2M26A

Nmr structure of the c-terminal domain of the protein hcfc1 from mus musculus
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
126
structure length
126
Chain Sequence
GCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQASGEPKSSTPAQLAFMRVYCGPSPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWLQETSKDSSGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HCF C-terminal chain 1
publication title NMR structure of the C-terminal domain of the protein HCFC1 from Mus musculus
rcsb
source organism Mus musculus
molecule tags Cell cycle
total genus 10
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2012-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2m26A01
4MCZB 4K3EH 4JPWL 1C16B 3QUYD 5J1AA 3SE4A 5KVFL 2XKNB 1HILA 2APXA 3N1QC 4DVRL 4XAWH 1N26A 5TPWH 4MB5A 3QDJE 3CXDH 3FB8A 4TUOB 2F9BT 4H1LA 2AJ3B 4YHZH 3RX8A 5LAXB 1ZHNB 3BGAA 1FZOB 1KJ2H 3BMVA 5HYFA 2HKFH 5DUBB 3U0PB 2XPGB 2FH6A 3SO3B 2R39A 2PTVA 3FJTA 1OAQL 4DAGH 2BY0A 4L9DA 3PGCA 4AT6B 3QWRD 4EN3D 5KOVC 4XNQA 5CWSA 2X1QA 1Y6NR 4FMKA 2DYPD 4ZFFB 1DVFD 3KPOA 3ZKMD 3U1SH 4JFZH 5D2NB 3BWAB 1ZTXH 1WCBA 1ROWA 1ZSDA 4PUBL 4U7SA 4P5TB 5E2UL 4HGWA 4GAGL 1LEIB 3ZDYE 1H0DA 3GJEB 1FNLA 1UH2A 2I5YH 4IRSB 3PL6B 1Z2KA 4DGVH 4ORGB 3BX7C 2YC1B 1A7OL 4WW1B 4OZFB 2V2TB 4WO4D 2YD6A 4PJGB 3SKMB 1EV2E 3O3DB 4POYA 1U0QA 3IVKA 3L3IA 5C0IA 3TT1H 2AEQL 1MCRA 1BBDH 1T1ZB 2E6PA 1ZHLB 3L3OA 4PJ5E 4PGJA 4NUGL 1FNFA 1BBJB 1M71A 2E7LC 3FB5A 5LBSL 3T77A 1SY6A 4L5FL 2XY2A 1A9BA 5GZOC 4HAFA 1IAOB 3DV6A 1B6UA 5D93C 3LKRA 4UDUA 1A7BA 1S9WA 2HJLA 4UQ2A 3N1GC 4F7CB 3EFFA 4ZUUA 1ONQA 4KQ4L 1S7RA 3P9MA 2VZOA 1Z9LA 4KVNH 5I17A 4OM0H 2CGRL 4I4WB 3OAUH 4IRJC 3PGDA 4OCSH 4K8RH 5FM4A 5ALBH 4ZFGL 4YDLC 3BOVA 4P2YA 1MCOH 3EDDA 2ZWLT 3HZKA 1NCUA 4XP4L 1R5WB 4P5KA 4R26L 5DQDL 4FQ1L 3DUUA 4APQC 3CX2A 2GSIB 3QG6B 4OT1L 1BAFL 1WEJH 4PBVC 3WDHA 1RVFL 5E2TL 5JW4M 3UDWC 4I3GA 1WBZA 1B4JL 3FT4A 3F7QA 1BQLH 3WIFB 1XF2A 4AJ0A 4FNLH 4G7YL 1T89A 3F65A 1F58L 4JFFB 4MAYA 3VW3L 4O51A 5DD1H 4NO0A 5DI8A 5JOFB 2VITA 4MJ6B 4FQXB 3ZTJG 4R4FH 1EERB 3S88L 2UZIH 4MD4B 2NY3D 3O81A 2PCPA 4P4RB 3QFJA 3H0TA 2UZXB 1N59A 4ERSL 4NQVB 3W9EA 1MFAH 4MLIA 3ZTNL 4XI5D 2ATKA 1AGBA 5MERA 1R3KB 3GMPA 4OM1L 4NN7B 1CDUA 3AUVA 2YPVL 3PG2A 4Z7NE 2HFTA 4ZUTA 4M7LH 4LVHB 1Z3GL 2F74B 5CJ8A 1J0KA 5D8JL 2H32A 2Y9RT 2KQNA 4YE4H 2BJML 2VDNL 3GEWB 1MFCL 3IXAB 1IC7L 2AK4D 2ZUYA 3BKYL 3EYSH 4XMKH 2ZOLB 5DFVD 2NX5A 4POZD 4G6KH 4RX4D 1RUML 2P42B 1H5BC 5AUMA 1YY9C 3O2DA 5F9OL 1W0WB 3IDIA 5IFAH 5D7LD 3AXLA 1IBGH 5L7XL 4EDXA 4G9FB 1VFMA 2XTJB 1P4LA 3HAEA 1HCVA 4N9GA 3UJJH 3ZDZE 1KPUA 3T2NL 4OZIF 3B9VA 3WFDH 3MUGA 1H3TA 1NPUA 4LIQE 1FL6B 5TQ0L 3WFZA 3ESUF 3BH8B 4JN2A 4OCXL 3T0EB 4NWTH 5C0EA 1AIFB 4LCUB 4R2GD 4PRIE 1XF5B 1NGWA 3T0XA 3PQYE 3V0VB 3GRWH 2IGFL 2VDLL 3N0PB 3REVB 5IKCB 5EU5B 1A7PL 5DT1L 5E95B 3LDBB 3SDCA 5F7WC 4YHLH 1EMTL 4BH7B 4OV5B 4MB4A 3WE6A 4JQVC 3GHEL 3VH8G 1D6EB 1DQMH 2R1XA 1A1OB 4KVCH 4QHMA 5F89B 1I7RA 4NFDA 5GJSL 4LFHD 4WI3A 5DLML 1MLCA 3MNVA 4FFWD 3GIVB 1R3HA 2IMMA 2HVJA 4LSVL 3WO4C 4NBZB 2P43B 3V5HA 1MJ8H 2NY4B 4KROB 5DMKB 1NMCB 3KPRA 5IBLC 1HKLL 3FN0L 3ZKND 1CGVA 4NSKA 4AENA 4HXAL 1NCBH 3UTZB 2GY5A 4F8TA 1EVUA 5DD3H 5ISZB 3K1DA 1CICC 1HHKA 5F7EH 3IDYC 4C83A 1V3MA 5T1LB 1MFDH 5ACZA 4P5MB 4H0IA 1MCFA 3NACL 4LCWE 5BRZD 3EOTL 3RKPA 1I1AA 2OQJA 4H20L 4HCRH 2BVPB 2APFA 5GGSB 2EC9T 4JDZA 1ZS8B 1DUYA 5IOPA 4PJCB 3UPRB 2VXTL 3CPLA 4KTDL 5AYUL 3MV8D 2P24B 5E7BA 2VKXA 1XGRA 4UBDD 1CD0A 3QO0B 1MH5A 5E94A 4R0LC 4F15C 2EE2A 4MS8D 3TYGL 2CK0L 5E8OA 2Q6WA 4ZFOL 1IEBB 1G7QB 3KHQA 4L29B 3WNLA 1RUKH 1C5BL 3DX8B 4L4VE 4FQIL 2IFGA 2R4RH 5DJ2A 1U58A 5C3LD 1TQCC 3TF7C 4R90H 1VB9A 4IDJL 3OKYA 1TZGH 3GBLA 4KJWC 3V52L 1CFQB 3ZYJA 2E9JA 3HE7A 1JNJA 1YMMA 4X6DA 3H9SD 2VJXA 1ZLSL 1QRKA 4S0TD 4BUGA 4XNZC 1AO7E 1FLRH 5CZXD 3V9FA 3PDOB 3IGAA 1H8OA 3O2VL 4YBHA 5MEPB 5HY9A 3BPCB 1HQRA 3WD5H 3DVGB 1XGPB 5DD5H 2DLHA 2BVQA 3EZ8A 5J7CC 4UDTB 3DBXA 4HULB 1QYGL 4KRMB 4S11A 4AH2A 1CLOL 1YEEL 1RZKH 1FORH 1BFVH 4KHTH 3OKOA 1TQBB 3MLVH 2GYSA 5FGBA 2Q1EA 5DS8A 4U6TA 4XWOC 3TH2T 1A47A 3C5ZD 2VLRD 2VISB 5DK3A 2R23A 4GRLD 1NGYA 4GSDH 4NBXB 1TCRA 2WWMC 3O6FC 4YGAB 4OCRH 3QZWB 3B8SA 4JO4H 5J1AB 3L1OL 4M00A 1KCLA 3AS0A 3JXAA 2JE8A 4D0DA 3LY6A 4APQA 2YD4A 3KLHD 3FB8B 5CP7A 4H1LB 4M3KB 5E08L 3BKCH 3DX6A 4QHKJ 1U93A 1JI2A 5EN2A 4F57L 4PJHA 3D85D 5CAYB 3KXFE 5FGRA 1A7NL 2GITA 4YFLF 4JRYA 5EBMA 2NZIA 4RRPG 5DR5H 2AV7B 5I75B 4QHNA 3ARDA 3K2MC 5INCB 5D6DC 1U95A 1SJEA 3PGCB 4P2RD 3CSGA 3B2VH 4XNQB 5CWSB 2Z91A 4M1DL 3CX5J 4F33A 2X4PB 5C07A 1J0JA 3KPOB 3VXME 3UJTH 5LQBH 3O4OC 3QIBD 1D6VL 3TA3A 4I13B 1CFVH 4FXGA 4X4ZA 5FYJL 1MJUH 1WCBB 3GNMH 3ZE2F 5D1ZA 4Y1AE 2QR0A 4HGWB 5CZVL 4HFWA 4HXBL 3VWJC 5B8CC 1YECL 1H0DB 3IDUA 1LP9E 4JG1L 4K23H 5H94A 3WXWH 2X4UA 3RUGE 3K81A 3MV7D 4TN9A 3L7EA 3RVUC 4EVNB 2DMKA 2I26N 4F7MA 2XWJA 3IVKB 3ZT6A 3L3IB 2R56L 1F3JA 1U2CA 3ULVF 3FT2A 2AEIT 3L3OB 3QXUA 1H5BA 4WFGE 4KI5C 1M71B 4LVEA 4C59B 5L8JB 3FB5B 3T77B 1MCLA 2FEDD 5D7JC 4U1JA 1MCWW 1A9BB 1F8TH 5BVPL 3H9HA 2CUMA 1OAKL 1VHPA 5KTEL 1U8IB 