1A4CA

Azurin mutant with met 121 replaced by his, ph 3.5 crystal form, data collected at-180 degrees celsius
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
AQCEATIESNDAMQYDLKEMVVDKSCKQFTVHLKHVGKMAKSAMGHNWVLTKEADKEGVATDGMNAGLAQDYVKAGDTRVIAHTKVIGGGESDSVTFDVSKLTPGEAYAYFCSFPGHWAMHKGTLKLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rack-induced metal binding vs. flexibility: Met121His azurin crystal structures at different pH.
pubmed doi rcsb
source organism Achromobacter denitrificans
molecule tags Electron transport
molecule keywords AZURIN
total genus 35
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1a4cA00
3EHBB 1EHKB 4GYBA 1BAWA 2EIJB 1PLAA 5AZUA 5LDUA 5I5MA 3ERXA 3OD3A 2EILB 4KO7A 3ABLB 3KW8A 3CVCA 4E9QA 1OCCB 1NDTA 3QJVB 1PZCA 2VMJA 3BQVA 4GY4A 4YSCA 2UX6A 2YAQA 2IH8A 3NSCA 1MG2C 2GC7C 4HZ1A 2XXGA 1BQRA 1GSKA 1BQ5A 1ILSA 1AOZA 2B08A 4BK5C 2IWEA 4BWTA 2HZHA 1J9QA 1ASQA 2XX0A 1BXAA 2BO0A 2PPAA 1OE1A 5I5JA 2Y69B 1J9SA 4KO9A 3UGEA 1W8EA 2YAHA 1OE2A 4F2FA 4A2EA 2BHFA 4E9TA 3WKPA 2AFNA 2PPEA 1M9WA 4GP4B 4YSTA 1AG6A 2IWFA 3QJTB 1XMEB 1J9TA 1KGYE 3ABMB 2AZUA 3AZUA 2DWSA 2PPFA 4M3HA 1M57B 3NSFA 4FA7B 3FYIB 1N70A 4DPBX 4KOCA 1JZFA 4HIPA 1PNCA 4KNSA 4N4YB 3TBCA 3MBWB 1GS7A 3UADA 1JOIA 1KDIA 4W1TA 3V9CA 4G7SB 1L9SA 1AZUA 2HRHA 2JFCA 1NIEA 4Q89A 4GXFA 1JXDA 3CG8A 3NJNA 4ZK8A 3X1NA 1ZIAA 4YVUA 4JHUA 4BWUA 1A4CA 3G5WA 1YLBB 4A2DA 2R7EB 4HALA 1BEXA 4G7RB 1TU2A 1PF3A 2HX7A 4DP1X 1AS7A 2HXAA 2DYRB 4TXVB 3FU8A 4HHGA 4Q8BA 3FPYA 2NRDA 1L9OA 1JZGA 4QKTA 2CAKA 1MZYA 1IC0A 2UXGA 6PCYA 1BYPA 2XX1A 1JXGA 1R1CA 4GP5B 1E67A 2YXWA 1OV8A 2IH9A 1AIZA 2YAFA 5B7EA 1BXUA 1OF0A 2BWIA 3PAVA 5D4JA 2OJ1A 4PAZA 4MFHA 2XYBA 1PNDA 3NYKA 1W6WA 2VSKB 4YSRA 2PP7A 1GY2A 5TK4A 2UX7A 4X4KA 1E5YA 4YSUA 3QJSB 2HRGA 5I6MA 1CURA 3EH5B 2HX8A 3WIAA 1NPNA 1AS6A 1DYZA 2DV6A 4KO5A 3AY2A 2Q5BA 2DY2A 1L9TA 2QDWA 3QJRB 1CYXA 2FT6A 1JVLA 4CSZA 4NERA 3IN2A 2UXFA 3MX0B 4KNUA 4UANA 1JERA 2TSAA 4EF3A 3S8FB 5TK2A 4WKXA 3CVDA 2BW5A 2H47C 3NP4A 3PPSA 3H56A 2WO3B 2GIMA 4JKNA 3OMAB 2UXTA 3FPXA 4A66A 2EIKB 4YSDA 4F7KA 2JKWA 1IKOP 3FYEB 1NWPA 3OQRA 3V9EA 1PY0A 2A3TA 4DP0X 3CDZB 1A4AA 3NJIA 1B3IA 8PAZA 5B3SB 1OCRB 1PZBA 3ZIYA 1TEFA 4A68A 1WA2X 1ZDSA 2DWTA 3FQ1A 3H4FA 4YSQA 4DP9X 3AG2B 1WA1X 3DTUB 4ENZA 2YQBA 3NJGA 4KOBA 4M4RB 5A7EA 2UXVA 3JTBA 4A2GA 4HCIA 1XB8A 2X87A 3PLYA 1ET5A 3T6VA 1J5CA 3C75A 5I26A 1ET8A 2EINB 2Q9OA 4DP2X 3CVBA 1AZCA 2CUAA 3AG1B 1DZ0A 4BXSV 2J55A 1BQKA 2P80A 2YARA 1NIAA 1EZLA 3ABGA 4G7QB 3FSZA 2RACA 3UABA 1JZEA 3FSVA 3UACA 1V55B 1PLCA 1HFUA 1NTDA 2AANA 1I53A 1SF5A 4KNTA 3TBBA 1BYOA 1AACA 1ZDQA 2DYSB 3NP3A 2VN3A 3PCYA 3HB3B 3T6XA 2HX9A 1AZRA 3EH4B 3N55A 3QQXA 4A67A 3ZBMA 3IEAA 4E9YA 3TU6A 2R7EA 2IWKA 1ID2A 4AKPA 5I6OA 4KO6A 3CZUB 1JXFA 4AX3A 4HCFA 5B7MA 4NB7A 3S3CB 1VLXA 2IDFA 2OV0A 1WS8A 2TSBA 2XV2A 1IUZA 3KW7A 4DP4X 3SBRA 1OCOB 5B1JA 2XWZA 3AW5A 3NSYA 3BVDB 4NAJA 3AG4B 3IBOA 3UAEA 5IY5B 1QHQA 2J5WA 4BDVB 2IDQA 1JVOA 3S8GB 1AANA 2OCCB 4QLWA 4P5RA 2ZONA 1ADWA 3SBQA 3X1GA 1J5DA 3FQ2A 4A2FA 2PP9A 2WO2B 4YL4A 2GI0A 3S3BB 4AKQA 3EF4A 2CALA 1WAEA 2VW7A 1KDJA 2N0MA 1E30A 1GW0A 3WI9A 5D4IA 7PAZA 2XV3A 1WS7A 5I6KA 5FC9A 2VM3A 4GP8B 2I7SA 4E9WA 2IDSA 4PCYA 1PZAA 5I5IA 2E86A 4G72B 1OCZB 4HHWA 5B1KA 3WNIA 3GYRA 3PAZA 2WSDA 3NJFA 2ZOOA 4E9XA 3DKHA 4CSPA 3QJUB 4RH4A 1AAJA 1PLBA 5I6PA 1SHXA 4HAKA 1OE3A 2PCFA 1QLEB 3NJHA 4AZUA 2GHZA 4W9ZA 1E5ZA 1RZPA 2P80D 1AZNA 4F2EA 2HLEB 1CUOA 5EHFA 3T9WA 1L9PA 1NICA 1RKRA 4UF7C 2XV0A 2YAOA 2ZWNA 4P5SA 1SDDB 2I7OA 1A4BA 1FA4A 3FS9A 1WA0X 1QNIA 4A2HA 1SFDA 3JT2A 2EIMB 5ANHA 5I28A 1MDAA 1URIA 1NZRA 1GR7A 2B3IA 1XB6A 2MRYA 3GXUB 1V10A 3FSAA 3FU9A 5PCYA 2JXMA 1GY1A 1RZQA 3FU7B 1TKWA 1PCSA 1N68A 3CDZA 1NWOA 4DP6X 1T5KA 3EH3B 3OM3B 2LLNA 5AFAA 1OOWA 1L9QA 3QJQB 4WTQA 2BZ7A 2J56A 2VW6A 1X9RA 2YXVA 3WG7B 4BWWA 1FFTB 3T6WA 1JZJA 2PPCA 2CBPA 1KCWA 2FJSA 3IN0A 3DIVA 4YSAA 2AZAA 5B1BB 5B7FA 4DP7X 3N2JA 4DPAX 2FQEA 5F7AA 3NJMA 5B1JC 3FT0A 4YSPA 1W6LA 2YAMA 5I6NA 3X1FA 1SNRA 4YSSA 1GYCA 2H5UA 3SBPA 3PAUA 2H3XC 2ZXWB 3U25A 1NIFA 2VSMB 1MZZA 4E9VA 5PAZA 2PPDA 2PLTA 1SJMA 1X9UA 2XU9A 3ASNB 1KCBA 2W88A 1XB3A 7PCYA 3PXLA 1BXVA 3D12B 3NJKA 4HCGA 2BZCA 2FQFA 1A65A 2FQGA 3WNJA 3ABKB 2XXFA 1JZIA 2IDTA 2PCYA 2VM4A 4YSEA 3HEIB 2AVFA 1UATA 1ASOA 2BP8A 2QDVA 3ZDWA 3WKQA 1F56A 1HAUA 3NT0A 1KV7A 1SF3A 3OMNB 2IDUA 2QT6A 4G70B 1ET7A 2GC4C 1PAZA 1GS8A 1CC3A 1NPJA 2BP0A 4BDVA 2YAEA 3X1BA 3H4HA 1TEGA 3ZX1A 1E65A 1NINA 1J9RA 2XLLA 2PP8A 3T6ZA 2QPEB 4G71B 4DP8X 1ILUA 3IE9A 2VW4A 4K9JA 5AKRA 3NSDA 2BP8B 4YVNA 3FSWA 2FT7A 4N8UA 1RCYA 1ZV2A 1AG0A 1IBYA 1MG3C 2X88A 2BW4A 3OMIB 4BXVA 2GBAA 5E9NA 1AQ8A 1FWXA 3AG3B 3TA4D 3SQRA 1AZBA 4YSOA 3X2QB 1NIDA 1IBZA 2FTAA 2BP0B 2QPDB 3X1EA 1NIBA 1PMYA 1ASPA 3UAAA 2FQDA 1GS6X 1V54B 1ZPUA 5F7BA 1CYWA 2J57A 4L0PB 3T71A 2Y1AA 1L9RA 1AS8A 4UAHA 5D4HA 5I6LA 1M56B 3RYMA 3QPKA 2GSMB 3L45A 2CCWA 2I85A 3ASOB 1KYAA 1SFHA 2GB2A 4AI7A 1A8ZA 1HAWA 2XUWA 2FNWA 3FU7A 2W8CA 2FWLB 4AKOA 3GDCA 1KBVA 2IAAC 4DP5X 1SDDA 1A3ZA 2CJ3A 2FT8A 2MTAA 3NJLA 3NJJA 4DPCX 9PCYA 1ZIBA 3S3DB 4E9SA 2BWDA 4E9RA 2YAPA 1ETJA 4JHVA 1AR1B 1SHWA 2XVBA 4FAAB 6PAZA 5B1AB 3FQYA 1JZHA 1KBWA 3TASA
