2DMBA

Solution structure of the 15th filamin domain from human filamin-b
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
124
structure length
124
Chain Sequence
b'GSSGSSGTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Filamin-B
molecule tags Structural protein
source organism Homo sapiens
publication title Solution structure of the 15th Filamin domain from human Filamin-B
rcsb
total genus 9
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dmbA00
3FQUA 3QUXC 3S88L 2NY7H 1F4HA 1FO0B 3O6LL 2R39A 3K2UL 2VXUH 4WJ5A 1LDPL 5C0CE 5IP4A 5BS0B 4WGWB 3Q6GH 3SQOL 4R8WL 3WLBB 1BJMA 1K3ZA 2AK4A 3EYFB 3T3ME 1PY4A 4G5ZH 2VITA 4Y5XB 2X70B 4MXVF 4ELMB 5DMIL 3SJVB 2P43B 3E0GA 3P9WB 5DJDA 4MZ2A 3VXRD 5B38A 1YPZF 1NEZB 3O9WC 1AP2B 4OLYH 1ACYH 4U1JA 4C54A 4QF1B 2AJYH 2A6JA 1M7XA 2NY5H 5I17B 3VD4A 5FCUL 4FQIH 1MQKL 4OV6F 3RHWF 1FV1A 4DN4L 5J12B 2BZDA 3U4BL 3DTXA 5FHAL 3RNQA 5F1KC 3GBMH 4MDJA 4U6VH 5CMAA 5C0EA 1FL3A 3KPPB 4HLJA 4R0LA 5L2KA 1N2RA 4P2OD 4P46B 4YO0A 4M5ZL 1PGRB 3O6FC 2HJLA 3O8XB 4FZ8L 1IFHH 12E8L 4JDZA 4YHPB 1INEL 1IGTA 35C8H 1S7RA 1S7SA 4LPXA 3VJ6A 2KKQA 3BO8A 3OAYH 2NLJB 1GH7A 5F89A 3VFNB 5IESL 3N1QC 4XGZA 4BSVA 3LQZA 2HWZL 1MCQA 1JPSL 1YYLH 2Y5TA 1G9MC 5FYLD 3MYZA 1PSKH 3VGFA 5IB5A 2DLFH 5D1ZA 1JYVA 3VFPB 4TVSa 3S5LA 4HEPG 3TO4B 1NAKL 3UBXB 2AV1A 2OTPA 2HLAA 3NA9L 1A6UL 3VFRB 4DGIL 2CGRL 2VLJB 3VD3A 4OTXL 4LSQL 5I16B 4NZRL 2IBZX 2V5MA 5F97E 3O2DL 1JWSB 1NANH 3CLFL 2HVKA 2Y07L 1OGAB 1KLUA 4XWGH 1FYTD 5IESH 3OAZH 5IMOB 3KG5A 3D6GA 3M8OH 1FFOA 5GIRB 2XWTA 4FQXA 2A6IB 3WYRA 4X6FA 2ED8A 3QO0A 1SMOA 3FT2B 4Z7UB 5SX4H 4FQ1L 2B4CH 2E8YA 4FN0A 3WFHB 3WNLA 2VISB 2EE6A 1MFDL 3NZHL 4KJQD 1U2HA 3WS6A 2AXJA 1UXSB 5I73C 3T0AA 5FGSA 4FXGB 2QQKL 1HZHH 3BPNB 5FM5O 4HC1H 5BW7C 2DWDB 3FHAA 1XH3B 3SHSA 3UTZA 2NNAA 1MIEL 5A1AA 1GYAA 1KFAL 3ZDYE 4GKSA 2VDMH 3DURB 4N90D 1MCWW 4RISL 1QSEB 3NIDF 1HCVA 4P23D 1HN1A 1UM4H 2VB5A 4HZLA 3HZKB 4JPWH 4O9HL 2NZ9D 2C4FT 5MP6L 3QI9A 5CCKH 5EOCJ 4QNPE 4S2SA 4Y2OA 4YGVA 1CTOA 4HCRA 5DJ0A 5CZXD 4LARH 5HHOD 4PRAA 4YHML 3MV8B 4LPWA 1TCMA 4U1NA 1UZ8B 2FEDD 3MRBB 2VXVH 2DM7A 1RZJH 4E41E 1LO3L 3ILPB 1FRGL 2X4RA 1GGYA 5I1DA 3EDFA 1HHHA 4WV1A 3LD8C 5HGBA 4JPWL 2ADGA 4OI7A 4Z78A 3BUTA 5GHWL 3ROLA 3ZO0A 4XC1L 4IOIB 2DI7A 2VLLA 3EOBB 2VDPL 4V1DD 1OGTA 2CLRB 1QBBA 5DQ9B 4P3CL 4MAYB 2VC2L 5FM4A 2DBJA 2G75B 1I1AB 4NPYB 2V7NB 3O81A 5FOJA 4I5BA 4YE4H 4ZAKA 4M4RA 4WDIA 3P77B 1NH6A 4YIQB 1OAUL 4PV9B 3T4AA 4ODSL 1T66C 5ITBH 3D2UB 1F3JA 3A6CL 3M07A 3ZKXB 3B6SA 4G6AD 1U92A 1XEDA 3MYJA 4CW1A 5CJXC 4IIQA 5T5NF 2XXMB 5I8EB 1T1XB 4AIZB 1MCPL 2J4WH 1JMZA 4OIIL 3HUJB 4N90E 2ICCA 4IS6B 4YBLB 2AEPL 4DEPC 1WT5A 5SV4A 3ZKSD 3MRRA 4NUGH 1MNUH 1YNTB 1MFCL 1U2CA 2I9LB 2BY2A 3QH3B 1TFHA 4TNWF 5D7JD 5SX5H 3H7LA 1A6PA 5DD3L 4HXAL 1IEBA 3RVVD 5CGMA 3UPRA 1CE1L 2JJWA 2J8UE 4YUEL 4C56B 4DOHE 1MREH 5EUOA 4OD3L 4Z7OE 4X5XB 1XF2A 4HLZH 1GGIL 1NCWH 1QKZL 4KDTA 4XPFH 1NDGB 5F9AC 5C9JB 1HH9A 4OBRA 3B9KA 3M45A 4JPVL 3MGOA 2DWDA 1QLFB 2C5DC 3QXUA 3ZT6A 4OIIH 1N6QL 1W72H 2QBWA 3WO4B 1RU9H 4F9PA 5KVEL 1TDQA 4XXDB 3QCUL 3H8NA 4DKEL 4WY7H 3P9LA 3A6OA 3CCHA 1FO0A 3CX5K 5GXBB 1XF4A 1G7MA 3TWCL 4RGNC 2FECI 1R5WA 1RZ7L 2UUDK 4DQOH 15C8L 3V52H 2BVEA 4LVOC 4YBHA 4MA3B 4MQ7A 1I3GH 2IMMA 1RV6X 2MTPA 5DEFA 1BFOA 5HGDA 5CBEB 3SDCB 1O7VA 4M93B 1N6QH 3UO1L 1V7NH 3LKOA 2JELH 3D25B 1UVQB 1MIML 1WFUA 4QWWC 3MLTB 3RBSA 3TZVB 2ICWB 1UWEL 3MREB 2CMRH 1MIEH 1H15A 2YXMA 3V6ZA 1AD9B 4XPAL 4NQEA 4L3ED 2I07B 2H2SC 5HVGB 1KCLA 4GW5B 3WMSA 2FGZA 4JPIA 1QEWA 4NQDB 3KHQA 15C8H 1ULVA 2ADIB 3B4NA 1J86A 1H0DA 4J3WA 4XNMA 5FO9A 5DQJB 2CRIA 3QG6B 3BVNB 5EC2B 1RD6A 2LE9A 3V79C 4ZG1A 1A6AB 1G9EA 1J88A 1LVEA 3OG4B 3IVKB 4PG9A 4XVJL 2A9ML 5J13B 4PJBB 3FB5A 2XZZA 4YHIA 4HLZG 4HUWA 2VXSH 5C6TH 5KTEH 3MLZL 5JXAL 4OZIB 3MCKB 4CVZB 2AEQH 2AXGB 2VR9A 2D0GA 3BSZL 2BVPA 2XICA 2GUOB 2V7HA 4L8CB 3SDAC 2P42B 4NKDA 1ZLSL 4D3CL 1RZ8B 3AMLA 3RVWC 3DO7A 3RNQB 4LLUA 2DQGL 4ODXB 3UTTA 2ITCB 3L7FB 3DV6B 4L4JA 2ZZUT 1K8DA 4WW1A 2ZUVA 4ZUWA 4N9OB 3SE8H 2HJLB 4KQ3H 2VLKA 4LF3A 1KJ3L 1W8NA 4HKBA 3RQ3A 4K71C 5C07B 2UVFA 4FQXB 4CVZA 3N1MC 3U9UA 3FCTA 1LK2A 3KJ4B 1Q9WA 2FECL 3CMGA 4XPGL 4E42A 3O3EB 1E4XH 1PX3A 5DJXA 4FFVC 5DZOA 5CZXC 5E2JA 5J1AB 4Z8FL 1BVLA 1N5AA 2YPKA 4LBEB 5F96H 3RU8H 4K2UL 1ZLSH 2ZKHL 4D3CH 4JFFB 1G7IB 1MEXH 2IAMA 5E6ZA 3TCXA 4Y19D 4P2QD 3W5NA 2X9WA 2ZCKL 4ZO6A 2HJFB 2J6EL 4LLDA 3I6LD 1MQ8A 3ZDYF 2NTFA 4PJGF 4WO4C 1QSFB 3P0VH 5EBGA 3QXDA 4WWID 4NN5B 4JJ5A 1FSKB 1AGFA 2XTJB 3JVGA 1E6OL 1PVHA 3L3DA 1AD9A 4XHJC 5E4EB 1NMBH 4TTDD 5HVHB 5JIKA 4X5XA 1XF2B 2WBJD 3HZKA 3DUUB 3GKZA 1YEEH 25C8L 4S1RL 4PJFB 4U1HB 2GJ6B 3MOBH 3RPKA 1XIWD 5JNYB 3RWFA 5F89B 5LCVL 2UZIL 3B5GA 4F3FA 1OTSD 1R6VA 2GT9B 4M61B 4ZTPH 1AE6H 2FO4B 4PGDB 1E27B 5ICXB 4D8PB 2Z92A 3UZQA 1PBYA 2VDQH 4K3DH 4URTB 3ZTJH 5HHVH 1JF1A 2CLVA 3MBEC 1BZ9B 3BQUB 3VFOA 1R5IA 6CGTA 2NXZD 5F7WC 1L9NA 4RRPA 4ODUB 1RZ7H 2G2RB 4UBDC 3U0WH 2V17L 2VLRB 4L8CA 2O5ZH 5E2WL 1QNZL 3G6JB 12E8H 5K93A 4KHXL 5C09B 2ITDA 4G8GA 3PWLA 3LRSA 3UPAA 1MJ8L 35C8L 