1HAUA

X-ray structure of a blue copper nitrite reductase at high ph and in copper free form at 1.9 a resolution
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
336
Chain Sequence
QDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title X-Ray Structure of a Blue Copper Nitrite Reductase at High Ph and in Copper-Free Form at 1.9 A Resolution
pubmed doi rcsb
total genus 89
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2001-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1hauA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1hauA02
3CVDA 1J5DA 1MDAA 2FNWA 5TK2A 1KCWA 2NRDA 1WA2X 1PLCA 3X1BA 3FPYA 1ILSA 1PNDA 2UXTA 1JVLA 3D12B 1A4CA 1JERA 2BP8B 4NB7A 2VW7A 4DP7X 3S3CB 2UXGA 4E9RA 1ADWA 1ZIBA 3TASA 1QLEB 1BQRA 2FT7A 2HZHA 1V54B 4CSPA 4HCGA 2IDTA 2WO3B 2PPEA 3MX0B 1OV8A 5ANHA 1J9QA 5I6LA 4P5RA 2HX7A 4X4KA 4A2EA 1KYAA 3CZUB 2XUWA 1WS8A 1RKRA 2GSMB 3FU8A 2J57A 2ZWNA 3GXUB 2FQDA 4BXSV 2W8CA 3FYIB 4Q89A 3WI9A 1GS6X 1L9TA 2YAHA 1AANA 2TSBA 3OD3A 4UAHA 4PCYA 2VM3A 2XLLA 1MG2C 1E30A 3FSWA 3DIVA 1NICA 4JHVA 3H4FA 1NZRA 1XB3A 4A2FA 3IBOA 4GYBA 3SQRA 2VMJA 4A67A 3FPXA 5B1AB 1ETJA 3CG8A 2J55A 2UX6A 1E65A 1NPJA 2FT6A 2YXVA 1GS8A 3G5WA 1JXDA 5D4HA 1ASOA 3PXLA 1AR1B 3V9CA 5A7EA 2YAQA 1KDIA 1M57B 1NIDA 2OCCB 4YSDA 4YSUA 2BWDA 2PLTA 1NIBA 2AVFA 2JKWA 2R7EB 4DPBX 4QLWA 3ABMB 3X1FA 3MBWB 1QNIA 1KV7A 1A4AA 2Y69B 1ET7A 1NDTA 4W9ZA 2IWKA 2PPAA 1ASQA 3UAEA 1SFDA 2YARA 1X9RA 4M4RB 4BWWA 5I6NA 1M9WA 2CJ3A 3QJSB 5D4JA 1TKWA 3CDZA 2P80A 1GR7A 3FSVA 3N2JA 3S8GB 4DPAX 9PCYA 8PAZA 3FU9A 1KCBA 4DP1X 2DWTA 3TBCA 1V55B 3PAVA 2GHZA 1GYCA 2B08A 4G7SB 1SJMA 2I7SA 3X2QB 5AZUA 2OJ1A 3X1NA 1PF3A 1ZPUA 2XU9A 3NSYA 4W1TA 2IWFA 3FQYA 1AZBA 2ZONA 3HB3B 4BWTA 4FA7B 4A2GA 2FT8A 1URIA 1RCYA 3NJJA 2GC4C 1W6LA 1XB8A 3ABGA 3WIAA 1MG3C 2BO0A 4HCFA 4A68A 2UX7A 3NT0A 3FQ1A 1MZZA 3TBBA 4FAAB 4AX3A 2QDVA 2ZXWB 1SDDA 2YAMA 2FJSA 4YSQA 4BDVA 3IN2A 3L45A 1OE2A 1ID2A 1JZEA 2GIMA 3AG2B 3RYMA 1L9QA 3FT0A 4DP4X 2VSMB 2DV6A 3QQXA 4K9JA 2X88A 5B3SB 1W8EA 3SBPA 3AG1B 2UXVA 1DZ0A 3BQVA 4Q8BA 4M3HA 3V9EA 4AZUA 1WA0X 4E9VA 1JZGA 2MTAA 4YSAA 2AANA 1SFHA 4KNSA 5I6MA 3WKQA 2RACA 6PCYA 1NINA 1NIAA 5B1JC 4UANA 4G72B 2ZOOA 4JHUA 5B7EA 4DP8X 5F7AA 4YVNA 4CSZA 1F56A 1BXAA 3SBQA 3PAZA 2GBAA 4AKPA 3S8FB 5I28A 3FSZA 4HALA 1L9RA 1ET5A 3H4HA 2CAKA 3HEIB 4G71B 2PPDA 4BK5C 4P5SA 1BEXA 2DWSA 1AIZA 4WKXA 1YLBB 5B1JA 4DP9X 4AI7A 1GY2A 2VW4A 5I6OA 3T6VA 2W88A 1QHQA 2FTAA 2I7OA 2IAAC 5FC9A 3OMAB 2QDWA 3AG4B 3FU7A 3AZUA 2BHFA 2AZAA 2IH8A 1J5CA 3AW5A 4A2HA 2YAPA 1TEFA 3NP3A 2EINB 3QJUB 3ASNB 2PCFA 1SNRA 2GI0A 1PZBA 1TU2A 4GP4B 1PZAA 5B1BB 1T5KA 1ASPA 7PCYA 2FQGA 1N70A 4MFHA 4BDVB 1JZIA 4HHWA 5AKRA 2E86A 3KW8A 1CYXA 2HRGA 3IE9A 1E5ZA 2XX1A 1A65A 4HCIA 2EILB 5B1KA 1AG6A 1IBZA 1JXGA 1PZCA 3ASOB 3NJNA 4E9TA 1GSKA 3IEAA 3JTBA 2BWIA 2PCYA 1OCCB 3EH4B 2Q9OA 3GYRA 4YSEA 5B7FA 1J9SA 2CCWA 1IUZA 1ZDSA 3UADA 2BP8A 2PP9A 3T71A 1OCZB 2XV0A 4DP5X 1PLBA 1IKOP 3QJQB 5TK4A 1AACA 2I85A 3ABKB 1OE1A 4N8UA 4E9SA 2IDQA 1EZLA 3NJIA 4KOCA 2CBPA 3DKHA 4QKTA 1WS7A 5I26A 1BAWA 2YAEA 2XX0A 1I53A 3EF4A 4G70B 2HX8A 4KO6A 1MZYA 3FYEB 4E9YA 3ZX1A 4AKQA 1CURA 3FQ2A 1A4BA 4A2DA 3N55A 2FQEA 3S3DB 3S3BB 3ZDWA 2OV0A 2H3XC 4KNTA 5I6PA 1JVOA 3EHBB 2BW4A 2YAOA 1V10A 3FU7B 2VN3A 1WAEA 2AFNA 1E67A 1AAJA 3WNIA 3NJHA 1OCRB 2PPCA 3UAAA 4AKOA 2BW5A 2HX9A 2XXFA 2PP8A 4WTQA 2HLEB 2H5UA 4DP0X 7PAZA 3SBRA 1OCOB 2YQBA 2IDSA 1OE3A 2QT6A 1GY1A 1GW0A 3TA4D 3T9WA 1ZV2A 4ZK8A 2J56A 1CC3A 2N0MA 5EHFA 2Q5BA 3NSCA 1FA4A 1ZDQA 3TU6A 1AOZA 4DP2X 3C75A 1EHKB 2TSAA 1IC0A 1SF3A 2B3IA 3KW7A 4PAZA 2X87A 3UACA 1AZUA 1PY0A 5PCYA 1W6WA 4G7RB 2HRHA 2VW6A 1ZIAA 5AFAA 2WSDA 5I5MA 1R1CA 3H56A 1L9SA 4F2FA 1CYWA 1PNCA 3CDZB 2VSKB 1GS7A 4GP5B 1JOIA 1JZHA 2XVBA 3PAUA 3UGEA 3X1GA 2FQFA 1NWPA 3IN0A 1BYPA 5LDUA 4ENZA 4GXFA 3FS9A 1OF0A 2PP7A 3PCYA 1KGYE 1HAWA 4F7KA 4A66A 1L9OA 3OMNB 2LLNA 1PMYA 2FWLB 2EIJB 1IBYA 2JXMA 1FFTB 1X9UA 3NP4A 5I5IA 1A3ZA 1B3IA 1NTDA 1NWOA 2JFCA 2EIMB 3X1EA 3NJMA 2CUAA 3OMIB 1M56B 4BXVA 1SHXA 2WO2B 4YSTA 4YSCA 2EIKB 3ERXA 3ABLB 4KOBA 4YVUA 1PLAA 1DYZA 2MRYA 2DYSB 4KO9A 5PAZA 1WA1X 2BP0A 3CVCA 6PAZA 2P80D 1E5YA 1SF5A 2J5WA 2A3TA 2IDUA 1SDDB 3EH5B 3NYKA 1NPNA 3T6WA 5B7MA 2GC7C 1J9TA 2GB2A 3NJGA 3WG7B 2YXWA 1RZPA 3NSFA 3QJVB 3T6ZA 1ET8A 1TEGA 4YSPA 5I6KA 2QPDB 2BZ7A 1UATA 3NJFA 4HHGA 2QPEB 4N4YB 4G7QB 1PAZA 4E9QA 1AG0A 1JZJA 2YAFA 3CVBA 1BQKA 4HAKA 1CUOA 1NIFA 1HFUA 2IDFA 3QPKA 4UF7C 2BZCA 3WKPA 4E9WA 3ZBMA 1AS7A 1BXUA 2AZUA 4GP8B 1N68A 3OM3B 4KO7A 5D4IA 3QJRB 1FWXA 4HIPA 3FSAA 5IY5B 1ILUA 4YL4A 1VLXA 2XYBA 1SHWA 3UABA 1BQ5A 4HZ1A 4DPCX 2CALA 3T6XA 2DY2A 1JXFA 3PLYA 4NERA 1AZCA 4TXVB 1AS8A 2Y1AA 1NIEA 2H47C 4RH4A 2DYRB 1L9PA 3U25A 1J9RA 2XV3A 3WNJA 5I5JA 3ZIYA 3GDCA 2IH9A 1HAUA 3QJTB 4BWUA 4YSSA 4YSOA 1KDJA 1AZNA 3AY2A 1XMEB 4KNUA 4DP6X 3NJLA 3NSDA 1BXVA 2XWZA 4JKNA 2PPFA 3BVDB 2IWEA 3NJKA 5F7BA 1OOWA 1AZRA 2VM4A 1JZFA 2XV2A 4F2EA 3EH3B 1PCSA 1A8ZA 4YSRA 3AG3B 4KO5A 1AQ8A 1AS6A 1RZQA 3JT2A 1KBWA 4E9XA 3OQRA 1XB6A 1BYOA 4NAJA 4EF3A 2UXFA 3PPSA 2BP0B 2HXAA 5E9NA 2XXGA 1KBVA 4GY4A 2R7EA 4L0PB 3DTUB