3LKRB 1GVIA 4UDUB 1CDHA 5I19H 2HJLB 4QYOA 4UQ2B 3EFFB 3AM8C 4ZUUB 1AGDA 2EDLA 3P30H 1JP5A 2X4OA 3S36L 1S7RB 3P9MB 3S96A 4CU7A 1XFPA 5I17B 2D7QA 4Y2DD 1DE4A 2FBOJ 2IANA 3D0LA 3KPSE 1JVKA 1FYTD 4TTGA 3HG1A 3PGDB 1OAYL 1WUNT 3LQMA 2IPUK 2QSCL 5DEGA 1NAMA 3HZKB 4KHXH 1FSKB 5I0DA 4M6OL 2P44B 4JQVA 4P5KB 1TVBA 3DUUB 3QT2A 1RULL 3GDBA 3QQNA 2PN5A 5D72H 3W39A 4WFHD 3LMJH 5CJQH 1WBZB 1NAML 3VD7A 4GAFB 1KLGA 3VGHA 3ECBA 5FKAA 1XF2B 4CGTA 4YFEA 5C0AA 5GS2D 3U0WH 1MCKA 1AY1L 4I8DA 4P9HL 4MAYB 3TJHC 4O51B 3CUPA 2HMIC 3CGTA 5F6HJ 1HINL 1FGNH 1RZIA 2D0GA 4QRQA 2XN9D 3V8CA 1B4RA 4RGMB 2Q3AA 1A9EA 4QRRA 5D2LE 1EHAA 2PCPB 3QPQD 2Q7NA 3QFJB 5FYJD 3CCHA 3H0TB 2ID5A 4IOFD 3LPWA 1N59B 1YEIL 3W9EB 1EGJH 4DZBA 1ORSB 2D7MA 2XOTA 3NZHH 2ATKB 1AGBB 5A2JH 4X8XA 5MERB 3RVTD 3GMPB 3KWWA 2H2PD 3HNSL 3RAJL 3W2DL 4HWEH 4U7KA 3BJ91 4ZUTB 5SWSD 1K4DA 2BK8A 5HHOA 3X12A 2H32B 5E99L 4XB8A 3BQUB 5CJBA 2BNQA 4Z95H 3PWNA 3VG0H 4M62L 4XPAH 1MJ7L 2NX5B 2R0ZH 3PHOA 5AUMB 3ZO0A 2RBLA 3IDIB 2XRAH 4G7VH 4ZS7L 3AXLB 1TJHL 1T2QH 4EDXB 3U9PH 1P4LB 3HAEB 4O02H 4N9GB 1S9VA 1KPUB 2BSTA 3MUGB 5IW3A 3QDAA 1OF2A 4KK9C 1JPSL 5ADPL 5IMLA 3VGFA 4JB9L 4JN2B 1B90A 2PR4H 4GLRH 4LSSH 5C0EB 1OWWA 5TH2A 5GIRA 1JNLH 3ILQC 5SWZE 4MX7A 1NGWB 1N0XL 2J8UF 5ALCL 1SVZA 1XMWA 2YSSA 1I9JL 3SDCB 1E4WL 2PF6A 1GAFH 1G0DA 3WE6B 2ESVE 2BDNL 3S34H 1WIPA 4Z9KB 5I1GH 2R1XB 4Q6YA 4QHMB 2W0LA 1I7RB 3MV11 5GSVB 2HRLA 1W2KT 1MLCB 3MNVB 2Q3ZA 4PRHD 5T5NG 4YDJA 1R3HB 2EYSA 2HVJB 1BOGA 3V5HB 4DGYL 1W72L 4XPHL 4PB0L 3KPRB 2NY6B 3QDGE 4JKLA 4YXKL 4NSKB 4AENB 1ZANL 5F1NA 1HIML 4K8RD 3MZGB 2YKLH 1HHKB 3BXNA 4C83B 5ACZB 3I6LE 2NLJA 1I1AB 2OQJB 4UAOC 4JG0L 4RAVA 4JDZB 5HTSA 4QXGL 1DUYB 3X3GH 5IOPB 4KGLA 5C09E 1WQVT 3CPLB 5I1JL 2F53D 5FIEA 2VDOL 3DPBA 1G7HA 5JTWA 1XGRB 1NANH 1KCUH 1X5ZA 5K9JL 1T21A 5E94B 5D6DA 2D7OA 5E8OB 2Q6WB 3QUYC 4Y4HA 4ZS6C 2WBWB 1LE9A 4JKPL 4L1DA 1P5VA 1UYWH 4IS6A 3NMEA 3BRDA 3RVVC 5GRVL 4JM2C 5DJ2B 4JE4B 2ICEA 5J57B 1FBIH 3MXVL 1U58B 1J1PH 3O4LA 2FBJH 1O7VA 4LSQH 2AK1L 5GRWA 2C7UA 5B8CA 1GGUA 3FRPG 4YFDB 1LO2H 2AV1A 2DMCA 4GBXD 3HE7B 3ORJA 3SOBL 4M61A 4X6DB 1N7MH 5K59E 4A6YA 2A6DA 1V7NL 3ARBD 4ELMA 2IQ9L 3WSQL 4XTRD 3IGAB 3CFDA 3ZKMC 4UUJA 5HY9B 3AU1B 1QLEH 3I02B 4OIAA 1HQRB 1CDCA 4QRPA 4R4ND 1E28B 4PG9A 2BVQB 5B3JE 5TQ2L 5D7JA 3DBXB 4P57B 4JQIL 2YZ8A 4AH2B 4A6YL 4HBQA 4ZYKA 4NRYA 1L7TL 3Q5OA 5D93B 3RWDA 2A9NH 2HWZL 3BDBA 4UU9A 5T5NF 3V8OA 4K55A 1YNKL 4WO4C 5LWYH 1K5NA 2RCSH 3OKOB 2NY0C 5HGAA 1CGWA 4WI7A 4XC3H 3MUJA 1PJ9A 5DS8B 4OLUH 5KVDH 5I6XB 3BDXA 1UZ8A 4D3CL 4KDTC 5KSBA 2R23B 1NGYB 4KC3B 4IOIB 1TCRB 1CYGA 3DXAB 3LHPL 4HQQH 3HR5A 4YDLB 4MDJA 3LQAH 2OR7A 4XRCA 4PJEF 2NZ9D 1DSFL 4D0DB 1FCGA 2PXYD 2EH8H 1B0WA 3HUJE 4APQB 4NQEE 4M1CD 1ZGLA 5CP7B 4M5YL 2DQGL 4GS7C 3GSRA 5EZIL 5D4QA 4JHAL 3DX6B 3S37X 4LDLB 3PXHA 3G6JF 1U93B 5EN2B 4PJHB 4V1DE 2F19L 5CJOL 5C0GB 4AZ8A 1QKZL 5GS0H 5I8KH 2GITB 4JRYB 5EBMB 1P4BL 1X5HA 4G5ZL 5FYLL 4QHNB 1U95B 4EI5A 1SJEB 2FGWL 4UQ3A 3ARYA 4V2BA 2Z91B 2Q8AL 4MQXD 1FDLH 4F33B 4GG6A 1WFNA 4AMKH 1BM3H 4FXGB 1EO8H 5GRUL 5T1KA 3BO8A 3E8UH 5D1ZB 1HH9A 2JCCF 2QR0B 5BZDA 3TZVD 4HFWB 4OF7A 1GGBL 2HT4D 3EYVA 4EDWL 4GW1A 1LK3L 5E03A 3VXSA 5DTFA 5H94B 4Q9QL 2X4UB 4XCEA 3H9ZA 4TQEL 3L7EB 4F7MB 3U7YH 2XWJB 1UM4H 3C9NA 3QH3A 3HI5H 4YDKH 1JYXA 3OJMB 4GXVL 1SBBA 2VWEC 4RFOH 1F3JB 2NY3C 1IFHH 4LCYB 4K71C 3T3MF 1H5BB 3WBDA 3VFVA 1LGVA 3S98A 1Q0XL 4XI5C 1PZUB 4DCQA 2DQDH 3FHQA 1S8DA 1RUAL 1E6OL 3H9HB 4LKCB 3BKML 4XNYL 4OFVA 1BIIA 3QIWC 4F7TA 3WIHA 4LPCA 4XAKD 4FZEL 4QYOB 1FNSH 3O11A 1AGDB 1P1ZA 4KKAD 1PZ5A 1NL0H 2X4OB 4PJDA 3BT2L 5DFVC 4POZC 5JQHC 4LVNB 5IP4A 1DE4B 3VFGL 5ABDE 2IANB 4YXHH 4KY1L 3D0LB 1AQDB 5GGRY 3SE9L 1KCSH 3HG1B 4HPYH 5DEGB 1NAMB 4HH8A 5ESQA 3UYRH 3QDME 1ND0B 1KYOK 2XWTA 3D2UD 3DYMA 4GUPA 1TVBB 4LAQH 2OX5A 4Q9RL 4RISL 5HHPB 2YUXA 3W39B 2JJSC 3CFCH 4R2GC 3GSWA 5E2WH 3SE3C 2DBLH 1KLGB 3ECBB 4K9EC 1IAKA 5FKAB 2P8LA 3KYNA 5C0AB 2DQEL 5DURB 3A67H 1O7SA 3CUPB 3O6LH 2LTQC 2CPCA 3KPMA 1RZIB 4U1IA 3BI9X 4QRQB 1EBPA 2E9WA 3SCMA 1CWVA 4QRRB 1A9EB 5LGHL 5ELIA 3CCHB 3GB7A 2APVA 3T0VA 3QNXA 4EQ2A 1DJSA 2RFXA 3HS0B 3DRTA 4DZBB 1A6VH 4FFWC 2D4DA 2VDKH 3F12A 4JDTH 3NCYP 3KWWB 1N2RA 3WUZA 2W0KA 5I1IL 5KZCD 4MXQD 3ALWA 2FX8L 3GSNA 4XXCA 1K4DB 5MHSE 3QDHA 3ZTJH 3FO0H 4RMQA 2ICWA 3GMQA 5HI5D 5HHOB 3X12B 2FD6H 1A3LH 5BV7L 2ZCHL 5I1AA 1KCRL 4JM2A 2Y36L 5JXAH 4ODHH 1UG9A 1Q8MA 3PWNB 4KRLB 2W91A 4UB0L 1JCKA 1QFUH 3PHOB 4WWID 1YEKH 1R6VA 2EIZA 1SQ2N 3TJEH 2VLJE 5I73B 5IUSA 3ZSTA 5JXED 4N0YL 4UBDC 1FZJA 2UUDH 5BMFL 4UV4L 1MVFA 4BK4A 4OFPA 1MSPA 4NCDA 2BSTB 4XNZB 2IBZY 5T3XH 3R8QA 4LHUD 2R0WH 4IDLA 1OF2B 3VFNA 3BRFA 1UA6L 1OP3H 5TH2B 3T0DA 4TSBL 4MA7H 2EECA 4BQ9A 4ZG1A 5GIRB 3LS5L 5DJ6A 3WUWA 4MX7B 4OBSA 2D7TH 1VCAA 4QEGA 3M1BA 5EO9A 5C0RL 2YSSB 4NHCH 1UCTA 1FO0B 4DOHE 1JL8A 4HK3J 1KELL 4JFYA 2DICA 4K94L 3DVIA 4DKEH 2EIBA 4CW1A 2YOCA 2JF1A 5CZXC 1UACL 2X1OA 3I75A 4GOSA 4EEEA 2JIXA 4P2QE 4JO2H 3MCLH 1GH7A 4YDJB 1BOGB 4XWGH 3ULSA 2HH0H 3JWDL 5C0FA 2P48B 2Y6SD 2J3SA 3BPOB 4TOYH 4QWWC 1NGPH 3EJJX 3HI1A 2Q20A 1ZT1A 5F1NB 1N6UA 