1HAUA

X-ray structure of a blue copper nitrite reductase at high ph and in copper free form at 1.9 a resolution
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
336
Chain Sequence
QDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title X-Ray Structure of a Blue Copper Nitrite Reductase at High Ph and in Copper-Free Form at 1.9 A Resolution
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 89
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2001-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1hauA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1hauA02
3PAVA 1BQ5A 2IWKA 3WKPA 1MZZA 3NJLA 3SBQA 4BDVA 1W6WA 4ZK8A 1ZV2A 2CALA 1IKOP 2UX7A 5ANHA 1NIEA 1KDIA 2DYSB 2X88A 5I6MA 3GYRA 3NSCA 4DP6X 5I6KA 3IEAA 1EHKB 3HB3B 1JZGA 2HX9A 1RKRA 1AR1B 1PAZA 5D4HA 1DYZA 4G70B 2QDVA 3ABMB 3C75A 4YL4A 4HZ1A 1AZBA 3CZUB 1AOZA 9PCYA 1XB6A 3FSAA 1AS8A 2JXMA 2XXFA 2FNWA 2VN3A 2WO2B 4JKNA 3NJFA 4HCIA 1NWOA 5PAZA 3NJHA 5EHFA 1UATA 5B1AB 1WS8A 4YSUA 4L0PB 1V54B 3BQVA 2UX6A 4DP8X 2PPEA 2FT7A 5F7BA 4A2EA 3AG1B 3FU8A 3D12B 3IN0A 3S8FB 2AANA 5F7AA 1HAWA 1WS7A 3X1FA 2OJ1A 2AZUA 4G7SB 1A65A 2HRHA 1CYXA 2JKWA 2VW6A 5B1JC 1W8EA 2B3IA 2FQGA 3OM3B 1NICA 2IDSA 1AZCA 4DPBX 1N70A 2YAMA 4PCYA 1TEGA 2W88A 1NINA 2I85A 3T71A 3KW7A 3H4FA 1E65A 4A2GA 2PCFA 7PAZA 2J5WA 4K9JA 1B3IA 5A7EA 2PPFA 4KOBA 3EHBB 1OE3A 4AKPA 2VW4A 2XLLA 4QKTA 1URIA 4M4RB 4FA7B 4HAKA 2UXFA 3UABA 3FYEB 1TU2A 1PLAA 1JXDA 3TASA 2CCWA 1OF0A 1SNRA 5B1BB 5TK4A 2ZWNA 5B7FA 4HCFA 2IDQA 4E9YA 3NSFA 5I28A 5I6LA 2TSAA 2EINB 1SF3A 3CVBA 2AVFA 1OCOB 3X1BA 5B7EA 2E86A 3H4HA 3NT0A 4G7QB 3AG2B 4P5SA 2P80A 3NJGA 1PCSA 2CBPA 2EIMB 3FSZA 3FQYA 4YSQA 1AG6A 3X1EA 1L9TA 2YAPA 3UADA 1BXAA 3L45A 1BQRA 3V9CA 3X2QB 3EH4B 3OMNB 2HRGA 4QLWA 1RZQA 3NJKA 3UACA 4F2EA 4E9VA 1PLCA 1JXGA 2DYRB 1GY1A 6PCYA 1HFUA 2DWSA 1MG3C 4UANA 1AQ8A 1WA0X 2I7SA 4JHVA 4YSTA 1A8ZA 4Q8BA 4P5RA 2HXAA 1NIDA 4YSSA 3NP3A 2DWTA 3MX0B 1V10A 1A4AA 4BWTA 2TSBA 4HHWA 3CVDA 2RACA 3FSWA 1GS6X 4N4YB 4AKOA 3EH5B 2GBAA 4A2HA 3UAEA 4YSCA 4TXVB 1QLEB 3SBRA 1JXFA 3DIVA 2EIJB 3ABKB 3NJJA 2VM3A 4YSEA 6PAZA 5FC9A 3JTBA 3RYMA 2ZONA 1KDJA 2FTAA 3V9EA 1YLBB 2BZ7A 4DP7X 2PPDA 4GYBA 1BQKA 3ASOB 4PAZA 5B1KA 3EF4A 3GDCA 2Y69B 3S3BB 3ZBMA 1E5ZA 3ABLB 3NYKA 4KOCA 1M57B 2J55A 2XX1A 2UXVA 1ASPA 3WIAA 1JZIA 2VSMB 1AACA 3DTUB 3QPKA 4YSRA 1GS7A 4YVNA 1KBWA 2XV2A 1KV7A 1AS6A 2BP0B 3FPYA 4BXVA 2FQFA 4A67A 5B3SB 4E9QA 3S8GB 1L9OA 2IWFA 1NTDA 3ABGA 2BP0A 1N68A 2GC4C 2HZHA 1X9UA 5D4JA 3NSYA 1MZYA 1AG0A 4GP4B 5D4IA 1ADWA 2CAKA 2BW5A 2IWEA 3CG8A 4G71B 2QT6A 1OV8A 4CSPA 4NB7A 1J9SA 3QJUB 2XUWA 4E9WA 3WKQA 3UGEA 2BO0A 2GHZA 4Q89A 3NSDA 3OQRA 1NIAA 4RH4A 2YARA 1CUOA 4DP1X 1CURA 3S3CB 4DP9X 1ILUA 2YAFA 1SFHA 3AG3B 3QJSB 1SJMA 2X87A 2DV6A 8PAZA 2QPEB 1JZEA 1TEFA 1NDTA 2R7EB 3OD3A 4N8UA 3FU7B 1JERA 4KO9A 1E30A 3NP4A 1JVLA 4GXFA 3TU6A 2GB2A 3FU7A 2AFNA 1BYPA 5I6OA 1EZLA 3IBOA 4A68A 4DP5X 4DP0X 2VW7A 1NWPA 1WAEA 1ET5A 4FAAB 2B08A 2HX7A 3WI9A 2XX0A 4KNSA 1R1CA 4GY4A 4F2FA 5I5IA 1KBVA 1E67A 1CYWA 3ZDWA 1BEXA 1WA2X 4YVUA 2FQDA 3WNJA 2XWZA 1MG2C 2FQEA 1AZRA 3AY2A 1XB3A 1AZNA 3FS9A 2PPAA 5I6PA 4YSOA 3ZX1A 3SQRA 1BYOA 2PP7A 3ZIYA 3BVDB 1A4CA 2DY2A 1ID2A 1XMEB 2YXWA 1BXUA 1VLXA 1ZDQA 1A3ZA 3IN2A 4HALA 4W9ZA 4X4KA 1JZHA 5AKRA 3GXUB 1WA1X 3S3DB 2XYBA 2YAOA 2XU9A 3QJTB 1J5DA 2BWDA 2FT8A 1PNCA 5I5MA 1XB8A 1I53A 1KYAA 3CDZB 3QJVB 1J9QA 2QPDB 5PCYA 2EIKB 3G5WA 2BHFA 1SHWA 2JFCA 4DP4X 2H47C 1SDDB 1AS7A 2XXGA 1ZIBA 3FSVA 2EILB 5AFAA 4HCGA 2UXTA 2PPCA 1OE1A 4A2FA 2OCCB 1NIFA 3N2JA 2HX8A 1HAUA 1ASQA 4KO5A 2Q9OA 1AAJA 1IBYA 4BDVB 2J57A 3OMIB 3T6WA 2A3TA 1NIBA 5AZUA 5B7MA 2I7OA 1FA4A 1L9QA 3PPSA 1L9PA 3KW8A 1IBZA 1KGYE 1V55B 2YAEA 3ERXA 1NPNA 2BZCA 3UAAA 4BWUA 2BW4A 2J56A 2H5UA 4E9TA 1GSKA 3PXLA 1PMYA 1QNIA 4JHUA 1MDAA 4G7RB 1FWXA 2IDFA 3T6XA 1GS8A 1W6LA 1JVOA 1JOIA 4MFHA 2BP8B 2UXGA 3ASNB 2P80D 4DPAX 3OMAB 2BP8A 2CJ3A 4G72B 4AZUA 1AANA 2YAHA 1X9RA 2XV3A 3X1GA 2GIMA 1BAWA 3QJRB 1AIZA 1CC3A 2VMJA 1PZBA 2FT6A 4HHGA 3WG7B 4HIPA 1AZUA 2YXVA 2MTAA 4BK5C 1OE2A 1J9RA 1ZDSA 3QQXA 1GW0A 4WTQA 4AI7A 4NAJA 2YAQA 3PAUA 1GY2A 2VM4A 2QDWA 2WSDA 3FPXA 3FT0A 1RZPA 1ZPUA 2PP9A 3T9WA 2CUAA 2H3XC 3TBBA 3HEIB 4A66A 2IDTA 2AZAA 2GC7C 3NJMA 4GP8B 3CVCA 5TK2A 5LDUA 1ET7A 1J5CA 4AKQA 1ASOA 2HLEB 5I26A 4DPCX 1PLBA 1JZJA 3MBWB 2Q5BA 4UAHA 1JZFA 1OCRB 1PZCA 2R7EA 3FYIB 4KO7A 4DP2X 2PP8A 4YSDA 4M3HA 1ETJA 2ZOOA 3FQ1A 5I5JA 1M9WA 3AZUA 3FU9A 4UF7C 1GR7A 1F56A 2PCYA 4NERA 2XV0A 3TA4D 4E9XA 3PLYA 3NJNA 1ILSA 7PCYA 1PY0A 1J9TA 1OCZB 1ZIAA 4WKXA 3T6ZA 1E5YA 5IY5B 4F7KA 2OV0A 3WNIA 4BXSV 1IC0A 2IH8A 1OCCB 1GYCA 1OOWA 3TBCA 1A4BA 3H56A 3DKHA 4KNUA 1BXVA 3NJIA 1PF3A 1NZRA 1KCBA 4EF3A 2PLTA 4E9RA 4ENZA 4W1TA 3FQ2A 3EH3B 1ET8A 3X1NA 2LLNA 1SF5A 2ZXWB 4E9SA 4GP5B 3SBPA 2Y1AA 4CSZA 4A2DA 2NRDA 1KCWA 2IAAC 2N0MA 2IDUA 1L9RA 2XVBA 2YQBA 3PCYA 3T6VA 2BWIA 3PAZA 1RCYA 1NPJA 1SHXA 1PNDA 1DZ0A 1PZAA 5B1JA 4AX3A 2FWLB 4KO6A 4KNTA 3AW5A 1SFDA 3N55A 4YSPA 3U25A 1IUZA 2WO3B 1L9SA 3CDZA 2IH9A 2W8CA 1M56B 3AG4B 1SDDA 2GI0A 5I6NA 2GSMB 4YSAA 1T5KA 2FJSA 1QHQA 3IE9A 5E9NA 3JT2A 4BWWA 1TKWA 2MRYA 2VSKB 3QJQB 1FFTB
