2M26A

Nmr structure of the c-terminal domain of the protein hcfc1 from mus musculus
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
126
structure length
126
Chain Sequence
GCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQASGEPKSSTPAQLAFMRVYCGPSPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWLQETSKDSSGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HCF C-terminal chain 1
publication title NMR structure of the C-terminal domain of the protein HCFC1 from Mus musculus
rcsb
source organism Mus musculus
molecule tags Cell cycle
total genus 10
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2012-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2m26A01
5ADOL 1J1PL 3CVHL 3QDJD 3EZ8A 2Q3ZA 1RUPH 3RUGB 4LU5H 4X9HA 3OXSA 1I8LC 4HF5L 2CXGA 1LK3L 1MIEL 1M6OB 4JFYA 3H3PL 3SQOH 1Q9LB 5KOMC 5DRWA 1YEKH 4WW2C 1WZKA 2C5DC 4YC2C 2E6PA 4PJ9D 3F62A 1CK0H 3OSKA 3VFMB 4PJHF 1NMAH 3SGEH 1G9NL 3U30C 5CUSH 4QF1A 3U6RB 1IKFL 1P7HL 3R0MA 3TT3L 4ELME 1OWRM 3I50H 4LLDB 1PG7X 1OGTB 4JRWA 1KUMA 2HFFA 1HKLH 1P7KA 3U4EA 4M8QA 5CEYA 4HZLB 3V7MA 1RZKH 4GKZB 1TQCB 3QULA 4K3DL 3QDGB 4MA3A 4JB9H 3GSWB 5F9WB 2AK1L 2UY6A 1ZLUK 2X1PA 3MNWA 2A9NH 3ARBB 2XZAL 3O6MH 1WF5A 4LQFH 3WIFB 1XCTB 5EWIH 4CU8A 3MJ9A 4F2MA 4K94C 4CNIA 4N0YH 3T09A 4P5MA 5J3HC 4I2XB 4ZSOE 1NAMH 2OL3A 4QYOB 5HXMA 3OHXA 3RGVD 5DHVB 1CDJA 4RZCA 3U4AA 3C87A 3OR6A 3F7VA 1DFBL 5HYSB 1IC4H 1P2CB 3WJJC 2A6IB 3DJ9A 3PP3K 3QCUL 3WIHH 4PJAB 5SX4I 1DP0A 2Q8BL 5F72S 1QSED 3F5WA 4XP6L 5CSZA 3RWGA 1A9EA 1VGKB 4X6BB 5HPMA 3OMZA 4ONOA 3NA9L 4CDGC 4Z78A 3O6FC 1LD9B 4TQEL 4IRSA 1S9VA 3UTSB 2F8XC 3STZB 3S36L 5T1KD 3TCLA 3BIKB 4WW2A 5DA4A 3SDAA 3RTQB 2IPUK 3TA3B 1EEUA 3GNMH 2IPTL 1KCKA 3BDYH 1FYTB 3QUMB 3CFBA 2NCMA 3N1GC 4OZFA 2MQ3A 2DD8H 1WTLA 4ZFFA 4FZ8H 1KYOK 3OAZH 1ZT7A 3ARFC 3GSUA 3MBEB 3LKQA 3BWUC 3QR2A 4OLYL 1PDKA 3HPLB 4UQ2A 5FA3A 4U7MA 3LRSB 5FF6A 5HHPA 2XWJB 4JFZH 4ZS6C 3DI2B 5H35B 1ZGLP 3LVEA 2X4UB 3BPCB 3K7UA 5ISZE 4OFKA 4RGNB 2B4CC 1NJ9B 2CGRH 3BO8B 4HJJL 4OSUH 3G5XB 3I9GH 4YHLH 3F6LA 3X3GL 1ITCA 1CLYH 3FAXA 2BCKB 1DQDL 4HIHB 2EC8A 4LHJB 2QTEA 4JFDE 1JIBA 2DKSA 5JNYA 3TO4D 3QRGH 4AH2B 1SEQL 1UWEL 4JPVH 4L5FL 3NBNA 3WJJA 5HGGS 5HHMB 3VXMA 1AE6L 4XRCB 4WCYH 1AGBB 1L4IA 3KPMA 1B6UA 4JAMA 1XF4B 1FE8L 2A74B 2I9TA 4OFYA 1ZANL 2W0KA 3A6BH 1U8LB 3RY6C 5DQDH 1IQWL 4HIEA 5GGTH 4K8RC 1UWGL 3O6FA 4YZFF 1PG7L 4YHPB 3BP5B 2JTDA 5CEXA 4HUVA 2M1KA 1QRND 1F02I 4XAKD 1F00I 4PTUA 2YD2A 2GT9A 2GFBA 4WHYH 4XNZC 5DJAA 1I7TA 4HBQA 4U0RB 3VDBA 2LVEA 4G9DA 1U0QA 1TZGL 3KLHC 4DJMA 3VWKB 4MSWA 3DBXA 4DKEH 1VESA 4DCQB 3ARFA 2IGFH 4QOKD 4AJ0A 3GHEL 5M94B 4RX4A 4KJQC 1FVDB 1RAMA 2FNBA 1A6TA 5HHQA 5D7IA 4DN4H 1H3WM 4L4VD 2RIKA 2VYRE 2EH7L 4O4YL 1DBBH 4XCCH 4HKJB 5HDBF 1XR9A 1A9BB 4XPGH 4HGWA 5EU7C 1FLRL 1UXSA 2AK4A 5GGUB 5GRWA 4MVBD 4J3XA 2KH2B 2DM3A 3PXJA 4WVRA 3NPZB 4BKLA 2NX5B 4TSAL 1J9CT 1WAAA 1SYVA 2ITCB 3BZFA 4M6MH 3K8LA 3BMWA 5FCUL 1X6NA 2K7QA 2GUOA 2AXFB 3QXWA 1YC7A 3DETD 5IMOA 1K5NA 3BKJL 3GMNB 4ZTPL 3LCYA 4NJ9H 2O5XL 2AEQL 3BEWB 1UXWA 5BVJA 3CC5B 4MAYD 1JHTA 4JRYB 4C83A 3ARYA 1GGIH 1F90H 1JPFA 1MF2H 1RZ8B 1ORQB 2Q76A 4OTXH 4J4PA 5D9SA 1A4JA 1TXKA 5DMIL 3KLAA 5F8QC 2X9YA 3FB7B 4UDUB 4MNHB 3BQUD 1VEPA 3HC3H 4LLQB 4JO1L 5EBGA 3UEZA 3S4SG 4QRTA 3VD3A 4RMUA 3CFEA 4YBLB 2VXQH 2MCPH 2F19L 4MJ2A 3EFFA 1CLZH 1CDYA 5ETUA 1MY5A 4WI4A 1PLGL 4FQQA 4YXHL 2EZ0D 3KNBA 5IJVB 4UT6L 3TCXA 4YFLF 3QCTL 4M48L 2DQFB 4MS8C 4H88L 3VGGA 1UWXH 3WXWL 4Z0XA 3VXPB 5E5MB 3K4AA 5IV2A 1W0VB 2OX5A 3I85A 2BVQA 4HAFA 4XCEA 1IT9H 1EH9A 2ZPKH 1BMGA 1KJVA 1WC7A 3QEGL 1ZHKB 2D7OA 5J6HB 3QA3B 3MLXL 1D5XB 3R06A 4Y5XB 3QQ3A 1C5DB 2Z4QB 1SJEA 4P59L 43CAA 5AD0A 2FO4A 4QWWC 3EO1A 4PLJD 3DRTB 2NLJB 1MPAL 2PR4L 4HWZA 5M7QA 2NY5H 3BZDA 4QXTB 2IBZX 5C07E 2YPVH 4FQHB 4YDVB 2HFEB 3WKNA 4CW1A 4P2RB 4N0CD 4KQ4H 1TNNA 1VCAA 1CI5A 3W5NA 3L5IA 3ROOB 4WJ5A 2D03L 4ORZC 5IVXA 1BFVL 3GJEA 4XI5D 1GXEA 1QLEH 5D72L 4K3GA 4S2SB 1LO2L 5FOBB 4X4YA 3IJHA 4N8VB 3HNTL 4HC1L 2VLKD 4F8QA 2F53D 5A2LH 3HCVA 3MCKA 2FX7L 4C58B 4Y16C 2WV3A 3NGBC 1NAMB 3HZYB 3OR7A 4H0IA 1EBPA 3FQWB 5ADOH 4MXVF 5JIHA 1J1PH 3CVHH 3SGJA 2FYYA 1CLCA 5DDHB 5JOPE 3VXME 4JFEB 2J5LC 1IAIM 2FLRT 4HF5H 2H2SD 3CUPA 1LK3H 1MIEH 4R0LC 4IRJB 3W9EB 3H3PH 4R4NC 1FNGA 1OM3L 3WEXA 4EUPB 2O61A 3NZ8A 2BOCA 4GKOA 4HKZB 4X5LA 3BEVB 3JBG7 4YO0B 1G9NH 4QTHB 3W81A 3VFRA 4JLRB 5JOFB 4IIQA 2DI8A 1IKFH 5HI5D 4LGPB 3TT3H 5ICZA 2ZUYA 4FMKA 4ZUSA 2RBLA 5GS1B 4HXBL 1GPOL 1ZLUH 2MKLC 1G7LB 1JV5B 1JNHA 1SMOA 2GK0B 2GSGA 4HWBA 1AJ7L 5IHBA 1EHAA 4XMPL 1K8IA 5E94B 4O2FA 4K3DH 4IHOA 3FZUC 5EUOB 2FWOA 4MQSB 4HS6A 5D7IE 1ORSB 2AK1H 2FSEA 4QRPD 1KTLB 2Z92A 2XZAH 2V2WA 4KKAD 4QT5B 1HH9B 1V3KA 4YGAB 3HE7D 4M62L 4ZUVA 3VD9A 5CGYD 4LLWA 3RWDB 2A6KA 3FHAA 2NY3C 1MCQA 1W0WB 5LQBL 3L3OA 4X5WB 3PP3H 4X6DA 2JJUA 3UPRB 1P9MC 1U36A 5EZLA 2JB6B 4OCXL 5MI0C 1WAAE 4C57C 5A16A 1JFQL 1RU9L 1FVEB 1E4JA 1A7NL 5JOEA 3QCUH 3H9SA 5TJWK 4Z7QE 3ET9F 5D2LB 2Q8BH 4EQ2A 4IEFB 3LKOB 2OI9B 3P9MB 4LF3A 4XP6H 3U1SL 3SGDI 3VGFA 3IGAA 4ONHA 3NA9H 2R2CA 4TQEH 4L3CB 1LMKA 5CLWA 3QNZB 