1A4CA

Azurin mutant with met 121 replaced by his, ph 3.5 crystal form, data collected at-180 degrees celsius
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
AQCEATIESNDAMQYDLKEMVVDKSCKQFTVHLKHVGKMAKSAMGHNWVLTKEADKEGVATDGMNAGLAQDYVKAGDTRVIAHTKVIGGGESDSVTFDVSKLTPGEAYAYFCSFPGHWAMHKGTLKLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rack-induced metal binding vs. flexibility: Met121His azurin crystal structures at different pH.
pubmed doi rcsb
source organism Achromobacter denitrificans
molecule tags Electron transport
molecule keywords AZURIN
total genus 35
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1a4cA00
2ZONA 1XB8A 2IH9A 2FT8A 2IH8A 3PPSA 4KNTA 4A2EA 1M57B 3KW8A 3NSCA 4KO5A 3OQRA 2DYSB 4BWTA 2J5WA 1DYZA 2YXWA 1EZLA 4JHVA 3DIVA 3NJFA 2BO0A 1A3ZA 4YSAA 1NPJA 2A3TA 2YAQA 1PZAA 1BYPA 2PP8A 3UADA 3UAEA 1ET7A 2H47C 1J9RA 2EILB 3ERXA 1A8ZA 1RCYA 1L9TA 4HIPA 3CVCA 2QT6A 4KNUA 2GC4C 3QJQB 1JZFA 2XUWA 1OE1A 2AANA 1ILUA 3H4HA 1QNIA 4P5SA 2R7EA 2Y69B 2R7EB 3ZDWA 4YSCA 5B1JC 1A4AA 2PPAA 4DP8X 2MTAA 8PAZA 2ZXWB 1TEGA 2XX0A 3AG3B 3IN0A 2XU9A 4HCIA 2XX1A 3FS9A 3H56A 4GY4A 4KO6A 3OMAB 5I5IA 4YVNA 1YLBB 1F56A 3CDZB 1MZZA 1NPNA 2BWDA 1GS6X 2UX7A 3X1GA 1AZCA 7PCYA 1FA4A 1WA2X 3BQVA 4YSOA 1PMYA 2J57A 1W8EA 2X88A 4FAAB 1JZHA 2GBAA 2I7SA 1JZEA 1E5YA 3PAVA 1NIBA 1AIZA 2QPEB 3QJTB 1E67A 1JZJA 1SHXA 2TSBA 4F2FA 1ASOA 2PPEA 1WS8A 1QLEB 2VSMB 1PNCA 5TK4A 2H3XC 4Q89A 1CYWA 2B08A 3ZBMA 3GDCA 5B1AB 1T5KA 3FSVA 4G7QB 1PNDA 1GY2A 4JHUA 3EH5B 2UXGA 3NP3A 3FU7A 1J9TA 3ZIYA 3KW7A 1SFHA 4N8UA 1CURA 1W6LA 1KV7A 2XV2A 3D12B 4YSDA 3QJUB 1JXFA 1MDAA 1X9RA 1WA0X 3FPYA 1AAJA 1OCZB 4DP0X 1NDTA 1L9QA 2CCWA 3IBOA 2DWTA 5B1JA 3SQRA 2AZUA 2XV3A 4KO7A 2IWFA 3AW5A 1JXGA 2CAKA 2FQFA 1BXAA 1GYCA 3AG4B 4A66A 1JERA 1I53A 1ETJA 2YAHA 5E9NA 2OJ1A 1NWPA 5A7EA 1PZBA 1KDJA 1ADWA 3IN2A 3PLYA 4GP4B 4E9QA 1ZIBA 2FT6A 5AFAA 3T6ZA 3FYIB 2XWZA 1SNRA 2VM4A 1L9RA 2EIJB 1V55B 4CSZA 4HZ1A 1A4CA 1ET5A 1AZNA 1KCBA 5D4IA 3UACA 1WAEA 1OV8A 5FC9A 4G72B 3TASA 3NJIA 3EF4A 2X87A 3NJKA 3WI9A 3NJHA 1EHKB 1SDDB 2GC7C 1PZCA 2VN3A 4G71B 3ABGA 4A2HA 4BXVA 3WKQA 3V9EA 2YXVA 3TU6A 1JVOA 1B3IA 1GY1A 1JZGA 1ET8A 5F7AA 4BDVB 2GSMB 2IDSA 1IBYA 4DP4X 2BHFA 1V10A 2CALA 3QJRB 1BQKA 4BWUA 2ZWNA 3NJMA 2VW4A 4AKOA 3NJNA 4DP1X 4YSUA 3PAUA 4YL4A 3ASOB 3IEAA 2YAMA 2P80D 3T6XA 2BZ7A 1AS8A 3SBRA 3QJSB 4A68A 3QQXA 4CSPA 4DPBX 1BAWA 2IAAC 4G70B 4A2GA 5D4JA 1JVLA 2FQDA 2UX6A 5PAZA 2DV6A 4AI7A 3NSFA 3HB3B 3OMNB 4UANA 1BYOA 5I26A 2P80A 4YSRA 1AR1B 4M3HA 1GSKA 2MRYA 5AKRA 4GP8B 4DP6X 2BW4A 1OE2A 2PCYA 3FSAA 3ZX1A 1TKWA 2PPCA 2Q5BA 1A65A 1BQ5A 3T9WA 1AACA 4Q8BA 5I6MA 2QDVA 3MX0B 5I6NA 1BEXA 1MG3C 4GP5B 3C75A 1RKRA 1OCOB 1NZRA 1FFTB 4ENZA 2EIKB 1GS7A 4A2DA 2FNWA 2W8CA 2OCCB 1J5DA 3S8GB 2PCFA 1ID2A 3DTUB 2IDFA 5I5MA 3CDZA 3NJGA 1HAWA 1N70A 2PPFA 2I7OA 3ASNB 3X1FA 4F2EA 1XB3A 2BWIA 5I6PA 4NB7A 3NJJA 1AZBA 3NT0A 3S3CB 2EINB 3FU8A 1SDDA 1SF3A 1BXUA 3NYKA 4JKNA 1JZIA 1HFUA 4W9ZA 4E9TA 1SHWA 1L9SA 1JXDA 4BXSV 2QPDB 1PF3A 4KOCA 2TSAA 1A4BA 4L0PB 1ILSA 1OF0A 2FWLB 1PCSA 1UATA 5ANHA 3S3DB 2FJSA 2JFCA 2YQBA 4KOBA 1NIEA 3JTBA 3X1EA 2JXMA 5I6LA 4DPAX 2XVBA 3FU9A 1OOWA 1WS7A 4E9XA 1M9WA 2B3IA 2HXAA 3FSWA 3UGEA 5B7FA 3NSDA 6PAZA 5EHFA 3ABLB 3WNIA 2HRHA 2XYBA 3X2QB 3H4FA 4HHGA 4PAZA 1BXVA 2VM3A 4HCFA 1AANA 1URIA 1ZPUA 1E30A 3AZUA 1ZDSA 2IWKA 3ABMB 3AG2B 1GW0A 2IDUA 3RYMA 2FT7A 3OD3A 2Y1AA 3CVBA 1TU2A 3WIAA 1ZIAA 5IY5B 4QLWA 2PP9A 2WO2B 4P5RA 4N4YB 3T6WA 4WTQA 4F7KA 3NSYA 4KO9A 2AVFA 2Q9OA 2CUAA 2I85A 3IE9A 4DP7X 1KBWA 1RZPA 3FT0A 2IDTA 2FTAA 1AZRA 2H5UA 4YSEA 7PAZA 4DP5X 4NAJA 4YVUA 3X1BA 1AG0A 3AG1B 2HX8A 3U25A 2CJ3A 3EH3B 4BWWA 3TA4D 4AKQA 1J9SA 3PAZA 1R1CA 4HAKA 3S8FB 3TBCA 2PPDA 2DYRB 1OCRB 2QDWA 1GR7A 4K9JA 1NTDA 2BZCA 3ABKB 3T71A 3CVDA 2UXFA 1KDIA 4GXFA 3QPKA 4E9VA 2PP7A 1NINA 2BP8A 4M4RB 2BP0A 5LDUA 3EHBB 1PLBA 2YAPA 1NIDA 3CZUB 4UAHA 2VMJA 2WSDA 3FQ1A 3MBWB 1ZV2A 3FQ2A 3WKPA 2PLTA 4E9RA 3DKHA 1PLAA 4RH4A 3FPXA 4E9WA 3FYEB 2VSKB 5PCYA 1PAZA 3FSZA 2BP8B 2VW7A 6PCYA 2J55A 1NICA 5AZUA 3EH4B 4PCYA 4YSTA 1KCWA 5B3SB 2E86A 3WG7B 1AG6A 2W88A 4UF7C 2CBPA 1AOZA 4ZK8A 2WO3B 1MZYA 1W6WA 2GB2A 1J9QA 3T6VA 2XV0A 3GYRA 4BK5C 2JKWA 2FQEA 2OV0A 1CC3A 3UABA 4YSPA 5B1BB 3AY2A 2BW5A 3NP4A 3OMIB 2AFNA 2IDQA 4DP9X 1KYAA 3PXLA 2YARA 1XB6A 1SJMA 4G7SB 1J5CA 2UXVA 2BP0B 2HRGA 4FA7B 1CYXA 1PLCA 1OE3A 1NIFA 4E9SA 3G5WA 5TK2A 3S3BB 4EF3A 3BVDB 4YSSA 1AS7A 1AZUA 2HX7A 5D4HA 2J56A 5B7MA 2HZHA 1JOIA 3UAAA 1KGYE 3L45A 2XXGA 5I28A 1DZ0A 5B1KA 2HX9A 5I5JA 4AZUA 2DY2A 4E9YA 1AQ8A 3FQYA 4WKXA 4X4KA 3SBPA 1AS6A 1HAUA 1IUZA 2XLLA 3N55A 3SBQA 1ASQA 3GXUB 2DWSA 1WA1X 4W1TA 1V54B 4BDVA 2YAOA 9PCYA 3N2JA 3V9CA 1L9PA 5I6OA 1E65A 2UXTA 1XMEB 2EIMB 2GI0A 3X1NA 4HALA 1X9UA 1TEFA 3HEIB 3WNJA 3PCYA 1VLXA 1MG2C 2LLNA 2AZAA 2HLEB 1FWXA 4NERA 3TBBA 2FQGA 1N68A 4MFHA 2N0MA 2YAFA 5F7BA 1IBZA 1SFDA 2RACA 1OCCB 4A67A 2GHZA 1GS8A 1KBVA 1IC0A 4AKPA 4G7RB 3CG8A 4HHWA 3QJVB 4HCGA 4TXVB 2XXFA 5B7EA 4AX3A 3NJLA 1M56B 1BQRA 2GIMA 1ZDQA 2NRDA 4GYBA 1SF5A 4YSQA 1E5ZA 1L9OA 5I6KA 1QHQA 4DPCX 1IKOP 3OM3B 1NWOA 1NIAA 4QKTA 4KNSA 1ASPA 4DP2X 3FU7B 3JT2A 1PY0A 1RZQA 4A2FA 2YAEA 2IWEA 1CUOA 2VW6A 2ZOOA