chains in the Genus database with same CATH superfamily
4MHHI 1FZOA 4YBLC 2CO4A 2R4RH 4H8UA 2WJ7A 4ISVB 5C6PB 3TT3L 1KCWA 4AT6A 3FH8A 3L4UA 4PB9L 4WCYH 3SZ6A 1L7IH 3IWUA 4GW4B 4N2HA 4XBPA 1AY1H 5HJ3A 4ZFGL 1HWHB 2X6BA 4FFWC 4IK7A 3AFLA 2X0WA 1UM5H 3EGSB 4OIAA 1DQMH 4APQB 1H0DA 1KGCE 5HDRA 4YGAB 2NXZB 5L88H 3FOLB 2E27L 1PIGA 5FYJU 5AAMC 5C70A 4LIQL 1RPUA 1CL7I 3IDIA 4FNRA 5C0JA 4XP4H 4YQXH 4EIUA 4F7MB 2F7IA 3EYUL 4F27A 1ZPLA 5EU6B 4QTIH 1PSKH 2B5IB 3MV9D 5EU4B 1DVSA 4Q9QH 2Y2TA 1MDTA 3QJZA 2L4OA 2I60L 3TURA 1XXFC 3K91A 3QZOA 5C86A 1PDKA 2FBOJ 4HPYL 2K3TA 2N3JA 3FT3B 3T3PB 4DZ8A 3W0WA 1GS6X 1WH0A 4ZFFA 1NMCC 3IXAB 4W6XB 1XF1A 4I0CC 3QORD 3VCLB 3V7AE 1YY8B 3FNKA 4QRPA 2CGRH 4ZO9A 3JWNC 3JVGA 1NGZB 4GRLC 2G5BA 3EBAA 2H32A 3FBKA 1O5DT 2IANA 5D6CB 1LO0H 4GYBA 2W0PA 4LOUC 1BIIA 3CG8A 4N24A 4OIFA 2J55A 3IAGC 1OCWH 5HJDA 4RWYH 4WGKA 2KYIA 3GRGA 3MJGX 3NZSA 4LCUA 1AE6H 5E2VL 4N2EA 1JXDA 2H1PH 2OMWB 2D7TL 3ENEA 5C09B 2X4TB 3RZCB 1Y1DA 5KG9B 4DUWA 1KDIA 1M57B 4PJAE 5F7EH 4LLWA 2H3KA 2OCCB 3IJSA 3KPNB 4UBDD 5LBSL 5C0CA 1JPFB 1NIBA 1RZ7H 4MQ7A 4QXGH 1MNUL 1PX8A 2IBZX 2WJ5A 4OQTH 2PTUA 1WWBX 3D25B 3QIBC 1YEFL 2LU7A 3O11A 2XHNA 2O5YH 2ALWA 5SWSB 1N5YL 4UINL 3ZKMC 1K4DA 4BWWA 4HJJL 3L16A 4M7ZB 5DMJB 2FO4B 1ETA1 2CH8A 3HG0A 1IM9A 2QQKL 2P80A 2WXJA 5IFHL 5EIIA 3N2JA 1WHPA 5EZJA 2RGSA 4B96A 1FVEA 1MN4A 5I1JL 5D7LA 2BNQD 4MNQD 5C08E 3V7MA 2ZSVB 2B1AL 4DCQA 4E36A 5IFJA 4MCMA 2DQHH 4LRIC 4Z7UA 1L0XA 5K9OA 4HCRA 4YHNB 5H35B 5KJRL 5IFAL 4MX7B 3HRZC 3K0WA 1URIA 3LS4H 4NKOA 1TVDA 4X4ME 1NJ9A 1XB8A 5SWZE 3ABGA 4OZIE 2BO0A 2J6EL 3G08A 3OAZH 3QWOA 5FUCC 1QUPA 1N19A 4AH2B 2LFEA 2ICWA 4PJXA 3FQ1A 4MA7H 1IC5H 3BIBX 4JFZL 2VCOA 4N6RB 4JFPB 3F5WA 4L8BB 3PL6B 4MAYD 2GTWB 4X9HA 1GZQA 5DUBB 2GIMA 2AVGA 3FO2A 2VSMB 4TTDC 1PG7W 3UTSD 5MEND 3KPLB 3P02A 5D7KD 2NY6D 5J6GB 3X13B 1VFMA 2F74A 2WNWA 4GLRI 4IM8A 3CXDL 3AG1B 3WLBB 5FYKD 3PWVA 4FQ2L 1H6FA 4NWUL 3TNNA 1IAKB 3EUUA 3PQYB 4PHZA 3D39D 4M3HA 5CN1A 4G80A 3WN5A 1QHOA 4LEOA 4JZJC 2ZKYA 1MCPL 1F13A 3HLAB 3LAFA 2FYVA 4WO4A 1BQHB 2XN9D 3WKQA 3OKOB 3HR5B 1ZGLM 4Y2DA 1WC7A 5D7IA 4PJDF 4UANA 3ZE1E 1QI3A 4FQHA 4EI5D 4NJAL 4RRPG 4NQUA 1CQKA 2VLME 2A9DA 35C8L 4OGAD 2ARWA 1ECYA 3WS6C 4JFWA 3RLSA 1QSED 2TAAA 4M6OH 4HFWA 2EDEA 1WTGT 4PJ9C 4CGUB 5D1XE 1L9RA 4MCNA 4LE8A 3O81A 5F8RC 2NCMA 4FTVB 2XTJB 2PTTB 3KVQA 4JY4B 3BWAB 4NI3A 4WKXA 4QYAA 3AQXA 3EJSA 4P4RB 2C9XA 3WE6B 4AV5A 4Y5VB 1E9OB 3EJRA 3LV3B 1H8NA 4YBQD 5BV7B 3AQZA 1BD2D 3T65B 4WNJA 2P7TA 5I0YA 3DDGA 3KD4A 2Y6TE 4NCC2 3CLEH 1VFBB 1TZHA 4XODA 4F8TA 4JLRB 3L1EA 5C0RL 3ZE2B 5KSBE 3E9UA 2IH8A 1TPXC 2OR8A 5JOPD 5GJSL 4BK5A 5DEFA 5KVDE 1INQA 1EBPA 2P28B 3GEWB 3HUJF 4Y1TA 2VIRA 5KVGE 4PUBH 2GI0A 4MJJA 2CXKA 3VD4A 2J8OA 3SDCD 4HULB 4GBXC 4WWNA 4Z78A 3AT8A 4EAEA 3GUTA 4MFHA 1EHLH 5BUAA 4P57B 1MCQA 2GJ6B 1A6AA 4JHAH 4XOCA 4PWFA 4QOKD 2YD3A 3KW8A 4ETYA 1ZSDA 2XTLA 3NFPB 4YPJA 1PD1A 1E5ZA 3VW3H 4U6HB 1XD1A 4P23C 1WCBB 4M9PA 4OCMC 5CBEB 1FJ1B 3I2CH 5T1KD 1KG0A 4Y2LA 4PGDB 1PD6A 1ZDSA 4LKXA 4P4KA 4XPBL 2NX5B 3L4CA 2L7EA 4KDTC 2WGXA 5KSAC 5ABAA 4JN1H 5INDA 5I1EL 1ZLDA 5CLXA 3BRFA 2DYPD 1OEZW 5BVJB 4KOCA 4AK1A 4PB0L 3VQMA 2DQEL 2Q3XA 5D2NB 1S8DB 3R1GL 5TFSH 4ZZKA 4NQEE 1EEQA 2HX8A 4XBGB 1MZYA 2IWGA 4UTBL 3BVVA 3Q0HA 2ADIA 3TIDB 2YGQA 4DGYH 3IFLL 2ADFL 2VO8A 3IJEA 2HLAB 3WOVA 4OJEH 2D03H 4AMWA 1CD0A 3TESA 4W4OC 5KZCB 1OLLA 2Q6WA 4G6KL 3WIHL 3NIGE 4UB0L 2AEQH 5J1TC 3CSBA 3S3DB 1KTDB 2PWDA 1T0MB 3V8OA 3RG1C 5KVEH 3RU8H 3VACA 1I4FB 1ZLSL 1J0IA 1CQYA 3ECQA 4Z3TA 4U6VL 3AJ7A 3E3QE 2FUQA 3O4OC 2DQUL 2OMZA 4JO8A 4ZQKB 2XSKA 1AAJA 5ADPH 1KJMA 3LXAA 3LNFA 2ETWA 2AV1B 1AGCA 1KTCA 1JGUH 3LRHA 5DQ9B 2H5UA 5I30H 4J8RB 1GOHA 5I8KH 3LKSA 4Z8FH 5IR1B 2VZVA 1OE3A 1I7ZA 1GY1A 1G7QA 1MRFL 1C5DB 4AVHA 4YHZL 1FA4A 3IAQA 5GGTH 3EO9H 4FOMA 4Q97A 4FMKA 3ZR5A 3P4LA 2H32H 2RCSL 3GJEA 4ZMVA 4XMVA 1TJHH 1KT2A 2OCFD 4YDIH 5IGXL 3GRWH 2H9GA 1J12A 4G5AA 3QIWD 3K46A 4HVBA 1IGTB 4KTEL 3AMLA 4Y1SA 5I16B 2JK5A 2APTA 4G7RB 1PQZB 3FU3A 1ROCA 5TE6L 3R06B 3AT9A 5JDSA 1L9SA 2IH3A 4UWQB 3L6FB 3WKML 1DBKL 1DBAL 4KK5C 3L8QA 4JDTL 4WNQB 4LBEB 2EH7H 5EN3A 4FABL 1U42A 1YHPA 4LU5H 5EC1A 5LDUA 3B3IA 2NY3C 3B34A 2PP7A 1KEML 1HWGB 4ZO8A 4MJHA 1A1OB 2R29L 3UPRA 3UZVB 1EERB 1U91A 2R2BA 3GKWH 3MJ9L 3N43B 5JA8B 3TZVA 5K9QI 3OPUA 2X4NA 3SY0B 1HXMB 4OJDH 5HDBB 2O5XH 4HUCA 1KCKA 4C4UA 2CGZA 3TV3L 3D08A 3MJ8B 3KLQA 1OO2A 3JWNE 3VRIA 1RZFH 1REIA 3D4ZA 1Z0MA 4MJ5A 1IFGA 3EDFA 4ZJ9A 5KYXA 4IBYA 5BS0B 4LL1A 1QRNA 1TTRA 4UTAA 4MVBD 2VR5A 2JIXB 2NQ3A 3O8XD 3EYOB 5I71B 1OTSD 1K4CA 4K3EL 3VDCA 1AXIB 3NYKA 4I4WB 4Y19E 3DUSB 1UM4L 3LHPH 2GITA 4ZUWB 1ET8A 4N9OB 4YSPA 1SHMA 3BAXA 3H9ZA 3GO1H 3OZLA 4HHGA 2QBWA 1BF8A 5EUOB 4QI3A 1KCVL 2V2XA 3W3BA 1DUYB 2XZCL 1CUOA 4ZRGA 4FHKA 3UH8A 1N26A 2Q2LA 4ZW6A 3UGXA 1BXUA 2HTLC 4DKFH 1FRGH 1G9NH 2IPKB 5JYMA 5TTRA 4JPSA 3CBRA 1AGDB 1HWWA 4PRIB 2Z1KA 1C12B 5BXFA 1IAIM 1VLXA 1C9SA 3RJQB 4A55A 2OMNA 4KTDL 1JXFA 1D6EB 2F19L 5LAPA 3U36B 3NESA 3VRJA 1IAIH 4I88A 5EPMB 3D4CA 1FG2A 2OZ4L 