2FEDD 4X9GA 5DJDA 2YPLA 5D7LD 5LGJA 3S36H 3SE8L 3G5YB 4QRRB 5CCKL 1XIWC 2QKIA 3KR3L 4BQ8A 2DIJA 5DQJB 4R97C 2IPTH 4YGVA 3ZDYF 1NGQL 1BAFL 4PJHB 3MODL 1U8OB 1E0OB 1DL7L 4H8WL 5D93B 4PJBE 4PP2B 1WIPA 3MV9A 1G1YA 4NQXA 1Z5LB 4POZD 1IGTA 1P4LB 5AUMA 4KJPD 3H9HA 4JDVA 5HI4D 1DVFA 4MD4B 2PXYA 5LG1A 2BHYA 3IU4L 3V5KB 3B4NA 2Z8VC 4OD3L 2GW5A 3V4VL 4X8JB 4NQSB 1G7IA 3P9LB 3GUTA 1JWMA 4P49A 1I75A 3O11A 4NPYB 2CLZB 4HJJH 4JQXA 4NRYA 3X3GH 4UT9L 3LQAL 5C0RL 1TQBB 1I3RB 4YBHA 5ANME 2BXZA 1DQDH 5F7YC 4XWGL 2IQAA 3VFGL 3SJVD 4KXZI 3AVEA 2P44B 5F1IB 4P4KA 1KJ2L 2I26N 4HHAA 4PJIF 4Y1AA 5IBLC 1SEQH 1UWEH 4L5FH 4XVJL 4ZO9A 1KN4L 1AE6H 3VRJB 1D5MA 1MQ8A 1MFCL 5H94A 4FFWC 4PRHA 2EDQA 5ITBH 1IEAB 1EAPB 4WY7L 1FE8H 3NH7L 2X09A 2H1PL 1AXTL 1ZANH 3PDDA 4GAJL 3I6KA 1IQWH 1UWGH 1AHWA 5F1NB 1Q9OA 4DEPB 1IJ9A 1PG7H 4LDLB 5IVXE 4ZAKB 1Q9WB 3GMOA 4JRXD 5C3LD 2Y7QB 2RFXA 1U8JB 1BF8A 4I3RL 5GGSA 1B88A 2A6DB 5DK0A 1TZGH 3BN9C 3LB6C 3H0TA 2H8PB 1Z9MA 4NYLB 5EO9B 3MRPA 2D7QA 3SKNA 2VL5A 5CZKA 3DV6B 3HLAB 3GHEH 5FYJL 4GRMB 5TQ2L 5FYJD 4JZOB 3ZE1F 5TH2A 4FG6C 5H37H 3IU3A 2EH7H 4O4YH 3C8KA 3QUZD 5I8CB 3IKCA 1ZSDB 1ZLWH 5J1TC 3N9GL 1FLRH 3SE3C 4J12A 1UB5A 1DEEA 1YEGL 2ZNWA 3TBWA 1I1FB 1S7XB 1BLNA 4HUXB 3WDIA 2VDLL 4L29A 1QA9A 1IC1A 1PFCA 2EDLA 3IDXL 4TSAH 1J10A 5HGHB 2X44D 5FCUH 5FA4A 1J11A 3Q48A 2AS5M 3MV7B 1CS6A 4MYWB 1R5IA 3ZL4L 1K2DB 5GHWL 4EXPX 2DQDH 4ZTPH 1OARL 4L3EA 2O5XH 3EYOA 2AEQH 1HILB 3ZYZA 1NBYB 3MRFA 3RTQC 1JZ8A 4IMLB 1BM3L 1V3MA 4GRLD 4YHKL 3CDFA 5FDWB 5A40E 1IAKA 1YN6A 3CFCL 2WWKT 2VXSL 3O9WD 2DQEL 5DTFB 3EOBA 5DMIH 3OTTA 3UTOA 1CGXA 3SKOB 3UTPE 2QR0B 4AQOA 2E7BA 4JO1H 5EN2A 3ESUF 5J89A 2EYSB 2G5BB 2V5MA 5D1ZC 1LP9F 1RHHA 2K3TA 5MEPB 2F19H 1V7NL 3SPVA 3B9KB 4Y4FC 1NDMA 3VXRA 5HGBB 3M1BA 4R2GC 1PLGH 4OFPA 4YXHH 3HPJB 2ZUXA 4NQEB 1TTUA 4UT6H 3JV4A 3QCTH 3VXNB 4M48H 3JWOC 5DFVD 4A2MA 4JM2C 4H88H 3D69B 3CVHB 1I85A 1NGWA 3WXWH 3MJ7A 2J8UF 2AJXL 3BOVA 3VE0B 5C3TA 4JN2B 1OAQL 2CDGB 4XP5L 3QEGH 3S96B 1EHXA 4CN6A 3NCBB 1CVRA 4TUJA 3H9YA 1BOGA 4PJ9B 4P59H 5DEFB 1VB9A 2DYPD 4JKMA 4PRBA 2IADB 3BRFA 2CK2A 3WDHA 1A6ZB 2FZ3A 1NBZB 2BRRL 4IOIA 3WO3B 5FECA 1MPAH 2P4AB 2PR4H 2X4SA 4E41A 2ZOLB 4WO4D 3MV9E 3IFNL 1NBVL 2CQVA 1HHHA 1L7IL 3E3QC 1NEZG 2PO6C 2V2XA 3QFDA 4PJXE 4OZHE 2D03H 4DVBB 1U3HD 5DF0A 1G9MC 1BFVH 4PTTB 5DHXB 5I1CL 1LDSA 5D72H 3TZVD 3BISA 4ETYA 3DVNB 5BVPL 3CFDB 3RKDC 1A5FL 3HNTH 5JHLL 1GZPA 3KPRA 4HC1H 4C56D 3B9AA 2MQ0A 3RGVB 1JYVA 1LEIB 4Y5YC 2FX7H 3OKLB 1AI1L 2R2BA 1XGPA 2X4QB 2YA1A 4NCC1 3HE6D 1NC2D 1GHFL 3BE1L 4Y1AE 4Q0XL 1Q9KA 2XV6B 4FRWA 4O51B 4EBQL 1G7PA 5MENB 2BVOA 4LNVA 4N9GA 3EYQD 3N1FC 2VZOA 4BELD 4LHUA 3MACL 1ROWA 3PV6A 1TTGA 1Y18A 2VITA 2KDGA 1OM3H 2HTKC 1EIBA 3KYKL 3LSOA 3HZVB 3ROLB 4P46B 1S7UB 3IXAB 5C0AA 5GPRA 4NZRL 4O5LL 1DQMH 3LKNA 5IHUL 2GQHA 1HEZA 3B3IB 3MLRL 5HHXL 1XGRA 3FT2B 2Z91A 2VISB 3FO0L 2UVEA 5IMMA 1IRAY 1FFNA 1AO7A 3V6ZA 4HXBH 1IL1A 1GPOH 2R4RH 3HRPA 3TP4A 1AJ7H 3T4AB 4XMPH 2NW3B 5GSVA 3OKNA 3DV4A 2E9JA 2EO9A 1NCCL 1RV6X 4JFHE 2PO6A 2HYMA 5B4MD 3O3AB 2VWEE 3EDEA 2DICA 4R6UA 1CDCA 4NDMB 1UACL 4M62H 4LSPL 2YEZB 3EGSA 4JCMA 1IGYA 1ZA3B 3CFJA 3MOAL 3UBXB 5BXFA 5LQBH 3C5SA 4PPTA 1M7IA 4Q74A 2P5WA 4Y5YA 4OCXH 4N0UB 1IM9A 3QEHB 5T3XL 3BSZL 1RU9H 4PJ5A 3TO4B 3UZVB 1A7NH 3FO9A 2FECI 3FRUB 1XF2B 4L3EE 1TVBB 1ODAA 1TCRB 1U8PB 2A2QT 3U1SH 1CXHA 3IFLL 3MJGX 3TVMB 3HR5A 3DMMD 3PWJA 1WV7T 2GTWB 4NKMA 3D0VA 3O45B 5E56A 5CP3A 4NCDA 3SE8H 1RJYB 4WNQA 5CCKH 3SDDC 3KR3H 1MUJB 1U2CA 2BC4A 2V5SA 1QR1A 1QRNB 5T3ZD 4NN7B 3ZDZE 5EFIA 5ESAB 1NGQH 4WFHE 3AS1A 1BAFH 4I3SL 3MODH 2ESVD 2LQRA 4Q58C 1F2QA 4JDZB 1DL7H 4H8WH 4XC3L 2DBJA 5F9AC 4KU1A 5I1IL 5TE6H 1RZKC 3RVWC 3OGCA 3FT4B 4HK3J 2F8VA 5B3JF 5C0FA 3G9VA 4U1IA 4JFXA 3IU4H 2HTLC 2APVA 4OLXL 1BF2A 4P2CG 1IQDA 4OD3H 3Q1SL 5E6ID 1T83C 4I5BA 3V4VH 4HPOL 1WBYB 5IR1B 3OKEA 3RX8A 4MZ2A 3KPOA 1K4CA 4UT9H 3LQAH 5C0RH 1LO4L 4HXAH 1A7PL 5E2TL 4XWGH 3VFGH 4UDTB 2APFA 1HHKA 4JQIL 1KJ2H 4KKCC 5DR5H 3VWJB 3CH1B 2CO6B 2V7NB 3E6HA 3TV3H 3WJLC 4XVJH 5KZCD 1KN4H 3KAAA 1MFCH 1VFBB 3Q0HA 3BGMA 2HRLA 4E41E 4WY7H 5C0EA 4D0BA 3NH7H 3QEUA 4JKWA 5B39G 3VXOA 2H1PH 5GS0C 1AXTH 3OF6D 1Z9OA 1U8HA 5F7MC 5T1DL 4GAJH 1RIHL 1J05B 2DWEA 3RWFB 5IJKC 4XVSH 3V4UL 5F71A 1IKNC 4XHJC 2P8PB 4G80B 4G42B 1RK1B 5C2BL 1PEWA 4I3RH 3BQUB 2F54E 1PQZA 1KIRB 5GGRB 2DKUA 1II4E 4HBCL 3HNSL 1J0IA 4PGBB 3WE6A 1AD0B 1JGDB 4HV8B 1WJ3A 5FYJH 4HH9B 1A4KA 4OIAA 3VFOB 4LCWD 4ZFOB 5FCSH 4MDIA 5EU4A 4XB8A 2HWZL 5DS8A 3SDCB 1DJSA 5IEHB 5J0BA 1RJLB 4N5EC 2Y6SC 3N9GH 4F80A 2DQHL 3T4YA 1HN1A 1YEGH 4APQC 1EGJL 3GB7B 2VDLH 1LEGB 3B5HA 1EXUB 1KTDB 2LVCA 3IDXH 1TTFA 3HB3C 4P2YA 3MRHB 4KJWC 1GGTA 4P2OB 1YPZB 3ZL4H 5GHWH 4W70A 2G75B 1VACA 1OARH 4PJIB 4OLUL 4MQTB 4UB0H 5DMGC 2ERJC 3LQZB 1ZVYA 4G9FE 5AZEL 1AO7E 4X0KA 1NCDL 5DJYB 2Z93A 4QHNB 1BM3H 4YHKH 3CFCH 1T5XB 2VXSH 3ZLQC 2DQEH 1BVZA 1ZHLA 4L4JA 1NGZB 1FNEB 2EC9T 1EDQA 3H8NA 4I48B 1OTSC 2C3XA 2X1WL 3D18A 4ORGA 2R1WA 4F7EA 1HQ4A 4WEMB 5D71L 9CGTA 4UNUA 4EZMA 4KI5D 1V7NH 1CGSL 2VLKB 2F53B 5MEQA 2W9EL 2P5WE 2ZSVA 2J1KA 1FYHB 1HK6A 2I9LB 5CS7A 