chains in the Genus database with same CATH superfamily
3ATBA 2ZUQC 2D0FA 4HDIA 1IAIH 4MWFA 4N0UA 1YVLA 2B16A 1SZNA 1IKOP 4UOZA 2R0WH 2FX8L 3KNBA 4O2FB 4YWGH 1O9WA 4KHXL 5FYKU 1GOGA 2CKBH 4F7EB 1IC5L 1UFUA 2LW3A 2X4PA 4BK8A 2CHZA 1PD6A 1OPGL 4WFHD 4X6CF 5I74C 4ONOA 5SWZD 4PRAA 3UZVA 3QI9D 3WY2A 1KIQB 1PDKA 2E4TA 3QVAA 4V1DA 3S2CA 2KH2B 1FG2A 4HLJA 4JMNA 3M17A 4JM4H 5DVMA 3C5ZA 3CUPB 2PPEA 1WFMA 4XWOD 5EU6A 5I73C 3GPEA 5GHWH 4G11A 4M8UA 5J6HB 4TSAL 3MBXH 4ZMAT 4U1NB 3MRHB 4ZFOB 1W72A 4MVBD 2X28A 2CD0A 2VZ3A 4RAVA 4MDJB 4CMMA 4I77H 3SKUD 2AJ3A 4CN6A 1NCAL 4HETA 3L3JA 3O6KH 4G6KL 5CBEA 2FQGA 3F7YA 1S46A 1Z1WA 4X6BB 1SLXA 4QYOB 1QYGL 4JG0L 1QWNA 5KSAC 4H8WL 4DTGH 2QVKA 4O2EB 4WHDA 1KIPA 3UMNA 3U4EB 4PJDF 2EYTB 4JJ5B 4CDGC 1TU2B 4XXWC 1T80A 4KUZH 1VA9A 4RMBA 3RFRA 4URKA 4MAYA 5D5ME 4QMEA 5F7DB 4M4RB 2VIRA 3ZHDA 4NM8L 4Z76B 1S9YB 2VN5A 2WZAA 3TASA 2YN3A 1SNRA 3T08A 4ZUVA 5B7FA 4H2AA 3CCHB 2DMCA 3F01A 3NPZB 3U9WA 3H9ZA 3PJLA 2GCYB 1WC7B 4GSQA 2O6DA 3E3QE 1N9PA 3BZEB 3H42H 1JTPA 1E9QB 3O3EB 1LDPL 1YMHB 5LN4A 4UT7H 5FCUL 3A6BL 1LLAA 4Y4HA 2XG5B 3B9KA 3MV8B 3QHTC 3UTTA 4IDLA 1JZ2A 2HT4D 2YPVH 4X9IA 4EJ1C 3QDHA 5BOPA 1P1ZA 4Y9BA 1X5LA 2H3NB 4HK3N 2EECA 2VSCA 4N8CL 1BQRA 4C56D 4XAKD 4ZO9A 4OFIA 2PMZA 4Q56A 3NJKA 4HIJB 4F2EA 2J5LC 4MXQC 1LO4H 1PLCA 5C0CA 1BVZA 1NGPH 4HJEA 4OZ4B 4XVTL 4HCRH 5J57B 4TULL 1AQ8A 5GS3A 4JFPA 4HBQA 4ANUA 3HBGA 1INEL 1QZ1A 3VI4F 3CFMA 3N43F 2Q76A 6TAAA 3HI5H 1XSIA 5CFHA 1CD8A 1S7QA 1TZGH 1QTSA 2WUBH 4X0NA 1U8LA 3KYOA 3V10A 3BKML 4CL7A 4GSDL 3L7EA 4WU5B 4QRRA 4F2MB 3SDDD 5DJAA 3NIFB 4LSRH 3O41A 7CGTA 4L4VA 4X6FA 1FO0B 1AQDB 4XP6L 3SKOA 3B2VL 2D3LA 3DETC 5L88H 2EC8A 3C8KB 5H35B 6PAZA 2W9EH 4ONHB 1BAFH 2Y7QB 3DX0A 4IOIB 4K15A 2ZONA 5J7CC 3PGDB 1SLVA 3QWRA 4FRWA 1KULA 1CFBA 2IPKA 1ESOA 2B59B 3HI1B 4FYQA 4PJXE 4S1RL 4C4KT 1ZA3B 1QLRA 4Z18A 5I8CB 3GSNB 3EF4A 2GY7B 2XXMB 4FXGC 2Q1EA 4KTDH 4PCTA 3T8XB 4FI8A 3D1MC 2IQ9L 5JHDE 4M7ZB 2NYZA 4KOCA 4ETYA 4HPHA 5BQ7B 1FO0L 2J43A 4GPVA 4RESB 5ESQB 2AEIT 1QACA 4LF3A 4NOBA 3UO1H 1T4KA 4JL1A 3VSQA 3Q2NA 4NFBA 2XWCA 2OSXA 4X4YB 3IKCB 3EDJA 1YNKL 3CSFA 3JV6A 1UB5A 2YRLA 4OGYH 1LEGB 5F7EL 1W72H 2AK4E 3L3HB 3MXVH 3ZE2B 3DUSB 5BVJA 3AS3A 1E2ZA 3NSYA 5A2LH 4KKCD 2BP5M 2KERA 1BPLB 2IBZY 2PXYC 3EO0B 4Z7NB 1O6SB 5C0IA 4CVXB 4MMYA 4PREA 2P5WE 1BDYA 3CG8A 2F61A 4LU5L 3MV01 3CVIH 4NIYE 4Z3GA 5I5RA 2XQBH 5CGYD 5GIRA 2NSXA 1DL7L 1JNLL 3FOLB 4NHCH 4U1LB 4HPYL 3FONB 1KCVH 2MKWA 2NW2A 3WKQA 2R1YB 1UZ8A 4GLRH 5JIHA 4RH4A 4S2SA 2ZKYA 2I9LA 1L5GA 2QEJA 2W07B 2Q7YB 2ESVD 2IADB 3KGSA 4ODTH 4UAOB 4H1LA 2WYIA 1F11B 4DP9X 5FYJE 2EUZA 1RZJL 4QJ3B 3TCLB 4FNTA 3EZ8A 1SOKA 1T2QL 1VIWA 2CNYA 3FUDA 5A40E 2QPEB 3N85L 5BOZG 1RHHA 3MLWL 1M1SA 2KBGA 2APTA 1TQTA 3FUNA 2CMRL 1G6RH 2EE3A 2VDRH 3O2VL 3VSVA 4OFVA 3FQRA 1SEQH 2K6YA 3ARGB 5C71A 3BSZA 4PJCE 3O4LA 2BSTB 3QW9A 5GS1C 1P6FA 1WH0A 1XGUB 3JBG7 4Y4KD 4AYDC 4KNSA 4HUXB 5LCVA 2PWGA 3B2UC 2MQCA 1YMMA 4BFFA 2CSPA 5I5IA 1J18A 1MY5A 3F6JA 5L2JB 2AEWA 4G43A 3KCWA 3H54A 1IJNA 5KANG 5EBMA 3ZDYB 3HR5B 2ZWZA 1HZHL 1AZRA 3EIFA 4QHNA 3S2AA 3ZL1A 1A5FL 3OZKA 4X9BA 3WOVA 5DJ8A 3SQRA 5DRWB 3BUYB 3V2AR 3BP4A 5TQ2H 4OF3A 3MN8A 2OMXB 1VEOA 3FQTA 2EICA 2KHAA 3F2LA 5I30L 3Q48A 4G8FA 4A39A 5HGDB 3F6LA 1KC5H 4I1PA 1MCPL 4F57H 2YAOA 3KWWB 1EO8L 1LO2L 2KZ1B 3ZDXE 2V3EA 4L3EA 4RRPA 2CO7B 1DBML 4JM2A 1QI3A 3QCVH 3U6RB 4E0RA 5E2TH 2D4FA 3PF2A 4R97B 3UERA 2DLFL 1IGJA 3NZSA 2PPCA 2XQYK 4A2FA 2VWEC 4KVPA 2UUDK 2BCMA 1ZMYA 2EQDA 4GI8A 2B1HH 2DH3A 3PNWB 3DXAA 4HKBA 3RNKB 2J57A 1EK3A 3RY5A 5DVOA 5E95B 3LV3A 1I7UA 3BH8B 1DQIA 2I7OA 3HMWL 5E70A 2OK0L 4RGMB 2P45B 3VXQB 2CLVB 4OCNC 2VDKB 3ERXA 5EZPA 1I3VA 3UH8A 5EOQL 2BVPB 2YMOA 1ZGLP 1RZFL 5DHYA 4WU7A 1FZJA 3HC4H 4I2XA 2HJKB 4U6VH 2K9FB 4JAMB 4P46D 3BCFA 2EIEA 1XMWA 2FWUA 2JKXA 2KDGA 4YFLI 2DWXA 3UTOA 1TTCA 5F7UA 3IFLH 2DQTH 3H7BA 4KTEH 4Z5RB 3FRPB 2XN9A 1GS8A 3HRZB 1FNSL 1T6WA 1D7FA 3EJYC 4W9JC 1ZVYA 4XPBH 3V0DA 4GUPB 2R0ZL 3FHAA 3UBHA 4TOYH 5BO1H 2VDKL 1TTBA 1R3HA 5ICYA 4UNVA 3V4PL 4I3RL 1NBVH 2WMPB 4MLIA 4IRZA 1SYSA 4GAGL 1PTZA 5FYKL 1BFOA 3PABA 2E7MA 5C0RH 3SD2A 5BV7B 1S7VA 1KENH 1OGAB 3VXUD 2H2PD 4TL5A 4IKKA 3FT9A 3AY4C 3LQAH 4I3GA 1CN4A 4GRLA 3CK0H 4P2OA 4CBZA 1E0OB 4BFEA 1CTOA 2WSDA 3BAEL 4P4RA 3KAAA 4NFDA 1QKZL 3LKSA 4P5TB 3PQYB 1TDQA 5I17A 3JYCA 4KKRA 2RGSA 1IAIM 1AXTH 1QZNA 1FNGB 1G1YA 2IDTA 4JHWL 3HZYB 1P7HL 5DUMH 2QZ5A 3EFFB 4YFLF 1S9WA 2W0FA 5GS0D 1J5CA 1ASOA 3Q5OA 3EW3B 5BV7L 1TJGL 2CK0H 5I15H 1ADQA 1AY1H 3QUHA 3ZKXC 4P23B 1C8PA 1BZDA 4OJCA 4LQFH 3TT1H 1E28B 1XX9C 2ID5A 3BLPX 2FH8A 1I3GL 3TBWA 4HUVB 2X3CA 2XRAH 5E5MA 5ECGA 4YDVA 3RX9A 2AJSL 1A25A 4KROB 4Z7QB 1UH2A 3GPSA 3HG0A 4HIXL 4O58H 4NWTH 3PLYA 5LCVH 3E8UH 4KKNA 3NESA 1J9TA 2MQGA 3C6EA 4I48B 4MB5A 5CGBA 2WOBA 1IAKB 4W9EC 4GMTH 1OCZB 2LU5A 3V5KB 3FBKA 2QSVA 2VC2B 2Q6WA 2D31A 1T20B 1RFDL 4NNPH 1BZ8A 4A63A 3WKNA 2VLRA 3KYAA 3VGAB 3H56A 1Q4NX 4PP2A 1UOLA 3DBXB 3VFVB 3D4GA 4BELD 5F9AC 3PWUA 1FFOA 3V0GA 3P11H 1SHMA 3Q8BA 3T77A 