chains in the Genus database with same CATH superfamily
4JE0A 1UB6A 1XB8A 4J6RH 2FH6A 5IEKA 1M57B 4OIIL 5HI3C 5SV3A 5DD6B 1AC6A 4K3JH 1SXNA 4GAFB 4IJ3C 3P9LA 3NRQA 4ZW3A 4ZDHB 3OAUH 4F37K 2GTWA 2ZXEB 3NJFA 3DUUB 1SN0A 1YEFH 4EKXA 2VXVH 1NFDE 2P49B 3D1MC 3MCKA 3QO1B 4F27A 3UADA 2PP8A 2WXMA 3LVTA 2QR0A 1NKGA 3K6OA 5FO9B 2CH8A 4B9IA 3RWFA 2O26U 2MWCA 2EILB 3LS4H 4FNTA 1CGTA 3NH7H 5HJBA 4BD4A 5HHQB 3L9YA 4UYQA 2FX7H 3HC3H 3MLRL 1XH3A 5AZEL 2QT6A 4LNRA 1JPST 2ED8A 3O3AB 2WMPA 1ORSA 1QNIA 2EDBA 2LR4A 2W0PA 3RVWC 3VFRA 1ONQA 1XF2A 3MV9B 1JP5A 5KVFH 3BUDA 1IM3A 3QUZC 3CZNA 3GMPB 4ZUWA 4OLVH 4WUKH 5GJSH 3N06B 4MB4A 4PGCA 4X8JA 2Z9TA 3GKZA 3BQUB 3AG3B 3BP6B 1FLTX 1NUDA 5E6IB 3OLIA 4PW3A 3MODL 4MXWH 4NQSB 1BFVH 3LPFA 1C08A 1GA2A 1XF3A 1FA4A 1ZY9A 3MSPA 3SJVA 4QYOB 2DPKA 4ZD3L 2Z7UA 3GSNL 2Q86B 3G5VA 3QJXA 2X3AA 1XGUA 4D0DB 4GRLD 5C0IB 2ID5A 2MQ3A 1JG9A 2K7QA 4TVPH 5E8OB 1LEKA 5J89A 4YMPA 1LD9A 2XQBL 3TO4B 4IS6B 1M4KA 2YWYA 3INUL 3ARDB 5IBLC 3OF6D 1QLEB 2DRUA 3JWDC 3LPGA 3VFNB 4PSRA 1YECH 1UT9A 2GTZA 1T3FA 1WBYB 1D5XB 4GAJL 1ZJAA 4PJAF 1DANT 1XEDA 7TAAA 4BHUA 4X5XA 5A6LA 3ZRSA 1C08B 1WISA 1PU0A 3M88A 4JHUA 4LDLB 3CZJA 1MSPA 1K9TA 3DIDA 3VWKC 1DVFC 2B5IC 4FG6D 4MXWL 4M8QB 4A1RA 2B1HL 3OB0H 1JUFB 2ZAHA 1F1DA 2VWEE 2XN9A 1JZ4A 5KUKA 2VZSA 4HS6A 1EJOH 5D5MF 4MZ2A 3PWLB 4M7LT 5BCAA 3V5DA 4HD5A 4F24A 1I7RB 5JPNA 4QXWA 1QLEL 2UUDH 2LTQB 1MHHA 2YUXA 3LQZB 5A1AA 3D69B 1V8HA 5E4AA 3JBG7 5E9NA 3UP1A 5TE7H 1JK9A 1M1XA 5E1IA 2Y06H 4GIOA 1CVSC 4KJPC 4I0PC 3RGHA 4DHLA 2IEPA 1JYXA 3NK4A 2ZUYA 4FDWA 5FYKD 2WUBH 4ZW5A 4KXAA 3D87B 1UXWB 3ARQA 1NCBL 4L8DA 1C12A 4NO5B 5BQDA 3K6IA 4R0LC 1TMQA 3ETSA 1ZT7A 2NNXA 1BIHA 1E4XI 2NYZA 4N6RB 3IJYB 3FO0L 1JAEA 3SO3C 1CT8A 4FTDA 1KELL 2F54B 2NOYA 4U49A 5IW1A 4R2GC 3LKQB 3U48A 1WEJL 2GBTA 4AEIL 3D6GA 1RJLA 1HTYA 2XIBA 3ZHDA 1E43A 5TPWH 2VIRA 3B9VA 3PP3K 3UH8A 3I6LE 4IGBA 1VIWA 3NFNA 2WZ0A 1UURA 4XNXH 4XXCA 4Y4FB 2NY6B 4NXKA 3AQDA 3P3YA 4N0UA 1RZIA 3KPSA 4P9HH 2ZP8A 3KHQA 4YHIB 4A2HA 1FPTH 4P5TB 5AYQA 3BP6A 1IKFH 4KTGA 4ABWA 2XCMC 3ZZQA 2VQ1A 4FMVA 4DGVL 5ABDE 1V7NL 3VJ6B 4PY8I 1DVFA 1ZA3A 1HHIA 4URKA 2IDSA 1U8KB 3RUGB 1IBYA 2JCCB 3CFJB 3MLXL 4FXGA 2BHFA 3G9VA 4HAFA 2YN3A 1LE5B 1T22A 3OHMB 2VC2B 4X80L 1TQBB 5DD6A 5EOQH 3VSQA 1KB9J 5JPMB 4K5MA 1U92A 1FIGL 3QEGH 2VB5A 3WD5H 1WT5A 4WJ5B 2NY1B 2FUTA 3ESVF 2QTVA 5ICZB 2WGNB 4MA1C 4NQCA 1HOCB 4BZ2A 1JVLA 2J20A 1EZVY 1JPSL 4R4FL 3LKPA 4LRNH 4YSRA 3D0VA 4OZHB 2HT3C 3OX8B 1U4EA 1X3DA 4UCFA 5I1AA 4FQXB 3GO1H 4CVUA 3OXSA 4L3EB 1HOCA 2Q5BA 1KWKA 4KKAC 4KGLA 3GZQA 4QTIH 4QF1A 1MCPH 5I6MA 3MLXH 4P2RD 2O6FA 1FNFA 5D1QC 3FT2A 1MFCL 2C9VA 4KKBD 4GH7B 1NEZG 1YEEL 4R5TA 4Z7IA 2DJSA 4KK8D 3X14B 4I18B 1MCSA 3MLWL 5C97A 1NSNL 1YEGL 4JRYA 5T3ZE 2M26A 1G0XA 2WQUA 5DMKA 4PRBA 3D4YA 1T21B 4OZHA 3SDAA 2BSRA 2APWA 2BOBB 3WNNA 1E6JL 1BFOB 2PPFA 2ZJSL 1F4WL 4JQIH 5EU4A 4QRRA 4HIJA 3S3CB 5EMYA 4LAJH 1DR9A 2DH2A 1SOQA 2B16A 1E9PB 3MJ9A 4MXVE 3TS8A 3EJCA 3WSQL 2KQMA 2VRQA 4GAYB 5GGRB 2CWRA 3V8CA 2XPGA 1KIUA 5EOTA 1FFPA 3LH8A 4M1CC 4BXSV 4HJJH 3LZFL 1P2CB 2DWYA 4L9DA 5KG9B 5CJ5A 1C8PA 5AW5B 5IW1B 2C7FA 2WTRA 5KVFE 4PQXA 3O6MH 1KT2A 4PJ7F 1MAKA 1H15B 4KKLD 1CXIA 3FU9A 4JG0H 3M46A 2LLLA 4FLRA 1QQDA 1BOGB 3FAWA 3US1A 2GUYA 1FP5A 1QEWB 1MH5A 3K74B 4OGYH 3MNWB 4EQ2A 2V8LA 3SDXA 5MHSE 4I5BA 1E7UA 2F9BT 2J1YA 1R3IL 2ICWI 4X5LA 3SDYH 5ICZA 1CDIA 4J3WA 4L29A 5E23A 5GZND 3L5HA 3ZZLA 2WLKA 3PWPB 2PUQT 1GZPA 4L9LC 4MQTB 1QWNA 2EDXA 4TLUA 2BSED 4ZW6A 1HILB 2X0UA 4N1CA 1U36A 4S0TD 3RDJA 3NZ8B 5KS9A 2WWOA 4UILH 4UT9A 5DWPA 1OT4A 1SBBA 4HAGA 2Z91B 3FFDA 2XZZA 1G0DA 1F8TL 2M2DA 1JTOA 3BN3B 2QVTA 3TN0D 4L3AA 3LSOB 4M56A 4RQQA 2AAVA 1IBFA 4QPEA 1Q4NX 1AGFB 1T1YA 5SV4A 5DHVH 1F58L 3MXWH 2DIBA 2V5YA 3GXPA 3CSBA 4Y1AA 4K7FB 3FL7A 3ELAT 1Q1JH 1T4KA 2VZOA 4IMLB 4JRXA 5MEPB 1JV2B 3BDBA 2V5MA 3A6OA 5K59F 1QFWL 3IJ7A 1F5WA 1OAUH 2QSCH 3WO4C 4Y19A 3U25A 4I3SH 1UACH 3ZXAC 1NAMH 3S4SB 3K2MC 3DX7A 2P8PB 4H4NA 4FFYL 3EYSL 3LRGA 5GS2H 2PYED 3RKDC 2WIIB 4HETA 1L4IA 4DO6A 1RJYB 3ARDC 5DJ8B 4N8CL 1NCOA 3RTLA 3C8KB 1EXUB 4JN2B 3EH2A 4LSVH 1MW2A 5L2KA 1TF4A 2PP7A 4P04A 1T80A 5I8CA 3EHBB 4EN2A 2VMEA 2B14A 2VMJA 3QEQA 2Y1ZA 3VFWB 5ENWA 5D5MB 2ZCKL 2ENSA 2IV9A 4ZZKA 3VFVA 5HGHB 1YPZA 4V2BA 4JDVA 3WKPA 3IFNH 1UWFA 4F8TA 3BRFA 1G6RA 5EZJB 4CA4A 1A9EB 5IR1B 5PCYA 4NNYA 1U8NA 4ZI8A 3FSZA 2DQEH 5E00B 1MI5A 1PEWA 4RCAA 1JWUB 1NICA 3UBXA 5HJ3B 3EG9B 2ZKHH 3F6LA 1KCWA 3E6HA 5I23A 4UBDC 5E4OA 2NLJA 3UTSB 1AFVL 4POZD 1WAAF 3TNNB 4Y4FD 1J9QA 5F7FA 2X70B 5KTEL 4JO3L 3EJYC 1DQJA 4DKTA 5D93C 4JL1A 5JO5B 4GBXB 2ICWA 3O2WH 3RPBA 2P47B 1HYSD 1UGKA 3A6BL 2PYEA 1IC4L 3CXHJ 1IC5H 3DOIA 3L7EB 1JN6A 1QBMH 4AV4A 2J5LC 2WTOA 4NRYB 1XB6A 2XKUA 2O6CA 5IHZA 2CDGB 2G9HB 2DDQH 5T1DH 1EZSA 3VSUA 1ZJBA 5AAPA 3WN6A 4XAKD 3S2AA 3BVDB 3MBEA 4PHZA 1ZT1A 4P2OC 2MJWA 2OMTB 4X0KB 3IWVA 4XXWA 1Z6JT 3L45A 4XI5C 4Z7WB 5MI0B 1T6BX 4AZUA 3KJ4B 5EZPA 2DY2A 1KZQA 1GOGA 5T33L 1T0PB 2E6PA 3FQYA 4J27A 