3EW3B 3GIZH 4JMXA 4UOJA 3AC0A 1TZGL 3PE9A 2BIQA 4P46C 3ARDA 3U1SH 2IH9A 5C97A 4RGND 2DBLL 3MYJB 4F33B 2P45B 2OMTA 1QX1A 3VG0H 2IJ0C 3MBEB 2A74A 1A7QL 3ZO9A 4DFHA 4U1MB 1JWUB 4HGMA 5I1LB 4PWGA 5ELIA 5FUCE 4IIQA 4JRXA 5F7YC 2X70B 3P73B 3ARWA 1PCSA 1N0LA 3BVWA 5HJBA 3GBML 3KBFA 2G4GA 3E8UH 2JCCF 4M3KB 3HNSH 4DW2H 1YJDH 2OK0H 4KQ3H 4KI5C 4BKLA 1MHEB 2QPFA 5JPNA 1FN4B 3SY6A 5EBWA 4NC0B 3QIUA 3Q5TA 4Q58C 2UXFA 4KRMB 2HXAA 2MQ0A 3TN0B 3BQUB 2QSCL 5DZAA 4EI0A 3QUMA 1ZA6B 3TA3A 4M48H 2HJKA 4KRPC 1T89C 2GUYA 4P2RD 3VFRA 2CG9X 1YNKL 2DM2A 4PBXA 5K39A 5ERWB 2IDCA 5CZKA 3FPYA 3GSVB 3ZGHA 1WUNT 2VITA 1UGKA 3VYOA 2JKJA 2QVIA 5D9SB 3QUHA 5DC4B 1GKOA 2J5LB 2VN4A 3TT1L 1JERA 3B9EA 3S3JA 1BHGA 5I19H 3QS2A 4RGMB 1BVNP 4ZO7A 2FAUA 4E9RA 3VX1A 3EIFA 5GS0D 4KHTL 5FIEA 4XXWC 3BZEB 3MRBA 3LRKA 4ZSOA 1N59A 3ORJA 4XXDB 4RQQB 3WXWL 4ZZFA 3EJPA 4JHWH 3ZDYF 1OAXL 1Z9OA 3RWIB 1EEYB 1FLTX 1GGUA 3QZBA 1DQDH 1UD8A 3K72B 4P5RA 4LPTA 2AABH 4HWNA 1KYAA 4ELMB 3QH3B 5LGHL 3QI9C 4HEPG 2E9IA 1OTUC 3EOTH 43CAA 1DJYA 2F53A 1T2JA 3MRHA 3SHSA 1F00I 2JF1A 5G5DB 2XQYA 3P69A 5FKPB 1GIGL 3HHRB 1F4XL 2ZCZA 4PCYA 3C6LC 1J1PL 4OZFG 1E30A 2H2SD 3U0PA 2X9YA 3BP6A 1AQKH 3VFNA 5JIQA 2HH0L 4Z3HA 4V1DD 4J3OF 2K4WA 5ICXA 3GZQA 5IK3B 3SCMD 5ESVA 1Y1UA 1NSNH 2ZP9A 4AQEA 3K4ZA 4XPHH 5IEHA 1KB5L 5LBGA 3L3GA 3MO1A 3C12A 3UG3A 3CFQA 2R8SL 2LLLA 1LP9F 3MNWA 4PJGE 4OFPA 4BUGA 4ACPA 5LKNA 4U0RB 4UNTA 2PKDA 2VDKL 4GSQA 1Q8MA 1RJLA 5HGAB 2PW1B 3BPCB 4HHAB 4EDXA 1RUQL 4M1CC 3NN8A 4FQIL 5KYYB 2OMUB 3BPOB 4U3CA 5ISZB 3MOAH 1T7YA 2MNUA 1Y6MR 3D0LA 1XCTA 1MW1A 2CDEA 3MRKA 3Q6FA 2OJZH 2AJUL 1MRCL 4U1HB 5DK2B 1XH3A 4H0IA 4HC1L 3QJHA 3SE4A 4IRZH 3MLVH 2KLSA 2I9TA 3BHBB 1ACZA 3RFZA 4KQ4L 4WF7A 4F9PA 2IMMA 4MWFA 1AQDB 4HJ0C 4RA0C 5ANME 3OQ3B 1XV8A 4QRBA 1ZK5A 3D06A 3EJZD 2A4ZA 3QUXC 3BAJA 3CFNA 2R9HC 2N7BA 1B0GA 2B08A 3A4EA 4M56A 3ZE0F 4GAGL 1G9NC 1CXIA 1FE8L 3DARA 3GK8L 5LAXA 5FR3A 1QFUH 1NKGA 4PRNB 2IGLA 2E6JA 5DJ6B 2NY2B 1ITCA 3P3SA 4ZUUB 2VLRE 1FL6A 4FXKA 5HYJD 3S96A 3W81A 1MY7A 4YL9A 4A2GA 4GQZA 4WI3A 2O26U 4D3CH 1AHMA 2W94A 1EJ8A 3ULUH 3O0RL 1T1YA 1AJ7L 1F18A 1UKSA 4ZMNA 3MLUL 4B9GA 2NR6D 2R1XA 4CSTA 5LBSA 1IZKA 1A3RL 2WVTA 3GQFA 1CXHA 3BGFB 1J11A 2Z35B 3QYCA 2QDVA 4M5YH 4Z0BH 2FJSA 3L3OA 4GUPB 3L4XA 5HGGS 5I0WA 4B5EA 3P9LB 1IM3B 4X98B 2HUHA 1TVHA 3UAFA 1BLIA 3ZMEA 4Y2DC 2OMXA 1FDLL 3VXSD 4EIBA 5BVPH 2JMRA 3S3SA 2FX8L 4XPGL 4N90E 3KCPA 5DJ8A 3HB3D 2B1OA 1AGBB 2OFQA 2G2NA 4LASL 5HYSG 1DBBL 1UD5A 1YJDC 4GT7A 4JKPH 4XRCB 2BSSB 3V9EA 5F1NA 4RRPA 5GS0L 2VQ4A 3FUHA 3K2KA 4PSRA 2ATKA 1HCYA 2EDWA 5CIPB 2J1YA 3RKDC 4BSVA 1TMCB 3ROOA 4LNRA 2VDRB 2XACC 3MLZL 3PWPA 3VXMD 1NIAA 2XC8A 4N87A 4G72B 2BHZA 4LLMA 2ZOOA 1BM7A 2HJLA 4KROC 4QXVA 4AM0A 4N8CL 1AD0B 3LY6A 2F8IA 2H7WA 4KY1H 3SBQA 1L0PA 3CHRA 4JL2A 4WK2B 4X8JB 4Y7OC 2DD8H 2CUHA 2J6EA 3CC5B 4MKTA 3DPBB 1A21A 4HF5L 4QO1A 3QDGD 3LQAH 4TVPH 3UBXB 1FYTE 1XZ0A 2WKLA 4OCXH 4PJ7B 5H37H 4BK5C 4P9HH 1TQSA 1EUTA 2ZCKL 3EO1A 4YHKH 3ZUNC 2J8HA 5IOKA 4JG1H 4NNPH 3KPQA 5ECGA 1G0YR 5E08H 3DOSB 2M8XA 5JW5A 5IBTL 2EDFA 5CM1A 2EZ0C 2V2WB 5F0MB 5HHOD 3G5YA 5DURB 2FNBA 3UZEA 1E2ZA 5CD5C 1KENH 4LLDB 3UDWC 4E0RA 3K8LA 4MJ4A 5IHUL 4G8IB 3QVAA 3C5ZD 5A3IC 4G5ZL 3D85B 4M62L 1F1DA 3WHXA 2XDHA 2P8PA 1XGTA 2GIXA 2VLKB 2E59A 3GGWB 3THMH 1DBML 1NGYB 3A22A 5JHMA 3OJVC 3IT8D 3O3BB 4YH6A 3FB7A 5D2LE 2HT4D 4ZTOH 4H4NA 2E86A 2EIZA 3NCMA 4NSKA 1JV2A 4A7GF 3I02B 1IBGL 4X80L 3T77B 1S7SA 4LHUB 2Q10A 2E8YA 2F15A 4IBLT 4ZS6D 1IBZA 4JQXA 2MTPA 2ZXGA 3HZYB 3QFJB 3QORA 3WS3B 1T4WA 4IRSC 3FMGL 1SEBB 4RFOL 4XCEA 5C7XL 4QHNA 1P84K 5BJTB 1O9ZA 3MRGB 2O4EA 2AJSH 2XN0A 4JFFE 4OCWH 5K5YA 3HIZA 1IBHA 1TYRA 4E9SA 4DOHE 2A6DB 1YNTF 1FIGH 1OGAB 2IG2H 3NJIA 1PG7H 1WHOA 3N9GL 1WZLA 1JPGA 3AREA 1DFBL 1LDPL 2WYIA 4PJAF 5AENA 2PTVA 4U1NA 5F3FA 4ONOA 1RUMH 3EZJB 3MRNA 1WQVT 2W65A 2QGBA 3RPKA 3VFOB 3GSQB 4Y4HB 4E9YA 3BSGA 1DQLH 1B4LA 1P9MA 4K5NA 3FTWA 5D71L 2HN7A 2ITDA 3BSZL 4L9DA 4A7SA 5I75C 1CR9L 4POZD 2I27N 5DD1H 2DIJA 2W92A 3IVKB 4F91B 3B43A 4PCSA 2OI9C 1QWNA 1ZS8B 4D0CA 2BSCA 2DMCA 3DHPA 2JKXA 2DM4A 2VXTL 3CMOH 4OT1H 3D4YA 2EYTB 3V79C 1JMZA 3WTVA 5FYJD 3V4VL 4IEFA 2MIZA 4PJ8B 4AMKL 5I73B 4K23L 1ZVYA 3OG6B 3NJHA 5J1SC 1O0VA 1HHKA 2AW2A 4XCCL 5DJYA 1PX3A 4MNQA 2E75C 5KVEE 3ULUC 1UB5B 2YS4A 4AYEC 5KW9L 1HOEA 3HTLX 3O4LE 4NRXB 1D9KD 5GSRA 4OZIF 1QPPA 2J56A 4JEGB 2W9EL 1JNHA 4AL8L 1H15A 3TU6A 4JM2B 1D2OA 3PWJA 1MH5A 1RQ5A 4B5ZA 1UWYA 5L2KB 3TT3H 2B9AA 2XKNB 3BLKA 4V2CB 2CE6A 4RMTA 1I82A 4BK4A 2PW2A 1QVOA 5CGTA 5AZEL 3W0WE 4ZFGH 4I0KA 1G4RA 2B15A 4JZNB 3DDFA 3RIFK 3ZKXC 5EF2A 1S9VA 2DI8A 1UUSA 4NYLA 4LOFA 4QRPE 4XTRC 3WIHA 4PRPE 1PJ9A 3APFA 4ABUA 4NPYB 2CJSA 3E80A 4LIQH 1D5ZA 4HG4J 3VWKD 2DDQL 2FQFA 2IANE 1B6UA 1BYPA 1LWHA 3FB8A 3H9HB 5JXAL 3EYUH 2DIAA 3BH8A 4ZT1A 2BC4A 3NCWA 3UTSA 1S7RB 2D2OA 3W38A 4I2XA 4PGEA 1T1ZA 3NDYE 5HBBA 4QRQB 4JFHE 4RZCB 2I60H 1B6DA 4AM0Q 3MROA 3RWGA 1WZ1L 3R8QA 3ZE1F 3FF7A 4HPYH 3NEOA 3D39A 3HZKB 4YNYB 4YGVA 4W81A 5TE7H 3LKQA 5C0CE 3M8OL 3VXPA 4UT9H 1LE9A 2JTYA 3K71B 3ABLB 2XN9A 3LQAC 3FONA 3K6OA 