1UB6A 2EYSB 3VW3H 5JORB 2NX5A 1THAA 4CSSA 3DVNA 3PPEA 2QJDA 4OVUA 3U0TA 3VDBA 4OFPA 2Y1AA 3EOTL 4GAFB 2O6EA 1T1XA 2VC2L 1FP5A 4UU9A 4XOCA 2YQBA 5F9JA 3LMJL 1A6ZB 2DEWX 2CHWA 4OAWA 3AADB 4XVJH 5C0AD 4G8GB 4QHMA 5L6YH 5B39A 2CLRB 3JTSA 1OT4A 4G9FA 2WO3B 1L9SA 2HUEA 3LKPA 3LQZA 5DQJB 1T5XA 5C08B 5FA3A 1F1GA 2WXMA 4QHPA 4XP1L 1IM9A 1SOSA 4UAOC 1I8UA 3LNIA 4MJHA 4PWGA 5FK9A 3IE9A 3AJ7A 2ZYSA 4JGJA 4PM1A 4UUJA 3B8YA 4B27A 2V5MA 2OXHA 1DVSA 4JDEB 4LPUA 5KJRL 2IF7A 4ZUSA 5AZEL 2FUTA 3LH2H 3RVVD 1I1YA 3EYVB 3MYJB 1DVFB 1YY9C 3SJVB 4KH2A 5I6KA 2FB4L 1OPOA 2LT9A 3B5GA 2R59A 3ARGC 3CU1A 1BQLH 3MMEB 5K9KB 1RD6A 4FG6C 2CPCA 3PFQA 4ZMLA 4L9DA 1JD7A 2AITA 9PCYA 4PBVC 4QRSB 2F74A 2ZSWA 4WVRA 4NO5B 4JKNA 3B83A 1JDAA 3ZHKA 5IP4A 1BBJB 3CFEB 3AREA 3VRLE 5IMLA 3QAZB 1XCXA 1MHCA 4DHLA 1WS8A 4J3BA 1AGDB 3KWXA 1GSMA 2UX6A 3FHEA 1CGTA 5A2JH 1SY6H 5KBLA 3KVQA 5DURD 3CUPA 1SUHA 4R26H 1U8QA 5F7AA 1BM7A 4MBOA 5SWSB 3OPUA 1U8CB 5J6HA 4RWYL 4N86A 2HRHA 5DMGD 5IHUL 2DICA 1KN4H 4MDJA 1T2JA 3HBPA 3VDAA 1XH0A 4NQQA 5DA4A 2F8XC 2RH0A 43CAA 2QKIB 2D7PA 4DPBX 2WQ8A 2W94A 3HG2A 1VFOA 2C1OA 3POCA 2DQDH 4QYOA 3TN0A 1PYWA 2MPAH 3CH8A 3LPPA 1KZYA 2A99A 3B3IB 5F7KC 4A2GA 4Z7IA 3IU3A 5CBAB 1P6WA 2EIDA 2VB5A 4DSYA 4O2EA 4PFEA 5F1IB 3IDJB 3OSVA 4AMKL 5CEZE 4JFUA 1J8HE 3D39B 3ZK0A 1EZUA 1BVKA 2R56H 5KBMA 4IRJD 2VW4A 4MA8H 3U4EA 5A2BA 4AY0A 1KJ3H 1URIA 2XT1B 3F65A 4LXFA 5D1QE 2JKNA 3DYPA 4JJ5A 1TU2A 4PCSA 4P2QD 5IB1B 4L05A 3VXMB 5F7DA 5ABDE 3QXUA 3TWYA 4F33A 4UILH 1OK0A 4D9RE 4B41A 2C4FT 1S9YA 2X38A 3WGVB 4J5VA 2AJYH 2IDQA 3CN1A 2VISB 4KU1A 4LOEA 1UXSA 2GITB 3U6XA 4A7TA 1AR1C 4OFDA 3J2PA 3APNA 5IT2H 2BH0A 3CCHA 1HHGA 1HZLA 4JKPH 1IAII 4QYAA 3UBFA 3MRRA 3S8WA 2VN7A 4P0DA 5JIQA 1DQKA 4WEUD 3HRZC 1WC7A 4JFFA 3NJGA 1PCSA 3RB7A 2H0EA 4XZUB 3BZEA 1O75A 3O3EA 4PGDB 5C9JB 3BUIA 3H55A 1YMHA 1W80A 4ODVL 1Z5LB 2ZKHH 3L45A 4OD3L 2XG5A 3MV8A 4ODSH 1A3QA 4F3FA 2EH7L 1IIKA 3DOHA 4KHTL 3I9PA 2ZCLH 3QGVA 4MB1A 5DRXB 4PSPA 3I3DA 5DC0A 4NZRH 5C0EA 5GZOC 1G7IA 1R24A 4HIJA 5AW9B 5IHLB 4JZJC 1Y18A 2NZIA 3Q44A 3SN6N 3KPMB 4YIQB 4OZ4A 1IQDA 4K94C 4X6DE 3KZ8A 1JGLH 4D9LL 2K78A 1V10A 2FX8H 5HHMD 1WD8A 3AY4A 3K1KC 1AYRA 4KK8D 1BOGB 1JZ3A 2Q7AA 1IC5H 4ZS6D 1M9SA 5H94B 5IF0A 1FFNA 2CXKA 4A2HA 4ZOBA 3UAEA 4EE2A 1OPGH 4WU5A 5C09E 2GW5A 3IVKB 4F2MA 4P23C 5FF6A 1QSFE 1EEZB 4X6CE 5I1CL 5CEYB 1U8JB 1FO0A 1AQDA 3LDBC 1Z9PA 2WXIA 2FTAA 3V9EA 1KXVA 1A1NB 2PPDA 3C8KA 3F85A 4LPXA 5J12C 4S1QL 4FTVB 4W9LC 1VJSA 2Y7QA 3M07A 4IOIA 1GPOL 4OCWL 3PGDA 4OZHA 4M43H 4FMVA 4W70A 2C9SA 1NAML 3ZZ1A 2D7NA 1ZA3A 3KHOA 5CLZA 4TSAH 4JG1L 1A7RH 1FDLH 3O8XD 1CFVH 5AW3B 4H88L 1Y7VA 3W11C 3ARBD 2A4CA 2DBLL 5BQ7A 1NCAH 1U6AH 3VGAC 1RLBA 3TVMA 2HJLA 3LPOA 2LU4A 4LLUB 3QWQB 4G6KH 5ESQA 1AS6A 3I85A 1MRFL 4ZYKB 5I1JL 1YUKB 1JHLL 2R9HC 1IT9L 1QYGH 4EPSA 4X4YA 3IKCA 1VADB 1EDQA 1IFHH 1Q0XL 3CV5A 2NMSA 2P43B 2FSEB 2UV3A 5CM1A 1LEGA 3DTXB 5JR1L 2RMNA 3L3HA 4IK6A 3DUSA 4LARH 3T4YB 4ETQB 2RALA 5D55A 1T0NB 3V5DA 1LO0H 5I24A 3EO0A 2OTUB 5FIEA 4NO0B 5AWNL 4PJDE 4F80A 1O6SA 1ZHKB 4CVXA 2EEFA 1J8SA 3IJ7A 4PJGE 5IIEB 4TQ8A 4NM8H 1NCNA 3JV4B 2W0LA 4JPKL 4XNYL 4M62H 2Z34A 3OQRA 3FOLA 4OFYA 4YDLB 4U1LA 2LFEA 3QDGB 3UCQA 4PU2A 3FU6A 5EZJB 5GGRB 3D85D 3TH4T 3EAKA 4A7VA 3WCYA 3GSOB 3RL1B 3VWJD 2WCGA 3ULVE 2Q7YA 2W07A 1XDTT 2IADA 1ML0A 2X87A 4FTDA 4K3JL 2AQPA 1F11A 4FJ6A 1DVFC 1EJ6A 3QZMA 4OM1L 2VZSA 5TF0A 1LDPH 5FUCC 5FCUH 3A6BH 3MNWB 3U4BH 2O6PA 4EN3C 4F9LA 2C9RA 1EDYA 3P0VL 4KQ4L 2AFNA 3IBOA 1OTUC 3LX9A 3DV6B 4YZFF 4N8CH 4ZFZB 1RZ7L 1D7CA 5GRYA 5A1AA 1BQHB 2MNUA 4N6RB 4NQCE 2X7LB 5HY9B 2BSTA 1XGUA 4HHAB 4NCC1 1PX3A 4P2YA 4TULH 2ED8A 4RGOL 2FO8A 4OLEA 5IJCC 4BUGA 4YVUA 1INEH 3V6OA 2X12A 3LZOA 1X5KA 2VDMB 1MHHB 2H1XA 3VI4E 1PPIA 2MKLC 2EH8L 2NQ3A 3F7PC 1KTCA 3HR5A 4HJIA 1XZ0B 5EIIB 3BKMH 3CVHL 4LCIL 4GSDH 3GXNA 1P9MC 3P69A 1BXUA 2X3BA 5DRWA 1TMQA 3BUYA 3C5JB 4PG2C 4XP6H 5LAPA 5JHLL 1AGEA 4IKJA 2EDNA 2Q0ZX 3B2VH 2OMXA 3SQBB 2QKIC 4ZW5A 4N0CC 2VDML 5HGDA 1INQB 1E9OB 4B53A 5PCYA 5IVXB 4NHUB 4JFDB 1LO5B 1RIVH 3AM8C 4XPGL 2I26N 3H2PA 3HS9A 3U6RA 2IQ9H 4HKXA 4NO3B 4D2NA 2FD6H 1G9NC 1XGQB 3VFOB 1FO0H 2W0PA 1USZA 4KO5A 2ARJQ 5DUBB 1WAAF 5DJZA 1G6VK 2BS8A 4BDVB 3MRBB 1J5IA 2Z31B 4ZO7A 2ZOLB 3EYUH 1U3HB 3HG3A 3PNWA 3RNKA 2YBRB 2R0KL 3AUVA 2ITDB 2DI7A 2F53B 1OTSD 2CM6A 1RZKL 5KYYB 1A6TB 3BH8A 5TTRA 3NACL 3GSNH 5FPIA 5GRVK 3N41F 3GO1L 1LK3L 4WUUD 1E6OH 3L6FB 1WBYB 4ZOAA 5E8OB 5E00B 2HLAB 3CX5J 3V4PA 1CXKA 1EVUA 5BRZB 3SZKC 5HD8C 3SOTA 4JAMA 3DOSA 3KLKA 1HWGB 2HJFA 2IDFA 4FXKB 3SCMA 4LU5H 4XPHL 5AALA 3ZZSA 1MF2H 4Y8AA 5KYUB 1QHOA 4Z5RA 3FRPA 1DL7H 1JNLH 2XETA 3CLWA 3W2DL 4M9OA 3VD5A 2DL2A 4N90D 3HRZA 1D9KC 4JPWL 3RX7A 1BMWA 4GUPA 2VITA 4MTMA 4R84A 3T0VA 4RRPM 4LEEA 2FHFA 3G08A 2G3NA 2X1XR 1S7RA 4L9LB 3M7FB 3VWKD 1IAOA 3UYPB 1Z5YD 3EYQD 2WMPA 1RZJH 2WZPD 2X1QA 1T2QH 3PJNA 1JS4A 4WTQA 5T33L 2UZXB 3N85H 2EYRB 2X2HA 4Y88A 1OGAA 1UT2A 3ARFB 4PVLA 2R23B 1J1XL 2CMRH 1RUML 3RVUC 3O2VH 4AEIL 5B38G 3QK0A 2BIPA 3U9PL 4GKNA 1MLBB 4XC3L 3NJMA 4ZFFB 4P5TA 3VX1A 3PQYA 5TK2A 1LYQA 4IOSD 