1A4CA

Azurin mutant with met 121 replaced by his, ph 3.5 crystal form, data collected at-180 degrees celsius
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'AQCEATIESNDAMQYDLKEMVVDKSCKQFTVHLKHVGKMAKSAMGHNWVLTKEADKEGVATDGMNAGLAQDYVKAGDTRVIAHTKVIGGGESDSVTFDVSKLTPGEAYAYFCSFPGHWAMHKGTLKLSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Rack-induced metal binding vs. flexibility: Met121His azurin crystal structures at different pH.
pubmed doi rcsb
source organism Achromobacter denitrificans
molecule tags Electron transport
total genus 35
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1a4cA00
2XV0A 8PAZA 1L9PA 3IBOA 1SJMA 1T5KA 3WKQA 4DP8X 2QPEB 5ANHA 1ASPA 3AW5A 2ZOOA 4G7RB 3V9CA 4M3HA 5I6OA 3NSDA 1UATA 1IC0A 3NJMA 4HALA 2FT7A 2I7OA 1PLAA 3EH4B 4BWWA 1RKRA 4GYBA 2IDQA 3PAVA 2FQEA 4CSZA 4DP1X 2HX8A 2J5WA 4HCIA 2R7EB 2GIMA 4JHVA 2Y1AA 3T6XA 1E30A 1BEXA 1NIAA 5AKRA 2GC4C 3FU7A 4Q89A 2WSDA 4GXFA 1L9TA 1WA2X 1GW0A 3TBBA 4BWTA 4A2FA 2R7EA 2UXVA 7PAZA 1ILUA 1AOZA 4DPCX 3NJLA 1NIFA 2XLLA 3NJGA 3PXLA 3TASA 4QLWA 3FSZA 4KNTA 1KDJA 3WNIA 1NIEA 1A3ZA 3GYRA 1ET5A 5B1JA 1BXAA 1JERA 1PNCA 1ASQA 4E9XA 4A2DA 3EHBB 1E67A 2BW4A 3FS9A 3SBPA 2EILB 5I6KA 3QJSB 1GS8A 5I28A 1A65A 4EF3A 4ZK8A 2TSBA 1XB8A 1CYWA 1L9OA 5D4JA 4F2FA 1YLBB 1ZV2A 3D12B 4FA7B 2DWSA 3ZIYA 4A67A 3FSAA 4NB7A 1AG0A 2FQGA 4GP8B 3AZUA 3DIVA 3DTUB 3NJNA 1OF0A 4BDVA 2CUAA 3FYIB 3ASOB 2XX1A 2J55A 4QKTA 4W9ZA 3UGEA 4YSAA 3NJFA 2P80A 2HXAA 2B3IA 2GBAA 2DY2A 1AZRA 3T9WA 3NT0A 3PAZA 4E9RA 1GR7A 1B3IA 3EH5B 1ZDSA 1NINA 2CBPA 1AS6A 1KBWA 1GS7A 5B7FA 1NDTA 1R1CA 5B1AB 3S3DB 1GY1A 1ZDQA 2PCFA 1NICA 1X9UA 4L0PB 3X1FA 1AACA 4P5RA 3WG7B 1GS6X 1SHWA 3RYMA 2H5UA 2H3XC 4DPBX 1JXFA 1BQKA 1RZQA 3JTBA 4DPAX 1ILSA 1OCOB 5A7EA 1GYCA 4N4YB 4E9SA 4E9TA 3TBCA 1KCWA 1W8EA 3FT0A 3GXUB 2JXMA 4KO9A 3NSCA 2XUWA 3FU9A 1RZPA 1AZBA 3N2JA 3UADA 3BVDB 1E5ZA 3C75A 1ADWA 1PZBA 4KOBA 1F56A 2FTAA 2VMJA 3NJHA 3WI9A 4GP4B 2BP8B 4AX3A 1IBYA 4HCGA 4PCYA 2DWTA 4AKQA 5E9NA 1BYPA 1OV8A 2GC7C 1TKWA 1BAWA 2HRGA 3T6VA 9PCYA 2BP8A 5B3SB 1QLEB 4G7QB 5I6PA 3S8GB 1IUZA 3UAAA 2BWDA 2PPAA 3FU7B 1XB3A 2BP0A 2DYRB 1NTDA 3GDCA 1HAWA 2PPDA 4A66A 1M56B 1M9WA 1AANA 4E9YA 1PLCA 3WIAA 1PZCA 2I85A 2AVFA 2YAFA 2ZWNA 5PAZA 1JZGA 3U25A 3S3BB 1HFUA 2UX7A 3HB3B 5TK4A 2QT6A 4BK5C 1E5YA 1JZEA 1URIA 1PY0A 3S8FB 7PCYA 1EZLA 2XV2A 4AKPA 1BXUA 4WKXA 3QJTB 4E9VA 3TU6A 2I7SA 1PLBA 2HX9A 4GY4A 3FQ1A 1OE1A 1AZUA 4YSCA 4BXVA 2YXWA 1QNIA 3CZUB 1BYOA 2VSKB 2W8CA 2BHFA 3PCYA 2VM3A 2X88A 1JOIA 2J56A 2IAAC 2B08A 1NWOA 4BDVB 2CJ3A 3FPXA 5B7EA 4A2GA 1N68A 1CURA 3S3CB 3OM3B 1DZ0A 2EIKB 4KO6A 1OCCB 4YVUA 1SDDA 3CDZA 1L9QA 2YARA 1J9TA 2TSAA 1AQ8A 3AG3B 1JVOA 2PPCA 3EH3B 4YSPA 5D4IA 3UAEA 2AANA 5I6NA 5IY5B 3FQYA 1MG2C 1ET7A 3ASNB 4W1TA 2FT8A 4YL4A 1KGYE 1PAZA 2PP9A 5B7MA 2BWIA 4BWUA 3EF4A 3ZBMA 3JT2A 4DP0X 1FFTB 4HHGA 1GY2A 4AZUA 3NJJA 5FC9A 1OE2A 3T6ZA 1V10A 4F7KA 1JZJA 1L9RA 2VW4A 2AZUA 2IWKA 1BXVA 3FU8A 2XVBA 2AFNA 3CG8A 4Q8BA 2A3TA 1ZIBA 1J9QA 4TXVB 3ZDWA 1NPJA 3IN0A 1OOWA 1PMYA 2RACA 3ABKB 1PZAA 3QJVB 1AS8A 1PCSA 2FQFA 3IN2A 2ZONA 4PAZA 4UF7C 5I6MA 4MFHA 3UABA 1TEGA 1RCYA 1HAUA 1ZIAA 3NP3A 1CYXA 3TA4D 3ABMB 1ASOA 4K9JA 1OCRB 3BQVA 3N55A 1EHKB 2XXGA 3NP4A 5EHFA 3ZX1A 4UANA 2OCCB 1IKOP 2YAQA 1TU2A 3QPKA 2IDUA 4YSUA 2ZXWB 4E9WA 2GSMB 2JKWA 3QQXA 2H47C 4YSTA 2QDWA 2EIJB 2LLNA 1XMEB 1AIZA 2WO2B 4KO5A 3WNJA 2XWZA 2QDVA 2QPDB 2PPEA 2NRDA 2IDSA 2Y69B 2BP0B 3QJUB 4KNSA 5I5JA 5AFAA 2UXTA 4YSQA 2VW7A 2EINB 2X87A 3SQRA 1J5DA 2CAKA 2EIMB 3T6WA 2GHZA 2BZ7A 2GI0A 3SBQA 3DKHA 2YAHA 1JZFA 2MTAA 3X2QB 1PF3A 3FYEB 3AG1B 1JVLA 3OMIB 2PP7A 2VW6A 2W88A 1NIBA 3PAUA 3IE9A 3H4HA 5B1KA 3UACA 1AZNA 3QJRB 4HZ1A 4G72B 3V9EA 4NAJA 1JXGA 4FAAB 3MX0B 2HZHA 5AZUA 4DP6X 2FWLB 3WKPA 2YQBA 1OCZB 2PLTA 4DP4X 1SNRA 5F7AA 2XU9A 1NWPA 5PCYA 4HHWA 1XB6A 4GP5B 3NJKA 4KNUA 3SBRA 5LDUA 2PCYA 3FQ2A 5TK2A 1J9RA 4CSPA 4RH4A 2CCWA 1I53A 4AKOA 1WA1X 5F7BA 3HEIB 4JHUA 2YAMA 1PNDA 1IBZA 3FSVA 1SDDB 1JZIA 2XYBA 3PPSA 1A8ZA 1V54B 2OJ1A 3CDZB 3G5WA 4HIPA 1M57B 2YXVA 4AI7A 5I5IA 1SFHA 4A2HA 1VLXA 1QHQA 2XV3A 1J9SA 4NERA 2E86A 1GSKA 1JXDA 5I26A 4YSRA 1SF5A 2YAOA 2IWFA 4BXSV 2XXFA 3KW7A 5D4HA 2HX7A 4DP9X 1WAEA 2UXFA 2HRHA 2VSMB 4A68A 4DP7X 1BQRA 5I6LA 1AZCA 1X9RA 1BQ5A 3NSYA 4HCFA 2DYSB 1NZRA 5B1BB 2UXGA 2VM4A 4M4RB 1MZYA 3IEAA 3OMNB 4HAKA 4YSOA 2IWEA 3AG2B 4E9QA 6PCYA 1J5CA 1SFDA 3H56A 1CUOA 1FWXA 4N8UA 1ET8A 3H4FA 2OV0A 4YSDA 1CC3A 1N70A 3AG4B 1ZPUA 1FA4A 4WTQA 3FSWA 3MBWB 1KDIA 3CVBA 2PP8A 3ABLB 4JKNA 2IDTA 3ABGA 1W6LA 1KV7A 6PAZA 2WO3B 1NPNA 4KOCA 4UAHA 3CVCA 3X1BA 1TEFA 2IDFA 1ID2A 2FJSA 1WS8A 2J57A 3NSFA 2CALA 3FPYA 4YSEA 5I5MA 1AR1B 3NYKA 4A2EA 1NIDA 4G7SB 1SHXA 2BO0A 3NJIA 3OQRA 1A4CA 2JFCA 2HLEB 2N0MA 2Q5BA 3ERXA 2XX0A 1AG6A 3QJQB 1AAJA 1E65A 4YVNA 4KO7A 2IH9A 1ETJA 3PLYA 4G70B 3AY2A 1KCBA 5B1JC 4DP5X 3KW8A 3OMAB 1A4BA 2FNWA 4X4KA 2FT6A 3OD3A 1A4AA 4F2EA 4G71B 1AS7A 2P80D 1WA0X 1WS7A 3T71A 1MDAA 1SF3A 1V55B 1L9SA 2YAPA 2UX6A 2FQDA 2IH8A 4P5SA 2AZAA 1KBVA 2GB2A 1DYZA 2DV6A 2BZCA 2Q9OA 1MG3C 1JZHA 3X1GA 4YSSA 3CVDA 2YAEA 3X1EA 3X1NA 1MZZA 1OE3A 2BW5A 3L45A 4DP2X 2PPFA 1W6WA 1KYAA 4ENZA 2MRYA 2VN3A
