1HAUA

X-ray structure of a blue copper nitrite reductase at high ph and in copper free form at 1.9 a resolution
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
336
Chain Sequence
QDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structure of a Blue Copper Nitrite Reductase at High Ph and in Copper-Free Form at 1.9 A Resolution
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
total genus 89
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2001-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1hauA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1hauA02
1R1CA 2XV0A 1J5CA 2UX7A 2EINB 2YQBA 3FU7A 4KO5A 1SDDA 2IDSA 3DTUB 5B1BB 1OCCB 4G71B 1GS7A 1A4CA 2IWFA 2J55A 3NJFA 3X1BA 1GR7A 4E9SA 4G7RB 2MTAA 3PLYA 4BWWA 3V9EA 1TKWA 1WAEA 4E9QA 1X9UA 3U25A 1ILSA 2W88A 7PAZA 1PZBA 4UF7C 1CC3A 1JZEA 2CBPA 7PCYA 2JKWA 4DP6X 1DYZA 3CDZA 2CUAA 4BK5C 4YVUA 5A7EA 4DP8X 1PLBA 1E5YA 3X1NA 3S3DB 1KCBA 3CVDA 3BVDB 2H5UA 4AX3A 3N2JA 4E9TA 2YXWA 1AR1B 5B1KA 3BQVA 4QKTA 4HCIA 3FU7B 5D4IA 1NIBA 2HX8A 4KNUA 1BXVA 2Q9OA 1BQRA 2FQFA 4BWUA 3ASOB 2BP8A 4N8UA 1HAWA 2HX7A 1A3ZA 2AANA 3FQ1A 2XWZA 2YAFA 1TU2A 2YAPA 3SBRA 4E9XA 4YSCA 4HZ1A 1N70A 2PP8A 4P5SA 3EH5B 3OQRA 4DPBX 3H4FA 1BQ5A 3FYIB 1I53A 3G5WA 1AG0A 2B08A 2FQEA 2DYRB 3FSVA 3SBPA 5I6PA 4YSOA 5TK2A 3ZX1A 5B1AB 4A2DA 4BXVA 1L9OA 1SHXA 1CURA 3FU9A 1AANA 1AZNA 4WKXA 3DKHA 1JOIA 4G7QB 2PCYA 3WNJA 4YL4A 4AZUA 2XX1A 4CSZA 1ASPA 2YAHA 3AW5A 4JHVA 1JZFA 3L45A 4GXFA 2VSKB 1ILUA 3FU8A 2EIJB 1NINA 3PAVA 3OD3A 5D4HA 2GBAA 3QJQB 2ZXWB 2ZOOA 1ET8A 2GHZA 4DP4X 1L9TA 1XB6A 2RACA 1BQKA 2FT6A 3JTBA 3ABMB 1OCRB 3OM3B 3T6WA 2ZWNA 4HALA 3D12B 3MBWB 1GYCA 2WO3B 3N55A 3OMIB 4M3HA 1OE2A 1AG6A 3NSYA 2A3TA 1DZ0A 2Y1AA 3WI9A 2JXMA 1MG2C 4KOBA 4Q89A 1ZV2A 2TSAA 3QJSB 4GP5B 1IKOP 1JZIA 1ZPUA 2QT6A 3V9CA 1VLXA 1GY2A 1FFTB 4A67A 3T6XA 2FNWA 3AG1B 1XB3A 3T9WA 2OCCB 1KCWA 4E9YA 1NZRA 1QHQA 4NERA 3OMAB 1AACA 2BWDA 2EIKB 3NSFA 3X1GA 3FT0A 5PAZA 3UGEA 1PLCA 1RKRA 3CVCA 4G72B 4FA7B 3WG7B 4F2EA 2EILB 2X88A 3TBCA 4DP7X 2YAOA 8PAZA 3ZBMA 2AZAA 1L9SA 2PPAA 3RYMA 1BXUA 2J56A 2VM3A 4A66A 1ET5A 3C75A 3ZIYA 3NJLA 1PLAA 5D4JA 3ASNB 3AG4B 4HAKA 1AZRA 3S8GB 1QLEB 4N4YB 1PAZA 4DPAX 2I85A 2UXTA 2P80D 2N0MA 1AQ8A 3UACA 4KO9A 2BHFA 5LDUA 2B3IA 1IUZA 4MFHA 1BXAA 1JZHA 3AY2A 4G70B 1SJMA 3IE9A 4ENZA 4K9JA 1IBZA 5AZUA 1NIEA 1QNIA 5I5IA 1KBVA 3CG8A 2BP8B 5E9NA 4W1TA 3IN0A 1EHKB 1OE1A 3GXUB 2BP0A 1AS8A 1OE3A 2IWKA 4RH4A 1AZUA 5I6OA 2VSMB 1NIFA 3FQ2A 1ZDQA 3PAUA 3EF4A 4DP0X 2XUWA 1ASOA 1JXDA 3NJMA 1PMYA 2PPEA 2XV2A 2YXVA 2HRHA 2YAEA 3GDCA 1IC0A 1CYWA 3NT0A 1AOZA 2J57A 2R7EA 1NWOA 4DP1X 2VN3A 2JFCA 1WS8A 1YLBB 3QPKA 2GIMA 2XLLA 1AZBA 3NJGA 1URIA 2AVFA 1OV8A 3IN2A 3FPYA 1W8EA 2IDQA 1F56A 4Q8BA 4NB7A 1OCOB 1PNCA 1E5ZA 2AFNA 1J9RA 4DPCX 3CZUB 3QQXA 2GI0A 1E65A 3WKPA 2AZUA 1AS6A 3AZUA 4KNSA 2H3XC 2YAQA 3H56A 2HZHA 2XXGA 1WS7A 1PY0A 1SF5A 5AKRA 2VW7A 2PP7A 1L9QA 3NSCA 1XMEB 1PZAA 3DIVA 2DV6A 1WA1X 1SFHA 3NP4A 3T6VA 5I5MA 1CYXA 2XYBA 3QJRB 2IH9A 3EH4B 1M57B 1XB8A 3AG2B 2BW4A 1NIAA 4PCYA 4X4KA 2Q5BA 4BDVA 1V55B 4FAAB 1E67A 2XV3A 2IAAC 3T71A 3S3BB 4BDVB 5B3SB 1J9QA 4E9RA 2PPCA 1NDTA 5B7MA 3X1EA 4GP4B 3T6ZA 4CSPA 2VW6A 4UAHA 3AG3B 1ETJA 4AKPA 1B3IA 4BXSV 5F7BA 3QJVB 2GC4C 2EIMB 2GB2A 3FSZA 1MG3C 4F7KA 1V10A 2HLEB 1RZPA 1GW0A 2HX9A 3WIAA 3IEAA 4P5RA 1W6LA 3S8FB 2BW5A 2HRGA 2QDVA 4A2GA 3NJIA 4NAJA 1JXFA 1GSKA 2I7OA 2XU9A 2MRYA 3TA4D 2GSMB 1RZQA 1A4BA 2XVBA 4GY4A 5B7FA 4AKQA 3ABGA 3UAEA 1GS8A 1NIDA 2BWIA 1BYPA 3NP3A 1N68A 1ADWA 2X87A 2CCWA 5FC9A 4KOCA 5ANHA 2FJSA 1NWPA 3HB3B 2FTAA 5B1JA 4ZK8A 5EHFA 4JKNA 2QDWA 2W8CA 4M4RB 4HCFA 4E9WA 3S3CB 4JHUA 2PLTA 1ZIAA 1MDAA 4YSPA 1W6WA 4G7SB 4A2FA 2QPEB 1J5DA 3PPSA 3PCYA 1M56B 3KW8A 4YSRA 3UAAA 4BWTA 4A2EA 1MZYA 1WA0X 2IDTA 2DY2A 5PCYA 9PCYA 3JT2A 3IBOA 4UANA 6PAZA 2PPFA 4YSQA 1EZLA 1FWXA 1JVOA 1JVLA 4HHGA 4PAZA 4YSUA 1GY1A 4KNTA 5F7AA 1BEXA 1GS6X 2DWSA 1ET7A 2GC7C 2I7SA 2WSDA 3SQRA 3NJKA 1KYAA 3ZDWA 1T5KA 1IBYA 3FYEB 1KV7A 1FA4A 1J9TA 3PXLA 1CUOA 3TASA 3X1FA 3CDZB 4HHWA 2FQDA 2HXAA 2OJ1A 3OMNB 5I28A 1ZIBA 4HCGA 3NSDA 2YARA 4YSSA 5B7EA 2XXFA 2UXFA 2UXGA 3H4HA 5I6NA 4QLWA 2BZCA 2UXVA 1PNDA 1BYOA 1J9SA 3MX0B 3ABLB 2R7EB 1JZGA 2PP9A 4YSTA 6PCYA 3FPXA 1PCSA 1E30A 1A8ZA 2VMJA 2YAMA 2Y69B 1TEFA 2TSBA 2CAKA 2CJ3A 5I6LA 3CVBA 5I5JA 3UABA 5I26A 5I6MA 5B1JC 1WA2X 2FQGA 5TK4A 4YSAA 2ZONA 2VM4A 2FWLB 2H47C 1OF0A 4TXVB 1SHWA 3TBBA 2LLNA 2QPDB 2XX0A 4AKOA 3EH3B 4DP9X 4A68A 4KO6A 3FSWA 1MZZA 3TU6A 2BO0A 1V54B 1OCZB 1AS7A 4KO7A 1SNRA 2UX6A 1HAUA 3EHBB 2OV0A 3NJJA 2BP0B 1PF3A 4GYBA 3FS9A 4DP5X 3NJNA 1SF3A 1JXGA 2IDUA 1NPNA 3HEIB 3PAZA 1A4AA 1ZDSA 1L9PA 2FT7A 3NJHA 4L0PB 1UATA 4AI7A 1RCYA 3SBQA 3X2QB 1HFUA 1JZJA 2WO2B 1L9RA 2DYSB 3WKQA 2PPDA 2IH8A 1AIZA 1NPJA 4W9ZA 1BAWA 2VW4A 4YSEA 1M9WA 2IWEA 4GP8B 1NTDA 5AFAA 1PZCA 1TEGA 1KBWA 2FT8A 2P80A 4WTQA 4EF3A 1JERA 1A65A 3ERXA 1ID2A 3FSAA 5IY5B 2CALA 3NYKA 4YVNA 3WNIA 3QJTB 1SDDB 2PCFA 3FQYA 3KW7A 1X9RA 4A2HA 1SFDA 3ABKB 4F2FA 2NRDA 1NICA 4HIPA 4E9VA 1KDJA 2DWTA 2E86A 2BZ7A 1KDIA 1AAJA 3UADA 1AZCA 5I6KA 1OOWA 3QJUB 3GYRA 4DP2X 1KGYE 2IDFA 4YSDA 1ASQA 2J5WA
