUCF 4N8VA 5J8OA 4G5ZL 1UA6L 5INDB 4L8DA 3L3JB 1FVEA 3M17B 5D7LD 3DMMD 3PE9A 2V5TA 2YRPA 2W0KA 1YEJH 2IBZY 3O8XB 2A77L 1B4JL 1LVEA 3OXSA 3RWCA 1IZJA 3UJJL 3KPMB 4BH7A 4DVRH 1MPAH 5I66A 2DQHL 1WTLA 2D31A 5KN5B 1G7JA 4ZS7L 1KCLA 3E8UH 2GTZA 4PRHA 5I75B 5E4EB 4PJGE 1FNEB 5JMRA 5EN2A 2VABB 3STZA 4O4YL 5DEZA 3KXFE 5EULV 3UTPE 3TC9A 3BKJH 1NMAL 4PJIB 2NX5B 1C16B 4U1MA 4PJEA 3BP6A 3RUGA 3H9SA 1AKJD 1GPOH 5DC0A 4Z0BL 5GZNC 5IWLC 1I8MA 4G7VL 4ENEC 1ZLSH 3MLPA 1I1AC 5D7JD 2BOBA 3RVTD 3OAYH 2VH5H 4PIRF 1CF8H 1XIWB 2WANA 4YLQT 4R0LC 1CICD 2J3SA 3HI1A 3LAFA 3R06B 4KVNL 3MGOA 4FQXD 4P57A 4MDIA 3LEYH 3ZDYE 4U4BA 1S7SA 4MD5A 1DQDH 5HHVL 5I19L 1YEIH 4MD4A 3T65B 4HFWB 4L4TA 3VDBA 1ZT7B 4LSPL 3MYJA 2NXZB 4WVRA 2ZZUT 1UJ3A 3O6KH 4LRNL 4MCYB 4HBCL 5B8CB 4Y16D 3O3DA 4HEME 4X7TB 2K9UA 1X5HA 3LH2H 4OLVH 3TZVA 5E2VL 2N4IA 2Q3AA 4I18C 4PY8J 4ODBD 1MCCA 1A9BB 5CP7B 4M6NH 2DQCH 1OW0A 1E4KC 3JTSB 3NFSH 1C7TA 1ZT4B 5C71A 3S3JA 4WCYL 4Z8FL 2Z93B 3BSZH 3TH4T 1HCVA 4JAMB 1RULL 4IMKA 5FOJA 4N1EA 4PPTA 4RFNB 3TCLA 2XQYG 3QZWB 4PRIA 3QG7L 1OLZA 2DQDL 1I3VA 2XNAA 3U83A 4A2MA 1NLDH 2NY5H 3X3FL 5D71H 5IHUL 4GSDH 5JHDD 1EAPB 3GJFA 1IQWH 2ORBL 4Z7OE 1JFQL 4UOJA 1L7TH 3EJJX 1QSZA 4U0RB 3DX6B 1Z9MA 5HVFB 5E94B 3LRSB 5B22A 2BOCA 1LEGB 2PR4L 3KPSA 4ODSH 4ZXBC 4PJAB 3LOWA 1YMHA 3VI3F 5C0CB 5C0DB 3WFHB 3T0EB 1UCBL 5IG7A 2NLJB 5EZOH 3U4EB 3RZCA 1QSFA 4K07A 3V0VA 4NO2A 4RMQA 5AYUL 1U8HA 3V7MA 2WUBL 1AY1L 3W9DA 3ZE1E 1U91A 4K94L 1CLOL 2AQ1A 1A02N 4A6YA 1ZEAL 3C6LD 2FIKB 4YFLF 3HLAA 4WDIB 1K4DA 4PJ9C 5C70A 3WO4B 3KLAA 3PHOB 1EK3A 4XC1H 1ZHLB 4U1NA 3QPQD 1V3MA 1Q9OA 4MZ2A 5E8PA 2ZSVB 3BQUA 1MCDA 1X4ZA 2GKIA 1FYTB 4NJAL 1NUGA 5EBLB 1ZA6B 4R96A 5ITBH 4AEHL 1IZKA 3QFJA 1BJMA 1MCWM 2MNUA 4PJ7F 4GAJH 5IM7A 2P49B 3I6KB 2RIKA 3O11B 4NO5A 1EFXA 