4NKQB 4MQTB 1QSEA 1UJ3C 4ZMAT 3BXNB 4OB5L 2VXUH 2JB5H 2LU7A 3BE1H 2CJUL 2NLJB 1MWAH 4L4TA 4RAVB 5DVNA 2AJZA 3GSUA 2B0SH 1JPST 3G6DL 4TPRL 4ZTOL 1I7TA 1SBSL 1A0QH 3ZKQD 3MLRH 4FFZL 1OGTA 1AR2A 5JW5A 1G7HB 4NN5C 2CKBB 4M4RA 4CVUA 1MRDL 2F5AL 1DBAL 1CL7H 3RGVD 5JHDD 1XT5A 4YGVB 1LE9B 1I3UA 3IB4A 3RIAF 2UZYB 4OZIE 3NGBC 5KSAD 4IS6B 3T08A 1MCHA 3KLHC 4WTZA 2ICEB 1IILE 5IMOA 3O4LB 4G6JH 2OK0H 3CZJA 2C7UB 5B8CB 3MCG1 2FL5A 4JO1H 1H9VA 5ICXA 1BMGA 4KDWA 4XNUL 2AV1B 3MLZL 1HHJA 4KKCD 2ORBL 4MNQD 3UTPE 3RBSA 4M61B 5JIHA 4A6YB 2A6DB 3CNKA 2Y1VA 2Y07H 4ELMB 4ISVA 3UTSE 4WFFE 3CFDB 4E41D 3QIBC 4UUJB 2RQ8A 3RU8L 4JKWA 2DI9A 1CXIA 3HFML 3QHFH 1DBML 3JV6A 3F5WA 4QRPB 3LKOA 1S7TA 4YJZL 2BVEA 4DN4H 4PG9B 5D7JB 2NXZB 1UCBL 4U6VH 4W6WB 5J3HD 3BVNA 2HFEA 1K6QH 4ZYKB 2UWEA 4NRYB 4D9QD 2IG2H 5HDBE 3HI6H 3RZCA 1YA5A 1AXTH 2I24N 2BXYA 1NCAL 3QEQE 3QIWA 4LSTL 3RWDB 3RNKA 3OKEA 1K5NB 1JV5A 3MLXL 1MAMH 5HGAB 4XC1H 1ZLVK 1S78D 3DI2B 4X6CE 4OZGA 3T2PA 3QISA 1TZHA 1YJDC 1IC4H 5C08A 3EO0A 5AAMA 1UZ8B 5E2JA 3UTQA 1RPQA 1X4YA 5KSBB 1NJ9A 4Q6IC 5FFLA 2FEDC 1OM3H 4ETQA 4JRXD 1BECA 4JM4H 3HR5B 4MDJB 3ULVH 1U3ZA 3NFPA 2VZTA 4JR9H 2EDNA 4XRCB 5GS1A 1U2HA 3EYUL 5DUMH 5F72S 3T3PE 4HIJA 3OKKA 1MNUL 2ZSVB 2BHYA 1ZGLB 2JJSA 4Z7QE 3L5XL 3GSRB 1FFOA 5C0CA 4Y2DC 4JFED 2JB6B 1MF2H 3ZKSD 2WBKA 1HXYB 3WJJC 1F4XH 3UO1H 4FTVA 5BXFB 2O26U 4UQ3B 5F9DC 4Z7WA 1P6AB 3DLQR 1JMXA 3EDFA 4GG6B 5GRZA 3OMZA 4K9EL 2I25N 2UVEA 1K4CA 5T1KB 2FO1A 3QP3A 3BO8B 1HH9B 4LSPL 5BZDB 3PWPA 2D7PA 2OZ4H 4U7MA 1MCPL 3EYVB 4GH7B 5D96C 4GW1B 4NNXA 4B0MM 1OGAA 3VXSB 5DTFB 5L2KD 4P9MH 4KXZI 1R3IH 1DANU 4XCEB 3TBVA 1HHIA 4YR6A 4X4MA 4KWUA 4TVPL 4U1GC 4UT7L 3C9NB 5B39A 3QH3B 4H8WC 3HCVA 1PEZA 2HRPH 4X98A 5HYJE 4AEHH 5HVHC 3QPQC 2CRIA 3VFVB 1HEZA 4BQBA 4IOFC 4OGYL 5D70L 4PTUA 4FABL 1PGRB 3BKJL 3S3JA 4FQJH 3RVTC 1FVDA 2D03H 4DCQB 2H2PC 2X44D 4HS8L 1S8DB 1WJ3A 1JHKL 3U4BL 3QO1A 25C8L 3OKNA 1QBBA 1D5XA 4HKBA 1DBKL 4F7TB 4RA3A 4XCNA 1UT9A 3O11B 1P1ZB 1PZ5B 3CFKA 3P77A 4PJDB 2AJUH 3ARED 3T0EE 3GUTA 3QI9C 3H3BC 2Z8RA 1TENA 1E4KC 4Y89A 3RY5A 5ESQB 1MFNA 1T6VN 3LEYH 4ODVH 3UZQA 5C0BA 4IM8A 4UNVA 4ZD3H 3KJ4B 1SMAA 4GUPB 3FZUD 4YDIH 3VI3F 4B7LA 1X5IA 1JI1A 1GGIL 4G8GD 1RJLA 1MI5E 5JR1L 3ZE2E 4CADA 3B9KA 3GSWB 3OAZK 3SJVD 2WWKO 3LV3A 2J7LA 5HYIA 5I1DA 5BO1L 1IAKB 2V7HA 1TPXB 2P8LB 3W81A 5JUEH 2D9CA 2O5YH 3KYNB 1F4AA 4F7EA 4YUEL 2MSPA 4OZHA 5EWIH 3AROA 3J7HA 4IIQC 4XVTH 4RGNE 1UJ3A 3V6OC 4B50A 3NABL 3KPMB 4U1IB 1OQOA 2IJ0C 2DM4A 3O0RH 3SCMB 4C57C 3TO4A 4ELKA 5ITBH 3GB7B 5BV7B 3QNXB 3U82B 4OQ1A 2RFXB 5IJVA 1F4YL 2WM0A 3DRTB 5DQJA 1EEYB 3F12B 1BVLB 1N2RB 3S35H 2J88H 2KL6A 5CKGA 3CXHK 3SDYL 1DQDH 3QDJA 4UOJA 4PJGF 5GS0D 3GSNB 4OLVL 4HFUH 1IKNC 4L1HA 1E27A 2ICWB 3GMQB 4WIQA 3VD9A 1NUDA 4U6XA 4K8RC 5I1AB 1YEFL 1IC5L 4JM2B 3OXRA 4QHKI 3U7AA 4YHPA 3IFOB 1QBMH 1G84A 2BSRA 1RUPL 3BZDA 2EIZB 2K7QA 1F90H 1OP9A 3MRJA 1FZJB 1V7ML 1A14L 2DLFH 4JFHE 1U6AL 4BH8A 3QFDA 2DYPB 4HWBA 2AABL 5I18H 2BERA 3F7YB 3VFNB 3VFPB 4P23D 2OTWA 4M48H 2Y06H 4JFDE 5GHWL 3RL1A 2VN4A 5DJ6B 3WUWB 5I74C 3CLEL 5IHUL 1AXSA 3EKCA 3M1BB 5EO9B 2FATH 3GIZH 1EUUA 2BHUA 3I3EA 4GBXC 2A6KA 3FCTA 4JFYB 4XVJL 4PJ5A 2NY0B 4ZXBD 4CW1B 1MCEA 3ARBC 4XTRC 3LN5A 1CD8A 3NPSC 3AS2A 2WQRA 2W59A 4KZDL 4O5LL 3H3PL 5HD8D 3I75B 2J8OA 2JIXB 3G08A 1H3PH 1UM5L 4R4NC 4K07A 2FSEA 2XZQH 4Q6IA 3EW3B 4XMLL 5JW3L 4D9LL 5EFIB 1PY9A 4ONHA 5H35A 1T03L 4JY5H 3ULSB 1MPAL 1YEDA 2VZ1A 3LIZH 4GFTB 5GXBB 4DVBA 5C0FB 4MMZC 1DL7H 5MI0B 3HI1B 3VE0A 5C9JA 1P9MA 1ZT1B 2VIRA 4D9RE 1JGLL 2IALA 3GKWL 4X9BA 5BS0D 3MLYL 1T7ZA 1QSEB 2AAVA 2WIMA 1DQQA 1BFSA 4L4TB 5IB4A 3IFPA 1BLNA 5C6TH 2AJZB 3GSUB 5CILH 2C3VA 3MOAH 1I7TB 3CH8A 1RZGA 1OGTB 3BYTA 3HKFA 5JW5B 3WO3B 4XXDA 1X6LA 2NQCA 1JJUA 5IHZA 4B53A 4D0BA 1IZJA 4M93C 1EEZA 4P3CL 2PXYC 3MBXL 3KLSA 1PSKH 5TE6L 4M1CC 1LO3L 2P47B 5IMOB 2ZNXA 2R0KH 2DM7A 1QNZH 2VDPH 3NFSL 3IDXL 1GZPA 1GC1C 2VMFA 2FL5B 4HC1A 2XI9A 5ICXB 2R69L 2J8UE 1OSPH 5GS3A 1HHJB 2CIIA 4DGIH 1G6RB 2M26A 4Y5XA 4DK6A 4PJIF 4NQDD 1KXVC 4ODWA 5D7IF 4MQXC 4ISVB 4FQ2L 2QQLL 3AS1A 1A3RH 3JV6B 3WHE1 2Q86A 3F5WB 3LKOB 1S7TB 4PJAE 2QQKL 4GJTB 3WXVL 1Z6JT 4BUHA 5J1TC 2VQ1A 2EZ0C 3L3KA 3BVNB 1KJ2A 3QEUA 4Z7UF 2HFEB 5DVLA 2UWEB 1G9ML 1WTLA 4JO3L 3RZCB 3QIWB 4CAGA 5TPWL 2EEAA 3RNKB 3OKEB 1ULVA 2GQHA 1JV5B 4YHZL 4LCCC 3EHBD 2R4SH 1NMBH 5T3XD 4NZTL 1TZHB 1I9IH 1NQBA 5BOPA 2C5DC 4XP9L 5C08B 1PFCA 4TUKL 3UTQB 4KKBD 3QI9A 1S9XB 5AZEH 1NJ9B 3QCVL 2WBJD 4ETQB 5CEZL 1MRCH 5IEHA 3EDEA 5A40E 2EXYD 2DQTL 3NFPB 1IEAA 5FCUH 2BY1A 4N8CH 6CGTA 1OAZH 3HMXL 5GS1B 1S5HA 3CVHH 4MLSA 5E4EB 3ULUE 4K3DH 4DKDC 2F58L 1LDPL 4HIJB 4PRIA 4C56D 4CKVX 3OKKB 4R7DA 3LPFA 4YXLL 4G8IA 4LPWA 4RDQG 4KKAC 1FFOB 3QIUD 3V4PL 4LIQL 3TVMA 1XEDA 5C0CB 2BNRE 3IKKA 1JWMA 4GLRI 3P0YH 4XPBH 1P53A 3FFCE 1LEKA 1WVZA 5F7DA 3TPKA 1IGCL 4FTVB 4N9OB 5GGSY 4LLYA 1PG7W 3V6OA 3CDFA 2XY1A 3W0WD 2Z31D 3E2HB 5I71C 3ISWA 4Z7WB 5DRNA 5FB8B 5E6IC 4WHDA 4G3YL 1X5XA 4P49A 5HHMB 4PRPD 5SX4H 5IROA 3OGCA 2VH5L 3PWPB 1KSRA 1QZ1A 3LH2L 2B2XH 3QFJE 4X5WA 2F54D 3IS1X 4NNXB 1OGAB 4Z7OE 3TBVB 3H2WA 4LCWA 1HHIB 