chains in the Genus database with same CATH superfamily
1R1CA 3WJJA 4I85A 2VZUA 1TTUA 1WH0A 5FW6A 1TQBB 4LCWB 3CMOH 3SO5A 5JHAA 3BD3A 2EEXA 1E2VA 5B1BB 4X6FA 2NSMA 4G71B 5IHWA 2NXZD 4ZNEE 2J55A 2WSPA 4ZAKB 3RILA 3TC9A 3MLYL 3OLGA 1QD0A 4D0DA 4OF7A 4AW4A 1O5PA 5LNGA 2QQNH 3PGFL 4E42A 1EEZA 3U30C 3H3KA 3UJTL 2VLRB 4ZDHB 3KPRA 2JKWA 2WYTA 4YAQB 2XZZA 4H25A 3GPSA 4WI0A 1UURA 1L0QA 2YQ3A 4PJDF 4NNYA 5E6RB 5HHME 1T1XA 2UY6A 3Q6GH 4XP9H 3N2JA 3EO1A 4XN2A 1OB0A 5F96H 4DTGL 5ISZB 4LLDA 1YPZB 1RIUH 3WO4C 4P2CG 3FU7B 4L5FE 2VR6A 2ADJB 3GUFA 1HHGB 1INDH 1D5BA 2HX8A 2HTLD 2FQFA 4P4KD 4PJFB 2HX7A 4A7GF 2AANA 2E27H 1UWXK 2RHEA 4I77H 4NNYB 3WFCH 3KS0J 3PV6A 4LCIH 4PBXA 4OZGA 6FABL 1DQTA 2PTUA 4XMVA 3VSUA 2BY2A 1MPAH 2VM9A 1TMQA 4D3CH 5FKAB 2WW8A 3QNYB 1NCDL 3VFVB 1VCAA 4LVOC 2FQEA 4A2DA 4N8CL 5E1QA 5F93C 3D48R 1D9KC 2VLLA 1CURA 5F7DA 1TCRA 1JGEB 2KYIA 2NYZA 2XZAL 5EC1A 4ZAKA 2F8VA 2ZF9A 1N7ML 1QFWM 5LO7A 4NQXB 2EXYC 4XMWA 4BYHA 4WHYH 4WK2B 3TBWA 3GXIA 1R34A 3MJ7A 4UQAA 1INEL 2PR4H 2HRPH 2V5YA 4AEIH 3QUYA 1W8OA 4N2CA 2ZUYA 4Q58C 4ATWA 4OCMC 4U1MB 5TGBA 3T0BA 2K8MA 2B77A 4HLZG 4RZCA 5F89B 3GIVB 4XX1G 3BQUD 3MBWB 4RRPG 4M3HA 1E4XI 1J05B 4HGKC 1S3RA 4YHPB 1S3KH 2D03H 3D2UB 5FHAL 1ETB1 4NT6A 1T2XA 5FGBC 2V8LA 4AEEA 3K46A 3WFEH 1OD9A 4FZEH 3VYNA 4JRXB 1PKQA 4QHNA 1TQBC 3LKOB 2G4GA 2IALA 4KVPA 2Y36L 4MCMA 5E8DL 1KB5H 1R0AH 1CDIA 4LQFL 2MCPL 3LZFH 3I6SA 2FX9L 3EOTL 5FFGA 3WJLC 4M9OA 3QIBA 4DEPC 5HPMB 1P6AB 4K23H 4Y4FD 3B9VA 4TVUA 4I2XA 2FNWA 4JY5H 4YR6A 1IBGH 4UQIM 3IMVA 1JZ6A 1ZS2A 2Y7NA 1YEGL 1CGTA 1YC8A 1W8NA 4JHBA 1JK8B 4HJ0C 3HZVB 5BZDB 4GAYA 5ACLA 1XH3B 1DANT 1KB5L 4JM4L 1R0AL 1T80A 1GYWA 5FS5A 3S0PA 2F19H 4PU2A 3ATAA 1L9SA 2KZ1B 5C0AB 2WZPA 2B20A 1YEHH 3C75A 3HJ0A 3NJLA 5A2AA 3JTTA 3NRPA 2BSRB 1HDMA 4QYOA 2FZ3B 3L4VA 3S37L 4MHHG 2I85A 3KYOA 5GJSH 1DVFB 4AENB 2B2XL 3GSOB 1RU9L 4QRSA 4PJBF 1VGEL 4XOCA 5I0XA 4HT1L 4S0SD 4XGZA 1KB9K 4ERSL 3MFGB 2NPLX 4NS0A 5IBUB 4LEXH 1Q9WB 4Z95H 2I9LB 1MEXL 2AXFA 2Q20A 5E9DD 4GRMB 1HQ4B 1C08A 4UIMB 1UJTA 2CE6A 1XXFC 4O9HL 4ZOAA 1XO8A 4J8RA 3L3GB 4NBYB 5DJDB 5E1AA 3RVTD 1LK3H 3WNOA 1F42A 2CPUA 5KW9H 1QWUA 1Z1WA 5C07D 2CKBL 2Q86A 4KPHL 4LHUD 2DJUA 4HT1H 5B39A 5AOIA 4WWKD 3QUMB 2ZKYA 3CFIC 2P3YA 3LIZA 3QDAA 3EXLA 2EVJA 2VDLB 4UI2A 4OGZA 4XXWA 1N5AB 1N67A 3U2SA 3VWKB 2V2TA 3QO1A 4K7PH 1UOVA 2ZOTA 2LW3A 3PNRB 4MNQA 4RDBA 4XI5D 3ZOAA 2BNRD 2JMRA 4KI5D 3MO1A 5E03A 4TS6A 2CBMA 2D9CA 4N28A 1G9HA 2V9RA 4GUPA 2OZNA 1WS8A 4YDIH 4E5XB 5B8CC 4DUXA 3CXFA 3PWPD 1XQ4A 1UFGA 4ISVA 1LP9A 3GIZH 4HKXB 1A4KB 4WUKH 4XNZC 4TTDC 5IEHB 1TENA 1YYMH 3Q1SH 2ICWI 2W9DL 2ROXA 4D9QD 1HH9A 4E41B 2V3EA 1R3KB 2EQDA 3F6JA 1FV1B 2D03L 4L1DA 4CMMB 4GIAA 4HH9B 4LNRA 1G9MH 1CE6A 3TWCL 2IQ9H 4JDEA 4M02A 3AC0A 1FPTL 1JGIA 4OCWL 5MEPB 3ZL1A 4IM8A 2AKRA 4P23D 4XMXA 4XB8A 5DUPH 2HTLC 2J8UF 2XG4A 3BKMH 2DV6A 1WA1X 5DFTA 3RIFF 4LGPB 4TUUA 5DS8A 5E8PB 1AGDA 3G6JF 3MBEB 3ROOB 1RVFH 2IH9A 1A5FL 3SOBH 2HJKB 1EJFA 2ZICA 4PCYA 2L7JA 2X4RA 1SEBB 5ETUB 4KRNA 1WP6A 2IAAC 5JTWA 2IQAB 4YE0A 3V5DA 5LGJA 1VACB 1A6PA 3W0WA 5I73C 5C9JA 4L8DB 4WW2A 5HY9A 3BLKA 3PWLA 4E9RA 5EU7E 5JOEA 3O3BA 4NO2A 1AGEB 1IAKA 3MJ9A 3LXUX 3L8QA 2XN9A 4HEMA 4KRLB 4AYGA 2D3JA 1BWMA 4ZUUA 1QBLL 2G3MA 5AL8A 2VDKL 1RMFL 2JCCB 1BQLH 3OX8B 4PRIE 3RWHA 1N8OE 1P4LB 1I8LA 2AV1A 4R4FH 2HX9A 3O0LA 1HXKA 4XBPA 1MVUA 5CIPB 3CQFA 3IMUA 3VQLA 5D70L 2XPZA 3WAJA 3CQPA 4DAGL 1GSKA 4APQD 1D5XA 4J3BA 2MRYA 2G60H 2R2EB 1P9MC 1RJLB 1SGKA 1WZ1H 2D7NA 3MV9D 5L88H 3KPTA 4GW5B 5AW0B 1I4FA 3B9KA 3VFUA 5JLZA 1F3DJ 2R0WH 4QRPD 3B7SA 1OXYA 3FTGB 1ONQB 1TSHA 3L3OA 3DVGB 3C09B 3L9RB 1CFTB 3G5ZB 3W56A 4PREB 2WVTA 1UZ6F 2E0PA 3CU7A 5DJZB 4LCWD 3BHBA 2CPCA 2G60L 3I9PA 1CZ8H 3C08H 5ECJE 4WSJA 1PJ9A 4J3OC 5C0FA 2XWEA 3IGFA 4LEOB 2IH3A 1MCHA 3LZLA 4NP4L 4L8SC 2L04A 3O6FB 3AT8A 3N5AA 1KCVH 1PX4A 4YSRA 3MQIA 1F4YL 3FMGL 2F8XC 2EDKA 1XIWD 2DY2A 2WLKA 4P5KB 1DFBL 5GRVL 4HBCL 2APTA 4C4UA 2JELH 2NSXA 3EFDL 1UOLA 4U1HA 5C07E 3SJVA 3CHPA 2XI9A 3EOBA 1I4FB 3B9KB 1PSKL 2KMWA 3ZDWA 5JXED 1DR9A 3MRNA 5CN2A 3FYEB 5E9DE 3AXIA 3MUGB 2QQKL 1CI3M 4X6CE 4XC3H 4ZTEA 5EEUA 1R3IH 2YFOA 4EI5B 2WLZA 1BZ7B 1KJMB 1U3HC 4C4KO 3VQ1C 4TSCL 2XNAB 4UV4H 3OPZH 5D2NA 1AYRA 3WIIH 4QLWA 3MJ9L 4LKCB 5AEAA 5GS0D 1HL8A 4DEPB 3TF4A 4PJIE 1LO2L 2NX5A 3GT6A 5DJAA 2DQDL 5MP6L 5IVZA 1D2OA 2H8PA 5AVRB 2AQ3A 4Y5VB 2X05A 4Z3JA 5I1AA 2PWGA 3O6MH 3JUYA 2VN7A 1JD7A 1QO3B 1XCTA 4CC4A 3AT0A 3TEXA 1YSOA 4JPVH 3D1MC 4MWFA 5JQHC 4NN5C 2EDLA 3V5DB 4FFWC 4WI9A 2PW1A 2CM6A 3FDWA 3P4MA 5DUBA 4LSTL 1UZGA 2JIXB 3UTTD 2OMXB 2W91A 3MLUL 3TBBA 4AL8L 5I1KL 1GZHA 4L4VE 1NH6A 1SRDA 4PRDB 1QFUL 5F21B 4XNMA 3FUEA 4ZZKA 2OMZB 5FOJA 4AKOA 3SDXF 1KJ2L 3GSNL 3ARWA 1OQOA 1J12A 1LXMA 3QULA 1MZZA 2WY3B 4EUPG 1VFOA 4I5BB 4GUQA 1NCOA 2XG4B 4KO7A 1KMGA 4H0GA 4NUJA 1AGCB 1T89C 3GSVB 3PHSA 3B2VH 1T5WB 5LWYL 2C1OA 3TZVC 4AZ8A 2Z34A 1VERA 2C34A 4LNRB 5J6SA 3CZKA 1J1XL 1ZT1A 4KTDH 3U7YL 4AL8C 1HT6A 2MHAA 4BFKA 4Z3TA 1HH9B 4L4TA 5J89A 1G7IB 2O93L 3EGSA 