2DMBA

Solution structure of the 15th filamin domain from human filamin-b
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
124
structure length
124
Chain Sequence
GSSGSSGTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Filamin-B
publication title Solution structure of the 15th Filamin domain from human Filamin-B
rcsb
source organism Homo sapiens
total genus 9
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dmbA00
3G6DL 4PJDB 4PLKC 3KPRA 5KTEL 3ZLQC 5JQHC 1LO3L 2XV6B 1LEIA 5EU4A 1MWAH 1KCVH 3DROA 2APWA 1NGYB 3LEYH 5D6CB 5ADOL 3TN0A 1DQQA 1C12B 1GHFL 1BOYA 4XMKH 4OF6A 4DQOH 4XNZC 5EOCH 1AD9B 2BDNL 5C6TL 4F9PA 1T80A 1N7MH 1MCOL 5F1SA 1WFTA 5TQ0L 3TWCH 3QI9A 5MENA 4M93C 3IDUA 3HZMB 3SCMA 3DXAB 3EFDL 3JWDL 1MJJA 1LD9A 3KVQA 4R3SB 2O61A 4NRYB 1QSVA 5AYUL 5D2LF 1QKZL 3P4MA 3CH1B 2XFXA 4DUXA 5I1LB 5J12B 2IH1B 3MJ8A 4GQ9L 1S7SA 3V9FA 5EG6C 4EEEA 3QNXA 4KV5F 2VDKH 2B2XL 4KI5E 3QCUH 4XX1G 1TMCB 1J8HE 1D6EA 3EOBA 3FB8B 3S98A 1Y18A 4QRRE 2BOCB 4UU9A 4XHJD 1UCBL 2A6JB 1RUQH 1INQA 3CLEL 2VITB 3BHBA 2FX8H 1HIMH 1BVLB 4LL9A 5E8PB 5TE7H 2UV3A 4XC1H 1GOGA 1JNHA 3PP4H 4K71B 4KUCD 3STLB 8CGTA 3ARSA 4JKPL 4DFHA 5GZOD 3ROOA 2XPGB 3L6FA 5ALCH 4RFOL 4LLQB 1HQ4B 2HRPL 2Q7NA 4YPGA 4IHOA 4JFPB 2MMXA 1G0YR 4ZS7L 4Z18A 1ZLUK 1V7ML 4Q6YA 3SE4C 4GG6F 2R2BA 1YDPB 3H42H 4M1DH 3C5SA 2A1WL 1TQCB 3HRPA 4GFTB 5D2NA 3Q5TA 4NJAL 2ZOLB 1EHXA 3P4OA 3CFBB 4LLMA 3REWA 1MHHA 5D7LA 2FRGP 3VDCA 3I84A 4P4KC 3O8XB 1MJ8H 5GGRY 1IKFL 4JE4B 1G7LA 5H35B 3QXVA 3MRLA 4LHUB 4JFHE 4GBXA 3NPSB 5HVFB 3CFEB 4H5SA 2DL9A 4YE4L 2AXGB 4JRXB 3KR3H 4U6VH 1NBYB 5F9AC 3G5XA 3MJGX 2YD5A 1IGCH 3MV9D 2R23A 4HAFA 4JY5H 4TVPL 4JJ5B 1KNOB 1OPGL 3G6JF 2DQJL 3A6BH 4DW2H 3G5VA 3WNPA 4HUUA 3EDKA 1LEGA 2XA8L 1UM5H 1S7QA 3VU2A 4RFEA 5IQ9A 4OQTL 1NEUA 