3B8SA 2BSSB 4PJ5E 4LL9A 3AXLA 3G6AB 5IB4A 1A6AB 2VZUA 3MLWL 1KENL 3CJJA 1NFDA 5IM7A 1PY4A 2AJXH 5EZJB 4AM0B 1OAQH 1WSST 1JCKA 1QEWA 2X4OA 4XP5H 5DD6B 4TUKL 3EJZC 4K7PX 2XKNB 2H26A 4H1LH 3KYNA 5INCB 3NIDF 1YQ2A 1HHIA 1CYGA 1YMMD 1ZHBB 2NXYD 4KJYB 3AMLA 1CU4H 2BRRH 4NQVB 2DM2A 3FL7A 5CD5C 4X9FA 2JIXD 4M3JA 4X5XA 3T0AA 1L7TL 1HI6B 1OCWL 3IFNH 3G6JA 4YNYA 1L7IH 4K71C 5IFAL 5H8DA 3SE4A 1T0MA 5I1CH 1JRHH 2C3VB 3D2UA 4QRPB 1EO7A 1GGBH 1A5FH 4FQXC 1LK2A 1RZIA 3LKPB 4MJIB 1SEBA 3HE7B 3QUKA 5DJ2A 1CF8L 4N90D 4N1EA 2XFXB 5B38B 1KOAA 1QTYT 1KJMA 1AI1H 2PF6A 2OXHA 4Y8DC 4OT1L 4XNQA 3BE1H 1GHFH 1KG0A 1REIA 4KY1L 2FB4L 2EE6A 4PRDB 1P69B 4OLEA 2VR4A 1YQVL 2XG4A 3K74B 5EIIA 4WDIB 4X6FB 4EBQH 1Z0MA 2H3NA 5BJTB 1JGLH 2D3VA 2CUHA 4LRIC 2WUBL 5LVEA 2EXWC 3MACH 4Q9CA 4UU9B 2E7LA 1BD2A 3KJ6L 2GJ6D 1JBJA 2H2PC 2DL2A 3KPNB 3KYKH 5D7LB 4YEEA 5TDPB 4NZRH 4O5LH 5IHUH 5HSFA 2ZCHL 1NFIB 4OZGF 1BZQK 5HY9A 4ZYKB 3MLRH 4N0FA 3MRBB 3UPAA 2NY5C 4MNQD 3MRKA 3FO0H 4XNMB 3C60B 3ZTJG 1RZJL 1S9KC 4EIGB 1R3IL 1U8KB 2OM5A 1AIFA 2IBGA 2P42B 5GQBA 5E6YA 4XXDB 1AP2A 4MNGA 4P23D 1GZQB 5KJRL 3OPZL 1UYWL 3QB7C 4X98B 4RAVA 2D2OA 4JM4L 1HDMA 5DYOB 3IJYB 2M26A 1UACH 3D85D 3HAEH 5I15L 4LKCB 4LSPH 3UZEA 3O4LB 1U9KA 3MOAH 5HYQB 2J6EL 2P45B 1OP3H 3MLVL 5T3XH 3BSZH 4H0HB 3SJVB 1WT5A 4LAJH 5E8OB 5CEZE 1KCVL 3P4NA 2BNRD 4YUEL 4Z7WA 4K7PL 5JPMB 1KN2L 3DROB 3UAJC 5EULV 5L2JB 3IFLH 4NT6A 3WLWD 3HHRB 3QNXB 3BRGC 5GXBB 2YSSB 2CRIA 4RRPA 4HS3B 4M9OA 4LRIA 1MRCL 1ZT1B 2Y5TB 4PP1D 1L0QA 2AXHA 4JE4B 2YRPA 4ZPVA 3MLUH 3SY0A 5T3ZH 7FABL 1S8DB 4JFPB 1K8DB 3RIAK 3LEVL 1ZA6A 1G9NC 2CXKA 4N1CA 43C9A 5I1GL 3WUZA 4I3SH 3VH8G 1ZWIB 4KI5F 3NCMA 3SEPA 1LNUB 4ZUUB 2HMID 4XC3H 5IW1A 4NUJB 3GSRB 1KGCD 1X9QA 1UVQA 2G9HA 3KWWB 4NO3A 1S7RA 5I1IH 1BJ8A 2P8MA 4J6RH 1WITA 1U41A 1T2JA 2XICA 3MQIA 2GIYA 3RL1A 5E70A 3T65B 4M5YL 1B0GB 4PD4K 3RVXC 4OLXH 4Z7VA 3Q1SH 3RGVC 3M07A 3INUL 4HPOH 1NFDE 1KTKE 1QD0A 4NQCA 1E27A 4PJEA 5E95B 4LSQL 3KDMA 4HX1B 1CICC 4CUCA 3JTSB 1FZOA 1YZZA 4U1MB 4OGXL 4FA8A 1LO4H 4U1LB 3I3EA 3IJSA 5EU6A 1A7PH 5E2TH 1MWAA 4M7ZC 3WCYA 3ZKQD 1U8MB 5T1MB 1CXKA 3MLTB 1P7QD 4JQIH 4NP4L 5EUKB 3TNMA 5E1HB 1U93A 2J4WL 3BZ4B 3EZJB 2DKMA 5IGXL 2COQA 2OK0L 2YPKA 2M8XA 4UQ3A 1JPTH 1OQOA 4J3TA 4ODHL 1GOFA 3QUYA 2WBJD 5T1DH 4RFEA 5I9QC 3G6JE 1RIHH 3MYJB 3IFPB 2BNUA 2XWBB 4G3YL 4GRLB 5I8KL 3MRIB 3V4UH 5F97E 3TT1L 1XGUB 3B43A 3WNOA 3PG2A 4CKVX 5ECJE 3MV8D 5E6ZA 5C2BH 1KNOB 5D70L 4R7NB 3QEQD 5L6YL 1NGXA 4HBCH 3HNSH 1M7DB 5EZOL 3T0EC 3VG0L 1QFWI 5BQ7B 2LTQB 4LSTL 3T1WA 4ETQB 2YRLA 5EOTB 3GDBA 5IF0B 4HIJA 3C2SA 4E5XB 3ALPA 4A6YL 4P4RB 1BZ9B 4MGXA 4KZDL 4LVOB 3QUXD 1JGEB 2HWZH 1MELA 4KRNA 4OGAD 4JO3H 3P4OA 4FXKA 5CP7B 5J56B 1BD2E 2DQHH 5GGVL 3TO4C 1CICA 1EGJH 1H8NA 2BX5A 4KROC 4EI6B 4OKVB 3TN0B 2DYPB 4K3HA 2FGZA 5LGHL 2X40A 4NKOB 4OLUH 2EKSA 2BNQA 2UVFA 5TGBA 3SDXF 2VQ1A 3BMVA 3L3JA 1I1AB 5AZEH 4NO5A 1LE5B 1NCDH 1KT2B 4WO4B 3U9UA 5I76A 4XTRD 4YR6A 2VABA 5T1KA 4Y2DC 2YWZA 5I1DB 3FQNA 2DL9A 4FXGB 4PYGA 4FOMA 3FOMA 3D6GA 3DX9A 4QCIA 4Y89A 5J9PA 4FMFA 3EAKA 3P73A 3TZVB 2GJZA 1BVKB 4OCMC 4X6CF 3BHBB 4YHYB 5D71H 4DKAA 3QG7L 2QL1A 1CGSH 4OAWA 4OZ4A 2W9EH 4OF5A 3T0EA 4OI8A 2IH1A 1VADB 4B53A 1YNTB 4Z76B 1UB6A 4DGYL 4JJ5B 1NC2B 2YHGA 5E4EB 4Z7WE 4YFLI 1NUGA 3MLWH 3RVVD 4MVBC 3T3PF 4CVZB 4NHUB 3FONB 1A6UL 4U7SA 3RIAF 3N1PC 3O4OC 3JV6A 2P24A 5E5UB 4TUKH 4OUUA 3MR9A 1A7OL 4XCNB 2XA8L 2JCCF 3KPSA 3DECA 3MCLL 2RCSL 4J8RA 2X70A 4F8TA 1KLUA 3CPLA 1XH3B 5DEGA 4WUUB 3NIGE 1FP5A 5L8KB 4YQXL 3O41B 4HLZG 1Z9SA 4MAYC 1IGCL 3BWAA 4TPRL 1L7TH 1UFUA 1TZHA 4LVNB 4MX7A 5DSCA 1OCWH 4L8SA 2FH6A 3BP6B 5F1OB 3WN5A 4Y2DA 3I02B 3BQUC 5EOQL 5DJ0B 1Q94A 2O5ZL 3WNPA 5IB2B 5ISZD 1EA9C 4Z7VE 2AJSL 3E6FB 4O2EB 4NQCE 4PJEE 3UBXI 3JV5A 3MRNB 1CF8H 4JFDD 3SHSA 2AGJL 2EZ0C 1OSPH 5F3BB 3RZCB 5EU6E 4OT1H 1F3RB 2NY6D 3RNQA 2ITDB 5F3HA 1DUYB 1UZ8B 2FB4H 4PJDB 1A64A 3MZTA 1YQVH 4FTVA 4MCZB 4Y7MA 1JPST 4ELKB 1NQBA 4V2CB 3BAEL 2O26U 1IEBB 4RFNB 3GMRB 2WUBH 1AGEA 5BV7L 4LLMA 3KJ6H 5ILTL 1IGIL 2DM4A 2VLJA 3IVKB 3O3DA 1KELL 3DO7B 1HQRA 1UM6L 4RGOL 3RU8L 4PLJC 5BZWA 1N4XL 1P4IL 4PJFF 3PHQA 1H15A 1YN7B 5J1SC 3GSXA 3OBAA 3O3EA 3MLSL 5CMAA 5KSBF 4OCSL 5DK2A 3ZHKA 1KPVB 5IBUG 1CFQB 5DJ6A 4M93C 4N0CC 1RUKL 3MRGA 5CAYB 3B9EA 1R3IH 2AP2A 3TBYA 4XI5C 2E7CA 5EBLA 2OSLA 5KJRH 2AJYL 4IS6A 3OPZH 1VFAB 2X7LA 1HCFX 1OLLA 2A83B 1XGYL 4JM4H 2EECA 1FL3A 4ZUTA 3GIVA 3PL6A 4WV1A 3PDOB 5E6IB 3HMXA 5I15H 1RQ5A 5CIPH 3L3KB 3VFTA 5EC1B 3OKDB 2V7HB 2J6EH 4E9LA 5C0CB 1T3FA 4WEBL 5HHNB 4J1UA 3PGCB 1G7MA 3MLVH 5HYJA 3H6JA 4ZO7A 1KCVH 4YUEH 1CT8B 2AERT 2H2SC 2ZJSH 1F11B 3GMQB 4YHOL 4K7PH 1KN2H 4Q6IC 1QFOA 2ED8A 4JVPA 1NGYB 1MRCH 2E6QA 1DZBA 4ZFZB 3MJ9L 4HH8A 3ZT7A 4GW1A 7FABH 2OL3L 1EVUA 3KPPA 4Q7DA 5JDSB 5I1GH 2X4RA 3IF1B 3N1QC 1NCWL 4JFOB 2BMKB 5KVDL 3DX8B 4U3HA 5JHDB 3RP1A 2CRMA 5J1AB 1Y0LA 1IAOA 3PHOB 3V95A 2E7HA 1MFBL 3HZKA 4PV9A 5JW4R 4KKAC 2PW1A 4M5YH 3HE7C 2YK1L 1I4FB 3V5HB 1QSFB 1MI5E 2HG5A 4D2NA 2DLGA 3INUH 4IRSD 1PBYA 5T33L 4LSQH 5FOJA 2X1OA 1TLKA 3SDAD 2DQJL 1YEDB 1A7RL 4OGXH 3GSQA 2GTZB 2HVJA 2PYFB 1H8OA 1C08A 