2P5WD 4LP4A 4YR6B 5B39B 2Y4SA 5DA0B 3HCVB 2X4RA 4PJFF 4PJ7F 5LCVL 1GGCH 4X98B 5FA4A 3WLBA 1T80A 3B2UD 4HUMB 1WWBX 1HEZB 4PRNA 5A2KH 3CFBA 2FNBA 4PG2A 4PTUB 3EGSA 1QEWA 4O58L 2DLTA 5ALBL 1FVDB 1QRNE 2EDKA 2ZPKH 4MXQC 3QO1B 4KMTH 1F45A 4L4VA 4HKBB 1D5XB 1IKFH 3MTRA 1KN2L 5FUOL 4MGXA 4PJEE 5HI5C 1YC8A 4XCNB 4ENED 4I77L 4M9PA 4YHKH 1F11A 4UV7H 4CU6A 4AQOA 4MA1C 2E3VA 2NW2A 1T1WA 3CFKB 3M8OH 3P77B 2P45B 5J11C 4JDVA 4JGMA 3SBWA 5HVGB 1S3KH 3OJVC 3GUTB 4RDQF 3ARGD 1B88A 1GXEA 5JXEC 4KJYB 1U8NA 5CEZD 5JHLH 1AO7A 5DD1L 2DDQL 1ZVHA 2VDRL 3RJDA 4L3CA 2KPNA 5C0BB 1CG9A 1P7QA 2X42A 4LRIC 1LO4H 4Y4FA 1OPGL 4CADB 2XZAL 3B9KB 4R4BA 1SJHA 3LV3B 5D5MF 1NAKH 4QRTA 2V7HB 1K85A 2YD8A 4M7LL 4EJ1C 1M6OA 4X4YA 4F7EB 2JJTA 3NN8A 3PQYD 3C60A 4OZHB 2ZJSH 3SKNA 4MZ2A 1X7QA 3ULVD 1UJ3B 1U3HC 3GKZA 3ZE0E 1BGXL 3I50L 3TO4B 3FOLA 4ELKB 2NY5L 5GGVL 3T3ME 1A5FL 3V4VL 4AEIL 4C55A 4M5ZH 5IJVB 3PWUA 5DQJB 1UXSA 3JWOL 1CGXA 4KJPD 2BSSA 3GI9H 1ACYH 4X9IA 1TNMA 3FB7A 5FO9A 2BMKA 1RD6A 3QDJB 4OLZH 1CXKA 3NCMA 2Y6SC 5D71H 1E27B 5JQ6L 2O5XH 1U8HA 4EUPG 4U6XB 1CLZH 4WCYL 3VD3A 2VSDA 3OXRB 3KXFA 1Z9SA 1FRGH 3P4MA 4YHPB 5AG9A 2YXMA 4G6MH 1D5ZA 4PYHA 5IEKA 2BSRB 1PG7H 4KZEH 1FC1A 2BRRH 3JV4A 2N4IA 2PYEE 2A77L 3RNQA 1I7UA 3RGVC 4Q0XH 2CKNA 4LU5L 2AERT 4BH8B 4ZPVA 3QFDB 4NQCD 1C5CL 1SJVA 4QOKE 4Y1AA 4JZNA 4KAQH 3NA4A 2OTWB 5K9QI 3KYKH 1LP9A 2EKSA 4IMKA 5IB1A 3RL1B 3RUGA 3SQOL 3BEWA 1T2XA 1NGQH 2AJVH 3NIFF 1J1OH 1AXSB 1KEGH 1MCWM 1NSNH 3GSVB 5DD3L 3MLWH 4WENB 2A6KB 5ADOH 3FCTB 4PJ5B 3FFDA 3S9DB 1RIUL 2ZOKB 2IBBA 2XFXA 2WZPD 3LN5B 2AEWA 2VLMD 4DKFL 4JHZA 3TH3T 3G08B 3LZFL 3WKMH 2DM2A 4Q6IB 4CVZA 5I2IA 4PY7A 3LN4A 2IAMA 4ONHB 5H35B 5J3HC 1UKTA 1F4HA 1NEZA 5I1EH 3QSKB 5TF0A 5IVZA 3VRIA 4S0SD 4DVBB 4DEPC 2XA3A 4NHUA 4X9FA 5TE4H 4UOW0 4HZAA 3VE0B 5C9JB 3UJIH 1ZEAH 2BOCA 2ZKHL 3DXAE 2IALB 2R4RL 3U9UA 3QEGL 1KGCD 2AJSL 2LVEA 5DRWA 1S78C 2V17H 2BZDA 3KPSA 4Z0XA 5IB4B 3IFPB 1BLNB 4K7PH 4MJ2A 4F37F 4Z78B 2CR6A 1F97A 2C3VB 4Y2DB 2ZG2A 2VDML 4Y7MA 1RZGB 2XZZA 5JIIA 1QFWH 4XXDB 1Q72H 4Q97A 3IFNH 4KPHL 3PF2A 2CUIA 4HBCH 4LRNL 4Q9BA 3PJSA 4LSUL 2DI7A 4PJHE 3SE8H 5DJZA 4X7CC 4M6MH 5D7KD 4P3DA 5IHZB 5IF0A 1CE1L 4S1SH 4BQ6A 5E6IA 3D3VE 2DJUA 4D0BB 1EEZB 3TV3L 2QADD 3SGJC 3HE6A 4LGRB 3C2AH 2B7DT 3LD8C 2YMXL 1GZPB 4WW2F 4W70A 4ZO8A 1DBBH 3VXUD 3X14A 5D96B 1JTPA 2VXQH 4XCFH 1OB1A 1LHZA 3BIAX 1RZKL 2CIIB 4Y5XB 1KIQA 2KH2B 1S9YA 3NZ8A 1R3LA 5D2LA 3IXTA 43C9A 4ODWB 5EA0L 3QWOA 2AKRA 5HVHB 4XHJC 1J0YA 1OTSD 2QQNH 4OIIL 2Q86B 4NIKB 3VXMD 2VQ1B 3L3KB 4N0UB 3J8F7 4OCRL 2J4WL 2GJ6A 3UROR 1KJ2B 3QEUB 2K3TA 5E6ZA 4JO4L 2PETA 2HYMA 3VXQA 7CGTA 1D5IL 3G9VA 1CQKA 1J1XL 3R1GH 3TP4A 3D9AH 1OWRM 3VXNA 4HF5L 1JHLH 4X5XA 1RU9H 1OT2A 4LGPB 4TNVK 3MV9E 3AMKA 4JQXC 3EDKA 4MXVF 1BJ8A 1P84K 4IRZL 1A7RL 3D87B 5DFTA 3QI9B 1QHPA 2VQTA 3OZ9H 4PLOB 5DR5L 5F8QC 3QUZA 4KK5D 4DQOH 5IEHB 5E2VH 1R24A 1RHHA 2KQMA 1CFNA 3TN0D 1IEAB 3KG5A 2DQCH 5F7YC 1UEYA 1DN2A 1S5HB 5LQBL 5ECJE 1MCIA 4PRIB 2YA2A 5SWZA 4R7DB 3QG7L 4G8IB 4ZUVA 3I2CL 4DUWA 2GT9A 9CGTA 4UNTA 1RZ8A 3FONA 4DFIA 1JWMB 3DVNB 3AREC 4G80A 1OOAA 1LEKB 1W8OA 3SO5A 2RAMA 2V7NA 5F7DB 2ZUUA 2ESVA 4GQ9L 2H3NA 1Q9KA 1QO3A 4LLYB 2VLLA 5K9KA 4KTEH 1U3HA 2X4SA 1JGVL 5DRNB 2XIDA 4L3EE 2VLKD 3MODL 1SYSB 1X4ZA 3RY6C 3FZUC 2C26A 4MJ5A 2R9HD 2YPLD 3OGCB 5IK3A 1FFPA 4MHHG 4QRRE 3QDGA 4X5WB 1CXFA 4X6DF 4NP4H 2FIRT 5J1SC 5CEXA 4GKNA 4LCWB 5I19L 4ZNCD 3UC0L 3LQAC 1F4WH 2X4RB 2XKSA 5C09A 5F97E 1JNHA 5IG7A 5FA4B 3WLBB 4PRNB 3H7LA 1NCTA 3CFBB 5TE7H 5LXGH 3QULA 4OCWH 5TDOA 3U30C 4BFIA 2ADFL 3EGSB 4M03A 1JNNH 4XP5L 2HFGL 4KHXL 2FGZA 4L4VB 5L6YH 5HI4D 5GS0C 5IESL 3VXRD 3G5VA 4ORZC 1KJVA 3ARFA 3QCUL 1QSFE 1I1FA 1CL7I 1MHCB 3N50A 1F11B 2JELL 1MQKH 2NW2B 3LMJL 1T1WB 3FQTA 4EBQH 1QA9A 3Q2CA 3QBTB 1VKXA 1HOCA 4WGWB 5DC0A 1NH6A 3GSQA 3UTTD 4BM7A 4HMCA 3ZL4L 4PJ9D 1EGJA 1U8NB 3SKUD 1AO7B 3KPPA 4FQCL 1BREA 3VGEA 4L3CB 5CLWA 5B3NA 5E8NA 3MRRA 1AQKL 1W0VA 1CG9B 3EO1A 4P23C 1JF5A 3Q6GH 1P7QB 4OD3L 4Y16A 2GI7A 2PW1A 3BDYH 4Y4FB 4LQFH 5IW6A 5IWLC 1SJHB 3AY4C 2XQBH 5JDJA 4S1RH 2Z8WC 4ZAKA 4J4PC 3D39E 1M6OB 4X4YB 1K3ZA 3MRHA 2V6HA 1NLDH 4R9HA 3O8XD 3NN8B 1JZ4A 3C60B 3D1MC 1WFOA 1EO5A 1X7QB 2IFFL 3NCFB 3NAAL 3WS3A 3BP6A 4ZXBC 7FABL 3PP4H 2DQHL 2QEJA 2AI0H 2W0FA 5HD8C 5JO5A 2HTKD 3PWUB 1UXSB 1IC1A 2VR4A 3T8XA 3SKJL 2BSSB 2O5ZL 2VDQH 3FB7B 4M7KL 5FO9B 3HUJA 2BMKB 1D9KD 3PGFH 4J12A 4NQEA 4OCYL 5CP3H 3VG9C 1IM9D 5HPOA 1QUNA 1U8HB 1KBGH 3C5JA 3MROA 2A0LD 2L7JA 1OTTD 4LSSL 1IAMA 3RTQD 1F2XK 4V1DA 2EE6A 4QO1A 3KXFB 3EJYD 3P4MB 4WFED 4YK4B 2GFBA 1CLCA 1X5KA 5IEKB 3ELAT 3WFEH 1MOEA 4G42A 3ARSA 3JV4B 4X9GA 4HH9A 2ZUWA 4NCC2 3H9YA 3F7PC 1NBVH 3S3SA 3RNQB 4OLEA 3STBA 1YEHH 2R29L 2V2XA 4ZPVB 1DBJH 4M7LT 5EU6E 4Z18A 4NZJA 5MP6L 4Y1AB 4Y4KD 2BRQA 4JZNB 4WGVB 4OFIA 3HRPA 3VI3E 4EOWH 3VRLF 4L8BA 1LP9B 2EKSB 3F8UB 5IB1B 3GK8L 4JFQA 1T7XA 3OHXA 3RUGB 3BEWB 3TC9A 3OF6A 1KN4L 1FLTX 2Z0BA 1U8JA 4KI5E 5ACMA 4WV1C 3TIEA 1DLFH 1S9KC 2YEZA 3A6CH 3MNZA 4MJID 4PJ8C 4WEMB 2YKLL 5E8DL 1Q38A 2WMPA 4YX2H 2PO6C 4FFVD 4OUUA 2H6PA 5CS7A 2W9EH 4F3FA 1MREL 3FFDB 5DWUH 