4KAQL 3S4SA 5FO8A 2C7UA 1U92B 4G7VL 4PJXB 3KPSE 3L95B 4PJ7A 1DUZA 2FX9L 3NCEB 3BVNB 4Q74A 3D5OF 3IJSA 4GAJH 1MCLA 1NCDL 3I85A 4QRTA 4L9LB 2Y9RT 3V5KB 3CX5J 3TVMA 2DDQH 4P4RA 1S5IH 2WP3T 3SBWC 3TCLB 1JPSL 4XB8A 4OI7A 3BPCA 4AZ8A 4LQ1A 5CZVL 3MNWA 2BRRL 2V7NA 4FNLH 4RGNE 3OKDA 2DM2A 3KYOB 3RNKA 2PCPA 5FYJE 1J5OH 1BX2B 4KU1A 4R96A 2B0SH 3B9DA 1TDQA 1S8DB 3KPRE 3JWOC 3DX7A 5HYJA 1ZXQA 5E4EB 4ENED 2BXZA 2ITDB 4HC1L 5D1ZA 1EH9A 1KN4L 2WINA 1C08B 5FGBC 2CO7B 1IGYA 3D18A 2ARJB 2EDHA 4ONHA 3F7QA 3JZ7A 3S34L 5D96C 5E95B 3UC0H 2VMFA 2QHRL 2Y6SC 3MREB 1T89C 2GTZB 1H3XA 1NAMA 1NLDL 3GHBL 4XBEL 2BRQA 5CSGA 4OBRA 3RY5A 2D7QA 4XZUB 4I2XB 1S7UA 4S1DD 1TXKA 5J57B 2BVOB 5CSBA 4HIHA 3RI5F 5CLWA 4JGJA 1HSBB 4QLRA 1A6UL 3QUZC 5I1DA 2VZVA 1I8KB 4KK8C 1K4DB 4HUXB 3MX0A 2NY5C 5CP7A 3O6LL 4OD1H 2PW2B 3MYZA 5FYJH 4LDLB 4P48A 4WTZG 2NR6D 4CN1A 3UBXI 3VXOA 2F74B 2IMNA 3JVGC 3UZEA 4KHTL 4YHZL 2GITB 3DI3B 4HG4K 3PHQB 3ULVF 1ZWIA 5TH2A 3BP6A 4K9EL 2L7JA 4JKLA 3CLFH 5B39B 4U7SA 1FYHB 1M7IB 2BSED 4GUPA 3AAZA 3KDMB 5GIRB 3FOLB 1QRND 3HE6B 3U48A 2FL5B 2X41A 3MLWH 3OR6B 2VKXA 3RL2A 5HI3D 4XWGH 5ACMA 2VLRB 5HGGS 5CHNB 1IEHA 3LPGA 3HI5H 5E70A 5HYSB 1U93B 5EPMA 3BEWB 1FL3B 4G8GD 4J3VA 3GMQA 4K7PX 1CXFA 1KB5B 3D25B 3J8F7 2OK0H 4RAVB 1HHGB 4OF5A 5F7UA 5CJ5A 2VAJA 1UWGL 4KKBC 3TFKC 1INEH 5DXWA 3RKDD 3QIUA 5DSCA 5HHNB 4PJ5E 3KYNB 3GSNB 1P2CA 4TQEH 2BNQE 3OJDA 1MQ8A 1G7PA 2YBRB 3LN4A 4P23A 3MRCB 1HHIB 3W5NA 3P9WB 2UZIH 4X98B 3LQAL 4RMQA 5LCVL 1JRHL 1MHCA 1HI6B 4YNYB 5FK9A 5HHMD 5GJTH 4LLDA 3I2CH 3C08H 3SKOB 4N5EC 3GSRB 4L3CB 3L3JA 4URTB 2X9YA 4N8VG 1I7ZA 4U1HB 5EO1A 4PJ7E 2NY3D 4OLXH 3IU4L 4P9HH 5AD0B 2CKBH 4U4BA 5C7XL 2F53D 3CVIH 3JXAA 2AEPH 4YGVB 4HKZA 5HYIA 1K85A 4B41A 4L3EE 1PBYA 1LEKB 2ZUQC 1BD2D 5I74B 3MLUH 4JZJA 3EYQD 2XWJB 