5D6DC 4OGXH 3S5LG 5I1AB 4EI5A 5AYUH 4P9HC 4L1SA 5GISL 2YA1A 2YEQA 2J5WA 1NDGB 2VUOA 3V4PL 2WOBA 1ODAA 4MA3A 1DQTA 3EH5B 4HAFA 5CZVH 1H5BA 4YO0B 3T0AA 3TO2A 1GRWA 2ATAA 1QEXA 2J2ZB 5DS8B 1IQDA 4OAWB 1FIEA 4FG2A 1JF1A 4XX1G 2K1MA 4KK6D 5E2VH 1A5FL 2D7TH 3ZHKA 4LDEB 4HK0A 4E9QA 1LEKA 2I69A 4B9IA 4HAKA 4U6YB 1MW0A 4L4VA 5BZDB 5KSBF 5LBSH 1FV1A 4Z3GA 4Z7UE 3ZBMA 2R29A 1P7QB 1LD9A 3ARDC 3MJ9A 5I1CL 5DO8A 1RK0B 3TBSB 4F7EB 1N68A 1YEFH 4G9FB 2MCPH 2WQWA 3DGCR 5L4IA 5EN2A 3NH7L 1QPKA 2F5AL 2BOCA 1N5YH 4UINH 1YDPA 2GJ6D 4HJJH 4YLQT 4EXPX 1UWXH 1VGEL 3OKMB 4IIQC 4NERA 1HZKA 2QQKH 3GMNA 4PJXE 3K4AA 4AUJA 1FNSL 5IFHH 3EXLA 2YPLB 5I1JH 2NW3A 1OY3B 1J5OL 4WV1C 2B1AH 4QOKA 5JPNC 1KB9J 4OKVB 2O61A 1PY4A 2NX5D 3KBEA 3QIUC 4BQ6A 2HFFA 1N8ZA 4ONHA 3HG2A 5IMOA 2Z93B 5EULV 2XWZA 5FYJL 5HHNB 3P0VL 3NJKA 1KWGA 3NCBB 5KJRH 5IFAH 4JW3A 3TA3C 2OM5A 1FPTL 3MC0A 1KLGB 1ZOXA 1RZQA 3O3EB 4Q4IA 2J6EH 3U9WA 1JYVA 3E2HB 4IRJB 1OM3L 2VLLB 2CPCA 2DYPA 5DD6A 4NAJA 1MCCA 4HJSA 5D7IE 4JFZH 1VZGA 2AV7B 2GCYB 4H25B 5KZCD 1LEGB 4X7DC 3F6IA 4PJEA 3NIGF 3QQ4B 1LO5A 5KBPA 2P49B 3K5SA 2OS7A 2EIEA 5C0BD 3ULAB 1MAML 2Z7YA 1RPQA 3IXTA 1BJ8A 3VI4A 2BM3A 2ENPA 1LQSR 3QNZB 1A6TA 3CXDH 1I1YB 1I9EA 3BYYA 2GSIB 3LXBA 4FQ2H 2ADGB 4NWUH 2UXTA 4F7PB 3ARQA 5JOEA 5JIPA 3I84A 4Y1AD 1C08B 1MY5A 1XX9C 1YEHL 1JZ2A 2VW7A 3II3A 3GSUA 1JI1A 2GK0B 2JLPA 4AYSA 2BNRD 4PGBA 4X5XA 1VGKB 3G6JA 3JV5A 3MLRL 4NJAH 1XGRB 2PYED 3GSNB 3MRRA 4JO4H 2XJLA 35C8H 3Q9PA 1TZAA 1ZT1A 4GEJA 4NPKA 3NGBB 4XNZB 2IQ9L 1SY6L 5GSVA 2X3CA 4FXGB 4L3EB 2JB6A 3OMZA 4OZFA 4ANKA 3KBHE 5AZ2L 1WCQA 4Q89A 1JGIA 1V3MA 3B83A 4KXZI 1AH1A 4R4BA 3RDTD 1ZHNB 4UAHA 5JIMA 3ILQC 1CBJA 3I9GL 1WWCA 3ZQ9A 1AIFB 4IBZA 4NQSB 2QV2A 3PGCB 4KTGA 3BZ4B 1CFTB 1EVUA 2Z92B 3H3BC 3SKOA 2E0PA 3GMRA 3ZRCC 4F92B 4JDVA 3ATEA 3IB4A 5FW8A 2J21A 4HJGB 3B3BA 5DI8B 2Y5TB 2OR7A 1OP5H 3C2SA 1E5BA 2R4SL 3DI3B 4MNHA 2LAGB 1U4EA 5LG6A 2YFNA 5GJSH 2PYFB 3ETTA 1J86A 3CDGB 2D3JA 1NDMB 1S7VB 1EBAA 4WSGA 4X5PA 4HJIA 4AE0A 3SE4C 5EU3B 1KGJA 1U92A 4P99A 4J3WA 3SPVA 4Z7VA 4G8FA 4X7CC 4U4IA 1DQJB 1EPFA 1FVCB 3VD5A 4F9PC 4YSUA 1D2PA 5H2BB 1LWJA 2H1LM 4UU9B 4MB5A 4O51B 2W0KA 2WBWB 2OSLB 4RAVA 5E0QA 5IUSA 2M1KA 4H40A 2HJFA 3HE7D 5GS0C 5LG1A 4NM4L 3RUGA 2D3NA 1A6ZB 3CQQA 4RA3A 1N12A 3QJOA 4MGXA 1P53A 5I6NA 1PKQA 3L9RB 2CK2A 5ACLA 5DRWA 1WIOA 1TKWA 2V3FA 1J8HD 2X28A 4NRYB 5I15L 5I1EH 5CCKL 4OZ4B 9PCYA 4ETQB 4I9XA 4M03A 2FK9A 3MR9B 2PWHA 5JIKA 2DQEH 3ARBA 5KBLA 1FBIL 1UWGL 4OV5A 3DUHA 3BEVB 2BVOB 2NY0B 5HHMB 5IG7A 1A8JH 3GI8L 1KB5A 4UTBH 4XOAA 3FT2B 1YEWA 3EJYC 4EI6B 4ZFZB 3IFLH 1DLHA 3BCFA 1RIVL 1Q4NX 2O6CA 4FI7A 2X89D 2XWTB 4WI5A 3BP7B 3GJFA 4NHUB 5HY9B 4G6KH 4LSRH 3OJDA 1QBAA 4K07A 2G4EA 2ZWYA 3ARGB 5TDOA 5BZWA 5CS7A 1ZLSH 4HKJA 2ALAA 5AB9A 5K1VA 2AK4B 3V5KA 2FGZA 3ULUE 4HC1A 3KLLA 1ORQA 2DQUH 4Y0GA 4LSSL 4QRUB 4FNQA 5HYSA 5FYKH 5GPRA 3D2UB 1U41A 3X3FL 1JCKA 3EOAB 1R5IA 1RK1B 4G7VH 5GRJH 3L3JA 2ITCA 3AXLB 3MJ7A 4GG8B 4XPFL 5G4NA 2WB7A 2CD0A 3UBFA 1Q94A 2PCPB 3OG4B 1GOFA 3LKOB 3BWUC 3IETB 1MRFH 4EZJA 4YHZH 1KELL 4UT6L 2FGWH 4BH7A 5EEWA 2P52A 5FOBA 2LLGA 2A99A 2NTFB 1E6OL 2RCSH 3G5ZB 2PCXA 5IGXH 4JCMA 3TN0D 4JHUA 1FUNA 3PXJA 3HC0B 4KTEH 2NW2B 2ZP0T 5TE6H 1V3KA 2IFGA 4Z77B 3ZL2A 1QRNE 2JE8A 4TNGA 3A4DA 3WKMH 1KBPA 1DBKH 3LZPA 1DBAH 1SOSA 4MMYB 4JDTH 1FFNB 2ZOKB 4FABH 1R5WA 4QHMB 2D8KA 3V5HB 4UAOC 4D94A 1LEIA 3F7VA 4NAMA 4P2RA 3KGTA 3N44F 5F44A 4BYHA 3MJ9H 2EUZA 3TOPA 1S5HA 2W88A 4XVUD 1GXEA 1QUNA 1JJUA 5FYLD 4XNBA 3ZT6A 3V6ZA 4YHIA 1A6WH 2FLMA 1CFSA 2SODB 2X4RA 5JHBA 1HDMA 1PKOA 3L1FA 3QQ9D 1JPSL 2WXGA 4PJIA 5T5NF 1NMAL 3QORC 2VDMB 4H8PA 4F7CB 3U9PL 2PCFA 3LKNA 5EBMA 5AUMB 4MBOA 1EJFA 1MREL 3UMNA 1UXWA 3WO4C 1G43A 2KLRA 1UM6L 1OT4A 1UM4H 3OHXA 2DTMH 4EZKA 4UQCA 3UYPB 4ZAKB 1D5RA 3ESPA 1CYXA 3OR7A 1GYWA 1OD7A 4ZYKA 2WXIA 5ID1B 4X9BA 4MXVE 3KJ4C 4L1TA 1KCVH 3MTXA 1MAKA 3Q2WA 5FCSH 3IPEA 2QV4A 2XZCH 1G1CA 4FQJL 4XVSL 3VXRB 2RD0A 3AY4C 5BUGA 4H0HB 4YX2L 5CN2A 5J7CC 1NKRA 2ROYA 3V0EA 1RXLA 3NIDE 5JR1H 4PPTA 4UBDC 4V1DA 3TCXA 1F97A 1R3HB 3WJJA 1A1MB 1QI5A 2CLZA 4PJGF 4QCIB 2Q7YA 5C0AB 3OF6D 3CZSA 4JRXE 4JO1L 4MMZC 1T0OA 3GINA 1DUZA 3IFOA 3B2VL 5EO1B 1DLFL 2JELL 5EOCL 1CGSL 2AKRA 3FXIC 4IOSD 4KTDH 2D7MA 2F19H 2VN7A 3SKNA 4E41E 1F6AA 4XWOD 1J10A 4B3VA 2OZ4H 3LPFA 1TZGH 4XCFL 3KXFA 3KYNB 2GABA 4YDLB 5HI4D 2FIRT 3AS1A 5LO7A 3GPEA 1A4BA 1LM8V 2R2EA 3P9MB 3U79A 3NIFE 5ICZA 4NT6B 3ELAT 3S3BB 2L7QA 2X2IA 1PL3A 2R27A 3WAKA 4KNTA 5I6PA 3K3QA 2NOYA 2BY1A 1HIMH 4GS7C 4DVBB 4RX4D 3I75B 4HZLB 2Y1VA 1L6ZA 5H4YA 1DJWA 4HUXA 5DDHA 3C09C 1KXTB 5JQ6L 1WAEA 3GXIA 1SBSL 1HL8A 2AQNA 5DHXB 3JV6A 2NY2D 4OZFH 5IQOA 2JWYA 3EFOA 2PP8A 3GEFA 3UCQA 3CFDA 3G5XB 4CADA 2DQJL 3MLSL 4HXAL 4ZSOE 1XFPA 3RI5K 1OW0A 2IDSA 4PY8J 2FJFB 2UZYA 2NUTA 4OZGB 1EZUA 1CC3A 5EHFA 4WI2A 4MAYC 1TJIL 3NSCA 4ALAL 2WN2A 2HVKB 4BSWA 2NSQA 2A6IB 5HYJA 2OAAA 1YNKH 5JYLA 2F53E 2E56A 3MZGB 1OZTG 2F0CA 2NY6C 1PY0A 4LDCA 4FLOA 5DMKA 4LL4A 3LDBB 1DEEA 5EZOL 4AXWB 3BSZA 2DWEA 2ZSWB 3FCTA 1S3KL 3V6FA 4FE9A 5ECJE 2F8XC 4PV9A 1GS7A 2YSSB 4M7KL 5IWLC 