5DQ9A 2XFXB 4XHQA 4XX1G 4JQXA 1ZK9A 3C8KA 4KRPD 5BJTA 1U92A 4NNYA 1LILA 5DC4B 4CVZB 5I2IB 4PY7B 3LN4B 2IAMB 4UIKH 1NEZB 3VDAA 3VRIB 1P4IH 3ET9F 3QUXA 5CINL 1QBAA 4ODSL 4NHUB 4NPYA 1MFEL 1NC4D 2D4FA 1RV6X 2BOCB 4DUVA 4G8FA 4PS4L 3LS4L 3U9UB 5CBAA 3MA7A 3MRQA 1Y0LA 5B38G 2AQ2A 3EHBC 3KPSB 2UUDK 3N1MC 3L3GA 4PFEA 4Z0XB 1WIOA 3C09C 2NW3A 2Z8VC 1BEYH 4HKXA 4U1KA 2GHWB 1U8KA 4KKBC 4P2OD 2X2YA 2QLVB 4X8JA 3QDMA 1WTGT 3HMWH 4HHAA 2WBJC 1WZ1H 5J12C 2Z9TA 2EXYC 3BAEH 2NPLX 5DJZB 5T3ZL 3RA7H 1FZKA 5I71B 1JGDA 4P3DB 3X3FH 5IF0B 4X7FC 5E6IB 3TEUA 1U41A 1L0YA 3RY6A 5FYJU 3O9WC 5HYSA 4U1HA 2VZSA 4PGEA 2ICWJ 3HE6B 3JSSA 1J8HD 1WBYA 1HHHA 2P5EE 4J23A 4X7SH 3QIUC 1BQHA 2OYPA 3X14B 2Z4QA 1OB1B 4TULL 1OCWH 4RWYL 1N8ZA 2OSLA 2FX9L 3O6KH 4KRNA 1KIQB 3UP1A 1S9YB 1HXMA 3NZ8B 1R3LB 2RCSL 5TF1H 5D2LB 3IXTB 43C9B 4DN3L 2Z31C 3QWOB 2AKRB 2BVTA 3CU1A 3N1PC 1AE6H 4U0RC 5FDYA 2X5PA 1I9EA 2K9UA 2OL3L 3CMOL 5C92A 2OMBA 1QSVA 2GJ6B 1J5OL 1YPZF 2J5LC 3OX8A 5JZ7D 2D31A 3VXQB 2F8VA 2AQ3A 2BFVH 3IJYA 4X5XB 1ADQA 3NCBB 4MA1B 2APTA 2KZ1B 5J11B 2VLJA 2HKHL 2B4CC 4XBEL 3B2UC 3GJFA 1HZHH 2WUBL 4YEFA 2Q8BH 4CMHB 3EUUA 5F1IA 1P5UA 3NCJL 3QUZB 4CN4A 4Y19D 1ADQL 4F2MA 1T66C 4V2CB 1R24B 1RHHB 3G5XA 4ZDHA 1CFNB 5CMAA 2V5YA 4LHJB 3CZFA 1RUQH 2IPUG 4LHUB 5FOBA 1U91A 4PRAA 3K8MA 5DRXA 4P23A 1F42A 1RURH 5SWZB 5E0QA 1RIVH 1OARH 2ARJA 3ZE1F 2IQAA 2HFFA 4ZUVB 2GT9B 2DOCA 2DQJL 3A6BH 1Q1JH 3AY4A 3V6BR 5J8OA 5E9DD 1RZ8B 1OD9A 3FONB 3HLAA 2DQIH 5F1SA 1OL0A 4G80B 2NY1B 4J4PA 1BD2E 3ARGC 4JPWH 5IVNA 3ARWA 2V7NB 5KVFH 3U7YL 1SM3L 3DWTA 1UM4L 4GKOA 2DM3A 2ESVB 1KJ3L 4DVRH 2H3NB 1Q9KB 1QO3B 5T3ZD 2VLLB 5K9KB 1AR1D 3T0WA 3SDDD 1A21A 3T1WA 1OAXH 1U3HB 2X4SB 3KYMA 5D7IE 4JZJA 1FNGA 4MJ5B 2MKWA 3Q1SL 5I76A 3RBGA 4KQ3L 4J3XA 2AQ1A 5IK3B 1FFPB 1OAQH 1M7DA 3QDGB 3RP1A 3P0VL 4KK8D 4Z7UE 1EAJA 3PWLA 5I1HL 4MCZA 3EBAA 4GKNB 1I1RA 1OP5K 1FNSL 4ELMF 4Z6AT 3RVWD 3ULVC 3QAZC 5C09B 4LPTA 4F9LC 1T0NB 5E2UH 1KLUA 2BVOA 1JNHB 2AJ3A 5IG7B 3NIGF 4GAGH 5CJ5A 5BVJA 2CXKA 2OR9L 1RHFA 1FYHB 2EIDA 3QULB 4YHOL 5TDOB 4BFIB 1KCSL 3BW9A 4QRSB 2OXGA 1J88A 3I6GA 4WUUD 1A7OH 4DJMA 3DUSA 4OZIA 4HUXA 1YYML 2AEQH 1FVEA 3G5VB 3WLWD 1C12A 2AXGA 2VERN 4J1UA 1WITA 1KJVB 3ARFB 1XR8A 1YUHB 1B0GA 1I1FB 1J18A 4PJXF 1MQ8A 3CFCL 3FQTB 2DLEA 2QHLA 4HUNB 4XMPL 5J9PA 4NZRL 5LBSH 1QA9B 1KTRL 1VKXB 1FL5A 5ERWA 1HOCB 4L5FH 3S5LA 3GSQB 2FYYA 5MEND 2E7HA 3W82A 3HC3L 3MFGB 3GJEA 1IQDA 3ARPA 4Y2OA 3AS3A 5DJYA 4QXWA 4RWHA 5EUKA 4PJ8A 1AI1L 3KPPB 3UTSA 1L6XA 4WW1A 2PO6A 4OZFA 3G5ZA 1KYOJ 3BIKA 2OM5A 1J87A 5E8NB 3MRRB 3BN9C 4KQ4H 2VL4A 1W0VB 3EO1B 1T3FB 1GPOL 4PY8I 5C0JA 2APWA 2CGRH 4Y16B 1A6VL 2PW1B 2CUHA 1FZMA 4XZUA 3SDAA 4PIRF 5IW6B 4YHYB 3QEQA 1AJ7L 3MBEA 3MUY1 4ZFGH 1JTOA 4NWUL 4ZAKB 3FO0L 2EDXA 1F3RB 3MRHB 4FG6C 4XP4H 3OV6A 3QR2A 4R26H 1FNHA 4X6CA 5DQDH 2L7UA 4FQ1H 3QYCA 3U36A 3WS3B 4OT1H 3BP6B 1BAFH 1RJZA 1RVFH 4PJ7E 2PW2A 1IT9L 1YEKL 1B4JH 5JO5B 1N6QL 1KLFA 4BK5A 1KFAL 4X4XA 4G7YH 2PKDA 3T8XB 4I2XE 1F58H 3ZDXE 2OJZL 3BMWA 4P2QD 3HUJB 4NQEB 3IDJA 1C8PA 2R0WL 3UBXI 3S88H 2OLDA 2ZG3A 3C5JB 3MROB 5IVXE 4WNQA 2Y7QA 3O9WA 1YEJL 4V1DB 4ERSH 1CLYL 3LD8B 3QIUA 1XIWD 5I1CL 3ZTNH 2GFBB 4NT6A 5D1QA 1ACZA 3CFJA 2C1OA 1WFTA 3UZVB 4G42B 3UXFA 4NHCL 4LAJH 4LCIH 1Z3GH 4HH9B 3E3QC 1GSMA 1NFDF 4RFNC 3MC0A 2BJMH 2V2XB 2VDNH 2HA1A 4OFYA 4R8WL 1FIGL 4TUJA 2J6EH 1IC7H 4MJ6A 1XAUA 3BKYH 1RUMH 2AJYL 4PJDF 3VH8A 2D0HA 3NA9L 3TCLA 4L8BB 5L7XH 3OBAA 2VWEE 4JFQB 5HDLA 1OAUL 3OHXB 1MWAA 2H32H 4OF6A 1EEQA 3V2AR 1U8JB 3GM0A 5DZNA 4YPJA 1T83A 5I15L 4NN6C 5GZND 3TIEB 5D5ME 1FN4A 2HJFA 2DMBA 3DGCR 3T2NH 2YEZB 3OB8A 4HKJA 4GG8A 3MNZB 2D7NA 4JANA 5TQ0H 4LARL 2WQ8A 3UX9B 5HYJA 4ZSOE 4OUUB 2H6PB 3HB3D 1E4JA 1RK0A 4KKNA 4F3FB 2UVFA 3UTPD 1BJMA 4P5TD 5DQ9B 2EE3A 2VYRE 1DUZA 3RWFA 3V7AG 1OTSC 4FQLL 2BP3A 2Y72A 4NO2A 4IRSD 3C8KB 2CRZA 5BJTB 3PL6D 1U92B 2VDLH 4NNYB 3TFKD 4JFPA 2AK4E 2Y5EA 1INDL 1A7PH 2AXHA 5DT1H 1CL7L 5C08E 1EMTH 2BVYA 2X41A 5D7LE 3GHEH 5HI3D 3SGDI 4FXLA 2W92A 4G8FB 4N90E 1FL6A 3MOQA 3MA7B 3MRQB 4OGAC 3WJLA 1Y0LB 3FQRA 3FT3A 5GJSH 3T0EA 5DLMH 2EDBA 3L3GB 3KPNA 5IBUB 2NW3B 1HYSC 3FTGA 2RIKA 4TSCH 4HKXB 4U1KB 1U8KB 2E9IA 1RIHL 1YNLL 3ARRA 3QDMB 1HKLH 3FN0H 4X8JB 4HHAB 4KK5C 1KPRA 4R3SA 4HXAH 5EU5A 5TFSH 5K33A 3KPLA 3TN0C 1FZKB 2Y07L 4OLXL 1JGDB 4OI7A 1BX2A 4MNGE 4MXWL 3NACH 4LL9A 3EOTH 1MI5A 4H20H 4OCMC 5HYSB 4U1HB 4PGEB 1WBYB 2X6MA 4KTDH 5AYUH 1BVKA 1HHHB 1BP3B 1BQHB 1CDIA 3RWJA 2LU3A 3OAYK 3MV01 4RMUA 1INEL 3V79C 2Z4QB 3TYGH 1S7WA 1AXTL 1RSFA 1IVLA 2YBRA 1N8ZB 2OSLB 2Z8SA 2P1YA 5J6GA 5DK2B 3DYPA 4M7ZC 1HXMB 1C5BH 3UTZA 5GRYA 4FQIH 2X9XA 5HHXL 1RK1A 3UZEA 3VFSA 1LK2B 1XCTA 3OB0H 5FHAL 3VI4E 1IEHA 2CMRL 5I9QB 3WIIL 2XA8L 2R9HC 4IDJH 3Q3GA 4OCLC 2ZZUT 3B5GA 3V52H 3U30B 2P4AB 5BRZE 3EO9H 2Y23A 2V5RA 3MLPA 1Y18A 2A1WL 4JFFD 2YWYA 1KENL 4JR9L 1VERA 1I8LC 4FQXD 3VWKD 2NNAA 3C8DA 1ZLSH 3OX8B 2D31B 3MV8E 1H15A 5AWNH 4H25A 3TCXA 2PNDA 3IJYB 3O2VH 6FABL 2EYRA 2VLJB 4K3HA 1QYGH 5CJXC 2UY7A 5HYQA 2CLVA 1FFQA 5F1IB 1CLOH 1YEEH 2WNGA 3LAFA 1UH3A 1CFQA 4OQTA 1MAJA 2OZ4A 1VPOH 3G5XB 4XBPA 4ZDHB 4X5LA 1XF4A 