4XHJC 1TJGH 3NACH 5L2KD 4H88L 4OGXL 2X4TB 4ZUUB 4IS6B 2ENYA 2D4DA 2J12B 1R3IH 5IMMA 5ABDE 4P49A 3IDGB 4A6YH 5C0AA 3IFOA 5DUMH 4G8EA 3I75B 3AS0A 5EU3A 3TEUA 4JHWL 4LPUA 1TVHA 4XP5L 4NN5B 1T2QL 5GZOC 3EOYG 1QSFE 3VCLA 3L1OL 4QKXB 5J1AA 1PY9A 1P7QA 2PW1A 4D2NA 1JMXA 4JAMA 1Y6MR 5DZOA 4XAWL 2DQDH 4ONFL 3TBWB 3KS0H 1EK3A 3BDYL 1NSNL 2EDTA 4WEBH 4HIJA 4MA7L 2EE6A 2J8HA 1MEXH 5C08B 1VERA 4DKFH 4GS7B 1DQMH 4EVNB 3UBXB 3BGAA 4NDMA 5FGCE 1E6OH 4TUOB 3HB3D 2YMXH 2BFVL 1CGUA 4PJDA 2DJ4A 4XVTL 3OXRB 1OTTD 3O9WB 4Y2DD 4S1QL 4WFED 5IFHL 1NGYA 3PUCA 5D6CA 1A3LH 1OAYH 5I1CH 1DQLH 1UYWL 4NRZB 5CBEB 5DVLA 5GGSY 4Z7VF 3BGFB 4MNQE 4YGAB 1X4YA 1NDGB 4GLRH 4NQXB 4HXAH 4UTBH 4NQCA 3HZMA 1FO0L 4M9PA 3DXAA 4R3SA 3GMLB 2J88L 4NRYA 1PQZB 5BXFB 2OXHA 3CH1A 2OMNA 1E28B 2RIKA 3HUJB 5I1LA 5BV7H 4FQXB 2G5BB 3QDJB 2IH1A 1EEYB 4U1NB 2HA1A 3LS5L 4OIIL 1BQHG 4LIQE 3ARPA 3WO4C 2YA2A 5E9DE 3I50H 3F7PC 4G42A 4LEXH 3WIHL 3AM8C 2P7TA 2ZCKH 2FEDC 1PW3A 2BOCA 2ERJC 2A6JA 2OJZH 4P3CH 5E8PA 4GW4B 2D0FA 5BZDB 1NCBH 2XT1B 4LAQL 3STLA 1SJXA 1CYGA 1ZMYA 1AXTH 1CLOL 3GMMA 2XPGA 1D6VL 1MELA 4LLQA 1HQ4A 3MGAA 1U8NB 4J3TA 1G7MB 4OQ1A 3QA3B 3AMLA 2OM5A 4EI5D 4ENEC 4JFPA 4N68A 2CXKA 5T3ZE 2XQBL 4JFFD 4TN9A 1YDPA 5DTFB 4MJ4A 4AEIL 5GGQL 3RTQB 2Y36H 3OG6B 4XBPA 2AEWA 4BSWB 1EMTH 4QXGH 2ZOLA 2AEIT 4LIQH 1C5CL 3CFBA 3K81A 4P2QD 4D9RD 3VG0H 4JVPA 3O8XA 3TIDB 3ULVL 2HN7B 4LHUA 1T5WA 1NUDA 1VFOA 1NC2D 3CFEA 3H0TB 4S1DC 3V7AE 3U36B 2AXGA 4JRXA 1YNLL 1EO8H 1NBYA 5F93C 3BJ91 4DTGL 1ZK9A 3LB6D 4JJ5A 4OZGB 1KNOA 2CK0L 1YPZF 3VRJB 3FN0H 2FO4B 1AKJB 2YXMA 4Y19B 3QZWG 4Y5YB 3BI9X 3QEGL 4N5UA 4XPBH 1RIUL 3CC5B 4OZHA 5D71L 2NR6C 5F6HJ 3T1FB 1U92A 3H9HB 4PJXA 4NUGL 2L0DA 3L95A 1F6FB 5L8JB 5E08L 3VFRB 5C0AE 4LVNC 5T3ZH 3BVNA 4DN3L 4J8RB 3S37L 1ZTXH 4L9LA 5L0QB 