2FX9L 2W60B 4I48B 2PUQT 5C08D 5DJZB 3OPZL 3LZFH 2Z92B 3CH1B 4KUZH 1X5GA 1XGYH 3D0LB 4JZNA 1DQLH 5GZOC 1X5XA 1U93A 2V9QA 1JF5A 1KUMA 4L9LC 1BZ7B 4OZ4B 1YEEL 4Z7VB 1WCQA 3GSUB 2BDNH 4YDKL 1I75A 4ZAKA 1DQJA 3B43A 3RDTC 3KLDA 2Y1VA 3VG0L 1EO5A 4HPYH 4QXWA 4HXBL 5DTFA 1G0DA 4CU8A 3WL9A 3KPRA 1UH2A 1LK2B 3TYGL 1CL7I 1A6ZA 4R7DA 3CCHA 4X9IA 1X6NA 1UT9A 1AFVL 3QWRA 4K8RC 3KYKH 4FHBD 1GGCH 2R2EB 1AGBA 4JRXD 3V0WL 3QIUB 5FGSA 4NC0B 1KULA 3U6RA 2W92A 3RPIA 3UPAA 5T1KD 1S7UA 2DYPB 3P4NB 1SEQH 2AKRA 4WFFE 3ULSA 4JPKH 5CZXD 4MB3A 2CMRL 4HZLB 1KXQE 4R4ND 3BUYB 3RL1B 5IW6B 5CILL 2R23A 3CXHJ 1W0YT 2DOCA 4J3SA 4CVXB 5EUOA 1CFSB 4Q6IB 1AP2A 2BY3A 3ULVL 3I02B 5HYQB 1IVLA 3GSVB 3R1GL 3MJ8A 1H9VA 1N64H 1BIIB 3DMMA 5D7LA 1F6FB 1EXUA 5D96C 2XPGA 1J10A 1PX3A 4OZFA 4ZPTA 4FRWA 4BFGA 5EU5B 1JHTB 2PO6D 3OSKA 2C1PB 3WUWG 1YEJL 2XWJA 4F8QA 4NQCE 3PWPA 4MA7L 4U6YB 2IADA 4DVRL 3ESVF 3KJ4C 4WW2F 3OAYK 4HIJA 4K8RH 4XX1E 5ISZB 3P0YH 2BERA 4JHBA 4ZFOA 3CSPA 3DVGB 3MLYH 4HLZG 2AJ3A 2I27N 2XWBB 3GI9H 2XQBH 2NW3A 4KJPC 3ZDZE 3LKOB 4PG9A 2HT4C 1BVKA 4XWGH 4JZJC 3DIFB 3K7UA 4F33A 5D7JA 3B2UD 4PJXB 3AMLA 4MJ5B 4LBEB 5F7HA 1CICA 5T5NG 5D93B 1KTKE 1BQSA 1GPOL 1HOCA 2BHYA 4LCIH 4ETYA 2ICWA 4FQXA 4J8RA 4WUUB 1ZLSL 2YS4A 1UFUA 2VH5L 5C07E 1CF8L 1T1WA 1KT2B 3N1FC 2D3VA 1FSKC 3LEYL 1NAMA 4LDLB 4LPXA 5D96B 4X6FA 4LPCA 4APQD 5K9OA 3JWOH 4Q9BA 5L2KD 1DQDL 3GMRA 4FTVB 4HUUB 1YEIL 2FL5A 3CAFA 4Y16A 1E28B 2R1WA 1QSEB 4XCYB 4UT7H 1OP5H 2R1XB 2BVQA 3O6KL 4I3RH 2R0KL 1AD9B 3DNKA 2E8ZA 3LH2L 4OLVL 3QP3A 5HD8D 2VZUA 2AERT 3FQXA 4HG4K 3MACL 5J9PB 4M6NL 2DQCL 2VMFA 3L7FA 3QQNA 4HWZA 2YXMA 1FVCA 3NFSL 5K59F 3K2UH 2HN7B 3BSZL 3ROOA 5A43C 2F53E 5I76B 1HCFX 3T4AA 5JHDA 3TBTB 2X7LB 2J2ZA 5AG8A 5K9QI 4KJWC 3MLTA 2NY5L 4X6CA 4PUBH 5D71L 3VXSD 2EEAA 1QVOB 