chains in the Genus database with same CATH superfamily
2YD0A 3C2AH 3VDBA 1IM3B 4P2RA 4PWHA 3NRFA 4BUHA 3MA7A 1PKQE 1L9PA 1BBJB 1SZNA 2QKIA 2BVQB 3FFCD 4RQQA 5MEND 4PJ7E 4M3HA 1HHIB 5JPMA 3TWCL 5DLML 3ZU8A 1MFMA 3D4ZA 3GFUA 4BWWA 1B4JH 4PJ5B 2N01B 3PAVA 4WFHD 1GC1C 3QEGH 2FQEA 1D7CA 4HUWB 1JNHB 4CSZA 4H88H 1S78D 1UQSB 4HUVA 4BQCA 3H0TA 4IOIB 4WO4A 1Y1UA 4FQXD 4NC1C 3QDGA 5AUMA 3VXQA 1BEXA 3CSYA 1CLVA 3BP5A 3APCA 4OV5B 3JV0A 4NZFA 4Q89A 1IAIL 3AAZB 5IJKA 1XQ4A 5CSZB 5AVYB 1IT9L 2DBLL 3EJUA 3HG1B 5JXED 4JZOB 3MRPB 3TBBA 1GKEA 5C0AA 3O41B 4QY8B 4O02H 5A2JH 2HKFL 2JV6A 1BG9A 3HRZB 1G1YA 1ED3A 2E9WA 1DDHB 3BH8B 3PQYD 3IWUA 3P4MA 4HXBL 4RVBA 4OGXL 1S7UB 1S9WB 2VJ0A 4X6CA 3CFEB 4GW5A 3TZVB 3HC3L 2ENQA 2GEQA 7FABL 2EDKA 3SQBA 2AABH 2NNAA 5LDSA 3KLSA 3QJSB 5KG9B 1DHKA 3OAWA 1IEAB 4J3OH 4RMQA 3J27A 4OGQC 4PMFA 1DBAH 4KVCH 4WTXA 5I28A 3B9EA 2BVEA 4EF3A 2AQQA 3DX6B 2OS7A 2DQMA 1OO2A 4HAFA 1BW8A 2XXMB 3HI6L 5L88H 5EMYA 5G5DB 3CX5J 4WI4A 3UMTA 3NIFE 3VW3H 3QQ3B 2RAMA 1IKNC 1A7OH 1ZSDB 5F97E 1PG7X 3RE0A 3C08L 2FEDC 5EU6A 4G8GA 1AGCA 4GAGL 4JE4B 1Q72L 3LKNB 3U6RB 1D5MB 4XODA 4ZAKB 1DLHA 2J55A 4X6EA 4PV9B 5E2WH 5C0DB 1EZUA 1T04A 2DN7A 4X4MA 2AEPL 2GBAA 4DQAA 4XNXH 2P8LA 4PGEA 2F18A 3ARBA 4URTB 1OAKH 3LVEA 3DVGA 3P73B 3QULA 4CC1A 4LLQB 3S3PA 1JTPA 3M1BA 5IJVB 2JELH 1FYHB 2M8XA 4DZ8B 5T1LA 4Q58C 1KBWA 1FPTL 4CRPA 4FEIA 1FNHA 3MACL 2WM0A 3B9DA 2CGYA 4NHCH 3BT0A 5EZOL 1DFXA 3MNVA 4WFED 2AERT 5BUGA 4KKBC 4P05A 4XMZA 2AEOA 1SHWA 3ZYIA 5AEAA 3T4YA 3MJ7A 7TAAA 3I3BA 4UU9A 4HOWA 3CLWA 4L4VD 4ZMLA 1O0VA 4MMXA 2YFOA 1F4WH 2JXMA 2VMDA 4MJIB 1E2VA 2FB4L 1FL5B 2HG5A 2QFPA 2RCSH 4PM1A 4XHQA 1SOXA 3Q7JA 2PO6A 4BUGA 1JNLH 3E3QE 4N1HB 2GG1A 2FTAA 3A6CH 3CZNA 1N10A 2FUTA 3EOAB 5DJAA 2VDQH 3ZO0A 3LN4B 2DB8A 1H8LA 2NNFA 2C9QA 4UT9H 3Q8BA 5JA8B 1MN4A 4F20A 1JF5A 1T66C 2J88L 3GQFA 2DWTA 4QF1A 4JK0D 4Z7NE 3I6LE 2C5DC 4RIRB 4OTXL 4M9PA 1A6VL 2WBJB 1BAWA 5EZJA 5LNEA 5J8OA 2WWMC 1M1XA 2JMRA 4Y5VB 3S8GB 1KN4H 4Y1TA 3S37X 4U6TA 2B16A 2Q87A 4PU2A 4TNEA 2E7BA 3GXMA 4JDTL 1HAWA 3I6KA 4Q4IA 2Y4SA 5IZ7A 2WNKA 4PWGA 3WHE0 5KWYC 4HC1L 2F0CA 4ZW5A 1XCTA 3DETC 4HJJL 3HVNA 4KMLB 4Q9BA 1F6LL 3HE6C 1P84K 5F88A 1EHAA 3RX7A 4F7TB 4LVNB 2DWEA 2MCG1 3FFOA 5EOTA 1ERNA 1YEJH 3FC8A 3FU5A 1YMHA 1YDPB 1LEGA 3RJDA 3PDDA 5JR1H 3O9WB 1FP5A 1RZJH 1YEEL 1ZLUH 3ESOA 1OF2A 2JVUA 3G5VB 1BJ8A 5CJXC 3ARGC 4KZDL 1CD0A 1R3LB 3KPTA 3KYKL 2E75C 2ZXBA 1F97A 4HIXL 3FN9A 2FWOA 3HN8A 3MR9A 3BZ5A 1OE1A 4ETQB 3ZDYE 2Y1YA 2L4OA 3VD5A 4XB3A 4TUUA 3I74A 4I1PA 1BQLH 2BMKB 2UUDK 1OP4A 2Y5QA 4FKKA 4KKCC 4IU2A 2XBTA 2PCPA 1IEHA 3FPXA 5GJSH 2H7WA 4M1DL 4Y0GA 1AGDA 2ZKHH 4N0UE 2F5AH 3WIHL 2LFEA 2VKXA 4HF5L 1WAAE 4NQSB 3DTDA 1UM5H 2VJXA 3V5DB 1F3DJ 2ED6A 2XYCA 3CDZA 3PXHA 2WB7A 4KXAA 3FO9A 1QZNA 1AZVA 1KYOJ 2YARA 2AKRA 2NXZB 3LKSA 1R5WA 4AUUA 4OJEH 1NEZB 4IKKA 1FAKT 1TFPA 1C5CH 4ZUSB 1IAOB 5D4IA 3PU7A 4RISH 3L4XA 4FP8H 4NQCA 3FTZA 3O45A 4OLUL 4P5TC 4PRAB 5DUBB 3K46A 4QAMB 4GMSH 1J86A 3TLRA 5L2JA 5E9DD 2BK8A 1LP9F 1WFIA 4UTBL 2BWIA 3MCLL 4ZMOA 1H6TA 2BNUA 1LP9E 4WKZA 4XPAH 3LKOB 4PJEF 5F7YC 4ODUB 5I16B 1EJ6A 1MCEA 3PL6C 2JJVA 3ZYJA 1G4RA 4PJEE 2VW4A 2HVJA 4LEOB 4OLYH 4ADJA 4RAVB 4Z3GA 5ICYA 3ZDXB 2GW5A 1PIFA 1KJ2B 3HG1D 3MRJA 3IFLL 5BVJA 3THML 4ERSL 1ZIBA 1CXIA 4NM4H 4PGCB 4QRFA 3TO4C 1H3TA 2X89D 4Z76B 3E6HA 5JIQA 5BS0B 4G8IA 3ABKB 2VMFA 5KN5B 4FNRA 4IK6A 3GJFB 4FQPA 2W07B 2P46B 3MRDA 3EOTL 4O00A 3SJVA 4L1BA 2YEZB 4ICWA 1ZIAA 4YFLF 4MB4A 4FZ8H 1OARH 4L29A 1THCA 4PP2A 3ZE0B 3EYOB 4JRYE 1OCRB 4LARL 5LAXA 2HUEA 4FQIH 5ANMB 4AM0B 2CMRL 2Z9TA 5DD3L 3KJ4C 1D9KB 1RIHH 2FWSA 3NDYE 4HCRL 4X6FB 3WNOA 2EYSB 4JO5A 2VZSA 3GHEL 3T77A 5T3XD 3AXLB 5BMFH 2R4SL 3ULUH 3I9GH 4IRSA 5IIEA 3AUVA 2YSSA 2QZQA 1NA8A 4AVJA 1CR9L 3MV9D 1YUHB 2CR0A 2G3NA 4M8QA 3DUUA 2Z31D 3U36B 1BPVA 4KGJA 4ZFFB 1JZ5A 1KOAA 3KGRA 4ZQKA 3WE1A 2MQCA 4C57C 3AT0A 3ARFC 3DI3B 4LKCB 4PJIF 3LDBB 2YAHA 3DV6A 5FOJA 4PJIE 5K9JL 4EDXA 5FB8A 3HMXA 2V5MA 5T5FH 5FYJE 4MMYB 5HDLA 1HVXA 2BPBA 2BNRB 4M6NL 4XTRC 3FMGH 3A4AA 3U7YL 4BUQA 3MTRA 1NM4A 2DIEA 1F4YH 4HJ0D 2YD5A 1SJHA 5ALCH 3UACA 4QD2E 4YDJB 5E7FA 4MRBA 1QNZL 2CO3A 3C9NA 3LV3B 5E9AA 4NAJA 4KI5D 5CGMA 4JG0H 1X4YA 4EI5A 2NY7L 4QXTB 4KJQC 2ZKMX 1SVCP 5LXVA 2DIBA 2Y5EA 5KUKA 4ZFOA 1VGEH 3NZHL 5HDQL 3CE1A 4FXKB 2H6PA 3P30L 1U3HD 4XP9H 1SNRA 2ADFL 4KHXH 4B9YA 5KS9F 3K6SA 1TQCC 2YN5A 2GY5A 4M6ML 1FV1B 3AFLA 5KS9E 1TEYA 1OOAA 2IBBA 2X70A 3IPBA 4WFGD 4N2FA 5AVWB 5L7XL 5EEXA 1BECA 2H2PC 4AEHH 5KVFL 1W0VA 5DK0A 2I9TA 2V17H 2QQQA 5GHWL 2UZYB 4A37A 4Z7VE 1JZIA 4JZJB 4FL4B 4PD4K 3L3OA 2IPKB 3C5XA 5B4MC 4N87A 4R4BB 4NRYA 1QPXA 1J0JA 3BZFA 4LVHB 4F93B 4C56E 3UDWC 4OZGE 4AQ1B 2HRHA 2ALAA 1UWFA 5J13C 1AGBA 4HUMB 3W3BA 2E7CA 3SDDD 1SBSL 1WT5C 5IK3B 2J1WA 4AM0Q 2DYSB 3QUML 1NZRA 2ZCLH 4PJHE 2VL4A 3Q48A 3ZL1A 3RAJL 1LNUA 2NY4D 3AG2B 4NZRH 4LDOB 5EUOF 1CFVH 3MLWL 2JQZA 4YDMA 2HT4D 4P2OB 1T0PB 2QKIC 3ZT6A 3G6AA 3G08A 3AREB 4FNUA 3S34L 5GS0C 5JPMC 1Y6MR 1IBGL 2X1PA 3JTSA 5IFJA 