2H8PB 1ZANH 4UOW1 4KVCL 4LSPH 3TCLA 4X4ZA 3SDYH 3K1KC 1VA9A 2VC2H 4PGZA 1W72L 4R4FL 4HT1H 1I7UB 4U6XB 3LY6A 1A1OA 4ELKB 3QIBD 5F1KC 4TSAH 1H8OA 5T33H 1F90L 2F19H 5D7IF 1BX2A 1X5AA 3WJLA 1ORSB 4PJDE 1S8DA 2IGFH 3UDWC 2G75B 2P5WE 5F70A 1INDH 4HPYH 2Q76B 2ITDA 3OB0H 5HJ3B 4LNVA 1IZKA 5FO7B 1C08A 4KJQD 4QRPB 2ARJA 3S97C 4Q9CA 4Z7WB 5EU6E 3EO0B 3NABL 4NQCE 1D5IL 3MA9L 4U1GC 4PB9L 4DGYH 2OZ4L 5CEXB 4XZUA 4QTHB 2C4XA 1U0QA 4I2XA 3WIFA 4OZFG 2NY3C 5IQ7L 2BVOA 4WHTB 2J6EH 4TSBH 1F2QA 4YBQC 2DTSA 1DN0B 1HSBA 2D2OA 2ZCLH 1T7ZA 1TZGH 2F8XC 1I8KA 2X1OA 1FPTH 2QADC 1JZ3A 1K4DA 4HUXA 1MCPL 1J1PL 3KLAB 3PDOB 4JQIH 2PW2A 1FSKC 2X05A 3EYQC 3QWRA 4HIXH 4R26H 4E5XB 3EYUH 1P84K 2ICWJ 5T1DL 1C1EH 1U8JB 2F74A 5EZOL 4X9BA 1Q0XH 4J3WA 4D3CL 2GITA 2UWEB 1FFOB 3PHQA 3RBGA 4X83A 5LAXA 2X4OA 1OP5K 3RZCB 3BH9B 1AE6L 2VDOH 1BAFH 1M7IA 2XN9B 3KDMA 3JUYA 1QYGL 4XP9H 5GIRA 3FOLA 3W11D 4PP2B 3HE6A 2FL5A 2ICCA 3OR6A 4PJCB 1FZMB 5KS9B 4HKBB 5HVGB 5DMJB 2VLRA 1CT8A 4XPTH 4DN4L 1C16B 5HYSA 4K3EL 1U93A 1ZLSH 5JIPA 3BPLC 1YEKL 5LGJA 1JWMB 4XBGB 3WLBA 4HJ0D 1FL3A 5BOZG 4DVRH 3RIAK 1YQVH 3D25A 1EXUB 3HB3C 4NC1E 5HDLA 3FB7B 3MV7D 4BQBA 2ZCHL 5TF1H 4U1LB 2IJ0C 4UDTB 5EU7C 1OTTC 4Y2DC 5HHNA 4XNQB 1HH6B 3KYNA 1K3ZA 3GSNA 5EWIL 3TBSB 5DGRA 2YBRA 2YK1L 3MRCA 1HHIA 4U31A 1ZEAH 3STZB 4X98A 5H2BB 2HMID 1QBML 1HI6A 2VH5L 4YNYA 4OZHE 4ERSH 5CAYB 4P9HC 4ODBD 3GSRA 4L3CA 1AC0A 2YEZB 5DQDH 2B4CL 3MRFB 4PJXE 5C1MB 4U1HA 4MMZC 1L9NA 4JR9H 4QHKJ 3RVXD 4X6CB 5AD0A 2Z0BA 3U30B 2FH6A 1EGJH 4XAKE 3DHMA 1FLRL 2CR3A 2NNAB 1W0VB 4E42B 4K94H 2CJUL 3QDAA 1LEKA 5C86A 2R29H 3VXUB 3CFCL 2XWJA 1J0JA 1EO7A 4E41B 1BREA 4PJAF 2X4TA 4ZUUA 4PJGA 2VE6B 1IAIL 2XNAB 2EO9A 4UAOB 4M7ZB 2ZPKL 3IDGA 4POUB 4U1JB 3D1MC 3I75A 1MUJB 1UM6L 1FN4B 1JPFB 3DUHA 2NY2C 5KSBF 4MD4B 