chains in the Genus database with same CATH superfamily
2FBJH 3F65A 5L7XH 4OT1L 4YE0A 2CBQA 4JFHD 5KZCB 2HLAA 4NO2A 2EIEA 3BX7C 5K9KA 3FFOA 3FL7A 4IRZH 2OYPA 3KPOB 5E95B 1U8QA 1WIUA 2BSSB 2PW2A 4M03A 3HLAB 2VMJA 1JNLL 3PFUA 1JN6A 5KBDA 1MRFL 2ITDB 4BJLA 4TUJB 2VIRA 1E7VA 4H8VA 2QLYA 1CK0L 3APFA 3K72A 1AIFB 2VITA 4K5OA 2DL9A 1JHLL 5GRVK 1EHNA 2APTA 4YBHA 1OTTD 1RHHB 2Y69B 3LQAC 1GGIH 3F5WB 2VJ0A 2M8XA 3MCKA 4HLEA 1NH6A 2WLHA 4FZEH 4TSAL 5ANMB 4F2FA 1E2ZA 1YAIA 1TZHB 2UY6B 1U8IB 4JQIL 4U1LA 2IWFA 4M6MH 2ARWA 2YGNA 2HUEA 3GSOB 5J6HB 4DGIL 2DICA 4KK6C 1RJZB 5CLZA 3ZE1B 4AK2A 5C9JB 3B56A 1P2CA 2J6EH 2H26B 3OXSB 4NUGH 5I8CB 4GSUA 1TJHL 4FLHA 1JZFA 3HRZB 3FN9A 4HIPA 1UB6B 3ZO9A 2WAHA 2A6IB 1L3WA 4XE0A 4WW2F 3FQUB 4MYPA 3APDA 4W9KC 1Z5HA 5EB9A 5IMOA 1MIMH 2ICEC 1L9SA 3IJYB 4B7IA 1D2PA 5IIEB 2ICES 3A3YB 2WIMA 4XMKH 3NN8B 3QH3B 4Q6IC 1IC7H 3I3BA 1P5UB 2X1QA 3CG8A 1IL1B 2Z8RA 2QR0B 4TNGA 1F4WL 3TLRA 3MJGX 5DRWA 1JZ4A 1KWGA 3MR9A 1KG0A 1OVZA 3QG7L 4WU5B 3UGUA 4F7CB 4KQ3H 3RWGA 1AO7E 2OZ4L 3GSWB 2C9RA 2DJUA 4PJ9A 1AS7A 5GS1B 1ZLDA 4XC3L 1WFUA 3FU8A 1WAAA 4AL8L 3MNVA 4XI5C 2ZUQB 4OY9A 4Q6IB 4W68A 3TXAA 5HJBA 2CGRL 4MBOA 2CJUL 4KDTC 1V05A 1T0NB 2DIJA 2NX5B 4JFYB 5F1IB 1HYSC 2PCXA 1AY1H 4I5BA 3HKZA 4ZUVA 2XX1A 1EMTH 2O5ZH 5KN5A 4N0CC 1J88A 4JQIA 3SKOA 1DLFL 3CPUA 3B1TA 4R2GD 4YHIB 4Y2OB 1LK3L 2CLVB 4Y19E 1KIQB 4H7VA 5DHVH 4F8QA 1H3GA 3MXWH 3OKMA 2F74B 5DGRA 2WVVB 1HHJB 2BHZA 3PAVA 3ZTNL 1P7QD 1E8WA 1YYLH 4EUPH 1AXIB 5DQJB 4APQA 5T1LD 4PRAB 1TLMA 2VERN 3CZKA 5HGAA 3TOPA 4C56B 3KYOB 3E1F1 2IH1B 4ODXB 4LSVH 5IHZA 1QEWB 1WISA 2FEJA 5KS9A 4X4KA 1OAXL 4CL7A 1UM5H 1ZTXE 1QQDA 4WU7A 1CFNA 2E56A 4JO1H 4L8CB 4B9GA 1OTUD 1R9FA 5CWSB 4F33B 4U7KA 5J12B 5IB4A 1KJVA 2Z8VC 5DEGB 4FQXA 1BQLL 1PKQA 4BSVB 4NJAL 3U4KA 2KDGA 1AKPA 1U8LB 4NHCL 1VEOA 1MF2H 3DV4B 1BVZA 1LILA 3FTSA 5SWZB 3ZO0A 1LP9E 4GUOA 4ZFOA 1G9ML 3C2AH 3FUIA 1AOHA 2C34A 3LPFA 1G9EA 2PR9A 4OW6A 3IAPA 1JWSA 5C0AA 3ZDXF 5IHHA 2IANB 3UZQB 1NC2A 4XXWC 4PQXA 1TTFA 1A8JH 4JKNA 2DIBA 4L3EA 4L9LB 5JHMA 3H53A 1Q9WA 1BEYH 1X4XA 3JUYA 2EIKB 5I73B 3HG5A 5INCA 1P4BH 5GRUL 3UJTH 5EEWA 3G5XA 3IETB 3OQRA 4JN2B 3VH8A 1W2KT 5IMLA 5ADOH 1F86A 1IM9B 3GLDA 3NIFE 1GJWA 5ANMA 2Q8BH 1AQMA 5HI4C 5LB1A 1VEMA 1RZGB 3OR7B 1I9EA 2ARJB 3P4MB 3ZE0F 1B0GA 2EDNA 2H41A 4LSTL 2XXMB 3EH1A 4Z7VA 2NLJB 4P2QE 3ZKNC 1JPFB 3VFTA 2O61A 2VXVH 3FQNA 4HK3N 4JFSA 3N9GH 2BP5M 1HINL 2H26A 3I6SA 3TV8A 4YBLC 4ZFOL 4M4RB 3ZU8A 2ESVA 2MMXA 1HSAB 4YIQB 3PXJA 1KTBA 5DFVC 5ICXA 2OL3H 4DK5A 3RI5F 4KRMB 3H42L 3RGVB 1ANUA 2PO6C 1CE6B 2F8OA 4QRTB 3ZKSD 5HXMA 1USZA 1BQKA 3B9KD 3GJFK 3N41F 1HTYA 1JVKA 3F7YB 4PBWD 5GRZA 5C6PB 1EHLL 4XO4A 3UACA 5EIIB 1G7MB 3RBGA 4BSWA 3BDXA 1PLCA 2HB0A 4YBLB 4C8XA 1A6WL 3F7VB 1WZ1H 1AACA 1CFMA 4FNSA 4P4KD 5FYKD 5IBTH 1DVFA 1KG0B 1U0QA 1MY7A 4IM8A 1AVAA 3BYYA 4E5XG 1TTGA 4N26A 2R1XB 2VL4A 1T7XA 4I48A 3TEZA 3VSTA 1FLTX 2LE9A 1V7ML 3N55A 1EO8H 1BM3L 5CHNB 4FMKA 4XCNA 4WO4D 3NUKA 1XEDA 5E6UB 4F15B 1G7PA 1D5ZA 5I8OL 2IV9A 4XRCB 3KPQB 3P30H 1OD9A 2EO1A 4IHOB 2PWHA 5K9QG 4H8WH 1Z3GL 3OKYA 4KROC 2F54E 3FBKA 1GC1H 4NKOA 3VWJB 4Z7UE 5BUPA 3A47A 5GGTH 3S0PA 3UAEA 1JK9B 1D9KA 1MHHA 3KPSB 3UTPD 4JDTL 3QHFH 4YHPA 4E42B 1ZT4A 4JGJA 4P5RA 4IS6B 5BOPA 4X5PA 4Q9RH 2IPKA 4Y88A 3T77B 1I31A 1IM3A 3BUTA 1WT5A 3AQDA 3G5YA 4A2FA 4UQEA 4HPYH 3F8UB 2R56L 4BKLB 3NA4A 5HHVH 3MLZH 4KROB 1FC2D 3DXAA 2RFXA 3RUGE 1BAGA 3SIKA 4F8LA 4NN6B 1H3WM 2YLKA 5J13C 1KGJA 2V2WA 4PMEA 5C0NC 1BD2A 1PZAA 2MKWA 5I5IA 1FLRH 3DUUA 4Y9FA 1SJHA 4CVXB 3L13A 2ZE0A 3D5OF 3SDYL 4DKTA 1Q0XH 3IAGC 1H6EA 5F7YC 2R0LH 1NKOA 3UX9B 4PB9H 1NFDE 1INEL 1T1YA 3WHE1 1N26A 4LSSL 4N2EA 4FD0A 4JDVB 3ULUH 4FG6D 4CGUB 1OGAD 4N6RA 2OMYA 3L4ZA 1SBBA 4A7VA 4AQZA 2E27L 3G5ZB 1G7JB 3LIZA 4KQ4H 3AB0B 4BGLA 2R2BA 1L9PA 2VMDA 4PV1C 2XTSA 2R69H 4UB0H 2EDTA 2ZUVA 2ZXCA 4E9LA 5DRZA 5T1DH 1R3LB 4OZGB 4OVUA 2DEWX 1I1CA 4WZ9A 4BFEA 1AXTH 1CIDA 1FNGA 4G6FD 1CR9H 2B3IA 2MRYA 4GJTB 4ZMOA 1MFCH 2E4TA 5DD0H 3I85A 3RLSA 3DOSA 1ORSA 3TESA 4OZGF 2YBRA 4K8RD 3ULSB 4LVHC 3IGLA 5LWYH 2AJUH 3RU8H 3P4OB 3UBXB 2VDPL 5J57B 1U58B 2PKDA 4XXCA 4OSUL 1A1OB 3X13A 4I0PA 3MZGB 2H6PA 1EJFA 5I19L 1JGEB 5EC2B 1F13A 4HKZA 1X5GA 35C8H 3ZQ9A 2CHZA 3INUH 1H19A 3WNNA 4P5MA 3PDOB 2UZXA 3LQZA 4PJFE 4V1DB 3V0FA 3LHPL 3HHRB 2W81C 4AEHL 3CLWA 3CFUA 5ECJE 4WHCA 3V8CA 5I1KH 1OAXH 4OCRH 4ONOA 2H3XC 4JK0D 5K39B 3P0VL 4E41E 1X5ZA 4X8CA 5ICUA 3QDHA 4S11A 3ARQA 1ZLSH 3VXRE 3G6JF 3VGBA 1KCBA 4OIAA 4OU3A 4IRZA 1U8QB 1T21B 3WFEH 4KTGA 2K4WA 5D2LB 1BBDL 2BJML 1ZANL 2I9TB 2RIKA 2EDFA 2WO4A 1A5FH 1KENH 3MACL 1N3NA 4M1CC 2ZNWA 4KZDH 3TBYB 2PCYA 1U42A 2YXFA 3PF2A 1BCIA 1KFGA 3HEIB 4JFXB 1ZVSA 4Y8DC 1NMCB 3SE9H 4NQCB 3ZDWA 1E8ZA 3WKQA 3Q7JA 2NZ9D 2YKKA 2Q20A 3NT0A 1WWCA 2ICWA 4F7TB 1T2XA 3CH1A 3KCWA 5D72H 2HH0H 1F3JB 1TZOA 3AQZA 1PZ3A 2AABH 3BGMB 5DC2A 5JPMA 1JI1A 1TTRA 4MB1A 2J4WH 1DUZA 5TTRA 1F8TH 4WTXA 2WWNA 4GAGL 4J3OD 1VADB 4LSTH 4UIKH 3EHBC 3Q8AA 1SBSH 4PRHA 1T1YB 