2VKWA 4PRAB 1Y18B 4DWHA 1HAUA 2WZPD 5CGYD 5LCVH 3TN0C 1IZJA 3RI5K 1QLRA 3IGAA 3QWQB 3Q1EA 9PCYA 3CAFA 3N2JA 3PDDA 2VRKA 4GSDL 5EF1A 1ETZA 2MPAH 5I0ZA 3HCVA 3IDYB 4QRRB 5FYKL 3KL0A 4MQSB 4WHYG 4L1TA 5E5UB 4DOHB 1CFNB 4O9HH 4EIBA 4ESKA 4JN2A 2F19H 3C08H 3MRNA 4IK6A 4MDIB 2ZUQB 5AW0B 2Y07L 3M1BA 4TL4A 3VG9B 1T6WA 5KVFL 4OB5H 5MENE 3Q2VA 4FQCH 5CGTA 5DHYA 3OAWA 2X1OA 2Z0UA 3V4PB 1HQ4A 1G7QB 3QQDA 4G7RB 4H8VA 4JKWA 1RIUH 4XPFH 2HFGL 3CH8A 4QRSA 3U30B 3QI9A 4NPYA 5GGVY 1I9EA 1LK2B 4EI5B 5LN8A 1WFIA 2EXTA 2X89A 4Z95L 2CLVA 4A7TA 3HJEA 2NRDA 5HHQA 2WWKO 3O9WB 1UFGA 2F8VA 1LVEA 5I6KA 1LXMA 2IGFH 1NWOA 5DUBB 2H41A 3TYFB 1GL4B 3B5HA 2FL5A 3D07A 5JXED 3PL6C 1WEJH 4KITB 2V5TA 5EULV 4GUQA 5T3ZL 1QLFB 5DK0A 4X9YA 2B3RA 1WAAA 2VISA 4ZSOB 4KHXL 1QBML 2WWNA 1EA9C 4CMMA 2E6QA 4FQCL 1M3JA 4M62L 1SUJA 3P0VL 3NSCA 1L6PA 3VMPA 5JLZA 3CFBB 3GRWH 2RFXA 4LPWA 4QIRA 4XB3A 3Q48A 5KOVC 3T2NH 2J5WA 1YAZA 2DLEA 2QHRL 2VRAA 2NY0C 3UAFA 4OVVA 1A9VA 1GMEA 4G80B 3EF7A 1NBCA 1CFVL 2P5WD 5LGHH 1C7SA 3RAJL 5B1CA 3ROLA 1A3QA 5IVZA 2K45A 4R7XA 5DJXB 4F7CB 3CH1A 1ID5I 1H6FA 1TTAA 1HCVA 2Y24A 4PJHB 3O41A 2R7EA 1I8IB 3O0LA 5D9SA 4MVBC 4ZPVB 1IGJB 4MCMA 4L2YA 4XMLL 2ZYIA 5BW7A 1JNLL 1HHHB 2WIMA 1SVBA 3LZRA 5IESL 1Y6MR 3QUGA 5D6CB 4LLDB 5GJTL 2XX1A 1X4XA 1F4XL 1NCNA 4P9HC 5A16B 1RZKC 2R0LH 3LH2H 2EEXA 1AQKH 5EZJA 2VMFA 2N56A 3KPRE 2FJHA 3VNZA 1EEZB 4PJGB 3ZL2A 1KYDA 5CKAA 1FV1A 1MWAL 3KYNA 1S9YB 1XHHA 3TZVB 2Y7MA 7PCYA 4DKFH 2VQTA 1SMDA 3NMEA 2P7TA 1JF6A 1GZHA 4DPRA 2Z8WC 2X88A 4WI0A 4AEIH 4Y7MA 4PRID 4ZPVA 1SN5A 3KPMB 3SY0B 3VACA 6CGTA 1G7PA 1LO5B 2R1XB 3MUY1 1WUNT 4KZDH 2QPEB 2AKRB 3QR2A 3P2DA 4PCKA 1WAPA 1F3DH 1ASOA 4CAGA 2PPEA 2D4FA 1NKOA 3QRGH 1PNCA 5C6TL 2VLRB 4FFVD 5C8JA 3FT3A 4GSRA 2VDLB 4I9WD 1DVTA 2GT9A 4UB0H 4G7QB 5I2IA 5F7NC 3NSJA 1PNDA 3WSQH 2PNDA 1CB4A 1TVBA 1KYUA 5A3IC 3SOBL 3ZIYA 4ZT1A 5IMLB 1QABA 1P6AB 3GRWL 4H1LH 1FI8C 1QSFB 2BJML 3ILQD 3MQIA 3IDNB 3PGCA 3SCMA 2BVOB 2Z7YA 5AW3B 3S48A 3SQRA 5JHMA 2AZUA 1IEBA 3P73A 3VTMA 4PRDB 1CXHA 2O5YH 5CILL 5CJBA 2XY1A 3C5ZD 1CG9A 4WHCA 1CYGA 5ISZD 4F37F 1JYNA 3MRPA 5C07B 1GKEA 4UINH 3MN8A 5TF0A 4X9FA 4JRWA 5JDJA 4KQ0A 3IKCA 5FHAL 1NM4A 5EU7E 3UJJH 1IIKA 2V9UA 3FCTA 4ZFZA 3O0RL 1VKXB 1R3IH 1JV5B 3W0WA 4H8PA 4L4TD 2NYKA 3WIIH 4GRMB 2X4RA 3IN2A 1NGQH 2DLHA 4GP4B 1SLXA 2AK4B 1A3RH 2J6EL 1PY9A 3VWJB 4XO4A 2KDGA 3RLSA 4XNQA 5AKVA 3S8WA 4PP1D 4EZMA 5IWLC 2OTUB 2CO6A 3BW9B 5IVXA 1S3RA 3K5RA 3EFOB 4G1MA 4FG6C 3GXFA 2PTTB 2K3HA 5HHXH 3ETBF 4DO4A 3MLWH 3KHOA 2WC7A 2WMPB 3ABZA 3NJKA 4ZW7A 3ULUD 2D31B 2WSKA 1U93A 5DZ9A 5LBSL 4GBXC 1KELH 4G71B 1JNJA 4NC1E 1MCQA 3ZUNC 2XBDA 3A6BH 2X4QB 1FBIL 4UM9D 3UBXI 2DBLH 2R2BA 1WPCA 1TZHB 1I1YA 4PG9B 2YPKB 3BMVA 4PP1C 4MJ5A 4JZNA 1UOLA 3GK8L 4LASH 3D39D 4GKOA 1ES0A 5GSRA 3S5LA 3SYAA 3TIEA 4KMTL 1RLWA 3J27A 3S5ZA 1SXSA 2I60L 3OVUB 3CFCH 1I3GL 2E7DA 3NRFA 2K1MA 3NCMA 4MA8H 1Z9MA 1WWBX 2X10A 5D7LE 2X0WA 3QJSB 1NC4D 12E8L 1LO2L 3A47A 4EIGB 2DKUA 4I48A 5JTWA 3EYOA 4MMXA 1QA9A 4G6FD 1C5DA 3K6NA 4OCYH 1AIFB 1CFBA 3FUHA 4Z7WF 4BZYA 1CGUA 4Q6IC 4YXLL 3HZYB 3ENEA 1FGVL 4L3FA 3L3DA 1OAYL 1IMHC 3O6KH 2WQSA 4OF0A 3C12A 1VCAA 4Q8BA 5KG9A 3WKYA 1K8IB 4L4TE 4XMXA 1HN1A 1F1AA 2XRAH 3C09B 3DURB 4FFTA 3VG0H 3FUFA 5CLYA 4FHKA 5AUMB 2DEXX 4ELMB 2W9DH 1T7WA 1S5IL 1QWHA 2G5RA 4ALAH 4JK0D 4ES9A 4KU1A 2W8CA 2WXIA 3S8GB 1U8LB 3KPNB 3LHPH 1F6FB 4XE0A 5E8NA 3DTUB 2IDFA 4PBWD 3UOAB 5SWZA 1F97A 1NFIA 1ED3B 4RMUA 4P4KD 4U3SB 1AH1A 3JXAA 2DI7A 4KI1A 1O5DT 1RPQA 4LK4A 3PL6B 5HI5C 4DN4L 2WK2A 4CW1A 5I8OH 5DMGC 4GOSA 4QOKA 1PG7X 5C0RL 2NR6D 1JS4A 3WE6B 2C3VA 2FYYB 2NZ9D 1MJJB 1A1OA 4NAMA 4PJBB 4QRRD 3L7FB 3BW9A 1OF0A 2XVKA 2VITA 2XT1B 2FJSA 2JFCA 4KX9A 1T0OA 1TNNA 1DVYA 4QOKB 4Y7OC 3QHZH 3OKMA 5IHUL 2JXMA 2OS7A 3PDOA 2F68X 3QNFA 2IANA 1WZ1L 2Z31C 4KKNA 5HGAA 3L17A 2Y07H 3V0WH 1U30A 4OZGF 2VAAA 2WUBL 2ZUSA 3U7WL 2D2CC 4QGTA 3LV3A 1FZOB 1WTGT 2XZCL 2IANB 2NW3B 4Y4KB 1URIA 3NIFF 3L8QA 2DMBA 5ABAA 4R0LB 3V5KA 1N4XL 2CK2A 5JORB 3OJVC 3N85H 4D3CL 5C1MB 4TNWK 1VA9A 1YEJL 3QCUL 1EMTL 5BZWA 4Y4KA 2NW3A 2DD8L 2EEFA 1MY5A 4XH2B 5FDWA 4U6HA 4P99A 2APBA 2VAAB 4KY1H 1NCCL 2XN1A 1IFHH 3OX8A 5GGTL 3Q8FA 2L7QA 5FFGA 4X5RA 2G4EA 2O4EA 5D7IA 2ETWA 4B41A 1BECA 4ZMNA 3AXHA 3QXDA 3P4LA 4PWGA 1WITA 3KPRD 3S88L 4L9LA 1R1CA 2H1PL 2X6VA 1IAOB 1NEUA 3GXDA 2IFGA 4N6QA 4P3CH 3D48R 3ABKB 3B5GA 4KZDL 2DZEA 3DGDA 3IE4A 4NKIH 1WHOA 1NINA 4NO5A 5LLIC 5I18L 4KFMA 1R3HB 2PW2A 1G9NL 1A7BA 4GW4A 3MRFA 3FCSB 3PGFH 1YAIA 3C8DA 4PRBB 4APQD 1X5ZA 3HG0A 3ZQ9A 3RVXC 3RZCA 2J8OA 3KCWA 1GIGL 5L2JA 2JXMB 3A22A 2FE0A 2WGXA 3CHXA 3TN0A 2X40A 1RV6X 1IAOA 5AZUA 1Y18A 1G7IB 4R8WL 4ONGH 4XP6L 3N9GL 5G55A 1C9SA 1T89C 5D7JB 3O3DA 4YXHL 2H1PH 4Z18A 2P8LA 1E7VA 1ZCRA 2OMWA 3L4ZA 4OFDA 2Q20A 1OSEA 4Y4FC 3TA3D 5D2NE 4X6EA 1QHOA 5AB1A 4KRLB 4HOXA 4DGYH 1AQDA 1GAFH 5FUZH 5DO2D 2X12A 2EC9T 4K9EH 3JVGC 2Z64C 1KTDA 3BFWA 3D2UB 1BPLB 1RP8A 1X44A 1YY9C 3FQNA 2F6AA 3KVPA 3MCLL 3QCVH 2Y5TA 4KH2A 2P5EA 4GXVH 3MHZA 4E9SA 5IF0B 2WZ6A 3SKMA 4BFJA 3V0AC 1XCQB 3S2CA 3A67L 4QHUA 2YN5A 2WN2A 3ZPDA 4DO5A 1JIBA 