1N70A 3VRLF 3D2TA 2CO1A 3ARZA 3MOAH 3VRLE 2XTLA 5FK9A 3TIDB 2IDTA 3WFBH 4BRJA 3ABGA 3O9WD 4N2KA 4OGYH 4NQEA 3PIQA 1WFUA 1A3LH 2N7SA 1WYJA 4JN2B 2J57A 4PJDB 5IJKC 3NSFA 4KITB 4LHUB 1PZ3A 5DA4A 1VRSA 4WHCA 3OVUB 4HSAC 3TH2T 4X4ZA 3Q2LA 1BOYA 3TPUA 2VR3A 5GGQL 1BJMA 4GRLB 3AQYA 1EAJA 2G75A 3MLYH 3QHZH 2GJ6E 3VFGL 1AE6H 2AXGA 5HGHB 1B0RB 2OMXB 3II3A 2HT3C 1FF5A 4MD4A 3KWUA 3TFKD 3PP4L 1CFQA 1H3XA 3S0PA 1FO0L 25C8H 4JDVA 2IQ9H 5C92A 2JJSC 3DWTA 1U2HA 3EGDA 4F5CA 4E2OA 3HZYB 4AGPA 4G5ZH 3RBGA 2NXZD 2HN7B 5HHME 5CZXD 4WVRA 2MPVA 3OKKA 2XOTA 4OU3A 1TG8A 2WSPA 3AS1A 3K4DA 4NN7B 5E70A 4IBSA 3FKUS 3IJ8A 5D7IA 3JSSA 2F5BL 1MZZA 3CSFA 4LU5L 1VF5C 2DI9A 2FYVA 1KYAA 4P0DA 1E4XL 3BPOB 4PJBF 5ITFB 5GSRB 5E99L 2FJGA 1X9QA 3IPFA 3M07A 4YHLL 2CR6A 2MQ0A 4PJBE 4R3SB 1JF1B 1SJMA 2VERA 4R9HA 3QUZB 1P1VA 1VFUA 1HCYA 4N8CL 3BPNC 5BZDB 4DEWA 5JUEH 4AEIH 1P9MA 1BFSA 1QFWL 2NUPA 2CO2A 3DDGA 5FR3A 3O4OC 3BRDA 1QOKA 4K5PA 5F21B 5KSBB 2WQVA 4PREA 1G7LB 2ZCKL 5EU5A 2MHAA 3ARBC 3WLBA 5HVHC 2GK0A 4Z7QB 3V95A 2R59A 2CBQA 3P3UA 4OF6A 4FDWA 4H8WL 4BINA 4ZMZA 4HPOH 5DD0H 3QRLA 3GTVA 1JNNL 5E1GA 1U30A 4JB9L 2XBDA 4U3HA 4WFFD 5CBEA 2G9HA 3G5XA 3CQQA 3ZHDA 3T0DA 5JXAH 3RUGA 2ZXQA 5F6IB 3I6LD 3QO1A 4P9ML 3DECA 3O4LE 1KXQA 2Q7YA 3NK3A 4P49A 4E9XA 1T1XB 1KELL 1XO8A 2CHWA 2A6IA 3MRRB 4NKOB 4BE5A 2DQEL 3EHBB 2LW3A 3JYCA 2DJMA 2ZCZA 4MMXC 4M3JA 2BVPB 5D70H 5TH2B 3QIUD 4IRJD 3QXAA 1O6SB 2FUQA 2GY7B 1U93B 2AMGA 2VYRE 5CCKH 1A65A 4KXCA 2NY3D 2PO6C 3DURB 5GSVA 3N50A 4S1QH 4MCZB 4F8LA 5CIPB 1YLBB 1YUKB 2DD8H 1AHWC 2YPVA 3CC1A 4ZMVA 1TTUA 3O2DL 3KDMA 3GXTA 4AV4A 3NMEA 2V5RA 3FSAA 1VPOH 2BNRD 4M00A 2R23B 4DKFH 3V0VA 5CMAB 1RUKL 4G8FA 4UM8A 4WNQB 3T0XA 1CD1A 5AL0A 3WDJA 1KPUB 2A6KA 2O61A 1E28B 2ZYRA 5FCUH 2Y6TE 3MVSA 5EC2B 5C9KA 5HI5D 3D33A 3NJFA 1WGVA 1QBLH 3OKMB 3KEHA 4PRIB 1R24A 1KF9B 5EZIL 4AXWA 2YD7A 3HHRB 5IGXL 1H3PL 1B6DA 2DLHA 4D0BA 2ZWLT 4FABL 2YPLA 1CXHA 1FE8L 1E27B 1PAMA 1RD6A 5DUPL 5GRVL 1BV8A 2H4EA 3MOBH 2D0GA 3MLSH 1ZDQA 3U46A 1E8YA 3HFML 2FBJH 2R2EA 4MHHG 2DKUA 4Y2NA 4L3EB 1A1NB 3QJXA 1E42A 1FVEB 2MSPA 3IU4H 1ZA6A 4JL2A 1ZHNB 1P4IL 2Q3ZA 3RWDB 1RIVH 4WSKA 3H2PA 3HS0A 1HNFA 5CINL 4KRLB 1IC5L 1Z9PA 1F11B 5KSUB 5F1SA 1YPZB 2Y36H 3RZCD 4YHYB 1MHPL 1ADWA 1WIOA 3RPIA 3Q3GA 5E4EC 1RUMH 5A2KH 2BP8B 2KS0A 2BH0A 4N0CC 4JKKA 2E9JA 1A5FH 3EJQA 4OM1L 3W39B 2XNAA 2WBKA 3H7LA 3T1FB 1OAXL 2Y3NA 2H3NA 1NFDE 1VIWA 3V4VL 1EPFA 4IRZH 4F7PA 3FBQA 1C1EH 3BN3B 5KVEE 3OHXB 4XAKE 3HJEA 3L95A 2H32B 5CWSA 1CDCA 4X9IA 2ZXAA 3A4DA 3MODL 4JRYD 5CLXA 2NX5B 2Y7MA 3R8QA 3STLB 4P2AA 5IBLC 3F6JA 3VX0A 4J3OG 1ADQH 5IMKA 3X3FH 4QRAA 3CFBB 4W4OA 4G6FB 3UZQA 4OF3A 1UT1A 3AU1A 1QSFE 4E9YA 5FLVA 4Y4KA 1LLAA 1TJHL 5GGTA 2OYLA 5TTRA 4K3HA 3B2DC 3CH1B 3TP4A 1SJEA 5CP3H 2JKNA 5A43C 2ENSA 3T6QC 2ZSVB 2KC0A 3S8FB 4G42A 2ENPA 4GRLD 4PRBB 3WEAA 4ZUTB 1UUSA 1KXVC 2A0LC 3MKGA 3PJSA 3IFPA 1KGIA 1NCDL 1SY6L 2YS4A 4WKXA 4B50A 3D3VA 5FF6B 1JPTH 3QS2A 2HFFA 3VXRB 1SGKA 2J4WL 5ACZB 1PLBA 3U82B 5KYNA 3NH7L 1KTLA 2FK9A 3S36L 1TITA 1DQIA 1N0LA 3FAWA 2VXSL 1G1OA 2ATPB 3D18B 4Z3EA 2V7HA 1LK3H 2WAQA 4Y2DD 5C6TL 1NDGB 3MXVH 2VC2B 5D2LB 3V8OA 1YAZA 1KB3A 5IBUB 3QW9A 2FGWH 4UZSA 3FCTA 5E2JA 2EIKB 1S5IL 4IRSC 4KO6A 4PS4H 3IDMA 1OAYH 3P9WB 4GAYB 4NNPL 4XBEH 4YO0B 2OL3A 4F2MB 1KC5H 2WGNB 1AGEA 4X83A 3STBA 1W72B 4U3XA 1E5BA 4WQOA 1U4FA 1P7HL 5IHWA 1DLFL 1AMXA 1LO5A 3O6LL 3TX4A 2AHIA 4OFDA 3V4PB 4QPEA 2MQ3A 3ASNB 1U8QA 1HNGA 1VGKA 2YGVA 2WHVA 2CGRL 5B7MA 1L0QA 5D7LB 5D1XE 5MERB 2XQYK 1QBAA 2R56H 3QDJA 4GQQA 4PJGF 4F7KA 4Z7WB 4WENB 2AZUA 4JDZA 4MQSB 4NKMB 3FU8A 3OKOB 1M2VB 5CU5A 4OIIL 5EBLA 1AD9A 4WW2B 5DHYA 4C56D 3JVFC 3ARWA 5BCAA 4XN9A 4WUUB 3IN0A 4GXUM 3CFCH 4XH2A 5H4ZA 2AJ3B 3FNKA 5AKVA 5L8LB 4I88A 1CS6A 5A40E 3EG9A 2DQ6A 4F37K 2JKLA 4MFHA 1TEGA 2VXQA 1OAZH 2XWDA 3GSQA 4LSPL 1K5NB 3WO3B 2AQNA 4QO1A 3TA4D 3ABMB 3H85A 4JR9H 1XSOA 3EHBD 5HPOA 3TA3D 1Z9SB 4ZUUB 4MXWL 3ZX1A 3CSPA 2VXVL 1QRNA 3L3OC 1YJDC 4PN6A 1NC4D 4G6MH 1CFSA 1ZV9A 3EFOA 3CLEH 2FJHB 1UB6A 3CHPA 3MGOA 4YSTA 4Y1AE 4KO5A 4X4XB 3P77B 5D93B 1GGIL 3B56A 3QFJB 4UQCA 4LLWA 3KG5A 4GINA 1T22B 3ZTJH 2PYEB 4P4KB 1USZA 3CZFB 5CF3A 1JCVA 2J43A 3JVGC 4CADA 2X87A 4DFHA 3QUYD 3V0WL 1KEML 4N2MA 2LLLA 5TE4H 1ZHBB 4FCHA 5KYYB 5EPMA 2N4IA 5I8KH 1G9MC 3F00A 1BD2B 4UOW1 4WTWA 4A6YB 3EJYC 3B2UC 5D2NB 1I7TA 2QVMA 1P7KB 2UZIH 1DQJA 1JZDC 4IHOA 4AITA 1IEBA 5F7DB 4RMRA 3QCUH 1CI5A 4E41E 1TTAA 2O6EA 2R2HB 4KAQH 4PGZA 3L4WA 3WS3A 5C6WH 5J1AA 2DKMA 1DQTA 1JGEB 3QH3B 3BKMH 4FAAB 1BGXL 3MNWB 4OZIA 1QLRB 5E7BA 3UIZA 2A1WL 4KUZH 4PGDB 4KVNH 2HP4A 3ZDZB 4HOXA 1YAIA 1IL1B 3Q8CA 3UERA 4Z78A 4E68A 4PVBA 5I1IH 4YGVB 5HHMD 3TYFB 1ZJBA 6CGTA 4G1EA 4R96A 4V1DE 4ZODA 4M7ZC 2M1KA 4PS3A 2EXYC 5JQIB 2ZNXA 3QEHB 4PSRA 1PNDA 4C83B 1IBZA 4XZUB 1PJWA 1EXUA 1UVQB 3FSVA 3U6XA 3EBAA 3BE1L 3IMUA 5CGTA 4X98B 4HMCA 5I5IA 5LCVH 4W6XB 1GGBH 4NKDB 3OZLA 1EEZB 5AW1B 4DN3L 1NCCL 2PXYA 3KPPA 3PWPE 4BFKA 1LD9B 4P4RA 1QD0A 2BRQA 3QZPA 5ID1A 3G6DL 4X7SH 4X2UA 1VFOA 3IDJB 1TZ8A 3NIGB 5ESVB 2WNGA 5FYKL 3FOLA 2PW1A 5I6LA 4U1JA 4UILL 1AZCA 1UJ3C 