1IGJA 4ODBD 4X4ME 1UB6A 3MZTA 3T2LA 2NUPB 3PL6C 4LARH 2F1BA 2ZWKA 5F7EH 5CF3A 5ITBL 3MCKB 1UA6H 1KLGA 3G5ZA 2YFNA 3OHXC 1PD1A 5JPNB 2I24N 2ZKMX 4OIIH 3CZFB 4DJMA 4DK3A 2EYRA 3QHTC 5LO7A 4GBXA 3VXQA 3P73A 1F4WH 2DLEA 4XB8A 3X1EA 2A6JA 1MRDH 4LNVA 2MHAA 1S7WB 3UAAA 1J8SA 1JK8A 5D7JA 2WSKA 1E4XH 2FR4B 4R4BB 4FNLH 1FNLA 3G5VB 2ZYRA 2G9HB 3FOLB 5KBPA 4BFIB 1DJXA 2EO9A 2CRMA 3Q1SH 1BZDA 3KPTA 4WSGA 3JZYA 2ADGA 3WGUB 1EO8L 1OGAA 5CEYB 1N2RB 3TEYA 4PGEA 1FNSH 1VA9A 4U6VL 1A8ZA 5IVXA 2CDFB 1VJSA 2EAEA 4HKJA 4P9ML 3C60B 4JUTA 1KIQA 2ZUTA 1LNUB 2ZXDA 5KSAC 2CJ3A 5LCVA 2ZWLT 4R8WH 4WNJA 3L3IA 1Q9LA 3HUJF 3RL1B 2YGOA 2JNZA 5IKCB 1OQXA 2GTQA 3NFPB 2X2HA 4MJ4A 3TASA 3FULA 4PJBE 3UPAA 2LQRA 4QHMB 5CN3A 3FMGH 5LDUA 4F80A 4DUWA 3UCQA 3FFCB 4OJDH 2PW1B 2YN3A 3MKKA 1HILB 2Y4SA 3JWNE 2IXQB 5IFHL 4A1RA 2J21A 1FVEB 4HHAA 2IALB 2L04A 1BQRA 4JGNA 2CLVA 4PJ8C 2Y1YA 4NRXA 2WXMA 2XN9D 1BFOB 4RIRB 3CZLA 4JGUA 5EO1B 1IBBA 1HN1A 5I5JA 3S2CA 2HTLD 1ZTXH 2XDHA 3GKZA 4KO9A 3D0VB 3DJSA 2Z0UA 5D6DC 1OXYA 2V2XB 3FRUA 4DZ8A 2CKBH 3VD0A 3IDNA 2Y22A 3BCFA 4Y2DC 1PZUB 3QJTB 4H40A 4QXGL 4JCMA 1T2QL 2DYPD 1DANT 1UZ6E 4YDVA 4ELMF 2CO7A 2YHGA 3SE9L 1YEJL 3IGAA 1SYVB 2X9ZA 4GRLD 3S34L 1NCGA 3JWNC 2V17L 3IJHB 2WP3T 4AYFA 3ULUE 4XVUC 5I0YA 1RD6A 1QW8A 3ZKXC 4U05A 1F58L 2J1WA 1D5IL 2AQ1A 3E8UH 1CLZL 4NNXA 4PG2C 1L9MA 2JJWA 4ODSL 5DVNA 4K7PX 3GBDA 3WO4B 1XGPB 3QI9A 1YJDL 3E0GA 4DEPB 3CBKB 1IBDA 1KY6A 3VFPA 1IFHL 4MMXC 3UFIA 4QRPA 4AK1A 5IHWA 3DURB 2FVNA 3UBHA 1WEJH 4QWWD 2NY4B 3EHBD 3QEGL 1MOEA 4JJ5A 3QQ3A 3R4RA 3QG7H 4HALA 1AQDA 1EVTC 3Q3GA 4GRWE 3QBTB 3CZFA 2Z35B 3QORC 1GKOA 1T5XA 4TXVB 5INCB 3SCMC 1TZHA 3OC8A 1TYJA 4KXAA 5DTFB 4PV8A 4C55A 3OLDA 5FDWB 2RBLA 5BW7C 3WXWL 1JZGA 2ZUXA 5AYUL 3E7JA 3PWLB 3NCFB 4JN1L 1A4KA 1F4AA 3TA3A 4J3OF 3LN4A 4DUXA 5KG9B 1CJYA 2FD6H 4KI5C 5HI5C 3UTQB 2P5EE 2R0WH 5LGKA 1DP0A 1OARH 5EBLA 2ZT9C 5IM7A 4XRCA 3BP4A 3I9AA 1VAHA 1OF0A 4H20L 4R9HA 4DKFL 2WXKA 3MLPA 2X4OA 4AVKA 3OAUL 4FX5A 2GK0A 4ZTPL 1JGIA 2ZCLH 4HQQL 1R4XA 1KT2B 3GLAA 2YA0A 3TONA 5B22A 4PGCA 2P5ED 1G6RH 4Y1AB 5DYFA 3DX3A 4JDTH 5G4OA 4GIPD 4HD9A 4FNQA 3D30A 2R0ZH 3ATFA 3VNYA 3H0TB 3VD7A 5D7IA 4YHNB 3QA3B 3ZYJA 3O8XA 1QR1B 3QQNA 3BO8B 5KYWB 3D08A 2FL5A 5EA0H 1Q9KB 2OS7A 4P23D 5DZ9A 4JPVH 2C3GA 3IN2A 3WFBH 5F89B 3SOBL 3MA9L 3TV3H 4L48A 5KSBE 2L7JA 1MFEL 3RKDD 1XF5B 3TNMB 2CHWA 4JHAH 4CN4A 2JIXD 5JHDE 2EDXA 2Z92B 2V9TA 2Z0BA 2YQ3A 3DUUB 3FPXA 1FLRL 4LLDA 4Q9QL 3FQRA 1NCNA 3T0EA 1P1ZA 4NWTH 4JM2A 3PWJB 3LTVA 2DMBA 4G6JH 4HS6A 5GGUB 2EDDA 3NJIA 3EGDB 3WIHL 5EEZA 4G7VL 2NY3B 1HHJA 3DX2A 4LFHG 4N2GA 5C0BD 2E6PA 2LAAA 1WD8A 1IU1A 1N67A 5I30L 3N3EA 3DUHA 4P5KB 3ARFA 2WZPA 4XXDA 3WEMA 4B50A 3CUPA 1T4WA 1DQML 4JRYE 2DWTA 1CN4A 3QIBD 3H4FA 4ERSH 4ESKA 2IBBA 3ULVF 1JD9A 1ZT4B 2FBJL 5HHME 5EBGA 5LNDA 5B3JF 1EUTA 3BKCH 4GQQA 1JFHA 4L23A 4B9PA 4UIMB 5EOQL 3UTTE 4A2GA 3QORD 4Y16C 3PLYA 2I69A 4L8DB 2JCWA 2MSPA 2H8PA 2Q3AA 3GMRB 4GT0A 4N1HB 2EVHA 4IMKC 4CU6A 4UT6L 3S5LA 3GMMA 3BD3A 1VERA 1D7BA 4GSQA 4JPWL 4L05A 1I75A 3K71B 3NSXA 2GBTA 2ZP8A 2VXUL 1TOXA 2WLLA 4K7FB 4Q4IA 4FFYH 3FSVA 3GSOA 2O72A 3DNKA 4PU2A 3D34A 4R5TA 2QBWA 5J56B 4P59L 2YA2A 1WZ1L 5GS0H 4OVVA 2VWEE 4JDEB 1HDMA 1Z0MA 2X5PA 4OCYL 1HVXA 4PLOB 5CCJA 2AK1L 2EXWC 3CH8A 1L7TH 3HVDA 3KPRE 4OB5L 4IBVA 5DJCB 1HXMA 1VFAB 1NLDH 4XO5A 5EOCJ 4IJTA 1NBVL 4M1DH 2VXSL 1OO2A 1RZJL 1F6LL 3RILA 3Q8FA 4ZMLA 2D7TL 4G80A 1CL7I 3KPNB 2WM0A 1CLOL 4PYHA 3HB3C 5B1JA 2Y06L 2IV8A 4UYPA 4A6YL 1FFRA 1WWBX 2OMTA 2WANA 2HT4C 4AUUA 1FYTD 2Y72A 2IAND 4OZGE 2D4FA 2VL5A 1C16B 3FQ2A 3BPCA 2ICCA 5MHSD 4IK6A 3VFMB 2FYVA 3GD1C 3M6DA 3ILEA 3W3BA 4Y5YC 3S3BB 4NENB 2C4FT 5D1ZI 1OB1B 1E30A 1X4ZA 4M4PA 4PRPB 3WEBA 5FECB 4UM8B 4A63A 2BS71 3W38A 4LGRB 4M7JH 4GAFB 1NUNB 5KVMC 5D71H 5D8JH 1W72H 3QEQD 3U4AA 4O2FB 4E9WA 4F33A 1B9KA 4H0IA 2CGRH 5JYMA 3SE6A 5B1KA 1U3HC 1NCBH 1D9KD 1H3XA 1QI4A 2NXZB 5LG6A 5GZNA 1MFEH 4E9XA 5KS9B 1UENA 3QW9A 5ESQA 4CVWA 5D72L 1OAQL 2V4LA 4RH4A 2X05A 1UEMA 2A6KB 3MLRH 5IVZB 3FQRB 4X6DE 1MWAL 3NJHA 4NN7B 2A4EA 1FIGH 1IC4H 2V2TA 4U7MA 3SKUD 1BYNA 5DEGA 3NIDE 4FI8A 4WO4A 4K5NA 2HRPH 1IGJB 3QS2A 2W9LA 1R46A 4CW1A 1AXTL 1NICA 4HC1H 2BWQA 3VWKC 1SMDA 5C97A 2P43B 3EDEA 4F9LC 4HJ0C 4N1CA 1A1NB 5EPMB 4QRRA 1E4JA 4GW5A 2B39A 4NN7C 2J44A 1FRGL 4FTDA 4GAYB 3HE6B 4QCIA 3FSAA 3FU9A 4PJ8D 2P5PA 4E68A 2AQPA 3RB7A 2P8LA 3I02B 4M8RA 4OAWB 3CVIL 1BXXA 1S7UB 3IU3B 4A04A 2Y5TA 3GPEA 3RWFA 2EIBA 4P5TB 2AJ3B 2KKQA 3DJTA 4NHUB 2Y7QB 1MCHA 1UYWH 4RBPH 4HJGB 3OR7A 4WTQA 1AR1D 2VZSA 1UT9A 3DMMD 3IXAB 3Q43A 4OCLC 3RDTC 3VWJD 3QRGL 3MLXL 3T6WA 3SKNA 2G5UA 4YSAA 2QGCA 2YUZA 5D2LF 5I19H 1T89C 4AEHH 3UYRL 1F4XH 5BZWA 3HG4A 4M61A 3F2LA 1R75A 1NGYA 1V3LA 3V7MA 2ZF9A 1MI5D 4KKCD 3NFNB 2NOYA 3O4OB 2BVOB 5T8IA 2LABA 3NABH 1CE6A 1DJGA 2MFNA 2OMVA 1SYSB 3C2SA 3HN5A 3MREA 3X1FA 2CBOA 3VFNB 4DKDC 1GYCA 1KEML 2JVUA 5AVYB 5L88H 4KROD 2GEQA 1CICC 2QSCH 1FGVL 3MYJB 4JVWA 1X9LA 3SBPA 3PAUA 3QIUD 2GBUA 2OCFD 4HF5H 5JUEL 4QF1A 4PGJA 4KPHH 4YDZA 4NZ8A 2BHYA 3F64A 4XZUA 2F6AA 2P9RA 3FT1A 3O6MH 4P2YA 1ZLSL 3FAWA 2IPUG 