2XYCA 5B1KA 4G6JH 1PS3A 2CUIA 4P9MH 5TE4H 1PQZB 3QCTL 3OG4B 5DZJA 1AHWB 3NACL 5GHWL 3PWPA 1EEYA 3SBQA 4P2QB 1V54B 4UYPA 1ZE3H 1FLRH 2ZQKA 1YN7A 1U21A 4K73A 1J10A 4NO2B 2Y5TB 2FWOA 4HT1H 1HHJA 1J87A 4X5PA 2ZAIA 4AYEC 5E8PB 3MFFA 3VTAA 5DURB 5A40E 3NTCL 5B8CC 5MEOB 1MG2C 1L5GA 2F54D 1A4JB 4TUOB 4EXKA 3TESA 3VFGL 1BFVL 3KLLA 3ZTNL 2A6KA 3RBGA 2N0MA 3FRPG 4U0RC 3WUWA 4NSKA 5KSBF 4OZIA 4F2MA 1A7QL 1Q90A 2AK4D 4M5ZL 5J6SA 2VDRB 1ZLEA 4G8FB 1BQUA 5D70H 4M1GH 2ZE0A 4TXVB 1U2CA 1S7QA 1U42A 4WFFE 4RZKA 1DL7L 2X1QA 3EJZC 4Y5VB 1PSKL 3UZQB 2AQPA 5M7QA 2JKRM 5MEQB 2NXZC 2BPBA 2VDPH 2AI0H 4C58B 3MLTB 2I9LA 3HMXA 4Y1AB 5I30H 2CQVA 3GMNB 4C4BA 4YXKL 5EZOH 1H3GA 1XBDA 1XGPA 1GVIA 4Y4HB 2XTJE 5EEYA 3CVIL 1RUMH 2UY6A 4POZC 4UZSA 1KXQA 1I9IL 4F8QA 3DK2A 3QZWB 2IWEA 4FQIH 3MJ8B 2C7UA 2VC2L 4LOEA 1GXEA 4Y5YC 4LEEA 1U8HA 3RU8L 1RFDL 4UTBL 4R2GB 3GBNH 1XSJA 5CMAB 2CR3A 1P1VA 4DCQB 2DYSB 3BO8B 3EJTA 3MGTB 4Q6YA 3VG0L 2X2YA 4EI6B 3B2DC 3V6OE 4OKVA 2NDFA 4YUEL 3QSKB 2IPUK 3SDXB 2BSEA 2WQWA 2CDGA 2G9HA 5C0BE 1J05B 1MRFH 5C0CA 3UAEA 1CTOA 4Q9QH 1SJVA 4A6YL 4KROC 3W9EA 4UILL 4LKXA 4YXKH 2DTSA 2JJVA 4QHMB 2W59A 2W94A 4JO2L 1E42A 4JFED 1FGNH 2WD0A 1LO2H 1A3LL 2D03H 3BKYH 2ZKHL 1YUHA 3S5LG 1OB0A 2VXUH 1X6NA 1OWWA 3BCFA 3DETD 1PD1A 3P2TA 4XC3H 1UXSA 4IOIB 3T3PB 1J1XL 4IRJC 2HVKA 4PV9B 3HPJB 2H8PA 2XZAL 1BCIA 4HC1H 3VRIA 4MLIA 2JI2A 4ZQKB 4APQC 2WV3A 2XN0A 3K1DA 2OLDA 3FCSA 5I71C 4Y1AD 2R8SH 1F6AA 4KO6A 1JI2A 3CDZB 2G2NA 4Q56A 1ML0A 4WFFD 4N8CH 4NN7B 2Q87A 1AD0A 2Q1EA 2F0CA 2ZX8A 2RH0A 2V9QA 4NKOA 3T1FA 1CF8H 3S0PA 3GSWB 4HUMB 1NIBA 3LHPL 4FRWA 3HFMH 2P24B 4A7GF 3DXAB 4XPGL 2DL9A 4KKCC 4R7LA 4JRFA 5LCVL 1J1OH 2AQSA 2E75C 5AVYB 5GS0H 2PR4H 3T0AA 1AGEA 1IZKA 3BAYA 3MV7B 4KK8C 5MP6H 3C6SA 3NQIA 1CVRA 4OAWA 1CURA 4N8UA 3LQAL 4M6NH 1RUPH 3HE7B 2CGRL 1JXFA 1CBVH 3A4FA 3O9WA 3GZPA 2W9EH 3L5IA 4GQ9L 1OCZB 4JPKL 4PN6A 4JJHA 5BRPA 1KCSH 4OB5L 3IBOA 4LMQI 4Z5RB 1KJ3H 4KH9A 3HN5A 3VGDA 4UQ2B 3BPOC 1AGBA 3FKUS 3JQOB 4V1DE 1JXGA 4D8PB 2VISB 4PGDB 2HFGH 4A66A 4QO1A 5DS8B 3FQXA 4P59L 1SJEA 1LEIA 4X4XA 2VQUA 1RURL 4N0FA 3BKYL 1QP1A 4QXUL 3R06A 4EI5C 4QNPE 4LCWA 1PZBA 4M5YH 2YBRB 3NIGE 4M6OH 5K33A 3GSQA 3RJOA 3EBHA 1CK0L 1XGQA 1YY8B 4XC3L 3ZLQC 3BCDA 3WHE1 1F4WH 1EO7A 3DX9A 3KWWB 2KMWA 2P26A 4D8PA 2YGVA 4GO8A 5JW5B 4HFUL 2JKLA 3GSWA 4KKAD 4NHUB 4OZFA 5EIIA 3CHSA 4MXQC 5D4IA 5E5RB 2C3XA 4TNFA 2VLLA 3CDGA 3P0VH 5EPMA 3UTZB 1R5VA 4ANKA 1T04B 3QG7L 5DD5L 3NJIA 3FOLB 2AQ3A 5E7BA 4K9EC 4PB9H 3T65B 1S7SB 5BV7B 4H1LG 2YQ3A 3FN0L 3IETB 2GC7C 4E0RA 1TSHA 3L3GB 1ZTXL 2BFGA 4G6ML 3NIGB 3ABGA 3KWTA 3HE6C 3C6SB 4WNJA 2NY0B 1DO5A 2AXJA 3SDDA 4TOYH 4MXVF 1CK0H 3R0NA 3CX5J 3RIAF 4K9EL 3RVTC 1EQWA 2IO5A 2JCCF 3C5JB 4OLEA 5K39B 3ULVC 2D9CA 2M1KA 4PRPE 3BEWA 2AAAA 3EYQD 3QS2A 1BVKB 3JYBA 3S7GA 1XF1A 4L3ED 4OZ4B 4PWJA 2PABA 3PAUA 2NZIA 2W60A 1ONQB 3KM2A 3HNVL 3CV5A 4M48L 4P4KA 5GS0C 1QFUH 2XVGA 3PWPD 1E9OA 1H9DA 5CD5C 3WFDL 1K2DB 5ADOL 3FHAA 1NCWL 3C5XA 2OQJA 5HVWA 1YNTB 3HIZA 3FH5A 4LPVA 4UANA 4M3HA 3F8UB 4MA3A 1Q38A 4JM2B 1IL1B 2HB0A 4TOYL 4HJ0D 3ESNA 3VX1A 1TKWA 2PWDA 2WBJC 3EJRA 4R2GD 5I0XA 3KAAA 3D2UD 3L13A 2H3KA 2QDVA 2DL2A 4OFYA 4I7ZC 4PS7A 5EBMB 3C75A 2WLLB 4GQQA 3WXVH 4NZTL 1UKTA 4CVZB 3UC2A 4LF3B 3MLPA 2WO4A 5DQJB 3KWWA 1J86A 2GCYA 4J3TA 3F64A 4I9WE 5JW3H 1ZHNA 2VLKB 3BH9A 3NJGA 5I66B 1DJIA 1BQHB 4WSJA 1DEEB 3X1FA 3NJJA 5F9OL 4R7DB 3CPUA 3R06B 1TYJA 3FU8A 4ZFZB 5D1XE 3ZTJG 5KS9F 4ECNA 4JG1H 4APQA 5D71L 3PJNA 4HKJA 4M7KL 5DSCB 2YR3A 1SHWA 4OQ1A 4CVZA 3MZTA 4BQBA 4H8UA 1JL8A 5E8EB 3TWCH 1I9IH 1TIUA 1XX9C 2JE8A 1TJHL 3E1ZA 5DT1H 4QTFA 5AOLA 4R9HA 1K4CA 5I6LA 2W65B 5T3XD 2IGLA 2NMSA 2B3IA 2DI8A 2V17H 3O2WL 4FCAA 2ZF8A 3FSWA 3S3PA 1CDUA 2WTPA 1OGAD 4GI6A 3LDBB 4M48H 4PMFA 4Y2OA 2HRHA 4JMXA 1T0NA 4WWPA 4JPQA 4ZQTA 3PDGA 1OVZA 4PAZA 1MAJA 1ORQB 5HVHB 1QUPA 5DLLA 4MNQE 1WC7A 1WWAX 4N28A 4AIZA 5D9SB 5F7HA 3IJSB 1N19A 3HS0A 2XIIA 3EGDA 1F1GA 3EYQC 4NP4H 5JA9A 4EZKA 4R26H 4JGJA 3BPNB 4APXA 3FFCA 3BE1L 5K1JA 3RZCC 3TJHD 1HEJC 3PL6A 5EOQL 3IPEA 4F8LA 3NSYA 3UZEA 4GT0A 4JPIB 2H0PA 3W82A 3ROOA 3BVTA 1YEKH 3FT0A 1FBIH 1RHHA 1M2VA 4IBZA 4X7TB 2J6WA 2FTAA 1RZFH 2AITA 3CHQA 1CFTA 4CDHA 1DUYB 4XH2A 4NN7C 5CINL 5DMKB 1XH0A 3GJFB 1JPGB 1LNUA 2V7NB 3CTTA 3CC1A 3D39E 4ODVL 3CNKA 5D7JA 5BUPA 2D7TH 4UZGA 3KG5A 4AEFA 2FUQA 3TYGH 3IS1X 1TFHA 2DN7A 1PX8A 2ITFA 4N86A 1BD2B 1EFXD 2PPDA 1W8NA 1SEQH 4LOUD 3ZTCC 4DGIH 2VLKE 3BQUC 3SQBB 5I76B 1WICA 1ZT4A 4Z0XB 1BEYL 2FLBT 1NTDA 3ECUA 4G7VH 3ZQXA 1MLBA 5BO1H 3TEUA 2J4WH 5C2BL 2WKLA 3LN5B 3W2DH 2VO8A 1NGYA 1ZWIA 4ADGA 5IBTH 1NIDA 2Y72A 5AG8A 4O4YL 3BSGA 4NFBA 1JFHA 2OFQA 3T2LA 2B4CL 4FQXC 1AIFA 1B4JL 3B6SB 4FZ8H 1FGVH 3RUGE 5TDPA 3HE7C 2Q8BL 4L05A 5DJDB 3ORJA 4L8CA 1EXHA 1KF9B 3RVXD 2AJZA 3QDGD 4X7DC 3BKJH 2BNUB 2IQ9L 1MVUB 4O2FB 4HJ1A 5DUMH 5F7EH 1CXEA 3MR9B 2GB2A 3GJFK 5BQ7A 4HUWB 2ZCLL 5DJDA 5KJ7E 4DGIL 3QHTC 1W72A 4NCC1 2ADJA 1ORQA 4XN5A 1VEMA 3L1OH 3V7AE 3ZKSD 3ISRA 4HUKB 5GS1C 4LCUA 3AUWB 3PHOB 4NBXB 2VUKA 4K7PX 3IWUA 2BOBA 1IAKA 1UHVA 1LO0H 2QQNL 5I16A 1L0PA 1W0WB 1NIFA 4MNGA 5TK2A 