4IGBD 4M8VA 1FNGA 3VA6A 1W0VB 2Q5BA 3WN5A 3UIZA 1JV2B 1TTAA 2FBJL 1TQBB 3NEOA 3HZ3A 2SEBA 2A83A 4OF5A 1Z66A 4QOKB 1CMOA 3RHWK 3ML8A 2NY0B 4JO5A 3WFCL 2HT3D 1DDTA 3T04D 2ZOOA 3FQ1A 3F8UB 4P23A 5I5JA 1M9WA 3TIEA 2G2NA 4PRIB 3TLRA 1HZHH 1R5IA 2G9KA 2JJUA 2PWHA 4NP9A 1NSNH 4AL8C 5E9DE 1PZSA 1A5FH 1H9VA 2ILLA 3II3A 5AVSB 4JZNA 3NFPB 4WKZA 3QUZD 5L7XL 3ULUL 2E7LA 3WY1A 1EAOA 1QPPA 1QSEB 2E9BA 5AKVA 4DZBA 1QTYT 4R7LA 1S78D 2X42A 1MHPL 4I48A 3ZQ9A 1LJMA 4NZFA 5D6DC 5I30H 2X6VA 3UG3A 4AT6A 1NBZB 1GYCA 1T20A 1MCPH 3LQMA 3R1GH 3ZTJG 1EO8H 4LLVB 4NZDA 2CBTA 3WFZA 1FIGH 3DBXA 3X1NA 4WDIB 2NLJB 4AVKA 4GP5B 5CKAA 5BJTA 1U4EA 2IAMD 1YUHB 1HL9A 2EDBA 4M8RA 2DLFH 2JJTC 4XBPB 4ZBJA 3RURA 3EYFB 5IMMA 4G5ZL 2AQ3A 1KGJA 2FWLB 2EZ0D 1A6ZA 3QNYB 3PUCA 4M6OH 2Z35A 4L3AA 5KS9E 3EJJX 4L8BA 4G8GA 5IQ7H 3RFZB 3ILPB 3O4OB 2OK0H 4Z3HA 2WM0A 1I3UA 1DQDL 2CLRA 2QL1A 5A2CA 3BAYA 2WTRA 4WFEE 2IXQA 2AP2A 3ECWA 5EOQH 5DQJA 2QQKL 3L4YA 1HWHB 3EDDA 3Q2CA 5GS2D 1G0DA 1JN6A 3PAVA 5L4IA 3T0EE 3LEVL 3NTCL 1O9VA 1W6WA 3T2OA 3T3PB 4JDEA 2J88L 2DYSB 2OSWA 4OZGB 2R0LH 1KYUA 4K7FB 5DA0B 5J89A 1FNSH 2AKRB 1KCSL 1SN5A 4JPQA 3ECQA 3MYJA 2R0ZH 2VAJA 1CDYA 2Y7SA 2R2HA 2VDKH 1DYZA 2YEQA 3MZGB 4DKFH 1UWFA 1K4CB 3BVUA 4GS7C 3KWUA 3MMEA 4I3RH 4YBQC 1WIUA 3S96B 2XXFA 1EAPB 1HNGA 4GAGH 5FYKH 1IGMH 4LEOB 4X8JB 5PAZA 2HLFC 4NO5A 2WOYA 4M5ZH 4E41E 5DFWH 4FQ2L 2EACA 5AW7B 3M86A 1QWUA 3QS3A 3WEMA 1BBJA 3CFEA 3EJPA 3OMZA 2Q8AH 3NCFB 3C6LB 5DXWA 1PFOA 1QKZH 5IBUB 2FO1A 1KBKA 1SJEA 2EUXA 4JHWH 3A4DA 2JJSC 4DQAA 3BYTA 1ZRUA 3KGTA 2G2PA 4BH7B 1FG9C 5EN2B 1BJ8A 3DK0A 5BV7H 2FEEL 3ARUA 2YGQA 4DKDC 1DVXA 4TM9A 4XBMA 2XWRA 1F4AA 2D03L 1M1XB 4K94H 1I3GH 1RZKC 1ICTA 2HKFL 5ICUA 1U92A 4NXKA 1HNFA 3SY0A 2E8ZA 4UM9A 3T71A 4Z7VA 2GYSA 3C5SB 2J3SA 2VUKA 2GFBA 2WLZA 4PUBL 3FO2B 5KBPA 3GSUB 3B3IA 2DQJL 5CBAA 3X3GL 4R96B 3LN5B 3LVTA 1RFDH 1KY7A 2Z31C 5F1IA 3IDJA 2NZ9D 1U3HC 4X5LA 4WY7H 5KVFH 4HU2A 5DR5L 3WTWA 3QZWG 2H1PL 3WDIA 3P77B 2FZ3B 2V8LA 4WFGE 5DI8B 4XZ4A 2A6DB 4W9IC 5C6TL 4L3CB 2ZUUA 5IB1A 2F19L 2LE9A 4WK2B 3V6FA 1B0RB 2NR6C 5ALCL 1IKNA 4U6HB 1EZVY 3MCKA 4P04A 2XWDA 3ZRFC 3CVBA 3EOTH 2AVFA 2N7SA 2VISA 2XKSA 4HIHB 4R2GD 1AP2B 2GITA 4GKZA 3S4SA 5BW7A 2VC2H 3B4NA 4LCCC 5KANI 4S1SL 1UA6L 4F58L 1H5BA 3HJEA 2WTOA 1P84J 2ZF9A 1ZLWK 4O5LH 3J07A 1CIDA 2EDKA 4PGDA 1NCGA 4XT1C 2KPWA 2GTQA 1CXIA 1AOHA 4L9LC 4FA6A 1Z5LA 1ZS8B 3QFJA 2G3ZA 1G9HA 4DFHA 2Y6SC 2BFVH 3ZKNC 3KLLA 3C5ZD 1L0YA 3QR0A 3V4VB 2PTVA 5TGBB 5I8OL 2IWGA 4P57B 3GXDA 5DRXA 5CR8A 5AZEH 3ARFC 3MLSL 4EIUA 2YO3A 4CJ0A 4YSSA 4KK5C 4KJQC 4Q9BA 5AVRB 3KPMA 4GRWB 5KYWB 2WQWA 5E2JA 3P3TA 1VFBB 2RACA 3HOGA 3FTZA 1Y0LA 2OXGB 2WUCL 3O45A 4X80L 4ANKA 4PJBF 4R83A 1ETA1 3G5ZA 2AK4D 4JQXC 2CRZA 3W0WD 3KPPB 4PRPB 1BOGA 1HCFX 1NAMA 3GMPB 3POHA 1QLEB 1W8NA 4PJHF 1HWWA 3DIVA 5FLVA 5D2NC 2ARJA 3W82A 2NY1C 3RYMA 1KDJA 5CEYA 1U8JA 2FH6A 3EJQA 2WAQA 4L4TB 1UZ6E 4X4MA 1DJHA 2LTQB 2E7BA 3NCEB 4W6WB 1A1NA 1L6PA 1RZ8B 4MAYD 2ZX5A 1I1AC 3QT2A 1N2RB 1QLEL 3DGGA 1NBCA 3QPKA 1I3RB 1U8KA 3DRTB 3II1A 4K4KA 4RWYH 5DMJB 5FLUA 4P8QA 5IHUH 2C9VA 2W65B 3PUUA 4LVNB 4ORZC 4OZIE 3RTLA 2HRPL 3CLEH 2AK1H 3N91A 5F0PB 4HQQL 1VZIA 4YE4H 2FECL 4ZYKA 5JPMB 4ZQKB 1AKJB 1OAQL 4OB5H 2JKLA 3KWVA 4PI0A 2OCJA 3NN8B 1EO7A 3G04B 1VADA 3B9KD 4OR1A 3WGUB 2FSEA 4FQJL 4AMKH 4PJIF 3F3HA 4WO4B 3DTXA 4Y1AA 3NABL 2G5UA 3T4YA 2VM9A 4ETQA 5DCCA 3BW9B 2IOIA 1T0NA 2X4QB 3ZMEA 1JG9A 3L7FB 3GK8L 4NO0A 4PB9L 1WFJA 1ZHKA 3NIGB 5AB1A 3WS3B 2Y5EA 3OKLB 1UJ3B 5IIEA 1NMBL 2UWEA 3OKOB 4YDKH 2YARA 3QXDB 4LLQA 5DFAA 4W6XB 5JXEC 4MNQB 1FCGA 4PHZA 1T7VA 3AG3B 5EZJA 3G6AB 2P5EA 5GGRA 5L4JA 5E8EB 5GRVL 3EJTA 2JF1A 4YL9A 3RL1A 3L4CA 1G9NH 1V7NH 3B3BA 4R9HA 4WTXA 3HBQA 1EA9C 2A9DA 4AZ8A 1QFOA 4X9HA 1UD3A 3PIQB 1FGVL 4M61B 1PJWA 4L4VD 2V3FA 3WTTA 5I6OA 4NT6B 3MNWA 3DWTA 4ODVH 4HMEA 4A68A 3MRCB 4OH2A 1WAEA 4OD3H 4FAAB 3GI8H 3RX5A 4HUMB 1R75A 4KHTH 4XMVA 3DV6A 2P47B 4J3OC 3VD7A 4ZFZA 4YZWA 1TCRB 3CVHA 4QHKI 1U8IB 1TQCC 3O0LA 4QXTB 4N6RA 5HY9A 2X7LA 4GO9A 5IJKA 2JCCB 4HHAA 5IB3A 5DO2C 5HDLA 3V7AE 3NPSB 5JHLA 1R3KB 3MR9B 1F13A 1RIHL 2A77L 4AQZA 2JLPA 4O51A 3H9SD 5AOLA 4Z7AA 1MHHA 2HMID 2ZOKB 4BH8B 3CDGA 5E2WL 1N4XL 4BFOA 1XZ0A 2BNRD 1N8ZB 3IGAB 4QAWA 5DC2A 5JZ7C 1NH6A 3T0XA 2BCKB 4EMZA 2Y4SA 4BD4A 1OAYH 4QHKJ 5I1CH 2NZ1A 2XIIA 1JZ8A 3BPNC 2WN2A 3C5JA 4EXPX 4PTTA 3WELA 4TTDD 3SQBA 2YPLE 3G5WA 4ZXBD 4DP4X 5IBLC 3ZTEA 4UQ2A 1Y6KR 1INQA 1GPOH 1E9OA 3AQZA 3PWPE 1DSWA 1NDMB 2EILB 5C0FB 4MXWH 2IBBA 4JFDA 4JO2L 1LO5A 5CLXA 2WY3B 3OKNB 4TVPL 4H88H 5E23A 3FSOA 1UURA 4A04A 4NO3A 3D0VB 3DRQA 1XGQA 1NOFA 2MEJB 3VFOA 1AHKA 2K4AA 2YXFA 5DUBA 1WWWX 1L9PA 2VQUA 3DUHA 5I1JH 1RY7B 1IT9H 2YBRA 4ZMXA 4EZJA 3M7OA 2ITDA 2PYEB 2F53A 4BWUA 3MROA 1Q0XH 3H0TB 5KYYA 2WKOA 5JR1H 4BCZA 3TF7C 3L6FA 1WBYA 5E8OA 3HBZA 5E00A 4OLVL 4P4KB 2N7AA 4ZQTA 2HLAA 5BRZA 1LEKB 5AVQB 4LSSH 4UIKL 2RHEA 1HCVA 1KOAA 3FRUB 5AWNH 3SGEI 3IAQA 1G87A 4B9FA 4FXKA 2QADB 2UUDH 1Y6NR 1TYRA 4JPKH 4XNYH 3DIDA 4Q4IA 2XY1A 4HK0A 3HNSL 2NY3C 4FQCL 1UM4H 3BP7A 4H20H 1BAWA 4WGWB 1CC3A 5FO2A 4NKDB 3WJLC 1FL3A 