4KVNH 1V7MH 1SVCP 4IEFB 4X7SL 2KZ1B 4C58B 4MD5A 1XFPA 4TOYL 2DQEL 2XWBA 2Q8BL 4OCMC 4U1IA 2Z93B 5HGAA 3SKNA 5HHME 3HG1E 1KLUB 2DQUL 4YDLB 4X6CA 1CGTA 3EDDA 4TSAL 2HWZH 5DYOA 1DBBH 1EV2E 3FQTB 1P69B 1PFCA 2MNUA 4PRIE 1DBAH 4MHHI 1U42A 1M4KA 3DX7B 3MLYH 3RKDC 5L9DL 2OL3H 1NLBH 1KLGA 2GQHA 4AM0B 4Z7WB 4OGZA 5D1XB 2ED7A 2Y7QA 2PO6C 2JCCB 4NRYB 4D0BA 3QWOB 2WUCL 2J8HA 1IM3B 1YY8A 3PP3H 5F9OL 5AYUL 2W9LA 4NDMA 2YBRB 1J7VR 1F58L 3GB7A 2BSED 5KSBB 4ZPTA 4M1GH 2MCPH 2Y23A 1DL7L 4CVUA 4KKCC 5HDQL 4F80A 4ZNEA 1LO5A 4KUZH 1ED3A 1HSBA 2X4QB 5EU3A 2AGJH 1ZTXH 4TSAH 3EYSH 3MACL 5FUCC 1QFPA 4XBEH 4Z7VB 3G6JE 3L1OH 1FORH 1MVUB 2APWA 5ANME 3GJEA 2L7UA 1Q0XH 1ADQH 3HKFA 2B4CL 5J4MA 5T1MB 3VXTA 2VR4A 3L5XH 3EJYD 2HFTA 2XT1B 2G9HB 3QFDB 3DX9A 5B38G 3U0PB 3NH7H 3BKYL 3OKLA 3F7VB 5IW3A 1JUFA 1D5XB 3BWUC 2ZNWA 3GMRB 3SDCD 1FG9C 4Y19B 1BBJB 3IFPA 4JAMB 3RL2A 5LXGH 1AO7A 1CZ8L 3NCFB 4EEEA 4PLKC 5KVGH 3RWIB 3MO1B 1MJUL 4H1LG 1CD1A 5DGQA 1Q9KB 3TZVD 5HBBA 1J8HE 1I85A 2CDFB 2ZUTA 4S0SD 3MJ8B 4N0RA 2D7NA 5TQ0H 3MUY1 3ZDZF 2GK2A 3N1PC 5DD5L 1JK8B 4NQCA 2ERJC 4XNQB 4FABL 3A0OA 3PG2A 1BOYA 4S1DD 4PRAB 1FJ1A 4F9LA 3VXQB 43CAB 4LLYB 3VFOB 1HHIB 2EEDA 1IEAB 1N7ML 2HN7A 3LOWA 1HOCB 5IBTH 3IDGB 4LCWA 3LKOB 5L2KD 4HUUA 4KKAD 2D9QB 4HF5L 2P8PB 1CIDA 5MEOB 4WO4D 3HE7C 4UMGA 4HAFA 3WXVH 1JZ6A 5MENB 1Y0LA 1FL3B 4N1EA 3FB8B 1LK3L 3F12B 4KKBD 1J1XL 5DWUH 4R2GB 3Q48A 5C0BE 3H3PL 4PJXF 1J10A 1BP3B 1DQMH 4Z5RA 3NAAH 3R8BB 3E1F1 2BX5A 4O51A 3ARSA 4QHKI 5KSAD 3X11A 5ISZA 3MCLL 4MXWH 3DPBA 1E4JA 3H9ZA 4ISVB 4X6BA 4JM2A 2W0FA 4YE4L 1NC4A 3I02B 4P2QE 2EDFA 3RI5F 1T2QH 4ODSH 3KR3L 4HFWB 4NKIL 4PP1D 4L5FH 2IQ9L 2CDGA 4N0UE 2B20A 1ZEAL 5E2WH 3LB6C 5ETUA 3LIZL 3QIWC 4Y16D 1W0WA 3BD3A 3GHBL 3ARVA 5E1HB 1MELA 5CJBA 3ALXA 3DRTB 5IJKC 3PDGA 4NOBA 1ACYL 3NBNA 2WLYA 1AKJD 4NBZB 2G5BB 4L3EB 3MRGA 4QCIB 3QIBD 4XX1G 3VFTB 4KJYB 1N8ZB 1KB5L 3QB7C 5AD0B 4G9FA 2Z8SA 1GGIH 1G7HA 1QKZH 2IPTH 4JO3L 4WFHE 3KS0H 3RKDD 2XTJD 3QQNA 3VRJB 3IXAA 5HD8C 5AZ2H 4ZFZA 4MD0A 2H3NA 5DFVC 3X14A 4UAOC 3F5WB 4LCUB 4R4ND 2BVPB 5EB9A 1Z5LB 4MNGB 5F7MC 4YHKL 2BVTA 3Q5TA 3C87A 2W07A 3GSWA 1JZ5A 4H26A 3WFBH 2ADJB 1YN7B 2DD8H 4CAGA 5HHXH 2P5WA 4GW4B 4RISH 2CRYA 5F6IB 3GHEH 4LLWA 1FORL 5HI5C 4ZDHB 4APQA 2FX7H 3VMOA 4O02L 3O45B 5J12C 5B8CA 3GSVA 5HPMA 4U2ZA 4EOWH 1Y18A 4NCDA 2APBA 2P8PA 1PZ5B 3RJDA 2R9HC 1BF2A 3U1SH 4ZS7H 2F54D 4YHKH 4OZIA 3QJFB 5ITFB 5IWLC 5LXGL 1LEKA 4GAFB 4XWGL 2XG5A 2FBJH 2HT2C 4UTBL 3IDXH 2GYSA 4M7JH 4F15C 3TO2B 4EDXA 1DVFB 2FIKA 5E7BA 3D0VA 3O11A 1DN0A 3MRKB 3O8XA 2C1OA 3SOBH 5FGBA 2XN9E 4YXHH 1JGEA 2UY7A 3BEVA 3T65A 1UENA 2XA3A 5IV2A 2MHAA 2ZUUA 2I60L 4GXUM 4WWKA 2R2BB 4XBPB 3UPCA 2F54A 3GI9H 2J8UB 2BNRA 2UV3A 5EZIL 4JQXA 1CFNB 4WU7B 4PJ8B 5ACZB 4X7TB 5GZNC 4KJYA 4XNXH 2UWEE 3CU7A 1WBZB 3A6CH 5LVEA 5DD6A 4EBQH 3SDDB 5DMYA 1K4DA 2VXUL 1S7VB 5DJ8A 1CI5A 1TZIB 5LBSH 3O6FD 4IIQC 4PRHB 4APQD 1JMXA 1MRCL 4BZ1H 5EWIH 4W81A 4X6DA 3F58L 3TBSA 3TBVB 1FAIL 3RWEA 2DQIH 2P5WD 1M05A 4HPOL 5A3ID 3F65A 1ZVSB 2R1WB 1SJHB 1CFVH 3CFBA 1P7KB 3SBWA 2BHUA 4L8BB 3VFSA 4P5KA 1OGAA 1VPOL 1ED3B 5I18H 1A2YB 1PLGH 1BMGA 3GSNB 4BKLA 1DFBH 3I02A 2R0ZL 1NCWL 2V5SA 4RAVA 5FF6A 3DLQR 4X6FB 2YUZA 4JPVH 4J2XA 4GT7A 4XZUA 5DJZB 5I76A 4I0PD 3FTGA 4LBEA 4NJ9H 1SYVA 1I9EA 3QUZA 5DJ2A 4Y1AE 2FJFA 4YC2C 5GSVB 3IDYB 2W0KA 1UACH 1HQRA 1KPUA 1KT2B 3OPZL 3THML 1VFBB 5F8QC 3WV0A 2VQTA 3SDYL 1R0AH 5D93B 1CXLA 4NO2B 3V5DA 4R26L 4D9QD 4M1CC 3VJ6B 5FO7B 5JPMB 3IU4H 1I1FA 1UH2A 1X5KA 3L3HA 5ENWA 3MLSL 2F58H 4QRUA 3A67H 3MYJB 5MEND 5IK3A 3MRDB 4YK4B 4PJXB 4KI5D 3QFJE 4PRPE 1OD9A 5HYFA 1KPRB 3RX5A 2K7PA 4OFKA 3CD4A 4OZFA 1XF3A 4RMVA 1KN2H 1LO4H 4RGOL 2FD6L 3KPSB 1U58A 3U48A 3D0VB 3O11B 3UTQA 3W0WA 4P57A 3AAZA 3DVGB 1LD9B 3QHFL 1FLRH 5HHXL 1H15B 2Q3AA 4H25B 3KPPA 3P9MA 2QHRH 4JFOB 5EBWB 3CDFA 4YEFA 3NVQA 1L6ZA 5HI5D 3GUTA 1LNUA 3PGCB 5E24E 1UB5B 4TOYH 4RNRA 4UINL 2OX5A 1RIHH 4X9HA 4C57C 1LO0H 1BWWA 1MCLA 2IG2L 2ICWJ 3LPFA 3H6JA 3RDTB 1BZ7A 1D5BA 1IAOA 4OAWA 2BRRL 4I3GA 4YWGH 1I8MA 4Z7VA 1FE8L 3UBXG 1GZPB 4LVOB 3CCHB 3TCLB 4G80B 1NCTA 1X5ZA 1M71A 5D1ZD 4ZSOA 4NZTH 4TTGA 4DQOL 3BPLB 1N6UA 3OGCB 5FA4A 4RMRA 5TGBA 5EC1B 4MHHG 2VLJD 3SKJH 4M48H 3I6KB 1IGJB 1YEJH 4MAYA 1ZHKA 5F1OB 1DBJH 4JO4L 3U30B 4PJBF 5EZIH 4W70A 1XCTB 2NY0C 4MGXA 1A7RL 5GGSB 5JW5A 4ZD3L 3SDXB 1JGDB 1MCRA 5F96L 4XNUH 3L5WA 1WISA 5J9PB 4RX4A 1DE4A 1KOAA 2NR6C 4GKOA 3V6OC 3M17B 5LAXA 3FT4B 5EPMB 5D71H 2HRPH 4PR5B 4H88L 1NGQL 1YPZE 3LQAC 4FNLH 4LLVB 4NP4L 1ADQA 2R69L 4Q9RH 3RBGA 4L29B 1P7QA 3OKDB 4TYUA 4LMQI 5I0ZA 2BCKB 4M5YH 3QJHA 4PJFF 4M4PA 1AR1C 5KSUB 4GXVH 1AD0B 3JUYA 1U8JA 5DMJB 1CXKA 3VXUB 2R29L 3V6FB 4R7DB 4ELMF 4ENED 4FTVA 3EDJA 1BAFL 2DLIA 3HC0B 3G5ZB 3HE7B 4HV8B 3RHWK 3RWJB 1WWBX 5ICZA 1ZE3C 2VRAA 1BFOB 1F3DH 3HG1B 1N3NB 3QWRA 1YEDB 3LS4L 3QEQD 3IB4A 5EULV 1QLRA 3ARGD 4ACPA 4L1HA 2LVCA 1UKQA 1X7QA 5F7LB 2ADFH 4O2EA 4PG2A 2F8XC 1YEHH 2EZ0D 3IKKA 2JCCE 4YUEH 4JFZL 2X4UA 5GS0D 1CD0A 3NTCH 2B8OT 5F1NA 3DXAB 5DMIH 2ADGB 4YX2L 1ZXQA 5E5MA 3WLBA 2J12B 1JHKL 2H32B 5GIRA 3D5OF 5E9DE 