3KPSE 2DDQL 15C8L 4NP4H 4O9HL 2C1PA 3NCYP 2J4WH 3OKMA 5K9KB 2OMNA 2VTFA 1JWSA 5IGXH 1C16A 2F74A 2WLYA 2XQYK 3HG1B 3MSPA 2OK0H 2FEDC 4ODHH 2W38A 3GM8A 4Z7UE 2KZ1B 4ZUWA 1I1RA 2H9GB 4W4OA 3L7FA 4Q2ZB 4G3YH 5I8KH 3N85L 3ULVC 1T03L 5L2KE 5FKAA 4E0RA 2FL5B 1NMCC 5GSRB 3TT1H 3NOIA 5F9JA 3KXFA 5FM4A 5FYKU 3U46B 5HGDA 2C7UB 1JZ5A 4U6TA 2HN7B 4G8IB 5D70H 2R1YA 1ACYH 5KN5A 2VDRL 3VI4E 1BOYA 3EO0B 5L6YH 4POZC 1CBVL 5J11C 3UYRL 3MA9L 3VFPA 4KJPC 5EZOH 3VG0H 4YAQB 5HI4C 3O6LL 4LSTH 2LU4A 4EN3B 5JOPD 4Y19A 3VXMD 3MRQA 4U1GC 3THML 4RFOL 3X12B 1I9RL 4FTVE 4A6YH 4BQBA 3ISWA 3STLB 4QHMB 2B5IC 4D8PA 4HSQA 3EYVB 3MUY1 4OFYD 2A38A 4KZDH 4L9LC 1EJ6A 1J0ZA 3O6FD 2R69L 5GGVH 5DJ8B 2EDXA 1NEZB 3NFPB 5DRXA 1M6OA 3AM8A 3C5JA 1G0XA 3FB5A 5IQ9B 1Q9LA 3VXTB 3RX7A 3QZWG 2PW2A 2Y5EA 4Z0BL 4NN5B 5LGHH 3EJJX 1QQDB 2NXYB 2W91A 1Q0YL 4JZJB 3ARFD 3R4DA 1VEOA 4RX4D 1ZS8A 1VGEL 3U6RA 4G8EA 2JIXB 4LKXB 4F9PC 1U95B 2WANA 5HDOA 3SCMC 4UAOC 3HC0A 4ZS6D 3UTQB 2XXCB 1LWRA 3FB8A 4EVNA 1RIVL 3QDGA 3GSWA 1ZVHA 4GW4B 4Z77B 1JYNA 1NC4D 4I18A 3V5DB 4XH2B 4D9RE 3ARBA 1UQSA 5T5NF 3QG7H 3AS0A 3OWEA 4HUUB 4B50A 1QR4A 1XCTA 3WIFA 2LAAA 2DMCA 2W0FB 5GZND 3CXHJ 2OZ4A 5HYJE 2JLLA 4DGYH 5FXCH 2A6JB 4Q97A 3QUZC 3C6LA 2ZUTA 1FG9C 3FO2B 3FHQA 5I30L 2VDPL 4NFBA 2X42A 5J12B 1P2CA 5SWSB 4K8RL 2A6IA 2XWTB 3SBWA 4RAUA 4L9LA 4N0RA 3ILPB 1A6UH 4AT6A 2Y25A 4PJAA 4JFQB 4K8RD 1WTGT 3BW9A 3EHBD 4J4PD 5CD3B 3S9DB 1A7OH 3ULUE 1TNMA 4X6BA 3MCLH 2RCSH 4LNRB 5D8JL 1HNFA 2Q87A 1N64L 1LD9A 1GH7A 4XPTL 1OF2B 1RK0B 2VXVL 4YQXH 3BIKA 3KLHD 2UWEA 1ZLVK 5KW9L 4QO1A 2EDYA 4GRLC 4Z5RA 3CFIC 3ZKND 1IGCH 4MNQB 4D0DA 3GJFB 4TPRH 5HVWA 3O9WC 1KULA 3DPBA 3SDXB 2A0LD 4F57L 3VXUE 1ULVA 4KFZC 2IAMB 1SVCP 3VFUB 5EOQH 3SCMA 1R3KB 4U6XB 4R8WL 4UV7L 2O5ZH 3MBEA 1FL5B 1IM3B 2IBBA 3LRSA 4HD9A 3ZYJA 3BVNA 1KIQB 4WW2F 5KAQF 2L7UA 1HIML 5EG6C 4ZXBD 5I74B 5DRNA 5H35A 2AGJH 2X4UA 2GK2A 5HYIA 4X6CB 2MSPA 3EOAB 4IOSD 4LLVB 4JQVC 1NJ9A 3PWPB 3BO8A 3G5XA 2IMMA 1R3HB 5AEAA 4HULB 2BCKA 4NC2B 5GRXG 4HIHA 1TCMA 1FORL 1GOHA 5FO9A 3BAEH 3BD3A 1JI2A 4NC1E 1A6WL 1DBAL 1FZMA 5JXEA 5MHSE 5HYSG 1S9WA 4FFYL 3HC4L 3E0GA 5BV7H 4XRCA 5CKAA 5ILTH 1IGIH 4ISVA 1AGBA 3UTTE 1FNAA 1KELH 1LO5B 1RY7B 2YD8A 2Z31B 3NFSL 4YEFA 1MRDL 2AV7B 1UM6H 4NKDA 3RU8H 3L6FB 5GJSL 1N4XH 1P4IH 3KXFE 2VLME 2NTSP 1FC1A 3ARGC 3MLSH 5HTSA 4OCSH 4WO4C 2ICWB 5DHYA 3O6KL 1TJHH 4LCCC 1IE5A 1INQA 1VERA 3AREC 1QFUL 4YK4C 1U3HC 4U1JB 4Y19E 4O2CA 4MAUL 2WQRA 3VWKA 2AJYH 2V5TA 3QXAB 4UOW0 1F3DJ 4MS8D 3DVFA 3ARQA 4DCQA 5BOPA 4HFUL 4LASL 3TLRA 1XGYH 1TENA 1FVDA 1PX4A 1A21A 1P53A 2WLZA 2ICCA 1FN4B 3HE6C 1BIHA 1WICA 2ICWJ 4QRQB 4R4BB 1F45A 4QHKI 3CCHB 4HKJA 4WEBH 4Y4HB 4GQ9L 2OR8A 4YWGL 3LDBC 1MREL 1LILA 3EYQC 4JQVA 2DLFL 3TBTA 4YHOH 2NYYD 3AU1B 4HWBL 2ITCA 3W0WA 3HS0A 3TPUB 3CX2A 5D7IF 4P5TC 2AXFA 1VDGA 5C6WH 3GMNA 4ZS7L 4G6ML 3W82A 2ATPA 5I16B 4IJ3C 3MJ9H 5JA8B 5CSGA 2PUQT 3P11H 3BEWA 4IMKC 3UTPD 2OL3H 1CZ8L 3CC5A 1J0JA 3BPLB 4JRYA 3QDGE 5CGMA 5C9JB 4LVNC 1RZ8A 1KEML 1F6FB 3D39B 1CDGA 1DQQA 4PJFB 3U36B 3ARGA 2PTTB 3VMOA 5DMKB 3DSNA 4PJ7A 1NCWH 5EBWB 4UDUA 4MNHA 2OQJB 3QEQB 4LLQA 5B22A 3X17A 1JNJA 4I2XE 3AREA 3H9SD 3T77B 5FDYA 5B4MC 1MFBH 2QLVB 4KDTC 3ZYOA 5CHNB 1AH1A 5K9QI 2YK1H 4RDQF 3GO1L 4N68A 2MPAH 4A6YB 3QFJB 1MJUL 3TBVA 5IJVA 4WI6A 1XF3B 2DBLL 4R4ND 5D5MB 2ENSA 4PJAE 2YPLD 5T33H 1AC6A 2DQJH 1A7RH 1TDQA 3VXPA 3N50A 5E5MA 4XGZB 2YZ1A 1KCSL 4XPAL 4OZFH 4I8DA 4HLJA 5E2VL 2DDQH 15C8H 5D2NC 2DN7A 4O9HH 4RFNC 1C12A 5T1LB 1ZHKA 3DMMC 4C4KT 1C7TA 5E4IA 2YMXL 1C5DA 5HVHB 2X05A 3MV9D 5F7DB 3MOQA 1LQSR 3VGAC 3VD5A 1FYTE 3PP4L 4P5TA 1DVFD 3ELAT 4ZDHA 2PXYD 3N85H 1T03H 3RVTD 2ZNXA 4QXTA 2UZYB 4YDVA 1P5VA 1YYML 4UMGA 3IDJA 2DI7A 1YEIL 2NY0D 4UUJB 1MHEA 1CXEA 4P2RA 2I07B 3VFNB 3K80A 5K59F 1X5XA 4OF3A 1F6AB 3ROOA 2Q20A 1FZJB 2VDRH 5JW5A 1WCBA 1CBVH 3UYRH 3MA9H 4PGDB 2ZG2A 3O6LH 4P4KD 4Y1AD 4N8VA 3S34L 4RGNE 4R3SB 5I1LB 3THMH 4RFOH 5E6IC 1QO3A 1I9RH 3OL2A 4KDTA 4PBWD 3ZT5A 4XBPB 4JANB 1Q8MA 3HZYA 3AB0B 2W60B 2DQGL 1E4KC 3KPLB 3PF2A 2VC2L 5IVXF 5HHME 4JFEA 1N0LA 2R69H 3STBA 1LO0H 3MCG1 5JMOC 1P1ZB 3NFNB 1FGNL 3W9EA 2RR3A 4IRJA 5D6DA 4RNRB 5DC0A 3TH2T 1N0XL 1J86A 4EUPA 4GRWB 4Z0BH 1Q0YH 4XVTL 4XPHL 5IB5A 3BEVA 4PRPA 1S7SB 4QTHA 3RWEA 1VGEH 5JOFA 2UYLB 5I1EL 3PUCA 5ERWB 2LU3A 5DT1L 4JFHD 3VJ6B 3FAWA 2OJZL 1G7HA 4XWOD 3GBML 5GS1A 1G7LA 3IT8D 1JV5A 2GK0A 4QHLA 5C7XL 1RIVH 5E94A 3TGXA 1NUDA 4JFFB 5DWUH 3FO1B 2EEBA 5EUOA 3WLBA 1ORSA 3HN3A 1RD6A 3KS0H 3RWIA 1WVZA 4NQUA 1J18A 1G9EA 4S1SL 5L0QB 4G8GB 1BFOB 2J88L 3MRCB 1W0WA 2NY6B 4L3ED 4X5WA 4N8VG 5CILL 1N5YL 3RDTB 4FFWD 2JB6A 4BSVB 5I30H 2VDPH 2NX5E 3W39B 5KSVB 3ARZA 1KLGB 4OJFL 4K8RH 7CGTA 4TOYL 1I9JL 3C2AL 3CDGA 5D2LA 3F7RA 3VFVB 3CZFA 3TC9A 3LKOA 3BPOB 1ZLVH 3UJTL 5D8JH 1CR9L 1BHGA 1N64H 4L3CA 4XPTH 3H2WA 4X6DF 3QNZA 4JRYE 2VXVH 2ARWA 1MHHA 1JYWA 2AEPL 2NTFB 5KW9H 2XZQL 3BPNC 3VXRD 4EUPG 5DQJA 4NRZB 1WBXB 5IG7B 2CLRB 3QIWA 1U8OA 2QHLA 4F57H 2JB5L 5I8EA 5BZDA 5AG8A 4DQOL 4K07A 4PFEA 2Z8RA 3OXSB 4R8WH 2MCG1 5F8RC 1Z5LA 5F44A 4JFYB 4NC0B 3CGTA 3Q5TA 2VSDA 4MD4A 3QI9B 5DRWB 1HIMH 