1HAUA

X-ray structure of a blue copper nitrite reductase at high ph and in copper free form at 1.9 a resolution
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
336
Chain Sequence
b'QDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title X-Ray Structure of a Blue Copper Nitrite Reductase at High Ph and in Copper-Free Form at 1.9 A Resolution
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 89
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2001-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1hauA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1hauA02
3AG1B 4AZUA 1ZV2A 4BWWA 5B1KA 4KNTA 4CSPA 1BQKA 2CCWA 1SDDA 2CBPA 4EF3A 1ZIAA 4N8UA 4A68A 1AS8A 1IBZA 1AZBA 2DV6A 2FNWA 1SF5A 1A3ZA 4YSTA 1B3IA 1PZAA 2IDQA 3S3BB 3ASNB 5I5JA 1RZQA 2XYBA 3FSZA 3X1GA 3ZX1A 2GI0A 1J5DA 3IN0A 2HRHA 3PPSA 4AKPA 5D4HA 1MG2C 1FFTB 5F7BA 4KO6A 1ET7A 3H4HA 2AANA 1SFDA 1JXDA 1NDTA 1SDDB 4QKTA 3IBOA 4YVNA 2YAHA 3X1EA 3NJJA 3H4FA 1BAWA 3JT2A 3CVDA 4YSQA 4JHVA 4BXSV 2RACA 1AANA 3SBRA 3WNJA 1L9PA 1L9SA 3TA4D 1NIEA 1AZUA 3V9EA 1PY0A 1AZNA 1NICA 4DPCX 2YARA 4K9JA 1HFUA 3SBQA 2FQFA 1ASOA 1MG3C 2H3XC 2YAQA 1GW0A 1JERA 1JXGA 2XXFA 3S8FB 2IH9A 4YSUA 3WNIA 1VLXA 2E86A 1CYWA 1DYZA 2R7EA 4A2GA 5PCYA 1KGYE 2UXVA 1NIDA 4WKXA 1OOWA 5B1JA 1AR1B 5I26A 1OCZB 1GYCA 3NJIA 1E30A 3FSVA 4AX3A 2ZWNA 1QHQA 2ZONA 3V9CA 2GSMB 3DKHA 4W9ZA 1JOIA 2FWLB 2HX9A 3QJVB 5AKRA 1GS6X 1RZPA 3DTUB 8PAZA 3UGEA 2CUAA 2UXGA 4JKNA 1V55B 2CAKA 3OD3A 1NPJA 4BWUA 2AZUA 5B1JC 3TBCA 1TEGA 4DP4X 3PCYA 1BYPA 3NSDA 3T71A 1A65A 4AKQA 2PPAA 2UX7A 3FU7A 4G7QB 2EIJB 3EH5B 1JZHA 2VW7A 1PMYA 2QDVA 2H47C 4HCFA 4F2EA 1NTDA 2WO2B 5F7AA 1XB8A 2GB2A 5AFAA 1GS7A 3NJGA 2Y69B 4NERA 2J5WA 1OCOB 4HCGA 1E65A 7PAZA 3ABGA 4E9SA 3X1NA 4BDVB 3FPXA 2YAOA 3OMIB 3FU7B 3FS9A 1KBVA 2FT6A 3ZDWA 1KDIA 1E67A 1L9TA 3FQ1A 1L9RA 4UANA 2B08A 4YSDA 1NZRA 4M3HA 2PP7A 3FYEB 1JZGA 2I85A 1NWPA 1JVLA 4YVUA 2PCFA 3RYMA 2CALA 4A66A 1X9UA 4M4RB 2XXGA 1WA2X 4PAZA 4DP6X 4E9XA 1E5YA 1M56B 3GXUB 2HX7A 3GDCA 2BW4A 1GSKA 3FSAA 2IDFA 3QJSB 1MZYA 1ZIBA 2QDWA 1ASQA 1ILSA 2X87A 4NAJA 2PPFA 4HIPA 1E5ZA 4G7SB 1CURA 7PCYA 4L0PB 5TK2A 1I53A 3BVDB 2QPDB 4DP2X 2P80D 1KBWA 1ZDQA 1ADWA 4YSOA 1M57B 1PLCA 1AQ8A 2FQEA 4P5RA 1BXVA 2PPCA 2XLLA 1SFHA 3NJNA 3PXLA 5AZUA 3WIAA 3FPYA 3S3CB 2QPEB 3CVBA 2Y1AA 4A2HA 3H56A 2OV0A 3G5WA 5B1BB 1AACA 1PNDA 1IBYA 1N68A 3NP3A 4KOBA 2PCYA 1EZLA 1PNCA 3EHBB 3OQRA 1OCCB 1OV8A 4A2FA 4G7RB 1JZJA 1TKWA 1W6LA 1AS7A 1PAZA 2PLTA 4YSPA 4WTQA 1OE1A 1UATA 3EF4A 4KNSA 4FA7B 1ID2A 2PPEA 1AAJA 3ASOB 5D4IA 2XU9A 4YSRA 2XVBA 3NSCA 5IY5B 1ET8A 2DYRB 4GP4B 2OJ1A 3UADA 2HXAA 1FA4A 3NT0A 1J5CA 2OCCB 3PAVA 1AS6A 2VW4A 3ABMB 4A67A 1GY2A 2EIKB 3WKPA 4E9YA 4E9RA 5B7MA 1RKRA 2CJ3A 2VM3A 2WO3B 2ZXWB 1PF3A 1KDJA 4G72B 1JVOA 1BYOA 2VM4A 2BO0A 3FU9A 3MX0B 1SHXA 2XX1A 3NJFA 2J55A 1EHKB 3GYRA 3NP4A 2IDTA 4GYBA 1WS8A 5I6OA 3WKQA 2EILB 4JHUA 5I5IA 1JZFA 1PLBA 2AFNA 2EIMB 2QT6A 4YL4A 2R7EB 4BK5C 3SQRA 3NJHA 4HHGA 3U25A 3OMNB 4GY4A 3QJTB 2XV2A 3EH3B 3CVCA 1BQRA 3NJKA 4G70B 3FT0A 4UF7C 3WI9A 2UX6A 1X9RA 2JKWA 4ZK8A 4GP5B 2J56A 4HAKA 1GS8A 4AI7A 5B3SB 2YAFA 1L9QA 1NIFA 1YLBB 2A3TA 2IAAC 2XX0A 1J9TA 1R1CA 3T6WA 4DPAX 3UABA 1NWOA 2DWSA 1PCSA 2I7SA 2BHFA 2YAEA 3D12B 3KW7A 3QQXA 4HZ1A 5B7FA 4ENZA 4QLWA 2BWIA 4RH4A 4MFHA 3JTBA 2VW6A 1A4AA 4UAHA 5TK4A 1JZIA 1WS7A 6PAZA 2B3IA 2BP8A 3X1FA 1OE2A 5B1AB 2TSAA 1HAUA 3ERXA 2BP0A 4PCYA 2IH8A 4BWTA 4P5SA 1DZ0A 2W88A 3NJMA 1CYXA 4TXVB 3NYKA 1BEXA 1IC0A 2GHZA 3QJRB 2YXVA 2P80A 1WA0X 4HCIA 1L9OA 1MZZA 4YSAA 3CDZA 2VMJA 1GY1A 3N2JA 1AZCA 5B7EA 9PCYA 4KNUA 1URIA 5E9NA 1BQ5A 2HRGA 1ETJA 2XV3A 3CG8A 3X2QB 2BP8B 1A4BA 3FSWA 3ABLB 2YXWA 1SNRA 2BP0B 4DP7X 2Q5BA 3AW5A 1F56A 5FC9A 4YSSA 4E9QA 5I5MA 1KV7A 1NINA 4DP1X 1NIAA 2IWFA 5ANHA 2PP9A 1ASPA 1N70A 3CDZB 4KO5A 3NSFA 1NPNA 2AZAA 3ABKB 1BXAA 4DP8X 3AG2B 3FQYA 3FU8A 3UAEA 1J9RA 4A2EA 1XMEB 2GBAA 4Q8BA 5PAZA 4KO7A 2FTAA 2NRDA 3HEIB 3S8GB 1ZDSA 3OM3B 2GC7C 3PAUA 4G71B 1BXUA 4HHWA 2J57A 3FYIB 5I6LA 1ZPUA 5EHFA 1TU2A 1A8ZA 4BXVA 3UACA 3AG3B 3OMAB 3S3DB 1PLAA 2ZOOA 4YSCA 1RCYA 1IUZA 3NSYA 3T6VA 3N55A 3BQVA 1PZCA 4F2FA 1JZEA 3UAAA 2VN3A 2FQGA 1CUOA 5I6PA 1KCBA 2BW5A 1NIBA 1SJMA 3EH4B 1TEFA 2IWKA 3KW8A 4Q89A 3QJUB 3ZIYA 4W1TA 3IN2A 1MDAA 1W6WA 2FJSA 3AZUA 2FT8A 2HX8A 1ILUA 2GIMA 2WSDA 4KOCA 1M9WA 2UXTA 4KO9A 1XB6A 1AOZA 6PCYA 2W8CA 3L45A 5D4JA 1SF3A 5I28A 1J9SA 4DP9X 1QLEB 2FT7A 2YAPA 3WG7B 3TU6A 2VSKB 2UXFA 2GC4C 1PZBA 1OCRB 3IE9A 3TASA 1CC3A 1HAWA 1SHWA 5I6MA 2EINB 1AZRA 3T9WA 4DP0X 2Q9OA 3FQ2A 4AKOA 4NB7A 4X4KA 3PLYA 3TBBA 2XWZA 1V54B 3T6ZA 1IKOP 1W8EA 3C75A 1V10A 2JFCA 3ZBMA 4FAAB 4GP8B 1JXFA 4BDVA 4E9TA 3AG4B 1GR7A 4YSEA 3AY2A 1A4CA 1QNIA 2VSMB 2YQBA 4E9VA 2H5UA 1KCWA 2LLNA 2BZCA 3QPKA 3IEAA 1XB3A 1J9QA 1OF0A 4CSZA 4F7KA 2TSBA 4N4YB 2DY2A 2IWEA 4DPBX 2AVFA 4A2DA 4GXFA 2XV0A 2PP8A 5LDUA 2I7OA 1T5KA 2IDSA 1KYAA 4E9WA 2HLEB 2HZHA 3CZUB 3X1BA 5A7EA 1AIZA 1WAEA 1AG6A 2YAMA 3NJLA 4DP5X 2BZ7A 2N0MA 2DWTA 3PAZA 3QJQB 2FQDA 1AG0A 2X88A 2MTAA 1FWXA 2PPDA 5I6NA 3T6XA 3HB3B 2JXMA 3DIVA 5I6KA 3MBWB 4HALA 1ET5A 2XUWA 3SBPA 2IDUA 2BWDA 1OE3A 2DYSB 2MRYA 1WA1X