3OB8A 4JEGB 3O3UN 1BVLB 2YPKB 3QUZC 4HXBL 1W72L 3MLRH 2JJSC 4QOKB 4WW2A 2BVUA 2CKBL 2R2EA 4WV1C 3MNWA 4G9FB 2PNDA 3RVTC 1V3JA 5JZ7C 5ADPH 2HG5A 3RIAF 3WKNA 4XCYA 3LV3B 5C2BL 3G5VA 1F3DJ 3QXDB 5DJ8B 3OF6A 3TJEH 5ISZD 5JQ6H 2NW2A 3QIWB 4WFGE 4NYLA 2VLME 4NRZB 2OZ4H 3ZLQC 3C8KA 3LIZH 1KB5B 1TZGL 3M1BB 2NMSA 5GRJL 3L7FA 5E8DH 3BKMH 4AIXA 1Z6JT 2E9JA 5FYJU 5JHDD 5KS9E 4P0DA 5ABDE 1QSEA 5T3XH 3FQNA 4PREA 1ZVSA 4KUZL 1S7QA 1WFOA 2YMXH 5F70A 3VW3H 1MHPL 4F7EB 1Z9LA 1OAKL 2VDQL 3HC4H 2XWTB 3UDWC 2DQTL 4ZPVB 3TM6A 1NAKH 1H3TA 1OLLA 3G5ZA 5CSZA 3RWJA 4HK0A 1XR9B 3WFHA 3MRLB 1MHCB 2O5ZL 4X7TA 3BJLA 3G6DH 2FIRT 1CICD 3MUGB 3RZWA 1EO8L 2FHFA 2VLJA 1NCAL 3S35H 5H94A 1E4KC 3O8XC 1JI2A 2Z93A 5HGAB 3VG9B 3L3OB 3QWOA 5CLWA 4DVBB 1OSZA 2VDOL 1R3KB 5FGCB 4L3CB 5J7CC 5E08H 1EAPA 3EOBA 2IFGA 3NCEB 3RY4A 3KPSD 4OSUH 4CBPA 4APQB 1HQ4A 3TVMB 1A7RH 1AIFA 3RWHB 3PQYB 5F7DA 3WNKA 1NLBL 3HMXH 4O02H 4ZO8A 5I1JL 4RRPG 1A2YA 4QY8A 1T5XA 2XQYG 5E5MB 1EGJH 4IMKA 3UZEA 1KCUL 1TNMA 3PNWA 3DX8B 5C0BD 3PL6D 3LKSA 3U1SL 1ZV5A 4PTUB 1CG9A 5KSVB 5D7IB 5IB5B 1RIUL 3W9DB 2SEBB 3QR2A 2O61B 1X5XA 3F5WA 2IPUG 1FFNB 1ITBB 1CN4A 3QBTB 4YZFF 2DQDL 4DZ8A 5JLZB 2IMNA 1NCUA 1T3FA 5IVZB 3V6OE 1V3MA 2LTQB 5DDHB 3IFOA 3HC3L 4ZAKD 4HGWB 2MKLC 1T0NB 3EO1B 4NO3A 1KEGH 3UX9B 4Z77B 4MDIA 1IRAY 1P1ZB 4RCAA 4OFDA 3HTLX 4GQ9H 4L4VD 1OTSC 4XCYB 4JJHA 4NJAH 1KCUH 3BZ4B 3KPOB 4R4FH 3ULUH 1AGDB 1HH9B 5DJAB 2E5EA 3KPNA 4LPUA 4TUKL 4XNXL 1N5AB 4K3JH 1FVCB 3ALPA 3ZT5A 5KVGL 4J3UA 3I50H 2X4RB 4RX4D 5B39B 1G7JA 1S9XA 2BFVH 4YDJA 2Q7YB 3U0TB 4U1MB 2IPKA 3HC3H 3MV7D 3PHOA 1WV7T 5TQ0L 1H0DB 2GCYB 3SGKC 3KYNB 2YBRA 4OCYL 4JCMA 3VXMD 2DQFA 5DJCB 3ARED 5E2UL 5BV7C 3SE3C 4ZUWB 1WFTA 4WI8A 4DVRH 4WI6A 2F53E 1BD2E 1YQ2A 5IHLB 3IDIB 4LSSH 3GSNH 3ZKMC 5C07A 3C6LA 5D7LA 5HY9A 5GGSY 5CEZE 1D9KB 3O6LH 3E3QE 1EVUA 1Q38A 3B43A 4M9PA 3QNYA 1LDPH 1EIBA 1X5GA 1YEFL 3B5TA 5DK0B 2BFVL 4ZFOL 1U8LA 1RUAL 2MOVA 4TNVK 4RQQB 1NGPH 1A1MA 4EUPB 3CXHJ 2YUXA 3R8QA 4NQDE 5HYIA 4F7MB 1MFCH 5AG8A 1JFQL 3K4AA 3C2SA 3OPZH 1P4LA 3QEUB 4PJDB 3LN4A 2Q6WA 1QPXA 3MA7B 3JWOC 3SGEH 5DXWA 5C2UB 1KTLB 1GRWA 1AC6A 2VZTA 2FLBT 4KI1A 1QPPA 3L3HB 4MJ6A 5GS0C 1GCFA 4K7PH 5EO1A 1EHLL 4M03A 4NKIH 3MLSH 2PUQT 3JXAA 4YZFE 5AWNL 1K8IA 3GSUA 3PQYD 4PJGA 5JO5A 1F11B 3OG6B 3VXOA 3KYOA 2Z31D 2I27N 3QXWA 5C86A 2F53B 3QUMH 4QEGA 4W4NA 5EU4B 3EO0A 2MCPL 1B2WH 1IEAA 1HZHL 3KNBA 3MLWH 3VDBA 5KN5B 3PABB 1RUKH 1AXIB 3FMGL 3PGDB 3E6FA 4OCXH 3CU1A 1KFAH 2AV1B 1KJ2L 5IW6B 1I85C 1FFQA 2R4RH 4QRRB 5DUPL 1JHLH 2Y36H 3OHXA 5EIIA 4HIJB 4N8VB 2WK2A 1NKOA 3BGAA 1JWUB 2VAAB 4G9FD 2AK1H 3SKOB 1WEJH 2E7MA 1KXQE 1C5CH 3OKMB 7CGTA 1I3GL 2EO1A 3IJHA 5GRYA 4UDTA 3UJJL 1HWGB 2VLRD 3QQ3A 4ZOBA 5I74C 1UQSA 3OZ9L 1AXSA 3RGVB 4Y4FD 3DNKA 4NUJA 4U1GB 4WFED 1WBXB 1FNGA 1FVCA 2BVOB 5IKCA 4I8DA 3OMZA 1D5IL 4MNQA 3TPUA 1WAAE 3GMNB 4J6RL 4KC3B 1FP5A 5DRZA 1A3RH 5HHOA 4R4BB 1YEDA 1JI1A 1MJUH 3LV3A 4MD4B 3HE7D 1AGBA 1XGQB 4LAQH 1N59A 3RRQA 4XBGB 3FQWA 4LL9A 4WO4B 4GMTH 4BZ1L 4XB7A 3X3GL 1AXTL 3FKUS 4F7PB 5D8JH 1AH1A 3SY0B 5HGBB 3FO0H 4FABH 1I1RA 5GS0H 5SX5K 4H8WL 3BISA 1KGCE 1P9MC 1NBZA 3DMMC 1B4JH 4OB5H 1I9IH 2DLTA 4LRIA 2YN3A 4IRJA 4QKXB 4BJLA 2HT3C 3N1FC 1T4KA 4UILL 2PXYA 2NY7L 4KRPC 2FATH 1YMMA 3MX0A 3MV9E 4YBQC 1RUPH 5SWSD 1HILB 1NCCL 1HCFX 3S96A 1NMAH 3SDXA 3C5JA 4NFCA 3PXJA 1YNKL 4X7DC 5F93C 1UVQA 2Y1VA 1QUNA 4RWYH 4JFQA 3BZEA 3QFJD 5IIEA 3V5HB 4F7TA 3GMOA 5K9JH 3NAAL 3THMH 3MLUL 5JXED 4P4RA 1P7HL 5F6IC 2QHLA 5EO1B 4R26H 2HFGH 2VZVA 4M7ZC 1HNGA 4FQIL 1MREL 5EC1A 3V6FA 2YD2A 1SEQH 3DRQB 1LO3H 2OL3B 5IBLC 3DX6B 3KR3H 4XP9L 5E6IA 4MJIB 2A38A 3H0TB 5EIQA 3GSQB 5I6XC 3A67L 1WBYB 5GS3A 4M7LT 1KTKE 4PP1C 4E0RB 1X4YA 2NXYD 2VIRA 3B2UC 4NWUH 2HAZA 4AYFA 5JIIA 4RDQF 5EWIL 1A1MB 4GKZA 1AGCB 1Q9LB 2QSTA 3HPJA 3LKSB 3UC0H 1YDPB 4PJ9B 2FO4A 3RY6C 1NJ9A 2HVJB 2WIIA 3VCLA 1JFQH 5J0BA 3VGAC 4N5EC 5J11C 3MLUH 1AO7B 3MV9B 4OF8A 5EBLB 1GVIA 3ISWA 2X4PA 2BY0A 4PLJC 5L8LB 2PYEB 3P0YL 3OKDA 3S97C 3RVUC 1BQLH 1MLCB 4WO4A 1AFVL 3H9SA 4K7PL 3OSKA 4NNPH 3C8KB 3VRIB 3STLA 5ITBL 1ZVYA 1I8KB 4LNRA 2EH8L 3N06B 4KK9C 4JZNA 3S3SA 4FFYH 1T7YA 3BRGC 3QXVA 4X6DF 1IGFL 1YYMH 3SKNB 1C8PA 3ORJA 3QEGH 1WWAX 3TT3L 4ZXBB 4XCFH 4YFDB 4HKZA 4OZGA 3RJQB 2CUIA 4OCSH 2Z91A 5A16A 4NQCD 4JO2L 1A47A 3O4LE 4PJCF 3HHRB 5A2KH 2XWJA 3LDBB 4EDWH 2ZP0T 1CBVH 5T1LB 3PWPE 3FO9B 4P2RD 2AK1L 2VAAA 3PWVB 1OSPL 1RUQH 1IC4H 1I1FB 3HZYA 4X6DE 5TF1L 3PDOA 5DHVA 2E8ZA 4JFYA 1D5MB 4QYOA 3UJJH 2WZPD 3O2WL 2A83B 4NO5A 4YEEA 1CD8A 4HWZB 4HDIA 3V5HA 5D1QD 2XZQL 3L5JA 4HGWA 5JXAH 2JKXA 2W92A 3P4MA 5IF0A 4NWTH 3ULVH 3HC4L 4NQVA 3S4SB 3DUUA 4J6RH 3MRGB 4PJ5E 4IHOA 1RK0B 1FJ1B 4K9EL 3T0EC 5D6DA 4YBQD 2AI0L 3QNXA 5LWYH 2X7LB 5D9SB 3TWCH 5I1CH 3WS3B 3KPTA 5DTFA 4EDWL 5DFVD 5KAQF 4APQC 2QHRL 1MFNA 3GSOB 5D71L 3SN6N 4HIEB 4ELKA 4EZMA 3DX8A 1T0MB 1QG3A 5J9PA 3Q6FB 4YBLC 4Z0XB 4B7LA 4JFDD 2FH8A 1G7JB 1LO2L 4YDJB 1R5IB 3Q5OA 4MA8L 3GMMB 4MVBD 1P7KA 2F53D 3WEXB 1QLEH 1ZAGA 1CGVA 4WHYH 1J9CT 4XCCL 1YC8A 5IT2L 4AK1A 1UZ6E 1MLBA 4MJ5B 3I6LE 4I77L 2XIDA 4N0YL 