3C6SA 4L4TB 4PGCA 3RAJL 5IK3A 4X8JA 4NQSA 3BKCL 1RZ7L 4NPYA 2CLZA 3IDNA 5HI3D 5TFSL 4WI7A 4E41D 4XXCC 4L8CB 3QO0A 4M7KL 2VRAA 4LVEA 3W11C 1FORH 2HFFB 2NPLX 3IETB 1A6WH 3QJFA 5DJXA 1DBAH 3QDMB 2HLAA 4M8QB 5CEYB 3RY4A 4V1DA 3L1OL 4FFYH 3HC4H 3QULB 4BZ1L 1WZLA 3W9DA 3NFSH 1NKOA 4LSUL 1EAPA 5IHLB 4GMTL 4RSVA 1BQLL 1MRDH 3HRZA 3RWHA 5K93A 3ZDXF 5GJSH 2QV2A 1B90A 1R6VA 2F54D 4OB5L 4B5EA 3WFCL 4CNIB 3KPRD 4P2RE 1CDUA 5F1NA 2OS7A 4AMKL 3OHXB 1WWWX 4URTB 4QY8B 4YDJB 5JQ6L 2VE6B 1L9MA 3O6KH 1Q9WA 1O7VA 1WZMA 3Q6GL 2Y7QA 3OR6B 5E9DB 3ZHDA 1QBLL 2SEBA 4LCYA 1QFUH 2A6DA 1M4KA 1AR1D 2H8PA 3J7HA 5EO9A 3MLYL 4MAUH 3A6OA 3B2UD 3ZE2E 2DWDA 2FBJL 5FUCC 1H8SA 2XY2A 4HFUH 4LASH 4WHYG 4LHUD 1ZXQA 5CSZB 3RWGB 1A9EB 5HPMB 5SWZB 4PJGA 4Z78B 3RA7L 2IALA 2MHAA 5IMKA 4IRSB 1S9VB 4JFEE 4LCUB 1T2XA 5C0AD 3TCLB 4WW2B 4YC2B 3MROB 5FYLE 1ZSDA 4GQ9H 4YWGH 1MREH 2CIKB 3CFBB 2K7PA 3U30B 1I1FA 1S7XA 2DLFH 4OZFB 4HUXA 4ZO6A 2AEWA 5EORH 2P49B 4L8DB 4ZFFB 1AO7D 4HWBH 4XXCA 5HGHA 1ZT7B 2GCYB 2FJFA 1B3JA 4PRPE 3LKQB 3MV7A 4NO0A 4GFTB 2WINA 4OFDA 5FM5M 3GBLA 4HWNA 4Q9QH 1G9ML 3DIFA 4ZS7H 5HHPB 2V2TB 4G6MH 3QAZC 5E2JA 3B9VA 1HILA 3Q2CA 3WV0A 1NBYA 3K8MA 2FHBA 5GZOD 4IMLA 1CZ8H 2KPNA 3NN8A 2Q7YA 5FDWA 3C09B 2D9CA 5EUOE 1KEMH 5DTFA 3VFSB 2P5WD 1K9TA 3ZE0E 2AQ1A 5DD1L 1IM9D 3JWDC 3T8XB 4P23C 4Y8AA 3I84A 2CJUL 2EICA 4WHCA 1WCQA 5JNYB 4PJ5D 4BFEA 1XR8B 3I2CL 1KIPB 2G5BA 1AGFA 4FQJL 1YC8A 3VXMB 1KPRB 3IXTA 3RX5A 3B9KA 4LMQI 4EQ3A 1CDIA 1D6EB 3KPMB 1KCUL 4LDEB 1E4WL 1E4XL 1OW0A 3GO1H 3MJ8A 1M05B 2QEJA 1OTUD 4NQEA 3TEUA 1MJUH 5I1JL 5EBMA 2ADFL 1DSFL 4HIEB 4JKPL 5C8JA 3O6FB 3D69A 5D2LE 2HTKD 3ZDZF 2ICES 3PWUA 5CEXB 1KCSH 4XPAH 4BQ9A 5E2VH 4PTUB 2CDGA 5DJAB 1I7TB 1S5HB 1C7SA 4G6FB 1NBQA 1I1YB 3WLWC 3V6FB 5JUEL 4P48A 3CAFA 2YUXA 2YMXH 5DI8A 4UV4L 5DEFA 4PP1C 2IADA 3ARFB 5JTWA 5FEBA 1A6ZA 1AY1L 1CE6A 3PP4H 3DX7B 3MRJA 5E1AA 4PJHE 4ODWB 1MOEA 1NKRA 1AGCA 3WBDA 5MEOB 1A02N 4R4FL 4DZ8A 3GSNH 1YYMH 3D87B 3D0LA 3FQUA 2FHCA 1YEIH 2YBRB 4F37K 1XR9B 2Q3AA 2WP3T 4HCRA 4KDVA 1UXSB 2AK4B 4MA8L 3BGFB 4PTTA 5KBNC 3CFDA 3LH2L 4BKLB 3S34H 2GUOB 1FG2B 1NCUA 1LEIA 3VU2A 2PETA 3OKLA 2YD1A 2EYRB 2R1XA 5C08B 2DQGH 3ZSTA 5EC2B 4WFFE 2VC2H 1UXWB 1I3GL 3O3UN 4PB0L 4O51A 3HA0A 1HSAA 4XPBL 5E99L 1FV1B 4HEPG 4C83B 3H42L 3LOWA 1EK3A 1JPFB 5D9SB 1MLCB 1A4JB 3Q5YA 1LHZA 3DURA 3CMGA 4Z9KB 3IFOB 1N0XH 5IESL 4XNZB 1HKLL 3PIQA 4QRTB 2QJDA 32C2A 4CAGA 1PSKL 1HHGA 3CFEB 4P46A 1S7UA 1DQJA 3IXAA 4LLAA 4UIKL 2WBJC 4XVTH 4XNUL 4XPHH 4Y5VC 4AG4L 2P1YA 5ETUB 4NJAL 4FQQB 1NAKL 4MA1B 5DT1H 3FT2A 3KNBB 2VISA 4F7PB 1KSRA 1JNNL 3O6ML 2OJZH 4DK6A 3MO1A 3GBMH 2HTLD 1Z0NA 2VQTA 1ITBB 1GGUA 4D0CB 5C0BB 4Z0XB 5C7XH 2CKBB 5I73C 4XCEB 5CBEB 4JY4A 1BVLA 4J3OC 1WC7B 1RURL 2DQCL 3WUWG 5CEZL 4HG4K 3R06B 3QQ3B 4S1SH 5CEZD 1SJEB 3VDAA 2VDML 2J88H 2YEZA 43CAB 4NQDB 3UBXA 5I71B 5CILH 3QUXC 2EDTA 1N5YH 1K3IA 2JJVA 1VFUA 4WGVB 5GS0L 4OJFH 3RRQA 1GL4B 2ED7A 5GS0D 4JGMA 3MV7E 4TOYH 2YD3A 3KYOB 1CGYA 3FRUA 3O8XD 1MHCB 4GAYB 5FM5O 4CW1B 4K9EL 4WTXA 1XF2A 1UC6A 4NGHL 1TCRA 4WJ5B 3TVMA 5IVXB 3GJEB 3QP3A 1NLDL 3TBSB 4ODUA 1IZKA 2GTWA 4XX1E 3UJTH 1CR9H 3IS1X 1R3LA 5FUOH 4X4YB 3IJHB 4FZ8L 4O02L 2ICWI 1CVSC 3EDJA 5KSAA 1RJYA 2AEPH 1GJIA 2XZQH 3P0YL 3RBGA 3ILQD 1MUJA 5D7KD 4XTRC 2IPUG 2WBJA 3OAZK 2D7TL 3OR7B 5ESAA 4Z7NF 1NL0L 5E24E 2V9TA 5GIRB 25C8L 5GISH 2JB5H 3ZHLA 4DQOH 3OGOE 4JHZA 3DX6B 5EZIL 2BVPB 3UDWA 1S9XB 2NY1C 3D3VB 2Y07L 3E2HC 4OSUL 1ADQH 3CUPB 2CLVB 3FT4A 4NQEE 1NUFA 5F96L 1JMZA 4D9LL 4N5ED 1U8NA 1FNGB 2AEIT 3WEXB 2O61B 3RL2B 2KQMA 3NZ8B 3RAJH 2BOCB 5FHBL 3BKCH 1F58L 2BJML 1RZ7H 5ICYB 3KPQB 3VRLF 1BECA 5F88B 1XF5B 5HDBE 5TFSH 3RVVC 3S5LA 5IVNA 3LRGA 2C26A 5ICZB 1YJDH 1JK8B 4M7KH 4QGTA 1FNLA 3UBXG 3RPIA 4HDIB 4BSWA 1JMXA 3CH1A 2V7NA 1JNHB 5F7NC 3L1OH 3ECBA 5A3ID 4BZ1H 1VFBA 3MLPA 4F37F 2FWOB 2ZG1A 2A73A 4LSUH 4GMTH 1BQLH 3D2UD 3PWVB 1OTSD 4ELMA 4OB5H 3KYMB 1A1MA 3WFCH 3WFDL 4MD5A 1F97A 4AMKH 4X8XA 3EO9L 4PRNA 1WFOA 4MWFA 5GGRY 1UA6L 5JQ6H 3MRDB 3L3OB 4X6DB 2P8PA 3G08A 5D7SL 4EI5D 3Q6GH 4G42A 1RK1A 1QBLH 4Y16B 3NGBB 4OCRL 1BEYL 1KIRA 5GGRA 5BW7A 1QFWM 4MCYB 3MLYH 1LVEA 1UGNA 3H9SB 4CVXB 12E8L 3OB0K 2FBJH 4G6AC 2C9AA 2J5LB 1AD0A 4AY0A 1PZ5B 1JGDA 4HV8A 1D3CA 4FHBD 4MJ6A 2A9ML 1BD2D 5L0QC 1HHJB 4GBXA 4R0LB 3RA7H 4CDHA 5JO5A 4NRXB 3BN3B 5IROC 5J6GB 2JE8A 5MENE 2YPLB 3EJZD 1A1OB 4ZFOA 2QKIB 4XVUD 3SDCA 3LV3A 1RJLA 1U42A 2XKUA 1DR9A 1YNKL 1QVOA 5H37G 3T0WA 1KTDA 3RVUD 1E28B 4OBRA 1HKFA 3MRHA 4U3CA 3RKPA 4OQTA 4U6VH 4P2OA 4NQXB 1F90L 1YPZA 3PNWB 4LVHC 5FAAA 5BV7C 5CJ8A 5T5FL 5IIEA 3EYSL 1G9MH 3BJ91 4JDVB 1TETL 2PXYB 3LQZA 1F5WA 1UJTA 4QHNA 4M02A 3GZKA 4QLRA 1S7WA 1G7IB 1JWMB 1T5XA 2MTPA 5DZLA 1FNEA 1GSMA 2HJLB 2EKJA 2ZZUT 3MREA 1FNFA 1FH5L 2CJUH 1EEQA 2ICEB 5MI0B 3I2CH 4P4KB 5AAWA 4FQJH 3WDJA 1ZHNB 3GKWL 4NKIL 3T08A 1Z6JT 2XA3A 3QZWB 5ISZA 4JREC 3M17B 4PRHB 3CK0L 3QQ4B 1KCUH 3L7EB 1E4XH 4KK5C 2I9LA 1UWXK 5CP3H 1J0HA 4DK3A 5I1JH 3RQ3A 5KSUA 4EXKA 3I6KB 1CIDA 2ADFH 1DSFH 4JKPH 1Q9OB 4MXVE 4PBVC 3ZKMD 1KEGL 5LXGL 1I7ZB 2AAVA 3JUZA 3GMOB 4NM4L 4AM0A 3DSFL 1B0RA 2XIDA 5DD6A 5GGSB 