3TS8A 5D93C 4O02A 5L0QB 2LLGA 4HCFA 3L7EB 3TJHC 2GTZA 1JYVA 2COVD 3PYCA 1NGPL 4PV8A 5JW3H 3SD2A 4P9HC 5KBPA 2NX5D 3IWVA 3L3GA 5HI4C 3O0RL 3H56A 4UV7H 1RURL 3BLPX 3U0PA 2H0JA 1HSBB 3QI9B 3O4LD 2V2XB 5TF1L 1BFTA 4DETA 4JANA 3BAYA 2GFBB 3QXDB 4PG2C 4XMPL 1ZPUA 3OKLB 5CJ8A 3MBWB 4GRMA 4WI6A 1KDIA 1FQ9C 1YYMH 5JQ6H 2PP8A 2X9YA 1K6QL 3P0YL 1LE5B 4HW6A 1S7WA 2I25N 2FX9H 2MFNA 4Q6IB 2OMWA 4FE9A 5C71A 2W65B 5BZWA 2E3VA 5E8EB 1Q94B 2W0KA 2EDHA 3A24A 5D7EA 2UZPA 3K1KC 5I1EH 1MAKA 2BY1A 4RGMB 2VDKH 4UQIM 5HHXH 2ATKB 3GRWA 3TPKA 1PYWA 2BSRB 3UO1H 3D87B 5LWYL 4LCWA 3U4EA 2AQSA 5IMMA 3VFTA 2F7IA 1MFDH 1QO3B 4JUTA 1AAJA 4UINH 1HIMH 4LEEA 3SB3A 3SY0B 1Q0YL 1HXYB 2IFFL 2HKAA 1MFCH 1TTGA 3OMAB 5HGAB 3RZWA 4IBVA 2XKUA 1O7DE 3FRPB 4X8JA 1LL1A 4LL1A 1SYSB 2WUCL 3D06A 1XH2A 3BCFA 3FQTB 1OCWL 2VDML 3MO1B 5HJ3B 1B4RA 4OCMC 4N9GA 4U7MA 5EU7C 1BDYA 2ESVB 2Y1VA 3ETTA 3RX5A 1YC8A 3ZL4H 3ZQWA 4KMTL 4AVIA 1IIIA 3O6FD 4X9FA 3QQ9C 3KLLA 3Q1SH 3KNBA 4DP2X 4XMXA 2GCYB 3TNNB 1TQBC 2AEIT 3BSGA 3MV7D 5T1MA 5G2NA 4EUPA 4Z5RB 1P53A 1JV2A 5F44A 1XGYL 3F64A 5MI0C 4I0PC 3GPSA 3RA7H 2E59A 4S1RL 1P84J 2PYFB 1G0XA 2CSPA 3T4AB 5DHEA 5K59F 4TOYH 1ASPA 2DICA 5K59E 1AXIB 1QA9B 1QYGL 1WFJA 2ID5A 5DEFB 2BVTA 1BVOA 2YD6A 2A2QT 1YNTF 1V3LA 4XBPB 2J1YA 4M56A 1HCVA 1I8KB 4KRNA 4NZTH 2DTML 5E6UB 4UWQB 4N0YH 4YGAB 4WUUD 3CXDH 4M4PA 3AGWA 5EFIA 3V79C 2XA3A 3O11B 4LOFA 2ODHA 1R4XA 2CDFA 1A7RH 1A7PH 3TEZA 4JFXB 4R5VA 5E1QA 4YHML 3BZEB 2HJFB 1EWHA 4O58L 2IV8A 7PAZA 2AITA 3NEXA 3VD9A 3DRTB 2PW2B 4I9WE 3BEWB 5KSAB 1FDLH 2VH5L 3ECBA 2XVGA 4M5ZL 4O2EA 4WUKL 1N8OE 1IAKA 2NR6D 5DJDA 5HHQA 3CMOL 1X5ZA 4L3AA 3WEXA 3BPCA 2R0ZL 4FTVA 1F2XK 4JJHA 4WTZG 5L4FA 2PMZA 3TO2B 1U8MA 3ILPA 4D9RE 1J05A 4UYQA 1J1OL 4X8GA 3LH2H 3VI3F 4N2GA 1YEWA 1VKXA 3BQUB 5HHVL 3GWJA 2F19H 3IKKA 5BRZA 3HS0C 4DIXA 4G3YL 1U8IB 2CG9X 2V9UA 3D0VB 4FERA 1GJUA 1MHEB 2GJZB 2TSBA 4M61B 4ZPVA 4MJ6A 1VFBA 2KPNA 3D12B 4FA7B 3CBKB 1RUAH 2DKSA 1BD2D 1WP6A 3UAJA 4J5VA 3K6DA 4AG4L 2FQGA 4L8SA 3MAWA 3RFZC 1AFVL 1DJIA 2F1AA 4JREB 4R0LB 1I1RA 4J8RB 5I8OH 2V2WB 2OZ4H 1A1MB 1UM4H 4YHKH 2IGLA 3HB3D 2FZ3B 4FHBD 5E8NA 1JZ8A 3GB7A 4P23D 1RK7A 2W9EH 1YG9A 4XO9A 1JWMB 1MI5A 3BKJH 3EJTA 5AYQA 4AH2A 1FBIH 1Z5YD 1I3GL 1P6FA 2O5ZH 3E1F1 2MPAL 5J12C 4W4OC 2X05A 1N3NB 1S9XA 1UD8A 3DRQA 3H7BA 4QEGA 5FA3B 5T3ZL 4FG0A 1ZD6A 4NC1E 3NOIA 3BGFC 4AC4A 2P45B 3GHBL 4ZTOH 3WD5H 5HHOA 4AMXA 1NDTA 3MLXL 4XWGH 2R1XA 2QADC 1K3IA 4L0PB 3LKPA 3VSVA 4L4JA 5BVPL 1PW3A 5CEXB 3WELA 1ROWA 3LQAH 5F1IA 1BJ1H 1I8IA 3INUH 4GW4B 3AVEA 1OCOB 1QFOA 4NWTH 3S35L 1CK0L 3GMQA 2YUZA 4GEIA 3V4UH 4E9SA 5F1OB 1FRGH 4YBLB 1NLBH 5E2VH 2JI1A 5AD0B 4K07A 3BT2H 3SKMB 4M7JH 3JWOH 1EXGA 5I1LB 1DL7L 1JN6A 5F9WC 4ORGA 3D4GA 1WBYA 4Q2ZB 4XNYL 3EYQD 4HPYL 5BRQA 3VXME 1OM3L 2Z35B 1A25A 2R1YA 4QJ4B 4OIBA 4KQ3L 4LLYB 1MH5B 2A6DA 1ZWIB 4HH8A 5HDRA 4ZOCA 2AF2A 3LH9A 5A1AA 5BO1H 3I6SA 3PWJB 2DMBA 2FHCA 3GDBA 3TC9A 3OJDB 5LB1A 1NGWA 1CFTA 1OV8A 1QACA 3MXWL 1N26A 2FX7L 1UD5A 3P4NA 5I1JH 5HDWA 3VGAC 2ZWSA 3SSGA 4MA1B 1JZ6A 1Y6NR 2JTDA 3LHPH 2CZNA 4QHMA 1U21A 5CEZL 3TJPA 3C2AL 4UDUA 1ETZA 1EJ8A 3V7AE 1LDPH 1M3JA 2L7JA 3EBGA 4H5SB 2L8AA 2OMUA 5AW3B 3U0TA 4A39A 1RUPL 4RAUA 5C8JB 4NO2B 4E42A 3DYMA 1JK8B 3TOPA 1OPGL 1RL1A 4QOKA 4OCRH 2X4RB 1JZGA 4L4TE 4PHZA 4JPKL 1FC1A 1HFUA 4PYGA 5T33H 2HTLC 2OYMA 3APMA 4Y1AD 3QORB 3VXSB 3I3DA 5DUMH 4GKSA 1OPOA 5HYEA 3O3AB 4PD4J 1T1YA 1L0YA 3EJJX 3QEGL 5IQLA 3PRZA 3QDMB 1R33A 1XCQB 1JRHI 3X13A 1CDBA 4PI2A 1BAFL 5T5FA 3K91A 3JUZA 3HR5B 4RCAA 3D39B 4KNQA 5D7KE 1EH9A 3UYPA 1INDL 3K5SA 2HX9A 3T08A 5DI8A 3OR7B 2W0PA 3QFDB 4FFYH 3W0WE 1AP2B 3L4ZA 5DMJB 4E41D 3QIWD 1JOIA 3QIBC 3MV11 5HHNA 2QHLA 2CJ3A 3MUZ1 4GBXA 1CDYA 4L8CA 1NBZA 3Q6FA 4DSYA 5I15H 1EANA 2VLRB 5KJRH 1SHSA 4W4NA 2AABL 4JVPA 2VAAB 5CJ5A 1BF2A 1TPXB 4DWHA 3ZE2B 2WVVB 3ZN6A 5LGJB 1DBAL 1ZE3H 5TQ0L 1MRFH 1XZ0A 3HPLA 4UBDC 4EDWH 5I8CB 4AENB 4N9OB 2G60H 1KB5B 3IAPA 5DJCB 3S2AA 4UQBA 2QR0A 3VXPB 4YHIA 5L88L 2WTPA 2ZOLB 3TM6A 1TO5A 3T5WA 3MCYA 1A7OL 4PB0L 2VZUA 1DBJH 3V0EA 3D1MC 2XZQH 4XVSL 3LD8C 4XE5B 1H6EA 5K1NA 3Q2CA 3KEDA 2XY1A 1OD9A 3LZLA 1KB9K 3VAEA 4HIEA 4Y16D 1KGJA 1N8ZB 4FS0A 5FC9A 3EDEA 3HUJB 1DQKA 1ZT7B 3UC0H 4PJ9D 3UTQA 4YBQD 3UTSE 3L7FA 3V6ZB 3PWPD 2GBVA 2FHFA 3GIVA 3S4SB 4Z0XA 1OAKL 2F7QA 3T09A 2Z92B 4BH8A 2HLAB 4W9KC 4APXB 1NPJA 3DTXB 5CO1A 2LT9A 2X0WA 2Y07H 4P5KA 4N0RA 4ZSOA 1CIUA 2JELL 1EZSA 3VMOA 3GT6A 4LXFA 1DVTA 3ZUNC 1AQDB 3JUYA 4JKLA 4I18C 2WINA 1NAMB 1LMIA 1KFGA 1MAJA 2NQDA 5EHFA 1TSHA 2HLFC 1AOHA 1NM9A 1V27A 3BQUD 3WN5A 2OR8A 2WMPB 2DWYA 4HWEH 2AAAA 4GG6B 1JHTA 3FZUC 2VZVA 5DZVA 4EAEA 1UKSA 2ZXWB 3KCPA 4HAGA 2VDRL 2A83B 1NGZB 1B90A 4XPHH 3QPQD 4RSYA 3TVMA 2OSYA 2PXYC 1MCWM 4NT6B 1KT2B 4OZFB 5MP6L 1IFRA 4OIAA 4N2OA 4MJIE 1A21A 1N5YL 4GW1A 1BPLB 4TLSA 3FCSA 1JZ3A 2O5YH 1XHHA 2MIZA 4FXGB 4PRPB 1QSEB 1OTSC 2A77H 2IQAB 2NXYD 2OMBA 1JNLL 5DO8A 3SDYH 1J0IA 1MQ8A 2GHZA 3A6CL 1J8HB 5IMLB 1KGUA 4MXQC 1QG3A 2MCPL 3X2QB 5EF1A 5DJXA 2CHDA 2YPKB 3HC0A 3ZVVA 5C0IB 4H1LB 2IAMB 2XA8H 3N43F 2YRZA 3UBGA 1JMXA 3BWAA 1DANT 5EU3B 4EIGB 