chains in the Genus database with same CATH superfamily
3H42L 3ALPA 3VI4F 4PRHB 3RAJH 3VGHA 5FDYA 2YFNA 1BW8A 2FLRT 1VAHA 2K3HA 2XKNA 3QORA 1SRDA 3V0AC 4GXVH 1QVOA 3HI1B 1N0XL 2YXMA 4JZJB 5CFHA 1UCBH 1AS8A 1NBZA 1YUHB 2DPKA 5LNGA 2WWOA 5ICXB 1KLUB 5LQBL 5CSGA 2XA8H 3G7TA 4UTAA 3MACL 3L5JA 4QO1B 2E3VA 1HE7A 3ZL2A 3T2OA 2BIMA 5MHSD 2FIKA 2MTPA 1MNUL 4FN0A 1MHHA 1YY8A 3H4HA 2FVNA 2HFGL 3TONA 1I85A 2G5RA 4WW2B 3QEHA 3V5KA 4ODVH 2XKNB 3QORB 1BVOA 2DIBA 5HI3D 2F19H 1AO7B 2BOCA 5E9DA 4ODXB 4PJBF 4EVNA 4AWJC 2ERJC 4EZKA 4ZD3H 2RACA 1A1OA 3GRBA 3S4SA 4JN1L 3AU0A 4HC1H 5FO7A 3V4UL 2DYPB 1N59B 4DF9A 4IIQC 3T77B 5CGYC 4XPGL 4IRJD 1QI4A 1UFGA 2R29L 3PP4H 2J2ZB 2OAAA 3QUMA 5F3BA 5DJZA 2H1PH 2EDJA 3ARGA 3I6LE 2AEPL 3QEHB 3V5KB 2APFA 4PWHA 5DMKB 4PGDA 3QDJE 5E9DB 4OD3H 1OCZB 5D7KD 1ZVNA 4M8VA 4H26A 3K71A 1LO2H 1ZTXE 3SPJA 1A1OB 4AX3A 1E28A 3S4SB 3VWJA 4M8QB 2HX9A 4F5CA 2PWDA 1U8QA 3ZE1E 5A2KH 1XL4A 3IRCA 2CAKA 3VQ1C 5D71H 3QUMB 1FZOB 4P2OC 4CADA 1QRNA 5DZVA 2VZ1A 3ZL1A 1AHWB 3VB9A 4HPOL 3U1PA 4PGDB 3KZ8A 3BC9A 2ZXDA 4NQEE 2AJSL 3LEYH 3OZLA 4GOSA 4H26B 5MEPA 4F20A 5T5FH 4WTZA 3VWJB 2YR3A 1BLNA 2VZSA 3GKWL 1FYHB 5A43C 1YNLL 1T0MB 1A25A 3B4NA 2NZIA 4M4RA 1XCQA 4F7PA 3BFOA 4JO5A 4Y9BA 3QIWA 4U3CA 4BQ8A 3NJGA 4CADB 4DGVH 3BRFA 4LCWA 2WB7A 3US0A 5JA9A 2F5AL 2DMHA 3GSXB 7PAZA 4E9SA 4XOBA 1SOXA 4ZO9A 1SVCP 4RMRA 4TYUA 3GSRB 1B3JA 5FIEA 5MEPB 4WWKD 4NZTL 4KJPC 1R6VA 4XNYL 4GMTH 3WJJC 1BLNB 4NENA 3BH9A 4PS7A 2PTUA 3FQNA 3LKPA 4KAQH 2Y6SD 4M4RB 1XCQB 4LCVA 1P7QD 4TLSA 5H2BA 4F7PB 1K85A 4FZEH 2UVEA 3RAJL 4BFNA 1E5YA 3QIWB 1FFQA 3QRBA 4P57A 4G1MA 3WEAA 5GGVL 4EIGB 1F90H 2LTQB 3HHSB 4UTAH 5KG9A 4GXVL 5GGTA 4QXUH 4NUJB 1UEMA 3A4AA 5D5MF 3F12B 1F8TH 5F93C 4NENB 1Q0XH 4XAWH 5EIIG 2WXFA 3LKPB 3HS0B 1XIWC 1IKFH 2WINB 3BZ4A 4YSOA 1KEMH 5H2BB 3WFHB 1M57B 2C4XA 1HVXA 4JFWA 4PN6A 5AZUA 3RWFA 5JYMA 3WLBA 4HVBA 2H8PA 4P57B 3HR5A 4G1MB 5DRZA 2QFPA 1R3LA 3GBEA 2WLIA 4ODVL 1Z66A 32C2A 5ABZA 5KG9B 5K1NA 2F19L 2F5BH 5F7MC 2PETA 5L4MA 3MRIA 2OJEA 3IJ7A 3KGUA 3VFOA 5I1LA 3QWQB 4EI5D 4ZD3L 3IGKA 3BXNA 2BY2A 4HC1L 3QUMH 4FQLH 3MJ8A 4I2XE 1DVFA 3BZ4B 4CL7A 3R06A 2VZTA 4OD1H 3MLPA 4G7RB 5EZPA 1T89A 3RWFB 1TKWA 2I32A 4L4VD 4J39A 3PP4L 1WITA 3K4DA 3QUHA 3RVVC 4IRSB 2P8LA 5DRZB 5GS1A 5I1GH 5IBLD 3SZ6A 4BE6A 1R3LB 4HJ0D 2JQMA 2WLIB 4J3OD 2VZVA 4HEPG 3P30H 3GBLA 2O6FA 1LO2L 3BXNB 1O0VA 3ISWA 2Y4SA 3ILEA 3QW9A 2VLMD 1YNTB 2NY6B 2VDLH 4HAFA 1PJWA 4N1CA 1DVFB 3ABMB 4IGBD 1ZS8A 1GZHA 4K4KA 5JW4R 1TKWB 4LVNC 5AZ2H 1G1YA 5JLZA 1KDJA 5B8CC 1IZJA 4XI5D 5D71L 2WN3A 1BYOA 1LK3H 5DWUH 3VSUA 5GS1B 3IPEA 4TUJA 3FU3A 5KVEH 1SHXA 4QD2E 3PWPE 4JKLA 3ZDXF 1YQ2A 3D06A 4GYBA 4JFTA 4F2ME 2X4SB 4DERA 4YAQB 3LEYL 1JZFA 2EIMB 4RBPH 3THMH 5T5FL 3DBSA 1IARB 5TQ0L 1SVBA 3WHE1 2RQEA 1ZS8B 2JKSA 3EYQD 4UQBA 5AW0B 1F58H 3I6LD 3EF7A 4JFOA 1BVKA 4MWFA 4DUVA 5B3SB 4KX9A 3QDJD 3QSKB 4U7KA 3CDGA 3BH4A 4S1DC 1B4JH 4TUJB 4JG0H 3BP7A 4XO3A 2V17H 1SOKA 2YAEA 2X4UB 2OMBA 4LSSL 3QQXA 4W9FC 3QZLA 1UM4L 1YECH 4OFIA 4Q6IB 4L3AA 3IGAB 1HHJA 5IB5B 3PJLA 2F18A 2PYEE 4KAQL 4JFOB 3HRZA 1BVKB 4KJQD 4MWFB 5GGTH 4XB7A 4FZEL 5E2UH 3CDGB 4NQED 2AQ2A 1SQ2N 4GRLA 1F90L 3A6OA 5F2FA 4UTAL 2GG1A 5EBWA 1K2DB 3QZWG 4HCIA 2IH3A 1TTUA 1VIWA 2VE6A 5ALBH 1QPKA 1F8TL 2YQ3A 1HHJB 1Q0XL 4XAWL 3VXUA 2HRGA 3QO1B 2X6AA 1A1NA 1IKFL 3LNEA 2QZQA 1HZLA 3ZVVA 3L6FA 5TJWK 1G9MH 3DSFL 5MP6L 4G6AD 2YMXH 4GRLB 1R17A 4Q4IA 2GJPA 2YBRB 2PP9A 1E6JL 3FUNA 4IM8A 2DF3A 4YEEA 5EBWB 3MBXH 1KSRA 2IH3B 2F5BL 3KAAA 2VE6B 5CJ8A 1WAAE 5AVUB 1R3IH 4JRXD 4WUKH 3QUML 1NGYA 4OY9A 3VXUB 3K5RA 4FX5A 1TVDA 2DQCH 4JQIA 4AQAA 3U6XS 3Q48A 2ZZUT 4OD1L 4OZIF 3NZSA 4YHPB 3W3BA 5JOEA 1F45A 2XTJD 3L6FB 3GIZH 4HKJA 2MCMA 3R19A 1MJJA 5I1GL 4FULA 3MOBH 2OMNA 3EYFB 3UTZA 1IAOA 4KQ0A 2W94A 3WY2A 4PJ8D 2V5YA 3QAZC 4NKOB 2XBTA 3ARFC 3T6VA 2ZUQC 2I60H 3GT6A 2Q8BH 1NGYB 4PRPD 3R18A 3BFQG 4GFXA 4IOFC 1IE4A 3HZKA 2DLTA 4AQAB 4CC4C 4Z76A 4EOWL 1FORH 5ACZA 2IBBA 2IWKA 3STLB 1J5OH 4HKJB 5AZ2L 3TNNA 5J9PB 1W6WA 4PJEF 1LK3L 5DWUL 4KMTH 1CD0A 3C5SB 4LT7A 3ZU8A 1BQSA 3VYPA 5KVEL 1NGWA 3UTZB 1E8XA 3FFCE 4X6BA 1E4XH 4HIEB 1YEEH 5E6ID 1UD8A 1DN0A 3LKRB 3THML 4AIEA 3SOBH 3D85A 2YAPA 3VI3E 2Y1VA 5DUPH 5AOJA 4Z76B 2BVOA 4W9HC 5LBVA 5ACZB 3BQUA 2EP6A 2D0HA 3VGBA 5C7XH 2WKLA 3V79C 2ZJSL 3VRJA 5HHOD 2WAHA 1I1YB 4JG0L 3NRFA 4RMUA 2RJMA 1X5KA 5AYTA 1DANU 1TUPA 4KK9C 1QUPA 4JZNA 4BFKA 1FH5H 1SYVB 1DN0B 1N7ML 1EPFA 2Q3AA 3I9IA 4JG1H 4ONHB 4RRPA 1YECL 4WHYG 3V4VB 3BX7C 1L3NA 2GBTA 5CJ5A 1KCLA 2YD1A 2JB5H 3D85B 1CPUA 4GSXA 1DTUA 4DN3H 3AT8A 4YSEA 1A4CA 2V2WA 2BVOB 4CSSA 1FNLA 3BQUB 4ODTH 2WKGA 1LQSR 3C8DA 3EG9A 3B2PA 5GGTL 2Z9TA 4Y5VC 4F7EB 1MF2L 4RGMB 3GSQA 5HVHC 1ZD6A 2N7BA 4YHMH 3HOGA 4N2OA 1KV3A 1DVYA 3IEAA 3QPKA 4CA4A 1XB3A 4B0MB 3Q0HA 4JZNB 3SYCA 4G8AC 4EBQH 1AQKH 4FQXC 4HSAC 5EEVA 2F8VA 4WFFD 3I75A 3N6YA 1HYSD 3DHUA 2HLEB 2H0FA 3DUUA 1RZGA 4NWUH 5D9SA 3FULA 1AG6A 1E5CA 5KANG 3IFNL 2DZEA 4Y9GA 1FIEA 4P46D 2QADB 1JWMA 4YGAB 1G9ML 1V05A 1TYEB 4ZUUA 5K39B 