4GSDL 3CLEH 4MDJB 4RAVB 1IQWL 4J4PA 3VE0B 3BKYH 1L7TL 3CU1A 4EUPH 4OZIB 2F58L 3UBXG 3QUZC 5ICZB 4Y2OA 1LILA 5AZEH 2ZUTA 4ODSL 1CGXA 2B0SH 3BW9B 3AB0B 4NDMB 3S37X 1S5HA 3LMJH 3QDJE 5E8EA 4EUPB 4YX2H 3O6FC 2P47B 3FT3B 4K2UH 4HHAB 3P77A 2VZTA 5I1EH 4HC1H 1MFCH 5IMOA 3C6LA 2PW2B 4RIRA 3MBEC 1BLNA 2DJUA 1RUPH 5CSGA 4Z5RB 2NY0C 3HZMA 3QI9C 4F7CB 5IMLA 1JWUB 1H5BA 3IF1B 3I3DA 1NEZA 2PF6A 5F70A 3FONB 4XC1L 1I1FB 1LO4H 1UKSA 3IDIB 4H8WC 1GH7A 2LTQC 4P2OD 1OOAA 4JHAH 2HG5A 5EB9A 3FFDB 2B5IB 1RJYB 4QHLB 4U6XB 5C09D 5ITBL 1B0RB 1FORL 5J12B 1PDKA 3O2VH 5HPMA 3CFJB 3KVQA 4GAJL 5C08A 5KSBA 8FABA 2A6IB 3FZUC 4R3SA 2VLKD 4MMZC 1MAKA 4W68A 4XX1G 1IARB 3LZFL 5J7CC 4KUZL 3HR5B 1IEAA 5DJ8B 1DQLL 2V17H 4X7FC 4YK4B 3A6OA 4J12A 2GCYA 4X83A 2GJJA 4GT7A 2G2RA 2BDNL 3RX5A 4LHUD 2E9IA 4P2QB 4MJ4A 2E7HA 5AUMB 1RZ8B 1OGAD 3NPZB 3IDNA 5E95B 2XZQH 4HPYL 3WN5B 4CUCA 5J1TC 1FH5H 1CG9B 1D6EA 4F9LC 4H8WH 4JRXA 1R3KB 3D25B 4LKXA 4XMPH 4AG4H 4PJDA 2E7CA 3T77A 1J8HE 1PEZA 3KYOA 3FOLA 5T1KA 4QTHA 2FJFB 3KYKL 4ZO9A 1U92A 1GGCL 4X5WB 1I3UA 4WI2A 5D2LA 5C0JA 5DRNA 4RFOL 2OQJB 1PG7L 4MX7B 4JLRB 2Q6WB 1SEQL 4MS8C 1YNKH 2AV7A 4WU5B 4HGWB 1JZ7A 4KDTC 4QXGH 4S2SA 4GMSH 1NFDA 5C9KA 3OJDA 4AT6B 2APFA 4N8VB 1KTDB 1YY8A 3FFCA 1V5JA 3PL6D 1AQDA 3LV3A 4L8DB 3UX9B 1N64L 1FVEB 2PO6A 4U6HA 3N85H 1L6ZA 3T2PA 2BRRH 1KELH 5DF0A 3BO8A 4MA3A 2OYPA 3OXSB 3RWCB 4Q74A 4BH7B 4KGLA 5I66B 1XF2A 3DUSA 1S7XA 35C8H 2D31B 1X44A 1G7JB 2GTZB 4PRHB 5ANME 1IGFL 1P53A 3GRWA 3TEUA 5A2JH 4EI5C 4JKLA 5JMOC 4K8RL 3MLWH 2CLVA 5LGKA 2C7UA 2HRPH 3P0YL 1EV2E 1EH9A 1UXWA 1LGVA 5HY9A 3STZB 3ARQA 3MLYL 4F7EB 5F97E 2YK1H 3GI9L 2VO5A 2NY1B 4NQTA 4MYWB 4U1MB 2FHCA 5JNYA 4PJEB 3BP6B 1QR1A 3RUGB 2DL2A 3H9SB 3PQYD 3SKMA 4XWGL 1I8MB 1EHXA 2VLJE 1C08A 1LEKA 1YEKH 3GSNA 1OP5K 4LCIL 3HI1B 