3PAUA 3SDDA 3X1GA 4KHTH 5ESAB 4GQ9H 3BD5A 2ZWKA 2IGTA 1QZNA 3KMDA 1WDAA 3GXMA 3WXWH 1E42A 4JO5A 4F7KA 5I18L 4EI5C 5IM7A 2A77L 3MV8D 3V4VA 4ZUSA 4OGAC 3PFUA 3BSHA 3QXAA 3V8CA 5EIVA 3H55A 2OKMA 4FZEL 1UJ3C 5KS9A 2YGNA 4KMTH 1NWOA 2CDFA 4LIQE 1KN4H 1GOGA 1O9WA 1TFPA 3QUYD 3L4WA 5IB2B 1P7KA 1B0RA 1VCBC 4LVHC 4BXVA 3TBWB 5F1KC 3KYOB 1IQWL 2WCPA 1GIGH 1YYLL 2WLNA 4TYUA 4FYTA 3FO1B 5FB8B 2YRLA 3N41B 2C3HA 4CAGA 4WUUB 3ZVVA 2NTSP 4Z7AA 4Z95L 2HH0H 4YBQC 4PG2A 1SEQL 4JFYA 2M2DA 5F6IC 1NCAH 2FX9L 3F3HA 2JKNA 3P4NB 2Z31C 4L4TD 1CDBA 4KZEL 4AWJC 1U8LB 2DW5A 3RNQB 1TQTA 3C8HA 1GAFL 3H9SD 5JA9A 1KB5H 5IHZB 3H8NA 2UUDK 4GW4A 4R7DB 2C8NA 3C2AL 3DOHA 2FATH 2R8SH 3SSGA 4TQ8A 1UXLA 3LVEA 1I1AB 5FFGA 4APQA 5DURD 4TKWA 3LH9A 1EEZB 3OKDB 2VDKH 4B3EA 4RGOL 3SDCC 3FOLA 2BZCA 1RUQH 1CFVL 4P2QB 1JPTL 4B97A 3K6SB 4FKKA 3ARXA 2X44D 4FQIH 3W9DB 3LNIA 2WLMA 2ZG1A 4F7MA 3U30C 1N6QL 5HHOA 5EU6A 4KO7A 2VDOB 5BCAA 5EU4A 3FQXB 1A1NB 2AMGA 3RA7L 3OHMB 2Q3ZA 5D2LF 2W0FB 4L3AA 4QRRB 4AW4A 2LFGA 2VL5B 5D96B 1SXCA 2Y1AA 3FT3A 4OGYL 2H47C 4UYQA 3NOIA 4KQ4H 4LHUD 4P3DB 4XN4A 1QW8A 3C5SB 2YUZA 4FD0A 3IXAA 3TBVB 3U25A 4ZMOA 4KITB 1KIRB 3VCLA 4R4FL 3VYNA 2F7RA 3AITA 1YY8A 3OSKA 1T3FB 3MV7D 3PABB 1NGZA 1FO0L 4GAGH 3PUUA 2A4CA 3GK8H 4CDGC 1XMWA 2ADYA 1DJZA 4FA8A 4QTHB 3BVDB 4O2FB 2WIMA 1Z7JA 1UT1A 4LCCB 2XBTA 4X8GA 1H6TA 4J5VA 1XGQB 5DSCB 2QKIB 3PJLA 1QABA 2ESVD 4L4JA 1BAGA 5DGQA 1G5GA 3O0RH 3GZKA 1AJ7H 2OMWA 2XY1A 5C09A 1UXSB 2X4TA 3LNHA 3ZL4L 3RZCA 4Y4HD 5KG9A 4OJCA 5CWSB 1TSHA 3PWPE 2ENSA 4L8CB 3FFOA 3KPNA 4LPXA 2P5WD 4KFZC 5LXGL 3RX5A 2YGVA 5KBKA 3D25A 3CN4A 3B9VA 2MH4A 3WIFB 5FWQA 5EFIB 2FLBT 4WI0B 2J8UE 4A6YB 2E76C 4XPGH 4F8QA 4PBDA 1GZPB 2FO4A 4QAWA 2WO4A 2CIIB 1JZ5A 4PJ8D 4UNVA 1YEDA 5JW4Q 3H1ZA 2VSCA 5GS0H 1KTRL 1ZIBA 5GZOD 2ZSVA 3MLZH 3B2XA 1QYGL 3QXDB 5J13C 3LPOA 1CDHA 2BLFA 4TQIA 4N8CH 1QOKA 2VDRL 3QIWC 4YHNA 5B3NA 5H35A 3GS7A 1HH9A 4MX7A 1I8KB 4L9LB 5L2KD 5E5RB 3WELA 3M7FB 1ED3B 3MV9E 4BBWA 3QC6X 4Y2OA 2B2XL 2ZCKH 4AH2A 1IAOA 3EYSL 3VWJB 3SGKA 1F6FB 4JY5L 3HS0B 4KHXL 3CZEA 1P4BL 4N6RA 2XPGB 4N25A 1ZLEA 4Q9CA 4L8BA 3PL6A 4R5TA 1NUFA 4X5RA 2GTWA 2J88L 5DUBA 1ZLWK 4O02L 4PWIA 2ZX7A 3EYQD 1H6UA 2VMJA 4NX0A 2XCMC 4ZUTB 4JR9H 3BIKB 5IHUH 5J6GA 8CGTA 3X13A 1JNLL 2YXVA 1GS8A 3WLBA 4G5ZH 4Y5YC 4GH7B 2WSKA 5HD8D 4HLEA 1UQSB 3MOQA 1IAKA 2PETA 3PQYA 2YD5A 4MVBC 3O8XC 3W56A 2H6OA 2WWOA 1OTSC 4FI6A 4TNWF 2E46A 1BQHA 2JKWA 3OKOA 3HR5A 3CVHB 5AW3B 2R7EB 5IIEB 2X5PA 3MBWB 3T4YA 2A6KB 2AEOA 3FTYA 2D9CA 2LW3A 4KMLB 1G7PB 1X9RA 4G6AD 2Q86B 3TYFB 3DVNB 3H7BB 4XH2B 4BZ2L 2X53A 3QNXB 1AQHA 3L81A 2BCKB 1MCOL 3L5HA 5IVXB 3WUWG 5EMYA 3CDZA 3CN0A 3MCYA 2F08A 2PTTA 4NUGL 2VNCA 3BWAA 3HAEG 4JN2B 4JY4A 2DWXA 4CVXB 1QKZL 1CBVL 4DP1X 2ZXEB 3WE6A 3HVNA 1E9OA 2A9NL 3LV3A 3N9GH 4XC3L 3UBXG 1DFBH 3L5JA 3T65A 4MAUH 1RD6A 5AZUA 3O9WB 4Z7UF 1S2EA 3IM1A 3DMMB 1ZPUA 4W1TA 2IWFA 3FHQA 1DVZA 1VFBA 1AFVL 4MNQE 4JLRA 2FUTA 4BKSC 3LZLA 1OM9A 4YHPB 4FA7B 2FJGB 2FWSA 3IE4A 4JFXB 5D71H 4Z3EA 3KLSA 2X42A 4MCZB 2HMID 2V7HB 1CR9H 1Z2KA 3G6DH 4FERA 1T80A 4RGNC 3C60B 3KCWA 4PJXF 4KKQA 1ACCA 3OTTA 4M6ML 5DRNB 4Y16D 5AVQB 4P57A 2GJ6A 3JYBA 1OE2A 1YECL 3IMUA 2FDBP 3DX6B 4XMKL 2DIEA 4YHYC 1ZLUK 4OFKA 3NFPA 3V0VB 4AMKH 5DQJB 3VGAB 3QQXA 4K23H 4DP4X 3QRFM 4U6HA 1QFWM 1WCBA 3SGJC 5JHDB 4GI8A 1FJ1A 3ARRA 2F54D 3F7QA 5JQIB 4AMXA 5JLZB 6CGTA 2O6EA 3QULB 4PGDA 3NK3A 5KW9H 4HWZB 4LHUG 2NX5A 2EO7A 4CUCA 3UTSE 5MENE 1K8DB 2CUMA 2YO3A 4YHLH 3F2LA 4I2XE 4IRJD 5D7KE 4DEPC 4YSAA 3F12B 4Y4KD 5JPMB 5BVJA 1PZUB 5FYKE 1JNJA 3CCHB 4HKBA 1NINA 2X1WL 3BJ91 5D2NA 5D7IF 3TONA 3VXNB 5E2UL 4AYGA 1OALA 3D39E 3QUZD 2C9QA 4WHDA 5AZEH 5IEKB 3NABL 4XBGA 4LCWD 5F9OH 3K2MC 4ZX6A 1Z0NA 3EGDB 2GVYA 3QGVA 2Y9RT 4TVSa 1KYFA 4X0NA 4C4BA 3TIDA 2XN9E 3HZVB 2HLAA 3B4NA 1A64A 4TUUA 1GJWA 1WAAA 4FQLL 1DO6A 2DDQH 1UASA 1SDAB 5JXAH 1DVFB 4PS3A 1A0QL 2OR9L 1C8QA 1YPZB 3JT0A 4IGBB 1KTDA 1RU9L 2J43A 1QSEE 2BSED 4K15A 4KKAD 5BOJA 1T0MA 5EEVA 1E2VA 1CI5A 5BRZD 1I4FA 1UOLA 2R0LL 3WD5H 1XGUB 2E47A 4GRWB 2HPTA 3T1WA 3OMAB 1EZVY 3ZKSD 1D7BA 2Q87A 3BOVA 2BHFA 1IT9L 1WZ1H 4JPKH 4ICXA 4ZQKA 3X14B 3U6XS 4H8VA 2AV1A 4KX8A 1J5CA 3M8OH 1BD2E 4HLZG 1WISA 4QDGA 5DQ9A 3WKNA 4E42B 5EH1A 4MA1C 3ASNB 4J8RA 1AHKA 1BJ1J 5AW5B 2VZUA 1PPIA 4HW6A 5IR1A 3DGGB 5FV1L 2H2SC 5GISH 1UCTA 1ZV5A 3V4PH 3B6SB 2C3XA 1HJBC 5JOPE 2FQGA 1N70A 2WVVB 3QZNA 3REWB 4HUNB 3SCMC 5AKRA 3WTSA 4J12A 4FYQA 3IJYB 5C0GB 4UZUA 1DN0B 4F5CA 4MZ2A 2HYMA 3T2LA 1IGTA 1A5FH 5I16A 1PQZA 4NIKB 4ZQTA 3R06A 3DBSA 2VH5L 3EH4B 1NBZB 4QOKE 4RCAA 1GGIH 3OSVA 3RGHA 1IUZA 3L6FA 4I77L 2PP9A 3ESUF 2XV0A 4WNQA 3M6DA 4LBEA 4RSVA 2R69A 5T1MB 4GFTB 5I1CH 4EIZC 3BKJL 1ZY9A 4BE5A 4V11A 1A1OA 4OD1L 2BIIA 4ZMQA 1V5JA 1A7OL 3NH7H 3UZVA 2F5AH 3K2UH 1RSFA 4HG4K 3SY0A 5ALBL 4M7LL 5TE4H 1HXMA 1PZ5B 2VR6A 1U8IB 1FNSH 4TL5A 2E7HA 2V5SA 4H8HA 2FJUB 4Y4FD 1J5OH 5LHDA 1Y7VA 5BS0A 1BVLB 4IBQA 3EJZC 2JH2A 4PRAB 4PJEE 3N55A 5HHQB 3BPLC 2JIXA 1SXAA 3EYOA 1OW0C 4AGOA 3G7TA 1JVOA 1U3ZA 2C4FT 3DRQB 3LZFL 4UZSA 3VI4E 4I4WA 5FYJH 3DUSA 3KWXA 2H6PA 4XNYH 4PJBB 