2YMXL 3A4FA 1CBVL 4NJAL 3RGHA 1UEMA 3UEQA 3SPGA 1GW0A 3LSOB 4JREB 4K3JH 1H3VA 4M03A 3IDIB 4XVUD 3UYPA 5EIQA 4OM1H 3SOBH 1KBBA 3SDAC 4N0FB 3LNGA 5EU4B 2BSRB 2W81C 2NNAA 1JWUB 3KLHC 3QIWD 4RMWA 3P0VH 5ITBL 1NOAA 2R23A 1N67A 2OCFD 3DIFB 3OHXC 5D1XA 2HLEB 3LS4H 4KMQA 4ZNCD 4YZFE 4XGZB 3AT0A 3BN9D 1C1EH 1PG7W 3MA9H 1CQYA 2XKUA 1W0VA 4DP2X 4AE1A 4CA4A 2Y3AA 5L2KB 4ZMTA 4X98B 4RGOH 1DVUA 1ETJA 2ADJB 1A47A 3G9AB 1JK8B 1UUNA 2VXQL 3RVXC 4QOKA 4UF7C 1JK9A 1GR7A 2BOLA 2LTQC 4RGNE 1HIML 2BINA 4E9XA 5KZCD 2GG1A 1L3NA 2EH8H 5D70L 1OT2A 5DT1H 4PRIA 3FQNB 4HJJL 3PY9A 4R7DA 4JJHA 2A9NL 1WVZA 1XSOA 5TDNB 2AAAA 3NFPA 2NUTA 1FN4A 1A66A 3RGVB 1Q9KB 5ID1B 3H8NA 1QSEA 3LNHA 1EGJL 5D1ZA 4HPOH 4L8CB 2VLKE 5K9JL 4FQLL 1PW3A 3HG5A 4CC4C 1H6EA 1MFAL 3FB7A 4DUVA 5JPMC 2VKXA 3S3PA 2NCMA 4LLVA 4R4NC 5T1DL 1X6NA 2K45A 4K8RC 3NRFA 1CVRA 4N0UE 3QUXD 2IDUA 1YUHA 2H6OA 2HFEB 1LM8V 3IXTA 2XBZA 1N10A 35C8L 4J3OG 5KAQG 2WWKO 4N9OB 3HZMB 1Y07A 2ZWKA 4XBPA 2F6AA 4H4NA 1JP5A 3SE8L 1NGQH 1CBJA 1A6AB 1WAAE 2FSDA 3QIBC 4ZW7A 3X12B 4AM0Q 4KX8A 2R0KH 1UJ3C 2UZYB 3QNYA 1SDDA 2GI0A 2YRPA 2QMKA 1RZKH 2UYLA 2XKNB 4FFTA 4QRPB 3RFZA 3ILPA 2H9GB 1QW9A 4GRLD 3GO1H 1LK3H 4Z0BL 4KKLC 2G60H 4V1DE 2BXYA 5DD3H 4PJ7F 2DQEH 4OKDA 5LNEA 4UB0L 4F8PA 1K5NB 1MFCH 3GHEL 4XCFL 5DHXB 3RBGA 5DUJA 1UD2A 4Y7OC 1MI5D 3BSHA 3V7MA 5EU6E 2JQAA 3CZKA 4GKLA 3HB3B 3VFUB 4HOWA 5EF2A 2OA9A 1CZ8L 3S34L 4OZGA 3BPLB 4K7FA 1QRNB 4JPWH 5FO9B 4G70B 5I75C 1N7ML 3HC0A 3TONA 2FR4B 3BEVB 3ROOB 1T5WB 1XB6A 2VR3A 3FQWB 1K4CA 5DHDA 3UMTA 1CICC 2WO2B 5JHBA 3N1PC 4OLXL 4LPTA 5DWUL 1NPUA 2CE6A 1EAPA 1P4BH 3Q2LA 3CH1B 2J2ZA 1JI1A 3WNOA 4AQEA 5T33H 4KXAA 3RJQB 4X8JA 2OSLA 5D1QD 5IHBA 5C6PB 5J0BA 4Y7MA 2O26U 3ESMA 4QTHB 5A16B 1CTMA 1J1XH 1X7SA 4Z7NF 3VQLA 1I4FA 4AEIH 5D7LD 3TOPA 4UQ3B 3C6LA 3U9PH 4BEIA 4APQB 4HAFA 3FB5B 3ESNA 4TNWK 3WEBA 2NYYD 4Q6IC 3T5WA 1T1YB 5HYIA 1TYEB 1DSYA 4RISL 3ARRA 4H0HB 2FBJH 1F6AB 2WXLA 3ARPA 4BH7A 3AVEA 5K1JA 4WWKB 1G43A 1WGVA 3WFCH 4KZDL 1PG7X 4DK5A 1YCSA 2Z91A 1VENA 5DD1L 1AO7B 2X1OA 1HCZA 1M1XA 3P4MB 4PV8B 4H8UA 1ACZA 5FO7B 3WNMA 3RX8A 1MFMA 2WLIB 4YHLL 3MBED 5L7XH 3ULUH 4LKXB 1IFGA 3WNNA 4P3DB 5C0BB 3UTTE 5DJ2A 4YHIA 5EEWA 1A7QH 1MHPH 3GSUA 3LNFA 2X6AA 4IBZA 4R96A 2UXFA 3LN5A 2A4EA 2X9WA 5IGXL 1OOAA 2GUOB 1GKEA 2WKGA 3V5HB 2XWTA 5C0CE 3QNXB 4OCYL 2V9QA 1D5XB 1HESA 2FZ3A 4EI5A 2WBJD 3LRGA 2A6DA 2EINB 2G4GA 1ORSA 1KLUB 3UGUA 2PO6B 4EVNB 4EUPG 1IVTA 1EO5A 2OL3B 4RQQA 4U6HA 4Z3JA 3ZDYF 4PJ5D 5KVGL 1AKPA 2WVTA 5C09D 4HIHA 3HAEH 3QDJB 1A7OH 1AP2A 1UOWA 3DHUA 3D07A 1W0YT 3K0WA 5F1SA 3GKZA 1GJUA 2QADC 1N8OE 1XV8A 4QRRE 1GL4B 1KB9K 1GYWA 2W59A 1QR4A 2XCMC 1YNLL 3WIIH 4YHYB 2QV2A 1DQDH 3KLQA 4CW1A 3TEWA 3ARED 5C70A 4OKVB 3QBTB 5CD5D 3WEXB 5INDB 5LHDA 1CLYL 2BC4B 1DLFL 3GBDA 4CU7A 3QSKB 5KN5B 2E3VA 2NW3B 3SQOL 2I7SA 3US0A 3HIZA 5I2IB 3GUTA 3LEVH 3NTCH 3VI3F 4PLJD 3LN9A 1U42A 3ISWA 1FHGA 4IRSA 2J88H 5CHNB 5TGBA 4P57A 1YN7A 2WYHA 4BWTA 1KCSH 2EEBA 5CS7A 1CJYA 3KBEA 1JPTL 4I3SL 1OY3B 3GWJA 1ECZA 1Q94B 3DBSA 1FRGL 5KYWA 4K5NA 4W68A 1VFBA 2E6PA 4OF7A 2HG5B 2X1PA 4B0MM 3G6JB 1CK0H 4QTFA 3QG7L 4AC2A 2EABA 3KPPA 1QBLL 4PRPA 1JYNA 1WWAX 3TN0D 1U8HA 3GMPA 5KTEH 3IDMB 4QR7A 2P8MA 3ZO9A 2YZ8A 3MXWL 4PGBA 4JDTL 1TETH 5B1KA 1OP5K 4XP9L 3SPJA 4H0IA 5HI4D 3HJ0A 4FNRA 1V3LA 1K5WA 2Y69B 4FADA 3EJCA 4QRUB 3WHE1 3RPIA 4C8XA 4RAUB 4M7LL 3X14B 3TS8A 2UXVA 3RGVC 1RZ8A 3L4WA 5T3ZD 3ZKSD 4KNQA 1N2RA 4JRYE 1KBWA 4MHHI 2LQRA 2IANB 4FMKA 1I3RA 2X70B 3RUGF 3TM6A 2VLJD 4FQQB 4Z6AT 3QEQD 2W65A 2IWFA 4CSTA 1UM6L 1N68A 3NVQA 4DGYL 3SO3B 4XPFH 5IROD 5C0DB 1DVTA 1PD0A 4JFFD 1TCMA 4UV7L 4KK9C 2Y0SA 4ZQKA 1AKJA 3T6QC 4M7KH 4PJ6A 1WFOA 4NQCD 3NN8A 3BT2L 1FGNL 2DQJH 4JDVB 3MNVB 3X3GH 2XNAB 1HYRC 2ZAIA 5DGRA 1E40A 3PHOB 3QCUL 4NB7A 5IQLA 4WO4A 2WNXA 3KPRB 4JN2B 5DR5H 2IOOA 5F9OL 2H0FA 1FYTB 3O4LE 5GQBA 1HHHA 3UGEA 1NCBL 3KPNB 3BW9A 1U93A 2X4QA 5HGBB 5C6TH 1T0OA 2HVBA 1YMME 2F19H 4OU3A 3QUYA 2DQGL 2A6KB 5ALCH 3WS3A 3OKLA 1WUZA 1AGFB 2ZCKL 4Y19A 4Z78B 1XCTB 2XWBB 4IBTA 2CBQA 5ILTL 1D6VL 3GMNB 5D7IB 1H8NA 4MNQA 3A3YB 4ZNEA 3V0HA 3LEYL 3G6AA 2AHIA 5E8EA 1YY8A 1ZHNB 4F37K 2WHVA 1FLRL 3NP4A 5SWZB 1UA6H 3BPLC 4F58H 3QI9B 4GXFA 4H13C 1OAZL 4CNIB 5LBSL 4DP0X 1WAPA 4M61A 4J7RA 4M6MH 4NP4L 1OW0C 2B08A 2X6UA 3I75B 1ZXKA 2AQSA 5IQ9A 4NT6A 1MFVA 4OM0L 5GSRA 5HP5A 3MRCA 2Z8SA 3FDWA 3KLDA 3LRSB 4XBEL 1DEDA 1UYWH 2JKRM 3JWDC 1NLBH 2DAVA 4PJEB 5E94B 4EDWL 5BQDA 1A9BB 3I6KA 2EDYA 3KPLB 1TCRA 3MLSH 3W9DB 4NNYB 1C12B 1JPSL 3RI5K 3CFBA 3HPLB 1TITA 4NN6B 2KZBA 2P8LA 2YC1A 2K6ZA 2E46A 4NCC2 2B9BA 1EFXD 3LB6C 5FFOA 3UBXB 4APQC 2IH3A 1R3KA 3TVMD 3U7YL 2EDJA 1DCEA 2J8UB 3MR9A 2WUCH 4X80H 4OIFA 4B6ZA 4DGWC 3DXAE 1DQTA 1CLZL 5I1AB 4LBEB 3DX6B 3S0PA 4JNXA 1S5IH 2WN3A 4ODHH 3Q01A 2ZOKA 5AKRA 2NXZD 3V4VH 3NIDB 1UH3A 3KGRA 1BQUA 1U30A 2DIJA 3IGAA 3S3DB 5DSCA 2BCKA 4PJHE 1MNUL 1PNCA 5I5MA 4FQXA 2XTJE 4EBQH 4Y1SA 2X09A 4GRWH 4YQXL 4I2XE 3W5NA 4YC2C 1GZPB 2VDNL 3VXRD 4RNRA 4JVUA 4LK4A 4PN6A 3Q8AA 4JS7A 1ND0B 3WY3A 2XN9E 2JVUA 5K33A 3N2JA 3FFCA 3RY6C 3OX8A 3PDOB 4ELMB 1NDMA 5B4MC 