4RRPA 5GISL 5CMAB 4ZNEE 3CZFB 5HI4C 4JFDA 4C4KO 5FOBB 5MEQA 1U91B 4PRAB 3ZYOA 3U0TA 5DRXB 4P23B 3H9SE 4S1QH 4HJGB 2ARJB 4PB9L 1DZBA 2IQAB 4OD1L 4OF0A 4OQTL 5I0ZA 2HFFB 3BD5A 1AC6A 2OZ4L 4G9FD 2XTJD 1VGEL 3GBML 3D25A 3L7FA 3HLAB 3HC0A 4P9ML 4DOHB 5I8OL 1KB5H 3L5JA 3RQ3A 2AP2A 4PJ9C 2ITCA 2ED8A 3X11A 4J6RL 2FO4A 4ONFL 2HRPL 2AEPL 2ZUVA 3VFOA 5BOZG 5A3IC 5HDQH 1UKSA 1CIDA 3KYMB 2RHEA 2H8PA 4JZJB 5E56A 1FNGB 1SYVA 4F57H 5I76B 1PKOA 1A7NH 3MFFA 3P40A 1M7DB 4ZODA 2P7TA 3WFCL 5GS2H 4M6NL 2VLRE 3PWLB 3VG9B 4M1DH 3O8XC 3JWNC 4KI1A 1D6VH 1J05A 5IVOA 5FYJH 2IPTL 3B5TA 1A1MA 4PLJD 1DQJA 5IJKC 1IARB 1KLUB 1T5WA 2BVOB 3F7RA 5CZVH 4HXBH 1ZHKB 5BVJB 1YECH 2EDDA 2NY4D 2HTLD 4J2XA 4HAGA 5F6IC 1UADC 4JG1H 4KROD 3FAWA 3BW9B 5FXCH 2UWEF 4LVOB 3I6GB 2DN7A 5ISZD 3C87A 3DUSB 4OZIB 2DL2A 2AV7A 4HWZA 4HUXB 3AB0C 5INCA 1D9KC 5T1LD 5FAAA 5DRZA 1FVEB 5T5FL 2R56H 1C12B 2AXGB 4J1UB 1XR8B 2A0LC 2X4PA 4MA8L 1B0GB 4OZGF 2N1KA 1OTTC 4P2RE 2G75A 3RTQC 3D18A 2J8UA 1E4XI 5J9PB 5JMOC 3EJYC 5C6WH 1FL5B 5ERWB 3S5LB 2FYYB 2VB5A 5BVPH 2O5YL 2AS5M 1OAKH 1IQDB 5KTEH 5DJYB 5A1AA 1NUFA 5EUKB 3TM6A 4PJ8B 4QNPF 3UTSB 3HPLA 4CRPA 3BP4A 1T2JA 4XVTL 2PO6B 3G5ZB 4EVNA 2ATPA 1PLGL 3BIKB 1HSBA 1NCWL 3K74B 2FB4L 1YQVL 4PJAA 3FAXA 3ARUA 3S36H 3IU4L 5ITBL 4NNPL 3MV7E 4Y4KC 3TNNA 3V0WL 3EOAA 1V3KA 5C0JB 4GQPH 1CE6A 1P6FA 4L8CA 1ZWIA 1FZMB 3IAPA 4XZUB 3ARVA 3SDAB 3VU2A 1OAYH 2G5RA 3QEQB 4Y5VC 1FV1B 2QSCH 1DQDL 3MBEB 4FHBD 3RRQA 3GMRA 2XG5A 4M6OH 3JTSA 4X6CB 4Z7WF 3K2UL 1U8IA 1AHWC 1RULH 2DWEA 1TVHA 4FFVC 4MMXC 3U36B 4M9OA 1RJZB 1SY6L 4K3JL 2PW2B 4GRMA 3V5DA 3C09B 4R96A 3BHBA 5KANG 2DTML 4X4XB 4ZO7A 1PQZA 3CXHJ 3MLUL 4P9HH 2GUOA 3EIFA 2YRZA 4J3SA 2ZNWA 2X89A 3IDJB 4XCCL 5JW4Q 1HINH 5I18L 1X9QA 1FYTE 5JNYB 3F6LA 4WNQB 2Y7QB 3O9WB 4PLKC 1BZQK 1WISA 1B3JA 2BNRA 1ZXQA 1G7LA 3QIUB 3FFCA 3ULUL 3DI3B 4NT6B 2VC2L 2A38A 5D1QB 3HNSH 3CFJB 3RAJH 5T33L 3W2DH 2C1OB 3I9GL 4WFHE 3W5MA 5E99H 2FX7L 2Z31B 4TUJB 5EH1A 4U6HA 4AEFA 3VH8B 1H3PL 2YD2A 1QQDA 4WWKA 4C4KT 3TCLB 4TNWK 1N64L 1FQ9C 5DEZA 4ZS7H 2VR9A 1YDPA 2XN9E 1TJHH 1MWAB 1MFBL 5ESAA 3ZKXC 2F5BL 1ORSA 5FYJE 4TYUA 1QPPA 3U7WL 3LIZL 1FN4B 2J5LB 1QFHA 2HJFB 2VZVA 5C0ND 4Y5YC 3RJQB 2X9YA 4HKJB 4GG8B 4N0UE 4JANB 1EK3A 1JPSH 5ADPH 5HYJB 4JB9H 2BOBA 1RK0B 4NO5A 5ILTL 3BQUA 5SWSE 1B2WH 1JRHI 1A2YA 1DUZB 3RWFB 4JCLA 1N0XH 1CF8L 2H41A 4NO2B 5ALCH 1QRNA 3GO1L 4BQCA 2NMSA 4JFPB 1ED3A 3WHXA 4HUUA 3NTCL 4PJEA 1I9JH 1E4WH 1JMZA 2W0PA 4OZHF 5JZ7C 2EDHA 2BDNH 3P0GB 4RMRA 1MIML 2R1WA 3O2DL 5TJWK 3FQRB 3FT3B 3OPZL 2VDPL 5FYKL 1EDQA 4OI8A 3KPNB 3FTGB 4M4PA 4DGYH 1W72H 4XPHH 1NMAL 4PB0H 3FRPA 4YXKH 4IEFB 4OLYL 1KPRB 4R3SB 1ZANH 1HIMH 3R06A 5GRJL 3KPLB 1YZZA 1SEQL 4OI9A 1BX2B 1MI5B 3TBWA 4JG0H 3RIAK 2ZUTA 4B41A 4QXGH 1GC1H 4GKZA 5GGTA 3V6OE 4MYWB 5I1JH 2JKXA 1BVKB 3VRLE 5GSVA 4GMSH 1KCVL 3RWJB 3ROOA 4F58L 3MRIA 3WN5C 1S7WB 3S37L 2DD8L 2YBRB 4RGNB 4P59L 3UBXA 3KLDA 5J6GB 1WBXA 4PRHE 1GZQA 5HDOA 5GGTL 1CR9L 1AR1C 4UT9H 3WNNA 3FB6B 3SDDC 3C6LC 5JW4R 1RK1B 3VFSB 1WZMA 1NMBL 1XCTB 3MXVH 4LSRL 3ZDYF 1I9IL 3SKOA 3CVHA 2ADGA 4JLRA 2AK1H 4MWFA 4WTXA 3Q3GB 1AFVH 1G7IA 5HHNA 1LO0L 3NOIA 1NUGA 1Y18B 3SOBH 4AQ1B 1ZE3C 4MAYD 5AD0A 4KK8C 4NO0D 3N9GL 1TETL 4PYGA 5FCUL 4WHTA 2NNAB 2F53E 3CVHL 1H15B 1V7NH 2IQ9H 4H25B 3SN6N 3WSQH 4I3RL 3RIFF 1OLZA 5EO0A 1IRAY 3MX0A 2Q7YA 1FG9C 3BGFC 2EYRB 5E5UB 3U2SA 2JLLA 1B6DA 5TQ2H 1IGFL 4JQIH 3P0YL 4XPBL 5HYQB 1DFBL 3AC0A 4A6YH 2PYEA 2CLVB 3MSPA 3MLTA 3OWEA 1L7TH 3BZ4B 4KGJA 1YEGL 4XVSH 3MRBA 2HWZH 1YNKH 4KK6C 4XBPB 4QOKA 1XF4B 4HWUA 2XT1B 4JFDB 1MCJA 3L5IA 2GTZA 2NX5D 2YK1L 3WLWC 5MEQB 3U0TB 1HWHB 4AL8L 2NR6D 4D3CH 3AU1A 5FYKD 3I02A 2E7LA 1IZKA 1E28A 3BGMA 3D25B 3GHBH 3L7FB 3LHPH 2FHBA 4P57A 4JY6A 3HC0B 2FJHA 4PPTA 3ZLQC 1L0QA 2ITCB 4M1GL 1KJMA 4PJBE 3RHWK 2K7PA 2RR3A 3X11B 2FO4B 2RJMA 2QHRL 1RI8A 2QJDA 3VFOB 4ONOA 1O0VA 3L95A 4M5YH 2GW5A 2H8PB 5EZIH 4JHAH 2HT2D 4CDGC 5SV3A 1YN7A 1SYVB 2F19H 5CJOH 5DUPH 1QKZH 1YN6A 4YQXL 3L3HB 5L2JA 3MFFB 1D7FA 3Q5TA 3D0VA 4XX1E 2P7TB 1JGEA 4G5ZH 5FYLH 3BP7A 3PABA 4IRJA 3SDCD 1VFOA 4KMTL 5EULV 1FP5A 4IOIA 3MMEA 2FGWH 3DXAA 2ZCKH 4EI6A 3QHZH 3MZTA 2Q8AH 3CU7A 2OTPA 1C5DA 1HNGA 3HNTH 1J05B 5DF0A 5GRUH 1A1MB 3QWQB 1DQJB 1T5WB 4OTXL 1NBYA 4YDVA 4Z7NF 1TMCB 3BFOA 3UDWA 4EDWH 1LK3H 1RZJH 1LDSA 3KPRD 5C0GA 2NY6D 2MCPH 4QHLA 3FHAA 4X9HA 5JHLL 4JGJA 1AGCA 1GGTA 4TQEH 3D3VA 3P2TA 4RBPH 1RAMA 4HWZB 5A43C 1KT2A 5DRZB 1I1AD 4GXVH 4BSJA 4N68A 2ICWI 5D9SA 2R2EA 1CXLA 2VXSL 2X4QA 5C71A 4CVXA 2G75B 3D18B 2EH7L 1CGUA 1Q0XH 2J8UB 35C8L 1GIGL 4LDEB 5JIKA 1XIWC 2EYTB 2QTEA 5E5MA 5DFWH 1BVZA 1NAKL 3ZDZF 3VXUB 2Q87A 1BFOA 3C6SA 1ZVSB 1RUAH 1E6OH 4NN6B 4O00A 5E8PB 3BKMH 4CN1A 4XNYH 1ZGLM 3VGAC 3SGEI 2ED7A 5DHXB 4O2EA 1MUJA 3PHQA 3HPLB 3BP4B 4FZEH 2ATPB 1UH4A 1HSBB 4O9HH 1CTOA 4PJAB 3CVIL 4XVUD 2GEEA 3BT2H 3TNNB 2DQUL 1C1EH 3EOAB 4UTAL 4LCYA 3K46A 3VFGH 1CE6B 1N0LA 4KY1H 4L8CB 1JFQL 4WUKL 3HE7D 3SE9H 4YIQA 1ZWIB 1YMMD 5A2LH 3MJ6A 4OSUL 1ERNA 3FO1A 4LEXL 1A6WL 5GZNC 2DIJA 5FUZH 4XP1L 3GMRB 1VDGA 4LKCA 3FMGH 3JTSB 1EJOL 2ERJC 1CLZL 3MV9A 5D2NC 4Q9RH 4RISH 2DWEB 