1ZXQA 5KSVB 2YMXL 2R2BA 1CXFA 3K80A 2AQRA 4Y4FC 2NY2C 4JQIH 5F7WC 1N18A 1GCYA 2ESVE 2CHXA 3I85A 2BHUA 3I75B 1IKNA 5AAWA 4ELMF 3AUVA 3FU5A 1G5GA 1R3IL 3DUUB 4WUKL 5D9SB 2V6HA 1JL8A 4B96A 1M05B 3O6FB 4CSPA 4PCSA 5F44A 2DQCL 1U9KA 1E3ZA 4HX1A 2J21A 2J8HA 2YC1A 4UNTA 1U3HD 3GIZL 5CCGE 1UA6H 3BAIA 4Z7NF 2JIXD 3GO1H 2NXZC 5GGRB 3RNKA 2ITEA 4QHNB 1JPSL 4MTMA 3MOBL 2FJUB 2YRPA 4UMSA 5JZ7D 1DVXA 1NGZA 2CLRB 3ZX1A 4L3EA 3MOQA 4OLZL 1N10A 3KJ6H 2DWEA 3KPTA 4KKLD 3IF1B 3FTVA 2V8LA 1FFTB 2I60L 1I1FA 2X44D 4POZC 3SCMC 5MENE 2RCSH 4HJ1A 3C6LD 1SEQH 2FJHB 2H2PD 1SFDA 4W68A 4ZMVA 4FJ6A 2EC9U 3DBXA 4IJTA 1S7QA 2Z31B 2OTPA 2YC1B 1FORL 3IBOA 1J5OL 3OMZA 3TYFA 4G43A 2P42B 3KLHC 3M7FB 3V4VH 1DDHA 2BC4A 3F64A 4KMTL 4FHJA 1HZHH 1UACH 4HSQA 4PJDE 5EF0A 3RLSA 4ORGA 4LF3A 1NGZB 1E4XL 1JNNH 1YEEL 2V7HA 3GLEA 4PRNB 1A0QH 3N5AA 1PD0A 2DWEB 3MYJA 3LEXB 4X8XA 3PGFL 2NNCA 1RPQA 2DMBA 1DLFH 1E27A 2E5EA 3SOBL 1I1FB 2A6JA 2OX5B 1Q72H 2Z8VC 4TULH 1ML0A 2HJKA 4ZUVA 5FECB 4J27A 15C8H 5DUPL 3BAEL 3DBXB 1S7QB 2MMXA 2Z1KA 5E5RB 2DEXX 4X98A 1YY9C 1OTSD 2CXGA 3WHE0 5C7XL 4G43B 4IU2A 4PYHA 1AVAA 1U3JA 4R7XA 3TA3C 1DDHB 2BC4B 3QG7H 3QH3A 2J1YA 3CN4A 3BWUF 3MODL 1NJ9B 1NH6A 1QHQA 4BH8A 1EMTH 3MA9L 3O9WB 3TBSA 2FWLB 3QNYA 2V7HB 5HJDA 3IU4H 1NM4A 1HL9A 3MYJB 1FH5L 4YFDB 4XBGA 1S7XA 1RZPA 3QUKA 1E27B 2P8MA 2A6JB 4ZUVB 1N6QL 2JB5L 1TJGH 1NFIA 2BINA 4X8CA 1IT9L 2LFEA 2XVKA 1BYPA 4ODTL 1JFQH 4X98B 4P2RD 4G8EA 4ZX3A 4RWHA 4IU2B 4PRBA 3SQOH 3FFCD 3X11A 4X6DE 4DZ8A 3QH3B 4O4YH 4YHML 1O7VA 4MAZA 2F58H 2YO3A 4KXCA 2NDGA 2NYZA 3P11H 4ZPVB 4PREA 1IC5H 3C6SA 3L3JA 3FQUB 5FW6A 1PBYA 3TBSB 4BH8B 5MEOA 4EBQL 3ULUE 3QNYB 1AQKL 3DO7A 3ELAT 2P5WE 4FG2A 4F58L 4XBGB 4GMSL 3QUKB 4EN3B 2P8MB 3AT9A 5J12B 1UZ6E 3SYAA 3MPCA 4K55A 1NFIB 3CQPA 2CBTA 4ACTA 4NERA 3NEXA 1IJNA 5A6MA 5I73B 3UROR 2GJ6D 2X6VA 4G8EB 4Z1PA 4MJ5A 4ZNEE 3Q2CA 4BZ1A 4N68A 1NCUA 2R23B 2WLLA 3FQ1A 1RFDH 3VX1A 1FVDA 4PREB 3C6SB 3L3JB 3ZXAC 1X5XA 5JPMC 3IWVA 3O2VH 2O6DA 2UWEF 4JQIL 1DVUA 4JREC 4MAYC 5EOCJ 3VWKA 1CD1B 1RZ7H 5HDWA 1BM3L 4OCSH 4M1CD 3TL5A 5IB2B 1IEHA 4RAHA 3VQ2C 2MPVA 5KSBE 3HC0A 2WXNA 1IZKA 3LQMA 4BHUI 1EA9C 2Y1YA 3FAXA 2FUTA 1GKOA 3CFQA 1SJEA 3LNHA 4AL8H 3QUXB 1EZUA 1UA6L 4YEFA 3GO1L 4IKKA 2WLLB 3TPUB 3AITA 4XPHH 3PNRB 1FVDB 3W5MA 4CDGC 4N8VA 1NAMA 3WEOA 3UTTB 3VWKB 3KJ6L 1PD1A 3T3ME 3ULSB 3V6ZB 3HNVH 4G83A 1OB0A 5BO0D 1SEQL 1CDBA 4WGWB 1TCRA 3ENEA 4NQVA 2QPEB 3LNGA 2EDFA 4Z0XA 4NKDB 3L5XH 2JI2A 5IUSA 4BSJA 3VTMA 3PV6B 4G7YH 2I69A 5BV7C 1UACL 5T3ZE 1N68A 5HI3C 4HLEA 1BIHA 2PCYA 4LBEB 4HPYH 1JNNL 4XCCH 1OCCB 1A0QL 2GK0A 1VF5C 1OGTA 3NSJA 1GMEA 4KVNH 4TULL 1G7JA 5IWLA 2QL1A 3AVEA 3CH1B 1TCRB 3V8OA 2WK2A 1OZTG 4IRJC 2EXTA 5HYSG 1FAIH 4ZMPA 2PW1A 3U0PA 2MWCA 3LXBA 1YEJH 2M26A 4A55A 2C3GA 4P49A 1CXLA 2D0GA 3SGDI 3E38A 3QG7L 5EN2A 5C0CA 3PPEA 3M6DA 3DRTB 3MCLH 1E2WA 3PAVA 4NZ8A 2ZICA 3PRZA 3IU4L 1GY2A 2NNAA 1KJ3H 5B39G 4A67A 5L2KE 5AUMB 4Z95H 1OGTB 4GG6A 4GAFB 1ZK5A 1G7JB 1TJGL 5K9KA 1RAMA 3DARA 2LAAA 3LB6D 4L4TB 2ZYSA 1UWXK 4TQIA 3U0PB 2QJDA 2E0PA 3NJFA 1XTLA 1H3XA 3FZUD 4I0PA 3NZHH 1JFQL 3DX6B 5I6OA 3SQOL 1GIGL 1OW0C 2RFXB 5EN2B 4KTEH 4O4YL 4PBWD 2AFNA 2F8OA 2DAVA 5C0CB 2F58L 3P11L 1IC5L 3O0RH 3U25A 1MCWW 4NQDE 2A9MH 2P4AB 2E27L 2LU7A 3QJTB 5D2LA 2D4DA 5DFTA 3WI9A 3ZYIA 1X5GA 2NT0A 3RGVA 5GRWA 1GS8A 3VFNB 3RTQA 5K9KB 1GPOH 2LU5A 4FXLA 5GGVY 5SWZE 3ILDA 2IALA 4I0PB 1T3FB 3MRKB 4R96A 1AY1H 4L9DA 5B3NA 3U6RB 5AVWB 1S78D 4U3SA 1U30A 3KYAA 1XCTB 3KW7A 1MH5A 4QXWA 4NO0D 1B90A 3F6JA 2NPLX 3KBEA 1RFDL 2E4FA 3QCTH 5KBMA 1IAII 4GNKB 4X0KA 1UZGA 5DD6A 1BQUA 5D2LB 4WWKC 1RZ7L 4GI9A 4OCSL 2XWRA 4UAHA 3RGVB 3U9PH 3GXFA 2DQDH 4FJYA 1TLMA 4O2CB 4OJDH 3RTQB 3KS0J 4ZTEA 1VEMA 3ESMA 1B2WH 1KNOA 4ORZC 4XHQA 2ZXBA 2IALB 4Q74A 2Y6SC 2EKSA 4WUUA 2OMXA 4UAOB 1GGIH 4JANB 3ZTJH 4U3SB 2P80A 3FUIA 1MH5B 3Q3GA 4FQQA 4NOFA 3VXPB 4BD4A 3LVEA 3TEYA 3UG5A 4JKMA 4M02A 1AXSB 5FGCB 5JIDA 3OHXC 3PQYA 5E9NA 5I66A 3S97C 5DUBA 1YUKB 4XMUA 5DEFA 4R2GD 3HZMA 1T83A 3D33A 3UEZA 3VXQB 1CVSC 4F8LA 4JFDA 3WXWL 4GW1A 3SBWA 5D2NE 5C6PB 2EKSB 4UI2A 3U48A 1MCNA 4Q97A 3EYOA 2VDPB 3ZO0A 2GKIA 3AJ7A 4LPWA 3LQAH 1MJ8L 4N2DA 1Y6NR 4OF3A 4I89A 3Q3GB 4FQQB 4IS6B 2K9FB 4G7YL 3DX7A 1BXAA 2DWDA 2JTYA 3FU8A 4J8RA 4KMQA 3PQYB 3A23A 4N0YH 5CP7B 1JPFA 1OB1A 3H9ZA 4HPYL 5DEFB 4EI5C 4BGDA 5D1ZD 3HZMB 4PP1D 3SPHA 2EDOA 4I5BA 4P4KD 1M3IA 3TF4A 4KVNL 4Z7QB 2F53D 1ORSA 3SDXF 4GW1B 4AYFB 5SV3A 1ZSHA 1MQ8A 4NIKB 3EYOB 3X3GH 1FAIL 2L4OA 3O4LD 2FIRT 1YPZE 4IOIB 1YEJL 5C0BD 4MNHA 2DM3A 4TNVK 3Q2VA 5IBLC 3ZPDA 3FCUB 2XA3A 4N0UB 1BZDA 3PL6D 4M5TA 2DWDB 4U1GB 1NAKH 4HJ0C 2NY0B 3MCLL 3C12A 1PZCA 4J3OC 4D0DB 3SDCA 2JKXA 1VEPA 3W38A 4WEEA 4AC4A 1HHHA 1KJ3L 3EGXB 2BW5A 3C87A 3ATBA 4Z95L 2R69A 3QIUB 3K8MA 4I5BB 1TEFA 1MIEL 2ZP8A 4YDJA 1ORSB 3FSOA 1JE6A 4IGBC 1KTKE 5ESQA 1FAKT 1ZHLA 2NY1B 2Y6TE 4S11A 3B6SA 3D7PA 4M00A 1M9WA 1G7HB 35C8H 3KBHE 3G6JA 2FWOA 4LKXA 5GIRA 2IG2H 1G9HA 5D4JA 4JRLA 1DANT 4NWTL 4KITB 2EVJA 2EDRA 3O0RL 5EZOH 4GRWF 3SDCB 1XTMA 2A9ML 4KKCD 3RDTD 2VSKB 1HHHB 3MO1A 4NT6A 5HGBA 1C8QA 1RSYA 