5ICYA 2EICA 1RUKH 2X1OA 1M2VA 4HWBH 3V7AG 1AKJD 4EE2A 1YDPB 4N8PA 1XH0A 1KTLA 2F53B 3QNYB 3W11D 3LN5B 4IGBB 3FO1B 2R2HB 4WHTB 4B5ZA 2CGZA 1A64A 3S5ZA 3WLBB 2VR7A 2RD0A 3OJVC 4IU2A 3WDJA 4DGUA 4AZ8B 3VFMA 4YSEA 4FCHA 3M8OH 1KYOK 4NC1C 5IEKA 2BIQA 1ZGLP 4LPVA 1QP1A 2QDVA 3UPRB 1CGSL 3S48A 5I0XA 4ETQB 4YHML 2AJVH 1F97A 2VUOA 1PAMA 3HMWH 4F2MB 2NX5E 1LL1A 3OMNB 3L3DB 4IGBC 3N1MC 3RP1A 3OJDB 5AL8A 2X1XR 4TSCL 2XC8A 1PAZA 4G7VH 3QIWD 1CC3A 3S36L 4ZX5A 3ALWA 3ZYOA 1OHQA 1AMYA 3K8MA 2VDPB 3VA2C 1CLYL 1EBPA 1XSIA 2F5AL 3GMPA 1NINA 4LCWD 5DA4A 4IRZL 2D9QB 4G6FB 2ORBL 4LSPH 3LB6C 3K6NA 4GG6B 4G3YH 2XG4B 2AW2A 2ALAA 4F1SA 3DJ9A 1MRFH 4FKKA 3LD8C 4LLMA 3RX9A 4H88H 3GTTA 3HZMB 1DQQB 3G6JB 5IROD 5C86A 3MNVB 3H2PA 4CKVX 1AXSA 1XSJA 3PQYE 1HKFA 1WZKA 2NX5A 4UOJA 1BFTA 2JLPA 2E59A 2EDWA 4HMEA 4OFVA 2CJTA 4YHIA 3VI3F 5JMOC 5HYJD 3QFJD 3ZUCA 1U36A 3PWPD 4AGLA 3ZMRA 4D0BB 3GTVA 2CPUA 2DBJA 4TQEH 5IZ7A 3HZVB 2GSIA 2G0LA 5SV3A 2BSDA 3SDYH 1VZGA 1MJUL 1WAAE 3FQWB 4I3GA 5FYJH 5H2BA 4XNBA 3FUEA 4B60A 1DR9A 1SFHA 3CFKA 4OZFB 3BAWA 3TWCL 2HG0A 4AL8C 4FFVD 3CMOH 4Q2ZB 2G4GA 2ATKA 2AV1A 3BD5A 4MVBD 3GKWH 1R47A 1SDAB 2P5WE 1JF1B 5E03A 1KULA 1AD9B 2VXSH 2A9DA 1YO4A 1RK1B 2HCZX 3CBRA 3NJLA 5E56A 5ILTL 5D7KE 5E7FA 3LB6D 1CLCA 3BP7A 1ETJA 1JE6A 2QKIC 2GK0B 1JGVH 2YD0A 3ARDB 3E3QC 4LPWA 5EU5B 5FO2A 2XJLA 2ZXQA 1Q94A 2NTFA 3KZ8A 1KGWA 2EILB 4KO7A 3SYCA 1EHAA 1GH7A 5BJTB 5DO8A 3QUMB 1DLHA 1W80A 3CVHB 4HOZA 4LF3B 2F7OA 3QQ3B 4PWKA 2WKLA 3WTVA 2XXGA 2JJTA 1SEBA 3NIGE 2DEYX 3KPPA 5EBLB 1IM9A 3MRRB 1RJCA 3N0PB 5CJXC 3E2HB 1N6UA 1FL5B 3MO1A 3NFSH 5HTSA 4AGOA 4Z5RB 4XBEL 1I8KB 1W72L 2ZXEB 1IZJA 3D39E 5EZOH 2PPAA 5E1GA 1BJ1H 5SWSB 3PRZA 2UZYB 3P4MA 4HT1L 4PJXA 4U3SB 5DJYA 5FYLL 1YEWA 3UGEA 3U36B 1QSFB 1ZHKB 4YUEH 4ANXA 1QBBA 2OYMA 4KMTH 4NYLB 2EDJA 2NY0C 5C6TL 3ARRA 5J11C 3OAZK 4JFTA 4OUUB 4DGYL 5JLZA 3PWVB 4OF7A 4OZHF 2YS4A 3ULUC 1PSKL 5AVUB 3QUZA 1EPFA 1P4BL 5GRUH 1A66A 3FYIB 3A6BL 3ARSA 3BFQG 3TFBA 4PPTA 3QPXH 1RPUA 3X3GL 3GDBA 2AJXH 2YJQA 4PJAB 1NOFA 2Y24A 5FYKH 4U3HA 4F7TA 3VO0A 1KTRL 4I77H 5CGMA 1R33A 4JS7A 2EEFA 4OGXL 4Y4KA 4Z95H 4FKEA 2B4CC 4K94C 1B2WH 1YG9A 2CH8A 5T5NG 1JTPA 3O3DA 4OGAD 3WGVB 5JDSA 5KSBF 1G9NL 5CWSA 1O6VA 3C8KA 4ES9A 1J0JA 5FOBB 1DQQA 1UZ8A 4JPWH 2EEBA 3BRGC 1ITCA 4FQIH 4ZUUB 1DVFD 4I0KA 1NCAL 3F6IA 3ZL4H 3H7LA 1KIRA 5HP5A 3DX7A 4F8OA 4OBRA 4PJIA 1N5YH 3D25A 3DRQA 4Y5VC 5CBAA 3G04B 2RMNA 3NTCH 4WK0B 4K3GA 3ES6A 2O5YL 4BHUA 2FD6L 4IS6A 1UADC 3JBG7 3KPRA 4UQIM 4OLEA 4PGDB 4NZUH 3AS3A 5IQ9A 4RMQA 2RQEA 3BUBA 3EF7A 2YAFA 4IRSA 5B7EA 5TH2B 5HI3D 4XMTA 5IEHB 2FWOB 3RZCB 3CFIC 3U4BL 4NDMA 4JRYB 1J10A 1B4JH 4YSRA 3O6LL 5AZEL 5F0LB 1XF3A 1ND0A 1ZXKA 4YSUA 3HC3L 3MFFB 2J43A 3JZ7A 4HKXB 1F11B 1TQVA 1DVSA 4LKCB 2Z93B 1FFPB 1M9SA 3MOBH 4LKXA 4XVUD 5DURD 1CIUA 2DY2A 2D03L 4BFIA 3PABB 2BFVL 4OLZH 1KB3A 3G6DL 5DJXB 1K85A 4FQHB 1OTSD 1X5IA 1D2OA 4WKXA 3TV3L 1JAEA 1Z66A 2ADIB 1K5NB 1V7MH 2WLIA 3CX5J 4OCSH 2IG2H 2XTJC 2NR6D 3QNFA 1B3JA 5I1EH 3VB9A 3JSSA 1V3JA 1SEBB 5EU7C 5C0EA 5LUMA 3IKKA 1MLBA 3FYEB 3T2NL 3QUZC 4K73A 4MWFB 2BS8A 1Q0YH 5AENA 1E4KA 2BNRB 5E9DB 1J86A 4QYOB 2HKHL 2MWCA 2XA8L 3RVWC 3S36H 3SDDB 2WHVA 4PJGE 4NQDE 1A7QL 5B3SB 1NCDL 1UB5B 3O8XD 4WKZA 4IYKA 2A83B 4Y4FA 1NFKA 2XTJB 3O41A 4WNSA 2PTTA 4JHWL 4LHJB 2PTUA 3QDAA 4GBXC 5K59E 1KCRL 2NY4D 3NCJH 4JFUA 3CN4A 4UQCA 5T1LA 1W0VA 5EUKA 1FORL 4KOBA 2G5BA 4LASL 4PIBA 3I75A 4DPRA 3VXOA 4NXKA 1GZHC 2NY6C 1ET8A 4JPIA 3VD1A 4KDVA 4Y5XA 2X6BA 4NN6C 2CUAA 4X8XA 3TIEA 3O4LA 4M5YL 3BN3B 1EZLA 2OJZH 3ABGA 3EXLA 4ATWA 5AVTB 3ESPA 3WUWA 2OCJA 1E3XA 4YPGA 3FJTA 3GSQA 3LXCA 4ONHA 2QGBA 3ZZLA 3LRMA 1CGWA 2QVTA 2VN3A 1PEZA 3PCYA 2JKRM 5CN1A 3V6FA 1PKQB 4OF3A 3ZHFA 1AZRA 2AJSH 5DO2D 2OZ4A 1AJ7L 4PBVC 3DX0A 4UNVA 2YPKB 1G1OA 2YJLA 4QRRB 3VM5A 5DS2A 1FN4B 3S34H 3ARFB 4FCAA 3ZMEA 2EEXA 4FFWD 1HCVA 2E6QA 1T6WA 4OF0A 1USQA 2VLJB 5KAQF 1G84A 4FTVB 4MCYB 4XNDA 3N0AA 3SPVB 4ZUSA 1N3NB 3WS6A 1A6UH 5CJ8A 7FABH 4NAJA 4YBQD 4JFDB 5MEQA 4A7UA 3V4LA 2RALA 1KLFB 1TQBB 1NGXA 1A9EB 1PIGA 5B4MC 1YUHA 2P5EA 3IWVA 1S78C 2ZJSH 2WQWA 3FSOA 4M7JL 5J6HA 1UWGL 4OH2A 1A7PH 4UQ3B 3LIZL 5I75C 5CEZL 1MQ8A 4PWGA 2XFXA 3WNPA 4H0GA 4HISA 4QRBA 4D0DA 5LLIC 2EKJA 1WAEA 3M07A 5IW1A 2WYHA 4R90H 4ZFGL 1HH9A 1VEPA 5IJBC 2O61B 1AO7B 2WQUA 1YY8B 4KZEL 2QV4A 4AZ8A 4M7LL 3B37A 3HC2A 5DMKA 5I76B 2I7SA 2PN5A 2X9YA 3FF7A 4X7TB 1JUFA 5A2CA 2O6PA 2G3XA 3UPRA 3QYMA 2ZKHH 5HHNB 4YC2C 3EUDA 3ECBA 2H6PB 1AZZC 5I6PA 2AEIT 2C5DC 4P99A 1I82A 1NFIB 4JG0H 5CD3B 4P8QA 5FK9A 1A25A 2D7PA 3WHE0 3TJEL 2DQUL 2EYRB 5BZZA 1IMHC 1E5ZA 3ZRCC 3ROOA 5D7IB 3UERA 3WKYA 3ZXAC 2XNAA 5KSAA 4IU2B 5D96B 4JFOA 4FC3E 3PDDA 4I77L 5EO0B 5DJ8B 1S3KL 1YEEH 3RNQA 1P7QA 3DV6B 4JRWA 3RGHA 5KAQG 4GAAA 5FGBC 2I7OA 5BV7B 1CDUA 1JTOA 1CDBA 1TEYA 1LE9B 2LOEA 1S9YA 3GXTA 3ZDZB 1VGEL 1UM6L 1OGAE 4UTBH 1GHFL 3L3DA 3D2TA 3Q8CA 5JA8B 4DFIA 1FYTA 3SBWA 4LSUL 1LO5B 4DQOH 1T1ZB 3AWGA 2RQ8A 4JDZB 3LH2L 5BO1L 2ZP0T 2VR6A 3EYQC 2C9VA 3MRCA 1KGCE 4F9PA 5A2BA 3BEWA 4F7MB 2BVPA 3KYOA 1Z0NA 3OXRB 4B5EA 4M62L 5BV7C 2AABL 2VAAB 4M8QA 4NQED 