4NKIL 1TVHB 3P4NA 3ARZA 1FRGL 4QY8A 4JPVL 1V5JA 2NY2B 4GRMB 3V5DB 3VMOA 4XBGA 1PG7L 4R96B 4XAKE 2MCG1 1YYLL 3BHBB 1ZLWH 3HHRB 4IRSC 5EBLA 3PL6C 4ZUWB 1AQDA 1GYAA 1PQZB 2DQEH 5EZOL 1WWAX 3V4UL 5C7XL 2GUOB 2IEPA 4LLMA 5LGHH 1ND0A 4U6YA 4FS0A 2BNRB 4HSQA 4PJXE 5HHPA 1G7LB 2W9DL 3FFCB 1DQLL 2F8XC 2E27L 2CRYA 5E9DA 2ED9A 5I1IH 2FX8H 5HHVL 1OTUD 4NGHL 3R8BB 4APQD 5BV7H 4I3SH 1QR1A 4L3EA 5ACLA 3OKMA 1KCRH 3IRZA 3EAKA 3C6LA 2Y36H 4I0PC 3PIQA 1CICA 4U6HB 4UB0H 4ZTPL 5IIEA 5L88H 1QQDB 4WWKB 2VAAA 4LASL 4JRYD 3QXTA 1WAAE 1YDPB 2MWCA 4N0YH 3HS0A 3ARDD 5ESAB 5BMFH 1JYVA 1T04A 1QFPA 4GW4A 4UV4H 4P46C 4R0LA 1J86A 5SV4A 5TE4L 5C07D 3BUYA 2NY7L 4P2CG 2DF3A 2GJ6E 3TA3D 4O2FA 1IL1A 1UA6H 1S7QA 2BOBB 2YA0A 4NO5B 5D1ZD 4L3AA 3SDXE 5BCAA 1A4JA 1IGMH 3LS5H 1NDGA 5JOEA 1BWWA 1A2YB 3IS0X 3DHMA 5CBEA 2W9LA 3VFUA 1ZKAA 1QRNB 1EZVY 2R2HA 5C0RH 3IFNL 1ED3B 3WHXB 4HUUB 4PJEB 1T1YA 5CSBA 4BKLA 1KELH 4FQXC 2C3XA 2X1PA 1QSFA 3VWKC 1T0MA 4K94H 1E4XL 2FHCA 1UACH 5CGTA 1T1XB 3LSOA 2R1WB 2B5IB 2OXHA 4S1DC 3C2AL 3DNKA 1Z0NA 3DSFL 5GGVY 4KUCF 1A8JH 3NPZB 3S35X 5E70A 4XCFL 2I07A 1AP2A 3GFUA 1MRFH 4LVHC 4Z7VE 3JWDH 1EJ6A 1XGQA 3OTTA 1IGYA 1BHGA 1L0XA 3R06B 1NFDE 4G6FB 1FO0A 4KDVA 4OB5H 2CJUH 3TBWB 3G6DH 2IAND 4TPRH 3FO9A 4ZTOH 1SBSH 4GKZB 5KS9E 5HVFB 4FFZH 1IGJA 3D39A 1A6ZB 3HG1D 2XTJC 3ROOB 4X99A 1VFAA 3F7VB 1MRDH 3MRKA 2F5AH 2NXYB 1FO0L 3MRIB 1D3CA 2P8MA 3O6FA 1DBAH 5CFHA 3GSXA 3D9AL 3UBXB 1WBXB 5D1XC 1GZQB 2VL5A 2AGJL 1PY4A 3CIQA 5I30L 3DMMD 1AGFB 4RA0C 4MNHA 3SKOB 5EO1B 3CVHB 2ADGB 4JLRB 4MWFB 3BJLA 3RUGF 1G7IB 5HHNB 1UWEL 4JN1L 4XNUH 2CIKA 5C0AD 5DURD 3MLZH 4AYFA 2ORBH 5AD0B 2CKBA 3LDBC 5F8RC 2DQCL 1HH6A 1JF1A 4WHTB 5F88B 4QRRD 4YGVA 3GGWA 2ZG1A 3OQ3B 3RU8H 4HW6A 5EO0B 5T1DH 2Q7YB 4RSVA 4Y88A 3RWCA 3THMH 1DBMH 5JHDE 4YWGL 3U48A 5A2IH 3U2SB 4PLJC 1P84J 1GHFL 2CKBL 1UCBH 4WI6A 5F1KC 5ANMA 2PYEB 2NY4C 4GW5A 3VWJA 3BRGC 4KROC 1NMCC 3MLTB 2WLZA 5HHOD 4KUZL 1NCAH 5DMIL 3MRBB 5EU6A 3IYLW 3K1KC 2YUWA 2XICA 4QOKB 2BNQD 3MLXH 2BSED 4EN3C 4DTGL 2GTZB 4FQPA 4MNQE 4S10A 1S7XA 4W4OC 1DVFC 4BZ1L 3QQ4A 4KJWD 3QCTH 1A22B 1XF1A 5FO8A 2D2OA 1EFXA 1FH5L 2FECI 3BGMB 1NLBL 4E41E 5DJAA 2OI9C 4IJ3C 3RI5K 3QPXL 3U46A 1X5JA 4JY6B 4JPKL 3REWA 2FJHB 5EC1A 5HGBA 4HMDA 1CQYA 5T1MA 1KJMB 4I0CC 1JRHL 3EYUH 2UYLA 3UAJD 4HIXL 3QXAA 2GK0A 1MNUH 2FR4A 4D9QE 3L95B 4HUVA 3L5XH 2HLFD 2YZ1A 3AM8A 4LBEA 1FAIL 3RGHA 4U33A 1YN7B 1I3GL 2AVGA 4DKAA 4XNXL 1YN6B 2H45A 3LKNA 5L2JB 3D0VB 3DUHA 1JGEB 3MUHL 1XZ0A 1FJ1A 3VGDA 3BP7B 3LPGA 3PABB 4IRJB 4J7RA 4GRWF 1H3UA 3MMEB 1HQ4A 4EI6B 2MFNA 5H37G 4XWOD 1EXUA 1C5DB 4JRXE 5KSVA 2ICCA 3JVGC 4HJJH 3ZYZA 1Y6KR 1HKFA 3I85A 4N5ED 2ZSVA 1CFBA 1UQSA 1NBYB 3G04B 4LSPH 4YDVB 5HSFA 1A7QH 5DYOA 1ZT7B 1MCPH 3P73A 12E8L 4QHLB 3MXWL 1I9RH 2JB6A 1AGCB 4UTBL 3D3VB 1HXYA 4TVPH 4UT7H 1FIEA 2A74A 1FCCA 5EORL 2R0LH 1LO5A 5BXFA 4JFEE 4I0PA 1KT2B 2FEEI 4MDIA 4JRWA 3RL2A 4XCYA 2P5EA 3E1F1 5D9SB 2DB8A 5DMJB 2VXVL 2R2EB 3KVQA 1JYNA 3N06B 1TFHA 2X4QB 1I3VA 1LVEA 4CVXB 4OGYH 3L3JB 5D70H 4FABH 5CCKH 1U36A 5I1KL 3BKJH 5E5MB 4OKVA 1NC2A 4P46A 1BFOB 3C6SB 1NDMA 1VFBA 3U4BH 3GMLA 4Y4HD 25C8H 5KJRL 1NLDL 3SE4C 4Y5YB 1X44A 4O2EB 1DBKH 1MUJB 3PHQB 4WEBL 1K8IA 5I16A 2MPAL 3G6AA 1IAII 5CP3A 3O4LD 5F9AC 3H42H 2B39A 4BSWA 1MLBA 4OF3A 4QTIH 1JZ2A 1QTYT 4YIQB 2VDQL 3RVUD 4UINL 5CIPA 3FO1B 2XKUA 3PWJA 4D2NA 3BSZL 3MV9B 3MJ9A 3JV5A 1CBVL 4QRPD 3P4NB 4HLJA 5IGXL 4QY8B 4NQUA 5D7JD 2NXZD 2I27N 1N4XL 4Y8AA 5JR1H 4XBGB 2DKMA 5BO1H 5EBLB 3WFHA 4AG4L 3MGOA 4YUEH 1X4XA 3P11L 1RZ7L 5FK9A 3MJ9L 3S4SG 1NBVL 3WIHL 3L9RA 2C1PA 1DBJL 2YXFA 3PWVA 4RMWA 2NTFA 4LLMB 4FOMA 4U6YB 5C8JB 1KC5L 3KLAA 1HYRC 2AJXL 1L7IL 2QKIA 1F4YH 4BYHA 1BD2A 3T0BA 3K0WA 5E9DB 1NEUA 3SDYH 3WO4B 4G8GE 1F3DJ 5D1XA 2IPKA 1PAMA 3MA9L 3EYOA 5D7IA 3O2WL 5FYLD 3SJVE 2ARWA 4L3EB 1QR1B 3OKMB 1YEFH 3C6LB 3PIQB 1CICB 1PKQE 1F00I 3P3YA 3IDYB 4F9PC 2IBGA 5IIEB 3MJGX 1JWUA 1RUPH 3KJ6L 4G8EA 5B21A 2VAAB 1WCQA 1TCMA 2VOTA 4Z7UA 3C08L 1WF5A 3MRMA 1Q94A 1LD9A 1AKJA 1V7MH 4EI5D 1T04B 2IBZX 4GW4B 2B1HL 1P4IL 3DRQA 1EEYA 1A14H 1BVLA 3BZFA 4R0LB 1U6AH 4F15B 3WMSA 1FC2D 2AABH 3BUYB 3QUYA 4HIIA 1DANT 4PREA 3ZKNC 4O2FB 5ITFA 1IL1B 5T1KD 1S7QB 5B3JF 3BPNC 3KNBA 5GHWH 1IM3A 1A4JB 2G60L 1NDGB 1TJIL 3IFOA 1TQCB 1R0AL 3CLEH 4LOUD 5IHUH 5CBEB 3KR3L 3VFUB 3VXSD 1XGYL 1BWMA 2R2HB 5E1AA 3GSNL 3HMWL 4HWNA 4X80L 1JIBA 3VXPA 4WUUB 3INUH 5KW9L 1T1YB 4BKLB 1RY7B 4XVJH 1QSFB 1T0MB 2Z35A 1N5YL 1JPTL 3QWRA 4MS8C 4EN3A 4RGMC 5JA9A 4HPOH 1MHHA 1T7YA 1V3LA 4W4OA 1BQSA 2DYPA 3LSOB 4KZDH 1DVFA 3H3PH 1ZMYA 3F7YA 1QG3A 5JPMA 3VFPA 1JN6B 4X7SL 1UM5H 1XCQA 3ZZ1A 4U49A 4XMLH 5JW3H 4I9WD 3CFIC 3AGVA 3IFLL 4BQ8A 2I07B 4F37K 1MPAH 1AP2B 2CDGA 5F96L 3O6KL 1XGQB 3HUJF 4KK9D 3T09A 3VFTB 1IGYB 3MLSH 1R5VA 1JGLH 2ZCLH 1JHTA 4EQ3A 5KVGL 3MLYH 4WO4A 2VUOA 5IB5B 4BZ2L 5DMGD 5I1LA 2A6JA 3VFMA 2HG5A 1PG7X 4DWHA 2A9ML 5LKNA 3FO9B 2VO5A 3DX7A 5EOCH 3ESVF 2E8ZA 4WW2C 1IAIM 1IGJB 5TDNA 3D39B 4ODTL 4KDTA 4X99B 2IH1A 1VFAB 3MRKB 5EFIA 3B4NA 2R2CA 2P8MB 3O6FB 3ZYIA 3GSXB 5HYSG 5DZOA 1P7KA 4YPGA 4P3CH 4PJFA 2VL5B 1MCCA 4PJ7A 3MJ7A 5EOQL 4WHCA 