1PZBA 4H4NA 3HUJA 5IFJB 3T0XA 3F7RA 4YDJB 2MOVA 1CDYA 3SKMB 1C1EL 4BZ1L 4P9HC 1GPOL 4NKQB 1LO4H 3V7AE 3EYQC 1ZHLB 1XR9A 2EQDA 2ZXQA 1AH1A 1OKEA 1AY1L 3B6SB 2WUBH 4JFZH 4PRIE 3H9HA 1GSMA 1UG9A 5EBLB 2FWOB 4LKXB 4NB7A 5GIRB 5ESVA 5C3IA 4LL1A 3BVXA 5GRUH 4UQAA 3BIKA 4Z9KB 3WXVL 3MO1B 4NT6B 2GEQA 4ZYKB 5HGBB 2VDPH 3EAKA 2V8MA 3HUJB 2Y7QB 2DQDL 3U9PL 3OR7A 4I0CC 3TFBA 1B2WL 1XR9B 2ZUWA 1NAML 3EDJA 5EIIA 4BH7A 5J6SA 4XWGH 4CSZA 3DXAB 5D7LD 4E41B 3DMMD 5TDOA 4NQDD 1HHKB 3AMLA 3H9HB 1SMDA 3MBWA 2UV3A 1O5DT 2BVTA 3KWXA 3RBSA 1ZS2A 2YD8A 3QZOA 3ARWA 2R1YA 3CFKA 4H2CA 4OKDA 3BIKB 4J12A 1HXKA 4QDGA 1LP9B 5DJ6A 3RL2A 4I3GA 2YD3A 2BWQA 2N0MA 4APQA 5F7KC 3LHPH 4X6CB 3T8MA 1XGUA 4D3CH 5GRVL 3CDFA 5I71B 1RL1A 2YGNA 1IL1A 3L17A 2B3RA 5EIIB 4B41A 4BH7B 3QG6A 1TDQA 1FNAA 1FC1A 4OLYH 1GGUA 1S7UB 3DIVA 4ZUSA 1X5ZA 2QHLA 3MBWB 1JK8A 2UY6B 3LQAL 3WDIA 1EGJH 2NX5B 3OTTA 3WN5C 4QJ3B 4G6AC 2CLZA 3QDGE 2NXYB 4FI6A 1CFNB 3I6KA 2F7PA 5IG7B 2R1YB 3CFKB 1FJ1A 3H6AA 2IVFC 1U8JA 1EO8H 2APXA 2EKJA 3BVVA 5B1KA 3WLWD 1HT6A 4F3FB 3RL2B 4HEPA 1X5HA 1TITA 5CF3A 2ZXCA 4APQB 4ZDHA 1SDDA 2I9LA 2WTRB 1OGPA 3BPNB 5CCJA 5E1HB 2EC9T 1IL1B 2DV6A 4GIAA 3EXLA 1SF5A 1C5CH 3QG6B 2APWA 1MCWM 4ZUSB 2XTJC 1JK8B 2MFNA 5I5JA 3W39A 1RZQA 2BNRE 2G2NA 3OKNA 2CLZB 2R69H 4AKPA 3ZW3A 4TUOA 2CIKA 4P3WA 4K7PH 1NAKL 4FQ1H 2CBQA 4JGMA 1FJ1B 1TMQA 1U8JB 4PJ8C 3ZRFC 5ETUA 1AXTL 1JXDA 1VCAA 5J11B 4I1RA 1SDDB 2I9LB 1SBBA 4HD9A 4LGRB 3QUZD 4WI3A 4MRBA 4EN2A 1GC1C 4JL2A 1RPKA 2APSA 2X12A 4FA6A 4HUCA 4DK5A 1IM9A 3W39B 2YN3A 4M62H 4LSUH 4CRPA 4P5TB 12E8H 1TG8A 4B9CA 4TUOB 3CCHA 2IG2L 1GMIA 4V1DA 1MCCA 4CJ0A 3BE1H 5CD3B 1GGYA 1RK1B 5EZOL 5C08E 1E3FA 1BD2E 1JTPA 2H3XC 5ETUB 2G60H 5E6IC 2F7RA 1EHAA 4O02B 2IPUK 4QTIH 4Z77A 5K9JH 3C09C 4R7DB 1A22B 4PJGE 4PJCA 4Z3GA 4M8RA 2AQNA 3AU1A 3QO0A 4UM8B 1LO4L 2FLBT 1GYUA 2ZUSA 5I1HH 2ATAA 1ICTA 4DT2A 2HVKB 2CHZA 1IM9B 2WUBL 3G08B 3Q8FA 1N67A 1HDMB 2Z65C 1JD9A 1F4YH 3CCHB 1T0NB 3KJ4B 2G75B 1TO4A 3DTUB 3L3KA 4XO8A 4HIJA 3CLWA 2UXGA 1UWEH 5GRUL 4QRFA 1I7RB 1JP5A 4XN2A 2AZUA 2NW3A 3QZWA 3NJXA 4EAEA 4Z77B 2VDPL 4YDNA 3SYPA 4PJCB 2O5ZH 3QO0B 3AU1B 1S5HA 2P5ED 5CJXC 3T6QC 1PMYA 1MCJA 1SJXA 3IBEA 4XWGL 4PVMA 5FYKU 1L3WA 5EU6B 4YX2H 3L3KB 1JPST 4HGWA 2A9BA 4HIJB 3KWWB 1FCGA 3LKQB 3HRPA 5F7AA 3F2LA 1VKXB 4U0RC 3GSOB 5EA0L 3QZWB 2P7TA 1OCOB 4FNRA 3CN0A 4AQZA 1HYSC 2YQGA 5IJBC 3LHPL 3RVWD 1S5HB 2F68X 2WOBA 4PRID 3AXHA 3M8OL 4JRYD 1OGAE 1CFVH 3ZYZA 2ZCLH 1FDLH 4Y1AA 3UX9B 1UZ8B 4AIOA 1NUFA 4P46C 1TSRA 1KZYA 3P1VA 4P59L 2KUTA 4FA8A 3N0AA 3BJLA 1W8OA 1VHPA 3ULVE 3BGFB 4HXBH 1HNFA 5BZZA 2OMYA 1TJXA 2JI3A 4A66A 4S1QH 4M7LL 5FHBH 4M5YH 1JTTA 1QUNB 3WS3A 3PDGA 2CG9X 4H13C 4EUPG 4JDVB 1EO8L 3V0JA 3WIIH 2P7TB 1YEKH 2W9LA 2IDFA 4KV5E 2YN5A 1QR1A 4EIZC 1QW8A 4AEEA 1U36A 2IMNA 4FQPA 4PJ7E 4KQ4L 4WI4A 1RH8A 4YGVB 1KIQA 2WKOA 2X9WA 3SPCA 4YIQB 2E46A 2Y22A 5KVGH 1C5CL 5JIPA 2IANA 4Y4KA 1U3HC 5AEAA 1HEZB 3U1SH 4JM2A 2JB6B 4FFVD 4MXVE 3LZPA 2VLJA 2OMYB 3OB8A 4O02H 2R69L 4F9PA 1JZDC 5CCKH 3GXNA 4DSYA 2Q7AA 4K7PL 1PLCA 1WYJA 2FQEA 3WS3B 3LZFH 2WSKA 3SDAD 4PJHE 1TNMA 1KGCE 5JZ7C 3FPYA 1JZ6A 2XZQH 1QR1B 4U0QB 1KIQB 1ZT1B 3TP4A 5JXEA 4C57C 3EOBA 4MDIA 2EC8A 4X8JA 5BS0A 1KJ2A 3EGDB 3VFTA 1NFKA 3NP3A 5FV2A 4PRDB 2YLKA 3JWNE 4JM2B 4TRPL 4M62L 4XMLH 4LSUL 5CXPA 12E8L 4HK3J 2YPVA 1QSFD 5I17A 4F37K 3BE1L 4N2BA 3V2AR 4YSPA 1A6PA 4PJ5A 2ZYRA 4O00A 5DZNA 4LOUD 3OKLB 1FLRH 2PPEA 1F1DA 4QTIL 5K9JL 2AF2A 4LSRH 1R4XA 4Z3TA 3RIAK 2BNRD 3QISA 1WFNA 3RVTD 4OAWA 4AYGA 5I1HL 1THCA 3EOBB 4LLDB 2VLLB 4X8JB 5BS0B 1KJ2B 2CKBA 3LN9A 1F4WH 4LCUA 3VFTB 4W81A 4KX8A 3SDDA 2AK4D 1OTSC 4F27A 4XOAA 2Y36H 3M1BA 4QRPD 4AYDC 1F4YL 2QVKA 1ZLWK 3RILA 4S0TD 2DWYA 4JGJA 5I17B 2J5LB 4PUBL 4BM7A 3BWAA 4H40A 4PJ5B 4AGOA 1JVOA 2VC2B 4JUTA 2KI6A 3NCCB 5KYXB 2JKIS 5I6KA 1EHKB 4FQCH 1UXWA 4G8GE 3SGEI 4MJIE 3FTGA 3KEHA 2YLHA 1O5PA 1FNSH 1EVTC 5IQ9A 4NZRL 2CKBB 4LCUB 5HI4C 4JKPH 5E2VH 3SDDB 3MLVH 2WOYA 5ITBH 3CFTA 4YX2L 2LHAA 1RXLA 3ZRCC 1NBYA 3APNA 3BWAB 4R7NA 1HSBA 4XTRD 3IXTA 3OG6B 4HOZA 3TIEA 1EEZB 3OX8B 5G4NA 4DKTA 1UXWB 1BMZA 3FTGB 3B2MA 3CVIL 4GG8A 2UZYA 4WWOA 1A02N 4LARL 1CFVL 1U3ZA 3BKYH 4PYGA 5DSCA 4FLRA 4B95C 5IQ9B 2ZCLL 1FDLL 4QXVA 5EZLA 5JPNB 5ISZE 4DHLA 4LDLB 1KB9J 4HXBL 5SX5K 3QFDA 3ZIMA 5J3HD 4S1QL 3FF7A 3C8HA 5FHBL 1NBYB 2D2OA 4M5YL 4R7NB 4YO0A 2ZYIA 2WXGA 1HSBB 3CHQA 3GK8H 3GBMH 3K74B 2X4PA 3CX5J 4YHNB 2BP0A 3IXTB 4NCC2 3WIIL 5E2JA 3MGTB 4PJXE 1OP9A 1YEKL 3TIEB 2Q7NA 1AGFA 4OFYD 4M1CC 3RZCD 4PGJA 1ULVA 3L2NA 4RMVA 2G3NA 4U2ZA 3UTSE 2JCCE 1H3VA 3BT2H 3UC0L 1UFUA 3VXRE 3CDZA 2FBJL 4P9MH 3GS7A 1GGBH 5J0BA 5EZLB 2ORBH 4Y9CA 2BVUA 2GCYB 1W9XA 3HE6B 1T7VA 3VXSD 3U1SL 4Q9BA 1ETJA 3QFDB 3D2TA 4O02L 5CCKL 3Q01A 2OI9C 3ABLB 1MAKA 3WL9A 2BP0B 2Z7UA 3G6AA 1J11A 1B9KA 1KJ2H 1SJHA 1AGFB 1YMMA 3FT1A 1ASPA 4PJIF 4RNRB 4IU3A 1KN4H 4QRUA 2YPVH 1J5IA 1QLRB 3CDZB 1A6WH 3MV11 2X6UA 4XX1E 3FQYA 2YGPA 1USZA 4PJAB 3O45B 5GZNA 2VC2H 5GGSA 4FKEA 4FXKC 1RLWA 1T7WA 4GB9A 1LWHA 1DJGA 1ZA3B 3DX9A 4HW6A 4P4RA 5BUAA 4ALAH 3IDGA 3HNSH 1EHLH 5B3JF 3V6OE 2VJXA 3G6AB 