1TTUA 1L9MA 5F1IA 3KPNA 5EC2A 3UJTH 3QXUA 4M5YL 5IROD 2EYSA 1TZAA 4MJ2A 3QIWB 4PRPA 2JKJA 4OCNC 2Y3AA 4MJHA 2Z3FA 1AKJA 2H45A 2IQ9H 2YZ1A 3IAPA 4E9YA 4YL9A 3GJFH 3O6LL 1GGYA 4YE4H 3KWUA 3UEQA 3JTSB 3V4PH 3B2VL 4ZO9A 2AP2A 4JFYB 1RUKL 3VXOB 43CAA 3VGGA 4L4TA 4KZCA 4CSSA 5C0DB 3C9NB 1CR9H 2UY6B 3H7BA 5J1AA 3VD5A 2LLNA 3QQ9D 3VXPB 4NC0B 4X5XB 4Q58C 1QTSA 1YN7B 5KVMC 3C5ZA 4J3OH 4Y16C 3FJTA 1SRDA 3I2CH 1CXLA 3S6CA 2EE2A 5FGBC 3CDYA 2Q7NA 5G5DB 1A6ZB 1GGTA 1TVDA 2VL5A 1I8KA 1MCKA 1XAUA 4ZX5A 1ZS8B 3OG6B 1CMOA 4GKSA 1KBVA 1IC0A 5GGRA 2NZ1A 5ERWA 3CG8A 2LAGB 3RZWA 3LPPA 1MI5B 3QZOA 3E0GA 5JXEA 3EUUA 5F9JA 2RGSA 2WYIA 2V4LA 4FFYH 2XICA 3BN9C 2VQ4A 2ED9A 2G2PA 1CL7I 1EJ8A 5D96B 4D9RE 1GSMA 3MV9D 4ETYA 5JMRA 3K1KC 4PJCF 4QHKI 4D9LH 3QUHA 1O6SB 1LDPH 1RIVL 2YFOA 2ZPKH 4P07A 3STLA 4PB9L 1WIOA 2NCMA 2BY3A 3RL2A 1A6AA 3FB7B 2EE3A 3QUZA 1ETA1 3OR7A 4XNUL 3RVUC 3F7LA 3OQRA 4KMLB 1NEPA 4S2SA 3SDXF 1NLDH 4GRWE 1ZVSA 1YN6A 3P3TA 3B7UX 3NCYP 4JHVA 3DIVA 1N4XH 1MPAL 2ZYHA 5EH1A 2DQGL 2UV3A 2DH3A 4WO4C 1T1WB 3UC0H 1KC5L 2APFA 3MRFB 4YDNA 5D5MA 2P43B 3BP5A 2WY3B 4A2MA 3IGAB 3MYZA 4FYTA 1I85A 5C7XL 3MLVH 4HIPA 1CDCA 3P30H 2B59A 4QXGL 1T66C 3NN8A 3PWJB 4M02A 1OE1A 4IBSA 5D2LE 3BVWA 3F58L 5AZEH 4LEOA 1LGVA 4WEBL 5LWYL 2GJ6D 3EG9A 4NQTA 1I8KB 1P4IH 2VL5B 2ENQA 3QI9C 4FJYA 3MRCA 4RMBA 3KBFA 4Y89A 1ZGLP 1RZKH 3WN5C 4Y2DC 4WUUD 4GRWB 1X5AA 2X4NB 5D7JC 4DEUA 4Q6IA 4J2XA 1XH1A 1F4AA 1MIEL 4XPTH 4OFPA 1YPZB 5JQIB 3B9KB 1U8CA 2R39A 4GY4A 4HGKC 3K6SB 1QEWA 3FB5A 1RUQH 4XPAH 4MSWA 3R8QA 1MZZA 3RY5A 4UV4H 5E5MA 4H0LC 3PE9A 4F9PA 4RGNE 4ONHB 3HZVB 2HAZA 2WWMD 2P46B 4HXBH 5FOJA 5DVMA 2KPWA 2X9ZA 2FIRT 1OQOA 2UZXA 3B1TA 4N2DA 5CEZE 1IJ9A 1E67A 3UEZA 1CD9B 2ZSWB 4MAYC 2PR9A 2GSIB 1XIWA 5AAWA 1IGFH 4RVBA 4P2OA 3CBJB 2HKHL 3VE0B 5ID1B 3HG5A 1FJ1B 1YYLL 3O8XA 4CNIB 3P2BA 5D2NC 2FEDD 25C8H 1X4ZA 2NXYD 4WHTA 3SE6A 3UDWA 3GMNA 1M6OA 3IDYC 2NW2A 1XCXA 3QPQD 4ZMYA 4GAJH 2BERA 1V27A 3AWGA 3GSUA 3LN4B 3QEQE 3UZQA 4HUXA 3UPRB 1K4DB 1MDAA 1SXAA 4XN2A 3TTYA 5ECGA 3KWVA 3VG9C 3HC4H 5EPMB 4NNPL 4WI4A 1SJHB 1XSKA 4EO5A 2XHNA 2EKSA 1EX0A 1H5BB 3V10A 1KB9K 1TQSA 1I8MB 2C1OA 2EDYA 2BY1A 4JBSA 5D70L 1RP9A 5BZXA 3F04A 1GYCA 3VH8G 3DOHA 32C2B 1FHGA 3MRRB 4HUCA 1QLEH 1KXQE 4Q0XH 2OSWA 2ESVD 3QDGB 1B2WH 1OT2A 4JRXB 2J3SA 4YHPA 3ZDYF 4P46D 3BHBB 5G4MA 5J1AB 2VDNH 4LVNC 1WD9A 1FL5B 5ANMB 3FQRA 1P6WA 1QI5A 3PLYA 4GLRI 2K8MA 3MRLA 5AFAA 4N1EA 4WU7B 2EDLA 2ZD0A 4QRPD 1SJEB 5KVDE 1A6UH 1QI3A 1QSZA 2VM4A 2O5YL 4GG6B 4JFQA 1EAJA 1KXVC 2KLRA 1NDGA 5TH2A 3CMOH 1WJ3A 3GF8A 4WUUA 3U79A 3M8OH 4QRUB 4A63A 5TD4A 4CSZA 2JF1A 1ET5A 1AZNA 4S1QH 4Z5RA 4BSWB 1WAEA 2VABB 5EIQA 3TBYB 1WFJA 3BH4A 1TETL 3C5ZC 4YAQB 1M2OA 1UA6H 3KPLA 4FHBD 1WH0A 1BBJB 15C8H 2WBJA 3PP4H 1WLHA 4J8RB 2AK1L 4FYRA 2HMID 3S37L 1WCBB 3ZE2B 1UYWH 3IF1A 1H8OA 4JZJA 3M07A 3JWNC 2OPCA 1QRNB 1RZ8B 3RWGB 3TU6A 1BD2D 1JVOA 5KS9E 4A2LA 3I3BA 4FQLH 4E42B 5LBVA 1WE5A 2OJZL 3BWZA 2GJ6B 5FA4A 1PZDA 3MRHB 2AI0L 3U0PB 5FB8A 1K5NB 1A6PA 3WAJA 1HNGA 2ALWA 3NJMA 4AKOA 4LF3A 3VO0A 5A2BA 1OQXA 3FHQA 4DP1X 4DN3L 3RTQA 3K71B 4ODWA 1G0YR 3ZL4H 3DV6B 1HINH 1DQLH 1D9KC 3DUSB 5J3HD 1QFHA 2WXRA 1CD1A 1O75A 5ITFB 1FSKB 2RBLA 1BQLL 3IGKA 2UX6A 5PAZA 5T1KB 1GH7A 3GSNH 3ZO0A 1DEDA 4S1DD 3NZUA 4Y1AE 1F6AB 3J2PA 3UYPA 2Q7YB 4ZW8A 4NRXA 4LVNB 4C83B 1QFUL 3IYLW 4H8WH 4DP6X 2H8PB 2EDFA 3RVVC 4N1HB 5C09D 5GGTH 1NEZB 1N0XH 5F7YC 3W39A 2P5WA 3V55A 4M7JL 3GC3A 4G2AA 3RTQB 3W38A 3K71A 3MGTA 3DHJA 3GMRA 1EH9A 1AXSB 2LFEA 1UB6B 1GCFA 4Y9GA 5CF3A 5ID0B 1MQ8A 2OMXB 1GS7A 1NCAH 3HI6L 3GMOB 2IOIA 1XMWA 1H3PH 5H35A 1NM9A 2OMUB 4LIQH 1ZVHA 2PCFA 1FN4B 2XIDA 2I5YL 1A7OL 4HEMA 1GZHC 1TJXA 2ZOUA 3LMJL 1SQMA 2BVUA 4Y4HA 2KBGA 2VYRE 3IAQA 4YIQB 2YEVB 2UZYA 2ADGB 2EH7H 2GI7A 2PCPA 3ARUA 1KULA 1OGAE 2J73A 3GHPA 1BXUA 2W92A 3TYGL 4EBQH 3RWEA 3MV01 3EGDB 4HIQA 1ZEAH 3TT1H 4B5EA 4XZUB 4PHXA 5KN5B 3MBXL 5DURD 3DO7B 2Q2LA 2VLJB 4PWIA 1ICTA 1PF3A 3GLAA 1N10A 2P5PA 3ZE2E 1ACYL 1U3HA 1PCSA 1UATA 3QFJD 3AU1A 2BIPA 4LQ1A 4R4BB 4Z7UF 4QOKE 4HKJB 4YDJB 3C6LA 5I73B 1JGVH 4FI6A 2OXGB 1M2VB 2A5UA 4B9FA 1GC1H 1HZHH 2UZYB 3A6CL 1RZJL 3K4DA 2BSBA 3AADB 4LVOC 4CJ1A 2Y7LA 4I0PD 4GS7C 5DT1L 4LDCA 4KWUA 4XCFH 1D7FA 4R97B 3H6AA 4I3RH 4W9GC 4B60A 5C6PB 1K4CB 1DQLL 4XOEA 1I75A 2IPUG 4GG6E 1M1SA 3FFCE 3FTGB 4HCFA 4I2XE 1KIRA 1OAXL 1YEHH 3BDYL 2BSCA 2JJTC 4W9LC 3VXME 4KROD 3MLUH 3MRPB 5C7XH 3ZKMC 5IEHA 3EJZD 3F00A 3ULVL 2VR3A 3OD3A 3X12A 1L6ZA 3CVHA 3D09A 3QG7H 4GQ9H 2R0KL 2MPVA 2Z8RA 2A74C 1XGZA 1E5CA 1IKFL 3BN9D 5HHNB 5MENA 2X44D 4PGZA 1DVUA 2X4RB 1IL1A 4DKEH 4DKDC 3ARYA 1LDPL 3RJQB 3M1CA 3IU3A 4KDTA 3ALWA 2WNXA 1N7MH 3RA7H 4JEGB 2EVIA 4WDIB 1GC1C 2YD4A 2ILLA 3V4LA 4KJQD 3QORD 5EFIB 1QX1A 3BZ5A 1LTXA 1KGIA 1M05B 3RFZC 1YCSA 1ZGLM 1Z5LA 2IV8A 3N43F 3KBPA 4HAKA 2ZTBA 4UQ9A 2MSPA 4PYGA 5AVUB 3MRMB 1JWMB 3O6KL 3B2UD 4K9JA 2EEAA 3WEAA 3T71A 1VFAB 4JQIA 4YEFA 3FMGL 4PD4J 3IDNA 3PGCB 5TQ2H 2OSYA 3QUYC 2BP8A 4PJEA 2AXWA 1YNKH 5JIPA 4RWYL 2G60L 3UAJD 3W5MA 3OZKA 5ADPH 3ZRFC 2EECA 1IAIL 4CN6A 1HE8A 1U8PA 2TRYA 1E9OB 2Z65C 1EANA 2DM7A 4YDJA 