1QLEH 1WJ3A 1F3DH 2ZICA 4OFYD 3SKNA 4AJ0A 1NIBA 3LCYA 2P7TB 4C4BA 1HSAA 2DTMH 2OP4L 2PN5A 3D0VA 4DETA 1V55B 4G42B 3TX4A 4HQQH 5ADPH 5A43C 1W8OA 3FUHA 3TO4C 2PO6C 1OAQH 5IESL 5DJDB 1JRHL 1PMYA 5CD3B 3MLRL 3EBGA 1YEFL 1BQSA 4PJ9A 1OF2B 3H0TA 3WUWB 4ORGA 4KV5F 3LXUX 2DD8H 4C56B 2L04A 4OIIH 4E36A 4BSVA 3NABH 3J27A 3MUZ1 4PJIE 4YLCA 1BJ1H 1JOIA 3VDCA 3DX2A 4P4KA 4FLSA 5HGHB 3L3GB 3DO3A 4DPAX 4GO6B 1XGTB 2DI8A 3EJZC 3FRUA 4MJ6A 4PB9H 1FH5L 3D0AA 2CJ3A 5FW7A 3RNQA 3VGEA 5EEUA 1PKQB 1UWXK 1JGUH 4O02L 3X1GA 3L2LA 2RCSH 1E4XL 4OI9A 2VMJA 2Y06L 3DO4A 4XN8A 3VSTA 5H37G 4K8RH 3W37A 5SV3A 2YD0A 3O11A 4MJ5B 2OMTB 3K2IA 4NKDA 2GSGA 4J6RH 4Z9KB 3SDDB 5CZVL 1CD1A 1VRSA 2J72A 2YSSB 2VM4A 3QIUA 1B9KA 3LSOA 3K6OA 5BCAA 3C2AH 3TNMB 4J3XA 3NCJL 1X4ZA 2QBWA 2VXQA 1HSBA 5EU4A 1PY9A 2BSRA 3D4CA 1NCWH 3BD5A 5I8EB 2VLRE 4QWWC 3MBWB 4Q14A 3DIFA 3T3MF 3WLBB 2CK2A 4PYGA 1FH2A 3OJ2C 4XGZA 3OKKB 2XY2A 4UNIA 2NX5E 2LHAA 2PYFA 2N1TE 4FJYA 3L4UA 3TA3D 1EGJA 2BS71 1JK8A 1MN4A 1Q38A 1N0XL 4R7XA 4GUOA 2A77H 3I9AA 3NJNA 7PCYA 3P73B 3L3IA 2BZDA 4MA3B 3OXRA 2XZCH 4LSQL 1H9DA 4LL4A 2BK8A 5E2WH 3HZKB 4FDWA 1N4XH 4X9YA 1WRFA 3A0OA 3BSGA 3BQUB 3QFDB 3T0ED 1GIGL 3SGDI 3TBCA 5M95B 1HKLL 3R4RA 3NJIA 3FOMB 3RGVA 1Q9KA 2ZWYA 1F8TL 2GJ6D 1BZEA 2IV9A 4L8CA 1J0JA 1IBGL 2V0AA 3VD0A 1Q1JL 3SCMD 4MA7L 5ISZA 3IYLW 2J1YA 4K7PL 1CYGA 1WF5A 3CPLB 1L9RA 1X7TA 1FVEA 4JO2H 4OSUL 3ECVA 4L8SB 2O61B 4TVPH 4ATTA 3P0GB 2D4DA 1EUUA 4Z7WB 2ESVB 1HOCB 1NCJA 1E4HA 2HCZX 1QFHA 2OKMA 3HZMA 4H40A 1F02I 4YO0B 4WUKL 4JCWA 4YHKL 2GJJA 1XO8A 5B1CA 3EG9B 1A6AA 2GSMB 3L5WB 3QCTL 1T5KA 3CHRA 3QRGH 1BEYL 2VERA 3MLUL 1TKWA 1P7QD 2L7JA 4QRPA 4RMSA 3L1OL 2JKTM 5KUKA 1T21A 1FFTB 2XC8A 1FAIH 3AS1A 3PJSB 1BQ5A 3WKPA 3NJLA 3HI6L 2WQVA 3T8VA 2DLTA 5L9DL 4ANXA 3A47A 4OLVH 1NIEA 4FLRA 5JW4R 4Y4KB 1M7DB 4OUUA 2R27A 5MEND 4UIKH 3QI9C 4HWBL 1OLZA 4DEWA 2J6EL 3QHFL 4X50A 1UEYA 1JZGA 3P4NA 3Q05A 5CILL 2X4UB 3B7SA 4QD2E 3IMBA 4XMKL 1MWAB 3TURA 4B3VA 1RULH 4X5WA 3VFUA 3HNSH 4FQCH 5BXFA 2GKIA 3HUJA 3GTNA 5FO9A 4LHUG 2ATAA 3CFJA 2FR4A 3BEVA 1OQOA 3HC3L 2YMXH 5E1IA 4IBYA 4JRWA 4NJAH 2WTPA 5F88B 1OCWL 5J1AB 3FQWA 3SE6A 3D50A 1C7TA 2A9BA 2Z7UA 5EHFA 4W9FC 5TF1H 4Q0XL 4S1DD 4NN6C 3OPZL 3QRBA 2KS0A 3HE6A 3CH1A 3MJWA 2FT7A 1CDBA 1MWAL 4XBGA 4F1ZA 1FVDB 4KXCA 4LAQL 1MDTA 1CLOL 5A16A 2FE0A 4NO2B 2AANA 4PGZA 3RL2B 3K2MC 1DFXA 3PL6C 5ICXB 1TJHH 4XP4L 1JGEB 1U8OB 5EBLA 2VWEE 4FI7A 3I50H 4APQA 5JPNB 3FB5A 3QPQC 5DMYA 1CFQB 3HVDA 3EYSL 5GZND 4N9GB 4X5XA 1F1DA 4LCUB 4AUJA 2BS9A 1YN6B 1F6AA 3QQ3B 2VXQH 2D9CA 3NQIA 4BCXA 1TEGA 4MMZB 1M7IA 3QPXL 4WWKA 2NDFA 1O6TA 3B9EA 1E65A 4RAHA 2VDLL 3HRPA 1FAKT 4JZOB 1AO7A 4HJJH 1I85C 1KZQA 3PWNB 4X7DC 1BV8A 1TZHA 3P4MA 4PV8A 5A7EA 3MRMB 2A9NH 2VYRE 5KYNA 5CXPA 3IE4A 2WLIA 2CDEB 4BA0A 4FCAA 2CA3A 5LGHL 3MRLB 3J8F7 4LKXA 3U2IA 2YOCA 1KJMB 4P46B 3MV8E 4HV8B 4FQLH 2YD5A 4QO1B 3OR6B 3VTAA 2HYMA 3NG5A 4WO0A 4ZFGL 1IE5A 5C07B 2GUOA 3NSFA 2WP3O 2WV3A 1C08B 3GT6A 1D5IL 2ENSA 2HT4C 1PX8A 3QNXA 2EVJA 4UT9L 3MRJA 1D5XA 1WDAA 1J0KA 2EE9A 4I4WA 1UQSB 2MHAB 1DVQA 4K3DL 1KCKA 1ECYA 1QD0A 4XTRD 4AENB 1TVHA 4EVNA 4KAQH 4X42A 5D7KD 4DO4A 3SE8H 2PCPB 3B56A 3CZFB 4ZUWB 1E4JA 1L9TA 3QYNA 5EUOF 3VXUB 3SYAA 3IJ8A 3R0MA 2CA4A 5E4AA 3EH4B 4XO4A 4F2ME 2ZIDA 1U33A 3P30L 3NIFE 3B2XA 3DUUA 4Z0BH 2FGWL 4OKVA 2F54B 4UB0H 3WEXA 2DLEA 3GHEH 3T8MA 2BC4A 2BHYA 2OPCA 3BKCL 1HU8A 3SDDC 5KN5A 4GQ9L 1Q9WB 1NIDA 3ARDC 2ENJA 5IVXF 3QZLA 4XH2A 3D2UA 2EDEA 3WIFA 1KBGH 4N8VB 2QVMA 2HTLD 1HK6A 1DBJL 5F7WC 1CZ8H 2EDXA 2MMXA 3H6AA 4Y16A 4MZIA 1F4WL 1GS6X 4AKOA 1N7MH 2QQNH 4U6XA 1ZGLB 1Q94A 2HP4A 4KKBD 1ZLWH 5FM5M 5I0DA 3QC6X 2EIJB 4NQUA 3N1QC 4X99B 2H6PA 5AVZB 3U9UB 3RDTD 3ZQXA 5AD0A 3HHSA 5DWUH 4UM9D 3ZT7A 8FABB 5GS0L 2CRMA 4PJFA 5HGAB 3EGDB 3BKYH 4P2RA 1G1KA 3ZE2E 2BSCA 4Y5XA 5IJVA 4K23L 4DKEH 4JK0D 1JWSB 1JTTA 3FUMA 3MUY1 2J55A 4FEIA 5CJXC 3HHMA 4Z7NE 1TVBB 1XSKA 5BZZA 3O3BA 3S5LG 4QRUA 4HC1H 3BQUC 1UWYA 4YVNA 1GS7A 4RAUA 3HPJB 3BUPA 5IVNA 3CMGA 1B9ZA 4KKCC 3T1WA 1GGIH 2J1KA 1F42A 3AACA 1XVSA 3M8OL 2DYPA 4AMXA 5KSBB 2OMNA 4K5LA 1WCQA 1NMAL 1E3FA 3VRIA 3F7RA 3RZCA 1N26A 3OZ9H 1KJ2A 2X70A 4U3XA 5DD1H 5C0AB 2XPGB 5DD5L 2VL5B 3GSVB 5D4IA 2OMVB 3WKYA 5JO5A 2CAKA 4L8SC 4RDQF 3DMMA 4P5MB 2V3DA 5C0DA 3DVGA 2BMKB 3C6SB 5DS8B 1OV8A 2MH4A 3D3VD 4FYSA 4MASA 3VTMA 4B9ZA 1HJBC 4L8DA 2R29L 3QEGL 4CU8A 3IJSB 3T1FB 3QJUB 1F5WA 4JDVA 2XNAA 3QFJD 5IGXH 1EQWA 1ZWIB 1GMEA 1TNNA 3PHOA 3NSDA 1NIAA 3KPRA 3ZUNC 2D9QB 4J3TA 4JN2A 5IHZB 3NZ8A 1T04B 3ULUF 5EWIL 3SGJC 1Z9SB 2B1AL 4OCYH 5BO0D 1CURA 3DK2A 3S3CB 1ILUA 4RVBA 1UACL 2AABH 5LBSA 1TXKA 5CFAA 1OAUL 4OTXL 1X5ZA 1CFSB 1HHJB 1MCDA 1AGFA 1G1OA 1MJ8L 2WVVB 4Y4KC 5AOKA 5CUSH 4ALAC 1XCTA 1PZ3A 2XWBA 4FS0A 4PJ8D 4Z78A 5D7IA 2ATPB 3ZDYE 5E2VL 1B0IA 5LAXA 1GGTA 4WHYG 2X4RB 1WT5A 1MFNA 3KLAB 4YEFA 1IC4L 3MOBL 4N24A 4KKAC 5SWZA 4KY1H 3S37L 1OSPH 4DP5X 1JF1B 1HX0A 2B3RA 4WW2A 3VD2A 2R2BB 4CNIA 1CLYH 1DLFH 4KX7A 1AFVH 1A21A 2OL3H 3TCTA 3SQOH 1R6VA 3RB5A 5B38A 5DURB 3TV3L 1OGTB 5HHNB 1H8SA 5IM7A 1E9PB 3LRSA 4I0KA 5CCKH 3KBFA 4PJEA 3VI3E 1DO6A 