2G3ZA 4HUUA 2CKBH 5KEZA 1SJHB 3MRQA 1O6TA 1YMMB 5J6GB 5IT2L 1DJYA 3FCSA 1A6AA 1I4FA 4O51A 2WLYA 3OMAB 4UINH 4F57H 4QRUB 4MNGE 1TLKA 1L7TL 1RHFA 3MMEB 4WEBL 3NSYA 3TZVB 5ANME 1F4WL 3BQVA 3F6IA 3H9SD 4XNDA 3UAAA 5GGSB 5IFHH 2GVYA 1L0YA 3LZLA 2Y36L 1CUOA 3DX9B 3CFJA 3IDGB 2WCSA 4Q89A 2G9HA 4W70A 1S6NA 3MV8A 4HUUB 3NIFB 2FJSA 3MRQB 4Y16C 4DO6A 1ILUA 5LGKA 1OSPH 3FCSB 4PY7B 1I4FB 4O51B 1WRFA 4QOKD 4TM9A 3V0EA 3IPBA 3IFPA 3LB6C 3BAKA 1U8MB 2B5IB 3TIDB 3FZUC 2AJ3A 4JKPL 4U4BA 5E2VL 2OP4L 3NDYE 5FR3A 2FT7A 5DDHA 5JQ6L 3FOMB 4M7ZB 4PFEA 3MLVL 4TQEL 4QRRE 4OM1H 2E9GA 5E4EB 3U9UA 3EUDA 3CFJB 1I7ZA 5ITBL 2L0DA 1IBBA 5HGGS 2VR6A 2G9HB 2VMCA 3MV8B 1F3JA 3WNLA 4PS3A 1KXQA 1F00I 3LH2H 3MUUA 3IDXH 4IRZA 4M61A 2GTZB 2V2TA 3JVGC 3TYGH 3IFPB 2X4RB 4MA8L 3TTSA 4GRMA 3GZPA 2WXLA 1ADQA 5KVDL 1ZV5A 1INQB 4XNBA 5F1NA 4FAAB 1S78C 3LVTA 5DDHB 3D39A 3GTVA 4MMXC 2VDRL 3U9UB 1I7ZB 4U6YA 1MW0A 2FX8H 4NQCB 1SDYA 1RMFL 2QR0A 2VRAA 3VFSA 5DURB 3F01A 4E9VA 1J1PH 3GK8L 1F3JB 3GBML 4MJID 4E0RA 5CUSH 4LLQA 1F1GA 5ECGA 4NFCA 5DK2A 3P4MA 4BK8A 1UUSA 1XCWA 2V2TB 2TSBA 4M48L 4PD4K 4X4XA 4N6RB 4M5ZH 2IQAA 3BT2L 2I7OA 3CLEH 1DEDA 1GGBL 4E9WA 5JR1H 2ORBL 5F0MB 1WTLA 5F1NB 1EV2E 1RULH 4FNPA 4YDLC 4KXBA 4U6YB 3T0ED 4M1GH 2PUQT 2QR0B 2MOQA 3VFSB 2HFEA 4AOFA 1D7CA 1KYDA 3S6CA 2DWTA 5HHXH 4IBTA 4LQ1A 4O9HL 1KJ2L 2YUZA 3KCWA 3MV9A 4R2GC 5AVRB 5DK2B 3P4MB 4JKKA 1CF8H 5DU7A 1RZJH 4AQEB 3MUZ1 2JLPA 4BFIA 1IVTA 1F4XH 1KN4L 1TJMA 2YPVL 5ADPH 1IC7H 1A6WL 3ZDYB 2P5PA 5KS9E 3L1OH 2FHFA 3SJVE 3GMNB 5HYSA 3QQNA 2VC2L 1FHNA 5I6XB 4Z7UA 2A6IA 5CWSA 1P84J 2HFEB 4XH2A 4P2QD 4K3DH 4ALAL 3EZ8A 2EIDA 3HNSL 1QLEL 1AZZC 5EFIA 1U92B 3UTSD 4AXWB 5HYIA 1QSVA 2CKBL 4PWFA 3L3IA 3MV9B 5AZEL 5D1ZC 1Y18A 1U8HA 4PP1C 4P4KC 1BZ7B 3RWEB 3RTLA 3IS1X 4Y1TA 5K33A 5HYSB 1TO5A 1V7MH 3EO9H 5IFHL 5JMRA 4Z7UB 2A6IB 1NDTA 2FGZA 5CWSB 3IMVA 3AABA 4XH2B 5E6SB 1NDGA 4PV9A 2HJFA 2HMID 3L3IB 4UILH 1Y18B 4RFNC 4JY6A 5B39B 1CLYL 1OSPL 4P0DA 1DL7H 4BE5A 3UBXG 4M1DH 1NOLA 5FWRA 2IV8A 1NICA 1HS6A 3W11D 3SZKC 5BW7A 3IVKA 5C0EB 4FTVE 4GUCA 1T4KA 2CSPA 1X4XA 1JXGA 4OM1L 5FK9A 4AV5A 4IRZH 1KJVA 3QFJE 1NDGB 4KKCC 1NIDA 3G9VA 5EMYA 3HKZA 3RDTC 1KYUA 1ADQH 3A4FA 4WRLA 3D9AH 2VDMB 3LH2L 3R8QA 3KCPA 4X4ME 3CFEA 3IDXL 3BZEB 2CWRA 3TYGL 2KS0A 4UOZA 1F1AA 1PAMA 2KMWA 2QGCA 4HEME 4YDIH 4N8CH 2NY4C 5IQ7H 3IVKB 1N4XL 1H5BB 2YRZA 3QUYD 4NJ9H 4ZOBA 1T4KB 1UWYA 4RDQF 4BWUA 3NPSB 5FK9B 4Z7WA 2PO6A 2FX8L 4GS7C 3TBYA 4JO2L 4X9BA 5DJ8A 1J1PL 1YAZA 3HE7D 2EIJB 2VLRE 1DQQA 4PHZA 5G4MA 2DQMA 3KCPB 4MJ6B 5BRZE 3IE4A 2EH7H 5BVJA 2NLJA 2IPUG 4F15B 4M5ZL 5DS2A 4MXWH 5LAXA 2J4WL 1K5NA 1ZE3C 3CLEL 5JR1L 4I9WE 3DMMC 3NEOA 3VYNA 1RULL 4Z7WB 2PO6B 2Z3FA 2VL5A 4HCGA 3K7UA 3QJFA 1OK0A 5EUOB 3TBYB 5IEHA 5DFWH 4XVTH 5DJ8B 4KUZH 4PRHE 1X9LA 3RPIA 3TT3L 1KBVA 1T1YA 5HHXL 1DQQB 4PJBE 4QMEA 1DSFH 1L9RA 5BVJB 2NLJB 1JDDA 3QZMA 2PP7A 4OZHB 4O2EA 1H15B 1FG2A 1F4XL 1QSEB 2PCFA 5LAXB 1K5NB 5ADPL 1CB4A 1G6VK 3L1OL 3MDJA 4UUJA 3U0WH 2BSTB 1J48A 5ICZA 4KZDH 4DQAA 3D8MA 2VL5B 5IEHB 3UZEA 4LGPB 3E1ZA 1YJDC 4YS4A 5EIQA 4G8FA 4K3DL 4R84A 4XP4L 5AW2B 4PB9H 2DJ4A 1XH0A 1TSHA 3DETD 5IMKA 3RE0A 3WLWC 2D7TH 3O3EB 2J6EA 2RR3A 2Z92B 2MQGA 1RV6X 1I9RH 1P5UB 5F7LB 2J25A 1D7FA 2QKIA 2QPDB 3QEQA 1AO7E 2X1OA 2PCFB 4LMQE 1NCBH 2BMKA 4UUJB 2JELH 2D03H 2VDQL 3NFNA 2PPCA 5ICZB 4ZOEA 1V7ML 3ARUA 4MQSB 4DESA 3IMBA 2E7LC 1QBLH 2VDMH 4XHJD 4LPUA 2X0WA 1Q1PA 1O6VA 5IMKB 3D3VE 3UO8B 5KAQF 4UILL 2K7PA 4X4ZA 2KL6A 3HC3H 4ZMXA 5AVQB 4OV6F 3QUZC 1DL7L 3GNMH 4KRLB 3DGCR 3MUGA 4GKSA 4QHMA 3QEQB 3EHBB 4JHWH 3L3HB 2XN0A 4M1DL 1VSCA 2BMKB 3HAEG 3SE4C 3RFZA 1UTDA 1K3IA 4BUGA 5DHYA 5A7BA 3O3DA 4FA7B 3MX0A 5KSAA 3DLQR 4IRZL 3DGGB 1IGFH 4P48A 4BIKA 4YSRA 4XC1L 1TQBC 3ARDA 3B2VH 3LPFA 1PZ5B 2HJLA 3NRPA 3O6MH 5M7QA 1IU1A 1QP1A 1ADQL 3OKMB 5DTFA 2OJ1A 1YEDA 3D9AL 2C4FU 5FWQA 3VFVA 3UADA 3NT0A 4GKSB 2WZPA 2CDEA 3GMRA 5AW9B 2HVJA 5EU3B 5DEZA 1CBVH 4TSBH 4YDIL 3OKEA 4N8CL 1Q38A 4NQSB 2ZXWB 4XNQB 4NJ9L 5DHYB 3QCVH 1UURA 1WP6A 3O3DB 4IBYA 5LVEA 2Q6WA 3VMPA 5KSAB 3MX0B 1KIUB 4NC0B 4GEIA 4I8DA 4M7LT 1UB5B 3SPVA 4LRIA 5DYOA 3ARDB 2EEXA 2HJLB 2QSVA 3QVAA 5JOFB 5DTFB 1TQSA 2UYLB 1RVFH 3IGLA 5DO8A 4X6FA 1CQKA 1JUFA 2EH7L 4KZ0A 1JYXA 2DQJH 4K9EC 3OR6A 4FKKA 2CDEB 4FTVD 3L4CA 4AYBA 1UA3A 3GMRB 2HVJB 4MXWL 1EJ6A 1X9RA 4ZK8A 3OKEB 3QFJD 4ZXBD 4HU2A 1L9NA 4LZKA 4K07A 1CQYA 2XG4A 1SLXA 2Q6WB 1J1OH 3BVWA 3U36B 1A7NH 2JTDA 3SPVB 1FF5A 5A1AA 5DYOB 4K94C 1ZMYA 1F18A 4WK0B 1M3JA 4C54A 3V52L 3VM5A 1NC4B 3RVXD 1A2YA 1DSFL 3LN4B 1LM8V 3BIBX 3QI9D 4OFPA 4X6FB 1KPVA 1UXMA 1WLHA 3RVWC 5AENA 3OR6B 1XXDC 5D7JB 2OMTA 1LE9A 4ANWA 5J13C 5ELIA 1EO5A 4K7PY 4MB1A 2A5UA 1WS7A 1VADA 4GUQA 6PAZA 2CMRH 3VFRA 1KB3A 3U0WL 4KZDL 2XG4B 3L9RA 1AD0B 2J6EH 3VSVA 3MLZH 3A67H 4IIZA 4PCYA 4ES8A 4TXVB 2JCWA 5BRZD 2GBVA 1MFDH 2CQVA 1MJUH 2GHZA 3F58H 1G94A 2YXVA 1XF4B 4PB9L 4UT7L 4AIZB 2D7TL 1A2YB 4JY5H 4LASL 4R4BB 4RISH 1I9RL 1KPVB 5FYJU 3RUGE 4DO5A 3T0BA 5JW5A 2OMTB 3SGJA 4FYSA 3LQZA 4PSPA 1VADB 4HHAA 4OGXL 5C0FA 3X2QB 4ZODA 1NEPA 5AB9A 2JELL 2D03L 2WXHA 3CXFA 1U8IA 