4P5KA 4R0LA 1E50A 4G6AC 2X4PB 2W80C 1F41A 2BNQA 3DIVA 5D6DA 3ECWA 3GM8A 5CZXD 3NK4A 4OLUH 1AXSB 1V7NH 3EOAB 1VGKB 1XFPA 4PJEA 2W60B 3ZRFC 3ARBA 1T83C 5KZCD 1LGVA 1RZ7L 5I66B 1WBZB 1FZOB 1O75A 2YBGA 3ZKQD 5D1ZA 5C08B 4M6ML 2XG4A 5F9JA 1ZLUH 4WY7L 1NAMB 1OGPA 3OKDA 3BKYH 1F02I 2JJTC 5B39A 4KKPA 2AEPL 3MJWA 3C5XA 4PW9A 3WOVA 5L0QC 4M93C 2Q76B 1T0MA 1RURL 3OTTA 4EOWL 4TM9A 1QBLL 2XU9A 1IC7L 2AGJH 7FABL 3FXIC 3IPEA 1FZJB 2HT3C 2Q86A 4KUCD 3KBEA 2CIKA 1LLAA 3FOMB 4H0HB 4HPYL 4FFZL 1MIML 2H0EA 1QYGL 3CAFA 3I9GH 4J1UB 3U7YH 1CGSH 3UBXG 3DHJA 3VXTA 4JMNA 2IDTA 1MEXL 2F54A 2VM4A 4UTCA 1PGRB 3MAWA 3ZDYE 5EF1A 4K2UH 5I9QB 3LNGA 2EEAA 2BP8A 4KTEH 4JJOA 2WY3B 4L8SA 3RWIA 5HYQB 4WO0A 1F56A 3F83A 3TT3H 3QQ9C 1P69B 5HI4D 1KV7A 4JKKA 4EJ1C 5F71A 5CJ5A 2NY2D 1BIHA 2X12A 4PJDB 5AAMA 4ZMQA 1AR1C 4JB9H 2EXYC 4J3XA 1JZ3A 4JZJB 5F7FA 2WCSA 4CSTA 4AW4A 1SJEA 2E8YA 4M00A 5A2LH 1BW8A 2VXTL 4F8PA 4WWNA 5TE6H 1KZQA 2A4CA 4ZX6A 1TTBA 1I8KA 3KWTA 5DXWA 3BFWA 3KPSE 3QI9D 4FLQA 4YEEA 1OB1A 4HYTB 4PRPA 5EU6A 3WNKA 1ACYH 1W72B 3NSDA 2XY2A 5CAYB 1QSFA 4GLRI 3MV8D 5JXEA 2IPUK 4BFFA 4PRDA 4ZZFA 2NZIA 2XWTA 1I7ZA 4AMKL 5E9NA 3GSNL 2GI7A 3PJNA 4O58L 3CHQA 3MO1B 2X44D 5AW7B 1WFOA 1UACH 1E2WA 3BVNA 1CYWA 4CRPA 3HLAA 5D9SB 2JKTM 1SPDA 2OW7A 2B20A 4FEMA 5AALA 5JOPE 2V2TB 3LH2H 4YHPB 4E42A 5BO1H 1QRNB 4TUJA 4Y9GA 1JWMA 5BQ7A 4XX1E 3HE6A 4QCIB 3UTZB 2N7BA 4NP9A 4AI7A 3ZHKA 3X11B 3W9EA 2VOTA 1KBPA 4TNWF 3SYOA 2XN9A 2P44B 3LZFH 5AW9B 1FIGL 3QXTA 3G9VA 4RRPM 2Q10A 1XZWA 5T5NF 3F7LA 3QUKB 2LW3A 4GG6A 4LOVA 5T5FL 3GSNB 2WQ8A 3ZT5A 5E5LA 4Y4HA 4NI6A 1ZWIA 3MJ6A 3VXPB 2JTDA 2O6CA 5F93C 4PTUB 4PJFA 1JZHA 5B1AB 3SE3C 4ADIA 5CILH 3ERXA 4QTIL 5C0BE 4HEMA 1CF1A 3KW8A 4HWNA 3IT8D 2EUZA 2E9GA 4HQQH 3BQVA 4XBEH 1AMXA 5K9OB 4PJCA 3B2VH 4DW2H 1P1ZB 4YPJA 4MMZB 1U8MB 2MPVA 1HX0A 1WIOA 5FLVA 1BAFL 5IROA 1ILSA 1CD9B 3I6LD 2AGJL 2QQQA 4KJWD 3US0A 1COBA 1M7DB 2HZHA 4HDIB 4QHUA 5IUCA 3QIWB 2GTWA 3QH3A 4PCSA 2HWZL 4MNGB 5JHLH 2DWYA 2IG2L 2ID5A 2YAHA 4K5MA 1OE2A 5JOEA 1K8IB 1SHMA 4NSKB 1LM8V 4A2EA 3K0YA 1YMMA 2EIZB 3LKNA 1T5WA 2H0PA 4QOKB 4OJYA 5MEND 1KTLB 2F53A 3O3BA 3IFLL 5E5UB 2JJVA 4U1SA 2FNBA 1GVIA 3EO0A 3EOBB 4AYID 3RFZA 4L4JA 3RZCA 1TNMA 1KPRA 2PYEA 3PHOA 3E80A 3DDGA 4TVPD 1FVDB 4N2MA 4GAGH 4AGMA 4YQXH 2R29L 3E6HA 3Q01A 4G43A 1E8YA 5J9PA 3GIVA 5BOZG 4JPQA 4J39A 2YPLE 1OLLA 5CGYC 3ILPA 2IDCA 4JVPA 4R97C 4AQAA 3ZPDA 3VXRB 4EI6A 5AG8A 2JFCA 3WJMB 5DRNA 1MFBL 5D70H 3DX8A 4GQ9H 1UASA 4EQ2A 5MEPA 2J8UF 1YEHL 4GXVH 4FJ6A 1ZIAA 5LCVL 1IFGA 5IMKB 1CFVL 4A2DA 1PL3A 4ODUB 5FA4A 2WTOA 4MX7A 3SY0B 4EN3D 4K5LA 2F8XC 1UVQA 3NZ8B 1QO3A 4FZ8H 1FFQA 2CLZB 2HXAA 5E99L 1UXSB 4HHGA 3WEXA 2VGLM 5G4MA 1FAIH 4E2OA 3CZJA 4XPAL 3RHWF 1OHZA 4OUUA 1VPOH 3QCUH 1RUMH 1BYPA 3CDGB 2DLHA 4UQDA 1H6UA 4DFHA 3P9MA 3QEQE 1RIVL 5A3ID 4CMMA 1EXHA 2VDMB 4BH8B 3BKCL 4QHNA 1E6JH 3MRHA 1HZLA 2ZUQC 2R2EA 3WTXA 4ALAL 3U30B 4A7GA 1FNHA 5TJWK 1NBVH 3U6XS 4WO4C 3VJ6B 4XNAA 1WITA 2XXCB 4XNXH 5SWSD 5DQ9B 2WXFA 2BVQB 2AV7A 4TNWK 1RXLA 5JIIA 1LHZA 1PG7W 4MAUL 4KO5A 3V52H 4D7BA 4PJHE 2QQKL 1EZVX 3W2DL 1G9HA 1L9TA 1FH5H 5C0RH 1SXSA 1UOLA 1GGCH 3MV7A 2X4UA 4RFEB 4EUPG 5GS0L 2IQAA 4NERA 5J06A 4ODVL 4KNUA 5AAWA 4QI3A 1VESA 3C5ZD 1U3JA 1L7TL 4OB5H 1DQJA 3HR5A 1ZS8A 3LYRA 1A7RL 3U0WL 2C9XA 3H54A 2UXTA 2LVEA 2SODB 1MJUH 5FYJL 3WKNA 4QRUA 4IDJH 2CJUH 2IBZX 4KI5D 3QIWA 5F7MC 3LZNA 1FDLH 3O45A 4YFLF 1ZE3H 3MMEB 2R4SL 4OLYH 5KSUB 3WY3A 3INUL 3W39A 4FGMA 2JXMB 3ZKND 4R7NB 3LKNB 3EFDH 1OAJA 3SYAA 3GXNA 4OI8A 5IMMA 3CBJB 4G8FA 4KVCL 3ARBD 2QPFA 1E9PB 4GW4B 4KZCA 1IGMH 2H32A 2VLJE 4LPYA 1KFAH 4RZCB 4C56E 3IK2A 4YSQA 1A02N 2C4FU 4G80B 3POHA 4OCRL 2XY1A 1NGXB 1CCZA 3IXTB 1WHOA 3NZSA 4BA0A 3HBGA 5L4FA 4PP1C 4JO3L 5TF1L 2OXHB 4BBWA 1G6RB 1XWVA 1ZCRA 1A7OH 4WTZG 1NANI 3Q9QA 2VT0A 3LNEA 4WEMB 1C16A 2AQ3A 3ARED 3AG1B 5EO9B 4PBDA 2AF2A 1MFDL 3JTTA 3OKEB 1XGYL 4P4KC 5A3IC 3KLSA 1G7QB 2DKUA 3TH4T 1MLCA 5IFAH 4XPGL 5K9JL 1Q9LB 2EZ0D 1AGFA 3TBVB 3K2IA 2XICA 2GSGA 2WZ6A 2PO6B 3KLAA 4EN3A 5EO0A 1IAKB 3RNQB 5CZXC 4TVSa 4Y9CA 5HYSG 4PJAA 2X6CA 3BMWA 3MA7A 4N28A 5J6SA 1MPAL 2HJKA 1Z9PA 1JNHA 3HMXH 3O41B 3S35X 5D7LD 3O2DA 2PCPA 3QNXA 2FWUA 3TJHD 5B7MA 4KHTL 2OV0A 3QXUA 2XV2A 1CF8H 4P2QB 1BZOA 3B8SA 3L3OC 1T80A 2BSTA 2QQLH 3MLUL 5AWNL 2ENYA 4XAWL 3VVWA 2DH2A 3REWA 5C71A 1FNAA 2E5EA 3I6GB 4QLWA 1NCTA 1QBMH 4BQ9A 4X99A 1MVFA 3PQYB 3RY5A 3EYVB 3ZDZE 1KEMH 2MEJB 3KL0A 3KLHC 3KNBB 2QSCL 1KYDA 4AXWB 3L9EA 1XCTA 2DDQH 3P4NA 2GI0A 2KZKA 1BAFH 3EF4A 4WI7A 8CGTA 4MA3A 2W0LA 5DZAA 3N04A 1I1FA 3Q6GL 4HOXA 4RGMC 4MQXD 1KY7A 4IOFD 3VSUA 5T33L 1AHMA 3MV7B 1MQKL 4WHDA 4YZFE 1CFNB 2PWEA 3O9WA 5JHDA 4XMLH 4L37B 3NJFA 3U0WH 3ARGA 3TZVD 5HYJE 3ARZA 3PABA 4NZUL 4N8CL 1HC1A 4XCYA 1H8SA 1OOAA 1CLZH 1ACCA 2K7PA 4MHHG 5M95B 2YOCA 3QUYB 2H6UA 3BH4A 3CDCA 5IB1B 3N85L 4WWID 3B9KA 3QE5A 2A9NH 4JCWA 5EWIL 1JPST 5IV2B 3LY6A 3JTSA 3C6LD 3WJLA 3RA7H 5GGTL 43C9A 1HK6A 3BVTA 4Y1AE 5FKAA 1NM9A 1JNNH 1ACYL 1BVLB 1KB5L 3FB7A 4ZNCD 1KLUB 5CR8A 2XA3A 4MXVE 1CDGA 5KSBA 4NBZB 3QEUA 4S1RH 3VGFA 1X5HA 4XNQB 4QJ5B 4H2CA 3MR9B 3V79C 