3BVNB 3N41B 5C09E 3GUFA 1KCVH 3V9EA 4MD0B 1HYSC 1UA7A 5FHBL 1NBYB 4W9IC 4G43A 4HUXB 5E1IA 3VYPA 1PLGH 3ESUF 4NZUL 3NA9L 4OKDA 4UT6H 4PLNC 2B4CC 1PG7H 1DEEB 5AYTA 3RHWK 4FHJA 4LASH 2WQAA 1UWGL 5EUKB 4Z7UE 2GSIB 5C07A 2V8LA 1B0IA 5ISZA 4ELMB 4D8PB 2JLLA 1RZGB 3HLAB 3U7WL 1CD8A 2YAMA 5K93A 2XXCB 5GRZA 3ES6B 3OB0K 4MTMA 4ODVH 2YXVA 1SFHA 3P9LA 1AR1C 5TJWK 3AM8A 4U6VL 5DJ6A 4ZD3H 2PTVA 1T21B 1NCHA 4PR5B 2NZ9D 2V0AA 3RBSA 1HINH 2APTA 2WCSA 2YAOA 2CNYA 3ULSA 3UPRB 2EABA 3ZE1E 1BQLL 4PJFE 2HAZA 2NY1B 3QARA 4HEMA 4LGPB 1TVHB 2IC2A 1ZTXE 3L3IA 5D7JC 4KDWA 2ICEA 3VWJB 4TLKA 2ZKHL 4Q0XH 2F5AL 3KYMA 2Z8SA 2XPGA 2EDEA 1E4KA 2FSDA 2WWNA 5GRVK 3S6CA 3VD7A 1UGKA 3WFCL 4WO0A 3REVB 1ET8A 2ZP8A 3OPUA 3L4VA 1CXEA 4RISL 3Q2NA 4FP8L 3MCG1 3E80A 3C6SA 4Y88A 3ZTJG 5B8CA 5C08B 4D9RD 3VXSD 4NO5A 4GMSL 2A74A 2FJFA 3MQIA 3TBYA 1G7PA 2QSCH 3ILDA 1FLTX 4J39A 4UTAA 2ZF9A 1MW1A 4XPAL 3GSNH 2OMVB 3ZDXF 2C3XA 4PJCE 2EDJA 1EFXA 1MNNA 4YR6B 4OLYL 5I76B 1RK0A 3O3BB 1AXSA 1WS8A 5HDBE 5DZPA 4ZTEA 3S37H 3RGVC 3HG4A 4B0MB 2JF1A 4YSEA 1K4CB 4QRRE 4W81A 4C8XA 1SHXA 3I50H 4RWYL 4YNYA 3K6FA 4QHNA 5CZKA 3B6SB 1AG6A 3D08A 4N1CA 1QEXA 4A7GF 4YVNA 1KEGH 4ZO7A 5ESQA 5MENA 2E8ZA 2F68X 4L05A 2CIKB 5D5MA 3ZE0F 3K80A 3UAFA 2RH0A 2DYPD 4JDEA 4NNXA 1OARL 1T6BX 3BP7B 4PJXA 5C2BH 1BMWA 4HJ1A 4X4KA 4LPYA 4O9HL 5HY9A 3N5AA 3ELAT 4OZ4B 1X5AA 3IGUA 4BFOA 3VXUE 2YRLA 4MD5B 1DCLA 1CWVA 4JFFE 1TZHA 1RIHL 4M7KH 4FQXA 5HGDB 4C4KO 5CD3A 3RWGA 3C09B 3LNIA 4QT5B 4XRCA 4ALAC 2K1MA 2KQNA 2VDLL 2XACC 2DJUA 1MLCB 1NCNA 2GJPA 4I77L 1PBYA 4TUKH 4I0CC 2BW5A 3GXPA 2ZE0A 2XJLA 3X1NA 4Y5XA 2CXGA 1N5AB 1H5BA 2D2OA 5KOVC 2MOGA 3O3DA 1E4WH 1I9EA 4NHUA 3UAJC 1KBPA 4LP4A 8PAZA 2D31B 4MAYC 4L8SC 3EBHA 4MZ3A 1SOQA 5EBWA 2HKHL 3HN5A 3DX1A 2H1PH 2WXFA 1HQ4A 2JQMA 2ZOOA 3IXTA 4M1GL 4RGOL 4BFRA 2WZPA 1DJSA 2CUMA 1Q9LB 3NJMA 5I9QC 1PLAA 2CJUL 4YJZL 5KVGE 1HILB 4X7TB 1FNEB 4JFOB 3MJ8B 4BFFA 3FMGL 3NRQA 4PCSA 1JPGA 4IW4C 3IJYA 5DMIH 2UYLB 4ZNEA 2HX8A 3QB7C 4HCIA 4AL8L 1F4YL 5ALCL 5D6CB 3T6XA 1DJWA 3VXMD 4LBEA 2UWEB 1TZOA 3QNYB 2GC4C 2QPUA 4GSDL 3NCCB 4IRZA 1GW0A 3ISRA 3X14B 1PL3A 3IMVA 2R2CA 3AXIA 4A2FA 1VGEL 4IBLT 1P69B 1RHHB 2KKQA 1G9EA 2CLZB 1QRKA 2J6EH 4XP9L 3BUPA 4KHXL 4HWUA 4DGYH 3K71A 5C0AE 2CKBA 3VUAA 4ODWA 3FSZA 3N42B 1ADQA 2FEDD 1A3ZA 1U8PB 3DXAE 6FABL 1CB4A 4FQHA 4DK6A 3KBPA 3B2MA 1VB9A 2V17L 5L4IA 4FI7A 5DGRA 2P43B 3FK3A 3VFNA 3CFNA 5CP3A 3WJMB 4K5OA 5L8JB 3IJ9A 4QHUA 3VFWB 4H8VA 2ADIB 2O5NA 4PRPD 3P3YA 1ZT4A 3IU3A 1R3KB 3A4FA 4APQC 3CQFA 4G80B 4OD1H 2QFRA 4JFDE 3CBRA 2A9DA 2AJXH 2YQ2A 1LYQA 3QCTL 4ZFZA 4WI7A 5EBMA 4A67A 1AQKH 1AG0A 4B95C 2OLDA 3Q5OA 3B37A 1U8OB 1TETH 4G8GE 2ADGB 2OQJB 4MAUH 5D7KD 1HXMB 4CAGA 2N3JA 2ZZUT 1CDJA 2GTQA 3PV7A 4MNHB 3MNZB 2FEEI 4AIZB 1CFVL 4X4ME 3W0WD 4PBDA 4OBSA 3T3PB 3IK2A 1D2PA 5E5MA 3QHTC 4EZLA 4K9EH 5CEYB 2AJSH 4FJYA 3JWNH 5B3JE 3LNFA 4HIHB 5F2FA 4B9FA 4Y5YB 3BFWA 4JO8A 1UYWL 3U1PA 1REIA 3RX8A 1KLFB 1NMCC 2YGQA 5B1AB 1XGQA 3WFBL 1I8MA 4OGYL 1MJJA 4PJDF 2ADJA 3FBKA 1UFUA 4BZ1A 1T66D 3FQWA 1TJGL 1ND0B 5T1JA 1JXKA 2VL5A 5DQ9B 4FEMA 3ZTCC 3QPXL 4X0NA 1RZQA 3ZR5A 4DPAX 4PS7A 2WWMD 1BFVH 2WIIB 2D9QB 3MUUA 2VQ1B 3WYRA 4HZAA 4P46A 3VD3A 3K2UH 3QHZL 1R0AL 1FFNB 5KVEH 2G2RA 2NY1D 1AE6L 1MFBL 4P2RB 4Y19B 1UEMA 3FU9A 3SGEI 1T4KA 1VERA 4R5XA 3KLQA 4KK9C 2EDMA 2FX8L 3QZWB 4KDTC 2Y06H 1E5ZA 3DETD 1G7HB 2C26A 2D73A 3UTSD 2WWOA 1ACYH 1F56A 1VACB 1WFMA 3L1OL 3HE6D 4O2FA 1KYUA 3MREB 3FQ4A 3K8LA 1QLEH 1NL0H 3FCGA 3R18A 4HUVB 2WVUA 4GRWB 3L16A 4WO4B 3MPCA 4G9DB 3VXQB 3QDGB 4EMZA 1WLHA 4UNVA 4ZXBA 5I66B 4H20H 3DYOA 4DCQA 3RTQC 4Z3TA 1I75A 4YEEA 3OXRA 3M1OA 1PZCA 3DO3A 5BXFA 2FR4B 5JUEL 4I13B 1ED3B 5CGYC 1MKFA 3CHSA 3F84A 5FV1L 5KSBF 1M05A 2V3FA 3DJRA 3K0WA 3P2TA 2IH1A 5E5LA 4Z7QF 1FFPA 1NSNH 3NGBB 4X6CB 4RA3A 2IOOA 5SV3A 4WWKA 1EDYA 4H8PA 3VMNA 3SQBB 1DVFD 4HSQA 2OCJA 1YEFH 4HPOL 5DD0L 3SDAB 1BXUA 1IGIL 3N40F 4XX1E 1ES0A 1GXEA 3ME0A 5EZLB 3SQOH 1VCAA 1SN5A 5JXAL 5E2TH 2ED7A 4P5TD 3S8WA 3WN5C 1NEUA 1P4BL 2XBZA 2IANA 1I8UA 1AR2A 3VJ6A 3PGFH 4JO2L 5EU6B 1JGUL 1ONQA 5C09D 1BM7A 2E74C 3HBGA 1TCMA 3PL6D 4IKIA 1DDTA 4QGYA 4ZW6A 1IBDA 2JCWA 3LZFH 4AJYV 1DLHB 1KN2H 4M3KB 2R0WL 1XH0A 3FU6A 4JN1L 5EIVA 1T04B 1OCCB 2EH8H 2OR9L 1F3JA 2Q2EB 3BH9A 3RWJB 5C9JB 5IW1A 4NKIH 4XC1L 4N8VG 3TO4D 4JRXD 1NAKH 3DVGB 3QULB 1NDMB 5ERWB 5F3BA 1YEGH 5SWSB 2LU4A 2W1NA 1JVOA 4QRPE 2ATAA 3EH3B 4YSPA 3RDTA 3M1BB 4HH9A 2XWCA 3MU3A 3MRIB 5T1LB 4DHLA 2O26U 3PHSA 4X5LA 5IB2A 1LE9A 4NQCE 2XWBB 1DQMH 3UH8A 1PAZA 4DKFL 1F1GA 3EDKA 4TVPE 4LL9A 1NGXB 2AJZA 1G5GA 3MNVB 2W60A 3MLVH 3T6ZA 1AD0B 4ZX6A 1L9RA 4R2GC 2G30A 2X1OA 4PRIE 2HB0A 5DJ8A 3EXJA 4JFUA 4Q9RH 2P5EA 1RZIA 4Q8BA 5T1KA 5IQOA 4UU9B 4RMVA 4XP4H 5FX3A 2F54B 5D1QA 5C3IA 3B2VL 4NUMA 2RACA 2I5YL 3L1FA 2JXMB 1PZAA 3BP4B 3G04A 5J11B 4FFZA 5EV7A 3LY6A 3AQDA 2W9LA 1JDCA 5FFOA 4YE4H 5B3NA 1HDMA 3AQZA 2JKTM 2Z91A 3EO9H 4XPTH 3SJVE 2OMZA 3MOBL 2MNUA 4K9JA 5KVDE 2VXUH 4PGJA 3BQVA 4L1LA 5E6ZA 4A7UA 4ANVA 4EIUA 5DWPA 1P2CA 2FBJL 4AJ0A 3LN9A 4UANA 2TRHA 1I7UA 1QFWI 3L5IA 1K72A 2FLRT 4QF1B 4XTRD 3UROR 4Z23A 