4W9EC 4LSDA 1N7MH 1C8PA 5E2JA 5IJVA 3DX8A 3NGBC 1HZLA 4RGMB 1I1RA 2X6BA 4Y5YB 1CK0L 1WUZA 2JKLA 5EV7A 4X5PA 2E74C 3QZNA 1KBWA 1NKOA 2P80A 4QAWA 3WLBA 3MRKB 4LLQB 5EF2A 1CFNA 3JV6A 2YD0A 1N5AA 3NOIA 4MRBA 4P9HC 3IXTB 1YZZA 3C5JA 3CK0H 2BNQB 2WLIA 1FN4A 3ARXA 4APQC 4DZ8A 4HHAB 2CQVA 4ODSH 3BWAB 4N0YL 4TV3A 5F6HI 4AIOA 1NICA 4HIPA 1HEHC 1BW8A 2MNWA 3CLEL 4ZQKB 2ZUUA 1MW1A 3G5YA 1HVXA 4AYMC 3HI6H 1WT5A 4G6KL 1XEDA 4DOHE 2I9LA 3JWNG 4JY6B 3GO1H 4R97C 4XWOD 3S4SG 2YPLE 2EDMA 1OKEA 4Y4KA 1FFNB 3T2NL 3REVA 3GBML 4S1SH 4H1LB 1Q94B 2ICEC 1RIUL 5I1HH 4W6WB 2F54D 3C87A 1SDDA 4ODTL 1JYNA 4X80H 43C9B 1HDMB 1EVUA 3IKKA 1YNTF 3LV3B 3HAEG 3RVWC 4QRPA 4AM0Q 3ZYJA 4ALAC 1BVOA 5CSZA 2ESVE 3L81A 5IBTH 1PTZA 3IJEB 2EIZB 4R4ND 2C3WA 2DEXX 1MHCA 3OPUA 1PFCA 3B2UD 2EUVA 4XCCH 2DLEA 2YGNA 1EXGA 2P47B 3TT3H 1CD0A 2A38A 4XXCA 4V11A 1QTPA 1GC1L 1I8MB 2XXCB 3Q3GB 1DSYA 5FECA 1NCAL 4LPVA 4N1HB 1PG7W 3PP4H 1Y6MR 2WXPA 3MXVH 2LLLA 4U49A 1FH5L 4OIBA 5J4MA 3HG2A 4PJXF 5F7MC 1NGWB 1J8RA 2NW3B 3VM5A 2CKNA 2AMUA 4AUYA 5GS2D 1JV5A 3FC8A 4IEFB 3IRPX 2X0WA 1BXVA 5G4OA 4BWUA 4YHKL 4IRSD 4MSWB 5CN1A 1VIWA 1L9MA 3DXAB 5E5LA 5E2TH 3UAFA 5DZ9A 4ZO7A 4EQ2A 1AVAA 4JFUA 4UTAA 1SQMA 2XBTA 1V8HA 3US0A 3MACL 3G5WA 3N9GH 3OKYA 3CIAA 2JKJA 4DK6A 4XOEA 5KYXB 4TYUA 4P23B 3TFBA 5B1AB 3M8OH 4U0RB 2GJRA 4OCYH 3SIKA 3UTSB 2XPYA 3G6DH 3OWRA 3SO3B 4PJGE 3VM7A 2WWNA 2ZUSA 2VDKH 1ZAGA 2VLKE 4N9GB 2PCYA 5A43C 3BJLA 1ZA3B 1MCOH 1JZ5A 2FYVA 3ZDXB 3ZN6A 2W94A 1TO5A 4DHLA 1AGCA 2QSTA 3GMLB 2M2DA 5I1CL 4B9ZA 3SKJH 3WKNA 2K6WA 1OAQH 4G11A 4JW3A 4KX7A 4FTVD 3ZZQA 1D6VH 2BSBA 2OQJB 5I66A 1AKJD 3DHPA 4UNIA 2ZE0A 3R06B 1I7TA 3W11D 4CVWA 4XNMB 4AOFA 4F33B 4M6NL 1OE2A 3L2LA 4I2XE 1JHKH 4FOMA 1XAUA 1PG7X 1A3QA 4ORGB 5C97A 2MKWA 2YMXL 3VGHA 1KPRB 2GJ6E 3MHZA 3WFHB 4XP5L 5ACMA 3RA7L 4PSPA 1HKLH 2ZXBA 1IKOP 1WTGT 5IT2H 1TJGH 4MB1A 5JNYA 5HDQL 3QZBA 2A9NL 5B38B 4NC2B 1UD4A 1BIHA 5F9DC 2AHIA 2NR6C 3VFPB 5HGBB 1UXLA 4UYQA 3BDBA 5F97E 2FCBA 5FF6B 3RAJL 5DJXB 1JYWA 3T4AC 3VRJA 1HSBB 4X6CF 5AWNL 1YCSA 3R4DA 1WT5C 2DKSA 1DCLA 2DLGA 1ZS8A 1Y0LB 5I8CB 4MMZC 1DL7H 1YEJL 3UGEA 3T2PA 4X8XA 4ZDHA 2CM5A 4G72B 2P24B 4EEEA 5HI5D 2AJVH 3EO9L 3BVNB 3ETBF 2A9NH 3UTSD 2YAOA 4ZD3L 5E8OB 4E42B 3PE9A 1C1EL 4GKZA 4N3UA 4D2NA 3V95A 4WFEE 1WFIA 2DL9A 1T7WA 4D0DB 4O02B 4NYLA 4ZW3A 4OGXL 2PUQT 3UTQB 4NQDB 1W0WB 5FGSA 1YA5A 2FHFA 6FABH 4F1SA 2DQ6A 4WF7A 3DI2B 2YIHA 1I8UA 2ZYIA 5JMRA 1AXIB 3Q7JA 4PJDB 4AJWA 1TITA 1MFVA 5HYSA 4JFSA 5DMYA 4WI7A 1DO6A 5HGDB 5IB2A 3ORJA 4GT0A 4ZXBA 1MQ8A 2IANB 3VB9A 3TJHD 5KSUA 3MYJB 1YPZF 2NY4B 3O3DB 4Y4KD 5JOFA 1SN5A 2QBWA 3A6CH 3P0VH 5C0FB 2A0LD 1HOEA 4HPOH 4LSRH 3RVVC 2FECI 1RAMA 4IRJC 1KJ2A 2ZWZA 1QNIA 4OZGE 4XZUA 1UD5A 3VXUE 1B0RB 1UOWA 5CD5D 5E9NA 4OBSA 5EEZA 3SDDC 1CLVA 4HU2A 4G82A 2AQNA 1NANH 3LZPA 4JQIH 3K80A 1EDQA 3MGTA 4ZUSA 4NENB 4N90D 1OF2A 1U92B 5EIIA 4OFQA 4X6CB 2HSIA 2DMHA 4GW5A 1KGJA 1QBMH 5F7LB 1ZDQA 2H3KA 1FFPB 3A6CL 3HBPA 1IAOA 3P0VL 4GXVH 1ZMYA 4L1SA 5EA0H 4FKEA 4I8DA 5C07B 3WKYA 4R90L 1R19A 3HZKB 4PJ7E 4YDLC 4QEGA 2IANE 4JO2H 1D5IH 2F7QA 5IMOA 3NT0A 3S34L 1OGAA 4J4PA 4ZS6C 5FYKL 4UMGA 3D85D 3FT4A 1I8MA 1A7QH 3DGDA 3K8LA 3RZCB 3N9GL 4ACPA 4BM7A 4P2RE 5ACZB 1P1VA 1CIDA 4PJ8B 3K6NA 4DKDC 2AVFA 3D6GA 1OV8A 1T22B 3QVAA 3B2DC 2GIYA 4ZUUB 3UO1H 2GITB 4P2AA 1E2ZA 1HH6A 3BWSA 5IHZB 4KXZI 3PYCA 1BFVH 1AO7A 5FK9B 5SX4H 3ML8A 1ZLVH 3W0WB 3WD5H 2GTQA 1G7HA 1IBBA 1WS7A 4KQ3H 1BM3L 2Z8WC 2EH7L 4MBOA 5BOZG 3L3HB 5SWZE 3UO1L 1QZ1A 2HJFA 1DTUA 4R7XA 1MHEA 2F74A 2GYSA 3TN0C 5I5MA 4C4BA 5LGHL 2Y2TA 3PL6B 4I1RA 2H9GA 3ZE1F 1MQKL 1JHKL 4UINL 1QX1A 4JZNB 4J3XA 2IFGA 1OM9A 1U42A 3TBTB 3DO7A 4JX0A 2WLJA 3BGMA 4BFGA 4MQSB 3T6ZA 1JE6A 1YMHA 4HUWA 4KI1A 4W9JC 2OTPA 3GHPA 3IXAA 5LGHH 5MI0B 3ZGHA 4FKKA 5I1JL 4G7VH 2L7UA 5E9AA 3A4AA 1LP9B 3GGWB 2ZCKL 3GBMH 4G1EB 2QQLH 4S1SL 4TVSa 4DW2L 2X40A 4XPFH 4BCZA 4E5XA 4AMXA 3VE0B 5IM7A 4Z7VE 2K0RA 5GJSL 3AQDA 1KXTB 2FNBA 4MMXC 3VG9C 3OG6B 5IJVB 4G6FB 3U9PH 2R1WB 3O8XD 3N6YA 1I1AD 4IMKC 4ZI8A 5DZAA 3ESNA 3LKQB 3IXAB 3KXFE 4G42B 3FTXA 2XWBA 3W39A 2A6JB 3IE4A 3TBTA 3DO7B 2OR8A 2DKUA 2X28A 1P84K 3SDDB 3OPZL 3SGKC 3DGGB 1NWPA 1GC1H 4G9FB 3QUXC 1J0JA 2DD8L 3NZHL 4TNVK 5DJDA 1DVQA 1MXDA 1UYWL 3HG1A 2OMUB 4LP4A 4UTBA 4YSPA 5G5DA 3IETA 4MB3A 4OKVB 5CO1A 4HCRL 1FH5H 4LRIC 2RB8A 3VGBA 3MLXL 4BWTA 3TX4A 1MZYA 4CADA 1JL8A 4MNHB 1JNLH 2FZ3A 1B4TA 1L7IH 5IFHH 2PW1B 4YSQA 3EGXA 4FEMA 5JXEC 2OMBA 3NFPA 1A7NH 3RNQB 5BQ7A 3GMPA 4RFNC 3SQRA 3NJKA 1JNJA 5JZ7D 1NCBL 1IQWH 5GZNA 4NKOA 3U0PA 3EDJA 4X9GA 1NEPA 3ENEA 1J7VR 4K23L 2DMCA 4ZBJA 3VWJB 3VWJD 1HEZA 3FQXA 4A7QA 2MCAA 2Q3ZA 5CBEB 5GS0C 1FVDB 2HRPL 2BVUA 3PDDA 2X9WA 4HK0B 1NAMB 1PNDA 1NCWH 4KJWC 2Z1KA 3BKJL 3AM8A 3EYSH 1MFCL 2PP9A 5HYSG 1X7QA 4YBQC 2UWEE 1ZT7A 1VCBC 2OK0H 1FO0L 3AQXA 1OAZH 3FBQA 4XAWL 2WINA 4HJJH 5FLVA 3HRZA 3N40F 2VQ4A 3ZL4H 4DGIH 3PQYD 5DHMC 3MRNB 3GWJA 5FYKU 2BCMA 4PJBE 4LP5A 5DCCA 5KG9A 4OTXH 4WV1B 3S97C 5J11C 1A4JA 2LLNA 3VQ2C 3D0LB 3DX3A 3INOA 1AOHA 3SCMC 2MPVA 2BIHA 2CNYA 4FA6A 2PO6D 4HIEB 1RZKC 1NC4D 3HB3D 4BIKA 5KTEL 