2AEIT 1LE9B 5INCA 4EBQL 2JB6B 5AEAA 4PJEB 4KRLB 3HMXL 2J6EA 3FOMB 3CUPB 4HKXA 2YZ8A 3T0VA 7FABH 5ERWB 4BM7A 5BXFA 4GG6E 3OJ2C 3QDGD 1U8HB 2P5EE 1PX4A 4YHZL 4C56E 5J8OA 4QOKE 3QUZB 4RWYL 3MRIB 3EJZC 2WINA 2ORBH 4KROC 3NZ8A 3ARTA 1S5IL 3OKNB 1CLCA 1G7QA 2D4FA 4R0LB 2LTQC 5IEHB 2BVYA 3T1WA 2R0LH 4LNRB 4JFZH 3KLDA 5T1KD 1EX0A 3D39E 4X99A 1G7LB 3IAQA 5T1LA 1G0YR 3BSZH 4LPYA 3ES6B 3FZUD 4WNQB 3ABZA 4TUJA 5DUMH 4G6ML 3VE0B 4NKOB 4OFYA 5D6CA 1N6VA 1UQSB 4KI5C 1G7HB 5HI3C 3IAGC 4UUJA 4Z0BH 2HRPL 5BMFH 3BUYB 3CSPA 1KCKA 4X7CC 1MNUL 5HHVL 3HUJE 2EYTB 1F11A 1QFWM 2XKNB 4LMQE 5C2BH 3RTQA 1TJIL 4PJEE 1VFOA 1GC1H 1MVFA 3K2UH 1FHGA 4OFYD 3V5KA 4UT7H 4LPTA 1FVDB 2PKDA 2YD6A 3PGDA 2AJ3A 3P0GB 4Z7QF 3EGSB 3W11D 3OR7A 3AUVA 5JLZA 5E8DL 3OKOA 3QA3B 5EOTA 3L9RB 1RULL 3GGWB 3DGGA 2VUYA 2BNQE 2WQRA 3VWKA 4NO0A 4OF6A 5C8JA 3NIFE 1W0YT 1OGTB 1X9QA 2E27L 3VW3L 1HXYA 3QDMB 3ME0A 3CC5B 3D39B 4WI7A 2DQTH 5K59F 3ZL4H 4I48A 4S1QH 3ZE2E 4J3XA 3T0EB 4WW2F 3R4DA 2OL3L 3ARFB 4K7FB 5JNYA 3VG0L 3FAWA 3MODL 4MXQD 1EO7A 2VQ1B 3EAKA 2NW3B 4PJIB 3VGEA 1YEFH 1UWGL 1DUYA 4YDLC 1M6OA 1UXWB 3P40A 1RUQL 1INEH 1QEWB 5CZVH 4N8VG 1NLDL 1MWAL 3OAYK 1BM3H 3CFDA 1KB9K 5D7IE 3GJFA 3O2WH 4YX2H 4X4YA 4B7IA 1OTUC 3H42L 4MVBC 4YHLL 1JNNH 3C08H 1KG0B 1VFBA 4PRPA 3MFFB 4YXKH 1MIMH 2JIXA 1KB5H 2VAJA 3RVUD 3TESA 1TJGH 4ODBD 2EH7H 3QPXL 5INDB 1I8LA 1T5WA 3SDAB 1FFPA 3VG0H 1PAMA 2XG4A 3O4LD 1UEYA 3GBNL 5AZ2L 1A6UH 2P7TA 2V2TB 2D31A 4X9FA 1U3HB 3BIAX 4ZUUB 5DFWH 2YPVH 3TBWB 4HFUL 2OZ4L 1S7UB 4HBCH 1GAFL 2PXYC 3MRBA 3QDME 3FN0L 3M17A 2ICES 4MNQB 3BKML 2YN5A 4IRJC 3R0MA 2BHYA 3HUJA 3IXTB 2DWEB 4M48L 3DMMA 2DQDH 1BBJA 5D7SL 1ZHBA 2DQCH 4JY6B 1QTYT 5C3LD 4HGKC 4WHYG 5T1KB 5IEKA 4JO1H 1WEJL 2D7MA 5DI8B 3DRTA 1JGEB 3EYQD 3QA3A 3ARXA 4U1HA 1NFDB 2FJGA 3QPQC 2CO7B 5H35B 3Q5YA 5HI3D 3LN5A 3TYGH 4DW2H 1FZKA 4WFGD 1S78D 1MVUA 2VN7A 5TDOB 3GMQA 1ES0B 4QRPA 1FPTL 4QGTA 1EXUA 4PGZA 1P4BL 5D1XD 2BNRB 3KGRA 3FTGB 4W6YB 2MCG1 1DQTA 4JM4L 3DMMB 4JPKH 4FQXC 3VFRA 1OQOA 5J89A 5ITFA 2KZWA 4PD4J 1WZKA 3AVEA 3SQOH 3GB7B 5JW4R 2W9EH 1MHHA 3PV7A 3U0TA 1CS6A 5CP7A 4X8JB 5GS0L 2J7LA 3RU8L 4D9RD 1FNEA 5JIHA 2I60H 2EDJA 4J4PC 2C9AA 3TYGL 2VABB 5BMFL 4CN6A 4K71B 3P4MB 5IF0B 5C09E 4LRIC 1RZJL 4LSSL 4XAKE 3T3PE 5GRVK 3C9NB 4UQ2B 4CU7A 3I3BA 1B6UA 1QFOA 1HEZA 2FATL 4GW1B 4M3JA 4XMLH 3CFJB 1PYWA 3KLAB 4FMFA 1NBQA 4MQTB 4EQ2A 1NMBL 4TN9A 5DMKA 2VERN 5C0EB 4NKQB 2JE8A 1T03H 2X40A 5I1AA 4FXGA 4XC3H 4ODXA 5B8CC 1DQQB 4S1RH 4RAUA 5K9QG 1IAKA 1IT9L 1WUNT 3QDJE 3WDIA 3P9LB 5IB3B 4GRMA 4U1GC 4BFEA 5I9QB 3B3IA 4LCYA 4PJFE 2NLJA 4HULB 2AABH 3HZMB 3QUZD 4M62H 1JNHA 1LP9E 3QNZA 5IFJB 4TPRH 3CC5A 4LSVH 1MLBB 4MJ5A 1QBMH 5FO7A 4ZFGL 4OZHF 5DHYA 4NNXA 3SPVB 2QJDA 2DN7A 4PIRF 3BP5A 5A43C 5HHPA 4J3TA 2WBKA 3D85D 2J4WL 5B21A 3VRJA 2RBLA 4R8WH 1OT1A 5FM5M 4NZRH 1B0WA 3QUML 3GRWH 2EDTA 5ANMB 3U83A 3P30L 5F7FA 2NX5A 1JNLH 4IRSD 3MBEB 3Q1SH 4I3RH 5TE6H 4FXKA 2NTFB 5LGKA 5DI8A 1VA9A 1YNTA 1X44A 2MQCA 4YJZL 4OF3A 4BQ8A 5CD3A 4NHUA 5HYJA 1DBAL 1WIOA 4EUPH 5IFJA 2A0LC 2EYRB 2QEJA 3QPXH 4Y2DC 3KDMB 3CFBB 4WNQA 3QEUA 1RK1B 3QDJB 5LG1A 1MJJB 3TBYB 4UT6H 2QADB 5ENWB 2WIMA 2VWEC 3KPLA 5E4EC 4AEIH 3P77A 2H41A 1U8QB 4JGUA 4BQ9A 5HJ3B 4AL8H 1EHAA 1KGCD 4PJ8C 2F5AH 1CG9B 3P30H 4LCIH 3CVIL 3K7UA 1IM9D 1UXSA 4OKDA 1A6ZA 4ERSL 3EOAB 4XXCA 3O8XD 4LCCB 5I1KH 3QCVL 1ZTXL 1G9NC 3RUGE 3FB7A 1T6WA 3H9HA 4OCLC 3OXSA 3OJVC 3QDGB 3G6JF 5D96B 1FLTX 1JWMA 4Q7DA 2C3HA 2WSKA 3CDYA 1R3LB 4MD5B 5E8OB 2EC9T 4QHKJ 2HMIC 3OKEA 4U6YB 1JRHL 3BKJH 4RIRB 1UB5A 1T21B 4GJTB 3GI9L 3TA3A 2VKXA 1EERB 1LE5B 3HE7A 3CH1A 3HC0A 2VXVL 2JELL 3ZHKA 3T4YA 3WIHH 4GO6B 1RIUH 4Z7NE 3C8HA 1IKNC 3PWJA 1UWEH 3NFNB 4YR6A 4OCXL 4XVSL 5GZND 4JPKL 1RUPL 2ZWLT 5CJXA 3IDNB 1VESA 4K3GA 1ZS8A 2W0FB 4LIQL 4NQSA 3WD5L 3QHTC 4POUB 2DM2A 2WM0A 3C5ZC 1CU4H 1KJVA 4PJHF 2MSPA 1YMMD 1X5HA 4ZS7L 4HS6B 4KJWD 4QRPE 5FOBB 1H5BB 3GSXB 2PETA 3VFTA 3IJSB 4OUUB 5I1LA 1F4XL 3RWGB 4PJ7A 3DSNA 1CD9B 2FDBP 2VDML 1CDIA 5FF6B 3GFUA 2V9TA 7FABL 4KDTC 2GUOA 4KI5F 5DWUL 5EDXA 1WFNA 2DB8A 4HK3N 3SKMA 5B3JF 4H88H 3PWNB 4PY7A 2P49B 1BFTA 4IRSC 3FO0L 5DC0A 2ORBL 1YN6A 3IXAB 4DVRL 2BY1A 4IRSB 4LASL 4L29A 1XMWA 1OCWH 3VFGH 1PD6A 5F9DC 5T3XD 3R06B 3LKNA 1DSFL 4M1CD 4IRJB 3V4UH 3C2AL 1HIML 2VITB 2RQ8A 2EH8H 2R2HA 4PJ7B 4NQXA 2H45A 3BP7A 1WF5A 4NZUH 3WN5B 5HYEA 1DN2A 1T0NA 1IGCH 3RIAK 4G6JL 3B9KB 3H7BA 3CXHK 1CFNA 4ZOEA 1CR9L 5KVEH 4DOHB 3WUWG 2EDWA 2PTVA 4RGOH 4OV5B 3QFDA 2VZ3A 5IFAL 4DKEH 1JTPA 1T22B 5CKAA 5TE6L 3VFMB 5ACLA 1CFVL 2ADFL 1WC7A 4XI5C 3BPNC 3ULUE 1GC1L 4KK8D 4UTAL 1J05B 4P57B 4HX1A 1P4IL 4IOIA 4QRRD 1CQKA 1A4KB 1WLHA 3X12A 1I7TB 5D7LE 2YC1A 3S34H 1I1AD 1CGSH 2OP4L 2FL5B 4KTEH 1K3IA 1NAMA 1WAAF 3MNVB 4XGZB 4BSVB 2UZIH 3T65B 4PB9L 1T04B 2IG2H 1T2XA 5E03A 5MEPA 4QLRA 3C5SA 1P6FA 3UTPE 1CYGA 2X1PA 1FE8H 3JWDH 3TFKD 1E27A 1EFXD 2D03L 4I0PB 4OI9A 5ICXA 2AI0H 1Z3GH 1ZA3B 2BVQA 1NC2A 5EOCL 4PJ7E 1RK0A 1JHLL 3BP6A 1D9KA 4NZTL 4MB4A 2HG5B 3MJ7B 4N5UA 5D1ZC 2FBOJ 3K46A 1ZVHA 1BM3L 3RL1A 5FYLH 4UT9H 5ILTH 1IEBB 3FRPG 4JCLA 4PJGE 