1A02N 3DLQR 3BVVA 3AM8C 3D07A 5EZJB 1G6RH 2W0FB 1V5JA 1E9OB 2LLNA 3PF2A 2UY7A 3QAZB 4KKLC 2FH8A 1KLUA 1TR7A 4M43L 3OR6A 1G7QA 2PPEA 2LE9A 2DWXA 1RIVL 4OD3H 4XN1A 5LBSH 4KJQD 5DQDL 5I73B 2J5LB 4HUCA 4YSQA 4YDLB 1YPZF 5EWIH 3I6KB 3HI1A 2WOYA 1KPVA 2EIMB 5FKPA 3V7MA 4DVBA 2ICEC 2X4SA 1RUML 3UX9B 2WQSA 1A5FL 4RMTA 3N0AA 4RBPK 5GRYA 4YUEL 2X2IA 2H2PD 3SCMC 1XXDC 2VQ4A 3POCA 4N2DA 4U6XA 3RP1A 5SWQB 5CR8A 4PJ7A 4AWJC 1C1EL 1OF2B 3Q5YA 1EEYA 1MCLA 5B8CC 5KYWA 2ZUUA 5B4MD 1GYAA 5JHDA 1J8SA 4CN1A 4MA3B 3VXUD 2FWOB 5HP5A 3MR9B 4XP6H 5MEOA 3X3FL 5J6HA 2FWLB 4C4BA 3ULVF 4JFFD 5E6SB 3PGDA 1KUMA 3CFUA 1VFAA 1V8HA 5K39A 4KGLA 4Z3FA 3VA2C 5BJTB 5BRPA 2F74B 3CHXA 4GP5B 1N6VA 1NANH 2HTKC 3UPAA 1E6OL 4OI9A 4Z95H 1S3KL 4IGBA 4KRPB 1AGDB 4AW4A 1N18A 2OZNA 3M7OA 3KLHC 5DCCA 5C0RH 5F8QC 4AYFA 3CDZB 4P2RD 3OAZK 3FO9B 4HIPA 1M57B 5DWUH 2JCCF 3TT3L 1MIMH 1JGLL 1JPTL 4HISA 3OPZH 1J9SA 2JCCE 2XN9B 3QDHA 4OCYH 3CFQA 5GS0D 5HYSG 4MDJA 4M62H 5AOLA 3QNXA 2J25A 3T2NL 2X6UA 3LRMA 1LK3L 5JOFA 1A47A 2E8YA 2WQWA 3DX7A 5D2LF 5L2JB 3VFVA 1XH3A 3MXVL 3KBFA 3ZHFA 4Z3HA 5AAWA 4OCSH 4HBQA 1F58L 2FGWL 3W11C 1BWMA 3A6OA 2R1WA 5ICYB 3LH8A 4Y5XC 2OBGA 4GXVL 1BZ7A 4Q6YA 4R83A 3SN6N 2V3EA 2W94A 3MRJB 1OAYL 5EO0A 1SBBA 2WTOA 4TNVK 5IESH 4F24A 5CBAA 2HH0H 4OAWA 5C0AD 1KC5L 3E6HB 2OMYB 1PIGA 4FLOA 4PMEA 5HVWA 5I1CH 4G7VH 4WJKB 3KLAB 2CLVA 2QLYA 5K33A 2D03L 3O3EB 5GGSY 2HRPH 3DVNA 1YN7A 1NJ9A 3IYLW 3MZGB 2HT3D 4WTQA 3TF7C 2D7NA 5FEBA 9CGTA 2FH6A 4WHTB 4WV1B 1JI1A 3DV4B 3ABLB 1EV2E 3FUDA 3OJVC 5AW6B 4Z7WF 5DZOA 1FNLA 4OGAC 3VCLA 2ZUWA 5IHUH 5IT2H 3LMJL 2CH8A 4RMUA 2IDFA 4F3FB 4NQEE 5DJZA 3FUJA 4WW2F 2Z7YA 3UOAB 1YQ2A 4MXVE 2DQDL 4GI9A 2EAEA 5CLWA 5L2KB 2HLEB 2N0MA 3CC5B 3T65A 3ORJA 2IH9A 4M8QB 3DUUB 2EE6A 5EU6D 3FFDB 4G8GD 1T0MB 4I2XA 4J3WA 2QEJA 1M7XA 4ZQKB 5ABZA 3AADB 1IGML 4JR9L 3S97C 2V7NB 2VLJA 3DV6B 3WXWL 1P7QB 2BOBA 4G71B 4EDXB 5FB8B 3QBTB 3T71A 4DZBB 3TNMA 3ARBD 4G6ML 1GGTA 4MJHA 3F7PC 5DFTA 2DLFH 3F85A 4B53A 3PG2A 4XXDA 2DDQL 1SJHB 4OFYD 1Z9LA 2F58H 5DRXA 5T1LD 1T0NB 3DSNA 4N8VA 4MJJA 5D7IE 4EI5B 2MRYA 3KPSB 1UD6A 1T6WA 5HJGA 2YWZA 1KGCE 2B1HH 4F58L 3O6KH 2H6PB 3QISA 4HS3A 5DMGC 5TE4L 3ZMEA 1YY9C 2EUVA 4P07A 3K6SB 5FS5A 2IBZX 3ARDA 3HZMA 2D0HA 3WL9A 5A2BA 3QEUA 2UZIL 4KK8C 2XDHA 4LIQL 3MRNA 3MBXH 2I9TB 1ECYA 1FFOA 3QCUL 3WFHA 1UB5A 2XC8A 4HIIB 4Q56A 1XBDA 2CBOA 2R7EB 3A4EA 3MLZH 2GIMA 2FATH 2AVGA 1J87A 4F7MA 1M53A 1HL9A 3LEYL 3G5YA 5HGBB 5K9QI 4RFOH 3DK2A 2V37A 2PO6D 1MWAH 4KK6C 4NRYB 5B39A 3QQDA 4KUZL 4LMQE 4KVNL 1OB1B 3BZFB 1E6JH 5C0CB 1PFCA 1CF1A 2AJYH 4JFQB 4YZFE 3RUGE 1I85A 2P5PA 2OXHA 5FCSH 5I74C 1JFQH 1GZQA 4QDGA 2WK2A 4R97B 3B9KC 3IDIA 4NUGH 5IHLB 2A6JB 3CDCA 2NZIA 3NCXA 1N4XH 4CC0A 2VRAA 3MLUH 5GIRB 1E67A 2P8PB 3QR1A 2PWGA 4P46C 3WDIA 1LNUB 1MJ8H 4FQLH 5I6KA 4MMZB 3CAFA 4HEPG 3VVVA 2W5PA 4BBWA 1GS8A 2ZX9A 4N2HA 2VMCA 4UUJA 5LCVL 1GGBL 3CFKA 1TCRB 1GSMA 5EU7E 3G6AB 3RIAK 3KPRB 2E9BA 1X3DA 2I27N 1WAAA 5IB3A 4F2FA 3VVWA 3JTSB 1GC1H 2X4QA 3NIGF 5IFJB 4CVZA 4BKSC 4NO0D 1KB9J 5T3XL 3P11L 32C2A 2F53A 5E6IA 5FK9B 1S46A 1XIWB 4CNIA 3OKNA 4FFYA 2E7DA 1RY7B 1FL3A 2YHGA 5I71C 2J1XA 3DPDA 3PIQB 5DC2A 5IVZA 1CLZL 2XX1A 1RU9L 3FAXA 4DKAA 4JHAH 1W0WA 4TMPA 1IJNA 4J4PC 4CMHC 4NQQA 4H26A 3RI5K 1CBVL 3PAZA 3FN3A 3OX8A 3HHMA 3TPUB 5JMRA 3FO2B 1LP9A 3IKCA 4FHKA 3E2HC 2G75B 3VE0B 4QTHB 3VXOB 4R26L 2B59A 3L5WA 3HHSA 4FYSA 4PJEA 1J10A 2AXGB 1TQSA 3RZCA 3CVIL 2CBPA 4JFHE 2EIBA 5TDOA 4MD4B 5JQ6L 1YYML 4JM2A 3FUMA 1CFQB 1OTUC 4BSVA 3HZKA 1A4JA 4MKTA 3CJJA 2PCFA 4I3SL 2FX9L 1RJZA 3N06B 3VB8A 3N1FC 4URKA 4ZMNA 5H37H 2QGEA 1KACB 3EGDB 4QRPD 5I1EL 3S88H 2H5UA 2H3XC 3QUXC 4J7RA 4X5XB 2C9SA 3Q06A 5HHXL 5ETUA 2K4WA 1RVFH 1MHHA 4NQCD 4NCC2 4WI2A 4X5WA 1MFDL 4PJ8C 1XSKA 1HIML 4TVPD 1T5XA 4UM9B 5IBLD 3AGVA 3ESMA 1RZPA 2ZIDA 3NQKA 4QRSB 2AQ3A 5D72L 1O5PA 2Z8WC 3MBEC 1PEWA 3O0LA 1OT1A 1EHLH 4W6YB 2Y7OA 1AY1L 4N2LA 1ICTA 3EW3B 5DRWB 4MJ2A 2EDXA 5EU5B 3ZT5A 1LDSA 1H9VA 3ZKMC 2N7BA 1TTCA 3TF4A 1RZ8A 3N0PB 2GC7C 3WLBB 3BDYH 1VJSA 2CU9A 2GK0B 3K2MC 2AW2A 1XR9A 1CT8A 1JHLH 1JPFA 3ZL4L 3RDTC 2Z7UA 1M9SA 1R6VA 3DMMB 2A0LD 5I6PA 3Q1SL 4PJIA 5EIIG 3ZHLA 3SJVD 4LLMB 5H2BB 3MFGB 2R4RL 1UFGA 1ZT1A 4NNYA 5CBEB 2NW3A 4BQ8A 2G9HB 2QSVA 3G5XB 4GAAA 3CSBA 3B8SA 3J8F7 4TOYL 4AYDC 3S96A 3GMMA 4OZHE 2O5XL 5PAZA 1ZLUK 3C5ZA 4DOHB 2Q7YB 1D5ZA 1RJYA 4NZTL 1DBBH 1HTYA 1ZHKA 1T1ZB 1JZEA 4EZMA 5F9JA 1URIA 1OP9A 3KWXA 5ESAA 4JKPH 4IRSD 3CXDL 4F15B 3DDFA 3QXAB 2VIRB 4DW2L 4YHPA 5KS9A 1BFOA 2WO4A 5CUSL 4ANKA 1A7PL 1A7RL 4N2NA 1H3GA 2BDNL 3UJTH 4LLVA 3WTTA 1HS6A 1KENH 3WO4B 3D3VE 3FQ1A 2OCFD 2HT2D 5E00A 2MCMA 2OYKA 3BJ91 4XPBH 3AB0B 3EO0A 4NIKB 5GGUB 4Z7VA 3JWNG 1JV5B 2ED8A 5J6GB 1Z3GL 5FLUA 3RVWC 2IADB 2VM3A 1ZTMA 4JFEA 1TZGH 4G8FB 4UM8B 4UT6A 1CD1B 3CPLA 4J2QA 1X7SA 4JAMB 4OT1H 4EIBA 1BX2A 3S3CB 3LH2L 1FN4B 3DI2B 2EICA 4MA7L 2DM3A 3I02B 1GIGH 4ANXA 5EOCH 3ZGHA 4AXWB 3EOYG 1DUZA 3P0VH 3OXSA 3WAKA 4OF5A 4EN3B 3UZVB 2YPLB 2J8UB 4U3SA 4AT6A 5IQNA 4K7PL 1GVIA 1M7UA 2XWJB 2VKWA 1DQDH 3K7UA 1OLLA 5F7KC 2LVCA 2PP9A 3AJ7A 4QRUA 2MQGA 4MQ7B 5I8OL 