1ZD6A 4HX1A 1BECA 5I1EH 3U0WL 1KNOB 5ABZA 3GZPA 4YIQB 1UJ3C 4PB9H 3VXPB 2DW5A 3BHBB 2VE6B 5I1LB 4ZMNA 3RWGB 1QRND 3S3JA 3GK8H 1RP8A 2IMMA 2VN5A 5BRQA 5J13B 2JB5H 3HCVB 3M6DA 1A3LH 4Y16B 4X9IA 1A7RH 5FKPA 3U9PL 4QOKE 4A37A 3VB8A 3UTQA 1EBAA 3RWCB 5BPPA 1QQDB 4LKXA 1O9WA 5CHNB 3LHAA 4G7VL 4F58L 3T77A 3SE3A 5GGTH 3MUHL 1CDUA 2QFPA 3UC2A 2ZCKH 4CN6A 5IQ7L 1CQYA 1F4YH 1MCOL 4AQ1C 1GCFA 2R0WL 4IJTA 4LLMB 1MCNA 3SPCA 1O7SA 2VRQA 3T2NH 4ZXBC 5IIEA 2FRGP 4U2YA 4W9ZA 3D07A 4TSAL 1M9WA 4GP8B 4MA3B 4JZOA 4B53A 5BRPA 2AI0H 1R9FA 1WFNA 2FYYA 5I0YA 1N64H 1ERNA 3FHAA 4G80A 4EXKA 3OX8A 3RWFA 3U79A 5E5RB 4EVNA 2G3ZA 5I8EB 4KHTL 3OLDA 5BXFA 5HHOB 3PFUA 4FQQB 1J1OL 4PFEA 4F7PB 3VNZA 1M9SA 4I0CC 1BREA 2R0LH 2WWKO 2QVMA 4OLWH 3ABKB 4RCAA 4X6DE 2CGRL 4F2ME 2Z35A 1G9NL 4RRPA 4ZUVA 3PABA 5FCUH 3KPOA 1FL6A 1YVLA 3B6SB 3QG6A 3APDA 2EUXA 2IFFH 3K1DA 1FGNH 1NC2A 4WRLA 3T8MA 5EPMA 4HCRH 5FYKE 4H25B 4WI0B 5BMFL 1WC7B 4U6VH 2A5UA 1EH9A 2DM4A 4GEIA 4EUPH 5L4MA 2XV0A 1LJMA 1OO2A 3KPRB 1AMYA 4M3KB 2P5EE 1FF5A 2KERA 2AKRB 3BKJH 5FFOA 2PKDA 1CTOA 2PCFB 2IDSA 3GS4A 4N2LA 3T1FB 1GS7A 2IWFA 2QVIA 3X1BA 1V3MA 1THCA 5T3ZL 3ZJAA 4KZEL 2C4XA 4G6JH 3WV0A 2RQ8A 2E7HA 2IAMB 3EUUA 5GGTA 1E4HA 1FVCA 2O6PA 4HKXA 4I1NB 4NFBA 1U9KA 4UAOC 5EBGA 1AO7D 4H5SB 2GSGB 1RUPH 2EEDA 3LCYA 4AW7A 3H9SD 7PCYA 5HHMB 3JXAA 2CIKB 4WW2F 2VJ8A 4DP8X 4D9LH 4I0PB 4ZUTA 5F1OB 4J6IA 1Q1PA 3PWNB 5ANME 3SQOL 4M6AA 3CGTA 5AOKA 4I18C 5JUEH 1MI5D 2Q3XA 4E9TA 4W9HC 1ML0A 4QRRD 1AQDA 5DD3H 4X5XA 5DXWA 5C0BE 3RWIB 3GK8L 4MJHA 3UTPD 2FWSA 4XE0A 5JR1L 3OL2A 4LO9A 1FORH 2IEPA 2QEJA 4FQLL 4WKZB 3WEXA 1R33A 5IROC 1JJUA 1J5IA 2YSSA 1SUJA 4PJ9B 4N8PA 3D85A 3P73B 1MQKH 1PBYA 3APFA 3KYNB 4UOW1 1A6VL 2XCMC 4GUOA 3ATDA 2X1OA 2V9QA 4OLVL 3A21A 4ZPVB 1RURH 1JGUL 4N0YH 3D4ZA 1CDJA 3FYIB 3WMPA 5JXEA 1ZTXL 3DOIA 4OZHB 2VXSH 2P7TA 3FSVA 2JSFA 1U0QA 2Z91A 5K69A 5JIDA 4MXQC 5DJ2B 5AZEH 5LNEA 1MRDL 3D0VA 3JV0A 3MLTB 3TZVB 4Y89A 3F8UB 2DQUH 3DK2A 3L2MA 4OCRH 2VNCA 4G7YH 3QNFA 3TJHC 1JZFA 1HNFA 1BDYA 3WTVA 3HS8A 4PRAA 2I5YL 1S78C 1NCCL 5J5EA 2F8OA 5KSVA 5EEWA 2WWMC 2ZOOA 4K8RD 3NFNA 3FFCB 3BSZA 5CD5C 5EDSA 4JY6A 5J12C 5MP6H 3RVUC 4QKXB 4MD5B 3DLQR 1C5BH 3TO2B 5HPMA 3BUIA 3EFOA 2VH5H 5BMFH 5D2LF 4NP4H 3N55A 1GYCA 4PJEA 2Z1PA 4G7YL 1MEXH 4PJ9A 4L3AA 1AG6A 2CUMA 2IBZX 4LHUB 4NZJA 3TO4A 3ZKSD 4WWNA 1QW9A 4A6YB 3VFOB 4TQIA 2A3TA 2J20A 2NZ9D 3RY5A 2AP2A 1XF1A 1ZVYA 2DWEB 1CD1A 1KG0B 3DRTA 3HKFA 3BWAA 1MFEL 5CWSA 1NQBA 4M62H 1H5BA 3RWIA 5IVXF 1SXSA 3WEOA 3FULA 2GFBB 2AJYL 3D2UA 1XF2B 1HNGA 4CGTA 3RPIB 3SOTA 4L9LC 2QT6A 2R59A 2Y5TB 1Y6NR 5DTFA 5DVMA 3MBWA 3KCWA 3MRKA 1WAAE 1HILA 2EXWC 4OZIB 3RFZB 3RQ3A 1LL1A 2F53D 4K7PL 2C9VA 3P3YA 2LHAA 5KSAB 5FFLA 3DROA 4G8IB 1CGYA 5EZJA 1QFPA 2CXGA 4W4OA 2BP5M 2C4FT 2Y1ZA 4O2EB 3SN6N 3ECBB 2X6UA 4N0UA 3WG7B 5KS9B 2CXKA 2WN3A 1FVCB 5LWYH 3MGOA 4E41E 4BH8A 5BO1H 3QJZA 5IFJB 4NQXA 2Q7NA 4D9LL 1DQLH 2RA1A 1DLHB 4NC1C 3QISA 3B83A 1QBLH 4X5QA 3WXWL 4Y5XC 1CT8B 1S7SA 1TTRA 3LPPA 3DX7B 3ZDYF 2OX5B 2ZWYA 2KKQA 3DHUA 2G30A 1WITA 5D2LB 1DHKA 4U3XA 3FU6A 5D1QB 2GBUA 3O6FC 3QEUB 2F5BL 3MDJA 4PJ8C 3N0PB 2DQJH 2VDQB 4K3EL 1CF8H 1OAZL 3WLWC 3JWOL 3AREA 4PJXB 4RFOH 4HLEA 4YNYB 3ZHLA 2G3XA 2CNZA 3BUBA 4JKPH 3SKUD 1NC2B 2R4SH 2VAAA 4BK8A 2ZX9A 4IBZA 2DI8A 3ZLQC 4YL9A 4M1CD 1IU1A 3C09C 3FUNA 4YFLI 3L5XH 5EZOL 5GSRB 4AQEB 3FTWA 1KLUA 3OLIA 4PMEA 5DUBB 2EDRA 3C5ZD 4OTXL 1BOGB 3GXUB 1ZLWH 5I1DB 1G1YA 2FLBT 2UZYB 3R7QA 1FNAA 2VRKA 4K3EH 5I6OA 1E27B 1NMCB 5I23A 2ATPB 3L3IA 3PAUA 5JHBA 2YPLD 1FDLL 2XUWA 1RIHL 2NY5L 2PPEA 2W0FB 3DPBA 3KBFA 1CGSL 1T0MA 3NJMA 4R26L 5EULV 5CAYB 1U95B 5JHDD 3FFDA 5T5FA 3RFRA 1JAEA 3FO0L 2FL5A 2H45A 4K0OA 4PCSA 5JW4N 1CMOA 4M5ZH 1KZYA 4P2OA 5FV1L 3MRDA 1XR8B 1BCIA 3QUZB 1MWOA 1ZVNA 3ATFA 2P26A 4QLRA 3RNKA 1KJMA 5C9KA 2BXZA 2JE8A 1B88A 3VXRD 3HS9A 1DVFD 2EC9U 5IW3A 3R1GH 2X10A 1E90A 4IQHA 4Y2OB 3WIHH 3RWCA 1KZQA 2YGQA 4Z3HA 5DK3A 4J6RH 3VA2C 3MJ8A 1E6OL 2AZUA 4U1HB 4J27A 2H3XC 2H2PD 2PWFA 3CLWA 3HCVA 4Y16A 1GVIA 3LB6D 3WN6A 4LT7A 4ZO9A 5GGUA 1GRWA 3GRWH 3LRSB 2G75B 2IXQA 5KBPA 2ZOLA 4O2CB 4F7EB 3ARRA 5FV2A 4PUBL 5FM4A 4ANKA 3NP4A 1CBJA 4WLCA 5IW1B 4AV0A 1AD0A 3NEOA 4HZLA 4GI8A 3QJOA 3RJOA 5AVSB 2AGJH 1O9VA 4HIHB 1QLFB 4GMTL 1TVBA 1FP5A 5D71H 5IUCA 5FDWB 1H6UA 2OR9H 2A99A 2Q5BA 4JRXE 5D1XD 5C0ND 4FJ6A 4PREA 2I26N 2HPTA 5CFAA 5ISZD 4XP4L 1CLCA 3CCHA 5AB9A 2LU4A 2FIRT 1B9ZA 3D06A 4PVMA 3L3KA 4HZAA 2JB5L 3VFUB 2VL4A 3ZHKA 4DGVL 1HHHB 2DD8H 2EDHA 5AUMB 3U4KA 4CSPA 1WPCA 3AG3B 4HPOL 3IFLH 2WINB 4HS3A 3VXNA 2CBQA 3LKSB 2HLEB 4ES9A 1MJ8L 4L5FH 2AK4D 3Q01A 1WDAA 2GK2A 2I7OA 1U8IA 1MJUL 2JCCA 1GJIA 3GSXA 4HULB 5J1AA 5KOMC 1OHQA 2OCFD 2NOYA 5CJBA 2XN9B 4L4VD 4GI9A 3ABGA 4FQIH 1YY9D 3LKRB 4HF5H 4NGHH 4OZGF 5DT1H 5LHDA 1OOAA 2A83A 4Y1AA 1MCBA 2FBRA 4FEIA 2FE0A 5FC9A 3ZR6A 2G2RA 3S6CA 5ANHA 5DJYA 4ZK8A 1M4KA 1NCWL 4M4RB 3WEBA 2X2UA 4DO4A 3EAKA 1F97A 5C08A 1NKRA 3ZTNH 3MNDA 4NO3A 3VD0A 2EKSA 1S9VA 2JNZA 1EUUA 3BVVA 4GPVA 1HS6A 5EEVA 2WB7A 3V4PB 2RAMA 2Q6WB 1SYVB 5T5FL 4BA0A 1FG2A 2VWEC 5DRNB 4ZW8A 3UERA 5HHPA 4Z7UA 2J8HA 