2FWSA 3D0LB 3CFCL 4NNYA 2D2CC 4R0LB 3TYGL 3W9DA 4BHUI 3MV9D 1TFPA 2D73A 3HPLA 2VAAA 1JPTH 4I3SH 4DZ8B 3L2NA 4WHTA 5E1GA 1GRWA 1M53A 2VO5A 2F1EA 2QTEA 3ORJA 3UBXA 4PLKC 5LG1A 4V33A 1S7TB 4JFED 1T89C 4G59C 1JZHA 3QG7H 5LBGA 5BUGA 3VFMB 3DX6A 5CEXA 4L1SA 1QBML 5EPMA 5HDBB 1QBLH 1E4KA 5BS0D 1DE4B 2WXFA 3LY6A 4GBXC 4MMZC 3VH8G 4AV4A 5IFHH 2DW5A 1T6VN 5IB5A 4IRJB 4JDTH 5A2IH 4Y1AD 1KF9B 4XP9H 4CILA 5F97E 2EADA 2PABA 4O2CB 2NYKA 4FGMA 4UCFA 4X7TB 3BZFB 4P2QB 1X5AA 1WLHA 3BD4A 3IGUA 3N0PB 1HYSD 2DMBA 3SPIA 3SKJH 4M7LH 1OM3L 4K2UL 1AAJA 1JYVA 2ZPKH 3RQ3A 4P46C 3TIDB 3PDOA 4ELMA 1FA4A 1NGYB 4YDMA 1O9ZA 4TS6A 3MCLL 2P42B 1KGYE 5CCHE 4DVRL 1MFEL 5CMAA 2P5ED 4AYEC 2EXYC 3RUGE 1J87A 1ZVHA 3LEXB 4PWKA 1UM6H 4KUCF 1T3FB 1HKFA 4TLTA 2BHUA 5GSVB 2OULB 5F7FA 4J3OF 2XXCB 3NGBB 2H5UA 1GSKA 4UOW1 3RTQC 1ZEAL 4U0RB 3U83A 5H8DA 2Z7ZA 3D06A 1OGAE 4O02A 5DQDL 5DJDA 5TE6H 4AJVA 3L1EA 5CD3A 1CFNA 3AAZB 5H2BB 4HIQA 3ULVC 4XNZB 4CC0A 1OF2A 3B5TA 3QCUH 1YQVL 3S35L 2P80D 3LN4B 2H2PC 4PLNC 3PQYE 4XCEA 1NCBH 5HGHA 4G6JL 3ESPA 3L3GA 1EVTC 1TIUA 4ZW6A 2Z1PA 2EJ1A 1XGTA 1YPZF 3MHZA 4NGHL 2K3TA 2DQGH 5HDWA 5HHMB 5SX5K 1PKQA 1A6WL 2ZCKH 4OGQC 4WI3A 1VAHA 4N85A 1KB5B 4LFHD 5ILTH 4ZMWA 1D6VH 3JUZA 5KVFE 2VQTA 3RWJB 2KKQA 4G7VL 4LMQE 3W3BA 3RE0A 5IJDC 3UPRB 4MJ5A 3CBJB 5B3NA 4R3SB 3TYFB 4KJWD 3SDDA 4Z7QE 2YUZA 4JN1L 2H3XC 1RIUH 3QORD 1JGDA 5E6ID 1MQ8A 1OAZH 1TZ8A 5LBSH 3TNMA 4NP4H 2YKLH 1R47A 5F3HB 1HILA 4UAHA 4OM0H 3F83A 5JIPA 4QPEA 3P4OB 2VUOA 1XH1A 2JK5B 5FOJA 3LKOB 3MBWA 2VJ8A 1MCBA 3O8XB 3LS5L 4HJGA 3CFIC 4OI8A 1F56A 1JPSH 1K8DB 3ARBB 5JLZB 3IDUA 3C87A 3D34A 1IE4A 2DIBA 1J5HA 4JVWA 5DJ0A 4KVNL 4BZ2L 4XNUL 3U7YH 1YEJH 2OJZL 4OIAA 2BNQD 3L16A 1CLZH 5HHOD 1WCBB 1DJYA 2WB7A 3P73A 3DJSA 4BXSV 4FZEL 1JNNL 2NY7L 2GK0B 4MA3A 3ZMNA 5EIVA 2AQ2A 4BQCA 3HZKA 3DKHA 2YGOA 3CFDB 2ZKWA 4ENZA 4W1TA 5C08E 5D6CB 2DMHA 4DH2A 2WXQA 3V0WL 3G7TA 2NNFA 4M7LT 5C0JB 2K6WA 4A2DA 3RRQA 5K9OA 2IAAC 2N0MA 3QZWA 2CIIB 4H26A 4NRXA 1B2YA 1JTOA 3MU3A 3CPLA 2CRIA 1JDDA 1MRDL 1XWVA 1R4XA 4GRWF 4PRHD 4KNTA 3D85B 2CDGB 3SJVE 1QVOB 3PXHA 4B95C 3VWJB 1RZIB 2OP4H 5J9PA 1HOCA 2WJ7A 1SMDA 3IFNL 4K3HA 4LB8A 3V79C 4R4FH 3NFSL 4HWBA 4OD1L 5E6UB 5C86A 2BERA 1MJJA 1NMCB 4BWWA 1K2DB 5FHBL 3L5WA 4HH9B 5IESH 2XN1A 4PGCA 3BT0A 1JRHH 5FGBA 3KYMA 3MLRH 1YEFH 3FCTB 3E6HA 3FNKA 3EHBD 4WWID 4MRCA 3NSCA 3OHMB 1UD6A 4KV5E 5D1XD 4QHUA 2VR6A 5I0XA 3L1GA 3VMOA 2HX9A 1M7DA 5TQ0H 5C3IA 2QDVA 1QW8A 4RLDA 4ZSOA 4B9PA 3GSXA 1WSST 2GQHA 1BGXL 1Z9NA 3FTVA 4OGAC 5T5FH 1JPGB 2Q10A 4S0HA 1KSRA 5SWSE 1MWAA 2DF3A 1E4XH 2Z4TA 1P7KB 3B8SA 2Y06H 3HS0B 2WQAA 4NM4L 3GS0A 1C8QA 2H6UA 4RCAA 3VRJB 2Q2LA 5EEYA 2LAGB 5DD6B 3X3FL 4KI5E 4P59H 5F88A 1V54B 5J1AA 3VFTB 1DANT 2GT9A 5DMGC 3IXAA 3KXFD 4ABQA 4ZAKD 3NCJH 4DWHA 2ZAHA 2AEQL 1Y1UA 4KPHL 2YS4A 5D1ZD 4WTZG 1TPXC 1PL3A 3D39E 3EGXB 1A0QL 5HDQH 4NO2A 2HKAA 3VYPA 1SM3L 2OZ4L 3BVVA 2BWQA 4IKNA 1JNJA 4WFFE 5ICXA 1JPST 1G0YR 2VO8A 3NIGF 1GKOA 1U8OA 5JPNA 2IDSA 1CFQA 4QLRA 4R90L 3VXME 4IRJC 5IK3A 4N9GA 2PCFB 1U2HA 3OKEA 2Z92B 4XO3A 4X7SL 4JY4A 2ZJSL 1MLCB 4LCUA 3R06B 4RX4D 2I85A 4GO8A 4K5MA 3JWOC 4NZJA 4AK2A 1TSRA 3H4FA 4EEEA 5KSVA 4KZCA 1GGBH 2J5WA 2YZ1A 1XGRB 1NAKL 2C5DC 4PRDB 4LSQH 1PCXA 1WBXB 3TPUB 3PWNA 5I9QB 1F58L 4KVCL 4WUUB 4KMTL 4UT9A 5FYJU 3MRMA 4HAKA 5D7JD 2R1XB 1KWKA 4ZTPL 1HKLH 5BRPA 3DOIA 5AUMB 1XL4A 4FMFA 4LSTL 4GG6A 1S7XB 4HV8A 4A6YL 1E5AA 2BSSB 3NGBC 4E9YA 4QO1A 1IBGH 4MX7B 2VZ1A 3OR6A 4U0RC 4MA7H 3K6SA 4K7PH 2JCCF 4GKOA 3KPQA 3AGWA 1C08A 3UJIL 4XNZC 5J11B 3MUJA 4Q6KA 1TFHA 3ZGHA 2CBPA 4EOWL 2NY4D 2EIMB 1UQSA 1S3KH 2VRAA 1YEGL 3VWKB 4EIBA 4AENA 4A7UA 4HLZG 4F20A 5CWSB 2FEDD 2Z64C 4WUKH 4YHKH 3QDMD 4FFVD 5EOCJ 1U3ZA 4WI6A 4ZUWA 1RVFL 3DC0A 2AEPL 3A6CL 3V6BR 3VXUA 3WDHA 4F7MA 2A1WH 3MLUH 4JL2A 3KL5A 4MNHB 2G5BA 4KK8C 5J8OA 4X2UA 2E56A 3KS0H 1I9JL 4Q8BA 1WBZB 4Z7UB 5L9DH 1AZVA 3APDA 8CGTA 3QXAA 3VFSA 4X4ME 1IGTB 1UA7A 4IGBB 4DN4H 1T1ZB 2ZSVB 1RHFA 1UT9A 3EOBB 4FTVE 1Q9WA 4HWBH 1BWWA 3ISYA 3CSPA 2J6EH 3QHFH 3O2WL 3VFGL 2ENYA 3TJEH 1ZY9A 4N8VA 2YD8A 5ABAA 5KBNC 1DUYB 1P5UA 4ZS7L 1XH2A 3D69B 4N2IA 3UTQB 2ZNXA 3ABKB 3NJJA 1ZGLA 3K6NA 4AEEA 3HC3H 3OKDB 1DHKA 4CMHB 2EKSB 2X2UA 2BXZA 1OCWH 2DL9A 2ADFL 3FH8A 3QUZB 3FO1B 4ALAH 5ACLA 3U9UA 25C8H 1AXSB 2GIXA 3ARBC 4Y4FA 3OPZH 8FABA 3Q3GA 3LZQA 2EVFA 3QARA 1ZJBA 5CINL 1MWAH 2IFFL 3VD4A 1SEBB 2PF6A 3AWGA 3EGDA 3P4LA 4LAQH 1CLOH 5C3LD 1YNTB 4GW5B 3J7HA 4F1SA 3FTGA 1J05A 2BDNL 3CXDL 4HZLB 1JZIA 2VSMB 4ONGL 4X8XA 3S3SA 1JWSA 1ROCA 2CO6A 1YEHL 4XP4H 2JWYA 2X9YA 1HQRB 3CFUA 3UEZA 1TVBA 5MI0C 1HS6A 4OF0A 3RIFF 3WNKA 4EI5D 4JPIB 3HPJA 3BPOC 4C47A 5ELIA 4ODXA 1Z5HA 3SDXB 5G55A 1JV5A 1FORL 1L9OA 3QEUB 5LB1A 2FBOJ 2R29A 2VR8A 3QDGE 4A7SA 3QPXH 1RPKA 4RFNB 4BCYA 2DDQL 4QTIH 3IJHB 3ALPA 5C0AA 2DQMA 3GB7B 4FNSA 4NBZB 1OP5H 3KDMB 2XPGA 1CCZA 3BDXA 4ISVB 1EAJA 2OMVA 5EDSA 2XVGA 3TBTB 1QP1A 5LGHH 2FX9L 3E9UA 2BMKA 1J9SA 4LHQB 3ZT5A 3C6SA 3C8HA 3P0YL 3HFML 4NRZB 5IVZB 2AJZB 3IJSA 3WU1A 2P24B 3O9WC 3UAJC 3RG1C 1ZWIA 4XMZA 1XR9B 4OCLC 5IHZA 4Z7OB 4IRSD 1D5IH 1NEZG 2EXWC 