1U6AL 2Z8WC 3D85D 3GO1L 2X5PA 4G6KH 2RCSL 1RZFH 3VWJC 1U3YA 5ITFB 1CDBA 2JTDA 3X14B 1P53A 2RHEA 1CGSL 2FHBA 3EFFB 2QSVA 4EVNA 1UEMA 5JTWA 5MI0B 4M4PA 4L1HA 3UBXA 4B50A 1GIGL 1LILA 4X9IA 1LE5A 3HNSH 2NXYB 4TUOA 2OTUB 4BZ2H 1BP3B 5D5MB 4JM2F 1KULA 1F4AA 3BESR 3OXRA 5FUCE 3O9WA 3HE7D 1KEML 1MF2L 3E3QE 3LQMA 5JXAH 1MJUH 3G9AB 5I1KH 1I1AB 3QEQB 4NRZA 4KRPD 3WKML 3LB6C 3B9KB 4J3XA 5EIIB 2F54D 2EDBA 2DICA 4OTXL 4XCYB 1NDGA 4Q9RH 6FABH 4JHAL 5DR5H 4NQXA 5IBUB 3RGVD 1IEAB 4KDTA 4NGHL 3K4AA 4LSQL 4U7MA 3GMLA 1PQZA 4U3XA 4Y5XC 4IOFD 1E28A 3HUJA 2L4OA 2G5BA 3QDJA 4FQXA 1EEYA 4U1NA 3GKWH 5DWUH 5KAQG 3PABB 4NO2B 4BFIB 3LKRB 4NQUA 2X09A 1QNZL 4IRSB 3NCBB 2DMCA 2QSQA 3QISA 1HZHH 3QB7C 3DARA 5IMKB 3N85H 4NZUL 2ATPB 3O6FD 4GW4A 1CDHA 5AZ2H 1OSZB 1AJ7L 1FNGB 4FQCL 5BZDA 1GXEA 1FG9C 4MJID 3GK8H 1FH5L 3QIBC 1A7RH 2J5LC 4YFLF 2IPTH 4I13B 3FO0H 3I9GH 5ITBL 1U8NA 1G7MA 3VRIB 1N0XL 1XF5B 1H15A 1ZVYA 3P0VH 1J05B 3QCVH 4ZUVA 4H8WC 3W39B 3LMJL 5T5FH 1N6QH 3OMZA 2CDFB 3EDFA 5L88L 5DTFA 4KJQC 1EEQA 4BSWA 4I4WB 2ICES 1Q9LB 3F12A 3MBXL 3UTTD 4U1IB 5CJQL 4RBPK 4UBDD 5GSVB 5HYQB 2AJUH 3U0PB 4WHYG 3WN5C 4HWEL 4ZAKB 4W68A 4KMTH 3TIDA 2HN7A 3T2QA 3BT2H 3H0TA 1IM9B 3U36A 3S5LB 2JJTA 1AI1H 2VKWA 4M5ZH 4FHBD 4OZGA 4R4ND 3FHAA 3VRJA 2EDDA 2FO4A 1AKJA 4Y19A 5JR1H 2JK5B 4Y5YA 5E2UL 5D8JL 4L4TB 1GOHA 1UADC 1K6QH 4PJGE 1UM4H 1H9VA 1BEYH 5F3BB 2YD9A 1MRFL 3T3MF 3T1FA 1AY1H 3H9HA 4PD4K 5C2BL 1CL7H 4PJ8B 4GAGL 2VWEC 1F00I 4NQDD 4J8RA 3ARQA 3WXVL 1SY6L 2H8PA 2WWMD 3RY4A 5JPMB 1NUGA 3S3JA 1X3DA 1I9IH 2YD8A 1FFRA 3W11C 1T83C 4NSKA 4PRHE 2FECL 1H3TA 3U9UB 4RGOH 4X6DB 2KDGA 3QDMB 1EHLH 3UJIL 3BKML 2YZ8A 3LN9A 1I7UA 4U6XA 1ADQA 3M07A 4RZCB 3T65B 1ZGLB 4FQHB 4ELKA 4HJ0C 4K7PH 4NCC2 3MRHB 4PS4H 3RIFF 4Q58C 5HHOD 1CE1H 3V5DA 1MPAL 4XCEB 3TA3B 