2PTTB 3V7AG 3N06B 4J3OG 3SDCA 3VCLB 1D5ZA 4UANA 1PPIA 3IDIB 3P4NB 3L2NA 1BGXL 4QAMB 4PYHA 2ED8A 1KC5H 4XRCB 4Y1TA 1R5IB 1UG9A 1T89A 3UC0H 3F12A 4HG4J 5C3IA 2ZXAA 3CFKA 3A0OA 1FFOA 4P3WA 4FN0A 5HHMD 5DYOB 2BNQD 1X5HA 4OCSL 4F92B 2J1KA 3B7UX 2WB1A 1RURL 5FHBL 2YARA 4NRYA 4EDWH 4O02H 2WGXA 3DK0A 4URKA 5GZOD 1OLZA 4EI5D 3SKJL 5C71A 4ELKA 3S37H 1MCJA 3V4UH 1F4AA 5AAPA 5L8LB 5CN3A 5IFAH 1PCSA 4I13B 4R9HA 4GSUA 4XMZA 1F90H 3RIAK 1WE5A 5DYOA 4UT6A 4YWGH 4B9CA 5FO8B 2ZUQB 4WEEA 5ESVB 3QUMA 3J07A 3NIFF 2QMKA 3BQUA 3SKOA 4H0LC 5AAWC 5J1TC 4XRCA 4JK0D 4PJGA 1FLTX 2J1WA 1QZNA 3IVKB 2VM4A 4HC1A 4IBUA 1XDTT 1Z9MA 3UDWC 4Z7UB 4XVOA 1NCJA 2ZUWA 3DX4A 4J8RB 5GZNC 5L9DL 4TSAH 1TZGL 4UIMA 3TFKD 1J0YA 3ZKMC 3RB7A 2Q6WA 3ZE0F 1RZ7L 5I1IL 5DO2D 1T7VA 2AXFB 4ZTPH 4LSRL 3QS3A 1MNUH 4PV1C 3SZKC 3HBGA 1OY3B 3L95B 4L18A 4AK2A 2OYKA 1JCKA 5I75B 4HD5A 1XF4B 1DVFA 4X6EA 1K8IB 4KK6C 5LXGL 4JCLA 2A6IB 2OTUA 4NQCD 2NY0C 3FB8B 4WI6A 3PG2A 2IDUA 3N1GC 4NKDA 3OR7B 1KCSL 4ACTA 3QUXA 3LQZB 1RH8A 5SWZB 2FX8L 4AI7A 3S34H 2EE6A 3SBQA 2WVVA 4NKIL 5B38G 3IKCA 2R56H 4FHBD 3KLDA 1G5AA 1FNHA 5AAMA 4YSEA 4X7CC 2XZQH 1Q0XL 2CIIA 4W9IC 1Q0YH 1B0WA 5CCHE 4KY2A 4BINA 3M1BA 4MZ3A 3CWGA 3V0WH 4QF1A 3K8MA 2BOCB 1DQDH 4NKIH 3MREA 5AUMA 3SE6A 4AVJA 1M6UA 3ARTA 3APCA 1AXSB 1W0YT 1G5GA 3OVUB 3F7KA 2KBGA 4PGCA 3RTLA 3APMA 1O6TA 3UZQA 5CBAB 1U92A 5EIIB 1IAII 4AGPA 1NC4A 5AG8A 3B37A 4TM9A 3WY1A 1QATA 3BPLB 4RMWA 5IMKA 1MFCH 4NQDE 1I85C 2PWHA 4KGJA 3L7EA 5GRJL 3SE3C 1RUQH 1TVBB 1FYTE 1ZOXA 5DZOA 2O5ZL 2QGDA 3OLEA 1FNGB 4G9FD 3UADA 1I8LC 4MJIE 3OZ9L 5JW5B 4U6YB 1Q9KA 4DGIL 4OLUL 5IUSA 3WJMA 1JPSL 5I16A 1SY6A 1FBIH 1P7QA 2IANA 1AHMA 4PJ7A 3M17A 2K6ZA 2Y2WA 3L5HA 1HINH 2E59A 3JWNC 3IPBA 3Q6FA 3RWJB 4X7TA 4M1DL 3NAAL 1S46A 4QCIB 2WTRB 3G5XA 4AM0A 2NX5E 2ODHA 4NKMA 4Z77A 1RPKA 2VLLB 1BZDA 4LOFA 4E2OA 3L3DA 5CP7A 3TPKA 1AIFA 4NUGL 2RMNA 5G2NA 1Q8MA 1LLAA 4TULL 2MCG1 4ANWA 2HMIC 3D51A 1LWJA 4F7TA 1Y0LA 5I8CA 3CNKA 1JP5A 1KCKA 4AJ0A 3P30H 5FLUA 2EZ0D 4JN2A 5IEKA 4TNGA 3PV6B 5KBLA 1D7FA 1A6AB 2EDTA 3VRJB 1A6TA 1IMHC 1BIIA 5DQDH 1GYVA 2ENQA 4G6AC 4G8GE 5EIVA 3VFPA 4JFXB 4JY4B 4O9HH 4Z7UE 5JPMB 4D94A 1HHGA 2ENJA 1JF6A 4LAQH 2Q2EB 3PNWA 2BHYA 4TNEA 4GKNB 1Z9LA 4KNUA 4LVHC 5H94A 1UD6A 3UYRL 2AK1L 1WISA 4YDVB 4KXCA 4HKJA 5KVDH 3ZKXC 2H26B 1G6RH 1OTSC 3BUYA 3L4CA 5JHLL 1OAUH 1GOGA 2QLYA 2H32A 3NK3A 2WBJD 4XCNB 2D0FA 1X5KA 2OAAA 3MUJA 5FGCE 4EOWL 4LQ1A 4JFVA 4YC2B 3CFEA 1EFXB 3UEQA 5HYFA 1E28A 1LWHA 3V4VB 5I6PA 5AW5B 3FU9A 4K3DL 4N9GA 1JFQH 5JPMC 4G7QB 5CIPH 3R1GL 4GBXD 1A2YA 4NI6A 5D7IA 5C6TL 5KYXA 1ILUA 5BO0D 1XF5A 4Y9CA 3OD3A 2BIQA 3CXDL 3QRBA 1A6WH 3MRFA 5CEZD 3KS0H 2G5UA 1L9TA 3ISYA 2KH2B 3S5ZA 3WDHA 1UB5B 3I74A 4S1RH 1BQHG 4YUEL 1DDTA 3PWJB 4OZIA 3OZ9H 4W81A 4CSTA 1OM3L 2JQAA 4BE6A 5DTFB 4OF6A 4XPBL 3THML 3EDDA 3WL9B 4J23A 3QXAA 1JPFB 3S7GA 4MVBD 3KBPA 4F8TA 3WI9A 4Z7QB 5DVKA 2YN3A 1NGWA 1TZ8A 5LVEA 1IJNA 3DRTB 4KMQA 2R1XA 1I8KB 2YD4A 3B56A 2R9HC 4AXWA 4KITB 3FT9A 1HI6B 1QVOB 3FT3B 4WI4A 2FGZA 5FB8A 1IC5L 2VR7A 4XPBH 3WYRA 1EJOL 3D33A 4PV9A 1IIKA 2P5EB 3MV8B 3GLEA 1PZ2A 1KXVA 3IJYA 2CDFB 2HKFL 3QFJA 1UHVA 4KTEH 4JJHA 1N19A 5F7UA 5CZXD 5LKNA 4IBLT 2W9EL 1A3LL 1L3NA 3FTYA 1MHCB 3L5JA 2GBTA 5BUAA 1CK0H 1MHHB 3KYMB 2PF6A 3LB6C 1LP9E 2F6AA 2VKWA 4AYBA 2C1PA 4AEHH 1KJVB 4V1DB 2KQNA 5KJRL 4TRPH 2DTMH 1WZKA 3U4AA 5IY5B 1U41A 3QH3A 3RWDA 4L3CB 5HJ3B 2HN7A 5E94A 5ICYB 3ZQWA 3GMQA 1FFNA 4N2MA 1GTFA 3MA9L 1NGZA 2AI0L 3N3EA 5CXPA 4EIUA 1BZ8A 5BS0B 1GA2A 1UXWB 5HTSA 2HG5A 3D85B 3HB3C 2KZWA 2WM0A 4ELMB 1G4RA 4S2SA 4CU7A 3C5SA 4KVCL 3MZGB 2XRAL 5F7EL 1FAIH 4ZQKA 3SDXB 2VDQH 4M6OH 5C09D 3D9AH 4JM2C 1AS8A 1VGEH 4EUPB 2YPLB 2CO6A 5E95B 2OMVB 1XZ0A 1ES0B 2VO8A 4PP1D 3P3TA 4C59B 1DUYB 1JMXA 2XPGA 4J3WA 3C5JB 2GTZA 3C5ZB 3D50A 5CMAB 1KLGA 3FBKA 3JV6B 5LAXA 1KXQE 4ZUTB 3PF2A 3QRGH 2DQHL 3RL1B 4U1SB 1Q72L 3MRCB 4YHLH 3BWUF 3GMNB 4L4TD 1UB6B 3AUWB 3V5KA 3FMGH 3PXJA 2YEZB 2CKBH 3HN8A 3U30B 4GSQA 1AHKA 4P8QA 5IW6B 5D1ZA 1TZIB 2A6DA 5GGSY 2VN4A 4NLHA 3MRHA 1IQDA 3D0AA 1S8DA 5DI8A 4IGBA 5K9QI 3T3ME 1M1XB 3T0XA 1DJWA 1MF2H 1RZ8B 5DZVA 4DPCX 2C3VB 5GS0H 4X8JB 1ASQA 3WY4A 1G1OA 1ZT1B 3CMGA 3W38A 3IMBA 4F93B 5IMMA 1NFDF 2XXGA 3E1F1 5DLLA 4N2HA 2V5SA 2B1HL 1MFMA 1I7UB 2VIRA 4HSQA 5DQJA 3WHE1 2EVGA 4L29B 2DYPB 5DFVD 3EXJA 4OIFA 5F88B 3HZYA 1E8YA 2ITCA 2X2HA 4J1UB 2VKXA 2DIBA 3ZVVA 2DH2A 1GTNA 3NH7L 1INQA 3THMH 4I3GA 4F3FA 4PJEF 3VVVA 5EO0A 4XMLH 4Y4KC 2QGEA 1FO0A 1VFMA 2IJ0C 1NBCA 1AD9A 1Q90A 1FIEA 1I9JL 1RJZA 2PR4L 4BDVB 2G0KA 5E2UL 1NDTA 1QEWA 4GP4B 4BZ1A 3G6AB 5E6ID 2ENSA 5C08E 4UAHA 2R8SH 4AKPA 1B3IA 4I3SH 3D30A 5F7BA 5I8EA 5KS9F 2EIMB 2PCXA 3E9TA 1G84A 4PQXA 1GJWA 1CXHA 1E3FA 3QIWA 1ZA6A 2Q7YA 3QQDB 1ZLEA 2H0PA 4Y2LA 1GGIL 4D0CA 3QORC 3IRCA 3U46A 1J48A 1ZTXH 5B3JE 4WO4B 2VXQL 4OD1L 4F7CA 2H1XA 5CLZA 3GSWB 3KWUA 4EI5A 2FEEL 4K7FA 4WVRA 3BVUA 1TTBA 3V4VL 4BCYA 3MUGA 3BQUC 5GISH 3K6FA 4NHUA 4HU8A 2ZF8A 4XNUH 4L1TA 1D5IL 2P45B 3SJVB 3TZVD 1UUSA 2OKMA 5GS1B 2GIXA 4RNRB 4LAJH 3U36A 4AIZB 5I76B 5L6YL 3TH4T 3HB3B 2LE9A 1UFUA 2IPTL 4I48B 