5GGUB 2R9HC 4DAGH 1KJVA 3FOLA 3QEQD 1XR9A 4PCYA 1XF2B 2WUCH 4PJIB 2OA9A 4I1RA 2ZP0T 2B7DT 2AS5M 2WOYA 3Q44A 3Q5YA 2JJTA 3ZDZF 2FQEA 1J5IA 3HJ0A 1TQTA 1KCVL 1SZNA 1RFDH 1G9NH 2JCWA 1UD5A 2Q86A 3GM8A 4KTDH 1KCLA 4UTBH 5ESAB 3SDCB 3WJMB 3X11B 5C0RH 4L8BB 2J8UE 5D7LB 3UYPB 5DJ0B 2E8ZA 3IXAB 5ACLA 4PG2A 1FG2B 2DEWX 4ADJA 3QO1A 1OAQL 2ESVE 5FV1L 2ZX5A 1ZGLA 5F1OB 3DGCR 3OC5A 4XNUH 5DJCB 3GSVA 3QIWD 3OWRA 3P4NA 5ID0A 4LU5L 1B9KA 3U36B 2OI9B 4MMYB 1TFPA 3HE7D 3HG4A 3Q6FA 4XCNB 1MUJA 3GUFA 4FL4B 5D1QA 3ATFA 1MVUA 4WI5A 4Y8AA 5DHVA 3C60C 4RDBA 5HI4C 2R69L 1HKLL 1OZUA 1BJ1J 1UWEL 2EYSB 4BDVA 4WKZA 4Y1TA 3P77B 2VDKL 4TN9A 1NMCC 4PJIF 2VN7A 2AMUA 2UZPA 3MKGA 3Q9QA 4ONOA 2NR6A 4JAMB 1QR1A 3D5OF 3D8MA 3EJPA 2A6IB 1HH9A 4R3SB 4B9PA 4YC2C 3OGCA 1INEL 43C9B 2OL3H 4WW1A 2WZAA 2MKWA 2H7WA 1FL3A 4WFGE 4KC3B 4V2CB 4ZTOL 4L4JA 2CKBB 2O61A 2VE6A 3QULB 4HX1A 1BD2E 3IMWA 1J12A 2NY7H 5E6YA 3O45A 3UGXA 3SYCA 2F74B 4TUJA 3M1OA 1GS8A 3WEOA 4I4WB 4B6ZA 1G7HA 1QPXA 4MJJA 2ATPA 5B7EA 4PJXA 4KK6C 4PJ5B 3FO1B 4HYTB 2WJ5A 3BH8A 1QHQA 2ZWKA 4HK3N 3M7FB 1MCBA 1G7JA 2CM5A 4BZ1L 4NQCB 2X1PA 1RZQA 1UJTA 2FHCA 1KEGL 1HNFA 4PJFA 4TULH 4R7NB 5B4MC 2I24N 3X11A 3OR6A 4U7SA 3AY4A 2ZCZA 1P5VA 4U1NB 3DTXB 2A74A 1CXKA 2X05A 1W9XA 4LLQB 2CRZA 2IH9A 3BEVB 3RTQC 4D2NA 5T1JA 1XF4B 1T1ZB 1LO4H 3DDGA 1OSZA 2E7HA 2NT1A 4F8PA 2IBZY 3OJDA 1TPXB 5F9WB 1KCUH 1EERB 4Y2OB 3VGBA 4M8VA 5IBTL 4ONHA 1BYPA 5B8CA 1E9QA 5BS0A 3ULVD 3HZ3A 4R7VA 2GABA 2LW3A 4JG9A 5HI5D 3C87A 1J9RA 2X2HA 3MGOB 4ZAKC 3WY4A 4DW2L 2BK8A 4M6AA 3LD8B 2WCGA 4OZGE 1JHTB 4P4KC 3HE6D 1SPDA 3UYOD 4YHOH 3X14A 5LB1A 4UNIA 3QWOB 5EO1B 2NY5L 3MOBH 3W1ZA 2MKLC 5F9DC 4WEMB 3UTOA 3OJ2C 3S36H 4CADA 2J71A 1N6QL 1R17A 4Q9QL 4U33A 3VM5A 1LE9A 1DJYA 3DRTA 4AQ1A 2HFTA 3O4OC 3F58H 4HUXB 5GGRY 4K3DH 4EUPG 3MGOA 1DJZA 4KVNH 3WNLA 1BOYA 1ZVYA 4Y4FA 3KL3A 1NPNA 4J4PC 5I1CL 4FF9A 4E41E 4Y1SA 2J4WL 1MAMH 5FFOA 4AC2A 2X4NA 5T33H 1RZJH 2E9WA 1OM9A 1TJIH 4BKLA 1F58H 2YA0A 5I76A 2R0ZL 1F3JA 3VFTB 4YHOL 2BS71 2Y3NA 5ERWB 4DH2A 1QUNA 3AY4C 2L8AA 4EE2A 2NNAA 4YE4L 3UO1H 1EMTH 3TH3T 3EJQA 3FO2A 5GGSB 4BKLB 1JGEB 3HC0A 1F02I 4I77H 5CJXA 1QTYT 3V0JA 1YNLL 1TTRA 4NUPA 1FNSL 4NNXA 5IIEA 4YDMA 3NUKA 3NP3A 1J8HA 3MRIB 5I17A 2I07A 3WHE0 3BD5A 3Q8EA 5BS0E 3I9GL 5FGCE 5KVDH 2A9CA 2BC4A 2ZCHH 4FI7A 1MXGA 3HE6A 3JWNG 4MAZA 2DQFA 2KHAA 3NVQA 4LSSH 5DVLA 4J3XA 4ODBD 3RWIA 1MWAB 3SOBH 1WA0X 4KRPD 4AGMA 3BT2L 3DK0A 5EU3A 1OPGH 1NGWB 5AALA 1KT2B 2CCWA 2AW2A 3OR7B 1MFDH 5EF0A 1K6QL 3CMGA 3QIUD 5DMGD 4CC1A 2CJUH 4B9JA 3QZWG 2TRHA 1X5JA 3EYUL 4Y16B 3M7OA 1ZS8A 2AERT 1TTBA 4KJYB 1U3JA 4CC0A 4AGNA 1F00I 1Q0YL 4BH7B 3TBVA 4TTGA 1QMUA 3C5SA 4U2YA 1T4KB 4C56E 5MEPA 5E8PA 5EO9A 5SWZE 1F90L 1MIMH 3MNWA 4AQ1C 4ZMAT 2AVGA 2QBWA 5BOPA 5ITBL 3HPLA 3SDCD 3LS4L 4TKWA 1A4KB 2NY0D 4TLSA 3S37X 4P2OB 5E4EC 5L2KE 3RGVA 3B2UC 3ZN6A 1YEDA 1CR9L 1RJYA 2EDRA 2XV6B 5HDQH 4BRVA 3NFSL 1XZ0B 1L9NA 4BUHA 5EBLB 2FO4B 3CSPA 3T77A 4NSKB 1JWSB 1JE6A 3QEHA 5AQ0A 3EF4A 2VR7A 3N1PC 3P9WB 1JRHH 2OP4L 3BISA 1EHKB 5CEYB 3RA7L 5ALCH 5F1NA 2EYTA 5FLVA 1GAFL 4L1SA 3ZKXB 1CIDA 4I9XA 1MPAH 2G2RA 4HUVA 4C83A 2ITEA 5LBSH 4BXVA 4NWTH 1T20A 1J8HB 3MRIA 4PREB 3CLEL 3MROB 5I17B 3DRTB 1IVTA 7FABL 5DFTA 3NCCB 1TENA 4GRLC 5F7DB 4M03A 2XKNA 3A4DA 4HKXA 4IIQA 3KPLB 3VWKB 2B5IB 5E08L 4ZPTA 4BE5A 2WTRB 4JDTH 2R23B 4L5FH 5DJAB 2EEDA 2MFNA 1EHXA 3LZLA 3F62A 3CVHH 3EO0A 1NBVH 5CEXB 3L3HB 2D0HA 4OBRA 4FNSA 4YL4A 1GZPB 4WUUB 1X4YA 2BNQB 3BGAA 4N90D 2X3CA 4NNYB 1AQKL 3QQXA 3E80A 1F42A 3SDAD 5JIIA 2JWYA 5AVVB 1ESOA 2VLME 2P5EB 4HUNB 3X3FH 3OAYK 1S6NA 3AREB 4KKQA 3AQYA 4HT1L 5D2LF 1P7KA 4WIQA 2DQJL 3UO8B 1JJUA 2YKLH 1YYML 1Q9WB 4JKKA 4TF4A 2OK0H 1GSKA 2YPVL 5AKRA 1I82A 2GBUA 2BX5A 1FCCA 1HQRA 1D5IH 3KPPB 4AMKL 2PPCA 2VUYA 2GYSA 2EXWC 4YAQA 3RL1B 3D85B 2ZX7A 4PJ7A 7CGTA 4HWZA 5C9JB 3CN2A 4JPVH 1ZXKA 1Q72H 5E4EB 3P0GB 3DX7B 5HHPA 5CZXD 2X89D 2DJ4A 1I7TB 1SJHA 2FNWA 4LHUG 2W9DL 1PIGA 1J5DA 2DQMA 1O9VA 2JK5A 2OCCB 3OMZA 4WSKA 3QZWA 4FFVC 5FOBB 2WCPA 2CXGA 1F0LA 5JMOC 4FEMA 5D4QA 5D7IF 4IOSD 5KVEE 2I7OA 2V2WB 2BWIA 1XIWD 3FB8A 1RAMA 3HR6A 5I6PA 2YD9A 1RUML 2OX5A 3K0YA 3Q01A 2YPVH 3BHBA 3UCRA 5A2KH 3BGFB 4XCEB 3WDIA 2FJFB 4CNIA 3TPKA 3DLQR 1CCZA 1QNZL 5DGQA 5FWRA 3QI9B 1BZDA 3I3DA 1UQSB 1WFNA 4OM1H 1CICA 4TULL 5CEXA 1ZHBB 2C1OB 1ILSA 3DMMA 1B6UA 5DK0B 4ANUA 3BP7A 1IFGA 1NCTA 4LBAA 4Z8FL 2PW1A 1NANH 4H0HB 4MD4A 3TFKD 2E9IA 4Z7OB 4MDIA 3SDDD 1TCRB 1R47A 2C8NA 2W0KA 3B3BA 2XVBA 4WWKB 2R69A 3NDZE 1HH6B 1HSBA 2NYYC 4H25A 1QRNA 3U2SA 1BVLA 3MRDA 4JM0A 3KL5A 4CJ0A 4GXUM 4PTUB 3NSDA 2R2EA 2V9RA 3MDJA 1O9ZA 1R3JB 3ARBD 2K9FB 4EI5A 3MJ7B 2R1YA 3U6RA 2ARJB 3CPLA 1LYQA 5GRZA 1FGNL 4DCQA 3CFBA 1MFAL 3GHEL 5KYUB 2IWKA 2X6MA 3MRCB 4NRZB 2X6BA 9CGTA 2JJSA 5C0AA 5IMOA 1I3VA 4OH2A 2R4SH 4I3RL 1BZ9A 4NO3A 4PJHE 1AQHA 2RIKA 3D30A 2WO2B 4PGBB 4XMKL 4ZUTB 5AAMC 4BCXA 4GG6A 1U8JA 3CXDH 4FA6A 2J21A 5L88H 2JB5L 4ZXBA 2DQCL 4N2AA 2R8SL 1KJ2L 4Q2ZB 5DWUL 4K3EL 2Q9OA 4IRSD 5CP3A 1KBWA 5EORL 4YDKH 1KTLA 4QWWD 1N26A 3NZHH 3SE9L 1AZRA 4ZX3A 4WW2B 1NOLA 5HHNA 4YVUA 4YLCA 1A1NB 3QXAA 