3MBXH 2H1PH 5TE6H 4BSVA 1LO3H 1DDHA 4MNHB 1A6TB 4PGZA 3CLFL 5JA8B 3L3DA 4XPGH 4M6AA 3IDXH 4U4BA 2HT2C 4I2XA 2XACC 5BS0E 2X1WL 2R69H 5HVWA 3C5ZC 1J8KA 1E6JL 2CIKB 1MVUA 1FPTH 5AZ2H 5J06A 4GRLC 4YHMH 3SDCC 4PGDA 5IVXA 1JF1B 1HH6B 1VEMA 3SCMD 3MQIA 3GGWB 1RMFL 1M05A 2B4CH 4FQ2H 2QQLH 3O4OB 3EOYG 3RWCB 4UT6L 1VESA 2CK2A 2QQKH 3WXVH 5ANMB 2XYCA 5EUOF 8FABA 1JPGA 1EBAA 1QVOA 4GW5B 4N1HB 3VWJB 4ZS6D 4NZUL 1F6AA 1G9MH 2NY6C 4JO3H 3VGAB 3VDBA 3F58L 1OLLA 2DL9A 5EU6B 3RVVD 5K9QG 1K3IA 4JM2D 1G6RA 4R97C 1OAXL 3GSOA 4WHYG 4K7PX 1I1AC 4NZTH 1S7XB 4QGYA 3MRFA 5FHBL 2V5MA 4XP9H 3QQ4B 4TUKH 4NQDE 5FO8B 1FL3A 1LE5A 4NC1C 5D5MA 5ESVA 1EFXB 5CKAA 3QCVH 1G6RL 1RZFH 5CEZH 2WLYA 5DJAB 5IHLB 3U46B 1A64A 5A2FA 4HS6A 1X3DA 3REWB 2DQTH 5HGBB 5EC1B 3CK0L 5CUSL 3K8KA 4ZSOA 4UMGA 3OB0K 3B8YA 3HMXH 5T1MB 2ERJB 3IETA 3N85L 2UYLB 4M7JH 2F58H 1LDPH 3QXAB 2GK0B 4YXLH 4NJAL 2FR4B 5DHYA 4HUVB 4XVUC 4LBEB 3D5OF 4LIQH 3V4PH 2AK4A 4RX4A 4K2UL 3LKNB 5EZJA 3HE7C 5DD0H 1S9XA 5F7HA 3OAZH 5T3XE 1IGCH 1XZ0B 1FJ1B 5D7LA 5EU7C 4YC2C 2NY0D 2GJZA 1HQ4B 5TDPB 5KVEL 1EXUB 4XPTL 4ALAL 1KCKA 2QV2A 2EDQA 4G3YH 5KSVB 2JIXD 1L9NA 4OF5A 2WW8A 2VH5H 3DGGA 1UQSB 3QJFA 1IGIL 3LH2H 5DYOB 3SE3A 3MGAA 3P73B 4C56E 1S7SA 4GMTL 4NJ9L 4N1EA 4OGZA 4MNGA 2A74B 5LGJA 5KN5A 2XV6B 1QSED 5IFJA 1LO5B 5AAWA 4I0PB 5FGBC 3KYOA 4MDIB 3RL2B 4L4TD 4XCYB 5LCVH 2P5EB 4F9PA 4HG4K 5FB8A 5I6XC 4DW2L 3G9AB 5TGBA 2E7CA 3CDCA 2Y5TA 3W0WE 4WEUD 4OIBA 3EFDL 4GAJH 4O58H 1CXHA 4OKVB 1NC2B 4P46B 3CSPA 1NDMB 1VFBB 1MHPL 3GMLB 4U0QB 3NCEB 4PRPE 1KN2H 1OTUC 5FUOH 2JK5A 4PD4K 1HNFA 1K8IB 5I16B 3G6AB 4I77H 4Z0BL 2F54E 1TDQA 3S5LG 2YD5A 3E6HA 2AXJA 1T0PB 5BRZA 2P5WE 2R1YA 4Q2ZA 3TYFA 4BSWB 1MLBB 4YAQA 3MR9A 4BFBD 3MACL 4HZLA 3ZHDA 3MRLA 4OZFG 4FFYL 4RGOH 1CGSL 3MV8A 5JOPD 3P4OA 3ARDC 1REIA 5CIPB 2DDQH 2VDRH 3VWKB 3PWJB 4P99A 1DQTA 4XGZA 2R8SL 5FDWA 4Z8FL 1EAPA 3TA3C 3LEVL 4N0CD 1HK6A 1IJ9A 4EUPA 4HIEA 5D1ZC 5CGMA 2J6EA 5GSRA 1OPGH 3SPVA 4W6XB 2XZAH 3FRUB 4BFGA 2E6JA 2KKQA 3RZCD 3HZVA 1HI6A 4LCIL 3MGOB 3WFHB 4HV8A 3QIWD 4ZNEA 5FK9B 2EKJA 1ZHBA 3L9RB 4KJYA 2C1PB 4WY7H 4JJHA 4FN0A 4A2LA 2J6EL 3H9SA 3TT3L 3CD4A 3PWVB 2NTFB 4IHOA 5CEZE 1BGXH 2FECL 3I50H 3QUMH 1UM6L 5C08D 2NY5H 3LEXA 5GGVH 1A5FH 1QBLH 3V4VH 4AEIH 3KLAB 4WW2A 2QKIB 1BD2B 3JWOH 1UEMA 2DJ4A 4FP8L 5D7SL 2N7AA 4LEOA 4N90D 4NM4L 1QACA 4OGXL 2I60L 2OMNA 4NYLA 4PJIB 5AG8A 3CFEA 3QQ9D 4Q7DA 5JQ6H 3PV6A 5D1XB 2IPKB 3EYOB 5D7IB 4RMVA 3GI8H 2B1AL 4WCYH 3L6FB 2WV3A 3MO1A 5C0CD 15C8L 4LVNC 4X6BA 4UAOB 1JWUB 4G8EB 2EEDA 3ULVE 1MEXH 3C5ZA 4Z7UB 3L5HA 3HR6A 2VLRA 3MRMB 1Q94B 1R3JA 3T04D 1LD9B 4FTVD 1AKJB 1A6UL 4GRLA 5L9DL 2A77H 3DRQB 4NM8L 3MYZA 5DJXA 3BZFB 4LU5H 4RMSA 3FKUS 1C5CH 3QUYB 4HIIB 3GMOB 4PREB 5ITFB 4TVPD 4P9HC 5HHMD 3DMMC 2AW2A 3KNBB 5F70A 4ZFZA 5L8LB 4KXZH 1IM3B 1U8QA 1JZ5A 3PWPD 4O4YH 3SQOH 5FM5M 1KIUA 4TSCL 1IGTA 32C2A 4HEME 4YEEA 5HDBF 1OGAD 4DFHA 4EZMA 3RDTD 2V9TA 2FEEL 5E1AB 3D85A 4W6YB 5TFSL 3VXPB 3MYJA 4LDOB 2NYYD 5IBTH 2VN7A 3O3BA 1ZLUH 4X6CF 1H8SA 2Z35B 4QRUA 4P2RA 4EN3B 1RIUH 4HT1L 3JV0A 2GK2A 2H2SD 3TGXA 3ZT5A 1MHHB 4ZFOA 4DKFH 1DVFB 5C2BL 3WFBL 4ETYA 3QIBA 5JPMB 2GCYA 4QKXB 1XCQB 3LZFH 1NCDH 4NQCE 2OI9B 4IJ3B 5E7FA 1IAIL 2L4OA 2CDGB 5GGQL 3T3PF 3MOBH 4HWBL 1NCNA 1Q0YL 3NH7L 1RFDL 1FFRA 1R5VB 3O3AB 3GSVA 2ZKHH 1JHTB 3MV7A 4Z7QF 3RWEB 2EE9A 3QEGH 4WO4B 1QHOA 2AJSH 5I1LB 2A6JB 3VFMB 4H0GA 2HG5B 2N7BA 4P3WA 2ZOKA 4Z76A 4M43L 2JTDA 3DX7B 3FQWA 4PR5A 5I73C 2VDMH 3DVFA 3EO9L 3M17A 4FZ8L 3U6RA 4ODUA 5TDNB 2IH1B 1TJGL 2VLME 4KPHH 4LRNH 1A1NA 1BF8A 4LSUH 3IJSA 4JHWH 5AWNL 5C0BD 1S5IL 1CE1H 1P7KB 4RMTA 2FZ3A 4YPGB 1U9KA 4PJFB 3TV3H 1YJDL 2CD0A 4PJ7B 3UAJC 2EDEA 3MJ7B 2FJGA 4XPFL 4BSVB 1CCZA 1DDHB 4TSAL 1FE8L 4JEGB 3L3DB 3B9KD 2HLFC 3S97C 3L5WA 3V5KA 2YMXH 4GS7B 4U1LB 5IW1A 2WINA 4I2XB 2YS4A 4Z78A 4Y2DA 4LLDB 1KGCE 2ILLA 1KTDA 4QWWD 1MVUB 1VPOL 1FYTA 4PGDB 1UZ6F 3WJJA 5IVXB 1K8DA 2Q76B 1NCCL 4WRLA 5EA0H 2OP4L 5EBGA 1JGUL 1KB5A 4HDIA 3D69A 3TO4D 3CDGA 3E3QE 1M05B 2NZ9C 4S1QL 4OLWH 4OIIH 1U8PA 2XZCL 3RY4A 3FN9A 4GRWH 5D7KE 4N5EC 1UWGH 2J4WH 3VFWA 4QXUH 1ZVYA 2C3WA 8FABB 1JPGB 1QVOB 3QDJD 5IQ7L 4E0RA 5EIVA 4UILL 1KB5L 4RQQA 1WFUA 1F6AB 3IDGA 3BPOC 1HILB 1D5IH 4ZO9A 5ICZA 1J1XH 3F6IA 3VXUE 4HF5H 3GSOB 5HDQL 1MHEA 2YD7A 3GBNL 1CDJA 3IU3A 4PP2A 2XN9A 3HC4L 3MRFB 4QTHA 3LRHA 2NY3B 4HC1L 4IRZH 4K71B 1A7RH 5MEOA 3MREA 1FL3B 1LE5B 5D5MB 5ESVB 5ICYA 4ZOCA 4N8VA 4PY8J 5IT2H 4N0UA 5GRVK 3TZVC 4HS6B 4XP6L 4H8WL 4JGUA 4Y4HC 2HT4C 4ZSOB 4Q74A 4L8SC 4K3EL 2OJEA 3IAGC 3IETB 5SWSA 4XAWL 3CXDL 2L0DA 1ZSDB 3QG7H 2VTFA 5DJ8A 5DHYB 3AVEA 3I2CH 2XQYG 2AK4B 4WDIA 1KJ2L 2HKFL 5EZJB 5CHNA 1JF6A 5ETUA 4DAGL 4MAUH 5D7LB 4GQ9H 2MNUA 4PJ5D 3LRGA 1MY5A 5C0IB 1E4KA 2GJZB 1JGVH 2W60A 1CK0H 4JFXA 3M45A 3MODH 3U1SL 4JFZL 1HN1A 2HT3D 1ZTXL 4IMLA 3DGGB 2WK2A 2NXZC 3IT8D 3TNMA 4RNRA 3QJFB 3QZWG 1CZ8H 4R2GB 4PJCF 3AMLA 3DV6B 1S7SB 2I5YL 3EOBA 2WIIA 1MY7A 3DVNA 4X0KA 4HGKC 4DGVL 4MNGB 4NRZA 3SGKC 5H37H 1S9WB 5LGJB 5KN5B 4U1MA 5IFJB 4H1LG 3UC0H 3KYOB 4IIQA 1ONQB 4CMMA 2LTQB 3TT1L 1BBDL 1WC7A 1TVDA 3NFNA 1I85C 5TGBB 4D8PA 1SYSA<