2X3BA 1U8OA 2XIIA 4HJIA 4WTXA 2OMWA 3ELQA 3TBYB 3ARBC 2YD6A 5DGQA 3D18B 2NY3D 3UTTA 4WGKA 3BIBX 1YHPA 4Z7NE 1UVQA 3MLRL 5IQNA 2X6AA 5LBVA 5C7XH 2W95A 1JNHA 1SEQL 1L0PA 1GAFL 2CLVB 4JPWL 2R0LL 4FTDA 5FYJE 4X6DF 2CGRH 4BUQA 4E5XG 1T20B 4M8UA 4H20H 3QR1A 1WJ3A 1BEXA 1HINL 1X7TA 2DWSA 1DLFL 4IDLA 3FJTA 1TFPA 2APWA 3V4PH 4ILDA 3ULAB 3E2HB 2ITFA 2KDGA 5HHOD 4B9IA 4GUCA 2XA3A 3K0WA 2E6JA 1KBGH 1ZT7B 1S9YB 5EDXA 5B7EA 4JRYA 4ODXB 1QWHA 2BNRA 1NAMA 2DQCL 2ZXGA 4TKWA 5ALCL 4BFEA 6TAAA 4C55A 3MOBL 3FPXA 4NJAH 3BO8B 3QQ3A 4Q9QL 5J9PB 1E30A 1H6EA 4QRRE 2KQMA 3VAEA 4EIZC 5ESQA 1R3IL 3NDZE 4J3OH 1DVSA 4PB0L 1L0XA 2Y9RT 4GMTH 4NQED 2IVFC 3ZXAC 2F1EA 5I26A 1GHFL 1H15B 5B1JC 4MAYC 4OCLC 4RSVA 4G8GA 3UPCA 1QA9A 4KZDH 2TRHA 3PPEA 1SHWA 1GGBH 2JCCE 4OLWL 3UCQA 5DVLA 4IK7A 4XWGL 1OP3K 5GHWH 1ADQL 3B5GA 5D5MB 1UT2A 2FHCA 35C8L 3TIDA 2WBJA 4X6DA 4YXKH 2Z7YA 5TE6L 5MHSD 5J6HA 2P1YA 1SHMA 3ARPA 4R2GD 3QEQB 4PRIA 5DWPA 2EXWD 2ZSVA 3I02A 4XH2A 4XWOC 4PD4J 1JF1A 1IGYA 4G9FA 3GBEA 1I3UA 1RJYA 3EJZC 4NEHB 4LE8A 1NEZG 5ID1B 5HVFB 1NCDH 3BJ91 3EDEA 1S9XB 4BJLA 2A6JA 3PAZA 3W39B 3OAYH 1L9PA 1G1CA 1LDSA 3BKML 4KI5C 1E4XH 2UY7B 1RVFL 5C7ZA 1FJ1A 1BQSA 3KNBA 5TDOA 2DQEL 5I1CH 3X11A 5EBWA 4PRPA 2CO7B 4HK3J 4NWTH 3OKKA 4O58H 2R69A 4AYEC 4X83A 3QO1B 2ICWB 4BZ2A 4EF3A 5FUCE 5HHVH 2V2WA 2OS7A 1I9IL 2WGNB 1P2CA 1R4XA 4H8WH 3WGVB 1QFWI 4KKPA 4F2MB 1HE8A 4UU9A 5ID1A 4NUGH 3MMEB 5SWSB 4CVUA 4JQVA 1PYWB 5MENA 3P3UA 1IGYB 3IAGC 3VI4F 3KGTA 4BA8A 2ZSVB 3I02B 4L23A 3QQ9C 1GPOL 2B14A 3H42H 4QY8B 4XO9A 3BCDA 3PL6C 5DRWB 2ERJB 3L3GA 4PJAF 3S2AA 2PO6C 2MWCA 3BZ4B 4AITA 5CR8A 1I1CA 1HQ4A 2IMNA 2ZTBA 3HBQA 3M86A 4WWPA 3X3FH 1N5YH 3LHPH 1ETZB 4U7MA 3VTAA 3A4FA 4NRXB 3QEQD 1IB5A 4GSDL 3WFZA 4C58B 4JUTA 1OGTB 1YJDL 4RAVA 4XTRD 5HGHA 1HXMB 2WMPA 2YQBA 3GSOA 3SGDH 2ICES 2PMZA 2Y3AA 3HC4L 1QRNE 3V4UL 4ZFOA 2QVFB 1WWWX 3BGFB 3JTTB 3K4AA 5HDQH 4JFDB 1GYUA 3HPLA 2MTAA 3IFLL 3PDOA 4YHLL 1WAEA 1X6NA 2L8AA 3E8UH 5GQBA 1XH3A 4GEJA 3IFNH 5IWLC 3O41B 4OZFA 4K8RL 1GJUA 2AVGA 4YZWA 3P9LA 3CFMA 2K45A 4PUBH 2JELL 4QTIH 1U3HD 2BVOA 4L8BB 4PJCA 5DURD 2RTTA 3CE1A 4LFHD 4ODUA 1PSKH 2V17L 3KG5A 4XXCC 2QADC 2X7LA 4ZW5A 1FFPA 4HF5L 3L3JA 4KY1H 2ROYA 2E46A 3P11H 3RHWF 3MI6A 4HCIA 4HIIB 4EKJA 3I75A 4U3HA 4CA4A 2VLKB 3EUDA 4PRNB 1U8CB 2WAHA 3QWRA 4XPGH 2NR6A 5F3HA 4NT6B 1U30A 4L4JA 4PJAA 3MODL 4WUUD 3VFNB 2MEJB 3H2WA 1ECYA 3M1OA 3DVNB 5DWUL 4PRHA 1DN0A 3H6AA 3QIUC 3GEFA 3Q44A 4XHJC 4XP6L 2FD6L 3MRIB 3DTXA 1DQJA 4FS0A 4TVPE 3O3DA 3L7FA 2PP8A 1LEKA 3ESUF 1PX3A 5GS1A 3DX9A 1DJXA 2AEOA 3BH8A 3CD4A 3UGXA 1DQIA 4PJCF 4R84A 3HR6A 4AYFB 1EO8H 1TSRA 5I1HL 1FDLH 3FAXA 5DK2A 4BXVA 3ZRSA 4ZO6A 3MLUH 5IVOA 3W37A 5GGSB 5KYUB 1N2RB 2IBBA 2NDGA 2NY0B 3CJJA 4O02A 5FOBB 1IGIL 1NLDH 1IC5H 3CH8A 1MF2L 3Q8BA 2VQ1A 1S7VB 4LNVA 4JUSA 1CDYA 3ZKQD 3BT2H 1PEZA 4IMLA 2OFQA 1NINA 4KAQL 3RRQA 2MOQA 5FEBA 4JG0L 3V0HA 2GHZA 2K6YA 3KHQA 3QORB 4WGVB 1YEGH 1FZKA 3OXSA 4DNLA 3ZTNL 1WK0A 3NZSA 1CS6A 1OWRM 4JM4H 3ABMB 1MCPL 5DC0A 4CBPA 5E70A 5T5NF 1EJ8A 3D12B 4HH8A 4KTDL 4XVJH 2IAMC 3H9HA 3U7YH 3OMIB 4JKPL 3GLZA 4S10A 2V9UA 2CK0H 1IT9L 3OKLA 1E4WL 1JPTH 1A5FH 4AQ8A 3LKPB 4DQAA 2I69A 1SOKA 5CEZE 4IOIA 3TS8A 1AD9B 1ZVHA 1HHKB 5AYQA 1FO0B 1UT1A 1TZAA 1DBAL 1MCWW 4F3FB 2WNKA 3WFHA 3N1MC 3PGCB 1TMCB 4KRPD 2ZXDA 2V7NA 3UC0L 3OKDB 1Z9NA 4P04A 1WWAX 4M1DH 3MA9H 2OZ4A 4A67A 2DYPA 4LCWE 2LV4A 4PTUA 3DETD 1EXUB 4XMKH 4R4FL 4AE0A 3Q2NA 4MZIA 5HI3C 1HE7A 1EAPA 1X7SA 5KVMC 1PLCA 4RFEA 3VO0A 1MH5B 1Z5LB 4KKQA 1QRKA 1L6ZA 4YX2H 3GMLA 4N2KA 4I1PA 2DBLL 3HNVH 3LH2L 4YHOH 3CFBB 4HJ0D 2F54A 1F8TL 8PAZA 2FBJL 4HUVA 1F90L 1TFHA 5MEND 1ZHLA 4XNQA 4C57C 2XN1A 3OSVA 5IHLB 3BP7B 3BXNA 1OAUL 3MRHB 3ECWA 4K3GA 4OT1L 4PRPE 4M9PA 3AG4B 5AVZB 1C9SA 1J9CT 5FR3A 4P46D 2Z6FA 4BH7A 4MMYA 3HOGA 2YEZA 1K4CA 3ECQA 1S7TA 3FU3A 4NM4H 2EYTB 3D39D 3OKEB 3OKNB 4DGWC 1BXAA 1Q0YL 4PS3A 3AJ7A 2A1WH 3ZTCC 1MFBH 1G7MB 2AXGA 3KLQA 3FRUB 2XPGB 1UENA 1JWSB 5F1KC 5AZUA 4OT1H 5SV3A 4LBAA 3CG8A 5CJOH 4IHOB 4MNGA 1XGTB 3N41B 4ZZFA 3IN0A 4EUPA 1TETL 3F7YB 3Q8AA 1EHKB 4Y19D 4WW1B 5DHXB 4H88L 1OB1A 3FTVA 3BZ5A 3QARA 2V2XA 1IBFA 2OMTB 3RUGE 4KJYB 3OJMB 4KROC 4XWGH 4GW1B 3CQQA 5BUGA 1UXWA 1EHLL 2A1WL 4DP0X 3DSFL 3RB5A 2WWMD 3CC5B 4U05A 4BCXA 3AWGA 3FQRB 4PWIA 2BK8A 5LCVL 5F3BA 3VD4A 2R0ZH 1WBYB 3GI8H 1FYTD 4GQ9L 4PJHF 3VX1A 3QI9B 1A7PH 3RDTC 3SGEI 4EXPX 2VN3A 4FZEL 4NPYB 3LN5B 2R23A 5GGVL 1QNZH 3SPJA 4PI0A 1KC5L 1MPAL 1URIA 2E76C 4V1DA 1TQCB 1DL7L 3FPYA 3MCKB 3DSFH 4KKAD 3MV9E 1JHTB 1NAKL 1JHTA 1U2CA 3FB5A 5LCVH 1JN6B 1A64A 1EJOH 1VDGA 4K94H 5CKAA 1QEXA 3V8OA 3M46A 5ERWB 3FCTA 5CZRA 3LV3A 5D7IF 3D2TA 4BELD 4YDKH 3D69A 3ARBD 3PS6A 1NJ9B 3HC0A 4ONHB 3S36X 4P3DA 4B95C 1K85A 3AROA 4HAGA 4P0DA 4R96B 2PO6A 1UCTA 3WELA 5DVNA 3QZWA 3NSCA 3B7TA 3MV8A 2F58L 3Q2VA 1C7SA 1XMEB 5SWQA 5IFAL 5F3BB 4ONGH 4Z7QF 1XGPA 4H1LG 3CC5A 2JVUA 1YAIA 2P8MA 3RX5A 2CK0L 5BQDA 2BW4A 4TQEH 3VI3F 5L88L 4UZGA 4EI0A 1V55B 1E67A 4NQCE 4QWWD 1NBZB 3OXRB 4KTEL 2FUTA 3HAEH 5BV7L 4WUUB 1JXKA 3F7YA 3L1EA 4ZYKA 1A7RL 2MOVA 5BVJA 3Q43A 2CLRA 4ZSOA 4B6ZA 