3P0YH 1ACYL 4XCNB 1ORSA 4OZFH 1H5BB 2G75A 3QDGB 2J8UF 1T66D 2VOTA 3TP4A 3GHEL 5CZXD 5HJ3A 1CZ8L 5BCAA 3QPQD 4QYOA 5FO7A 3V6FB 3EDDA 1I1YB 3RI5K 3U1SH 1IILE 4Z7WA 2HMIC 3EO0A 4Z7NF 4PJEB 2VB5A 2AK1L 2YN3A 1MQKH 4ETYA 3QG7L 3CXDL 1OB1B 3FFCD 3DMMB 3LN5B 5CEXA 4NN6B 3UTSA 3HUJE 4QTHA 1R3HB 1FNSL 4N0FB 1LP9F 2EDRA 3C6SB 4OCRL 5DJZB 5KZCB 2EEDA 1Q1JL 3RVXC 4K3JH 4WHTA 5B3NA 4JVUA 1DN0A 3KXFE 4U7KA 4L8SB 2XXCB 4I3RH 4DK3A 3MUJA 3PDOA 5I8KH 2P8MA 5F7KC 4MS8D 3OAYK 4YX2H 5I6XC 2VL5A 2CUHA 1DBAH 3V0WL 2X42A 2N4IA 1Q9OA 4P5KB 3BISA 3T0EE 1ZHBB 1EFQA 1U8JA 2WSKA 2AK4B 3VJ6B 4L4VD 5BRZD 1IQWH 5I1IL 2UWEA 1FFOA 2DQGH 1DBML 5SWSB 5HDQL 2VDQH 4TNVF 3TO4C 3BH9A 3FO2B 1H3PL 3WV0A 2PNDA 3I6GB 4JPWH 3VFVA 3PL6B 2VAAB 4PP2A 4QXWA 3BP5B 1FZMA 3CMOL 5KS9A 5I15H 2WUBH 4HKBA 1X5FA 1EHNA 3U4AA 4KI5F 2DWEB 2Q8AH 1SQ2N 3PGFL 5GRYA 1JWMA 4XBGA 3RHWK 4I0PC 1MCDA 5KVMC 4NN7C 3MLZL 2XZCH 1EXUA 3VFOB 3EYVB 3FB7A 4D0BB 1YJDH 4XPAH 2ILLA 2AJVH 4U1LA 4PJIE 4UDTA 2VLJE 4XNQA 1HH6A 3TBSA 3HE7C 2EYRB 1RHFA 4KC3B 4CAGA 4KRPC 4KROB 2AGJH 3VD5A 4MYWB 5H2BA 1RZJC 4WU7B 1J18A 1FFNB 1F11B 3RGVC 4QCIB 3VI4E 2QV2A 5LXGL 4QXUL 2YEZA 3MRFA 4ODUB 2I9TB 4IOFC 4YDLB 2P49B 2I5YH 4X6CA 5D70H 3BMVA 4U3CA 4OCXH 4V1DE 4EN3B 4IBLT 1ITBB 3BYYA 2Z4QA 1ZGLM 4E42A 2NNAA 1W0VA 5ADPH 4YHLH 1KLFA 4TRPH 4ORGB 2ICWI 2C26A 3PWPB 3VXUA 5HBBA 3HC4H 1U3JA 1MFNA 4EOWH 4E41A 3O6FC 2VE6A 1Q38A 2XNAA 3F7YB 3HTLX 1UQSB 2O5ZL 5H8DA 2FDBP 3MV8D 3ZDZE 4NM4L 2HYMA 4U1JA 1MUJA 1FN4A 1AGCB 1JPFA 5AZEH 1XGRB 3FN3A 4MD4A 3LS4H 2DKMA 2R0ZH 1F97A 4MXVE 3FAXA 5A40E 1U2CA 4FZ8H 1UC6A 5ITFA 1T2JA 3X14A 4RMSA 2E27L 3ARDD 1UJ3B 5KVDL 4D9QE 5JW5B 3VXRB 3MACL 3QQNA 4P2RD 1HCVA 4KUZH 2M26A 3OAZK 3QHFL 1DDHB 4JG1H 1F4XH 2OTUA 4QHNB 4UBDC 1KELL 4Z7OE 3UTSE 1J11A 5D5MA 4HEME 2W0KA 