4PRIB 2YD8A 8FABB 3UPAA 4U05A 3LEXB 2FO4A 2J1XA 4G8GB 5KYYB 4DT2A 3RL1A 1KIPA 3D4ZA 2FHBA 1KB3A 4HPYL 4FC3E 3BGMA 3CLFH 4APQB 4FXKC 4K94C 3KPMA 4J6RL 2XWJB 2HVJB 2XG5B 3GI9H 4HH9A 2XA8L 3WL9B 1XH3B 1F2QA 3LKNB 2CZNA 5C0BD 1RULL 1PLBA 2JB5H 1EK3A 3IMTA 3QUXB 4UAHA 3RILA 1DJWA 1PKOA 4BEIA 1WFMA 1KJ2A 1KCRL 1QSED 1R75A 3DX8B 5CCKL 4L4VA 4E9WA 3BUTA 1NMAL 4XOBA 4Z8FH 4GO6B 3MCKB 1VESA 2WBKA 2A77H 1U91A 4PW4A 3S37H 4O02B 2YD6A 1IGYA 3EBAA 4G7VL 3A4EA 1PZ3A 2FBOJ 5A2JH 4DTGH 1AY1L 5ISZB 3I02A 4HJJL 1LP9A 2OV0A 4HOMA 3N9GH 3HAEG 3DHMA 3DX6A 3WN5B 5T5NF 2ARJA 3CPLB 4O4YH 4RMVA 4NQVA 5DZOA 3T4YB 5KSBA 4OZIF 2DIEA 2OL3A 3U9WA 4FQJH 1MFNA 4ELKA 3DX8A 4LIQE 3EJUA 2J88H 3VXQA 1YHPA 4OFYD 1JRHI 2YBGA 4TVSa 4XO8A 3KE0A 3O4LE 5ILTL 4H25B 4PJBF 4APXB 4LSPH 3SPIA 4A7SA 3CFEA 2DQUH 2SEBA 3E38A 1T3FB 1WBYA 2DKMA 4X50A 3IETA 3GIZH 3L1FA 4TQIA 1AR1D 1P84J 4XVSH 4ZUWB 3RX8A 2ZOKA 4WW2C 5F21B 4A55A 5K9OA 2L4OA 3T4AB 4EKJA 2VABA 3QQ4A 4ZD3H 4QXGH 2ZUVA 2WXLA 2CA3A 3VGAC 3WMQA 5MERA 1D9KB 3BFQG 1KIRB 5DR5L 3SKNA 1UZ6E 3JV4B 2LE9A 2EABA 3OV6A 3OZLA 4GAGL 5DYOA 3N1GC 5C0IA 5JQ6H 2YD5A 1A47A 1P84K 2Z34A 4UTAA 3H53A 3RWEB 2BVOA 4JFXA 1G4RA 3H6JA 4QOKD 2E27H 4JJ5A 1A6WH 3ZRCC 3OHXC 2NY3B 5C0CD 1ANUA 2VXQL 1LO3H 2XOTA 1B4LA 1FZKA 1Z3GH 1YC8A 3FSOA 4UQ3A 5CLZA 4DKFL 4O2EB 5BMFH 2BIQA 2GJRA 5K9KA 2HLEB 3MKKA 1FWXA 3VD9A 2GTWB 4NC1C 4G59C 2XG5A 4HH9B 1N68A 4XN1A 3V0IA 1EBPA 3ILPB 3VXTA 2BIOA 3P9MA 1T04A 3POCA 3FFCD 3QUZD 1TVHB 1I1AB 4Y4HD 2RACA 5KBKA 3L6FA 5IROC 3AC0A 5JW4Q 3MV9A 4KXCA 4I88A 1N64L 2JELH 4M61B 5IMMA 3V4PA 1P5UA 5SX4H 3NJXA 3P4NB 3WBDA 3QJVB 3S34L 4XNQB 3GNMH 5AYUL 2Y7OA 2GJZA 4WV1A 4J6IA 2P7TB 1MCHA 4L18A 1RMFL 2WLNA 3RWHA 2AABH 4NRXB 3V6ZA 3MJGX 3ME0B 4JHZA 5EU6B 3ZSTA 3TF7C 1UXLA 4L1HA 2YPLB 1ED3A 5L8JB 5ALBL 3MLSH 4KXBA 3JWOL 2MCPH 2QVMA 5D6CA 5IVNA 4ZBJA 4BA8A 4NWUH 4YJZL 3GPSA 3L3JA 2VDKB 4WGWB 3K80A 3HZKA 1BHGA 3ARGC 2ZOOA 3TWYA 4OGQC 5C07D 2FT8A 1ADQA 2JQAA 3V4VL 1VZHA 5IHLB 5IMOB 1HXYA 2G5UA 2GUOB 2Z4QA 1NFDF 3QULA 5J9PB 1I3RB 2YD3A 2F1AA 4WI0B 2ZUWA 3H42H 1F3DJ 1XR9B 2CGZA 3KJ4C 3WFBH 3RZCD 2IBGA 3U2JA 5LNDA 3TCLA 5CSZA 2PXYD 1HHIB 4YSAA 4XBEL 4AYBA 4LVOB 1NAKL 3NCXA 1FFNA 5L6YH 4X7TA 4QI3A 4KJWD 3QUYB 3PABA 2DWDA 2D0FA 3MLRH 2F18A 1BJ1H 3ERXA 1H6UA 4LRIC 1RZJC 3BKMH 3ES6A 5GZNC 1BBDH 1UD2A 3NIDE 3O9WD 3U6XS 4ZNCD 4P9HL 4FNQA 3RP1A 2YIHA 3DVGB 4NQEB 4KHTH 4PJBE 1MUJB 1OY3B 2DQIL 1R46A 1GJWA 1C8QA 2C1PA 2N7AA 1FH5H 2R7EB 4RSYA 5H2BA 2DMGA 4YSCA 1HDMA 4AV0A 5JORA 1TDQA 4G1EA 3ARBB 4RRPM 2O30A 3UJTL 3O8XD 5K39A 1AR2A 3GTTA 4OM0H 3OAYH 4WSGA 1FHNA 4YR6A 3KGTA 4GFTB 2FX8L 5EV7A 2Y7SA 3FS9A 5IB5A 5EU6D 4AMKH 1HH9B 1WZMA 4CVWA 3G5XB 4NN6C 3G7TA 1RY7B 2R27A 3PHOA 1KN2L 4TUKL 5KYXB 2G3XA 1T0MA 3FMGH 3TA3A 1W0YT 3WEMA 3L9RB 3SDCA 4YWGH 3WJMA 5IP4A 4WV1B 4ZUSB 4Z77B 4I3GA 3QORA 2NNFA 2VITB 2XTLA 4G1EB 4HWBH 1VFAA 3MR9A 1XD0A 4ELMA 1AIZA 4JO1H 2ATKB 5KZCB 1RJLB 5K1NA 1M6UA 2ZNWA 4MKTA 3V5DB 4NP4L 4KUZL 3BLPX 2R4RH 2NTSP 2J2ZB 1B2YA 4C4KT 2F5BH 1YRKA 2DYPA 4JFVA 3WNPA 5IVXB 2YMTA 3IJYA 3TZVD 2BNRD 3VU1A 35C8L 3EKCA 1MCCA 3VFOB 2UXGA 4HDIB 5D1QD 2QSVA 1EUUA 1OAYH 3BWAA 5H37G 4GMTL 5HVHC 5FDWB 3TXAA 4A39A 1DLFH 3DGGA 2CDEA 2HN7A 3A4AA 4YFEA 4RAHA 4OLYH 1QACA 2DWTA 2JJSC 3HUJA 2NX5B 4QNPF 3V0VA 5JR1H 1GRWA 5E6UB 4ZMQA 3BX7C 1GPOH 3HW7A 4GKZA 1NGXB 4KX8A 4LCIH 3BPNC 3U82B 2FATL 5E8OA 2NDGA 1BBDL 1T66D 1EHLH 2ENYA 5AKTA 3U0WH 2CUMA 4LCVA 3MUHL 1BF2A 4JQXA 1NOAA 3MNDA 1BAFH 1J8HE 4M8QA 4OZHE 4UQEA 3VXPA 4F9PC 4ZMOA 4PJ9A 5F7KC 4HZAA 4WK4B 4PSPA 5EB9A 5E9DB 4MNGE 3W0WD 4KKPA 3RU8H 3IRCA 4ZX4A 2IANE 1LK3L 3QDME 3OQ3B 1VZIA 4MQXD 5IMMB 1VFBA 5DRXA 1UA3A 3RL2B 3FNKA 2E7LA 2OAAA 2ZCLH 1A22B 1S7RA 4XOCA 3UYRH 5AVXB 2D7OA 2ENPA 3NZHL 2DKSA 3QORB 3MUGA 3RWIB 3RBSA 4YQXH 4AH2A 1FAIL 2XTJC 4NUQA 2D9QB 4PEEA 2L7EA 1N2RA 1J5OL 3WELA 3V9EA 4XNAA 3EAKA 3HC2A 2EUVA 1PW3A 5FIEA 5F7AA 1KLFA 1T5XA 4J28A 2X09A 3ARTA 1EXUA 1OTUC 3UIZA 3BPLC 2IAMD 1FYTA 5EO0B 2DYPD 2OMWB 3MNVA 4J1UA 4YSUA 2QZQA 2VLKD 5LVEA 4YPGB 2X4PA 3IEAA 3JWNH 4N5EC 2FBJH 4U4BA 2P80D 1R0AH 3T6XA 4QHUB 3STLB 1HZLA 1WIUA 4RZCB 4JANB 1J0ZA 5D72L 1BAWA 2XTJD 2NXZB 3M17A 1URLA 4R4FH 4NUGL 5DFVC 2BC4B 2DV6A 3N44F 4Q14A 1BOGA 3QDJD 3NCFB 2WYTA 5I1CH 2Z93B 5DC2A 3VFOA 1UC6A 2QVFB 4AYFA 2ZX9A 1H15A 4UQBA 1KLGB 1ZWIB 5E56A 5CFHA 3UTTA 4UV7L 1T83C 2F7OA 2D3NA 3T9WA 5IFAH 2I32A 4FTVA 1GHFH 3G6AB 1UM5H 2PN5A 1Z1WA 3MXVL 4XMKH 1OCOB 1N8ZA 3MRJB 4PY8J 4N2NA 3ZMEA 1A6TB 1I3UA 2O5XH 5G4NA 4QRQA 1RD6A 4O51A 4HPOH 2IQAB 3EO9L 2YPLD 1KJ2H 2YMXL 3VU2A 4ZPTB 2BNQE 3GJEB 4MLSA 2ORBL 2VXVL 1CD0A 3RDTD 3KD4A 1OAJA 3VQMA 1TZOA 4HMDA 1WT5C 5AL0A 4YBQC 5C92A 3MV8E 3QA3A 2VMDA 5FKPB 2KLTA 3KDPB 1KG0B 4ABUA 4DUXA 3LHAA 2UVEA 1P5UC 3ZTEA 1MFEL 3QZLA 1AO7D 5H4YA 2OI9C 1KYOK 3MAWA 1G7IA 4NIKB 4RMQA 4HWZB 5CAYB 1I8MA 1XZ0A 3QIWA 1A4JA 3JTBA 1KG0A 4H13C 5E2WH 3BT0A 3I9PA 3WE1A 4AJ0A 2YUWA 5DJ6B 3QRLA 2LTQC 1UWYA 5L2JB 2VXUL 3MRNB 3AWEA 2YLHA 4DPAX 4G6AD 3DYOA 4NKDA 2A9NH 4K5LA 3ULUC 1WCQA 4U1SA 5C0BB 2FECL 2FBJL 1I7UA 2E5EA 5ANMA 5EHFA 3ZDXB 2FR4A 2Y7NA 