4WCYH 2UY6A 5E5UB 5TE4L 1JRHH 3BKJL 3BE1H 3SCMA 2ZUSA 4HUVB 3DMMD 5KTEL 3CDGB 5EU6B 1MHHB 4Q97A 2HMID 5DC9B 2FJHA 1F8TL 1EZVY 1FGNH 4K7PX 1A7QL 1OB1B 1XF4B 4UTBH 5DSCB 5DD6B 5C0IB 1IQDA 3VFSB 5EFIB 3V0AC 1KXVC 3SGJA 1Q1JL 4HT1L 1VADB 5DEFB 3O6FB 4MZ3A 1M7IB 3TBVA 4M1GL 1UYWL 1S5IH 1VGKB 1FNFA 1EHXA 3TBTA 3LKPA 4WFHD 2V7HB 3EO9H 3TH3T 2DYPD 4F8TA 3BE1L 2H8PB 3ESUF 3MPCA 4LSRL 4WUUB 2AXFA 5SWZB 4KZDH 3Q2CA 2FJFB 2OYPA 3L1OL 1IVLA 3GSXA 1QYGH 2EEAA 1K8DB 5GZOD 2C4FU 1S9VA 1TJHL 1M1SA 4W4OC 1L9MA 3TF7C 1GJIA 1RZJC 2ZSVB 1EDQA 5E7FA 4UDTB 4FQJH 4PJGB 5JO5B 3P4NB 1RZKC 4JZNB 1U91A 3S5LB 5GGUB 1WZ1L 3K74B 4JM2B 1F3RB 2B5IB 3WSQH 3D0LA 1G7IA 1CFQA 4GMSH 5MEPB 4P59H 3C09B 2GSGB 3NN8B 5AUMB 3INUL 4Z7WA 3SGKA 1U3JA 1MH5B 3EO9L 2HVKB 4ZSOE 2VXSL 5C6TL 4PJHB 4ZO7A 5DJYA 1TQCB 3E2HB 2VUOA 5DS8A 4XHJD 4JHAH 1MCHA 4Y5VB 1UKTA 4DN3L 2W9EL 4FOMA 2XFXA 3ARWA 3ZKQD 1A1NB 4ZD3H 3AAZB 4P5TC 3L3IB 4NJ9L 5IHUL 4YHOL 1V3LA 4P2OC 2E27H 1G6RA 2F19L 5B8CB 3DX6A 4K3DL 1EEZA 1FZJB 3BAEL 4RFOL 2W38A 3K0WA 4GXUN 1HHGB 4NP4H 3VXQA 4Q9RL 5AZEH 3FRUB 4R3SA 5A2FA 4P59L 4KK5C 2BDNL 4ODWB 4NKDB 4JFPB 4OLUH 5MEQB 1KJ3H 3NCMA 1EFXB 3BDBA 5GRXG 2CLVB 5JQ6L 4PGJA 3GNML 4PP2B 1MJ7H 1OT2A 2P45B 3FO2A 4LQ1A 4LSPH 5FM8A 4D8PA 1U8LB 2D7PA 5C0AE 3STBA 4LGRB 5C0DA 4CUCA 1YMHB 5AYQA 4Y0GA 4WHDA 1QO3A 5DUML 5T3XL 4MX7B 1S5HB 4JG1L 2R1WA 1I9RL 5L88H 1MLCA 4YXKL 3BDYL 1I9JL 1ROWA 4D9RE 4QTIL 1TCRA 5EU6D 2ZCKH 3MLYL 5FHAH 3JWDL 4QT5B 2JIXB 3UJIH 4ALAL 2FEEI 5D2LE 1BVKA 1W2KT 4L8SA 3C8DA 1CCZA 1C7TA 1IAIM 2G5RA 1CBVL 1QFWL 2PO6D 3AS0A 3G6DL 1WBZA 4RZCB 4Z76B 3F7PC 5GS2H 2AJZB 3MNZB 3VA6A 3NTCL 3OB0H 2EDQA 5ANMA 3MRLA 1VEPA 4N0FA 2AXFB 1KJ2A 2NY6D 2IH1A 1SY6H 3ARBA 4WI3A 4HCRL 5H37H 1S5HA 4Z7WE 1EPFA 3JUZA 1M05B 3SBWC 2CR6A 4XNYH 1AY1L 3EYSL 3MACH 2DQCL 1E28A 3DVNB 5DK2B 1NFDF 2D7OA 3D39A 1JZ3A 2DLFL 4OGAC 4EXPX 4IS6A 3AS2A 5LWYL 1JNHB 5F72S 5EZJA 3L5XL 3PF2A 2H9GB 1ETZB 3TZVC 5FYKL 4E0RA 4CJ0A 5ESVA 2X10A 3QIUA 3PWPD 5CEXA 5CEZD 3REVA 1CLOL 2EE2A 2COQA 4OI8A 2O5XH 1DQDH 3U30C 2YD5A 5CSGA 4XCNA 1KSRA 4P2YA 5B4MD 3LY6A 4PJ7F 4I0KA 1DBBL 1V5JA 4KKAC 3MA9H 4M8QB 5GPRA 3T77A 3BP4A 4B50A 1CD1B 3V95A 4UNVA 3RWCA 1KEGL 1GOHA 2OSLA 2PTTA 5FHBH 1KYOJ 2WUCH 4NKOA 5D1QC 2WW8A 4X8JA 5FECB 4J7RA 4KRPB 3CH1B 1B0RB 2M8XA 2R1YA 4GBXC 3HUJF 1IJ9A 3MJ8A 3F7QA 1KEML 5I19H 1WQVT 1U92B 3HRZA 5E9DB 1U6AH 3T8XA 1CICB 4Y4HA 4M7JL 4OLWL 1TVDA 3CGTA 5JPNA 4O5LL 2R56H 1F97A 5KSAB 1IEHA 4G5ZL 4OSUL 3X3GH 2DQHL 5MP6H 5DA4A 1B0GA 1Y0LB 2PYEE 3FN3A 3WD5H 1IC5H 1IAIL 1F4WL 3HNSH 1S3KL 4LFHG 2HTLC 2OS7A 4Q9BA 3QZWA 3MCLH 4POYA 4Z0BL 1XAUA 4WWKD 3BYYA 5CP3H 4Y5YC 2PR4H 4OFVA 2B1AL 3QDMD 1RI8A 2AJVL 3ECBA 2IWGA 1ZHLB 5KJRH 1CZ8H 4UOW0 2Y6SD 1AXSB 3RGVA 3BJ91 5C0IA 5IVXE 2PXYB 4NQXB 1A6AA 3EHBD 1GZPA 1JTTA 3ARBD 4PLOB 5I8KH 1DE4B 4ELKB 2AERT 1GPOH 2VXQH 2AV7A 2DQIL 4HMEA 1S7UA 3S9DB 4F37K 1SBSL 4LGSB 2BSSB 1OTUD 5K9JL 1QQDA 2BNQD 1BWMA 1NGXA 3FRPA 3NZ8B 4KRMB 3VFPA 4LASH 4NRYA 3BDYH 1OARL 2DKMA 2GTWA 4WTWA 1DSFH 1IKFL 5EUOE 2Q86A 2V9RA 1KJVB 4X99B 4YC2B 1BBDH 3AMKA 4ALAH 5I16A 3FO1B 4K3JL 3BIBX 3U7YH 4C59B 3S37H 1OAZL 4PJEA 4XMLL 2YC1B 4D0DA 1PYWB 1AGEB 2X4NB 4G9FE 5D2NA 3U7WH 5DQ9A 3WFEL 5ICZB 2ZOLA 1AJ7H 1XF1A 4OLZH 5LGJB 4R96A 1T0PB 4L3EE 4XCEA 1TZGH 2FRGP 1MWAH 5C0RH 3C5SB 2E7LA 1JHTB 3KS0J 3UTTB 1K2DA 3MGAA 2APFA 3S8WA 3CFEB 3KPMA 1GC1C 3S96B 3SDYH 1R0AL 5DUPH 4PTTA 3DYPA 1T0MA 3TJHD 3DTXB 4PGCB 1FH5L 1FN4A 1PG7X 2X1WL 1MAJA 5DMGC 1UB6A 5EIIB 2O93L 4UQ3B 4AZ8A 1YA5A 3K8KA 5JHLH 3S37L 2RHEA 4IOFC 3MO1A 2B0SH 2H2SD 4QHNB 4QY8B 5FKPB 4HPYL 5ISZE 5BRZE 4PJIF 5CWSA 5DVMA 3MRCB 3ROLB 4BFBD 4KPHH 3FN0H 4UUJB 4HWEH 2CH8A 1JGLL 1HHIA 3GMQB 2YSSB 5EUOB 3QUKA 4HZLB 5F21B 1G9ML 4M1DH 5E2TH 2EIDA 4P2OB 4PYHA 4MQXC 5ELIA 4I9WE 2RIKA 3QHFH 3GJFK 3KPSA 3GMLB 1XT5A 4C4KO 4R4BA 1X3DA 1U8QA 3FT4A 5EPMA 4A6YL 1C5DB 1YDPA 4PJ9A 2IPTL 4JO3H 5IVXF 1J1PL 2F74B 2IF7A 4CVXB 5IW1A 1FNSL 3O41A 1K4CB 3KDMA 2Z8VC 1MRDL 2NY1B 4WEBL 4NQED 1LO5B 1F42A 3SDDD 4J4PD 2JTDA 4ONOA 4IRZH 3O9WB 3QUMA 1RUMH 5CEYB 1QRNE 3MCG1 3TH2T 1FPTH 2IBBA 4LOUC 3QDMA 4PRHD 2NY6B 4WWKB 4YWGL 3GIZL 1MFBL 1XGYH 1XF5B 4OGAD 3SEPA 2EDBA 1W72B 1NCBL 1G6RB 4ERSH 1HYSC 1EBAA 1OPGL 4IDJH 2IC2A 1FFPB 3SDDA 3EFFA 2WWMC 5BJTB 4XH2B 4NSKA 1VADA 2X05A 1NL0L 1QHPA 5ETUB 2X42A 3MNZA 1BJ8A 4Z7OF 4WV1B 3QG7H 2VSDA 1DP0A 1F4WH 1XGPB 4N0CD 5J11B 1LO2H 3X3FH 4G42A 3SKJL 1LD9A 3EYOB 5JXEC 5JIPA 4UB0H 1FFRA 1E0OB 1UADC 4OBSA 1D5IH 5F3BB 5CP7B 3SQBA 4YDKH 1T1ZB 2QADC 5F7YC 4CMHB 5DVOA 4D2NA 3OR6B 3BRFA 1A3LH 4PG9B 4X6CF 4CMHC 4TTDC 4S2SB 4YGVB 3U82B 1L6XA 4I5BB 1QRNB 1X4XA 2JLLA 3BI9X 2VXQL 2LQRA 3PP4H 1I4FB 3CNKA 1WTGT 5I66A 1JYNA 2CO6B 3REWB 4WI9A 2NCMA 4CADB 1CU4L 4QHUA 1OOAA 2X7LA 4HXAH 3UTPD 2PCPB 2DI8A 1J87A 1VKXB 5HDOA 3VFMA 3GIVA 3X13A 3NCJH 5CJOH 3KYKL 2W65A 2FYYB 1P4IH 4LSVL 2YK1H 4HS6A 4ZTOH 5C09A 1F6FB 4H20L 2ITCA 3T3PF 1T3FB 5IVZA 3F12A 1R24B 5ICYB 1DLHA 4P46C 4DN3H 3OXSB 2Y4SA 1I3UA 4LLWB 3U7YL 5I1DB 4JY5L 3TNMB 1HDMA 2VZUA 2BSTA 2OR8A 4OQ1A 1NAML 2KH2B 1NGYA 1FAKT 