2FHBA 3L9RB 4FFVC 4KZCA 4XBPA 2CE6A 3AW5A 1QBLL 2C3XA 2OJZH 5FGBA 4DP1X 5CFAA 5GS2H 3S3JA 1B0WA 4QJ5B 5CEXA 1FC2D 3UO1L 3SDAC 4QYOA 3T3PB 3CVHA 5F6HJ 4OCMC 4WCYL 5CLWA 2W81C 5FGSA 1AIFA 2BSCA 1J9RA 3B8SA 3GNML 3HBZA 5JW5B 1A3QA 1ZJAA 3LD8C 1MHEA 3NOIA 1MREH 4YHLH 4JHWL 3LQZB 3UH8A 4BFEA 4HHAB 4HKBB 4W9GC 1LLAA 3MV7B 3BFWA 1FQ9C 4PP2A 3T1WA 2EO1A 2XPYA 1LEIA 4YZWA 5EWIH 4L29A 2C3WA 1FLTX 4EXPX 1IGFL 4QYOB 1R0AH 3AG3B 4OIBA 3CVHB 2Y7LA 1TPXB 3B2VL 3L1EA 3QORD 3O6ML 2ZOOA 4NPJA 3NN8A 1AO7D 2WWNA 5I0VA 1CDUA 4JQVC 1WCBA 3HJEA 4RA0C 3TO4C 1EDQA 3MLRH 5L8LB 1MHEB 3PP3K 3Q8EA 2VN3A 3RVTC 4I2XA 1HI6A 4PP2B 1SJMA 3ZL4H 5KJ7E 2VT0A 5F0JB 4MD5A 2WV3A 5E00B 1LEIB 3QCVL 3SY0B 1CFQA 1ZTXH 4HJSA 4L29B 3AZUA 4QY8A 2FT8A 3VRLF 1ZANH 1S9KC 1RK0B 1VCBC 3HG1B 1BPLB 5HJBA 3NN8B 5E9DD 2ODHA 5AB1A 3KS0H 4NHCH 1WCBB 1RVFL 3DK2A 1YHPA 1SF3A 1LEKA 4TTDD 2DQJL 4U1JB 4I2XB 1FSKB 5FF6A 4GO6B 2DQIH 5E8NA 2X05A 1IGYB 2VNCA 4MD5B 1P53A 3WSQH 1CFQB 1OAZH 5IZ7A 4QY8B 4KJYA 5DJXB 5HHME 1PQZA 3ARGD 3PWPA 2XZCH 4F2MA 3QQ9D 4XTRC 3OLDA 4EUPA 4ZAKA 2CDGA 1TZHB 4I1NB 1E4KC 2XN1A 4BJLA 5AOZA 1IKOP 1ITBB 1LDSA 1V10A 3C75A 3PUUA 1LEKB 1JXFA 4LPTA 2ARJB 3CPLA 2V5RA 2GT9A 3VWJD 3MRDB 4JO1H 4G6KH 5FF6B 2JKLA 5JHBA 2GTQA 4ZS6C 1MELA 4DEPC 1ZLSH 3QFGA 2J6EL 4DCQA 2BZCA 3MRLA 3B5TA 4KJYB 1RERA 4TS6A 2HH0H 5J3HC 3CPUA 1HILB 1W0YT 5J6HA 4N86A 4NUGL 4F7KA 4BKLA 2DY2A 5F7EH 4JDTL 5FW7A 4FTDA 5IB4A 2AVFA 1UGKA 3F58L 4XXWC 4EUPB 4ZAKB 3KXFE 4JY5L 3SKOA 1U8NA 4FNTA 2RH0A 3RZCC 5IB1A 2HZHA 1N0LB 3VXMB 3ZY7A 4PWIA 3CPLB 2ZWSA 2KZWA 2GT9B 2ZOLB 1Y6KR 2Y2TA 5BOZG 2PYEA 2WBJB 3IETA 4IBUA 4WSJA 4WVRA 3CVHH 4AW7A 1TZGH 1HL5A 2CM6A 3MRLB 3QIWD 4FLSA 1BVNP 4J2QA 3RWJB 4HFWB 5EU7E 2MTAA 2OJZL 4LCWD 4BKLB 3T2NH 2HWZH 5IB4B 2A99A 3HI6H 3ZKMD 3II2A 2RTTA 3RI5K 3SKUD 3V0IA 4ADIA 3P40A 3ZGIA 1T0OA 3EH2A 1B6DA 4NLHA 4KMLB 3DTXA 2AI0H 5IB1B 2ZXAA 3IGUA 2N4IA 1IC1A 2JF1A 4RZCA 4UT6H 2BY0A 4WSGA 5TPWH 5KWYC 4YHLL 1TEYA 2IPKA 3GSUA 2PYEB 3POCA 4TNGA 4L8CA 5GRYA 3L3OC 4H5SB 4LSTH 2BY3A 4PEEA 3CSTA 4N8UA 1QTSA 3IDYC 2XZAH 4DAGH 1FP5A 3C6LA 1ONQA 3VACA 4A68A 4BFRA 5EWIL 1B3IA 1MIMH 2CA3A 3ASNB 1R0AL 2FH8A 1LE5A 2ED8A 3MVSA 2HRHA 1ZVSA 3DTXB 4JJ5B 3D5OF 3SKNB 1IGJA 3O41A 1WAAA 4Z3FA 4K2UH 4RZCB 1CE6B 2BS9A 3MLRL 2BM3A 1OK8A 3US9A 1D5BB 5IVXB 2IPKB 3GSUB 4EI6A 4F7MA 1KGIA 4DKDC 4L8CB 2ADJA 2LFGA 2YAHA 3MR9A 3V5DA 3X1EA 4OCRH 1ZTXL 3QXVA 3MKGA 1ZANL 2IGLA 2LT9A 2NDFA 3CUPA 1BVNT 2MCG1 1L9PA 5ALCH 5FUCE 4S1RH 2EDTA 4OUUA 1ZVSB 2B39A 4NHCL 1S9WA 1IGJB 3O41B 4I87A 4KI5F 3D07A 1G7QA 1SXNA 3UJIH 4LLAA 4EI6B 1CLVA 2NY6D 2XXFA 1DVFD 2Z7YA 2YFOA 2ADJB 3RU8H 2E86A 3MR9B 4EUPH 3WSQL 3EOTL 3NAAL 2XWBA 3NJIA 4UV4H 1BOYA 4S0HA 4GUOA 3CUPB 5FDWB 2ZD0A 2J44A 1FL3B 2O26U 4W9ZA 3FFCA 4G9FA 4OUUB 3QEGL 4YMPA 5D8JH 5I74B 4ELKA 4F92B 2BSRA 5KZCB 1TQCB 1SHSA 2F7OA 4C58B 4JKNA 5AVTB 5IB3A 3BLKA 3VI3A 4LP8A 3MA7B 4JO1L 4G6KL 4FABL 4JPQA 4F93B 3CE1A 3JWNG 4MHHG 3U7WL 3V0GA 4M93C 1ZLSL 4XPTL 2ZOKB 2WWMD 2XWBB 3C08L 1JZHA 1MLCA 2FEEI 2HH0L 3GS4A 5JQHC 3GJEA 4QF1A 4AQ8C 4DFIA 3FB6A 1CN4A 3CBRA 1CGVA 3BDYL 2V33A 4LLYA 4G9FB 5F7EL 4F1SA 2O93L 4ELKB 2BSRB 1AQDB 3SE8H 2H3NA 5I1IH 1I7UA 4NC1E 5FM5O 3VI3B 2FSDA 4DIXA 5ITFA 4DNLA 2XIIA 1QLFB 3ZE2F 4PTUA 4XN9A 2KPNA 4GG6F 3ABGA 4PY8J 1CGWA 4DTGH 1MHCA 4BDVB 2DICA 3CVHL 4CVWA 1TZGL 3BLBA 1B4LA 3Q5YA 5IF0A 1ACYH 1L9TA 3T0EC 3UTPD 4V11A 4EDWH 3GJEB 1XX9C 4PG9A 3FB6B 1NZRA 3T2NL 4ETYA 4LLYB 1E4JA 2A1WH 3HI6L 3FYEB 2RGSA 3DUSA 2CALA 4FFTA 5FKPA 4XMTA 4L18A 4Y5XA 2H3NB 3B7TA 1WA2X 2H26A 3EOYG 1CVRA 1RU9H 1UXLA 3GEFA 4QI3A 2YZ1A 5D2LF 4UT6L 5TPWL 2DWXA 5ITFB 1DBAL 4TLKA 1BOGB 1RQ5A 4NYLA 4PTUB 1SXBA 2BSED 1INEH 4LSTL 3ZR5A 3T1FA 4KC3B 2F7QA 1G4RA 5F70A 4DAGL 5IF0B 1JGDA 4PG9B 1MIML 4FXGA 4GRLD 2HKAA 3F7YA 4ERSH 1VJSA 2ZXEB 3DUSB 2ESVA 8CGTA 1B4TA 4PSRA 4RGOH 2GTWA 2H26B 2Y5TB 3FUKA 1BM7A 1BXVA 1MCQA 3JVFC 4K3GA 4ANVA 2R0WH 3A4EA 3VXUD 1VACB 2KYIA 2H6OA 3T1FB 3GLZA 3OAYK 3RG1C 4GQZA 4ZO7A 2EH8L 3US1A 1JGDB 3ABZA 2CGRH 2V9UA 3KE0A 4UTBA 3FDWA 4FXGB 5L9DH 1TJIH 5KTEH 2X0UA 5ALCL 3D2UA 1JD7A 1E42A 2R2CA 2ESVB 2HMIC 4NGHH 5I8EA 2C4FT 4UV7H 2P24B 5ES4B 2B59A 3EFOA 4AITA 2BRRH 5B21A 1OO2A 1RUQH 5J4MA 5MENA 1UWXH 3V0DA 1U2HA 2ZPKH 1NCWH 1XGPB 2FD6H 2VXQH 3PJNA 5JNYA 3TEWA 4PLOB 2YSSB 3RU8L 4Z7QF 1DQDH 2ZCZA 3K4AA 4RA3A 3PHQA 5DQ9A 1M2VA 3NSCA 4UV4L 3C8KA 4GSDH 4XBEH 5JO5B 5IMOB 4OU3A 3D2UB 1TETH 2AABH 3UCRA 4NEHB 1VERA 2E74C 5D8JL 5I9QC 5MENB 1JF5A 2Z8SA 4QHKJ 4UQIM 5DLMH 4X5PA 1XGRA 4XX1G 5JNYB 1CT8A 5DI8A 3QUYC 1WS8A 3PHQB 1M42A 1M2VB 2WWKO 2D7NA 4FL4C 5EH1A 3L4ZA 4YBLC 2Q8AH 3C8KB 2QV4A 4LNVA 4WI0A 5GGSY 5AB2A 4BK5C 2YEZB 2YMOA 4G6JH 4X6EA 4ODWA 4D7PA 2O6PA 1HKLH 1WT5A 1XF3A 4HWNA 4IBLT 4P2OB 1I9JL 3EBHA 5M95B 2W9EH 3HE7C 4ZFFB 1K9TA 3IB4A 2Z34A 3NK3A 3SE8L 3VGAC 5I1IL 1J8HB 4LSQH 3AS3A 4N0CC 4CGUB 1RP9A 4OB5H 3D85D 3V5HB 4XCFH 3DJSA 2XX0A 1XGRB 3GMPA 4FC3E 5DJ2A 4YHIA 1CT8B 2LQRA 4DTGL 4Q6KA 1NWOA 3BQUD 1S9XA 1C8PA 3LDBB 2VKWA 4X6DA 4CILA 1IM3A 4WI0B 1K5WA 4WFEE 4EDWL 1NFDF 4ISVB 4ODWB 1YA5A 1XF3B 5T33H 1NUGA 