1F8TH 4OBRA 4LGSB 4URTB 1ZANH 3QNXA 1YN6B 2DQTH 2HVKA 2ZWLT 3Q05A 1SM3H 3UL4A 3U4BL 3OKEA 3OKNA 4NI3A 2VDMB 1RZPA 1J8HD 5DMIL 4IIQA 4WHTB 3JWNH 4X4YA 4XMKL 4P5RA 1KXHA 4BEIA 1DDHB 5LXGH 4FFVD 5T1DL 4GS7C 1LO0L 1OP4A 2P5WD 5T33L 4HWZA 3LZRA 4JREC 5F1NB 3F7RA 3EYUH 5BV7C 4FQXB 4MA7L 3BRDA 1A6ZB 3X3GH 3AS0A 3EGSB 4Y88A 1QUPA 1XCQA 1AFVL 3HS0B 2BRQA 1KCRL 1NMCC 1X5ZA 3FHQA 4JZJB 3A22A 4AG4H 3TXAA 3B9DA 4AVIA 4XN8A 1TQWA 4Z7VA 3OMZA 1EFXA 4R2GB 3MRMB 4RQQB 2CCWA 2XN0A 5CM1A 4JJOA 12E8H 4C56D 4M5ZL 5GRWA 1E5CA 5CSGA 4KI5F 1MFEH 3I2CL 5B1JA 3VXMB 3K71B 2J8OA 2DQCH 4WSGA 2VMCA 3GMRA 4GLRH 4N1EA 3W2DH 2EDNA 4QRUA 4HKJB 2NR6D 2MSPA 3RIKA 4L8SA 2DLFL 5INDB 1X5XA 1SBSH 2F15A 2FB4L 5K9JL 3SBWA 4GKNA 4PRDA 3KW8A 5HXMA 3UAAA 4QRTB 5A3IC 2P28B 1LQSR 4FI6A 4X9FA 2QHRH 3UTOA 4A38A 2ETWA 2X2IA 1LK3L 1AP2A 4ZQTA 4PAZA 4H26B 2Y25A 3C12A 1WSST 2OM5A 4MKMA 4ZPTB 1SJEB 4BKTC 1A6TB 2ESVD 5H37A 2IFFL 4GAJL 3Q9PA 1BFOA 1E9QA 1BVNT 2BOBB 1U58B 1KY6A 4KTYA 5EBMB 5IBTL 5K1VA 1I1YB 4XMPH 3EJJX 4YHMH 4QNPE 2E6QA 5I1AB 1YMMD 4HJGB 1BZ9B 4IMLB 1TNNA 4LKCA 3DXAE 4Y8AA 3N44F 3AWFA 1EQWA 4LPUA 5E2WL 3NJXA 4YSTA 3P69A 1WYJA 1X5IA 3T0DA 2GY7B 4ZSOE 5KAQG 4L0YA 1UZ8B 2JKXA 1ZJAA 3FO1B 3HE6C 3WFCL 3BVTA 3TEWA 2CRIA 1JRHI 2O6CA 1PZUB 2VL5A 4G8FA 3FO9B 1SDAB 5TK4A 1WA2X 2J1XA 3D7PA 4KY1L 4WW2C 3RGVB 2ZONA 2FWLB 2H47C 2OMYB 4K9EC 4QPEA 2WXMA 4TXVB 4EJ1C 1YY9C 1HCYA 3WMQA 4KU1A 2HKHL 3GMOB 5JW5A 1DJGA 4U7SA 3CZFB 3OB0H 5LQBL 1DN0B 3SD2A 4TNWK 2CO3A 2F68X 3QT2A 3SQOH 1CL7L 2BO0A 2NDFA 4B3VA 1A9VA 4H8WL 1MWAH 2YA1A 4OLUH 4DPRA 1OP3H 1P84J 5AQ0A 2I9TA 2X4PB 4OZIF 3DVGA 1ZLUK 3EYUL 3L3JB 5GS2H 1EO7A 1Z9PA 4AJVA 4E68A 1UGKA 3C08L 3HEIB 5KTEH 1FZJB 4J4PD 4FG2A 4H40A 4P59L 2N4IA 1F13A 4M7KL 5JHLH 1OSYA 5FO9B 3QQ4A 2GEQA 2ZKXA 3IFPB 2R15A 2DTML 4JFZH 3CFUA 3BPCA 4RZKA 3N1FC 5EUKA 2Y2YA 4WU7A 3P9MB 5E8NB 3UROR 4DFHA 4TULH 4TVPL 1BAWA 2J2ZB 2O5XH 4L4TE 4E0RB 2XWTA 3B43A 5SWZA 5GRUH 3U2JA 1YDPA 1CD9B 3BZEA 2PABA 4X5RA 4NKDB 4PLJD 2OK0L 2LVCA 1QFHA 3NK4A 3QZOA 3HLAA 1LO5A 1RZJL 4DN3L 4Z7NF 4H44C 1NFDE 1WEJL 2VLJE 3DV6B 3NYKA 4NO2B 3DRQB 2XBZA 3TWYA 3E8UL 3UIYA 4UT9A 3OB0K 5K9KB 2QQLL 2MFNA 4JKKA 2WIIA 4XHQA 3UMNA 4DW2H 1F41A 2EC9T 4D8OA 4YHNB 3KJ4B 4I18B 4XXWC 1T6WA 5TH2B 1E7UA 4X5WB 3IYLW 3L95A 2UZPA 4MMZB 2C7UA 2NYYC 4UZUA 3RIAF 5JA8B 1JPGA 2VC2H 5JORB 4QR7A 3DECA 3POHA 1A22B 3DUUA 4DGVH 1LK2A 4KKCD 4U3SA 1SBSL 2WQRA 4CGUB 3NH7H 5KYWA 3BZ4A 4PB0H 4YWGL 1CFSB 1F11A 4XTRC 5B7FA 5E0QA 4MXWL 1GHFH 3KPNB 2UV3A 2VCOA 3AXHA 4Q2ZB 1F3DH 1ZPLA 2HVBA 1MJJA 3R0MA 1JF5A 3F62A 5A1AA 4RA0C 4G2AA 3HHSA 5FUCC 1GR7A 3WKMH 1FV1A 2O6DA 1NUGA 3OF6A 4G7RB 2OP4L 4ODVL 4P48A 3T09A 4FMKA 4C56A 2HT2D 2ZUQC 1TKWA 3QHZL 5IEHA 4I9WE 1PZ5B 1T4KA 3TV3H 5CGBA 3ALPA 4BFNA 3MRLA 4ISVB 4R4NC 2W88A 1WZMA 3K4DA 7PAZA 4MMXA 1BVLB 1KN2H 1RQ5A 2OJEA 1CC3A 2YR3A 3MJ6A 2LU5A 4FQXD 4XAKE 4YK4B 4V1DE 2ZD0A 3WENA 4OM1H 3ARDD 1L7IL 3BDXA 1YEKL 3CDZA 3HG0A 5DDHB 3X14A 5IFHL 1KIQB 3G08A 3PGDA 3FQUA 1I9RH 4LCUB 1MFBL 2DRUA 4OJYA 1VB9A 1PY9A 2XTJB 1QLRA 1GKOA 1CB4A 2C9PA 4KFMA 5D5MF 2DQMA 2UZIL 4KXBA 4HUKB 3W9EB 5D1XA 2KHAA 3V4PA 1JYVA 5EF3A 5FAAA 5J6HB 2BP8A 3AGWA 5JHDE 3WS3A 2FATH 3S35X 4NO3B 3QEHB 4OFDA 1I9RL 5JZ7C 1CR9H 4KV5E 4FKHA 5D1QD 3TV8A 4HJJL 1IFHL 4PJIB 4J3VA 2AJ3A 5FA4B 2VDPH 1A7OL 3FN0H 5IVNA 4UV7H 3MOQA 1RZFL 1SXCA 1VENA 3LEVH 5CINL 2VXQH 2NY2D 2DYPD 1AY1L 3MRPA 4OCWH 2JTDA 3MV7D 3SBPA 5ELIA 4M7LT 3HLAB 2CDGB 3II2A 2ITEA 3WIHL 2DQIL 3VXTA 2UUDH 1T66C 3KVQA 1YDPB 3CFDA 3HE6D 4PS4L 5AVVB 4GAYB 2BNRB 3MFFA 4UM9D 1V05A 4PRHE 3HG1E 1GPOH 2HVJB 4W9GC 3FB6A 3PWPB 5HVHC 4QRPE 5CS7A 2NZ1A 3W57A 3SCMD 5AB0A 3L4ZA 3HNVL 3LH2H 4YHOL 2B8OT 3GSNB 4C8XA 1E50A 1IBHA 3NIFE 3QEGH 3SB3A 5C09B 3VXQB 4FQJH 2N59A 4G43A 1NDMA 3OKOB 2IALB 3ISRA 4JG9A 2I9TB 4PS8A 3FCBA 3Q5OA 4R5VA 5D6CB 5FDWA 3UAJC 1ORQB 4WU5B 3JTSA 3RDTD 1U8PB 1QSEA 2FO1A 4HZLB 2IADB 1NM9A 2XVGA 1BWWA 3KGUA 4PRID 4KX9A 1E6JL 3V9CA 4CAGA 2V17H 3WFBL 2Z92B 4WWKA 3F2LA 2ZOLB 4O2CA 4F7EA 3WEMA 4YHIB 4K4KA 1TTGA 1TJHL 4E9YA 1NZRA 4W9CC 1KT2B 2BWDA 2UWEA 3OMAB 3G7TA 3U36B 4AYID 3FT0A 3GS0A 3CVCA 5E4AA 5C0AD 4YDIL 1MCCA 5JW3L 2AEWA 2V37A 4B9FA 1JDCA 1T1YB 4FXKA 1F86A 2AZAA 2FH6A 1T0PB 2VMEA 2X53A 2J56A 2VRAA 1TCRB 4M5TA 4RWHA 2WUCL 5CZVL 4I77L 2MIZA 1CFQA 5JDSA 4QT5B 4CU6A 2YXMA 3X12B 5AKSA 1RLBA 5DD1L 4BFRA 4RMTA 3U46B 3S8GB 1ZVSB 1URLA 4ZMVA 3TNMB 4GXUN 5T3XH 3UZVB 3K6SB 4P2OB 3QNYA 1ZA6B 3QQDA 2IQ9L 4GXUM 5E5MA 1GGBL 3QIWB 4KO9A 1CO1A 2BHFA 2E7MA 5TQ2H 3SKNA 3QUZC 3U4EB 5A16A 2ZZUT 1RFDL 1IGML 4N5UA 4UT7L 1N59A 4ZRGA 3N85H 3QI9C 3VDCA 3AY2A 2XWCA 4LCVA 5DEGB 4LL1A 1HESA 3MNWB 3LZNA 3QRLA 1H6TA 5F0PB 3O6KH 2ORBL 1BLNA 3MLXH 1IC4H 4HS8H 5JIKA 4QD2E 1PD0A 1AO7E 4FFWD 1D6EB 4HJUA 2XG5A 3T3PE 1ROCA 2DQJL 2ZWSA 1OE3A 3ALXA 3RKDC 2VSMB 1FI8C 3STLA 4A2MA 1T2QH 1UEYA 2QLVB 1WWBX 2UZXB 2NQ3A 5DEGA 4H8PA 3SPGA 3V6OA 2Z0BA 3VQMA 2E8YA 2EDFA 1F58H 1Z0MA 1RUML 2B9BA 4ZTOH 4B50A 3L5XL 2B59B 4XCYA 4V33A 4F27A 4UOZA 4O51B 3VFSB 4D9RE 4DP1X 3TNMA 1ZV5A 1RZFH 3HPJA 1C5DA 3MLVH 2DQFA 3NJGA 4KKAC 