3KPRA 2F19H 5A2LH 4XCFL 4WWKC 1IGTB 3K1DA 2X5PA 1HXYB 4U33A 2A2QT 2L7JA 3BD4A 3H3BC 1YEKH 3K8MA 3QNYB 5TDNA 3PWUA 5FGBC 1EJOH 1N4XH 1TJIH 1XIWA 1OAXH 4IRSA 2YZ1A 5I18L 3I6GA 2HFGL 4QWWD 4X4XA 2P24B 2UZYB 2DM3A 1SEQL 1MCNA 3AY4A 4PS4L 4Q74A 4QNPF 3HZVB 5TF1H 5D7IF 4JFOA 1QVOB 3BZFB 1PEWA 5F9JB 1C5BH 1MF2H 1KENL 4KVCL 2OK0H 3DXAA 2X4OB 5BZDB 4AEIL 4Y4FB 4X5WA 2F5AL 4FFZL 4PRIA 3MLWL 4O2CB 1HI6B 3WBDA 1H9VA 2CMRL 1G9MH 5E2TL 2F54B 3AREB 3DBXB 4XP1H 4TNVF 2CRMA 1MCOL 5H35A 4F8QA 3VE0A 1D6EB 1CT8A 2YRPA 4MD4A 3BP5B 1QFWH 2OQJA 1DDHB 3QUYC 1QLRB 1NJ9B 5D7JB 4N0CC 2DQEH 4JANB 3V5DB 1SJVA 4YDVA 1LGVA 4XP6H 3TN0B 4G80A 1QLEL 1CF8H 2VJXA 5BRZA 4XXDA 2ID5A 1ZT4B 3PHQB 4ORGB 1ZANH 4N0UA 5DDHA 4I77H 3QUXB 4GSDH 1KN2L 1LO4L 1ZOXA 2ADIA 4XNMB 2RCSL 2FYYA 1KLFA 2EH7L 2L4OA 1JVKA 3OKEB 1QA9A 3ILQD 5EOCH 3N1GC 4IOFD 3GBNH 1HYSD 4P4RB 4ZO9A 4FMKA 4RWHA 2Y9RT 1Z9SA 2B39A 2EIZA 4Y7MA 1MY5A 3MSPA 3UZVB 4UT9L 2Q1EA 1G1YA 2QQLL 4G6KL 1K2DB 4M5YL 4I18C 3KJ6L 4L4TE 1BD2D 1B3JA 3C5ZD 1A6ZB 1CF8L 4ZOAA 2EXYC 3ARGC 2NPLX 2AGJL 5IFHH 1ORQB 4AENA 4HIEA 3PDOB 1F90H 2AKRA 1SMAA 3WUZA 3KPRD 1OM3H 1OSZB 1BX2B 3VGHA 5GGQH 1URLA 1UGNA 3NFPB 4QHLA 2XOTA 3FT3B 2HT4D 1QA9B 1KT2A 5I1JH 2NY3B 4TUOB 4U1KB 4U1SB 4WGVB 4U49A 2LABA 3VFNA 4BZ2L 3ZTNH 5FA4B 5E8PA 4PRDB 4R9HA 1FNGB 2P46B 4P49A 4Z7QE 3QRGL 1HH6A 1IGMH 1A4JA 4FFWC 3L6FB 2CLRA 4MA8H 3O9WD 5E9DA 5HGHB 4PJEF 4OGXL 4E9LA 3SE3A 1T1YB 4JN2B 2D0HA 5DUBA 3ZYJA 2IAMB 5JZ7D 2AKRB 1W0WB 3D9AL 5F8RC 1PG7L 1QACA 4XP9H 1FVDA 4MYWB 5D2NC 2JCCA 4D0BB 4ONFL 3C60C 3UTSB 3GKWH 3WEXA 1U8NB 1ORSB 1T20A 4HG4K 3MRPB 3MGTA 4OUOA 3GUTB 4JG1H 3DBXA 1LEKB 1G7LA 4NN7C 4R4FL 5JDSB 2PTUA 2Z4QB 3ULUL 2C26A 1EHNA 5EBWA 3UC0L 4ZXBA 1XR8B 1NGQH 1RPQA 1TVBB 2H2PD 1DANT 4UIKL 4BQBA 1ND0A 1JGDA 2FB4H 4WRLA 3OJDB 3TJEL 4IIQB 3U0WL 1A6TB 4GXVL 4XI5D 3CFKA 3P0YH 5M7QA 4FQLH 5TDPA 2R29H 1UKSA 5BV7H 3RUGB 4V2BA 1A7PH 2E3VA 1PG7H 5B3NA 5DZLA 1CICA 4Y4HB 1ZT4A 3FOLB 1FVEB 1MF2L 4KVCH 4ZUTB 5IM7B 3BQUA 4M6AA 1KCSL 2DQUH 3ULVC 4YHLH 4XVTL 3QEGL 3D85A 4I4WB 5ID0B 2ZSWA 4M62L 5EUOF 3VXSB 5FOBA 3HZMA 1A5FH 2VLJE 3VWJA 3E3QC 2NY2D 3BPCA 1ZWIA 5FYJL 1MY7A 2D9CA 5FYKH 4GRWH 4PREB 4QHLB 1OGAE 3FT2A 4X9IA 5H37G 1EO8H 3VFVA 5AAWA 1GGCH 4I48B 2GSIB 1RHHB 5K9KA 3LMJL 3RNKA 1DL7H 2V7NA 4LAJH 3KXFE 2EDEA 5LAXB 1IAMA 4DKFL 4KQ4H 2EEBA 4GW1A 3WO4C 3Q1SL 4I3RL 2ENSA 4NM4H 1VENA 3IDJB 2EXYD 1C7SA 3LKQB 3HI5H 1ZANL 4RAHA 3JSSA 1RZKL 4NWTL 3ULVL 1FGNL 3DXAD 3MNWB 2P4AB 1U3HC 1P5VA 4IBLT 3VH8A 1REIA 2RFXB 1LILA 1U8JB 2BP3A 3MV7E 3HE6A 5DR5H 2QKIB 4EI5D 5ALCH 3NPSC 4Z18A 3W2DL 4WIQA 2YEZA 4LEOA 3UYPA 1J0HA 1I7ZA 2PYED 4L9DA 4OIAA 5TH2A 3NH7L 4N1CA 1UJ3C 4LLAA 1U8OA 2OR7A 1S7XB 1T04A 2RGSA 2EDDA 4LCIL 5IB2A 1QOKA 1S7QB 1RUKL 3FMGH 4KQ4L 3VI3F 5EFIA 3MRMB 4FQQA 1OP3K 3CPLB 4JFPA 4PUBH 4XCCH 5IT2H 2OXHA 3P73A 3UTSA 2DYPA 1WT5C 2I9TB 5A2JH 3O3DA 2KBGA 1VACB 4KI5E 1I7UB 1UZ6F 3KLHC 3VWJD 2BC4A 4N0YH 4LSTH 4MNGA 1C5CL 1J1PH 5L2KB 1VKXA 3FT3A 3MBEA 4EI6B 2DJ4A 1L4IA 4MXVE 4GRLD 3OKOB 4HS3B 1XH3A 8FABB 1EZVX 5FK9A 4RFNB 1WZ1H 3QQ4B 3G6AB 4HBCL 4R7NA 2C3XA 3CFKB 2E6QA 4AIOA 4PD4K 1X5YA 3RWDA 5D1QB 3HI1A 3INUH 1NCBH 3IDMA 5DJZA 5I76B 5C0FB 2JJSA 2M1KA 4BQCA 3FB6A 4HUNB 1MWAA 4PB0L 1BVKB 4JRXD 2UUDH 1T03L 1S9WA 1I7RA 1CFQB 1INQA 1JZ8A 1PZ5A 1KULA 4Y8DC 1CDUA 5GQBA 4IJ3C 2EDYA 4KMTL 4GKNA 3L3OA 1HINH 3ARUA 1DQML 1LQSR 4ZUVB 1IZJA 3LB6D 2WWKO 3C60D 1YN6B 2IPUK 4H8WH 1D9KD 3BPCB 2BMKA 5C0BA 2FWOA 3S35X 2OTWA 3RWHA 4FQHA 3QCTH 2YWYA 1H3UA 3S4SG 2ESVD 3MFFA 1C1EH 2GKIA 2VXTL 1BBDL 3QNZB 4X6BB 4NQDA 1A0QH 5E6YA 3VGBA 3IGAB 2JIXD 4OD2B 4JFDE 4OLWH 3AROA 3OKKA 4CNIA 5F7UA 1MJ7L 5HY9B 4ODHH 2CR3A 3H3KA 1PZUB 4M7KL 5SX4I 1CIUA 1PKQA 1LMKA 2AW2A 5KSAA 4JVWA 1DUYB 3GMNA 1CQYA 2DQHH 3DGCR 2WP3O 2Y5TB 5IMLB 5SV3A 5L2JA 2IH3A 3KPQA 5I73B 3V5KB 5KW9L 2O5YH 4MB5A 5E0QA 4JHWH 4JFXB 3ZE1F 1W0VA 5EZOL 2VKWA 3TVMC 2Z8RA 3IKCA 3LSOB 1GGUA 4PJ5D 2V2WA 4S1QL 2IBZY 3C2AH 3TLRA 1DBMH 4Z78B 1Z5LA 1AQKH 3R06A 4HAGA 2N7AA 1BQSA 4NO0B 4PY8J 2XN9D 1U9KA 1SBBA 1QR1A 5KOMC 5FB8B 4WI5A 1SJHA 4G6JH 4NWUL 2DF3A 4ZYKB 3G04B 1BQUA 1GGCL 4WW2B 3WJLA 5I8KL 3UTSD 2ZG3A 3D0LB 4P4KC 4I0CC 3ULVE 4X5WB 3WNMA 3LHPH 3AS1A 4OCYH 3S5LG 4P3WA 1TMCB 1K8IB 3GSUB 2QL1A 1ZA3A 4OGYH 5EZOH 4H0IA 1AY1H 4PJCA 3MJ9A 2DAVA 4LNVA 4A6YH 2CD0A 3C60A 3LCYA 3VWJC 1QBML 1KIPB 4PP2A 4LEXH 4PS4H 4Z7WF 1AFVH 4JFFA 4WUUE 3DV6A 2P5WE 2PYEA 5IB3A 1CLYH 1CGSL 2D0FA 1G6RL 3RVWD 3HE6D 4X4MA 5BCAA 4NKMA 2OK0L 2V2XB 2OLDA 4DZBB 1RUML 1C08A 4MWFB 4NNXB 4NQTA 3LDBC 4N8VA 4P3DB 3SPVA 3WIHL 4B53A 2IALA 4QHMB 4X83A 1S7RB 2DKUA 3FN9A 1DQDL 3GIZH 1L0QA 2JB5L 4RA0C 1JNLL 5HHNB 5CEYA 1F2QA 1SVZA 1NGYB 3KPRB 5J3HD 1MCOH 3FB5B 1KLGB 4MNQE 3CPLA 1FZMA 5DD1H 3VXSD 5IVXA 5C0CA 3BMWA 3DROA 2NY2B 3P3YA 4RZCA 4Z76A 2VO5A 3MBED 1IGYA 3UJTH 3T2QA 1RJLB 3X17A 5C6WH 2AXHA 1IGIL 1XZ0A 5FKAB 4GRLC 3JWNC 1P84K 2DTSA 3ARYA 5ID1B 1B88A 2IPKB 2EXWD 3GM8A 3LAFA 4ONGH 4FA8A 4LGPB 3VA2C 3DETD 5DC4B 2P5WB 3B9KC 1KJ2H 4H1LB 5DD1L 1NUFA 2BNRE 3BESR 3QCVH 3MC0A 4MAYD 2J8UF 4U1IB 1G7PB 