1ITCA 1VHPA 1F5WA 4MDIB 4P57B 5JXAH 3VXOA 4HS6A 4QHMB 1U3YA 3B9AA 4MD5B 2EO9A 4U1GC 3HUJA 5IUSA 1T1XA 5I71C 1FNFA 2VL5A 3G04A 5D70H 4L4TB 1QLRB 4BUHA 1YUHB 3MYJB 3JWOL 1UJ3B 4DVBB 3UYPA 2C3VA 1FE8H 2A0LD 3O3DB 3QHFH 4LLAA 3TZVB 5EDXA 4UT7L 4XHJD 4I3RL 4YHYB 4XAWH 3BKMH 2E6QA 4HUNB 3U9PL 5BO1H 1JZ8A 5DMGD 2Q7YA 2A6JA 5D2NC 2DM4A 5IROA 5KAQF 4NWTL 3SN6N 2YUZA 1H3UA 3TCLB 3ZSSA 3GJFH 3K2UL 4LASH 4PRIB 2XTJE 4K3GA 4HKZA 2XNAB 1FNHA 1FBIH 3GJFB 3EOAA 1BD2D 2APVA 1F4YH 1JUFB 1IBGH 2IG2H 2ZUUA 4JDZB 3CUPA 4PUBL 3MFFA 3CLEL 2ESVE 1FLTX 4NNYB 2CSPA 2BOCB 3DETC 3KPSB 2W9DH 1YMHB 3BKYL 1RU9H 2OTPA 2X70B 3C5SB 1BF2A 3PWVB 5IG7B 3AUVA 4U1GB 1F97A 5AZEL 3L3OA 2B0SL 4HXAH 3RZCB 1QSFB 2EO1A 4GW4A 4NO2B 4BZYA 3LMJL 4F9PC 1FFNB 4YX2L 3ULVF 3WJJC 1U8HB 2ZNWA 3SE4A 4K2UL 4A6YH 3U4BH 4ZAKC 2XACC 3G9VA 3W9DB 4NRZA 5I1EL 2JCCE 1U91B 4PJBA 4HC1L 5E2WH 1MFCL 4OBRA 2NY3C 3HLAB 1K4DB 2V5YA 5LCVH 5BCAA 3MLSH 3ZKXB 1TLKA 2NQCA 3D18A 1RUPL 4PJHE 3FRUA 4P2OA 4P5TB 4U3HA 5E8PB 2OS7A 1UWEH 1S7QA 3BQUB 3NZHH 4XPAH 5C09A 4R96B 3F58L 3QFJB 4PJIF 2WWMD 4JHAL 4U1SA 1TPXC 5F3HA 3T8XA 4CMMA 4X7DC 3I3BA 4OBSA 4M6ML 1EFXB 1YZZA 4PLOB 1NCWH 4OCNC 4QHKJ 3BMWA 3LKSA 1H3WM 3CZFA 1H0DA 3D9AL 1O7VA 5BV7C 1WWWX 4HH9A 3DMMC 3FN9A 4JZNB 1TZGH 1U93B 4OKVA 3C08H 3SPVA 5KSUA 1KLFA 4P4KD 5IW1A 1JWMA 4J6RH 4LHUA 4U31A 2V17L 5CBEA 3HR6A 1OGAA 3VGDA 4Z77A 3ULUH 4NN5C 4Y4KD 5E7BA 3VWKA 4JREC 2VR9A 4JKPH 2EZ0D 4WU7B 3BZEB 5DTFB 1QQDB 5FCUH 5HHQA 3KPRB 3QEQE 2XZQL 4P3CH 2NY4B 2X4UA 1FH5L 3CCHB 5DS8A 3OKLB 4ODTH 4O9HH 4QRUA 3RVVD 4AENA 1AGBB 4AG4L 3U6RB 1ETZB 3RPIB 3FQRA 1DFBH 1TZIB 4I0CC 5DD0H 3ZE2F 5D7JC 5MERB 1KG0B 1S7UB 3RVTC 5JLZB 4NBYB 1I7TB 2HVJA 2AKRB 1HKFA 1CICC 3ULSB 2XZCH 3LIZH 3TT1H 1TQCB 1QRKA 4JFFD 3KHQA 3PDGA 4P46C 1YNKL 4KK8D 5F8RC 