1B2WL 4J3VA 2XKNA 5JUEH 3MRPB 5JW4N 3MOBL 4UV4H 5INCA 5KOVC 1VSCA 2VL5B 3HKFA 1QRNE 4TVPE 3WO4C 1AY1H 4PIRF 1RZGA 1ZHBA 4KJYA 3GBNL 3QPQD 2F5AL 3HFML 5TH2B 1NFDF 1Q0XL 2H6PB 4R4FH 3UMTA 3VDCA 5DC4B 1CFSB 1HI6A 1FDLL 3MXVL 4L1HA 4NQCD 3C8KB 4LPWA 5E8NA 3IKCB 5DRZA 1X7QB 4GG6F 4CL7A 4WWKD 4MA8H 4JDTL 1MWAL 1N26A 1DEEB 2C3VA 3TBWB 1BLNB 5EU6D 4L29B 4G6KL 1QA9B 3LH2H 4RWYL 3BUYB 3LKPA 4MJIA 5FA4B 3FQXB 1BPVA 1R5IB 4M61A 1GC1C 2XFXA 5EOCJ 4W81A 3NA4A 4IRSC 3UAJD 1BBJB 3G6JF 4PV8A 3BXNA 1E6JL 3QUYD 3K46A 3IDIB 3SDAC 2EEDA 3MRFB 3FB6B 1U3ZA 3LMJL 1I3GH 5M95B 4PB0H 4X6EA 1C8PA 4WDIA 4X6FA 3PQYA 4XPBH 1YN6B 2XPGB 5E99H 4PJ8C 5BJTA 3H42H 1SY6A 3EOBB 1BGXL 2GSIB 5DVNA 1FPTL 1SJHB 3Q5OA 4KKNA 5IESH 5EN2B 4ZODA 4DZBB 2IBZY 3KPNA 4MMXC 1PSKH 1RHHB 4UIKH 5HGAB 1MJJA 1A2YA 4XNUH 3SPVB 4M00A 3DLQR 4AG4H 3VXRB 3M1BB 4BZYA 4NJAH 3ULSA 4KTYA 1NAKH 1JJUA 1JNLL 3JV4B 3C09C 1JNNH 3L5HA 4KVCL 2FIKA 3C60A 3ZDYE 1CFTB 3GSOB 2FATL 2YC1B 3RVXD 1NGWB 2APWA 3MJ7B 3LPWA 1K4DB 4XXDA 2GI7A 1GZQA 4ZOAA 4LSSL 1OB1B 1CICD 3RPKA 4HMCA 1RURH 2DQCH 1EEYB 5CEZH 3QXDB 3BD4A 4TUJB 1RUQL 3TF7C 1BOGB 4QKXB 4LKCA 2VDMH 1G7QB 2VLRB 4MXQD 4S10A 2D31A 1INDL 4B41A 1BJ1H 3RWJB 5HYQA 4PY7B 2E8YA 4FS0A 2BNQD 2DQUL 1J8HB 1EFXB 1N2RB 5FECB 1U58A 5GS0H 5B38G 3I75B 5F1SA 5E8OA 4GAFB 1CD0A 4K55A 1B0WA 1YPZE 4ZNCD 1T6WA 5C70A 1Y6NR 1YY8A 4K9EH 5JPMA 1J5OL 4PJIE 4CMMA 4NGHH 4PJ8A 5L2JA 3QNXA 1NLDH 2YSSA 4EDWL 4MQ7B 1FIGL 4OF6A 4HS3A 1SBSL 4UZGA 2BY3A 1FNSL 1ZT1A 4O02H 5ACZB 1IEHA 1GZPB 3KPRB 5C07A 1T7XA 2V9QA 1S8DA 4JFPA 3P0YH 2UZIL 5D1ZB 3T0ED 2D7TH 4Y4FB 2VOTA 1NL0H 4Z7WF 4F3FA 1ZWIA 4NNXB 4R2GB 1LNUA 25C8H 1Q9KB 2FGWL 4NUJA 4ALAL 3GSRA 3KWWA 2VLKE 1G7PB 2F53E 2BVOB 1MI5D 4M7LT 5EZIH 1B4RA 3BGFC 4JM2B 1WFTA 1VPOL 2Y07H 3UPCA 1XZ0B 4LPUA 1OP5K 4LHUB 1J0KA 4R9HA 1KFAL 5H2BA 5F96H 4D9LH 4GJTB 1KXTB 3D9AL 4ESKA 3PABB 1Y18B 5GZNC 3KPSD 3BYYA 1EMTL 4KROD 5FHBH 5C0AB 4F7CB 1DQLL 5HJ3B 1F58H 2BJMH 4UIMA 2OTUB 5ITBL 1T20A 1HZHL 4U1MA 1DBML 1XGRB 2Z91B 1U8MA 5F89A 5T1MA 1FFNB 3R8BB 2P5EB 3V6ZB 1IL1B 3EHBC 4J4PC 5DA0B 2YUZA 5GSVB 5L2KD 4FQ2H 4Y2DD 4Z7VF 3DV4B 3H7LA 2N56A 3S4SA 1LEKA 4AIZB 2PO6B 4PJEF 3SKMA 1OAUL 2C3WA 2EIBA 2Z35B 3WFDH 4QRUB 3IFPA 2XWBA 3ZKNC 2IH3B 2WM0A 3EO9H 3RY5A 1PJ9A 1IGYB 1UA6H 3CFJB 5BXFB 4MA1C 1R24A 3O0RL 5DFWH 2A0LC 5D7SH 4Y5YB 3AGVA 3OB0H 1IM9B 2NZ9D 4OCRH 1KNOA 4MJIE 1NH6A 1ETZB 1BEYH 1FLTX 2CSPA 3AMKA 4FTVD 4R7NA 12E8H 4X4XB 3F8UB 4TYUA 4ETQA 4HK0A 2VIRA 3HR5B 5EOTA 3FOLB 4JY6B 4ZXBC 5IF0A 2A9MH 1NC4A 4NO2B 4N5UA 4GO6B 4QXWA 2VLJD 4NKMB 4F9LA 4P4RA 1ZLWK 1BZ9A 3PQYE 1N59A 5I71C 2CO7B 35C8L 5C09B 1ZOXA 2DQDL 1QR1B 3JVGA 3WNKA 3BDBA 1YNKH 4MJ5B 4M6NL 3VXSB 5CLTA 3OKKA 5D7LE 4EI6A 5I1HL 3HNVH 4KMTL 3TN0A 1JVKA 1VA9A 2ZCKL 4PGZA 3OGCB 5T5FH 3EYSH 3CIQA 4NKOA 5LWYL 1XMWA 4U1IB 1TETH 4U1KB 1I1AA 3HMXL 1LE5A 3PL6D 3CFKB 4I5BB 4EDXB 1B4JL 1IARB 4PJBA 4DAGL 1IBGL 1FFOA 3TIDB 4D9RD 3OKEB 4FXGA 4M6OL 2HT3D 4DN3L 2XN9A 3LKRB 3SGJC 3KPOB 4OQ1A 4F33B 1QPXA 4LFHD 3CLFL 4X7TB 1FH5H 5HYJD 1BVKA 3FTGA 3ARDA 5DVKA 1F13A 3E6HB 3GKWH 3O4LE 4NKIH 2IFFL 3WFHA 1JWUA 3H7BA 3P4LA 1FSKC 3BGMB 3CK0H 1WZ1L 2BZDA 1PEZA 5C0EB 2D7NA 4D0BB 3QEUB 1YNTA 3SJVE 4Z76A 1U8HB 3ULUL 4ZXBA 5FK9B 5ANMA 2P7TB 4TSBL 4TRPL 5BRZB 2VZVA 2DWEB 3ULUD 4K3JL 3GSVB 1G1CA 4WI2A 4C54A 1KEGH 3EYFB 4IIQC 1DANU 5LXGH 2EXYD 2DS4A 5EA0L 4X99A 4YHML 3SDDB 5K9QG 2NYYC 4NM4H 3DSFH 1NCNA 1F3JB 1ONQB 4CN4A 1B2WH 3LN4A 2EH8L 3ORJA 4XCNA 3MOBH 4M9PA 4YIQA 4WUUA 1T0NA 3WE6B 4PG2C 4YPJA 5J8OA 3GBNH 4TVSa 1ZT4B 2F5AH 3HFMH 2BHUA 1Q0XH 1A4KB 4S11A 3I6GB 3QXTA 2C1OB 1FDLH 1QHPA 3MXVH 5DS8B 2WIIB 4JDTH 3T4YB 1MWAH 1Z9LA 2JJSC 4I1NB 4F7TB 5AYUL 5IB2A 4KMLB 4JO4L 3VW3L 3CSYB 4G6KH 3E6FA 4RWYH 2FJHB 1AKJA 2CPCA 1FIEA 3LPGA 3MRNA 4KTDL 1DLHB 2XZCL 3P4MA 4LIQE 4BH7B 5F3BA 2IPKB 4ZQKB 3NCCB 1E6JH 4NWUH 1PVHA 4CGTA 1DUYA 4RMSA 2DJ4A 3SE9H 4PJDA 3LMJH 4JPIA 2A77L 4MCZA 3UTTD 4P9HL 1I8IA 4ELKA 1DQML 5E0QA 1ZHLB 4JZNB 4HG4J 2ZKHL 4NNYB 3KXFD 2VLMD 4OFIA 1OLZA 1LE9B 1IEBA 1BGXH 4XC1L 5IW6A 1FPTH 3D18B 3VI4F 1DCLA 2DLTA 1A3QA 1J8KA 1AQDB 5FUZL 3K8KA 1T1XB 3QPXL 3WNMA 1MFNA 3DO7A 2HT4C 1I8KB 2HVKA 2R4RL 4YHNA 5DUPL 1DVFC 3LN5A 2PXYC 4PRAA 4Y19D 3RVTC 5CJOL 4LPTA 4PRIB 3M8OL 1AGDB 1JNLH 2IWGA 4BFIB 4PG2A 1KPVA 4KVCH 3AXLB 2NY0C 4HJGA 1CFQA 1I3UA 2ARJQ 4UI2A 2FATH 5IB4B 3QHZL 4JQXC 5HHOA 1UCTA 3RBSA 1IMHC 4XMLH 5IM7B 5F7FA 4B7LA 2X4PB 4CVWA 2P8LA 3GMLB 4KHXL 1QEWB 3PWLA 4LSSH 2X4OB 4P4KC 1QACA 2A83A 4WI5A 3WMSA 4GG6B 1R5WA 4WGWB 2H26B 2JJSA 5B3JE 4HLZH 5GRJL 4APQB 1RUQH 3PDOA 3KYNB 5C0IB 1JZ2A 1WUNT 2HLFD 4HWEH 1HHIB 3L3KA 2WZPD 1INDH 5EC1A 2V7HA 2M2DA 2R23B 4WTZG 2DQUH 1DDHB 4K7FA 3LRHA 1OPGL 3MNZB 4OGYL 4RMTA 5HHNA 3X11B 3PGCA 1AHWC 1TJIL 5ENWB 4AK1A 3HAEG 1U92B 4X5XB 4P5KA 5C86A 2ERJB 3N1MC 1CT8A 3ULVL 4U1SA 1F11A 1EVTC 3GMQA 4YNYB 2IEPA 4OF7A 1J5OH 3DXAB 3ULVD 3F58L 2ZUSA 3OX8B 5BMFL 4EDWH 3QDHA 3D2UB 4EJ1C 1FIGH 1SBSH 1EEZA 3QDGD 4TN9A 4GS7B 1FNSH 2OP4L 5ALBL 3ARBD 5DJ2B 5TE6L 2XN9E 3MFFB 4O00A 3WHE0 3F7PC 2UZIH 2OZ4L 3HMWH 2UV3A 2UZXB 1T4KA 4I4WB 4PJXA 4OZHA 4XWOC 