5FUOH 5L0QC 3LZFL 1CFTB 1ZLVK 3T4YB 5CAYB 4DWHA 1GGBL 5CINH 5M94B 3IF1B 2DLHA 2GT9A 5HYQB 3UROR 2GI7A 1IAIH 3K4ZA 1UZ8A 2ZOKA 3DIFB 3DV4B 3ZHLA 4O2EB 4OM0L 1MRDH 2VLKE 5IMKA 2XQBL 1VPOH 3ALWA 3P11L 2K1MA 1OCWL 3KPMB 3RUGA 4JRWA 3MMEA 4G8IA 3NFSL 4MNQD 4DKAA 4ZTOL 3D1MC 2AJXL 4M00A 4ORZC 4Q6IA 5C1MB 1VDGA 2R0WH 1MFBH 3QISA 3TN0A 1A64A 1EEQA 1FG2A 1NQBA 4JFFE 4JY5H 2W59A 4WUUA 4E5XB 1F6AA 4XWOD 4I4WA 2IANE 4XBGA 4HWZA 4TQEL 2R4SL 4U1SA 4U1KA 3VWKB 1DTUA 1TTFA 4Z7VF 4FQJL 2JB6A 3MJ6A 4FHBD 4QT5A 2FJHB 1QSFE 1BOGA 1WAAA 2AK4B 5EO9B 4N8CH 2HN7B 2H1PH 3KXFD 4X0KB 2R2EB 1NC4D 3S7GA 2XTJE 1YECL 1CL7I 1R3IL 1ZT1B 5D5MA 2BK8A 3U9PH 1JYXA 4Y5XC 4UV7H 1Q9WB 5IBUB 3RDTC 2OI9C 2QLVB 4UTAH 1U8PB 3CX2A 1P53A 5DFTA 5JOPE 4NBYB 1JRHI 3KVQA 5HYSG 5JQHC 3CZJA 4NCC1 5HHMD 1AGCA 1Q9LA 4GKZB 3PHSA 4EXKA 1DEEB 3T0BA 4X5LA 5DRWA 3F7YA 1AO7E 3STLB 4Y19A 3TV3L 2VMFA 3IJYA 1CFSA 1MEXL 3LRSB 3HE6B 1SEBA 3D69B 2FD6H 2FJGB 3U4AA 5AZEL 2J6EH 2D03H 3ULUF 1IGJA 4HJGA 5DGRA 5ESQA 3WHXA 8CGTA 3TFKC 2NY1C 4X6EB 4CADA 1YEHL 4OGYL 5F7KC 3EOAA 3W81A 3W9DA 1Q94B 3NCCB 5CBEA 3I2CL 5IR1B 3W0WB 3MCKA 4LU5H 4J1UB 1J5OL 4P48A 4OLXL 2YK1L 3HI6H 4V1DB 3WJJC 4H20H 5KS9F 4EUPG 2IEPA 1HIMH 4F3FB 1UJ3A 2YRZA 5FYLL 3D3VD 1BQHG 3CX5J 1QHOA 3MFGB 1L7IH 1RZ8A 2MWCA 3B6SB 4WCYL 1KUMA 2F8VA 2ZOKB 3DIFA 3DV4A 4XHQA 3DRQA 3DWTA 3BPOB 3ZE0F 3D2UD 4NN6B 1T21A 2KUTA 4JKLA 2EXWC 3CDGA 5MENA 4GAJH 4HIHB 1YEKL 3FONA 3CJJA 3UJIL 1GSMA 4YNYB 1KF9B 1FNHA 3QXTA 2ARJQ 3HR6A 4JREB 3RWFB 2V17H 1UWGH 2XTLA 3CSGA 4Q2ZA 5EO0A 3QEQE 5J6HB 2H6PA 5GGTA 1JV5A 1ES0A 4QRPB 5T3ZE 4NSKB 4HWBA 4OFIA 1UYWH 3MV9D 2V5TA 5I17A 1T66D 3U4EA 1A9EA 3E6HB 1YN7A 4FFYL 4ZNEE 1TQBB 3N50A 2V6HA 1F2XK 3IFNL 1CK0H 3GJFB 2YUVA 4HFWA 2A74A 1F90L 3G6JA 2LU3A 3WFCH 1OAQL 3VMNA 1XGYL 4ZDHA 3O3DB 2DRUA 5T33H 4BQ6A 1CXEA 1CDBA 2ATPB 4QRTA 4LIQE 4XWOC 5C08B 3DI3B 4JZJB 3QQ3B 4Z5RB 4Y19E 4OZGB 4NM8H 5EH1A 1D5MA 3WSQL 3CXDL 1IC4L 1U41A 2Q7NA 5F88B 3QRGH 2YPLD 5IHBA 5DK0A 2AK4D 4DKDC 3EDEA 1DBKH 4NT6A 3MOAL 4OZHB 3OKKB 3KAAA 3WL9A 3BEVB 2E7LC 2XWJB 2OI9B 2J3SA 3CFJA 4MDJB 4XP6L 2C3WA 2X9XA 3GSRB 2AXGA 4OZFH 2HJKA 1PW3A 2VOTA 2VDOH 5DQDH 3WFZA 4EI5A 3WIFB 3RPIA 3G08A 3O6FA 4GG6B 1CVRA 4K8RD 4XBEL 4YPJA 3QEQB 5E70A 3B83A 2X4PB 4F7CA 5T33L 4QRQB 1EUTA 5KG9A 3T08A 5CD3B 4CL7A 4G6MH 2R2HB 4YHOH 3VWKC 1NUGA 2DL2A 4P5TD 3MRJB 5E8EA 1F4YH 1YNLH 3ROOA 4LCWE 1AQDB 4X80L 4ZOCA 2XY1A 5MENE 4Y5VC 3DETC 4JREC 5HHPB 1XIWB 3MLXL 2I24N 2GTZA 1VEOA 1LK2B 3RVVC 4FQ2L 4K07A 5DQDL 2R23B 1J11A 3LH2H 4AH2B 3LPGA 3QEQA 4WFEE 3S6CA 5BJTA 3FO2B 3MV8E 4KMTH 1RFDH 4J3VA 5GGVL 5JW4M 1HINL 1N2RB 2ADJA 3L5HA 4R4NC 1I9RH 3FOLA 4Y5YA 3L9RA 1JYWA 1JWMB 4OCNC 4JDTL 4U6XA 3CMOH 4MS8D 3QIWD 2CKBH 2XA8L 5T1KA 5IEKB 1I1YA 1A7OL 1QZ1A 1C1EL 4N0UB 5BVJB 2BVOA 5H2BA 3CUPA 4HF5H 1HXMA 1HHJB 4JR9H 4CMMA 5I1GL 4NGHL 2X4QA 1H8NA 1OAXL 1JK8A 4NQCB 5KANI 1X5IA 1SJXA 1GOGA 3I50L 4ONHA 1OF2A 3CSYA 2D4DA 5MERA 3HNVH 1WIUA 4ODHL 1U95B 2MJWA 4K3HA 3MBXL 3D9AH 2NW2B 3QIWA 3G5YB 4LCWB 1GPOL 3FB6B 3OJMB 3BYTA 1ONQB 1LWRA 1RFDL 5GGVH 4ONFH 5DVLA 1XGPA 4KGJA 2H3NB 4KJQC 3VXUD 3MGTB 4HCRH 5IW6A 3O0RH 4Z0XA 1X5LA 4K94H 2B2XH 5DRXB 1GXEA 5TJWK 3BAEH 2C7UB 3O6KL 5F7NC 5E8NA 1LP9F 4HH9A 4KV5F 5ALCL 3QAZB 4JFFD 4L5FL 3ZE0E 5H94B 1UEMA 3WJJA 1OL0A 3CVHL 5HSFA 4LSPL 4W6WB 3VXRB 5SWZE 2QSQA 1NDGA 5C9JA 1A7PL 3GZKA 1NCAH 3KYMB 3GRWA 5I1IL 1JN6B 1TZHA 2XXCB 3LRGA 1HHKA 4K8RH 3IFNH 3QIUD 5IB2B 1AGBB 2IBGA 3LEVL 4WTXA 4Y4FC 5L88L 5K33A 3QQ9C 3U9UB 5DJAA 2IQAB 3IETA 3TNNA 2A74B 4JKWA 3T0EA 3WFCL 4CU8A 3V4PL 4IDLA 1RJZA 1QSVA 2I9TA 4KAQH 4YHPA 1EHLH 2Q8AH 4DFHA 4R2GC 1D6VL 2XFXB 1A6WL 1H3WM 5D5MF 4HPYH 4Q6IB 4AT6B 1KB5A 5I8CB 1S8DA 2YPLA 3QULB 4XPBH 5A3IC 4O4YL 2GTZB 3VI4E 3HPLB 1DBKL 4WU5B 4U6XB 3RP1A 3T0WA 3HNTL 2A6IA 3V7MA 3WFBL 1AHWA 4L8SB 4HGMA 5IV2B 1OVZA 4G6KH 3VU2A 2PO6B 2GSGA 2AAVA 4BSWB 3KWWA 2ZPKH 4HIIA 4XNYL 3I75A 4KZDL 3T2PA 5F9WC 4JQVA 2D7TH 3OKYA 1QYGL 3MRQB 3DROB 2ZCLL 4M6OH 3VXRE 2MQ3A 3SKUD 1RQ5A 4G6AC 1HOCA 4JKKA 3CFEA 3O4OB 4HUKB 1KG0A 3UP1A 1ONQA 1U8NA 2NXZC 5BVPL 4AY0A 4EUPA 1A8JH 1FBIL 4H5SB 4MS8C 1S9YB 3TA3D 3FQRA 2PR4L 2H2PC 3RFZC 4HD9A 4P2RE 1T2JA 3FO9A 1RJYB 2X1OA 5CILH 3SGEI 4RMQA 2VLRA 2V5RA 5FO8A 1RK1A 3QDJA 3MLXH 2ZPKL 4MDIB 5LGHL 2Y6SC 4QRUB 3D69A 4JRXA 3IS0X 5FUOL 1G84A 5TDPB 2WBJC 4R7NB 4XC3L 3SE9L 5L8JB 4CNIB 2KDGA 5DMKB 4RA3A 1H3VA 3ZT7A 4PGDA 3KXFA 5CGYD 2VNCA 5D2LB 2ATKB 1UH3A 5E2UH 5BW7A 3T8XB 1HEZB 3X3FL 4OD1L 4ETYA 3ULVD 2EIEA 1WC7B 1IM9A 5FXCH 3TBTB 3HMWH 2APXA 3HLAB 4L9LC 1CE6A 4DW2L 5C0GB 4UB0L 5E6IC 1KB9J 4LHUA 4RFOH 5TFSL 1UG9A 4GRLA 3FQRB 2FR4A 1P4BH 4JGJA 4AENB 5GGTL 3DUHA 1P2CA 2GK0A 4ZQKA 5JXEA 1C12B 1T7ZA 1Y6MR 1OAZH 3V8OA 2IH1B 5DVNA 5DJCA 4L8SC 4U6TA 4O5LH 1ACZA 2P8MA 3RKPA 1U91B 5EG6C 3MV8A 1RZGA 3MROB 3NMEA 5SWSA 2F8OA 1A4JB 3QIUC 5JA8B 1CGYA 4U4BA 5DD0L 3C6SA 1I9JH 2NX5E 5IQ9A 4XX1E 4JRYD 5I30L 2Y72A 4G8FB 2PF6A 4LKCB 3RIFK 4XH2A 2NTSP 4HWBH 4X4XB 2FR4B 1DCLA 3L3JA 4ZUSA 4DAGL 1S8DB 4W4OA 1T83A 1XGQA 4JY4B 3GI8L 2NY2C 3QZWB 4D94A 4H25A 2H32A 4LRNH 