3FU6A 1FPTH 1R24B 2DWYA 1NUGA 3KYMB 3F84A 3NRQA 4WHTA 2NY0D 3D3VD 3EADA 4ABWA 5IW1B 1JFQL 2HT3D 5EUOA 4IKNA 2IGFL 2VZTA 1OM3H 3UAAA 2QTEA 1NC4D 2BW5A 3KM1A 5DJ2A 2O93L 4L1LA 1DUYA 2NR6C 3NSXA 2FZ3B 3S7GA 1T6WA 2G9HA 2YQBA 3T9WA 1H19A 3DX0A 4YR6A 1L0QA 3VTTA 1FNAA 4WVRA 1YAIA 2IPKA 3MZTA 2EH8L 3FCSB 3ARGD 1MAMH 1KGCD 1AGDA 4PRIA 4F7TA 1C12A 3ETSA 5K1JA 2EDRA 3QDMB 3Q43A 3TGXA 4FTDA 1D6EA 1ZSHA 3WY1A 3HB3C 3U36A 5A2KH 3ULUF 5EPMA 5LGYA 1YEHH 2MQ3A 1MWAB 3D2UD 3SDYL 1C5CL 3QYNA 2ED7A 1U8NB 4I0PB 2BFGA 2C3VB 3KHQA 4JPWH 1OT2A 4ODVL 3UGEA 2X4PB 1NWPA 3TBTA 1CDJA 4NNXB 1LO2L 3MYJA 1P4UA 1XDTT 3MLRH 4ZD3L 3WFCL 4F33A 4NQXB 4U1SB 3MBEA 4ODXB 5A2LH 4U1MA 2OQJB 4PG2C 4PRHB 2IQ9H 2MOQA 3ESNA 4EOWL 1SY6H 5DZJA 4GG6B 3GSNL 2X70A 3P73A 1XL6A 2JFCA 2X09A 3TO4B 2K4AA 3GMMB 1EO7A 3GTVA 3OMIB 2W9DL 2IBZY 1MHEA 1NEPA 4DSYA 4UI2A 1FN4A 1GMIA 3ERXA 3H54A 3HG1B 3I9GH 3NEXA 3U83A 2MRYA 4LLYB 4MDRA 3TN0A 4FMVA 4M5SA 3BQUA 3TVMB 5FO2A 1GGYA 5AB0A 1ZA6A 2E6PA 1MOEA 3QXTA 1WWAX 3BE1L 2GPZA 2R4SH 5C7ZA 2DJUA 5ACZB 4FZ8H 1MFEL 4PSPA 2CHDA 4PWEA 5ERWA 1XTMA 2FJHB 3GSVA 5A16A 3C5ZC 4ZNEA 3WGUB 1ZE3H 1GMEA 2YAFA 5D9SA 3G04B 1R3KB 1JF5A 3I3EA 4CMHC 2H8PB 5CGMA 2V33A 4UF7C 1FCCA 3CC1A 3GXFA 4C56B 4DEWA 4OLVL 3VG9B 2HT4C 3QPQD 3JYCA 4RQQA 1TSRA 2CKBB 1B88A 3DJ9A 3RURA 5AALA 2WPGA 2F9BT 3RWIA 1EEYA 2IADB 1B9KA 4JRYB 4ZS6C 1NEZB 4HKXB 3K72A 4DTGH 1I85A 1MHHB 3ZDXB 2YA0A 4HUMB 4ELMA 4ZMAT 3QH3A 2TRHA 4ZAKD 1M9SA 2YPVL 5CSGA 2QTVA 4UV4L 5I15H 3T4AB 3V52L 5G5DA 3LEVL 5CCKH 4MXVF 1XF5B 5FKPA 1MJUL 5HDLA 2EXYD 4JUTA 5E2TL 4N9GB 3VXRD 2F8OA 1DCEA 1FBIH 1WZMA 1WWWX 1L3WA 1S4IA 1BDYA 2E7LA 3NIDF 2CHNA 3GI8H 2QQLL 5IK3A 5JXEA 5JW4R 4HS3B 4RGNE 1ZXQA 3ATBA 2WZPD 1AS6A 3LMJH 1NGQH 2CPUA 1CF1A 3RPBA 4KJQD 1IEHA 4F1SA 2Z8WC 1T04A 3OQRA 1YNLL 3RGVB 4FA6A 4XB7A 2IAMD 5ABDE 4POZC 1U8MB 2EDTA 4UUJB 2PW1A 3BPCA 4HHAA 5HGAA 5B39G 3ZRFC 1TF4A 4OW6A 5AAWA 5KYYA 2OMUA 5ISZA 4C47A 3ILPB 3NIFF 2X1OA 3N1QC 3N1FC 5JIDA 1U8CB 3QO0B 1X5XA 5CKGA 4LSSH 1MCFA 4O58L 1HTYA 4L37B 5DK2A 3LIZL 2W07A 4U1HA 3X3FH 3DSFH 2DEXX 1YN7B 2LTQC 2JJSC 2QADB 1IC7L 3H3PL 4LF3B 4XPFH 2WBKA 3BHBA 4P2RE 4N5ED 1MFMA 1D9KC 1UWFA 4QEGA 1KELH 2HFGH 4UT6H 5D5ME 3SGKC 1E6OH 1KBGL 5DA0B 1BQRA 3B9KD 3GSRB 3SD5A 1I8LA 2QVKA 5DK3A 2V3DA 4WDIB 4HUVB 4PRNA 5DJ6A 4ZUUA 1V3LA 2B3RA 2HX7A 3PIQB 4M93B 5IB4B 3A5VA 3CFCL 1UUNA 3GFUA 2G2PA 3FU8A 4LSUL 3BD3A 3I6KB 1GZHA 3SQBB 3FN3A 1L9TA 1OK8A 1PD0A 4U49A 1ES0A 1NMBL 3V95A 4XO8A 3OR6B 3VWKC 5I1KL 5AKSA 2DBJA 2Z35A 5BZXA 1DSWA 4GUPA 5HGHA 1D5MB 3P9LA 1IM3A 4FHBD 1XB3A 4X98A 4A2FA 4DUXA 1E8WA 1K3ZA 4H1LG 5J3HD 2OYMA 5BQDA 2FT6A 2J4WL 4WFHD 3CNKA 3Q5OA 4V1DE 2CR6A 1NMAH 4XMWA 5GHWH 1RMFL 4XX5A 5L4JA 5BOPA 1AGBA 1NCBL 1MREH 1OB1B 4TRPL 4XRCA 2BSSA 2VDML 5D1ZI 1UM6H 4YSDA 2PLTA 3M7OA 2Q8AL 2CBTA 3AM8A 1TETH 1A9BB 4QLWA 1QBBA 3GS0A 3ZHFA 4MMXB 3L5IA 4ZO6A 1AD0A 4HH9B 4Q9BA 1JVKA 1MPAH 4KK6C 3KXFE 4X8JA 2NYZA 1FSKB 1RIHH 4XVSH 3CC5A 4YX2H 3DPBA 1HNGA 3DSNB 3PAYA 1BFSA 3UBXA 1EGJH 5L8KB 1ZE3C 4GO6B 1GR7A 4LMQE 4PJ7A 4HSCX 3UOAB 4FQPA 1U8HB 8PAZA 3GUFA 1AR1D 1IAII 1KCBA 4JO1H 4B0MM 4P5TB 1H3TA 1CICB 4M8VA 1IVLA 3EJUA 2DM3A 3DOSA 1X5JA 3B2VH 4IDLA 1DLFH 5EOCH 1H3PL 6FABL 1CGSH 3EJCA 2XU9A 4ODBD 2V2WA 1AMXA 2XFXB 3OXSB 4NQCD 4X0KA 4AUYA 1CGXA 4LLDA 4EE2A 4XCFH 4G8IA 2GC4C 4XN2A 1TQCC 4HCFA 3D85A 4YC2B 3HZ3A 4MJ6B 2VLKA 2G75B 3GGWA 1NGYA 5HYJE 1AQMA 5C2UB 2ZOUA 2AMUA 1R33A 4WJKB 1WBZB 5LVEA 3O3BA 1SDDA 2YAMA 3LB6D 1DZBA 2EVHA 1ML0A 4BHUI 5LBVA 5JQ6H 3QXUA 1DO5A 2GY5A 3I02A 4MD0B 3SE3A 4AC4A 3T77A 1P4IL 4R2GD 5D2NC 1BLNB 4LHUA 5EWIL 4BZ2A 1SBSH 3U6RB 3HZYA 4S1SL 1A7BA 3QFJA 4GAFB 3WS3A 1KC5H 2UXVA 3Q05A 3ZLQC 5BJTA 4HXAH 3MRGA 1IC4L 5ID0B 4QD2E 1DQQB 3RBGA 3JBG7 1CL7L 3VXSE 1LVEA 3C6SA 4PJ5B 1TJIH 1H8SA 2A6DA 4ALAH 1OGAA 2VZ3A 2OSWA 1YN6B 5KS9E 4JVPA 3HFMH 5T1DL 3FBQA 3C5XA 2IFFL 2CRIA 5B7EA 1KZQA 3JWOL 1CN4A 4DP8X 1KYOJ 4JGMA 5H8DA 5EOQH 2V37A 3VFOA 3GSQA 1OQOA 2DICA 1N7MH 1TITA 4Y4HA 4X5WB 3VXME 2EIBA 4XGZB 1S3KH 4K5MA 4RISL 1U8PB 3AXIA 2K6WA 2P5WA 2J8UF 3FB5A 3BWUF 1IGFL 4GQPH 1EFXD 4XX1E 5T33L 4KKPA 1CXLA 2WQSA 1BEXA 3EFFB 3IVKA 4PCKA 3MRFB 1OT1A 5I18H 2A77H 1ZS8A 5FYLH 4NUPA 5IMKB 4ZPVB 3DBXB 4U6TA 2P9RA 1VACB 3UG5A 4AQ1B 2CLRB 5F3BB 2EYTA 2EEBA 1TZOA 5J5EA 1XCQB 4QXUL 2RMNA 2AK1H 4PJ8A 3KWWB 5TDPB 1IQWH 1YYLH 4Y19D 3RDTC 2VXUH 1I7TB 3CZLA 2VWEE 2XVLA 5GZOA 1UB5A 1NLBL 1Q0XL 4DGUA 2I24N 5INCB 4NRXA 4PREB 1Z9PA 4Z95H 5EU6E 3DUUA 4QHPA 4XP1L 5HHOE 5SV3A 3CQPA 1T5KA 2FX9H 2HKHH 3RY5A 4JM2A 2D0GA 2ZUUA 3V5DB 4U6XB 5HXMA 5L2KA 1GAFH 2XKNA 1T0NA 1CDYA 1PEWA 3T3PE 3C2AH 2ZE0A 1TYEB 3IE9A 2XX1A 1A65A 3B2PA 5AOKA 4I3GA 3VB9A 3ASOB 3P4OA 5DZPA 3UTTB 3M1OA 5M7QA 1U9KA 3HG4A 4UYPA 3UADA 5A6MA 4LSQL 4NPYA 1CFVH 1JPTH 2VO5A 1IKOP 3KH3A 4XNMB 5AKVA 3H9HA 1AACA 4UQEA 4F1ZA 4I9WD 4I48B 1UT2A 1EZLA 4QJ5B 2ZXAA 1BFVL 1S7RA 2KZ1B 3L3KB 5I26A 1PW3A 4JFEB 3KYAA 4FL4B 3RA7H 1J5IA 3HE7C 3UCRA 2VDOL 4KKNA 4QRQA 5C09E 4RZCA 3EYFA 4KO6A 3DO7B 5IMLB 1P5UC 4UV7L 4LARL 1HQ4B 1MCHA 4OGYH 1GCFA 4YNYA 3HBPA 3HZKA 2FX7L 4OD2B 