3G6JF 3NABH 1ZLEA 1RURH 1HIMH 2QVMA 2P5WA 4B0MM 1JZIA 1JPGB 4W9EC 1RU9L 1HXMA 3O4OC 3ERXA 4RIRA 4XP1H 5DJ2B 1G43A 3II1A 3UTTE 4E42A 4AVIA 3HUJF 4YHIB 2BK8A 4HWEL 3RX8A 3NYKA 1IQWH 4OQTA 4XVJH 1S9XB 4N9OB 4X7CC 1DQIA 4ZNEA 3LPGA 4X6DB 1WFOA 2QADD 3NFPA 2VXUH 1VENA 2WYTA 5DUJA 1MDTA 4AMKH 2VMJA 5B7EA 1PSKL 4KBPA 1I1AC 5DD1H 2PN5A 4JN2A 1ZY9A 4YHYC 2WVSA 4ERSL 2XQBH 3DETC 4YLCA 4A2MA 2PMZA 2ZKYA 1S2EA 3D0LA 1UKQA 4IHOA 4RGOL 3LZRA 2DQHH 4HWBH 3B83A 1HXMB 2A74A 2JKRM 4RIRB 2QLVB 2Q5BA 1UHVA 2E9BA 2HT4D 1TXKA 2R0WL 5KSBA 4UTBH 3UBXA 1BIIA 3O6FD 4WLCA 1OT1A 4D0CA 3VXTB 1C16A 3ARBA 5C1MB 3NFPB 1BZOA 4XHJC 5C0GA 2CHWA 2H7WA 3ABKB 1RI8A 3QIBC 5L9DL 3PWLA 5KTEL 4PGEA 4K7FA 4ATTA 4F9LC 3D0LB 2WSPA 2ZNXA 2WO4A 3A0OA 3ASWA 2YWZA 3PL6A 4KO7A 4NGHL 5HDBF 4PV8A 2G5BA 5C3LD 2A74B 5JIIA 5IHZA 1RUQL 2GC7C 5KSBB 4G71B 1KN2H 1OSEA 5CHNB 3UBXB 3FYIB 1BIIB 4D0CB 3G5YB 2ZPKL 1EJOH 2ZCKH 2FD6L 3DWTA 1RJLA 3ARBB 1DQDL 1ZA6A 3TXAA 4OVVA 1S9YA 2X4QA 1U95A 1INDH 4JFXB 4GSDL 4L4TE 4XCNA 4XBEL 5D7IB 5JW4N 4CKQA 3PWLB 4PGEB 4K7FB 1E90A 2VDOB 1JZEA 3GIVA 3HC4H 4Z7VF 1BG1A 2AABL 2VZOA 3QS2A 4J3WA 4X7TA 3H3BC 3UTQA 5C0AE 4L3ED 4FG0A 3ZDZF 1A9BA 2QMJA 4M7KH 4PV8B 2G5BB 3MCKA 1NQBA 5IHZB 1NCAH 1EANA 2VERN 5DLML 3J8F7 1M7DA 3QXDB 4YBHA 1RJLB 4ICWA 4H0LC 2H1XA 1HL4A 1NMAL 3MTRA 4RETB 2ZAIA 2DRUA 1KCSL 5EN3A 2Q8AL 1KENL 1KGJA 4LVNB 4XCNB 5LBGA 2D3VA 4OCNC 3GIVB 2Z93A 1J9SA 1HKLL 4DP9X 4HJUA 3NCJL 3O9WD 2W9EL 3UTQB 5L2KA 4N90D 4UIMB 5E8PA 5GS0C 3MCKB 3DNKA 4LSQL 1LTXA 1SN5A 3P0VH 2GSGA 4XCFL 3MBEC 3IYLW 1BBDL 4UQ9A 3B43A 1HCYA 5EF3A 4ZXBC 3BDBA 4WV1C 3ULUH 4U1MA 3RL1A 5L6YH 3DX0A 3KPSE 1JDCA 2VLKB 1E2VA 4GEJA 4NN6C 1OANA 4J6IA 2BSSA 5C70A 5C9JA 5TE4H 4N26A 5TQ2H 2Z93B 5T33L 4LU5H 2AJYH 2X28A 4NQDA 2ZP9A 3TWCH 4I1PA 3K46A 3NABL 1HIML 3RVXC 5L2KB 2JSFA 3EOAA 4OF0A 2IEPA 5E8PB 1PEZA 3QI9C 1XEUA 3H7BA 2H2SD 1FYTB 2EO7A 1EQWA 5FGCE 2GSGB 4Z7OB 4OTXH 5SWZA 2NQ3A 2O4EA 4PJCF 3QCUH 5EC2B 2ZXGA 1K4CB 4XVJL 5AALA 3JWDL 2Q0ZX 3IFOB 3SGKC 5DUMH 4JX0A 3WTYA 2BSSB 3D0VB 5HJ3B 4XAKE 4AMKL 5C9JB 3CX2A 1V3JA 2B1OA 3EYSH 4PWKA 5DD1L 1NM9A 1QBAA 4XN4A 2XQBL 5DJYB 2J7LA 3EOAB 5BUPA 3M7OA 3L13A 1KXTB 1HCVA 3H7BB 4UMGA 3JWOC 3NIGE 3SIKA 3OHMB 3B2DC 5F88A 5KYUB 5D6DC 3B7YA 4K71C 4UTBL 3CGTA 1OM3H 4P3DA 4MASA 3DO3A 2EADA 2VDOH 5E56A 3HAEA 1G0XA 1ET5A 3C2AH 3QUXD 5IESH 5LJYH 1MXDA 2DYSB 3NJVA 2E7DA 3BAYA 1HZKA 2AHIA 2ZAHA 1Q9WA 2HKHH 3UTTD 4AGNA 5DD0H 3VWKD 4JZJC 4N0UE 5E5MA 4X4YA 4KDTC 3MRJA 2CBPA 3S2AA 2N1TE 4BSWA 4M4PA 4NKMB 5F88B 4ZFQA 4EF3A 5JDJA 5B22A 3FO0H 4HWZB 3ARFA 4AG4H 3PHAA 4JMNA 5D2NA 3O6LH 5T3ZH 3WFBH 1EJOL 3N44F 4GQ9H 1VEOA 4BKTC 2TRHA 2VRKA 3NCWA 1PYWA 2XIBA 3MRGA 1D3CA 4YR6A 25C8H 3EIFA 3DVNB 4PW9A 4BFOA 3W56A 1A6VL 4YL9A 4N2CA 2YKLH 3QORC 2B1AH 4CW1B 1R5IA 2A77L 4BUQA 5E5MB 4X4YB 3MRJB 4M7KL 4X7DC 1AGBA 5FKAA 3GF8A 3VMOA 4YVNA 4R3SA 1NCAL 3ARFB 3CVDA 2ZUQB 3NCYS 4HH8A 5D2NB 4NO3B 5F0PB 4BXSV 4L8BA 4XR8C 1FL6A 4H44C 2CH8A 1YPZA 5CJOH 1UQSB 2NCEA 3MRGB 2WKOF 4MDRA 5C8JA 2EIZA 1RZFH 1I85C 4JM2F 2AXJA 1CU4L 3DJTA 3EJZD 1SMOA 1R5IB 4QTHB 4ZFOA 1G9EA 2VUKA 1ACXA 2VOTA 1CTOA 1R46A 4YSUA 1AGBB 1VLXA 2AJUH 5EF2A 3HVDA 4FLQA 3L9YA 4R3SB 5ABDE 1AMYA 5AYQA 1P6AB 3P0VL 1FFOA 4GAAA 2XN9B 5DVNA 1FL6B 3ULUL 2NY3B 5L6YL 1YPZB 2C9AA 3CDYA 3K1DA 4PHXA 4BKSC 4N9GB 4WNJA 4K23H 2EIZB 1J12A 4PU2A 2BZDA 3ARGC 4MSWA 5TE4L 1P7BA 1UKTA 2OXHA 3UGEA 5C0CD 3GKZA 5TQ2L 3AAZA 2PR4H 2VQUA 3QQ9C 2GEEA 3DXAE 4E41E 3C5JA 3TWCL 3S88L 4ZFOB 2IADA 4OQTL 1TEGA 4M6ML 3GC3A 4YK4C 3U4BH 2RB8A 1N5AB 1QFPA 3VWJC 5IROA 4WKZB 3VFPA 1FFOB 1X5IA 2V0AA 1WF5A 3BW9A 1LP9E 3MOAL 2YRLA 4I0PD 4IW4C 5F7NC 5INDA 4PRIA 4X6CE 5DUML 5DMIL 2OR9H 1EK3A 2QQQA 1P1VA 3KLSA 2OXHB 5L4FA 3AAZB 1KT2A 5D96C 1WFMA 3C5JB 1A6ZB 4P04A 2V3EA 2NX5E 3LX9A 3HPLA 5CSZA 4FQXB 5F6IB 3RGVD 4PIBA 3RTQD 4WFHE 3VFPB 4G7VH 1SMAA 1M6UA 2HT3D 3BW9B 1XF2B 3CN3A 1OM3L 4UANA 4Z8FL 3HLAA 2D3NA 3FO9B 1N5YH 2VDOL 5INDB 1AKJA 5FO2A 2R0LH 5F0LB 1BBJA 6TAAA 4JPIB 3B9EA 3AADB 3BUDA 2I85A 3C2AL 3QIWC 1NWPA 1JVLA 4OJFH 4B5ZA 3W1ZA 5EEWA 1KT2B 3BPLC 3RJQB 5JDSA 4E9XA 2LTQC 2HX7A 3ZKMC 2HKHL 4KY2A 5ECJE 5DD0L 4J4PA 2LOEA 5CSZB 3P3SA 1YEWA 2NY2B 4JKWA 2G4GA 2QDWA 4GAJL 3WNPA 3AT0A 1BF2A 3FO0L 1E2ZA 1FPTH 5DA4A 3AREA 4AG4L 2FE0A 1O7DC 3HLAB 3O6LL 5T3ZL 2DH3A 4LLWA 4GQ9L 1AKJB 4WUUD 3O3AA 4L1DA 2FSEA 5C09B 1JYNA 5IJKA 2HCZX 2EIBA 4DP2X 2P80D 25C8L 1CLOH 3QDGA 1ZDQA 4R97B 4H8PA 5FS5A 2OTUA 4M8UA 2DDQH 2NXZB 2YKLL 3N1MC 2B1AL 2HTLD 3PQYD 4WHDA 2HT2D 1OL0A 1HXYA 1F6LL 3H56A 5KVGE 5DVPA 5BXFA 1UWFA 4NQQA 3AREB 4APXB 4JFDD 3L2MA 4MKTA 3SYOA 3KYMA 3SCMB 4LLWB 4B97A 4ZMNA 1T2JA 5CKGA 3UBGA 2ENJA 3GMLB 3NIDE 4W9CC 5CJOL 2Y25A 3HNTH 3KYKH 4K5MA 4RSVA 1ZLWH 3ZYJA 3QDGB 5ILTH 3N1GC 1HNGA 4WHCA 2OTUB 4GBXA 1MCSA 3OZKA 4URTB 4W93A 5I0WA 2NY0D 5T1JA 1Q9LA 4HSCX 1UATA 4W4NA 4XMVA 5G55A 4OD2A 3DI2B 1ZWIA 1G9MC 2ADGB 3BSGA 2AJUL 4EQ3A 1MFBH 1HXYB 5BXFB 1X5LA 4K3HA 2HLAA 2NY6C 4OF7A 2F8IA 1DVFC 2ZUTA 5DGRA 4U7MA 3QQDA 1T89C 3H9YA 4UQCA 3QHTC 4AUJA 3I3BA 3B56A 4K23L 5GS1C 1GZQA 4GBXB 3OBAA 5FA4B 