3DURA 4XZ4A 4JFYB 1G7PB 4K3JH 5FM8A 4DKFL 4ZODA 43CAB 5IKCB 3PY9A 3V7MA 3TTSA 2XVLA 1MI5E 1DLHA 3BKYL 1LM8V 1BF5A 5F7HA 5EEXA 1J9RA 1RUMH 1QOKA 1JGVL 2AJZA 3HE6B 4QHLB 3QQXA 3ECBA 2WBWB 4KK5D 1IQDB 3CFNA 3VRLF 3PDGA 1TVHB 5HYEA 2XIBA 5DRXA 5GIRA 4OLVH 3ZSSA 5IW6A 1SF5A 2L7QA 3QW9A 1IV8A 4MCZB 5AZ2L 3AU0A 5KVFE 4W4NA 3OR6A 4EI6A 2F2HA 3TN0B 4BQBA 2NZIA 1OAQL 1SFHA 3T6VA 3WAKA 3N04A 3EGDB 4PRPD 3C5ZA 3UG3A 1G7QB 1U8PA 2LTQB 4GI6A 3KPLA 2G4EA 3AG2B 1TLMA 4IRZA 4X98A 1ES0A 3A4EA 3SD5A 1F6LL 3S5LG 3C8HA 1JGDA 2BVPB 1P1ZB 5DF0A 3UP6A 4LHUG 4UM8B 4KKZA 1ZHKA 5FO7A 4H4NA 3R18A 5DEFA 4J28A 2F18A 4I0KA 2IF7A 4H20L 4MD5A 3EH2A 2G3NA 3QCVL 3REWB 3FB6B 3PWPA 4F7KA 2GJZA 2ZAIA 4NHCH 2FR4B 5GRYA 1TJHH 2WLLA 1W6LA 2BSEA 4IIZA 5KZCB 3LH9A 2F08A 2VZ1A 5AWNH 4OGYH 4PW3A 2WCGA 4OCNC 4HLJA 3WHXB 2QVTA 1HQRA 1P7KB 4TL4A 1IGMH 3GHEL 4TTDD 4UT7H 4QI3A 5JQ6H 2NXZB 5EOCH 1IGFH 3D0VB 4BFFA 1T6VN 2GAZA 5J06A 4Y16D 1N3NB 4DQOL 1NCBH 2OXHB 3D08A 3BRFA 1NGQH 2BERA 1BYPA 3QRGL 1WEJH 2DPKA 3UDWA 1KACB 4XI5C 4KOCA 2R23B 1H3WM 2W60B 4KAQH 4Z18A 1W72H 2YC1B 4IBSA 4Q52A 4Z7OE 1YEKH 2CKBB 2R83A 2ZXEB 3HI5H 4MS8D 3IU4H 4P4RA 4RGNB 3IJYB 3QI9A 3HN3A 1IGFL 4KZDL 5JIIA 1XD0A 3P73A 3O3EA 3VTMA 4L3FA 4ANUA 3V0FA 3NACH 3QZWG 3M7OA 3PHAA 1E8ZA 2VISA 3WEXB 5BRZE 3C8KB 5GS0L 3HHMA 1MUJB 3WXWH 4GW1A 4PJ9C 5E6SB 3F7QA 3QWNA 1W72L 3NESA 1GKEA 3IBOA 5K33A 4WW1A 1P1ZA 1JGDB 3T1WA 1T03L 1UOKA 4OW6A 1DBMH 4KNTA 4N24A 1GS6X 2FX7H 5F7AA 3WL9A 5EU6B 1JUFA 2XTLA 3II1A 4NQSA 2AMGA 2ZOKA 5DS2A 3EGDA 3CDZB 3X14B 2CIKA 3OMNB 4I0PC 3TGXA 5CU9A 5CEYB 1BVLA 2OJEB 3OAUL 4MCZA 4GBXA 3TV3L 4FG6D 2UXVA 3DVIA 1XF5B 4JFEA 4EZKA 3E2HC 2X5PA 4XPHL 4FMVA 4UAOB 4B5ZA 4IU3B 5JOPD 3ARGC 3TA3B 1IFRA 1OAKH 4QHLA 3S5YA 2ZOWA 4OCSH 4NQVA 5IK3B 8FABA 2FHBA 4KH2A 3ZRFC 4N1CA 2RFXB 1M53A 3PWUB 4V2CB 3ZYZA 4QGTA 3OV6A 1N6QL 3BUQA 1RHHA 3KPNA 3H3PH 3OHXA 1I85A 4ZAKD 5ESAA 3L4WA 3GSQA 4I4WA 4ZO8A 2EYRA 5I8OL 4GO6B 1M2VB 2UZIH 5ISZE 3TJEL 2X12A 5KYWB 2QMJA 1U6AH 1WD9A 4KRPC 5IVXA 4FLQA 4Z8FL 4XN1A 5F9JA 2EYSB 5GGRB 2OZ4L 4R4BA 4CU8A 1I3GL 4PGEB 3NCWA 4KJPC 1V54B 2V7NB 4I18A 4HGWB 5IQMA 1Q72H 1TVDA 1FE8L 1TJIH 1WLHA 2HT4D 2CJSA 3GHEH 4DP5X 3VDBA 3NJNA 3CX2A 1I1FA 4BFIA 3LD8C 4N25A 1S6NA 3UYRH 1UM5L 5HI5C 3W2DL 3U6RB 3MXWH 4FRWA 2AJUH 3OGCA 3RWFB 3KJ6L 3MRQA 4LVNB 4YHZL 1CTMA 3MPCA 1KIRA 4WO4C 3MROA 2HFTA 5FYLH 3KPQB 1YMMB 3RTQD 1MCSA 2CJUH 4PGZA 4RDQG 2ADIA 4FGMA 2WJ5A 4Z7WB 1DVXA 5E8NA 1NOAA 4V2BA 4ZS7L 3SKNB 1BMZA 1P5VB 3UZEC 4F7TB 2XETA 2UVFA 2QHRL 2IH8A 4FQ1L 5JYMA 3IFNL 1DFBH 4PJCE 4Q56A 3U0TA 5I30L 2TRYA 5E6IB 2ZKHH 1S5IL 5CLXA 1DVFC 1BD2A 2O4EA 4PLJC 1KTBA 1RUAL 3GB7A 1XGQA 3DIFB 2I07A 2ZOUA 3RY4A 5GGSA 4GRLC 1ID2A 2GG1A 1VEMA 3VD1A 2GY5A 4K94L 5IV2B 2WXIA 3ZTEA 3HMXA 1IM9A 2FBOJ 1KBBA 2LGNA 4NNPL 2VMDA 4OZ4A 4DO5A 2W9LA 2FK9A 1GGYA 1L3WA 5HYJD 4NJ9H 4E9VA 1G7JB 2BHZA 4Y16C 4GG6B 2BSCA 2JLLA 1MIEL 3NRFA 2W5PA 1CG9B 1TOXA 2YA2A 4ZX5A 2BZ7A 1DQJB 1XBDA 5EOQH 1XGUA 4RVBA 3HIZA 3Q2CA 1AAJA 5KJ7E 4YHKH 4CSSA 1WFUA 3FONB 3NQKA 1YYLL 3KWWA 1H0DB 5KG9B 1D9KD 2GABA 2EINB 1U8CA 4GAGH 3FRPG 1NC4B 3F7VA 2VDMH 2YK1H 3LMJH 3US1A 3GINA 3F01A 4NO0B 3QRFM 3K72B 2JI1A 5LBSA 2EO7A 2ZPKH 4KJQD 1V3JA 4MAYB 3HRZB 2DKMA 1G9NC 4FFYH 4HJ1A 3DJSA 1FVEA 2OSLA 1F58L 3LDBB 2CMRL 1O7DC 5GHWL 1GL4B 3BZFB 1KCSH 2BVOB 4Z7VF 2HFGH 4ODHL 3V6BR 1MWAL 4DIXA 3H3PL 1JBJA 3BP5B 5FYJD 5DD5H 4TF4A 4BUHA 4UF7C 3KLKA 1IC7L 3A24A 3PJSB 1OP5H 1EIBA 1RZIA 4L4VA 2XZQL 1WGOA 5DJCB 1OSEA 4LPYA 4UM9A 4Z5RA 2VERA 1SJEA 4GG6F 5C2UB 1MKFA 4PY7B 4AJYV 5B22A 1XTMA 2J3SA 4D7PA 3ARGA 3FB8A 2QJDA 4JFZL 1H3VA 2YXFA 5I0DA 2AXWA 4QTHA 5DC4B 3W5NA 3V0VB 2BNUA 5TQ0L 3GQFA 2CBOA 2NYKA 4AUUA 4OZIE 2Y23A 1RUKH 5GJTH 4HW6A 2APSA 2AQSA 4L3EA 1JZ4A 3ASOB 1YG9A 4PJIA 2IAND 5GGRA 1A3ZA 2HJLA 3ROLB 4XMTA 2OMUA 3FTSA 1EJ6A 1M05B 3DUSA 3G5VB 1RUQL 4Y5YC 3GMRB 5DMIH 2J21A 3BGAA 4E9XA 3WS3B 3ARBB 3NUKA 3OKMB 4OIIL 5ESAB 4DPBX 4WAFA 3BEVB 4TUJA 2VZSA 3R8QA 4U6HB 3WNKA 5MENB 3EIFA 2FEDD 2OR7A 5EUOE 1USQA 1QLRB 2EH7H 2WZ5A 3MMEA 4ETQB 1EHLH 1XEUA 4G42A 2ZQKA 3DOSB 2OSXA 1CICD 2NNFA 5JIHA 3WN5A 3VXOA 1E5AA 2BZDA 4LCUA 3DKHA 4S1QL 3TA3A 5DHYA 3POCA 2X4QB 3QAZC 2ZX7A 4M48L 4AZUA 4FQXA 5E00A 4RSYA 1KIQA 3G08B 4MZ2A 5F1NA 1ORSB 3L45A 5T5NG 4JFEB 1UA6H 4WQOA 1HZHL 3PGFH 4U4BA 4UT9H 4M8QB 4AQZA 2Y0SA 1SXZA 3E7JA 2ZXWB 4MMXB 3P4OB 3WY3A 3WIHA 5KW9L 1XB6A 4HIJB 5EOCL 3TT1L 3NN8A 2WLMA 1RUAH 1Z7JA 1V5JA 5BO1L 2QADD 1G0YR 1ZCRA 3VDAA 4DUWA 3ZMNA 1KGXA 2FB4H 5E0FA 3ME0A 1IAIM 1J8HB 3HHRB 1IFGA 2NW2B 4PYGA 2FWOB 1FAKT 4PY8J 4ES8A 4JR9L 3SDCB 1UA7A 3VCLA 5L2KB 4NJ9L 3CX5K 4NOBA 3O11B 5AW4B 4JM0A 1SYVA 4HLZH 4JM2D 1JZIA 2EICA 3DJTA 4U33A 2P8MB 3K74B 4WWKC 1ZHNA 4Z7QE 2WNWA 2KUTA 2X4OB 2PYEB 3SSGA 5LQBH 3VD3A 4KK8D 2R29L 2WSKA 4MAZA 1FFTB 4LIQL 3DUUB 4OD2B 3ZZ1A 3OJVC 3L3HA 4M4RA 4PY8I 4P46B 4U3CA 3QUHA 3US9A 3ARFD 3VFGL 3MN8A 3JWDL 1J86A 4YZFF 4MQ7B 4HWEL 1G9ML 2D31A 3ESOA 4A7SA 4Y4HC 4YDJA 1BFTA 2K7PA 5FK9A 1QNZL 2HYMA 1CN4A 5EZLB 3VH8A 2JKRM 4HXAL 2D0HA 5I71B 1LO5B 1N3NA 2BSTA 2VTFA 3TBVA 2E56A 3RYMA 1BXUA