3L7EB 1KYDA 3C08L 4JG0L 3COOA 1IKFL 1UB6B 2KBGA 4A1RA 2XFGB 4R4FH 2OXHB 3K71A 8FABB 4ADGA 4AYDC 3WNKA 1JFHA 5TDNB 2CJUL 4Y9BA 1FO0H 2OSXA 1G5AA 2RB8A 1NDGA 3K4DA 4KVNL 3P9WB 2B0SL 4NZUL 4YO0A 1IGML 5DS8A 2ZUWA 4OAWA 3HC4L 1E27B 2W91A 1HXYB 5E6IB 2AFNA 2I9LB 1OSEA 3O9WD 4YAQB 4QWWD 3QEGL 4ZW7A 2PPCA 3VFUB 3ZL4H 5BUPA 4F8PA 4LLUB 4Z76B 3SJVB 3MRJB 4U6YA 1VRSA 3WJLA 5FYJE 3ZYIA 1NFIB 3TA4D 5LXGH 1CFNB 3ABZA 1MEXL 4OZHE 1HL9A 1RK0A 5GGRB 3TBSA 4F7EA 4G9FA 3C60D 3TNMA 1DQVA 3U0TB 1H3VA 2YUWA 4X5QA 3VXUB 4IK6A 3Q8BA 1N6UA 3QHFL 2B4CL 3UACA 2YEVB 5IMMB 3US9A 3OKMA 2COVD 2PXYB 3EO0A 1GGBH 4K94L 1Q38A 2WSDA 3S9DB 3E6HB 4ZX3A 1AYOA 2YPLA 3MA9H 3R4RA 5F9WC 4F3FB 5JHDD 1NCNA 2EYRB 3VRLE 3Q06A 3UXFA 1OWRM 1E5UI 3AWFA 4OKVA 1U93B 5E6ZA 1XF4B 2BRRL 2OMVB 3LH8A 3T0EB 4ALAC 2CK0L 3IU4L 3KPTA 3L2NA 4L48A 1S78D 3TN0C 2Z93A 1OAYL 5HHNA 1IGCL 1NCOA 5DMGC 5E99L 4Z3IA 1KN2L 5FA4B 1QR1B 1EHNA 4UNIA 1DE4B 3HAEH 1KLGA 3O3EA 1A47A 3LQZB 4IRJA 2B2XH 1KGUA 2VLLA 3EYSH 3SDAD 3TH2T 1MI5B 4YSCA 5CJQL 3JZYA 2YWYA 4JY5H 2Y23A 1BVKB 4JDEB 4P8QA 4NUMA 2AV7A 2GCYA 2VKXA 4OLWH 4G82A 4ONFL 1U8KB 1LEGA 4RGMC 1AO7B 2J88H 4XVUC 4LCWA 4OM0L 4O02H 1NPNA 3BP5B 3QQ4A 2WQAA 5B7MA 3L13A 5CEXB 1EJOL 2AEWA 3RVXD 1Q72L 2DPKA 5CGYD 4GXVL 2YRBA 1E43A 3MRDB 4AJVA 1GTNA 3IU3A 2VZSA 3RY4A 3F58L 3L3IB 3VH8G 5BQ7B 1I1YA 3QQ9C 1AVAA 2GSIA 1PAZA 1FNGB 2ADGA 1IKNC 4BA0A 4F7PA 3B1UA 3RKPA 2BSEA 2WIIB 3NZHL 4LPVA 1C08A 3T0DA 3NG5A 3D69B 3MV01 5DHVH 4PJ6A 3WEXB 3BDYH 4AEFA 2GK0A 2LR4A 2F7QA 1SMAA 1VGKA 4FRWA 3CFKB 2NNAB 3UTQB 1XGYH 3LQMA 1XGRA 3GSNA 2KS0A 4U1LB 3AVEA 5H94B 2E7LC 3CVHL 3B9DA 2KPWA 3MRLB 2XYBA 4LSDA 4KBPA 1S9WB 4FXGA 1JRHL 4L3EA 2YLKA 4YHOL 5HDOA 2DY2A 1MCOH 3FFCB 1KSRA 2B16A 3Q2VA 4WI6A 4C59B 4NUGH 1ZHNA 1J9RA 4QTFA 4TUJB 2GJ6E 3LPPA 4BGLA 4BFJA 3CXHJ 1CBVH 1AIFA 4PGCB 2A9NH 5LJYH 4XC3H 3DVGB 4JJHA 1RFDL 3BZ4A 1CFTA 1GC1L 1IAMA 2NLJB 2Z92A 1AZNA 5EBLB 5E4EC 5IW3A 5ACMA 1MW3A 5EUKB 1LO3L 2WQXA 4HJGA 5F21B 1QFHA 5BPPA 5AAWC 2AQPA 4JJ5A 1AFVH 2Y5TA 4W6YB 4ABQA 1OOWA 5F7FA 2XV2A 4OSUH 2V5YA 2NX5E 4XWOC 3RIKA 4KO5A 3LHAA 1NDMA 1S7VA 2MCAA 3KPPB 5HI4C 3LN5B 2D2CC 5EU3A 2AI0L 4GAAA 4XPTL 3X3GL 3LEXB 4KDVA 2P43B 4WY7L 1DQJA 5D2NE 1FVCA 2VXQL 4RAUB 2QQNL 5H2BA 3STLB 4UU9A 4JQVA 4JDZB 3O6LL 1JPST 5JO5B 1M4KA 3RWFB 1YECH 4TPRL 4XMKH 3WFEL 4PJEF 5CUSL 2OSLA 1GCYA 4A39A 3HFFA 4P9ML 4HLZH 1I8LC 3FT9A 1CLZL 1JHLL 4PJHB 4R7NB 3V6OC 2YPVA 3IBEA 3VI4F 1A6ZA 2E74C 1WAAE 1YEKL 2NY2C 3L9RA 4OBSA 2K6YA 3OLEA 3ZTEA 4JB9H 3PWLB 5F7KC 1OHQA 1UZ8B 3OAZK 1X5YA 4NRYA 3UYRH 3O6FB 4U2ZA 1GZHC 5LLIC 3HE6D 1W0VB 4OZ4A 1WO2A 2BPBA 4ETQA 4TMPA 3MR9A 2BVQB 3HJEA 5IQ7L 3G6JF 5E2UH 3KNBB 3BEVA 4Y1AE 1ZLWH 2BVOA 2P8MB 3UJTH 4PJAB 2J20A 1BZ7B 3D07A 3FT2A 3CBJB 1FI8C 1J9QA 4NN6B 4UM9B 4EI6A 4ZFZA 4X6FA 3IRCA 4A2EA 4G83A 2ENYA 4FGMA 3AAZB 1IBDA 1JMXA 2J57A 2LVCA 1RVFL 2XWTA 2Z6FA 4Z0XB 2PYEE 3BP7A 4DGWC 2W8CA 3QDMD 4NHUA 5HY9A 4FQLH 3EKCA 1QFPA 2G5UA 5D1QD 1U8JB 1A0QH 2OR9H 5HDWA 5KVMC 4GO8A 1RZJL 3HOGA 2DKUA 1Q90A 1QPXA 3ARGA 3D8MA 5DA4A 2OYPA 2J6WA 2AITA 4F5CE 2D7PA 4U7SA 4KU1A 2AK4A 4LSTL 4FP8L 5HYEA 3RWJB 1IT9H 3LIZA 5I5RA 5CLYA 4XMLL 2XKUA 5GS1C 2D7NA 4QRUA 1RHFA 5AVTB 1ZA3B 3D2UA 3QUYC 1NPJA 4W9JC 3EOAA 12E8H 1RK1A 3ML8A 1P5VB 2KUTA 3IMTA 3QS3A 1OKEA 1PYWA 2FE0A 4R5VA 4WWID 1X5IA 2OCJA 3QZWB 5I1AA 4GG8A 3PXLA 1E8YA 2PCPA 3AS3A 1U2HA 3LKOA 3IETA 5DQDL 3KPRD 3N6YA 3TWCL 2JI3A 3HG1D 4MLIA 4AJWA 1DBJH 5CD3B 3BN3B 2NTFA 3APMA 3G5ZA 4ZFQA 4N0YL 1QNIA 3GMQB 1BOYA 4W9ZA 3HC0A 1K2DB 2XN2A 2CLVB 2ICEB 3UAEA 3L4VA 5L2JB 2J44A 4ANUA 3GLEA 3RUGF 4KX9A 4Z77A 2VH5H 2FEEI 4I89A 4I77H 3LXCA 3TBYB 1HNFA 2WMPA 4MMYA 4PWHA 2ZUQB 1SXNA 1FFNA 2ZOKA 2V9UA 4GKZB 2F58L 4QHMA 1VDGA 1ETZB 4Y9CA 3BKJH 3V5HA 4GRMA 4OD1H 4WI8A 1WJ3A 4KJWD 1A7OH 2GHZA 3QDAA 1MFUA 4X6EB 4POUB 5IJKA 2AF2A 4LQ1A 5IVZB 4C56D 1J8HE 3MDJA 1Q9OB 1K3IA 4PJFB 5ALBH 5EUOE 5SX5H 1ZLUH 3PU7A 2E9JA 5DJAB 3KGUA 1OB0A 4NS0A 1Z5HA 3TV8A 4BWTA 4W9FC 3ZE1B 3V0IA 1F4AA 3K8MA 3NJJA 3S98A 2VRQA 4M1DH 2KPNA 4G1MB 2VSDA 5SWQB 4F7CA 5AUMA 1FFOB 3ZSTA 1CYGA 4RMUA 1S9YB 4DO4A 1HSAB 1JK9B 4LDLB 1FL5A 3IGAB 4L05A 4HIQA 3LZFH 5D1XB 1QACA 1H3XA 4LLVB 1NBYB 1RZGB 1DCLA 3QHZH 3UYPA 4ZAKA 4Y9EA 4HUKB 4XPAH 5ID1A 2VAJA 4OTXL 5DUML 4RMWA 3D4GA 5CLZA 1HZHH 1T4KB 4QGTA 3RTLA 3VXRA 4Y4HC 5D7JB 4HAGA 1KFAH 5I8CB 1JYWA 1R3HA 1KCUL 3RGVD 1A1MA 5IKCB 2Z8SA 4QCIA 3FUKA 2AQTA 2EH8H 3P0YL 1W0WB 5HHVL 1G9ML 2WZPA 4EVNB 4BSJA 5I24A 2WSPA 5F72S 4XN1A 1NAKL 4OJAA 4WFFD 5JW3L 4I18B 4K5OA 4S0TD 3U1QA 1X7QB 1H3GA 1SBBA 2IAMA 4FKHA 2WLZA 3F83A 1XZWA 4TSBH 3BGAA 4PJ8C 2R1YA 4W9CC 3S4SG 1VADB 4FI8A 5I73C 1C5CH 4NZJA 1XR9B 4MJIB 4ODVH 5E4IA 3P9MA 3BFOA 4ZD3H 4NT6A 3VJ6B 3UC0L 3ZIMA 5I1IL 5I6OA 2R0KL 4EOWH 2FTAA 4DVBA 5F7NC 3I75A 4HZLA 1F58L 1KCRH 2WVSA 4EQ3A 4ZNEE 2VR8A 4PG9B 1TTGA 1KXTA 1E5AA 1WSST 1Z9MA 2ICES 2W9DH 2WB1A 4BFBD 4CILA 1RHHB 2V9RA 1KXQA 1F0LA 3G5XA 4L0YA 2DEWX 3BPNC 1EV2E 3D7PA 5FYLE 4Z7QB 3K6NA 4Q6IB 1ZK9A 4YDKL 2FJFA 1EDYA 3AABA 4LT7A 3BAKA 4UDUB 4OZGA 5F88B 1ZWIB 4TNWK 2HRPH 2YHGA 2HVKA 3BE1H 