2VWEC 1KG0B 1OP5H 3IF1A 3C6LD 2FGWH 4ALAH 4JFOA 2BMKA 3DX8A 5JHDA 1QLRA 3GSNA 4GG8A 3UXFA 2H3NB 4K3EL 1T6VN 2DAVA 5J1AA 1VPOH 4QXGL 3C5ZC 3Q3GB 1FNHA 4KGLA 5C1MB 2IQ9L 1NFKA 1KFAH 5E2WL 4HXAL 1BD2B 3D9AH 2EC9U 1I4FA 3IDGB 1Y6MR 2VB5A 3V5HA 5DR5L 1EMTH 3TV3L 1DQLH 4WU7A 4JHBA 5DD3L 4QHUA 1OGAA 1HZHH 1DBMH 3TA3D 4RMQA 2APXA 2GTZA 2EDOA 1GIGL 2PYFA 3MRKB 4U49A 2BSRA 4HGKC 1F4WL 1NGPL 4S0TD 4WUUE 3WFZA 4XVSL 2BRQA 4LBEA 3MPCA 1AIFB 2ATKB 4MNGB 5K9JL 3SCMD 4K71B 3MBED 4IRZL 3HG1A 4RIRB 1GAFL 2VZSA 1DUZA 1OAUH 1H9VA 1HDMB 5LAXB 4N8PA 5E8DL 1A7QL 2ARJA 4Q2ZA 4UILL 4FQXB 5HVFB 2FL5A 2N7BA 3O0RH 2OBGA 3GMPA 1DN2A 1RVFL 3RJDA 3U46A 2C7UA 4RGND 5IEKB 1WEJL 2VAJA 2HN7A 1I85C 4G8IA 4AENB 5C0GA 2VR5A 3PJSB 3EO0A 1VEMA 2OJEB 3GK8L 4ODTL 3DGGA 1OY3B 4EN3A 2FECL 5JXED 3TPKA 1UADC 5HHMD 2Z0BA 1T7VA 3C5ZA 5EIVA 1N5AB 4PJDE 3X12A 4QHMA 4PGEA 5T3XE 5JPNB 1XCQB 2E9IA 1JTOA 35C8H 4P2QB 5HI3C 4BJLA 5L8JB 4UB0L 1ZVSA 4U7KA 1PZUB 4OLZL 5SV3A 5DJ8A 1R5VB 4M6NH 1NEZA 1YJDC 1R3JB 5D7JC 1SJVA 5I1HH 4KMTH 1UKQA 5FYKE 4NO3B 5IQ9A 3LN9A 3V7AG 3VXTA 2P8MB 2ZCKH 1G6VK 2NQCA 2BOBB 1AD9B 3VWKD 4ZOCA 3HUJA 1SYSA 4PLOB 5LWYH 5I1KL 3RL1B 4JZJA 3DOSA 3R0NA 4Z8FL 3HMXH 3BRDA 1SHMA 4RISL 3QDAA 4LKXA 5HHOE 1U95A 1E6OL 3GFUA 1B4JH 3LS4H 4DAGH 1IBGH 4UOJA 4PJEB 2EEAA 4M6OH 4BH8A 4DN3H 3UTQA 5BS0B 1D9KA 1ZEAL 5MERA 1O5DT 1FZOB 4Y4KA 1EPFA 4TTDD 1AR1C 1TITA 4XP1H 3IJSB 3CLFH 4KI1A 3B2UC 4GW4A 4Z77A 3QDJB 1G0DA 4DWHA 3V5DA 4XH2A 2ZCLL 1SBBA 2IFFH 3T0VA 4YHZL 3MRLB 3W0WD 5C0CE 5IFJA 2W0FA 1WZ1H 1MSPA 1FFPB 4HQQL 3VGDA 5I66B 2QQQA 1ADQA 6FABL 3QUYB 4MHHG 2PYEA 3MGAA 3ULUH 2R29L 4RFEB 3PGDB 3ULVF 2A6JA 4TSBH 3B9DA 1U3YA 4TRPH 1C1EL 3FO2A 4LPXA 4K3JH 5SWSA 1OAZL 2XWTA 5EA0H 4YHMH 3ILPA 4JRYD 1CU4L 2AJVL 3ARGD 3OV6A 4Y0GA 2EH8H 1MY7A 5JQHC 2EDEA 3NPSC 1NGXB 5D7JA 2PCPB 4GT7A 1QZ1A 1OF2A 3WUWB 3ARED 3K3QA 1XFPA 4XBEL 1JRHL 1HCVA 2VKWA 5GZOC 1GGBL 4X7EC 2KKQA 5GS3A 1ED3B 2KZWA 5JHDE 2F54A 3VD7A 1RIUL 1XAUA 3GJFA 3TO2B 4PJAF 4JVUA 1CFNA 5CJXC 4J3UA 4X7SL 4FXKB 2IAMA 1GCFA 5I1AB 2Q6WB 4NZDA 2AJUL 4HKBA 2B39A 5AYUH 1CICB 2EIZA 4JO4H 1QSFE 3VW3H 2BERA 5DEZA 5IFHL 3NMEA 2UWEF 4M7ZB 4WU5A 1OGAE 4KTDH 5JA9A 1JGLL 3VMNA 4P57A 1QSEB 2XZCH 1MEXL 3T2QA 5FKPB 1OTUC 3V7AE 3DVGA 2BNQB 2VQ1B 3EOAA 4LLVA 2JK5A 1T0PB 3ZKXC 3PWPA 2WUCL 3PDGA 4K7PY 4P5TD 3SO3B 4KTEL 2A77H 1R3HA 5I76B 2YA0A 2XTJE 1BWWA 2VABB 3ARXA 4P9HH 5T1KB 2CKNA 5I9QB 4HGMA 2ZKHH 1A6VL 3HG1E 4U1HB 1YNLL 1I7RA 4XC1H 3DX9B 4P2RD 3DYPA 4GQPH 3R8QA 2AXJA 4PS4L 4C4KO 2GJZB 5F6IC 1NSNL 4G9FA 1LO5A 2Z31A 5FUZH 3WS3B 3QPXH 4UOW1 2AV7A 4I3GA 1OT1A 4GXUN 5DUPH 1FVCA 2X9XA 4OZ4B 1DN0B 2APBA 3T0EB 3QXVA 4R7DA 1BIIA 5CJOH 3F7YB 2ICWA 3WL9B 3M8OH 3FN9A 4ONGL 1UB6B 1DANT 5E7FA 4NN6C 2YD9A 1CN4A 4KI5E 3BH9B 1XEDA 3QHZH 5LBSL 5CJXA 1YYLL 5D6CA 3OG6B 4U1JA 1N6QL 4JFED 4YDIL 3WHXB 1KYOJ 1INEL 5FYLL 4KHXH 4E42A 3MNVB 5D1XC 4WIQA 5CWSB 5CBAA 5FYLD 4LMQE 4OUUB 4IRJD 4P0DA 1FL6A 5GRJH 3MX0A 3QXUA 4KROB 2X70B 4RQQB 5B39A 3GHBL 4MA7L 2AVGA 1FN4A 1OP3K 2AQ3A 2CDEA 3LS5L 4R4BA 3JWNC 1TIUA 4H25A 4U2ZA 3CCHA 1OPGH 4OGYH 5KG9A 4PRPD 1TJIH 1NLBL 2OR7A 5C0JA 3BWAB 3S3JA 2RQ8A 5DSCB 2X4TB 3MLUL 3ULVH 5T3ZL 1FQ9C 3HUJE 3AU1A 4Y2DB 1YUHA 3F58H 3TPUA 1CL7I 4KMQA 5BMFH 1P4BL 5GGQL 1UJ3A 1C5CL 2OP4H 5J13C 3G6DL 5ALBH 5KVMC 4KK6D 3VGBA 2EE2A 4J6RL 4QOKB 2OZ4H 5C0DA 1NANI 2Y36L 1RFDL 3FQRB 5C9JA 3D39A 3RNQB 3U36A 1GGYA 2EDBA 3QIBA 2PTTA 5I8OL 1UKTA 4L4VB 1QPPA 5EBWA 1KB9K 4ZFGL 5K9OB 2OQJA 5TDNB 1WFUA 4K3EH 2DLEA 4DFIA 3L9RB 4QXGH 3OAYK 3QNYB 2EDWA 2IQ9H 3HZMB 1E4XI 5E2WH 2PYEE 5CHNA 4F58L 4I0PA 2FHFA 2VLJB 4D9QE 3O3DB 5D1XA 4DVRL 3O4OB 5F7LB 5BO1L 1HQRB 3QFJA 4OD2B 5GGVY 4QXUL 5SWSE 1XF3A 5DD3H 5D5MA 4LCIL 4FP8L 4PJ7F 2DQTL 5CMAB 1JPTL 5EU3B 1A3LL 4XGZA 1GIGH 3E8UL 1NDGB 3O8XC 4P3DB 3MXWL 5DJ6B 3X13B 3QIWD 1F4WH 1MCDA 2QHRL 2JJTA 4OZIA 4MAYB 1NGPH 3DVIA 5T1LA 4K9EC 5JORB 4NKQB 2I27N 5E08L 5K9JH 2NR6C 4IS6B 4PB9L 2FRGP 4IRZH 5F7DA 4TUOB 1GAFH 4MNQE 1T1YB 4LLUA 3GIVB 1RUAL 5E8DH 3SDXE 1A7QH 3ILQC 4UILH 4I9WE 4CMHC 3L3IA 3BT2L 3D5OF 3NTCH 1RVFH 2ORBL 4UUJA 4I0KA 1TPXC 3VFNA 1CG9B 1WEJH 1F6AA 5CJ5A 2X10A 1FZJA 2E9BA 1CGWA 5D1QC 4MQXC 1CWVA 4I13B 4CN1A 3GK8H 4JO3L 1HSBA 1J87A 4ODTH 3VI3E 4R3SA 4IBLT 4V1DD 5I1LA 5ESQA 3PWPE 3V0VB 4JANA 3V6OE 5CGTA 2C4FU 1ES0A 3SGEI 3UZQA 3QQ9C 4OLZH 3T3PE 1P1ZA 2X4RB 4PJCA 5L8LB 5ICXB 1RZFL 3ARUA 3UO1L 4M1GL 4ODXA 5A3IC 3SE4C 3O8XA 3SDYL 3OKOB 4M93B 3ZE2F 4GS7C 1OT2A 5I1KH 4Z8FH 1S7VB 4RISH 2Q86B 3ZYIA 1A47A 3QBTB 5ERWA 1E6OH 2HG5B 2YD6A 3MRRB 4EI5C 4FXLA 3GKZA 3X14B 1RULL 1NMBL 1ZEAH 1BZ7B 4J7RA 2X4NA 4XP9L 2HVJB 1SM3L 4YXKL 4Q9RL 4JFFA 3ZKSD 1IGJA 1C08B 4KPHL 1XGQA 2ZCLH 2C1PB 4M43H 1L9NA 3EBAA 3OKMB 4YHZH 3BD5A 4GUPA 2E7LC 5D1QA 3W11D 4G8GA 1JWSB 4HQQH 1BFOA 4NO0D 3MV7D 3GMMB 1T21B 3MRCA 3QWOA 4FNLL 6FABH 1G6RA 3DTXB 4Q6IB 4HUKB 2R29H 4ZUWB 3RDTA 4XVUC 3DO3A 4ODBD 5FGRA 4BSVA 1C1EH 3S36X 5B8CC 5FKAB 3W39A 5KSVA 4E0RB 3HR6A 3ES6A 4PREB 5EUOF 2DOCA 5F9JB 1OAZH 1MCBA 4WHTB 1MAML 2AJVH 5HGDB 4YPGB 2CR3A 3RVUC 1HOCA 3VFVA 5CZXD 4KVNL 1G0YR 4FQ1L 3FN0L 4X4ME 3BZEA 3VFPB 