3NIGB 5AB2A 1I3RA 2D3LA 3AB0C 2R2HA 4WHTA 1B6UA 4OD1L 3EH3B 5AOLA 2CHXA 1JJUA 2GT9A 4OLXH 2DQIH 4JW3A 5J13B 1EDQA 1QTSA 4LCIL 2A83A 4Y4FB 5IHBA 5IEKB 2VLJD 1RK0B 1CZ8H 2CKNA 3Q5OA 4O9HL 1XZ0B 1PYWA 3CX2A 2J5LB 2Y07H 3TIEB 4E5XA 4NZJA 3QA3A 4IK7A 1F2QA 1DQTA 3KJ4B 3VFOA 3SDCB 3U1SH 3B7YA 4MQTB 4XCFL 3TNNB 2XQ0A 5ADPL 1L9NA 3HBPA 2DQHH 2WB7A 1FE8H 2LGNA 5JZ7D 5JNYB 2C26A 1Q0EA 3TO2A 3JWOL 5HHMB 3CFEB 3EDKA 1VFBA 2WUCL 4WU7B 4YXLH 4KTDH 4GEIA 4JGMA 4TOYH 3T4AC 1GZPA 1VHPA 2HVBA 4FMVA 4AE0A 4X9GA 4OZIA 3PXLA 4YJZL 4FQXB 1HL5A 3ZOAA 3TFKC 1TYEB 3GXMA 1RPQA 4JQVA 4PJDF 2CO3A 5A2FA 2F7PA 5C07E 1MCCA 5IK3B 2SEBB 5F1NA 5MENA 3EYFA 4N0YH 1MUJA 3G08B 4OGYL 4JX0A 2OMNA 3IMBA 3OXRA 3OZ9L 1R3KB 2IANA 3UZQA 4WWKC 3TWCH 3VFWA 2JB6A 4PG2A 4RMTA 1A0QL 4IKJA 3RVWD 4P07A 3WDHA 4JQXC 4RAUA 3EFOA 3NJXA 4LHUD 4G9FD 4ZOBA 2QT6A 2B1HL 2OTWB 1GYWA 4PVMA 1FO0L 4CVXA 3L3KB 2I9LA 1U6AH 2Q1EA 4LP4A 4LB8A 1PQZA 3UZEA 2P46B 1GIGL 2BSBA 1EX0A 3VI3E 4AT6A 3TCLA 2KLTA 1WP6A 3BIAX 5FFGA 4IRSC 3E6HB 4R7LA 2XLLA 4XNZB 3U0TA 4MA1B 5T1KB 2HLAB 4HDIA 4NO2B 1F90L 3IXAA 4R2GB 1REIA 1I8AA 4EXKA 3RTQA 3AQXA 5C2BH 3PWPE 4XP9H 4DERA 1UWGH 4EMZA 5HY9B 5CEZH 3FRPB 1P5UA 3K7UA 3NFNA 3B4NA 2F58L 2NY5C 4DO4A 3PGCA 4XP5H 4LRIC 1A2YA 3EJQA 2AK1H 4QGYA 4PJCF 1GS6X 4CC4A 4MD5B 1KOAA 2Z4QA 4J7RA 4D3CL 3DOSB 4JFPA 5L8LB 4Q9QH 4QHLA 1PX4A 3LZFL 1M56B 2VDOB 2A74C 3RWEA 5D2NC 4YFDB 2I85A 2DQCH 3UOAB 4JHAL 3ZVVA 2E27H 4XR8C 4UZGA 3IJSB 1VFUA 4UB0L 4MA8H 4M7LT 5EBMB 5E51A 3S88H 1MREH 3IF1B 3WCYA 4U1JA 2CWRA 1A9VA 1I1YA 1RJYA 4PD4J 2DWEA 2GK2A 1FG9C 4OFPA 3EH2A 1BM7A 2R9HC 3NCYP 4H8PA 2G60L 2UZPA 5LAXB 3SPIA 1I8LC 5I1HH 4YSCA 5AZEH 3GLEA 4MX7B 3KLKA 4KK9C 4XHJD 2FX7H 4QYOA 3VMPA 2KZ1B 3PHAA 1SEQL 1UXSA 3RFRA 5HDBF 5DD5H 5D9SA 2Q87A 4EN2A 1GJUA 4L4TA 4X4MA 1YEFL 3H3PL 3VG0H 3WNOA 2V3EA 3KBFA 4MA7L 1JPEA 2KH2B 2VKXA 3BP5B 5IG7A 5EF0A 1C12A 3WL9B 2CIKB 2X6VA 5LVEA 3LOWA 2BXYA 3TYFA 2HVJB 1NCIA 4EQ3A 4PRIE 2GG1A 4R5VA 5F0JB 2GJ6E 3TBSB 3QUML 4UI2A 2GFBB 1QEWA 4AY0A 1ZJBA 2BERA 5EWIH 4MQ7B 4FYSA 4FTVE 3C60C 4ZXBD 4A6YH 3MODL 3UADA 1JOIA 1PU0A 4M5SA 4J1UA 1BLNA 1YC8A 1Z5LA 3QYNA 2RA1A 2DH3A 3B34A 5AVSB 2HRHA 3DTDA 4UTBA 2Z31C 4OQTA 2WPGA 2AV1B 2ATKB 2AMUA 5A1AA 2XFGB 5FDYA 2D7NA 1MCSA 1JXDA 3FW6A 3FO9A 3TEWA 3S37L 2F53E 5JO5A 3K8KA 3FHEA 4UQAA 4YHOL 4FQJH 4D9QE 4UOZA 2AQNA 3COOA 2Z1KA 4P4RA 8FABB 5KANI 1QSZA 3CXDL 2Q7AA 3FB6B 4DP1X 1U30A 3MGOA 2DLIA 3KYMB 4LBEB 4JZNB 4X7SH 5CINL 1S5HB 1HHGB 2NQDA 3F7PC 4YHKL 4PJIF 3LDBB 2R4RH 3PGCB 5DZJA 4ZYKB 4A38A 4FI6A 4DH2A 4CJ1A 1YQVH 3ISWA 3CN3A 5J6GA 4J3BA 3KPMA 3D85A 4U49A 5IBUG 2BCKB 1U8HA 4AQEB 4Y5YA 4MWFA 2VQTA 3TH2T 3MRGB 4JY4A 4OBSA 3WE6A 3OQ3B 5KJ7E 5KVGH 2DMGA 4ZFFB 2DPKA 3BHBB 4HGWA 4XB7A 5F7EL 1PX3A 3LDBC 1LMIA 4DNLA 2CA3A 3AREC 4HUVB 3DA0A 4HS6B 5DO2C 4J5VA 3LMJH 3CFQA 1S7RA 1EEZA 4PW3A 3O11A 5LN4A 4F8NA 1QUNA 2G9HA 3FOLA 5KW9L 4WGVB 3EYSL 5IREA 4HIJA 2E6JA 5DSCB 4YDKH 1OGAB 2DQMA 3ESNA 3MN8A 2WYIA 5I82A 2Q5BA 3NBNA 3VFGL 2VDKB 1SGKA 2D3VA 2GJ6A 5CUSH 3AS1A 2NXZD 4P04A 4U1NB 4MMXB 1W15A 2UXFA 4EF3A 1THAA 3D52A 1MH5A 1UUNA 4GRWB 3ZDYF 3RWJB 4ZJ9A 2H47C 2GAZB 1S9XB 3ETBJ 4J3UA 1IAKA 4QIRA 1KN4H 5E6IA 2AXFA 1BZ9A 1TVBB 5IB5B 3VGAB 5HHOA 1U41A 3H9SB 5DMIL 5TE4H 2HPTA 1AQHA 3HC0B 4PUBH 3S35L 4M7LH 1SVZA 2WINB 3VXPA 4DP0X 1R5WB 5DD3L 1ONQA 2WN2A 5IG7B 1UOKA 2ZKHL 5CSZA 1Y6NR 4HJ1A 5CR1A 4QNPE 1BSIA 1PSKH 1U3ZA 1HNYA 3BUIA 4B3VA 3MNZA 1SLVA 1DLFH 3U6RA 4LSVL 4TNVF 4I3RH 4KAQH 3V0VA 1CG9B 2WLJA 2AHIA 4LE8A 3V4VH 4ZMPA 4LESA 1AIFA 4KVNL 3NJGA 2O30A 3JTBA 1OM3H 3S6CA 3CDFA 5IJDC 4LU5L 4ZS7L 4HEPG 4N8VA 1J12A 3NA9H 3ZKMC 1UXMA 1Y18A 2VDKH 4P3DB 2UY6A 3T0VA 1M4KA 5JQ6H 3UABA 2EQDA 2DQGL 1ZT1B 4U1SB 2VERA 3D39B 2GT9B 5I71B 5CZVL 4FFTA 1BWMA 1TETH 2VSDA 1BEYL 3O6FB 3D3VD 3TPUA 2ZSWA 4YXHH 4WWOA 1SXZA 3FCBA 2VDRH 3FFDA 1HHKB 1JGUL 2W94A 4G8EA 4LIQE 5J9PB 5HGHB 4FQQA 1KBBA 2EXYD 3BN9C 1OP9A 1N64L 1IGTA 1D5MB 1QBML 2DQHL 2A4ZA 4MDIA 3O0RH 3VD3A 4O5LL 3GMOA 4ZDHB 4ZW7A 3BVDB 3EW3B 1HINH 1QPKA 2CNZA 2Z64C 3LS5L 2F0CA 3N44F 3WXVH 4KXDA 4X5RA 2F1EA 5K39A 3JXAA 5C09D 4LDCA 1T66D 3FO2A 5IVZA 4L3EE 5TFSL 5TD4A 2GUYA 1J5DA 2VR3A 1HHHA 2B2XL 2DQEH 4NFBA 1CXLA 4Y16B 5F1KC 1GRWA 2W9DL 4X4XB 1QUNB 4PS8A 2QSQA 5I74B 2FK9A 4KI5E 4PJFF 1QBLH 5FUOL 1SJVA 3GZOA 2WTRB 4FZ8L 4RQQA 5EIIG 3WSQL 5BVJB 1ZGLB 3CC5B 2WXJA 4JN1H 3H3PH 4OQTL 3VG0L 5I6KA 2NY0D 3QWQB 3FQ4A 4GP8B 4NZRH 2QL1A 2WSPA 5DQ9A 4URTB 4U1NA 4MJ6A 5T3ZH 3VXOB 1N6VA 2EYTB 3QJHB 4R7VA 3B3IB 2Q7YA 3GYRA 2H32H 2VLKB 1EH9A 1S8DB 3D05A 4NC2B 5JDSB 1WFTA 3BQUC 5D5ME 2IQAB 1MIEH 2DS4A 4TRPH 1RVFL 3C08L 4OT1H 3KXFD 4BFRA 1X44A 3PL6D 4QTHA 3H2QA 3CK0L 1WCBB 1G7LB 2A0LD 1GZPB 4OFKA 4QKXB 3W37A 2XV0A 4JRXA 4TPRL 2GBVA 1YZZA 1SDDB 2X9WA 5BNXD 4YO0A 1NKGA 2K0RA 3MBWA 3LQMA 1QNIA 5I5RA 5JYLA 4ZMNA 4ZAKC 1KCKA 3HPLB 3JWNG 4WGWB 5I28A 1JL8A 1MDAA 5IMMB 4HJSA 5JW3H 3GBML 5DJ0A 3ZR6A 2NZ9C 5LN8A 3QO0B 2R2CA 5B4MD 2WVTA 4NIYE 2WZAA 4IRJB 5FUCC 1MHEB 3ZMNA 1KJ3H 4H44C 3O45B 2VZVA 4JRYA 3LKSA 1IFRA 4MKTA 4Z3TA 1JHLH 4HGMA 3VWKB 2ILLA 4MAYA 4ONFL 3MRJA 