5B7MA 1G0DA 2CRZA 1T04A 2LVEA 4I3SH 1U58A 2PR4L 5C08A 1BD2A 1Q9LB 1R3JA 4G72B 4XGZB 3SDCD 3BO8A 1BVZA 1F42A 5BNXD 4BSVA 1IE5A 3EFDH 5EOTA 5EU6E 3S34L 3IMRA 1D5MA 3GYRA 4PJGA 5GSVA 2EILB 5F89A 3VFGH 3CZFA 3NIFF 4WI6A 5FM8A 1FI8C 2I07A 2QT6A 1GZHC 2R7EB 3CC1A 3QQDB 4DKFL 1DBKH 1UWGH 5SX5H 5JHDE 4ZS7H 1S3KL 2WWMC 2OR9L 3U1QA 5D4QA 3O81A 1T04B 4K73A 1AD9B 5EPMB 5C08B 2NSXA 1BD2B 1R3JB 3BO8B 2WCPA 3OKKB 5A2FA 1MRDH 3ROLA 3VTTA 3KLAB 3Q8AA 3QXTA 1D5MB 2QQKH 4PJGB 5LNDA 1PKQE 4NRZA 5F89B 3CZFB 1HJBC 1P9MA 3MFFB 1MCPH 1FVCA 4LLUB 5C0RH 5C97A 4HZ1A 1N5YL 2QQLH 2BWIA 2R0LL 5JHMA 3DXAD 3JTBA 4JPKH 1J88A 2K0RA 4OJFL 4AUUA 2DQTH 1MXGA 5IW1B 4ES9A 1AJ7H 1DBBH 1MHPH 4PCTA 1J8KA 3DOIA 2J6WA 2J20A 2Z91A 5L8KB 5JPMB 4KRNA 3WDHA 1E8WA 1S3RA 5DFVC 4LHUG 1NKGA 3Q2WA 1OGAA 1FPTL 1L9OA 3BD4A 4J3SA 5C0JA 2FK9A 3WS6A 2VWEC 3HRZC 2WYIA 4M9PA 4OFKA 5D1XE 2JJTA 3W2DL 4KKRA 1BQ5A 4ZO8A 3SYQA 1BFVH 1V27A 1CLOL 3CG8A 3VD0A 2NXYD 3V6FB 4GRLC 2X9ZA 5JTWA 3O3BA 2J71A 4OH2A 3VVWA 2Z91B 4FHBD 1EZVY 4QHUA 5D70L 5B38G 1A6UL 4APQD 4UDTA 4FI8A 5AOIA 4PJ7A 4I9XA 4P5MA 3F85A 4OSUH 2PNDA 1R3KA 3ELQA 4DP8X 3UAEA 3I9PA 2X4OA 5L4IA 5KN5A 4ZFOL 3KYKL 1LEGA 3PREA 2A4EA 3WJLA 1CFTA 1G1CA 3Q44A 3UL4A 4AEIH 5K9QG 3H6JA 1HU8A 3TBVB 4ILDA 1KTCA 1DQVA 3ZQWA 3BCFA 4KKAD 3D4YA 2B7DT 1WGOA 4YQXH 4I77H 4UDTB 1MFBL 5AKVA 5L88H 4PJ5E 4ADJA 3NGBB 3PNWA 2VR3A 4P5MB 1VFAA 3B34A 2DD8H 1BZQK 2DBLH 3C2SA 2X4OB 4LCCA 3FU0A 4H20H 5E03A 1LEGB 2C9SA 1CFTB 4MVBD 1GRWA 2HP4A 2AJZA 3EDFA 4P5TD 1HQRA 3CHSA 1Z0NA 3EH4B 3R7QA 3A6BH 4I3SL 4W1TA 1WJ3A 4Z7UF 3IN2A 3GPSA 4KKZA 3F62A 1KBPA 2PWEA 3A3YB 1NBQA 2OYMA 3IJ8A 1MCBA 4KOCA 4MAUH 1F6AA 4ZOCA 1EEYB 3VFGL 3PNWB 4MCNA 3L45A 2VSDA 4M5SA 3OXRA 5IHUH 5AB0A 4U6VL 4AW4A 3PGCB 4LCCB 1DBKL 1QQDA 1GYVA 1W0VA 1UWGL 3OWRA 1UJ3A 4HMEA 4JO4H 1IM9D 1SY6A 3B1TA 3PU7A 4ZS7L 2ISDA 5ADOL 3CFDB 3TJPA 5E24E 1NLBH 4UT9A 3HPJB 1JN6A 4BFBD 4PW4A 4OJYA 4JVUA 3NQIA 2J3SA 3EDEA 4JR9L 2NYYD 5C86A 3RIFK 5JQIB 1R5WB 3BP4A 4H1LH 3IJ9A 4PVNA 3UAJA 4B53A 4JBSA 2QQKL 2MEJB 4JB9L 1QKZH 1UOLA 3F8UB 1EAOA 1F6AB 4G8GA 4MJIA 4WENB 2ENSA 2C9UA 2YEVB 4DP0X 3F7KA 2DKSA 4LPXA 1CDCA 1MCPL 3OXRB 5C0RL 1QAWA 3UC2A 1QQDB 1W0VB 2QQLL 3BQUC 1UJ3B 4GP8B 3PABA 2BDNH 2VIRA 2CIIA 2CDFB 4RGMC 3MRNA 1AKPA 1W72A 3FT2B 5JW4M 1WICA 1AJ7L 1DBBL 3SE3A 1WD9A 5LGJA 2IIJA 2JK5A 2WQRA 4QCIA 1TVHA 4F7CA 3ULVH 2ZX6A 4GXFA 4JFEB 5BMFH 3IGFA 4EDXA 3RWGA 1GYAA 4ZMZA 4Q9CA 3SD2A 1D2PA 4JMXA 1ESOA 5ISZA 1L6XA 4RMQA 4PWEA 5DJDB 3PABB 1P7QB 2CIIB 2VIRB 4XO9A 3VFWA 1U4FA 1W72B 4GW5A 2AK1H 3WNOA 5LGJB 1BFTA 4PJAE 3DGDA 4GI8A 2JK5B 2FQDA 5E08H 2CPCA 2EDWA 4U3XA 3CU7A 4PJXA 4QWWD 2X88A 1TVHB 1QTPA 2WVVB 5I6NA 3RWHB 2AQ1A 3ET9F 4F7CB 4KDVA 3UTSA 2JCCA 3W9EA 2HT4C 1QFWH 3O2DA 5JHLH 5IFAH 4OSUL 3VXRA 1KELH 4U6HB 1OALA 5ISZB 1JNHB 1YMME 2XOTA 4BEIA 4YLQT 4HJIA 5EO1B 3VFWB 1ZHKA 4GW5B 4WNQB 1AC6A 1FGVH 1EIBA 1JGVH 1XGQB 4FKHA 2KZKA 2YD2A 3MLXL 1I8KA 2AXGA 3V7MA 5DJ0B 3FAWA 1IKNC 3MFGB 5AAWC 4ANUA 4R7VA 2D7QA 5IHBA 3JWNH 4I77L 3I9GH 4K8RH 4KH9A 4YQXL 1XF1A 4B7LA 4MDJA 3W9EB 4AC2A 5L88L 2XYBA 3OKDA 1M2OA 2JKJA 3QRGH 2CK0H 4FZ8H 1QWHA 3BAWA 2DD8L 4R8WH 3LN5A 5GRXG 3WUWB 1CI3M 1T1ZA 2IAND 5E4OA 4HP5A 5LLIC 4Y4KD 4H20L 5FUZL 2ZF8A 4JM2D 1BZ9A 3IJSB 4K5NA 4OLEA 3KPRE 2R1WB 1E50A 3X13B 4L8SA 3A6BL 4HCRA 1UYWH 1I8KB 2AXGB 5LO7A 3V6OA 2IQ9H 2P49B 4NCDA 5I8OH 1C12B 3QNXA 3RNQA 5CNHA 1FO0B 1SY6H 2E7MA 3QPQD 4Y19E 4MDJB 3OKDB 4UT9H 3LY6A 4MNGA 2H32B 3MV8E 3LZQA 3HMWH 3WY1A 3WKNA 3LN5B 5IHUL 5JXED 1T1ZB 2ED7A 4X5QA 4IGBB 5ANMA 3LS4H 4LEXL 5BS0D 5CILL 3LPPA 3KPQA 1U8OA 2YRBA 2K6ZA 2DM4A 3L3DB 1BZ9B 1NLBL 5BRPA 2X6MA 1BFOA 4XX5A 2VR4A 3EFFA 4JL1A 1NCGA 2DIEA 1UVQB 2GJJA 3BKMH 4N2AA 1LMKA 3MRPB 4LXFA 4XO4A 3I3EA 4PJ5D 1GYCA 3B9KA 1UD2A 1RUML 3QNXB 4XXDA 4NQCE 5CU5A 2GSMB 2W59A 2NNXA 1W72H 2YGQA 1KYOJ 5AKRA 3GJFK 5TDNA 2IJ0C 5ANMB 2X2YA 4ZFGH 5CR1A 1BGXL 4N2EA 1KTDA 4MKMA 3KPQB 1U8OB 3SDDD 1EEUA 1KCKA 2XWEA 1F2XK 3ZE0E 4QRRA 5E6ZA 3HW7A 1FFNA 4TL4A 4PJFB 2YK1H 3B9KB 4KUCF 4DUWA 4XXDB 1DO6A 2AQ3A 3NG5A 3T65B 5KJRH 4KK8D 4AYSA 5J12C 1W80A 1G7IA 3ULVL 3MROB 1F6FB 3ZTDC 4OZ4B 5BZDA 2JKTM 2R29A 3I2CH 5TDNB 5I73C 4NO2A 2CNYA 3JV4B 3Q5OA 1KTDB 3IAPA 1BREA 3LRHA 1JRHH 3ARYA 4IEFB 4QRRB 3COOA 4DVBB 4MJJA 1FFNB 2D7OA 3BKCH 2AK1L 2JMRA 4RGNC 1EUTA 3O2DH 3FS9A 1T21A 3OXSB 2VN4A 5E08L 3ZDWA 1FZMB 4S1SH 2ICES 4HS8H 1B9ZA 5CJQL 5E1GA 1T7XA 3QR2A 3EJJX 1DQML 4JDZB 2W07A 5BZDB 1QFWL 4YVUA 3CV5A 5IFAL 1E0OB 4B3EA 1KELL 3KHQA 4YHKH 4F33A 1DJSA 1WHOA 4JCMA 5HYJA 3SPIA 1BFSA 5LXVA 3HE6D 4J3OH 4E68A 1BWMA 1GSKA 3ZE1F 3GGWA 1FO0H 1GJUA 3TNMA 1FGVL 4ZMLA 1JGVL 1MZYA 4ZUTA 1CTMA 2YD4A 2H32H 1T21B 3ILQD 1WBYB 1IEBA 3HB3D 4KKPA 4KXZI 3VWKC 4EQ2A 3AQDA 2FZ3A 3I9GL 3L7EA 4K8RL 3FK3A 2C1OA 2W07B 4LHJB 4OGAD 4FZ8L 2CK0L 2OR8A 3GRWH 1MI5B 2R56L 3BP5A 3I9AA 1CGYA 2KZBA 4HKXB 4JRXB 4WJKB 4F33B 4R8WL 5HYJB 5KS9A 3SJVA 3R0MA 1LO5B 3NJNA 3VGFA 1DQKA 1CXHA 4TQHA 3S3CB 2FRGP 3GGWB 4IOSD 2VMDA 3TNMB 3RVUD 4IYKA 1QACA 2WLNA 4ZUTB 1CWVA 4KI5C 2NNRA 3G5WA 1UYWL 5AW5B 4EXKA 1IEBB 2IQ9L 4ZW6A 4P9HH