5M94B 1T0PB 1WITA 3UJTL 3AROA 4X7SH 1ED3B 1T7WA 2EDYA 5DF0A 3WIIH 2IAMD 2BVQB 3I3EA 1I1AA 3QEQA 3HI1A 2F5BL 3MJ9H 4RSVA 3OTTA 4FQLL 4R4NC 5EIIA 1B2WL 1U3HD 4MA1B 3KPLB 3QFJB 2HH0H 4QHKI 2C3WA 1KLUB 3BZEB 1OGAA 1JRHI 1XIWD 1MWAL 5EOQH 1YZZA 3PWJA 3GRWH 3A0OA 3MGOA 1S3KH 4DQOL 3P30H 5EOCL 2X4RB 2YRZA 3PABA 1N7ML 1KBGH 4NO2A 5KOVC 4BFIA 3LKRA 3ZKXB 1DBBH 4C59B 3MODL 2CRYA 4IRSA 2WWMC 2AEQH 3TWCL 2V9QA 1NMAH 4J6RH 3SDAD 5KS9E 2PTVA 1LWRA 5IMKA 1MCCA 5GGVY 1OSZA 1FNGA 4NZJA 1NCCH 4GRLC 5L9DH 2P24B 1FGVH 3QCUL 4IRZH 5IROA 3SGEI 2H32B 1SJVA 1NFKA 5DZLA 1H8SA 5K59E 1RUQL 3VRIA 2X70B 1XF5A 2FX8L 1J05A 1T66C 4Y4KB 5TE7L 4OLZH 2V5RA 3W39A 2O5XL 5CZXC 5DA0B 1MNUL 2CDFA 3PP4L 2GJ6B 3QPQC 4JFYB 3NCJH 2HLAB 3VXMD 2NY0B 4PRIB 2YUXA 1ZOXA 1E0OB 3WNMA 4I4WA 4OKDA 4TULH 1Q9LA 1IT9H 5ALCL 1TTUA 3JV6B 1P6FA 2NZIA 5GSVA 5HYQA 3WXWH 3U0PA 3BO8A 4V2BA 4ZAKA 4X6CE 4DVBB 3H42L 1IM9A 1V05A 4G3YL 3S5LA 3HMWL 2EH8H 1XGUB 1KSRA 1FRGH 1NLBL 4W6WB 1Q72H 3VXUE 4AENB 1MJ8L 5LWYH 2JK5A 4MS8C 2D7TH 4L4TA 4NBXB 3IFNL 5F3BA 3TT3H 3H8NA 1WK0A 2X4QB 3H9ZA 1U8QA 4U6VL 5D1QB 3FOMB 4PJ8A 1IGCL 4X9GA 3W9DB 3PQYE 4JY5L 2D0HA 2Y7QB 3A6BL 4RX4A 4HGKC 5D2LB 4PJ7F 3TH3T 2DB8A 5JPMA 1UM5L 1L0YA 3QXAB 4U3HA 1OHQA 3DUUB 4LOUD 3NN8B 3U9UA 5DQ9B 3IVKB 4X6DA 3BAEH 3L5HA 2VXQL 3QDMA 4M61B 1MREH 5DD0H 4NWTH 4LVOC 4RZCA 3T65A 4GAJL 4R4BB 4FQHA 1JCKA 3VD3A 3VXSB 3MRHA 4BZ1H 2DDQL 3AB0B 2NXZD 4MCZB 1S5IL 2CK2A 4CMHC 2EC9U 35C8H 4GAYA 4YXLH 3SQBA 1G9EA 3SE3A 4XCEA 1FC1A 4LP5A 5D5ME 4XCNA 3TA3A 3AGVA 1H5BA 5JW4R 3AS2A 4TUKH 4NWUH 5SWZE 5J9PB 3QDGA 3PXJA 4LRIC 5DMYA 1BWWA 6CGTA 4JFEE 3WJJC 1JTTA 1UACL 3FB6B 3V6FA 4FNLL 1TENA 1I1YA 1FYTB 3A67H 3V0AC 4ODTL 1RIVH 1ZHLB 1J5OL 4JFZH 2B0SL 2AJ3B 4PJEA 4GG6B 2XKUA 1OGAE 1EUTA 4RNRB 4CVXB 1OB1A 3D3VB 3DMMA 