5GGVH 2R4RL 2VRKA 1S7SB 5GIRA 1J0IA 3QDMD 1TDQA 3PWPA 4J3OC 2J56A 1QKZL 4RRPG 4RGND 2IAMC 3HMWL 2XRAH 2XETA 5LXVA 5EO9A 1M1SA 5E8PB 5EBWA 5T1MB 5KS9E 1CI3M 1NBZB 4K9EC 4TUOB 3MC0A 2E9WA 4QO1A 3BGFB 5D2NE 1KACB 2NXZC 3O6LH 4QEGA 4U3CA 2HFEA 4HS3A 3FT0A 5GGQH 4YSPA 1BQSA 1I8LA 2F1AA 3BWUC 4PJGF 5GRVL 5I6NA 1U8MA 2K6WA 4N0UB 1UXLA 2GCYA 2CHNA 3UG3A 3MJ8B 5H4ZA 1CS6A 4X4YA 1WD9A 1JZ6A 2PR4H 2H5UA 4Y1AA 2ZXWB 4QJ3B 1IGIL 1QLFB 2PPDA 3E6FA 1RU9H 1XB3A 4OR1A 3G6DH 1G9NH 4JLRA 4LCCA 4OJCA 5E8DL 4LEOB 3VA6A 1LDPL 3NJKA 3UTSB 2A9BA 2IMMA 3LIZH 2A6JB 1BFSA 3BD4A 2XWXA 5INDB 1XGUA 4IKIA 1KPVB 3ABKB 1Q9KA 3R7QA 1H6TA 5C07A 4GAJL 5I1CH 2C8NA 4N22A 2Z31D 3L9RB 3VFVA 5HVFB 3IF1A 3FT4B 3U2SA 2VLLB 1FZMA 1TU2B 4ABVA 5B38G 1CBJA 1I1AB 2C1OA 1Q8MA 1T6VN 4W9CC 4W6XB 4M43L 3AXLB 2D7OA 1GKEA 1HAUA 1XXDC 2AMGA 2OTUA 4HUWA 4NM4H 3Q2VA 4NPJA 2WUBH 4PUBL 4Q74A 1FYHB 4RMUA 4PN6A 3O9WD 1IEBA 4HIXL 4PCTA 4UTAA 5KYXB 1FNEB 4IMLA 3X1BA 2X3CA 1W8NA 1Q1PA 5BMFH 4BZ2A 1DQLH 3ECUA 4N5UA 5AVZB 3ZE0E 4ZMXA 4OZ4B 3RBSA 3TYGH 4HP5A 2X4TA 5I1KL 5JQHC 1EFQA 3LZQA 5GSVA 4G5ZH 4JFDE 2MPAH 2VLRA 3IE9A 4XHQA 4K9JA 5E2WH 2GJ6D 1WRFA 2CZNA 4P3WA 1ZA3A 5TE7L 1EEQA 1JHKH 4GI9A 3C6EA 1JV2B 5DHEA 5ESQB 2CM5A 4PVBA 2M1KA 1INDH 1QBAA 5HHQB 4Y4FD 5TDNB 3MQIA 4JREC 3II3A 3FMGL 3W56A 1AZBA 3E38A 3QXWA 4GINA 4L4VB 4NWUH 2DQGH 5EU4B 2G9KA 2BNQD 3BUYA 1MFBH 1G9MH 1IVTA 3EJYD 1T5XB 3QUMA 1PG7H 3IDNB 4XX5A 5ADOL 4X7SL 5JR1H 3T71A 2W0FA 2Q3ZA 4G6AD 5DTFA 1ZLUK 5CBEA 3L45A 4G82A 5JTWA 4P23B 2CO7B 1FL6B 4BRVA 4OQ1A 2OK0H 1CTMA 4NFDA 4Z77B 1G6VK 3CFCL 3RPBA 1OW0A 4HG4J 5ETUB 1FFOA 3D69A 1S5IL 1KJ2L 3VXNA 5F6HI 3UG5A 3BHBA 4LLYA 3S4SB 5MEOB 4DPCX 3FCTA 3WV0A 2XQYA 1S7QB 1QPXA 2QVMA 5ICZB 3GEWB 5EEXA 4KNQA 2R9HD 3RJOA 1GJIA 4NPKA 5L7XL 1RIVH 3DMMC 3RDTD 2Q2EB 3CSGA 4AITA 3G6JE 4GRMA 3CVCA 3HAEA 3FRPA 5HHXL 1WE5A 5JW5B 4EUPB 4W4NA 2X3AA 4X4YB 3GHEL 3QDME 4LQFH 4IBZA 4NQEE 1GA2A 2ZUYA 3W9DB 1NUFA 1K4CA 3NRQA 5EZPA 1DBKH 1QFWL 3MRGA 4JY4B 4G9FE 1LE5B 3ARDC 4LHUG 1WWAX 3S3JA 4PJ5E 5EC2A 4D8OA 1V8HA 2OMVB 3UTSA 1BXAA 1GGIL 1EXUB 4JVUA 1J9SA 3F7RA 5KEZA 2VC2L 3WLBA 3ILQD 4XVJL 1L6ZA 1P7QB 1SUHA 3DV6A 4TTDC 2AFNA 5GZOD 3VFVB 3CCHA 4AENA 3F6LA 4C83A 4FERA 4R0LC 5GGUA 5HHPA 3HRPA 5F3FA 3KR3H 1X7QB 2CD0A 4PJ5D 4XO3A 4Z18A 2P5WB 3GKWL 3H9HA 1LO5A 4AIXA 3IDYC 3U30C 4ZTOL 1XH2A 5AYUH 1N70A 2IGLA 4WI0A 3VFWB 1RFDL 1T0PB 4P46D 3D85D 1CD0A 1IAOB 5FFOA 3CK0H 3DHMA 4FXLA 4PV9B 5F88A 5BZXA 5ES4B 4YXLL 2QVKA 5IK3A 1JWMB 5BQ7B 3PNWB 4LVNB 1D5RA 3BUDA 2NPLX 4LVOC 4GKLA 1NIEA 2CXKA 2X4TB 5KYWA 2YKLL 4ZBJA 1HE7A 5MP6L 2JB6B 5C3IA 5CN2A 1YPZB 4ZK8A 1RUPH 3N41B 2LAGB 4OZHB 5L2JB 1QHOA 1BGXH 4L1TA 1WBZA 2UYLB 4H25A 1E9QA 3O81A 3PHQB 3O3EA 3G5WA 1H3PH 2YPVL 4OLZL 4R7XA 1GZQB 5CCGE 5F9DC 1NGPL 4Y2DA 5FWRA 1ZKAA 1WBXB 2XG5A 2OSXA 1RP8A 2Y5TB 3BZ4B 3IRZA 4OKVB 2Z93A 4JE0A 4I85A 1P84J 3VGHA 5MHSE 4U3XA 2FECL 1CDYA 2O5NA 2XPGB 3HVNA 3VCLB 1FO0A 4M8UA 1FZKA 2OULB 3ZLQC 1C8PA 1A6TB 4U0QB 5GSRB 1X5YA 5C0CA 3HS9A 2ERJC 4DGYH 3VXSE 1NCDH 3LX9A 2GFBA 2IH9A 1A7NL 3EJZD 1Y18B 4NQQA 3LQAL 4UQ9A 1JCVA 4KKQA 4X6BA 3KPNA 5B21A 1MCWM 2BVYA 4N3UA 4D9RE 3E8UL 1XR9A 5ENWB 1GY2A 2BRRL 1ID5I 2UX7A 3QZWA 4L3AA 4OD2B 2PNDA 1RK1A 2BOBB 2NUTB 1JXKA 5GJTL 3VDCA 5HYQA 5FCUH 1JRHI 1I7RB 4S2SB 3FQNB 1MCPL 2APSA 2ERJB 4HK0B 4KY1L 1AE6L 3L81A 3MLWL 4MD5A 1DYZA 2H9GB 3MLVL 3CFKB 2DV6A 3MLTB 4OZFA 3PAYA 4P4KB 3AS0A 4Y7OC 2VTFA 4L37A 2EE3A 2DQTL 1LTXA 3OAYK 4P4RB 8FABA 3IMRA 4J2XA 4Y2OA 1X3DA 2J6EA 1MWOA 1NSNL 4FP8H 3GFUA 3JV6A 4Z7WA 1F1DA 2W65A 2V5TA 2ZCKL 3UO8B 4W9JC 1PDKB 3H56A 5E6IC 2CLRA 3AJ7A 4WF7A 1XEUA 3GGWB 3CFDB 4MJ6B 1KWKA 2IGFL 2PCFB 1IBFA 2ZYIA 1XGRA 3P11H 1Q94B 5T3ZL 2WUBL 1N19A 2UWEE 3DETD 3BP6B 1LO4H 4PFEA 2V8MA 4BIKA 2WKGA 4ODHL 4MCMA 3SE4C 1A4AA 1NDMA 5K33A 5D1QE 1A1MA 2N0KA 2VZUA 5HJGA 3RURA 4UM9D 5JHDD 4TUKL 1N5AA 1MREL 3FTXA 4RA3A 3MUUA 3QJFA 5I17A 1EUUA 4M5TA 5KJRL 2NCEA 3KR3L 4M1CD 4ZS7H 4EZLA 1BBJB 1TQUA 3FQTB 3ZSSA 3FO2B 2W92A 1MJ7L 2IALA 4L1BA 3F3HA 2O1AA 4KVNH 4L3EB 2EDKA 4HCIA 2A9NL 2X87A 3BPLC 4X7EC 4UNUA 4U6TA 3LCYA 2C3XA 5HHOD 4MAYD 3W11C 3APMA 3RG1C 3FH5A 4FFZH 3PQYA 1VF5C 3QQ4B 5FLUA 3LEXB 2VITB 1EERB 4U33A 3PHSA 4G7QB 2W07A 1IVLA 4JFEB 3QFGA 4M8VA 5DVPA 1NL0L 3GIZH 3SJVA 4FXGA 4IBLT 4LL9A 1ZWIB 2TRYA 1GTNA 2HJFB 5BZDA 2XHNA 1NGZB 3ORJA 2NY6B 2DL2A 1DFBH 1HSBB 2AEQH 1QRKA 1H0DA 1DBMH 1J1OL 1GZQA 1ZDQA 1HOEA 2Q6WA 3TIDB 2O6FA 5HDQL 4OD1H 2JI2A 4WFFE 2WLKA 4NUMA 2M2DA 5E9DE 1H3TA 2F18A 2WQAA 4E9YA 4YO0B 4GO6B 1DVFC 1BG9A 1EGJH 1CGTA 1N8ZB 3QCVL 2VIRB 1TTUA 2DQDH 3D7PA 3CZUB 2ZG1A 1NGYB 2EDEA 4LCCC 4G7YL 1TZGH 4AX3A 3DHUA 1U3HA 3OZLA 3R06A 4H26B 4NKDA 3WMSA 3SDDC 2KDYA 2ED9A 5ITBH 3KW7A 3MV9B 1NBCA 4Y4KD 4ZT1A 1C8QA 1SYSA 3KPOA 2GTWB 3MREB 4NUQA 6FABL 1LO0L 3ULAB 1NC4B 3B9DA 4CDGC 1ZRUA 2OMYB 3IBOA 3IJYA 3DX9A 4LARL 4M7ZC 4PJ7E 4ZPVB 2DBLH 4WJG3 3UC0H 1K4DA 1JVOA 4G6KH 2OCCB 4HWEL 4PWIA 4C59B 3E9TA 5CD3A 5I24A 5IESL 3UXFA 3KYMA 4LBEA 5ICYB 2EVGA 5CLYA 3K6IA 3QUZD 4GUPA 3DGCR 1LDPH 1HXYB 4X9FA 5LBSA 5FDWA 4JM4H 3U7WH 1O9VA 1JDCA 4XN7A 4FFYL 