2R23B 4WHYG 2JK5A 1ORSA 3MV7D 2X9WA 1AP2B 3PL6A 4OZFH 5FHBH 4QXGL 4GMSL 5D7LB 2Y5TA 3NAAH 1EXUB 1DANU 2XPGB 3VGBA 3P40A 5LWYH 1GGBH 3CDGB 4PJAF 4ZPTB 4Y16C 2QR0A 2AGJH 5H37G 3DECA 3N85L 5HJ3A 3P9MA 2BRRL 1KELL 3DSNA 2XWJB 3ARGA 1UM6H 4ODHH 3PWPB 1X5YA 2IADB 2H2PD 3ESUF 1M7IA 4HIJB 1GVIA 35C8L 4TSCH 4DN3H 1NQBA 4ZFOB 3QULB 3SO3C 4WJ5A 2AJ3B 3CZJA 4G43A 4G80A 2LE9A 3MLWL 3T2NH 5JW4R 2HRPL 4J2XA 4OD2A 2FCBA 4PG9B 3PQYA 2QSQA 4TVSa 4U49A 5DRWA 1BVKB 2X2YA 4LCWE 1CGTA 1EHAA 4F33B 1MLCB 2WLYA 2IC2A 3H3KA 4TUJA 3OKDB 4N8CH 4LCCC 3V4VH 4GS7B 4XXCC 1HOCB 3SBWC 4LPUA 2ICWB 4FQXB 3MRFB 4EVNA 1YEKL 2XA8H 4D9RD 1NAMH 5DFWH 3L3GA 1T1WB 4TSBH 1BHGA 4IOIA 4M4PA 1UXSA 4GRLA 2FEEL 5ACLA 1WAAA 3NIFF 1OSPH 1FRGH 4XHQA 1NAMB 3S4SA 1AH1A 1OAZH 4X6FB 4GQPH 3LRGA 5K9OB 3GMRB 4CU6A 2FL5B 3VFVA 3JZ7A 2GAZA 4Y16B 4P49A 2R1WB 3OKKA 3GJFK 5D70L 2DIBA 4OV6F 2BNQB 4LLVA 3C6LC 2BVQB 4Z7VF 4FQPA 1FE8L 5E1AB 3SE3C 4LPYA 4HWUA 4X6BB 3RWHA 3QHFL 4YDLC 2WMPA 4WTXA 1E4JA 1GL4B 3FQXB 4G6FB 2CR3A 4XAWL 3BKML 4S1QL 3QPQC 4G9DA 4HWZB 1FVCB 5BO1L 5EO9B 1AXSA 1H5BC 2YD5A 3QUMA 3WNLA 3UTOA 3MRKA 4M8VA 4HK0A 1XCTB 5IV2A 1CLYH 5DLMH 4F58H 3T4AB 2AEWA 1D9KB 5ETUA 5JHDB 5JW4N 2IAND 1WFOA 1BD2A 3DURA 4JM2C 4LASL 4C55A 4AIXA 1MUJA 2EECA 3CC5A 3MLTB 2D7QA 3RVUD 3EIFA 4X6CB 5CLWA 1FBIL 5FYKD 4CN1A 3FRPA 3QO1A 4XB8A 1F4YL 5J4MA 2NYYD 1IBGL 2IG2L 2V2WB 4QOKD 4LCUA 1T04B 3QJFB 5C9JB 1EHLH 5BMFH 1A7OL 1OF2A 5JOPE 2W9DL 5E8EB 4NM4H 3VXRD 1UGNA 3UTTA 3O6LH 3VI3E 1AGEA 3DVIA 5IB2B 5HBBA 3QNYA 4HXAL 1XGPA 3P77B 5DVNA 3A6BH 4N5EC 4FFWD 3U4BL 1PW3A 1DUZA 4ELMA 3UEZA 1DDHA 1NGZA 4GG6A 4RIRB 5I74C 3CFBA 5E2WL 4OF3A 5DJYA 5F8QC 4GKZA 2PXYC 4FQCH 4KMLB 1T80A 4M7LH 2VL4A 3HZMB 5LCVL 4YH6A 1YN6B 2BHZA 2AJSH 1WWCA 1NEZB 1TTGA 5C6TH 1TVBA 1KN4H 3U36A 4DUVA 