4Z7OB 2OZ4L 1OW0A 2A4ZA 1NFIB 4JGUA 4Y4FC 3QWNA 5DHXB 3GTTA 3QDJE 2O4EA 3BKJL 4NO3B 3CG8A 1FBIL 3T0EC 2O5ZL 3SKNB 4LAJH 5J89A 3ZDWA 3PHQB 1VZHA 3CUPA 4LVEA 1HWHB 2IMMA 2YO3A 2ADYA 3ZSSA 1HHGA 1GRWA 3REWB 4KX7A 3WUZA 1RCYA 4ZTOL 1HAUA 1H15A 2D3JA 3RPIB 3Q3GB 4IGBC 3I9PA 1ASOA 1OSZB 5D1ZC 1KYFA 3OZ9H 4F91B 1K5WA 3P4OB 4ABVA 2GJ6A 2HVKA 1U41A 2OCCB 3GLEA 4W9GC 3LQAL 1KCRH 1EAPA 3MROB 5AOZA 4UAOB 3INUL 1K85A 1QRNE 4RFNB 3QQXA 4NWTL 1K2DA 1KTDA 1XWVA 4F7PB 2EIJB 3PHOA 1AIZA 2WO2B 4RDBA 3PV6B 2QDVA 1FRGL 3L95B 1NLBL 5CWSB 5E2VL 3BT2L 4M7JL 5AAMA 3ML9A 2UXTA 3PPEA 3F65A 3PABA 1U8CA 4GT7A 4DKDC 5IMKB 4KZEH 2CCVA 3QRGH 1DO5A 2BNQE 4W9FC 3BMVA 4L8DB 4PRDB 4Y4KB 2GI0A 3MRCB 4NQED 3W9DA 2P7TA 3HVDA 5F0LB 5BO1L 4Z8FH 1SJEB 2X4PA 1GZPB 4XO3A 4FC3E 1M6OA 2EXYD 1RZFL 4PJBA 2BM3A 5C97A 5F6HI 5JW4M 4G42B 3PAUA 4K7FB 2GVYA 2CPCA 1BLIA 4MASA 3IFPB 5E0QA 5ILTL 4QKXB 4OJYA 2HFFB 4V33A 4WK2B 1U0QA 2EE0A 2VMEA 2HZHA 1I3UA 5IROA 1X6NA 1XR8A 2BZDA 1OCZB 1YCSA 4MVBC 1N0LB 4QXVA 3PGCA 1A1OA 4OCRL 3WIFA 5GRJH 1DBKH 1ZLSH 5T33L 2AXHA 4LLDB 3II1A 1C08B 5A7BA 2ARJA 2PCYA 5DUML 2O6FA 4KV5E 5F7HA 3BYTA 5DS8B 3TJHD 1ZTXH 4IIQB 4GKNB 3QDME 1HSAA 5F7BA 2VGLM 3DVFA 2HPTA 5EEWA 2COQA 2ZPKH 1N9PA 3DROA 4U05A 4QYAA 2QL1A 2BY3A 1KGCD 3IDMB 1MFEH 4FLHA 4TRPH 2OJ1A 3H9YA 3O4LA 2OL3B 1BQUA 1YEIH 2G4EA 3R7QA 1AGEB 5E2UL 3RNQA 3W5NA 1U92A 5F8RC 4P2QB 1HZHH 1S8DB 4ANWA 3KVPA 1XEUA 3PWVA 5L4MA 4ZS7H 1MY7A 3BW9B 4POUB 2HX7A 1N59A 5DEGA 5IMOA 1VGKB 3JYBA 5HPMA 4OV6F 4AGMA 1HI6A 2J1ZA 4XNZC 2X7LA 3A3YB 3SDCA 1CICC 2X4OA 3FCUB 3CN2A 4JDZB 5KJRL 1Z5LB 1Z9MA 2H2SD 3ZE2F 4NGHH 2EIZA 5DEJA 3VXNB 1BZEA 4NDMB 3JXAA 4QHLB 2Y2WA 5EBLB 5SX4I 1AD9B 5DHYB 1SFDA 1MRFL 3K8MA 1JK9A 4EDWL 1Q1JH 2B9BA 4GSUA 3RB5A 4IJ3B 3W38A 4LO9A 4JJ5A 3OG6B 2Q86A 4K7PY 1NC2A 4PVMA 3EG9B 1R47A 1PFOA 1TZAA 2BERA 1XXFC 3ARDC 2GK2A 3GSQB 5KBMA 4ACTA 3T8XB 3CVBA 1NGYB 2XTJC 2XZQL 3BXNB 4LSVH 4BH7B 3P1VA 1OHZA 4TLTA 3WY2A 4JO4H 4MDIA 4EQ2A 3X1BA 3UC0L 1YVLA 1AGFA 2YBRB 1IIKA 5F71A 1CFSB 1I8LA 3O6FA 2CUIA 4OJAA 1MEXH 1UB6B 3MGOB 4NQDA 3HE7A 4ZTPL 5JNYB 1G0DA 5M94B 1A4CA 3QQ9D 3QXUA 4LLWB 2WC7A 1TNNA 2Y07L 2AK4B 2G2NA 4DEPC 3SO3B 1YEDA 3PLYA 5I5RA 3AY2A 4CADB 3IRPX 3O2VH 4DP5X 3SKUD 1I9JH 4G5AA 3RWFA 2CO4A 2NQCA 2ZKWA 3KXFB 4GG6F 5IUCA 2R8SL 4MHHI 1L9NA 4YL9A 4JE0A 3PHAA 4GG6E 1GA2A 3KM1A 2YUXA 5GS0H 4MNGE 5KZCB 2EDLA 5KVGH 4NENA 4OQTL 3SBWA 1JUFB 4F37F 4UNTA 3W1ZA 1MRCH 2BZCA 1R34A 4NZ8A 4U3CA 1R3JA 2ZQKA 3OKEA 3WS3B 5J1AB 1UKTA 1U2YA 3LCYA 3D6GA 2LTQB 4S1DC 2B77A 4H13C 4OZIB 2VN3A 2O5YL 1NFDA 2PETA 2W0LA 2I9LB 4TULH 5E1AA 5FUOH 1FZMA 3EDDA 5E6IC 2NR6A 2WLZA 2A77L 3SDYL 1T5KA 3WKQA 2R69L 2C1PA 2QPEB 5ANHA 3VH8A 1WG3A 2OW6A 4JVUA 2BS71 3QG7H 2C9AA 3N6YA 1TT6A 1HESA 4G1EB 4U6YA 2XA8L 4LQ1A 3E6FA 3FB5A 3DGGA 5BW7C 1F90H 4HG4K 1QSFA 3SYPA 4FQQA 1ECZA 4GAJL 3VA6A 2V3DA 3VFMB 5TDNA 3HKFA 2VLKB 1M4KA 5I0WA 3P3SA 3BKCH 3R4DA 1PLGL 1FORH 2C9VA 3GBLA 1RZ7L 4FFWC 1EAQA 3UTZB 4P4RB 1PG7L 5HYJE 4EI0A 4DO5A 5ID1B 1GTNA 4L2LA 4WJG3 3CWGA 4LASL 4P2YA 3S5LA 1JWSA 1S3RA 2VDPH 3FOLB 4MX7A 3T0BA 4ELMF 4U1JB 2KH2B 5B1JA 2YWYA 3WCYA 1A2YA 4GI6A 3IMBA 4O02B 4YWGH 4P23A 3VWKB 3MRFB 2HVBA 4FTVE 4AQ8C 2IGTA 3OLIA 2AS5M 4XOAA 3TN0B 4AMWA 4ENEC 4MQTB 3UTPE 1AKPA 4ODVL 4PJAE 5LLIC 2VTFA 2WQ8A 1TVBA 1FJ1A 5DXWA 2BVUA 4P48A 4ZD3L 3CZSA 3WUWG 3PNWB 5A2CA 1P4UA 4Y4KD 1OP5H 4EI6B 1ZAGA 1HINL 4NKQB 4OLEA 3TV8A 3IDNA 3R7RA 3ZQXA 5BV7C 4N2EA 1NMAH 1P4LA 4GRMB 2J2ZA 4V2BA 4XVTL 1Q0XH 2QADD 3MLTA 1FZJA 4ES9A 1S7WB 4BDVA 2ZUQC 2CUAA 2OMWB 2ZWYA 2XZCH 3DHMA 1NLDH 4YSAA 3D3VD 3GLDA 3JV4A 5AVSB 2HXAA 1LVEA 4MBOA 1ZLEA 4XCEB 5L9DH 3QEQB 5FHAH 4AYBA 3GZOA 4LLUB 1T3FA 3T9WA 4ONHA 4FQCH 2BSEA 4HZLA 4EBQH 4YLCA 4RNRA 3U4EB 3GI9H 3RPKA 1UWEH 4OVUA 1C12B 3VFTB 5AW4B 4BIKA 4JM4H 5D1XA 1B3IA 4H2AA 2QTVA 3K5RA 2Y6SD 2ZUXA 3C5ZC 2HA1A 4PJGA 1I9RH 1RPQA 2QSCL 1A7BA 4IEFA 3F7LA 5BOZG 1NICA 2WYIA 3APDA 3GSNL 2BWQA 1AACA 3N9GH 1HX0A 3WE6A 3MJ6A 4N9GB 4BZYA 5JPNA 1ZEAL 3DIFB 3S37L 1UENA 1RJLB 1IGCL 5F7FA 1ETB1 3SPHA 3V6BR 1DJYA 3PDGA 5JO5A 1NFKA 3HC2A 2A9MH 3AS2A 2QPSA 3TCXA 1M7DA 1N0XH 5MEPA 4CGTA 3GKZA 2F1EA 4KO9A 3CCHA 4GIPD 3ZKNC 1DVQA 43C9B 4YHZL 1HHJB 2GUOA 5KSVA 1RFDH 2B39A 4U1KA 1YSOA 3G9VA 3H1ZA 1IV8A 3QDJD 3BAEL 4R7LA 2HTLD 2R15A 3W2DL 4AX3A 2PCXA 1M1SA 3PWUA 4M7KL 3EYFA 1DJGA 4MCYB 1BYPA 2VDQB 3OAUH 5BQ7A 4R84A 1A6TA 3US9A 5CCHE 2XHNA 2PWFA 3GS4A 2NQ3A 4OB5H 4I4WA 3CZKA 3FO0H 5F6HJ 2WVSA 4AW7A 2CDFB 3H55A 4TNFA 3PREA 2LAGB 4BSJA 1NTDA 1EVUA 3KLDA 1G6RA 1I1YB 1IQDA 1XEDA 2H1PL 2ENYA 4HU2A 1IQWH 2J3SA 4HJEA 3MFFB 1OW0C 5D4QA 3ECBB 2ZWNA 4O2EB 5I1DA 1IAKB 1FNSH 1QRND 4G2AA 3RWHA 5HHQB 3MLRH 2RALA 3MRMB 1Q9WA 3BPCB 4I89A 5TK4A 4R7DA 3WEXB 5JZ7D 5C0JB 4NZJA 1U8MB 3ULVL 1J05B 1WCBA 3DOSB 2AI0L 5DMIL 2UWEF 3AABA 4G6JH 4KY1H 4N26A 4RGNB 1VKXB 5IUSA 4QYOB 3GBMH 4NOBA 3WS6C 3FT4B 5BRZB 2BNQD 3NCJL 2WXIA 3LEXB 1MFVA 1WBXB 4QTIH 3QJTB 4KI1A 4V1DA 4UBDD 4HX1A 2ERJB 3AACA 4FKEA 2OP4H 3K0YA 5SWZE 3UBXG 2P1YA 4ZPVB 2WOBA 1U8KB 1VFBB 4MJ6B 4NQUA 5FECB 3EH1A 1VCBC 4WLCA 4G1MA 3ZJAA 5GPRA 