4MA7H 2B0SL 2H9GA 4XRCB 3WLWC 1RZFL 3KPSE 2AQ1A 2VLLB 2V2WB 2DMCA 2GIYA 4HWEL 4OZFG 4AEEA 1H5BA 5GGRB 2QQNH 3CVIH 1C08B 1OW0A 1N64L 3ZZ1A 5IB1B 1II4E 2VDKL 4HBQA 4ODWA 3IJHB 5I1KL 3CFCL 4OTXH 2EIZB 3T2OA 3IDIA 1VGEH 1WZMA 1OARH 4JZOB 4N0FB 4G8FA 4LKCA 3UYRH 2GJ6E 1C16A 1RVFL 2BNUB 3HI6L 1OWRM 3OHXB 4JM2F 4PRBB 1NGXB 2ICEA 3REWA 3ARDD 4AM0A 3EYUH 3M8OL 4XTRC 3PGFL 3GMMA 2OSLB 1YEIH 2PTTB 1IGFH 1YYML 4IRZL 4EVNB 4HUUB 2RFXA 2D7QA 3QAZC 4W68A 2NX5B 4F33A 4Y4HD 5I6XB 1P5UA 5FIEA 4RSVA 2BMKB 2QQNL 3DO3A 4OJFH 4KKBC 3LPWA 2BRQA 3QDGE 4BFGA 4Z7VE 1L0XA 4ONGL 4L8BA 4XP1L 3SDCC 3TA3B 4XVSH 3UPRB 2R2CA 1Z3GL 1OPGH 3KWWB 4HIIB 3O3EA 1ZHLA 2IANB 4IDJL 1NMCC 1EA9C 2UWEF 1MSPA 5GGRY 5HHOB 4TSBH 4QXUL 5I0DA 1PDKA 1FC2D 2K9UA 2BHZA 4LSTL 1DR9A 2AK4E 3RVTD 3ULUD 4FFVD 3QG7L 1NBVL 4DGVH 3ARDA 5FHBL 4NBXB 1JF1B 2IH3B 3KPQB 3VGAB 2J88L 2YUWA 3QIBA 4ZPTB 3UAJD 5CCKL 2IALB 1JGLH 3B9EA 2R0KL 4XMKL 5KBNC 4LARL 1BLNB 3ZDXE 4G6FD 4QRRA 4WVRA 4TQEH 3B9DA 4HKBB 1F02I 1NMAL 2GAZA 2I26N 1YPZB 1B0RA 2R1YB 2YSSA 5BV7B 4NM8L 4M02A 1NFIA 4C56A 1H8SA 4QOKA 1IL1B 2DKSA 4NRXB 4YGAB 1OP3H 4U05A 4NC1E 1EJ6A 4ZODA 2A1WH 3RTQB 2BSSA 2DICA 2FZ3A 1HILA 1YEJL 4YXLH 1DBJL 4JO4H 3NCJL 5AAMA 1RZIB 3I85A 1D5ZB 1OD7A 1QSEE 2D31B 2ZNXA 3VFUB 4V1DE 4JZOA 2I07A 4OCRL 5KJRL 1A21A 5I8EA 4Q9QL 1MI5B 3VXMA 2FHCA 4MA1B 2WUBL 1TETL 3W82A 2EZ0C 3FFCD 4KTYA 3TV3H 2DL9A 1S9VB 4CDHA 1MHEA 3SY0A 5F1NB 1AGDA 4K23H 1I1AC 3TH4T 1E6JH 5CBAA 3V8CA 4L3AA 1IGML 1XGUA 3BKCH 1FYTA 4IMLA 2IJ0C 4C55A 4PY8I 1WJ3A 5HHNA 3MJGX 4JZJC 4B5EA 3P11H 2YWZA 3K1KC 4HJGB 5ESQB 1T22A 3DXAE 2ZUQB 3PL6C 4MAUL 4K94C 1ZLWK 3IDGA 3KPLB 1M6OB 1UXWA 1U8HA 4FS0A 1VACA 1CXFA 1E4KA 4DAGH 3X14B 4QXWA 3AXLB 3BWAB 4Y4KB 3MUGA 1F4XH 3S34L 1L7IL 3P4OB 1T6VN 4A2MA 1MPAH 2CXKA 4XTRD 4LCCA 1AR2A 3O41B 2C1PB 1MCFA 3ZKNC 4HW6A 5IIEB 2ZG2A 5DHVH 5C0RL 4FFZH 3CZFB 3ZYZA 4YDIL 3C6LD 5D7LD 4HWUA 3IYLW 1R3IH 2XYCA 3PWVA 4Z6AT 4HIJA 1AGEA 2X4NA 1I8KA 1MI5E 4UNTA 3UEZA 5BOPA 2HH0L 2RAMA 4ZS6D 1VFAB 5FDYA 4RNRB 2EYSB 1JBJA 3QI9B 3GNMH 5CJOL 4E42B 4FQLL 1PEZA 1FV1B 2DLEA 3E8UL 4JG0L 1DVFC 1UFUA 4MMZC 1LE5A 3O4LA 1NEUA 2C4XA 1X5FA 4KUCF 4LVNC 3ULUC 4Q2ZB 3QI9C 3KPOA 3ULSA 3ZE1E 5FUZL 5JR1H 3HG1D 1RULH 4PJCB 4NZUL 4RGMB 4XZUB 3EYVA 1I8LC 5A40E 1NC2B 1IILE 2XZQH 4P2QB 2BC4B 4JQXC 3VRLF 2ZUYA 1JPGB 5D1ZB 1BEYH 3FQXA 2HRLA 5D70L 5GRVL 3UAJC 3QUYB 5A2IH 1MCWM 5BRZB 5C6PB 1S9XB 2Q7YA 5BS0A 5IFAH 5IVOA 3B9KD 5FK9B 3RAJH 3TC9A 5J3HC 3IDUA 4RAUB 4UI2A 1I1YB 2ARJB 4QHMA 1I7TA 2GITA 3N85L 5FDWA 4UAOB 5IHZA 1XGRA 1N0XL 1FNSH 2DQJH 4NHCH 4R96B 1NBVH 2K3TA 4G7VH 5FGCE 3MOAH 4OKVA 1RY7B 5MERB 1D6EA 1YUHA 2OJEB 4WEBH 5CBAB 1EFXA 1I4FA 3UBXI 5I71C 3MRMA 5DA0B 3B5HA 3ZDZE 1S7WA 2UYLA 3HS0A 4DCQA 2H6PB 2EICA 3TN0C 1JPGA 4QXGL 4G8IB 1HWHB 2R0KH 5HVWA 2Q76B 4R6UA 2UVEA 5CP3A 1SYVB 4XPHL 4XVJH 3UTQB 3ARDC 2A6DB 1EEYA 5C09D 3BRDA 1D6VH 4P5MB 5LJYH 3UXFA 2HKHH 3V6BR 4DEPB 4YHZH 2YPVL 1GGBH 3RL1B 2G60L 3ZSSA 1CLOH 4GMSL 3LRHA 4R7DA 1OQXA 4BKLB 4UDUA 5DYOB 4F57L 3BP6B 3RTQC 3RWDB 3SDCA 4YXLL 5F7DB 2EKSA 2FSEA 5AUMA 3TO4A 1V3KA 3D48R 5JHDE 5BS0D 2GSIA 4JVPA 5K9KB 3QZWG 5DO2C 1UC6A 4YQXL 1W0VB 5D9SA 5HVFB 1IMHC 5KVMC 1HDMB 1ZHNB 2EDOA 3JV6B 3IRZA 1LEGA 1Q1JH 4Y16C 3WUWA 4NNYA 1MRFH 3CMOL 2CUMA 3W11C 1ITCA 1CFSB 1ZHBB 4UU9A 1H3GA 5IG7B 1N8ZA 4YH6A 1FYHB 4I18A 4JJ5B 2DQFB 2QQLH 1KYOK 3RGHA 1KCVL 3MXWL 1T1WB 3KJ6H 2Z9TA 4WTZG 4D0DB 2EYTA 1OW0C 3QIBC 1GIGH 2DBLL 3QDHA 1MCIA 5JOPD 4PB0H 1H5BC 3V0VA 4RFEA 1NDMB 4BSJA 3WKML 4LK4A 1BD2B 3C5ZB 4FQCH 2XY2A 3OB0K 5FAAA 3E6FB 3BQUD 1V8HA 1QD0A 2Z91B 1EK3A 4BZ2H 3JWDC 3TBSB 2UWEB 2XRAL 5C0GA 5HYJB 3BGMA 3CZFA 3O6KH 3BP4B 1YEEL 2B1AH 1JWUA 2VXTH 2W1NA 5JW4N 5C07E 4JPIB 5BRZD 2HLFD 3DI2B 4JFHE 3U46B 4JN1H 4RGND 5IJVB 4L4TD 3BMVA 3QT2A 3QHZL 4CU6A 4M7KH 2X89D 5LQBL 5GSRA 3OXRB 3W9EA 2A0LD 1OWWA 5EO9A 1FSKC 4QRPD 1SBSH 5ACMA 3K4DA 3B2VH 3WDJA 1UH4A 4GLRI 1ZLWH 3SDAD 1IZKA 4NC2B 2DIJA 4M8VA 1K9TA 5D7IA 3PE9A 3KLSA 2NR6D 5FA3A 2XA8H 4OFPA 3V4PH 4EDXB 2DDQL 3BOVA 3BHBB 2JK5B 2BDNH 4GRWE 4EN3C 5T3ZL 3SCMC 2ZUWA 3RAJL 4N1HB 3WHE1 1K4CA 43C9A 1YQVL 2F54E 4KKLC 5CS7A 1K6QL 2WLZA 5DT1H 3NFPA 3AY4C 5ID1A 4KK6D 2WBJA 3SKOA 3BO8B 1NGPL 1R3KA 2O5XL 4G7VL 4FZEL 1R3HA 4CKVX 3IT8D 2NXYC 4HC1A 5L8KB 4WU5A 3B2UD 4KY1H 3D18A 4FZ8H 5EIVA 2QSCL 4U31A 4QTIH 5CD5C 2E6PA 1DVFD 1RVFH 4KRPD 4LEXL 4LSDA 2NY0D 2P24A 1FZKB 1A5FL 4G9DB 3IU3A 1BHGA 3C6SB 1N59B 2A83A 4NO5B 5FYJH 3FQUB 3U2SA 4BH8A 4PGBA 1D5ZA 2I9LA 4UT6L 2P8LA 3CVHH 3JV4A 3GMPB 4LLDB 4UNUA 2C3GA 5DUBB 5T5NG 3FFDA 3IFLH 5IEHA 2BOCA 2GY7B 4L9LB 4UOJA 1Y6KR 3SE4C 1SY6A 1WTLA 2BXZA 3RWGA 1U8IB 5IVNA 3TP4A 4O2FB 4Y1AA 5DSCA 3MRPA 1F45A 5E99H 1HHJA 4JB9H 1FGVH 5DJ6B 1RZKH 1B9ZA 4GBXA 3SKMB 1A7BA 5GGQL 5CIPA 2G9HA 2Q3ZA 5DR5L 1IQWH 5DLML 1QR4A 1JGUH 3K3QA 2V2TA 3W2DH 3HNSL 2Z8WC 2Z31B 2VDLH 1A6WH 2Y7QB 1IBGL 3U4EB 4JE4B 1GHFH 3H9SE 4WEUD 3OGCA 5TFSH 1KELL 3SE4A 1KIPA 2IFFH 3MRIA 3TO2A 3FQXB 5IJVA 3L3DB 4EVNA 4S0TD 2HLFC 4XNZB 4Y4KD 4EIGB 1Q9OA 3DVFA 3QJHB 2ATPA 3WXWH 4U1LB 3FOMA 3VXMB 5J56B 2X70A