3PGDB 2NNRA 5D7LD 2A6IA 4PLJC 3EYQC 3NIGB 4ELME 1GYVA 4PS8A 3T6QC 5FA3B 1QSZA 1MFEH 2WLYA 2WLKA 2L0DA 5CMAB 3T0XA 5AB2A 1G7JB 3MJ6A 1FORL 1WFOA 4HIHB 4OBRA 4AXWA 2CRYA 1JWSB 5HD8C 4HJEA 2BWIA 2PCYA 2ZSWA 4WRLA 4WTWA 2CCWA 1JD9A 4J27A 5F0LB 4OLVH 3JUYA 1HHGB 1U3HD 5J11B 1ZS2A 4IOIB 3LZOA 3MUUA 4QYOB 5E51A 4TNEA 4IBTA 4OF3A 4J6IA 4YBLB 1UT9A 3TYGH 4YDJB 4J8QA 2Q76B 4HSQA 3VSVA 4WHCA 4G6AC 3Q9QA 4KKBD 2YPVH 3ZX1A 1T2QL 4UV4H 2NDGA 5IB2A 4CW1B 2D0HA 3G6AB 3V52H 4YN3A 4UILL 3TBWA 2ZQKA 3KYOA 1MJUH 1D7FA 4YBHA 3FO1A 5E2TH 5FB8A 3VVWA 5C0FB 5E6RB 4QRSA 4WUUA 3DVIA 5DC9B 2FEJA 5DHYB 3WJLC 2IALB 1JN6B 3SYAA 2L7UA 4JKWA 2QQLH 3P4NA 1U2YA 4G1EB 5DYFA 2WKOA 1J05B 4WJG3 1U8LA 3ZW3A 4KH9A 4WO4D 5DHEA 4WK4B 5IHZA 2GEQA 4R7DA 3TPUA 4XCYB 4HJTA 1E67A 3CSFA 1DHKA 2HMIC 1XHHA 1YNLH 4AKOA 2HX9A 3U4BL 1O6TA 1EEZA 3OKDA 4XC1L 4PCTA 3DX7B 3L9BA 4NO0B 3V6OE 1M1SA 4Y16C 4P2QA 4GRLB 2CQVA 2OULB 2AQQA 3W9DA 4I7ZC 4HBCL 4H1LH 4ZFOB 5HHXL 1AOZA 4XNUH 4O58H 1TG8A 3FQXA 1KPUB 3NQIA 1A1NA 3EHBD 1BP3B 2B3IA 4OJFH 3R8BB 3LIZH 1JAEA 1R3LB 1N18A 5DHMC 2W0FA 1AZUA 4QRRA 1E6JL 1IC7H 2ZX5A 5CU5A 3VU1A 2F7PA 3WNNA 3QBTB 4XNDA 4W93A 1R1CA 4P3DA 3ZZSA 4CC0A 2VN6A 4FC3E 4BQ8A 3C5SA 4EO5A 3HZMB 1NEZG 3TBVA 3WBDA 1KIRA 5ITBL 4IRJC 1HCZA 4OF5A 1KXHA 5LCVA 1T3FA 1KBGH 1W72B 3IN0A 4Y4KC 2HKAA 3PABA 1J8KA 3CJJA 3WSQH 5IB5B 3QCTH 4MZIA 1F4HA 3QIBB 1MKFA 3QUZC 4PJ5D 4QTHA 4O2FA 5CNHA 2AJXH 2X9XA 1U6AL 1X9UA 3NP4A 4LCCA 3HUJE 1W9XA 1XGQA 2I07B 2A2QT 2QKIA 3Q1SL 1NA8A 1T7VA 4O2EA 5DMIL 2CUIA 1CU4L 5KS9F 5CCGE 2VAAB 2C26A 2CR3A 4E68A 3GLZA 3FUIA 3LKRB 3MV8E 1UXSA 2DLGA 2GW5A 3T08A 4YFEA 1NMBH 1S5IL 3HNVL 3N91A 2GY7B 5CWSA 1SPDA 4KKAC 4L8CA 2X6AA 2WXFA 4FEMA 3CHQA 5GXBB 2APXA 4P4KD 4P0DA 5F96L 1SF5A 3LRGA 5DVMA 3HHSB 3NSFA 5FDYA 3WIFA 1MSPA 3W57A 5EFIA 4WI0A 4WJ5B 4A6YA 2LHAA 4HCRL 2J4WH 3RWCB 3QW9A 3VTMA 3VU2A 4PJ7E 4KGJA 4J4PA 1RMFH 4FXGC 1EZSA 2CIIA 4L4TE 1J0HA 1NCBH 3LH2L 4TRPH 3Q5YA 3S34L 2GKIA 43C9B 2VDMH 3GXDA 3H9SE 1HFUA 1ADQA 2LQRA 3CN3A 3BLBA 3Q13A 4B50A 4MQXD 5ESQB 3QXDA 4BD4A 5MEOB 3QUKB 2EUWA 1FWXA 3GWJA 5IQ9B 4JK0D 1ILUA 2F68X 2C4FU 1Z9LA 3PWUB 1I8KA 4L9LA 4OVVA 1A6UL 2HWZL 4DN3H 4HP5A 1F2XK 2VLKE 4OF8A 1AS8A 1ED3A 1HNYA 1KEGH 2ITFA 3T3PF 3UX9B 5JUEH 3VXQB 2CO6B 1G7MB 1HH6B 5E2WL 3BUYB 5DEZA 3ZIYA 3HS0A 4JZJB 4NO2B 3QJTB 2QZQA 3GMLB 2XPGA 2ZPKL 1KBKA 1SLXA 2AEPL 5EIIG 4YXHL 1H3PH 1ZT4B 3JVFC 3F62A 4BFKA 1BXVA 1CWVA 3QFJE 1ZKAA 1O7DC 3MV7E 1K5NB 3N40P 3SO3B 3BIKA 4LDOB 3AU1B 4PJ9B 4AQ8A 4AJYV 4LPCA 3MNMA 4Y4FC 5IESL 1UQSA 1OGAE 1BW8A 3RPIA 1LDSA 2ZP8A 4KUZL 1D5IL 4X6DB 2FCBA 2IV9A 1KLUB 5AL0A 1B90A 1OSPH 5AW8B 4AEIL 3CVHA 2QL1A 4L0PB 2R7EA 1F6LL 3MBWA 3PNWB 3KS0H 2A6KA 4H0LC 4RDBA 1P4IH 1F1GA 5EWIH 1MDAA 3KLKA 1B9ZA 4P5KB 1G7PA 4S1SH 2P5WE 4YFLI 2ORBL 2HT3C 4NP4L 5CJOH 2Q86A 3TYFA 3DVNA 3H7BA 4XH2A 3P77B 3TZVD 3QNXA 4EN2A 5AAPA 5CBAB 2BCKA 2JQAA 1IC4H 5IVXA 2EDQA 3GLDA 2HCZX 2W38A 1TQWA 3CX5J 1DDHB 1BREA 4JN2A 4CVXA 3QRLA 3S3CB 1ERNA 4B9FA 1MCEA 3ARUA 1QO3B 3ARGC 1U8OB 3SPGA 2IFFH 4P05A 5B38B 3HC3L 3BKML 3JWOH 1BBDL 3O9WA 2DOCA 3DMMA 2PPEA 2EEAA 4OZHF 4UT7L 2WY3B 4P23B 3I85A 2FJGA 4JFXA 4TL4A 3VXUD 2ZUVA 2DLFL 4JQIL 4N85A 1IGFH 3FYIB 4MCZA 5T33H 2V7HA 5D93C 1U30A 5KSAB 2VXQA 4M7LT 3DX1A 5EZIL 5K9JL 4EN3B 3C60A 4WSKA 2VM3A 1YYML 4X6BB 5L2KE 5DRNA 1QLEH 3MUZ1 3DIVA 5E8DL 3SQOL 4O9HL 5FUOL 5C3LD 5ANMB 2XXMB 2CM6A 3DX6A 4M8UA 1ETB1 5CZRA 4QXUH 4A67A 4GUOA 3V0VA 5DQJA 3GHEL 1CDCA 2UX6A 5JHDA 4APXB 1QP1A 4MKMA 5JLZA 2I32A 3QULA 1FFQA 1Q0XH 1VEPA 4FLSA 5FXCH 4HWZA 2VLRB 1S7TB 5TF1L 1TEYA 2QFPA 2A83B 3I74A 5HDQL 4JZOB 1AYRA 3F12A 2BWDA 1RJZB 5JPMA 2O6FA 2R15A 4S11A 4HK3J 5IBUB 2FWUA 1AD9B 1KIPB 2XVKA 4P06A 1MCRA 2BX5A 5HI3D 3VXNA 2ZTBA 1B0IA 5TF0A 5KYUB 3V4UL 1AO7D 5IQMA 1T83A 1ASQA 3EXJA 3ULSB 3SDAA 3EGDA 3QPXL 1Z3RA 3CD4A 2K0RA 3PS6A 4JRXD 3KBPA 3HZVA 1FC1A 1ZHLB 2Y06L 4LSQH 4OLZL 1R19A 5EO0B 3S35L 3MCLH 4ONGL 1INEH 1F8TL 1KYOK 1DVFA 2C1OB 2VDNL 1YPZA 5F7MC 3D87B 2O1AA 4IGBA 4LPUA 2ATPB 2DWTA 3QPQC 3D33A 1BFVH 2WXLA 2ZXBA 5K33A 2YC1B 4NJ9L 4XZUB 1I1CA 1XGUA 3ISWA 3X1NA 5FO7B 3T2QA 5ILTL 1PJWA 4O5LL 1CTNA 3WE1A 5HSFA 4R83A 4XBMA 2Y3AA 1GSMA 1LILA 4ZAKC 2FX7H 3X14A 3C08H 4JG0H 3EDKA 2HVJB 1AKJB 3S35X 3KLHD 3DYOA 4KKZA 2XWJB 2EXYC 1XTLA 3PJSB 1JZ4A 2CJUH 3SO5A 1MNNA 5EO9B 5BO1L 1ZRUA 2F1BA 3KL5A 1MZZA 3B6SA 3TBBA 4AX3A 1WICA 4KVNH 2ZXWB 3ILDA 2WVVA 2B0SH 1GW6A 3REWA 3TJEL 1FYTB 1IGMH 1GGCL 2AXWA 1C1EL 4PYHA 1ROWA 5AKTA 3HC4H 3IJYA 5C0GA 2QQQA 1DN0A 2B14A 4HH8A 2EYSB 3QEGH 3MVSA 2CNZA 4JVWA 1N4XL 4BQBA 1AXSB 1Y07A 1BG9A 4JVUA 3SBPA 3ZJAA 4KJQC 2VMFA 2IAMC 3ARFC 1WTLA 2ZYRA 3RL1B 4R5XA 3U4AA 1WA0X 4IW4C 5KBNC 5T1MA 5I9QC 5IVOA 2AANA 2F54E 4PIBA 2K6ZA 3APNA 1KJVB 3AT0A 4ELKB 2WLIB 1P84J 3DXAB 2OYLA 3BP4B 4TSAL 2RQ8A 1HHIB 3V0JA 3QHFH 3SPHA 2B4CH 2G3XA 3RX7A 1JZ7A 4GSXA 4K94H 2VABB 3D34A 3PAZA 1U8IA 2EDYA 3QCUL 5HTSA 3K0YA 3I6LD 4N5EC 3TL5A 2AJYL 1A4JB 4P48A 1UD2A 5T5FH 2ED8A 3CHXA 1GTFA 1BVLA 2XQYK 1WAAF 4LCWE 4PRAA 3PGFL 5E4AA 5F7DB 3BWSA 3WDHA 4ORGB 1L6XA 2BRRH 3LVTA 2VE6B 5HHQA<