1XT5A 1A4KA 1FCGA 3DJSA 2Q20A 3WHXA 2B3RA 4JFPB 2WWKT 4PJ9A 1JGDA 2BOCB 1E2WA 4HWZA 3WHE1 3PWPA 4TVPH 5CNHA 3QZMA 1CURA 2G3MA 2WSKA 3MA9H 2VC2L 5E8NB 2YA0A 5H37G 5FW8A 3D30A 1MI5B 1NCWL 4ZW8A 1O5DT 4AIXA 4NX0A 2DQJH 1UT2A 1O75A 2WQUA 3LTVA 4XMKL 1AQ8A 4B9PA 1S9XB 3DRQB 3FTUA 3H7BB 4YDVA 4ZNCD 2UZXB 1Y7VA 1KLGA 1XCXA 3H42L 2YFNA 5I6NA 1ML0A 2B5IC 2WLNA 3FQYA 4N86A 1HEZA 4CVUA 1W72L 4GI8A 1TYJA 4XN8A 5JDSB 2VABA 2R1XB 2I26N 2VDOH 1B9ZA 2HLFD 3V7AG 3ZKXB 5IW6A 3LKPB 5KVDH 2KLRA 4MAUL 1CTNA 3UGXA 1WBZA 2FLMA 5F1IB 4KXDA 2EEXA 3T3PF 2PXYD 3GMQB 2A3TA 1P7BA 5IROC 1BVKA 1X7QB 1KWGA 4K9EL 2AJSL 1IGJA 1AS8A 5ICZA 3QXTA 1FL6B 2IH3A 5TE7H 3IN2A 4HV8B 1WBYB 3UABA 2WPGA 1OTSD 4WI5A 4JY6A 4U4BA 4NPYA 4AGLA 3GSUA 2AV1A 3LIUA 3E9UA 4MXQD 1OQOA 5L8KB 5AG9A 1F4XH 3LB6C 5FM4A 4RDQG 1IBBA 4JRWA 2ZWZA 3JV6A 2BSTA 4YK4B 1XF2A 1NGWB 1CFTB 1RI8A 2Q8BH 3RVVD 5DR5H 1BFVL 4PWFA 5FW6A 3OAYH 5I8EA 5KVMC 1K8IA 3H9SE 1ZGLB 1HYSD 4NFBA 4LEXH 5E23A 5KVEL 4QHMB 2V33A 3G6JE 4UDUB 3T2LA 1ETZB 2VW7A 4LSRL 4ZMWA 3SQRA 2C3GA 5A16A 2WLHA 3B5GA 1ORQA 3ML8A 4RAUB 1KXTA 5TGBA 3SDCC 1ACYL 5K1VA 2EO7A 4QOKB 2OPCA 2DMHA 3DX8A 4HJSA 4BHUA 3UPCA 2BFGA 2JWYA 3AG1B 1JVLA 2WNWA 4GRWF 4U1MB 2XWRA 1NL0L 3VI4F 3U30C 3UCRA 4XNQB 4LCWD 3X13B 1ZHLA 3VI4E 3RTLA 2P8MA 1ORSB 3OSKA 5I30H 4CBPA 2YGOA 1AR1D 4UDTA 4PRHE 4X8XA 5CR1A 4KFMA 1UCBL 4WW1A 1U8HA 4H20L 3GMNB 1JD7A 2WBXA 2XT1B 3ZOAA 4TUOA 3VGFA 3ARUA 3FU0A 3BSZH 3CVHA 5DI8B 3WKPA 1YJDH 4CMMA 2PLTA 2MKWA 5DQJA 1G7IB 4GS7B 4AYGA 4MQXC 4NN5B 4CL7A 1CD9B 3EYSH 4OF7A 3WXVH 1I8LC 4NYLA 3QDAA 4X6CF 4GBXB 5D7JD 4E5XA 4CSPA 3IDYC 2NY6C 3Q6FB 2CHZA 3ATDA 1YMMB 3Q01A 5BPPA 5ISZE 2K0RA 4IHBA 3VSTA 2NY2D 1YEFL 1A8ZA 3TIEB 2XIDA 1BEYH 1Z1WA 1EO8H 2XZAH 3HPLB 4WU5B 5G4NA 2R2BA 1H3UA 3MZTA 3SQOL 1LILA 1JXDA 1X5IA 4U1SB 5DZJA 5E2TL 2OFQA 2VN5A 2ALWA 3GZQA 1UUNA 2KPWA 4YDKH 3VI3A 4DP9X 3F7QA 3STZA 1JPSH 4KJYB 2YEVB 1OXYA 1I3RA 3SBWC 4JNXA 4Z6AT 2OI9C 2VSCA 1RLWA 3LZFL 3L3HA 4WZ9A 1KN2L 4DKEH 5GGRA 4ZS6C 2EH8L 3T3MB 1P5UA 1YEHH 3RGVD 5J0BA 3W9EB 2AJVH 4HAKA 4NKIL 1EX0A 3BAJA 4OSUH 5IB1A 4Z0XB 4E9QA 2QQKL 3BVUA 2Q7NA 4BH8B 2Q2LA 4Q9QH 1YEGL 4IMLB 1JYWA 2VISA 1FIGH 3C6LA 4FKHA 2AQRA 1DQQA 8FABA 2DYPA 1QQDA 3IDGA 4ZSOB 1RPKA 4JFYA 3DJZA 2K8MA 4YDIH 4AYEC 4FTVD 4FNTA 4AQAB 1AHKA 2WINB 1LK2A 3UTPD 4BJLA 4QJ5B 1Z9OA 2J21A 1EDHA 3V8CA 3SE3A 4HK0B 1SDYA 1JHTB 1UXSA 4K2UL 1GCYA 2ZCHH 1XGUA 4AL8C 4JKWA 3KCPB 1NKOA 4F9PA 2VR7A 1MCPH 5I5MA 1YC7A 1YECL 3C5SB 1B4TA 2BC4A 1C5BH 4W9CC 4LKXA 4XI5C 3TVMB 4X80H 5F93C 1T5WA 4UB0H 4PGBA 4GS7C 2H1XA 3DA0A 3QJQB 4KUCF 5F3HA 3UAJD 2EIDA 1PKOA 1CGYA 4RZCA 3PUCA 1SEBB 1CLYH 1JBJA 5B1JC 1INEH 1HYRC 3EO9L 3L9RA 1WSST 4XPTL 1MW3A 4P9HH 5D5ME 5JW5B 4L5FE 4CW1A 2K6YA 2ORBH 1CL7H 1UZ8A 1A4AA 3MLPA 4I3RL 3GMOA 5DJXB 1GHFL 2W92A 2AXFA 3QR0A 4FQ1H 1X5FA 2YA1A 4H8QA 1C5DA 3FTVA 3KR3L 4HWBH 1BVZA 1GZHA 3BWAB 2EC8A 2EYTA 2DV6A 4QMEA 3QGVA 1JZHA 2DWDB 5D7SH 2YAEA 3NFSH 3PWLB 2Q0ZX 1FZOA 3M8OH 5LBSL 4LSQH 5EF3A 5HHOD 3F01A 1ZSHA 1UA3A 2J20A 5EWIL 4PLJC 5BZZA 1L3WA 1IKNA 1KJMA 4KZCA 3WV0A 4AZ8B 2X0UA 4RETB 3V9CA 4G7RB 2RHEA 3NAAH 4G8EA 1H0DA 4O5LH 4HALA 2FT7A 5C07B 3EH4B 1IM3A 5GGVL 1MAMH 1IGYA 2A9CA 3GNMH 4XAWL 3TJEH 5FIEA 2BVQA 1S7RB 3CK0H 1QMUA 4D9QD 5D1XC 4L4TA 3NIDB 1MUJB 1F8TL 3ATBA 5AKRA 4W9EC 1JYNA 4PJ5A 5DJ6B 5CN1A 4BWTA 3IDUA 4HUWA 1JNHA 5D96C 1AYRA 1UACH 1HNYA 4ILDA 4IOIA 4IOFC 1AO7E 3ULSB 1A66A 2VSDA 3F58L 3NJLA 1MVUB 3DC0A 4IKLA 4OV5A 2WLIB 2Z65C 2VUYA 3O8XC 5AWNH 4LFHD 1YZZA 3GYRA 1ET5A 1T20B 1BXAA 5LGHH 4JZOA 1GOHA 5GS1B 3L3IB 4J3SA 3WY4A 2J8OA 1MRDH 3VACA 5IHZB 1ZXKA 3CLFH 3KHQA 4QY8A 5IREA 1BG1A 3CH8A 4PJ6A 3KYMB 5F89A 3W0WA 1ZS8A 5C0RL 1OZUA 2XG4A 2YD3A 3T2PA 4N3TA 1DDHA 1QFPA 3RHWF 5DWUL 3GM0A 5F7LB 1MIML 3OPZL 5F1NA 1S9VB 1AQMA 1S7UA 1S9WA 1Z66A 2WVTA 3JTTA 4QOKD 2UVEA 3CFEA 2Z64C 4M62L 3TZVA 4DT2A 2DWSA 1QUNA 4NO5B 2A74B 2FJFB 3C87A 3TBYB 1BQHG 1G7PB 1VFMA 1QFHA 3AZUA 2NY0C 3NJNA 3KPOA 5GGSB 4JFWA 4HBCL 3UTTE 4HHAA 3GC3A 4XT1C 3NACL 1MCKA 5JIHA 5JHAA 3WEOA 1MQKL 1RK0B 5G5DA 1AXSB 5AALA 5SWZD 4MBRA 3IRCA 3QQ3A 1ZSDA 4XPFH 3LXAA 4YNYB 1W9XA 4XNDA 3L5XL 3LKNA 4G7VL 1GR7A 4RMWA 4ZAKA 5ESQB 4CUCA 5MENB 3FFCB 2E4TA 3L2NA 2PN5A 5LGKA 3TBSB 5FGCB 1FLRH 4KK9D 4PTUB 2WLLA 2AV7B 2BP5M 2NUTB 4GBXD 4NNXB 4PJXB 3IVKB 3P73A 1F00I 2Q8AH 4Z7IA 5HY9B 4YDZA 1KY7A 4LLQA 5GRUH 1PDKA 1R17A 5I0YA 3H3KA 2AC0A 3SE9L 1F13A 1BMZA 4JRFA 5IJVA 4ZMAT 1TZHB 4JQIH 4FQXB 12E8L 2QV4A 3ARGA 2QV2A 5CJXA 4Y4HC 1GOFA 4X9HA 1KIQB 4XXWC 2IGFH 5ABDE 3MCKA 3SY6A 2DH3A 3T8VA 4M93B 1H5BB 1U95A 3WAJA 3O3DB 5T5NG 4IBYA 3HLKA 4JRLA 3KH3A 3PQYB 1HQ4B 3IXTB 3X3GH 1TKWB 5CGYD 1FAIH 3UO8B 3BUIA 3DUSA 5LNGA 3TBWA 4MJIA 4AE1A 1FL5A 2CK0L 1H3VA 2Z93B 3HNVH 3L4UA 4HCGA 1EUTA 3MKKA 4PCYA 5GGTH 4CN4A 4FYTA 2ROXA 4FQ2H 3EOAA 2NYZA 3U4AA 1QP1A 2FVNA 1LMKA 4JPIB 4KROC 1NMBH 4LCUA 3KPSE 3JBG7 4FCAA 1F4HA 4P5MB 3U4BH 4LCIL 5BOPA 1U8LB 5DZLA 4XNAA 5LVEA 2E6PA 5JHLL 4CU8A 1MFNA 5CJOL 2JKSA 4Y5VA 4BA8A 4J28A 3QRFM 3BX7C 4YPJA 3NA4A 4M8VA 5IVXB 2V2TB 1UH3A 2L3BA 3QYCA 3CGTA 3QZBA 5AW8B 2HWZH 2CNZA