4P5TA 4XMPH 3WI9A 3IB4A 2CDGA 1MRCL 5E8OB 1U8HB 1UTDA 2OTPA 4PD4K 4QRFA 1CXHA 4CUCA 2NYYC 4P2RB 1N6QH 4XWOD 2J2ZA 1BPLB 2FBOJ 3DXAE 3WNIA 3KPSA 2WSDA 5F0MB 1I9RL 4NO0D 3VD2A 5DZNA 2GY7B 3GF8A 3JWOH 5DF0A 4P9HL 2PCFA 4XVSL 3TF7C 1LP9F 4P9MH 5FIEA 3X12B 4K8RH 4AZUA 1ZE3C 1WJ3A 3QRGH 3VX0A 4N0UE 5BRQA 4BV1A 1AZNA 5DVKA 2JJUA 1R34A 3NZ8A 3OKOB 5FKPB 3GEFA 1CUOA 3MRLB 4UDTB 4XNMB 4Z7UA 5AL0A 3SKJH 5KOVC 4HJJL 4YC2B 3OL2A 1P7KA 1ZAGA 1BF5A 2NY2C 3V6ZB 2N56A 2UZIH 1VACA 2DKMA 4KHXH 3T65B 4NUJA 3ZQWA 5DVLA 3TNMA 3FHQA 2B4CH 4XC1H 2Y3NA 4RA0C 1TQBC 3NVQA 4NO3B 1CICA 3MRQA 3ULVD 1K3IA 2APXA 1XHHA 3TA3D 1XTLA 3I75B 1RZQA 3DOIA 1NEZA 4N2LA 3S96A 4M3JA 7TAAA 3K4AA 4NKQB 1J48A 4ONGL 3EO1B 3F7QA 4L4TE 2X09A 1I7UA 3CMGA 3OX8A 4M02A 2VDPH 3WUWG 3G9AB 4XBPB 4KUZH 3QJQB 5ANME 5L6YL 2YXVA 5HVGB 3VM7A 5I16B 3D0LA 3T0BA 4R7DB 4POZC 1OWRM 1JYVA 1UH4A 3V5HA 4PS3A 1JDAA 2HKFL 2UUDH 2WXHA 1QUPA 4OZGA 1T20A 2WOYA 3DECA 3LS4H 5H4YA 5L4IA 3T4YB 4L8BB 1LJMA 2IWGA 1S4IA 2B5IC 5SWZA 1ZPLA 4L8SB 5DJDA 2DQUH 3ZE0B 5GSVB 4XNXL 4N8VB 4TSCH 1FBIL 1U2YA 4OCMC 4NZFA 1ROWA 2BSEA 4MA8L 4TLTA 1NGQH 3U25A 4ODSH 4F7EA 4NPYB 4E9VA 4F37F 1S7XA 5PAZA 1AE6H 3KLDA 3MLWH 1QFHA 4YQXL 4LOUD 1YJDH 3DARA 1BXVA 5A6LA 2Y2WA 2HRLA 5C0AB 4TLKA 1KBGL 2EDLA 3IFOA 4BH7B 3V0HA 2H7WA 3IPFA 1A5FL 1HDMB 2CK0H 1XAKA 2G5RA 2D3NA 2ITCA 2XXFA 5GZOA 3GUFA 1M05B 5ITFB 5EC1A 2ZOLA 3MRJB 1HXMB 2I32A 3IBEA 3VH8B 3FCTB 1NBQA 5H2BB 3LHAA 3K5RA 4JO8A 3VQ2C 5BRZD 1AP2B 1QLEL 4XVJH 1NFAA 1UFUA 3MLXH 3PL6B 5ERWB 1J18A 3PWNA 3T0XA 4EDWL 3OAUH 4AENB 4O02H 4GB9A 4JANA 3U9PL 4EN3C 1A6WH 4FLOA 1XF2B 5JW5A 5EOCH 4G1MA 4HUMB 3S3SA 4Z7NF 1KPUA 3OKEA 5DMJB 3FB8A 4CAGA 1Q9OB 5JO5B 3BSGA 2BPBA 1E65A 1Z9NA 2VH5L 4NO5B 1AGFB 3TBVA 4FYRA 3QEHA 3D9AH 4K7PL 3HNVL 4PV9A 5F88B 4HPOH 2CHDA 4G71B 3OPZL 3UTTA 3EJZC 1CYGA 4OLWH 3LKQB 4ZW6A 4EN3B 4F91B 2XN9B 1L0QA 5AKRA 3IDUA 1XDTT 2XI9A 5A16A 5C0GB 2IBZY 3WFBL 3MRLA 4UDTA 3ML8A 2FEDD 2J88L 2DQEL 4YHYB 3QDMB 3RPIB 3SSGA 3N40P 1HE8A 4OLVL 3B6SB 2VXQL 2VO5A 4WSKA 3X2QB 1UZ8B 2VKWA 3M1OA 2BP0B 4GOSA 3CHPA 5C8JA 3D33A 2AJZA 4BQBA 5I6XB 1FYTE 4JFFD 1NIBA 2VLLA 3VWJA 1MEXH 3E9UA 5LAPA 5KSAB 1AGEB 2FO4B 4KRPC 4ANKA 2I60L 1CD1B 1EK3A 1L9RA 4L0YA 3DX7B 4F1ZA 3C6LA 3QPKA 1S78D 1URZA 1UT1A 3KWUA 5AW4B 3MUGB 3C8HA 2K9UA 4RRPA 5KBKA 4U6VH 2WMPA 1A7RH 4P2OD 2OK0L 3BEVA 3ULVL 3DVFA 1G7IB 1MUJB 4W9GC 1KBVA 1SDDA 2MCPH 4QXUL 4X9BA 3T1WA 1DTUA 1S3KH 5I0WA 1A3ZA 2FT8A 1JN6B 2R8SH 5T3XH 4JKPH 2R0LL 3VRIB 1OSPH 3IFPA 1RLBA 3G3LA 3SY6A 2DD8L 1A14L 3HA0A 1PLAA 1MNUL 2EE6A 4HSAC 3VXMB 2WUCH 3PGFL 3QZMA 5I2IA 3OD3A 4NNYA 5AKVA 3I50H 4S1DD 5TDNA 3UMTA 4Z7VF 1IAII 2XTJD 1KMGA 2YAQA 4UCFA 1QFUL 1YPZE 4APXB 1BG1A 3HC0A 4U1LB 5ACMA 4Y2DB 5CD5C 1T03H 3DX6B 1B2WL 5FV2A 1SN0A 1U91A 5I1IL 3CV5A 5KYUB 5DMKB 5I76A 2F8VA 2FH6A 2NW3A 4PB0L 3QCTH 3UTOA 1FO0B 5EV7A 3FQXB 1DN0A 1UQSB 3FTUA 1U8JA 3P02A 5C0EB 3FU3A 4XMWA 5B3JE 1A0QH 3ZKXB 5DEFA 1HOCB 2GW5A 4ORGB 5GSRA 2NUTA 3DVGB 3NPZB 4X2UA 4MZ3A 4PWEA 4GPVA 1PZSA 1UJ3C 2ZG2A 1ZVYA 2WXGA 4ICWA 2BNRA 2LV4A 2R23A 4ODHH 3R8BB 2D31A 2NNAB 3IJEB 1RL1A 1YN7B 4HH8A 3HPJA 5E1AA 3DK2A 1FZMB 4LLWA 1M2VB 4R4FL 4O00A 4FKHA 2F54B 1NCJA 4N4YB 2L7EA 3OGCB 1E8XA 4AUJA 4UNTA 4JY5L 4XPTH 3SD5A 4KXZH 1F11A 3MLYH 1JNLH 4OZFH 4QRRD 5FOJA 4LSQH 2F7QA 4LCUB 5ID0A 2E8ZA 2JCCA 5JIQA 5DUML 5EZJA 2OMWA 1IEBB 1MI5E 3QEHB 2IMNA 2I9TA 1JGEA 3X1NA 3NIDF 3BJ91 5JOPD 3FFDB 4EIUA 4FA6A 1HEJC 4BWUA 1FJ1A 3I74A 4NKMB 1QQDB 3VYPA 3TT3L 2J88H 3QDMA 1PF3A 2BVPB 3RPIA 5KVFH 5LXGH 3WDIA 2QSVA 4AYFB 3OVUB 4A7GF 1J87A 1MH5B 2Y7SA 4MNGE 4OIIL 3RNKB 4DGIH 5CJOH 3P9LB 4NCC2 3FUDA 2HFGH 3CWGA 4FXKB 1SUJA 4QOKE 3HG1A 4WENB 5ISZD 1IC0A 2VLKE 3UJTL 2FJUB 4R4ND 4F37K 1LEIA 1T7YA 1J8HD 3FB5B 2ENSA 2YXWA 5EZIH 3N42B 4XP4H 5IW6B 3K46A 3VW3L 1A7NH 3AC0A 2Q7NA 3T3PB 3DGDA 3DPBA 3E8VA 4QMEA 1DCEA 4NQXB 1MW0A 2K9FB 3GSNH 1WZAA 4YR6A 2WGXA 1E5YA 2DYPB 4HAFA 5D7LE 2HRGA 5FYJD 5I6MA 4L5FE 2DTMH 3TYFB 1SY6A 3DI2B 2X6UA 4Y4HB 4FP8L 1JCKA 5D70L 4ZOEA 4NGHH 4PGBA 3VQMA 3MV7D 3S98A 4AQ8A 4DGVL 1BQUA 4JFEA 3O6KL 3BIBX 4ZOAA 3OJ2C 4E36A 1CYXA 4YE4L 2QZ5A 3B9KC 1DUYB 3LV3A 3S5LB 3BSZA 3L4WA 3GSNA 1RIUL 2MQGA 4ODWB 3QS3A 4ENEC 4LEBA 2VZTA 3EDFA 4M5YH 2QVIA 3OMAB 3Q9PA 3RWHB 3CNKA 4HOWA 4AMWA 3MUHL 1MWAA 5DK2B 1BMGA 5SX5H 4ZPVA 2EO7A 2RCSL 1PY0A 2CDEB 5IQLA 2JELL 2IF7A 2EE0A 4PRHB 1U33A 3LJ3A 2KYIA 1HSAA 2QSTA 3N44B 3P73B 4KI1A 2X41A 2LFGA 1E27B 4Z23A 2ALWA 3H3BC 5BOJA 2VH5H 4PJ8A 2VDNL 1S5HA 3Q0HA 2XNAB 1IGTB 1RVFH 3C08H 5AWNH 3DTUB 2LHAA 3V6ZA 5H37A 1G7PB 4XT1C 4PJIE 3ULUF 1RV6X 3IM1A 2Z92A 2EE2A 4V33A 5DQDL 4Q9CA 3VQLA 3C75A 4Y5YB 3L2LA 5I26A 3DGGA 1MDTA 1T0OA 3MNDA 1EXUA 3X3FL 4UMSA 1AGBA 5D2LE 1IV8A 2F5BH 1CFQB 1DZ0A 5HYSB 4RGNC 1HH9B 1KEGH 1C5CH 4NRXB 1GGBL 4FQJL 1D9KB 4LEEA 3CXHJ 4I2XE 5AW2B 5DZOA 3PUUA 1JZEA 1OSZB 4PM1A 4NRYB 4RX4A 1IGCL 1ED3B 1XGZA 1ZXQA 4TSBH 1I1YB 2AANA 4BFBD 2A6IA 1QW9A 1IM3B 4RQQB 2GABA 5IGXL 1Q72H 3V6OE 3NH7H 3ZL2A 5IHUL 5DJ6A 5EFIA 5D1ZD 5AYTA 3SGKC 3DXAB 3MJ7B 1B4RA 1JDDA 1OKEA 4OCXH 4Z78B 2WOBA 3QWNA 4MD4A 2AKRB 5F7HA