1IAIH 1KIPA 1A6VH 4HEPG 5C0AD 1S3KH 3U4AA 1T89A 1U3HC 1UWEL 3IFOA 4QKXB 2HG5B 4X4XA 4JO1H 2AVGA 3NZHL 2H6PA 4R4NC 4XPAL 4GUPB 4PJXF 5HPMB 5C08B 5KSBB 5J1SC 8FABB 4U7KA 2E7LA 4JFXA 2GY7B 1NCWL 2Y23A 1WIUA 4MNQB 4JVUA 5IGXH 1IEAB 3LN5A 2CJUH 5F7WC 1T2JA 4IIQA 3K1DA 2GEEA 2H45A 3C08L 5BW7C 5GGRA 2GCYB 5KSAD 2G2RB 3MRQA 4J6RL 3J7HA 2IPTH 4JZOA 4JKMA 1OCWH 1YEDA 4N90E 3RY6C 3ULUL 1CCZA 1MIEH 2FBJH 3IDNB 2FEEI 3LEVH 2YRZA 4JKPL 4W6YB 5HI4D 1D6EB 5FCUL 4JRXB 3KAAA 3L9RA 4LKXB 4P3CL 1K2DA 4PJDB 5D2NE 3FOLB 5T1KB 4JPVH 1TTUA 4QTHB 4NZTL 3RJDA 3B2UC 4O9HL 4ODTL 1U92B 5D2LB 5C0JB 1N6UA 5I73C 3L5XH 5DRNB 1DFBL 1RHHB 2NR6D 4MJ6B 5DD0L 1NKRA 4HS8H 4I0PD 3NFNA 2AV7B 2XZCL 3RVWD 3LIZL 3TT1L 5FEBA 1LNUB 2F74A 1MEXL 4AQOA 4ISVA 4S2SB 3OKNB 2QADD 3Q0HA 5CWSB 4DK3A 3OJDB 1J11A 4APQC 5IR1A 1YY8B 3FFCB 5DJ0A 4OZIF 5FHBL 1AQDB 2GTWB 3F12A 3LV3B 4LDOB 2PO6B 1T20A 3NAAL 4U6HB 3DRQA 2E9JA 2ADIA 5LWYL 1GGBL 4QRRD 2FX8H 5ABDE 3BO8B 3E3QC 4MA3B 2EKJA 3U30B 5DZNA 4JG1L 4PS4H 2AGJL 3BXNA 3GRWH 3BT2H 3I2CH 5HD8C 1N4XH 3KPTA 3D0VA 4JDVA 5EZLA 4OQTA 4NKOB 1UM6L 2HTLD 1GC1C 4ODHL 4ZFOL 3S8WA 4ODWA 1HHGA 1GGUA 1I3GH 2JIXA 2CLVB 5FYLE 2C7UB 1CIUA 1RIVL 2HLFD 1N59A 4DN3L 1UXWB 3KHOA 5INCA 1HKLH 4HUXA 5IHLB 1OVZA 1CD9B 3T2NL 4X7EC 4PBVC 1HDMA 1ZAGA 3GSNH 2P1YA 1QR1B 4OGYH 4RMVA 3SKMB 5C1MB 1C08B 1LEKB 2YD3A 4N8CL 3GSNB 3V4VL 1Z2KA 3MLXH 4JFZH 1WV7T 2X10A 5HDQH 5CINH 3EYOA 2XA8L 2KH2B 3TO4D 1NAML 3M1BB 4XAKE 5D1XD 3VXOB 4HS6B 4OM0H 4TSBL 4XNUH 3S34L 1W0VB 4WFHE 4HKJA 3HUJB 1OSPL 4UNUA 1T1XB 2VL5B 3G04B 4S10A 1OAZL 2Z8WC 2I9LA 1AC0A 4RAUA 2Y07L 5E6YA 4WHTA 2C3VB 1FN4A 1HYSD 4K23H 1FO0A 5DGQA 1OARH 5JW5A 3RKDD 4KQ3H 2Q7YB 2A6JB 2WZPD 2VR5A 4NQED 3FO0H 1MCFA 4P2OC 3P4LA 2IANA 5TE4H 5BZWA 5F1OB 1CLYL 5DLML 4F58L 4HKZB 3T2QA 4DKAA