1M7XA 4QR7A 2MH4A 1BZQK 1N64H 2JELL 2MPAL 3MV8B 2GK2A 4FQQB 2V6HA 3ZKND 4OZFG 1UYWL 1ZPUA 3SKJL 2XXCB 1ZDSA 1DFBL 2JKIS 4J3OD 4N2KA 4N24A 5A6IA 1SVZA 1WDAA 4QRUA 1I8AA 2G4GA 2BRRH 4AV5A 4K94H 3DMMC 2ZX6A 3C5ZB 1SYSA 1MCFA 1T89A 2AJ3B 1W91A 4BRJA 1UXMA 2IXQB 3EDDA 4P23C 4G8EB 3NQKA 4KO9A 2CCLA 4KX7A 2I85A 4FX5A 2IBBA 4KRPB 1T20B 4L5FE 4JZJB 3V2AR 3BJLA 5F0MB 1ZK5A 3BSZL 1DJGA 3NZSA 1RU9L 5C08E 5B39A 4V1DD 5F1NB 2UY7A 2NY4B 1T2JA 2IGFL 3X1BA 3IXTB 3DVNA 5I8EB 4F3FB 4HU2A 4MTMA 4AEHL 4BSWA 2R0KH 1U95A 3UTQA 4W6XB 4PJCA 3SGEI 3S8FB 3FULA 1E5BA 4YHKH 1KYOJ 2XDHA 1II4E 2NXZD 2X5PA 3E6HB 5ICYA 4ALAL 3QA3B 1OALA 5JHLH 4X4ZA 3WLBB 2Z7ZA 3X3FL 3RQ3A 3HS9A 2JIXA 1U2HA 3CZUB 3OKLB 3GSUB 3WY1A 2ARWA 2WSDA 4MCZA 4QRRE 4BKSC 1RPKA 4JO4H 3WO3B 3ULAB 1I8LC 3D3VE 3FONA 3GJEA 1R24A 1AGEB 5EBWA 4XTRD 1NCBH 2Y6TE 1PAZA 3CBRA 3VB8A 1PG7W 1D5ZA 3FUJA 4AIEA 3LKNA 4NOBA 5E2TL 3LD8C 4I18A 3L95A 3TOPA 3T0EA 1AZVA 4AGLA 3SKNB 4ZRGA 3AQZA 1D5MA 1DSWA 1XGYL 2H9GB 5E5LA 4AQAB 2E86A 4Z7NB 5HYQB 4X7SL 1W8OA 5HDWA 3BP4B 4B9ZA 1FFOA 3AITA 2HG5B 4P57A 4X7FC 3G9AB 1OPOA 2WZ5A 5BV7C 1HHGA 4FABH 3WUWB 4IJ3B 2P5EE 3CUPB 3GBML 2FO1A 1ZEAL 3TT1L 3AJ7A 4U0QB 5IG7B 1RHFA 2CMRL 1NBVL 4XNXL 5JHDD 3JTTA 1Q9LB 5AW1B 1KCUL 1SJMA 4KK9D 4AL8H 5JOEA 5AKSA 1EGJH 2JJWA 4LKCA 1QYGL 4F5CA 1CYXA 3VAEA 2X3BA 5CFAA 3B2PA 4ENEC 1F4HA 4EF3A 2BM3A 5DD3H 2A99A 2VDPB 4E2OA 2HX7A 5D4HA 4RGMC 3U4EB 1X5FA 3UAAA 4AYMC 4AWJC 1N8ZB 1TU2B 1BZ9B 1BSIA 1JGIA 2ITDB 5E4IA 4E9LA 1FVCB 1ERNA 3KNBB 1M71B 3WTSA 5AG9A 3G3LA 3U4EA 1P9MC 1D6VL 4G5ZL 3GSNB 2YAOA 3O2DA 1CGSH 2HP4A 3SCMB 1THCA 2AK1H 1INQB 2VDOB 4XVOA 5C0ND 3VQLA 2N3JA 2ZXDA 5E2UL 5ENWB 4HCRH 3OF6A 2WLMA 3DRQA 5A2AA 3HUJF 5C9KA 2W5PA 3PCYA 4YZFF 1E2ZA 4FNPA 2YZ8A 4EIZC 2XZQH 1JN6B 2YHGA 3ESMA 5I2IB 3JUZA 5J5EA 1OB1A 1TCRA 2IBZX 2X1XR 4LCIL 5B3JE 4X4XB 4O5LH 2CPUA 3MA9L 4CSTA 1ZVNA 4ODSL 1IBZA 2A73B 4NM4L 4OD1L 1UZGA 4QTIL 2XQYG 4Y8DC 3KNBA 5MI0C 3SJVD 1JGDB 4MDRA 2O6DA 5B4MD 3AM8A 2WLLA 2FJGA 2X28A 1J1OL 3G5YA 2R4SL 2CJSA 1G7MA 3LPOA 3MBEC 3BEWB 4NO0B 1S9VA 1U6AH 4LRIA 5GZNA 1NEZA 3G5VB 1WTLA 4F1ZA 4OIFA 2K3TA 1QSFA 4JVWA 2OZNA 1B9ZA 4UNUA 5GGVL 3MLTA 3B2MA 2WNGA 3DO3A 5FUOH 5BRZA 3N42F 4LHJB 2OSLA 5AOJA 2LABA 2QVKA 5EEUA 3GDBA 4NYLA 1S7SA 4BFEA 2YD1A 3HG1D 1FN4A 1FRGL 3V6OA 3QUMH 4JFFD 5D8JL 4XNYL 3TFBA 1JPTL 4MZIA 2MCMA 1ZTMA 3V4UL 5I1KL 2MQCA 4LFHG 1KBPA 2OYPA 3KW8A 4UV7H 2UWEB 3SHSA 5HYQA 3RNKA 2CO6B 1IGML 1WFUA 4YXHH 3T1FB 1JUFA 2MTPA 4JM2A 4NBZB 5DZLA 5JA8B 1CDYA 3QE5A 1KEGH 1Y6KR 4EAEA 3RWFB 3UZEC 5E95B 1ZSHA 3ARFB 1A66A 4MAUL 1H6EA 1O0VA 2VNCA 3RNQA 4ELKB 4POYA 5A16A 4IKKA 1NH6A 1RCYA 4GW5B 1INDL 2V37A 4UIMB 4ZFQA 3KMDA 5EUOB 1RZGA 2A9AA 2XUWA 4H7VA 4R90L 1ILUA 4XX5A 4OZ4A 3O3EB 1B88A 5CUSH 5LNEA 4F8OA 5BV7H 4BUQA 5JLZB 4R4ND 5DD5H 3AB0C 4Y19D 1CGYA 4XVUD 4H5SB 3CFCL 5T3XH 1TEGA 1RZGB 2Z92A 2NTFA 1HESA 1QRND 1SHSA 3IN0A 4J3OG 1E50A 4PP2A 5CP3H 4UIKL 5JXAL 1JD7A 3DA0A 4UTAL 1GC1L 2ADGA 2HKFH 4LVEA 3FQWB 1X5HA 2BSSB 4P2AA 5DA0B 4LOUC 3OMAB 4WAFA 1OP3H 1HSAB 12E8H 1XGTA 5LQBH 1AGDA 4HPYH 3KDMB 2KZKA 3WIFA 1UWEH 3O4LD 2L7JA 4OCWL 4QRPA 3MRKB 2EKJA 4PJ5A 1DJHA 3FRUB 4HK0A 4NQCD 1M53A 3U7YL 4WWOA 1OP5K 3HN3A 3H55A 5E9DD 3TCLB 5CWSA 4OV5B 2JB6A 4BFGA 3BVXA 2PTTA 2EZ0D 1RUKH 1ZLSL 3GXTA 4UOW0 1V7MH 5I6XC 5I15L 3O6FA 3Q6GL 5GRUH 2W95A 1TVHA 4R7NA 3RB5A 3ESPA 1N5YH 4KVCH 4S1DC 2W1NA 1NMCB 4LDEB 4AXWB 2NY7L 4ZTEA 1IQWL 5DK2B 5I74B 3SDDC 4DKEL 4HKBA 1AGCA 2KQNA 2PETA 4JFPB 5C0CE 2AQ2A 3GLEA 3GHBH 2XQ0A 2WINA 1JHLL 3AVEA 4J3OC 5JOFB 1P69B 4RFEB 4KJPD 1X9RA 3RWHB 4B0MB 3L4VA 2V3DA 3IDUA 3QFJA 4KROB 4U4IA 4WJ5A 5FR3A 3AUVA 3VMOA 1W2KT 4KZ0A 1E5UI 4D7BA 5B3NA 3O6FB 4IGBD 4TNVF 3ECWA 1MDTA 4AE1A 4DF9A 4TSCL 2CAKA 2NY2B 4M61A 2IC2A 4JM2F 5D1XA 1A6VH 1RQ5A 4BELD 3ZYJA 3PGFL 1NDMA 1PKQA 1Q72L 3TTSA 5C6WH 4KTEH 3P9MB 5HDBF 5DQDL 5KVDL 3N43B 1LEGB 3B9AA 3U9UA 1DUZA 3Q1SL 1IGTB 1SOSA 5T8IA 3DPDA 5INCA 3KR3H 1IAIH 2OYKA 2D4DA 4A6YA 5JOPD 2VLKA 5I66A 2VLJD 3NBNA 4Y4KD 4H88L 5FYJL 2CJUL 1FPTL 2Q3XA 1MFMA 4ODTH 2UZIL 3M45A 2K6WA 3LRMA 1BWWA 4OZHF 1I9JH 3OKDA 4HZ1A 3BAIA 2YSTA 4HJ0C 3TO4A 2OJEB 3JV5A 5E6RB 2O61B 2OKMA 2OXHA 4TSCH 4G72B 4QDGA 5DEJA 2DF3A 2X87A 1XR8A 3WI9A 1E9PA 3VW3L 1SDDB 2EE6A 3DJTA 3MCLH 1NBQA 5B22A 2NY4D 2YRBA 2L7UA 5TGBA 1UOKA 1XF3B 3TV3L 3NCBB 2KERA 4P5TA 4F58L 2HTKD 4B9CA 3ZQWA 3QAZB 2WP3T 1B3IA 2QQKL 4NXSA 1U8LA 3ULUL 3IDXL 2F08A 2FWSA 1PG7H 2HWZH 2MOVA 4P4RB 3TBSA 5E9AA 5L4FA 1IQWH 3SYPA 1V10A 2AABL 1ZPLA 3ISYA 2EDQA 2CPCA 3QJRB 2DQIH 1UM6H 5T3XE 5LGJB 3F7YB 1I7RA 4QF1B 3EYVA 3TEYA 2A2QT 2BXYA 2VCOA 2ZKXA 3L3DB 4D7PA 5J12B 2EEBA 4KKRA 2P4AB 2WVVB 3PHQB 2IAAC 2J8UA 4HZLB 1VFOA 3SE8H 3UTTE 5LBSA 4PPTA 2AGJL 2CHDA 4WRLA 2HJFB 4LLUB 1UACL 3GPEA 2JVUA 3IAGC 4W6YB 5EU6E 1Y1UA 1JK8A 3ESUF 3KLKA 5I24A 1DVXA 2V2XB 2P80A 1IT9H 5ESVB 1UCTA 2AEPH 4KAQH 1KTBA 1T4WA 5JHDB 3DI2B 1WZAA 4AZ8A 1I3RA 3WO4B 3CN4A 4W9FC 3P9LB 1QSVA 1ZMYA 3MV8D 4FL4C 4U3CA 4K3HA 5HYIA 1W15A 2E7BA 2EVHA 5F3FA 2EIKB 4G6FB 1QBLH 3HUJB 2NX5E 3K4AA 1UEMA 3UTTB 1CFTB 1QYGH 4M3KB 5EC1B 3H3PL 4EUPH