3MMEA 3FN3A 3AY4A 2J8OA 4GOSA 3ZTNL 3FCTA 5CJQL 4XBEH 3MRQB 5DFTA 2NTFA 3D39E 4PJFE 3B9KD 1QFWL 3RWCB 3DGCR 4D8PB 2I5YL 5IG7A 3QEQE 1RIUH 2XY1A 2CLRA 3LIZL 3BH8B 1UCBL 2QSTA 5D2LF 4NQED 2J2ZA 1S7QB 4OLWL 4X7SH 1U8QB 3UTZA 3P77A 4AIOA 1BQSA 1OSPL 3QIUC 3OJVC 4EI5A 2AJUH 1LP9B 1WT5C 1WBZB 5HVGB 3HI5L 5DRXB 1QP1A 5FGSA 2DJSA 5IFHH 3QFJE 3C5JB 5I75B 3FB5B 5D5ME 3TJHD 3D25B 3QI9A 1UZ6E 2R39A 4L4TA 2PW2B 3BX7C 1MEXH 4ZPTA 5JLZA 8FABB 2APTA 1UH2A 3ZZ1A 2QADC 4OZIE 2J8UB 1ZS8B 2WUCH 4G8FA 2X89A 4LQ1A 1D5BA 4KTEH 4G8EB 3ZKMC 3AC0A 4L8CA 3VH8A 3HC0B 4TNWK 5B8CA 1A6VH 4HCRL 3IETA 1J12A 1YNLH 3FB8B 3QDMA 1NMCB 1B9ZA 1EJOL 2CH8A 4EVNB 3WNLA 4PS4H 4NNPH 1NSNH 4M5ZL 1IZJA 2VSCA 4I18B 3JWDL 3ZSSA 1KPUB 1UQSB 4I0CC 5IB3B 1BFTA 3VFWA 5J11B 1I7UA 3QPQC 4GLRH 3DUUA 1QBML 4GKNA 1KB5A 4ONGH 4QY8A 4YDJA 4MD0B 4Y88A 1MFDL 2N7AA 2VE6A 1MCSA 4U1GB 1IAMA 3C6LB 5E9DA 4YH6A 2B5IB 4FQPA 4WWKC 2WP3O 1UH4A 5LBSH 2R2EB 3HI1B 1YYLH 1N6QH 4RAUB 4L9LB 4YDIH 4AT6B 1S3KL 2DRUA 3S3PA 1INEH 5FYLH 5MEND 5L9DL 1T89C 3BW9B 3QIUA 1FAIL 1N8ZA 5FIEA 1I8LA 1EO8L 5IBTL 4EUPH 3A67L 5SWZA 2ZJSL 4G7VL 1TJGL 3GHBH 4MA7H 3LD8B 4X4ZA 4C59B 1KJ2B 4LCUA 1MQKL 4PR5A 3QUYC 4P46D 3LS5H 3EOTL 5HDLA 1XGTA 1KJ3L 2UWEB 4PJCE 3MROA 1TZIB 1N3NB 4GXVL 3REVA 1V3JA 1BP3B 1NLBH 2LABA 4MLSA 1G84A 4Z5RB 5AZ2L 4D0DB 2CIKA 5TE4L 3F7QA 1S78D 2HJKA 5IKCB 4LSRL 4G43A 3TFKD 4GRWE 5JZ7D 5T5NG 4L8DA 2GCYA 5DD0L 4PJGF 4JRXB 3SCMB 4XZUB 4UAOB 2WAHA 1P4BH 5GGQH 5FO8B 1D5IL 2W92A 1C5CH 3TYFB 3BVNB 3G6DH 5EO0B 5FV2A 2YKLL 4FQLL 2V2TA 5DUBB 4KHTL 3CMOL 1MVFA 4H5SB 3RJQB 4OCLC 4H0GA 5DRNB 4XNYH 1CTOA 1H5BC 4JFFE 5F9OL 2D9QB 2Y36H 1RFDH 3OAYH 3VFSA 2EO1A 5I8OH 3QHFL 3PGFL 1U6AH 4ZFGH 3T8XA 3QUZB 4G8GE 5FO9B 1XR8A 1KIPA 4WWKA 2YR3A 4ZO8A 1FZMB 1Y6KR 1H3XA 3BP4B 4FZEL 3W2DH 1S9WB 1KPRA 3KLSA 1JPGA 4F58H 5IHZA 4ISVB 3EDFA 1D6EA 3TVMD 3S37X 2BVTA 1T89A 4DVRH 1MVUA 4MXQC 5BO1H 2GITB 1M05A 4NKDB 2BVUA 3RNKB 4QXUH 3CSGA 1JPSL 4LCIH 3TH3T 1F42A 2XQBL 4FP8H 5KSAD 5JW4M 3E1F1 4Q9BA 2DQTH 2QQKL 3SO3C 4TVPL 4S1DD 5DHYB 1A3LH 3E8UH 2MWCA 4TVPD 3MXWH 2QHRH 1Q38A 2IF7A 5KAQG 1INQB 1S5HA 2NXZC 1KXVC 3GGWB 3VG9C 3IB4A 3MGTB 1I1YA 3V6FA 3O9WB 4O2CB 4X7FC 5E08H 1JF1A 1TFHA 4PB9H 5IOPB 3OQ3B 4QHKJ 4OZFG 2E5EA 1YY9D 3F12B 1HXMA 5CKGA 3BIBX 2XQYG 3DX7A 3G9AB 1ACYL 4KRLB 5INDA 4ODWA 1RUAH 4ZOEA 5MEOA 1QKZL 5I19L 3JTTA 1O7SA 3BT2H 2ORBH 4Z6AT 5JIPA 2YBRA 4BK5A 4Z7OF 2J12B 1H5BA 1FCGA 1FZKA 4DW2L 5KS9A 3LEYL 3BYTA 4HUMB 1BREA 1TVDA 5ID0A 4L4TE 2R2HB 5JW3L 3TBTB 2MJWA 1TMCB 4M03A 3W0WB 3VWJD 3HS0B 1DE4A 4TNWF 2HP4A 3K1DA 1FG2A 1T22A 2Y23A 2VXUL 3K4DA 1OD7A 2EYRA 2ATPB 5C08A 2DMKA 5EC2A 5L7XH 4H1LB 4N1HB 3AUVA 2HH0H 4HKXB 3QDME 4QNPE 3AS2A 3SQBA 5GS2D 4U6HB 3RY6A 1FV1A 1WIOA 4KH2A 1DQQB 2XTLA 3ARGB 1RZFH 3UO1H 1MLCA 4L8SC 4PJ7B 3HI6L 2E6JA 4OV5B 2V5YA 3WN5C 4M1GH 2B1AL 3IFOA 4LCCB 3SDYH 5AYQA 2W9LA 2WW8A 3OJ2C 5EPMA 3AREB 4LOUD 5A2JH 2YRZA 4YK4B 1U3HB 5E8EB 4NBZB 3NIFF 2AQ2A 4GKSB 1FO0A 5E9DE 2NY1D 1CXFA 4GBXD 2HKFL 3TBVB 3EJYD 4C56B 4F7PA 2YXFA 4ZFOL 5JIKA 1RULH 1NMBH 3T0DA 2NZ9C 2AV1B 3MYZA 3IDYC 4XP9H 2V17L 3TIEB 5C0BA 3SDCD 4D0CA 1LO3L 3HE6B 1DTUA 1K3ZA 1T7WA 1SM3H 2CKBA 4YXKH 4F7MA 4Q9RH 5SWZE 5D96C 5CBEA 5IP4A 5FYJU 4KPHH 5J4MA 3LDBB 1C12B 4OQTL 3OJMB 1T04A 1MI5A 4QRSB 2MNUA 3S37L 3FFCA 4P2OD 2NNAA 3WKML 4FNLH 4U33A 1H0DB 4NQDA 4P5TB 4ZDHB 1FJ1B 4IJ3B 3IDJB 3KYOA 1MHCA 4GAYA 1MAMH 1MHEB 3IRZA 3REWB 5I0DA 2FBOJ 2UUDK 3CDYA 4KVNH 4RA3A 4RDQG 5I6XC 4XP4L 4FQ1H 4MB4A 3FN0H 5JW5B 3TBSA 4Z7UA 1WCBB 5KVGL 4KKLC 5E5RB 1OSZA 4IOFD 3ZTNH 5EO1A 5L2KA 3FFDA 2B8OT 5CJQH 1A7BA 2Z8WC 4DUWA 3PL6C 4WV1C 1QFWH 2VNCA 1QO3B 2YD4A 2C4FT 4AYFA 1U2HA 1T5WB 4G6AD 5E8PA 2I5YH 3U0TB 2E9WA 3LIZH 1UCBH 3SGKC 2HT3C 2VDKL 3VCLA 5GIRA 4OLWH 5IVZA 3NCJL 3W5MA 2ZSWA 4KAQL 3HAEB 2JELL 3LEXA 1QFHA 3DX6A 1MCHA 2GAZA 2BVPA 5J7CC 1S9XA 3D3VA 4JPKL 5FB8A 3SN6N 3HI5H 2CLVA 4PG9B 5GRUL 3QG6B 3NCFB 1F4AA 5CINL 1KF9B 1W8OA 1CQYA 2D4DA 5D2NB 2WQ8A 4TSCL 1MRFL 1W72A 3RL2A 1HH6A 4JG1L 1BX2B 3DMMB 4DGIL 2EDKA 4RMVA 2AKRB 3DYOA 6CGTA 2WSKA 5IB5B 1AXSA 2ZOKB 5ICYA 4PRPB 4DTGL 3KPQA 3RWEB 3ULUC 4JKKA 3EOYG 3VGAB 4BZ2L 3GIZL 5F88A 1XF5A 1X5JA 2EXYC 4X83A 4CADA 2P43B 3QJHB 1JK8A 2BY2A 1G7HB 2BHZA 2VN7A 4HDIA 2OTWA 5DJZB 2IC2A 5FGBC 4HCRH 3O3BA 4QHLB 1EJOH 2DI9A 2AJZA 5HD8C 2ESVB 1TJHL 4NM8L 3G5VB 4U3XA 1GRWA 3WLBB 4M5ZH 5ADPL 3JWDH 4N9OB 3PWVA 2IANA 5ITFB 3VMPA 3RWIB 1MHPL 4HIIB 3KYMA 4MJID 3NABL 3T3ME 1QBMH 4G7YL 3WNNA 1VKXA 5KS9E 2AK4E 3EFDL 3MGOB 3LPFA 3MRDA 1MFDH 4F15C 1I8MB 4W4NA 3MRMB 3AAZA 5HPOA 1DFBH 4Y16A 2W1NA 2WBKA 4KK5D 3SGKA 1SY6L 4M8VA 4YBQD 1H3PL 4MCYA 3PQYD 1S3KH 4CVXA 3CDGB 3CU1A 5L9DH 4ELMF 3CZFB 1PZ5A 5C08E 1FAIH 1EO8H 4PBXA 2H32A 3A67H 5IBTH 3C08L 4KV5E 2D0FA 4G7VH 1TJGH 1D7FA 1HHJA 4R0LA 5KZCB 4GH7B 2D0HA 5DURD 4NRXA 4NC1C 1MQKH 5J6GA 1MHHB 3EOTH 3L5WB 1A1OA 1KJ3H 5DZNA 1KB9J 4HEME 5I0ZA 1C5BL 1X4ZA 4NZTL 2HJFA 4GXVH 4W4OC 5AZ2H 2AJ3B 5TE4H 3QIWB 1S9YA 4P9HC 4LSRH 5KANI 3P11L 3C60D 5I8EB 5ACLA 3KHOA 5BZDB 5E7BA 1JE6A 4XB7A 1E28A 3QWRA 5DD0H 5C6TL 4UTBL 4CU6A 3PNWA 5FGBA 4OLYH 1D5IH<