3K2UH 4UT9H 1JZEA 1E8XA 4QKXB 4XX1E 3WTSA 1KYOK 1CFSA 3AS2A 2FWOB 4HXBL 1HHJA 5LNDA 4MMXB 1UWEH 1GZHC 5GRUL 2ATPA 5DZVA 3RIAK 4ODBD 4IK7A 2X4RA 3O81A 5CLYA 4YHML 1HC1A 2XX0A 3HN3A 3WFEL 4LESA 3P30H 3S6CA 1JF1A 3L3KB 4UT6L 5AYQA 4S10A 3WEAA 5GGUB 5D5MF 2W5PA 1JL8A 3BKCH 4GQ9H 2L8AA 5E8DL 1MWOA 4CVUA 2ZWSA 5LWYL 1OGTA 5ERWB 4WAFA 1E9PA 2ENPA 3APFA 4CGTA 5HHVH 3INOA 5IVXE 4JRXA 4JFDE 3NBNA 2A9CA 3GMQB 4Q97A 5FWRA 3STBA 1DBJH 3SYPA 4GAYB 3FL7A 4R0LA 1I8LA 3GSRA 5A3ID 3VB9A 1XH3B 4MSWA 4DZ8A 2OR9H 3RA7H 5J1SC 1SBSL 3KCPB 4MXQD 3FFDB 3KYNB 4P05A 3ZJAA 3SPHA 4BQBA 4NCDA 4ZMVA 5EU3B 4KKPA 5FFGA 3L3DA 1IIIA 2VXVL 1I53A 1M71A 2KLRA 4MJID 3VFMA 5GS0H 5I19L 1N3NA 2F53E 2DWDB 2QPSA 4LBAA 2HFFB 3DARA 1DE4A 4TUUA 1J48A 5HYSB 1A1MB 1CWVA 4MZ3A 3L5XL 3H53A 4IDJL 2ZNWA 4K23H 3ZZQA 3NCCB 5BRZE 1HH9A 4HF5L 3MUGA 3L4VA 4N0RA 5I9QC 4TQEL 3IJ9A 4X7TA 2P3YA 5ACMA 3TV8A 3BZFA 5LNGA 4P2QA 4HDIB 3HG1D 4XMWA 3WN6A 2CXGA 43C9A 3TL5A 3QUYD 3OG6B 4N2DA 1XQ4A 1ZLVK 3TEYA 3ILEA 1KXQA 3DETD 2B1OA 4R2GB 2WKLA 4J23A 1NMAH 2GJRA 4Y19D 4GT7A 3CN0A 5G5DB 3TIDA 3L1FA 1H3GA 3QHZH 4G8IB 3LEXA 5DD5H 4MD4B 1T3FA 3JXAA 4OLUL 3DO7B 5GSVA 4PRAB 4P9HC 4ZX5A 3UZVB 5IWLA 5EUKA 2L7EA 5F0LB 1AZZC 3D87B 4LLDA 1WEJH 1A1OA 4YXLL 4NQSB 5DUPL 3VWKC 3CQFA 5EF1A 1FG2B 2BP8B 4E68A 3QEGH 4HSAC 1E7UA 4NKOA 5H2BA 4AUUA 3C5ZB 4PJXF 5FW6A 3PRZA 2C1PB 4G72B 3KYKL 4I18B 4Y89A 3LKNB 2X44D 5DHMC 5EWIH 1GXEA 3NCYP 3ULUE 1HL5A 4DGVL 4NEHB 2WK2A 1U91B 4NQDD 3JSSA 1UACH 3Q8FA 2AS5M 4TPRL 1TZIB 2NT0A 1PLGL 2Z0BA 3RVTD 5F7HA 1OAUH 2PXYD 1PZ5B 1UXLA 4NAJA 1MJ8H 3PAUA 3W0WB 3N44F 1ZPUA 1AHWA 4HAGA 4PRIE 2E27L 2ICWB 5E2VH 1HOEA 3RILA 1E6JL 3D09A 3UPRA 1CDHA 4A66A 5F0JB 4R3SA 1KJVB 1KIPB 3MOBH 1TYJA 3S37H 3CWGA 2BFGA 1QSEE 1FL6A 2WSKA 4FQXD 4IM8A 1XR8B 4BZ2A 1L0XA 3OJDA 4PJAA 1OCRB 1PZCA 2R7EA 4N2HA 4X8CA 3ZXAC 4CMHC 5I71B 5GJSL 1E2VA 3QUZC 3OVUB 1UWXH 4MAYB 3TV3H 1M2VB 4XMLL 2VIRB 4I1NB 3P4OA 5ID0A 3UTSA 5CP3H 2KC0A 2JK5A 4U6TA 3OJMB 4KK6D 5FO8A 3V0VB 1S8DB 2XV0A 3LPWA 1A7NH 2QSTA 1K9TA 3DPDA 1VSCA 3O8XA 4LCWA 2XZAL 2G0KA 3HKZA 4N2OA 5J3HC 3TYGH 3I3BA 1K8DA 4EAEA 1GJIA 3VJ6B 3QWNA 3NK3A 3Q43A 4LRIC 4WKXA 3W1ZA 4AGQA 4F7KA 3NRQA 1QEXA 2IPUG 3HN5A 5HPMA 2X9ZA 4N2NA 1WCBA 4DKTA 3B2UD 2BY2A 1JGVL 1QBMH 1BD2A 4WSJA 2GK0A 3B9KB 3BUTA 1BM3L 1I1FB 1LQSR 5FYJL 3ARZA 4PJ9D 3CFDA 2EZ0C 1CU4H 5D6CA 1RURL 5T1LD 4CSZA 4NN7B 3VQ2C 5EZOH 1AI1L 1E3ZA 5C0JA 1OM3H 4JFPB 2CIIA 1MVFA 3N55A 4OZGE 4YJZL 1PEWA 2Q76B 2Q20A 3CDZA 5EA0L 3OF6D 1MXGA 2MJWA 3MA7B 3QISA 2GTWA 2F08A 4EUPA 3MCLH 3TZVD 3VWJA 1U8LB 3OZLA 3G6JF 1MFEH 4YSAA 1A6UL 1NFDB 3WXVH 4D9QE 4I0PC 1KEGL 4UMSA 1L7IL 2K9UA 5DJAB 4MKTA 3U7AA 3VMPA 4ANVA 3O41B 3QIUD 4L4VB 4X6FB 1JZ6A 4HS6B 3SKOB 5IKCA 3L54A 3KJ4C 1AHMA 2FUQA 4LLYA 2X2YA 4Z3EA 1YA5A 4JCMA 4AVJA 4GXVL 1MAMH 3KGUA 5GRJL 4NFCA 1OAKH 1N64L 3ET9F 2DWEA 3FCTA 2C9QA 3EDFA 5MHSD 4XPTL 1E2WA 1YQVH 3HR6A 3S35H 3GEFA 1QLRB 1PSKL 2FJUB 4FOMA 2GBTA 4YL4A 2F5BL 3ULSB 1X5JA 1QA9B 5KBDA 4ZTOL 3HN8A 2EE0A 3LPFA 5F9WB 1G7HB 4MAUH 4A55A 5CCGE 1A6WH 3H9SB 4LF3B 2CNZA 1K4DB 3HS0A 4L5FL 1MCEA 2QSCL 1Q0YL 5FYLD 2BNRB 1D5RA 2D2OA 3JV6B 2OZ4A 3VRJA 4LPCA 1U95B 3BO8A 4UQ9A 4F27A 4XOAA 5DD6A 3FT2A 3IDNA 3VFTA 3EBHA 3N42B 4JN1H 5BVJB 4RGNC 2IBZX 3BAWA 5DS2A 1UXWB 3VD9A 2B0SL 2RFXA 2YD9A 2P8PB 1C9SA 1T4WA 1ODUA 1J86A 3LNEA 4N1HB 4ZXBB 4WI0A 5C0IB 3FAWA 5EMYA 4PREB 5HYFA 1KB5H 4KXBA 2B3IA 3TCXA 2FJHB 2ED7A 3VGDA 3CLFL 1HEZB 3EH2A 3S5LB 5ISZD 1FZMB 1AZCA 1P53A 4L37B 3LS5H 3FFOA 4GAJL 2W88A 4UQAA 3B1TA 2CUMA 4AITA 2GHWB 2VT0A 3KLSA 3P2TA 4S2SB 4BUHA 2PCFA 1MCHA 3BJLA 4NUPA 5EO0A 4KVNH 2XHNA 4XNUH 4H1LB 3IPFA 2OJZH 4XODA 3OQ3B 4A6YA 2GSIB 2NY5L 4KJPC 4KQ0A 3HMXH 1FI8C 1XGRA 1JNNH 1OANA 2PW2B 1RHHB 5FW8A 5F6IC 4LQ1A 1CF8L 3G5VB 5F9DC 1GOFA 1PIFA 4HJUA 3OWRA 3VXTB 3GXPA 3VGGA 1EHXA 1QPXA 5FDYA 3V7AG 3WJJA 3V0WH 5AUMA 4C59B 1AGCA 2CM5A 4PB0L 3KWTA 3LRKA 2L7UA 4XN5A 2CR0A 2OS7A 2BSSA 3RWGB 4M93B 3DGDA 4MX7A 3H4HA 1IAMA 4TNFA 4XXCA 4JPVH 3CDCA 4P49A 4B9YA 2ZXCA 1MRDH 4FL4B 3C5ZC 1GYAA 3MGAA 2X5PA 2YAPA 4GRWE 1IX2A 3BX7C 2J8UF 3UIYA 3VFNB 4HEPA 3MRNB 3IFNH 3X2QB 1HEHC 5CWSA 1TJMA 1RMFH 3HNTL 4OD1H 3NIDF 1DFBL 4PRPE 3BP4B 4KDTA 2CJUL 4Y5VB 2ZD0A 4LGSB 5FHBH 2E9WA 1WA0X 3HE6D 3FQTB 4JHVA 2Y5TB 4ZOEA 2P9RA 2EC9U 5T1JA 1VKXB 4AG4L 2PETA 2AQRA 1R3JB 2A7BA 3ZZLA 2AF2A 4KX9A 4Z7UA 1CGWA 2DBJA 4L4TE 5EU5A 4IOSA 4HHWA 4IGBA 2WWKT 1T1ZA 4QF1B 2ZSVA 4C4KO 4TYUA 3ZDZB 5SV4A 4ELMF 1IGJB 3IMVA 4GAAA 1UUSA 2Y23A 5DHVA 1IJ9A 1S2EA 3LZLA 4XC1H 2RA1A 1FIEA 3N6YA 1DUYA 3RKPA 3AXHA 4MAYC 4Q9RH 4LVOB 5CLTA 2M26A 1YJDL 2CRYA 3D69A 3OAWA 5FGRA 3OKDA 3SPCA 3X3FH 2EKSA 2JH2A 3ASOB 3S88H 3IGKA 1YY9D 5HVHB 3IDGA 1AXSA 5ALBL 3S3BB 1NGXB 1SXZA 1YRKA 3MLXL 1IQWH 3S97C 4JFSA 1OARL 1FZJB 1H0DB 2AEQH 3RP1A 4A37A 4FG6D 4KPHH 1T22A 2F68X 3HG4A 3HZVA 4YSRA 1QX1A 2PWEA 3MGOA 1A0QH 1YNTA 4PY7A 3T0AA 1A6VL 5DEFB 4FQ1L 5TE4L 1SM3H 2OZ4H 2OMYA 1JHKH 3GLZA 3IPBA 3B9KC 4Y4HC 4KKZA 4LPYA 2FQFA 2CGYA 3QUXB 4IJTA 2R69A 2WD0A 5FAAA 2IAMA 1P5VA 1G94A 3NIGE 4R90H 3ABGA 3VE0B 3WEOA 1J11A 2ORBH 1R3HB