3KLDA 3OKLB 4DCQB 3DV6B 4N0FA 2XTJE 3C6SA 4PLJD 1XMWA 4OI8A 4NO0B 4GT7A 4CU6A 2BHZA 1LO5B 1I85A 3UC0L 1CU4H 4L8SA 4DOHB 5IGXL 1EJOH 3OKMB 43CAB 4OM1H 3KPQB 4YFEA 4JCLA 3K80A 2FIKA 3G6JB 4P5KA 1ZHBA 4FOMA 3VJ6A 5JA8B 3PP3K 4MAUH 1A6AB 4EBQL 4CU8A 2Z93A 1FE8H 5SWSA 5D1XC 4LFHG 3FO2A 5J13B 4OD1L 3I6GA 2BHUA 3P11H 3PL6A 5FYJL 5JIKA 2VAAA 2LFGA 5IW1B 3BQUB 3D69B 1JZ4A 3INUH 1T0NB 2DWEA 1S9YB 3ARDC 3QNYB 1XF3A 1AO7B 2HFGH 4LPXA 4RRPA 1YJDC 3WNKA 3ZKMD 3FQXB 2DBJA 3VFOA 1ZA6B 4KK9D 4D0BA 1FO0B 4LKCA 5DYOB 4XWGL 4Y4HB 3WFCH 2H3NB 1YEJH 1VFBB 4UIKH 4JFQA 3HI5L 3IDIB 4JG0H 4LLYB 2IAMC 3TN0D 1ES0B 3WFDH 2EYRA 3BZFB 3PIQB 1X44A 4OJFH 4GW5B 2OK0L 4JQVC 4WU7A 5GS0H 1F4HA 1U3HC 3WUWG 1INEL 1I75A 3QI9D 1FFNA 1F11A 5MEND 1QP1A 4QCIA 1LDPH 3SCMD 4L5FL 5DT1H 4NC0B 4ODUA 2I9TA 1I8LA 4JRYB 1N0LA 5EUOE 5A2FA 4ACPA 1CGWA 3X11B 4EN3A 3F65A 4OT1H 2P8PB 1DP0A 4G6AD 3RWFB 2UZIL 9CGTA 3VGEA 1QOKA 4ZFZB 1YNTA 3QO1A 1MVFA 3WMSA 3B2VH 4ORGA 2C1PB 3PWPA 5GJTL 2YC1B 3RX7A 3I2CL 3C08L 2EE2A 3SDAC 4XPGL 4X6DE 4ZS6D 1E4KC 5HI4C 3QDME 4OLXL 5KVGH 4P9HL 5JDSA 2CKBL 3TO2A 3F7YA 3GI8L 3CVIL 2AEPL 1AXSA 5ISZA 4JGMA 2A2QT 1HYRC 4NPYB 1URLA 3O2VH 3X17A 1AGCA 3EYFB 1P4BH 3E2HB 5L7XH 1BJ1H 1XGRA 5J11B 3MLUL 5HDBE 3ARVA 5LGKA 3NACL 4FTVB 2DWDB 4Y8AA 1KPUB 1LHZA 2I26N 4DK6A 3W9EB 1R3IL 1B4JH 2A6DB 3C09C 4A6YL 3BDBA 4MHHI 3VGAB 1UJ3A 5DUML 4KKCD 1NFDB 5JW5A 3CSGA 3VXRA 2QL1A 2E7LC 4PJEE 1DANT 1DDHA 5FHBL 1PYWB 3HN3A 1SJEB 3UTPD 1KTLB 2AJXH 4G5ZH 5D7LD 1BZ9B 3G08B 4QHNA 4OBSA 4BSJA 5FA3B 2FBJH 4OQTA 5C07A 3NFSL 1YY9D 3RU8H 2HT3D 1ED3A 4GBXD 4WEBL 3SGJA 4LCUB 3DJ9A 2RQ8A 1MEXL 2BVQA 4DKFL 3TYFB 4KH2A 4PGEB 2NY7H 2YMXL 3V4PH 5FFLA 3KPLA 3QFJA 1KLUA 3BZEA 3K7UA 1BMGA 1I1CA 4DZBB 5I9QC 1MCKA 5IMOB 3S88L 1W72B 1OAYL 1R0AH 1JBJA 4PG2C 3U6RB 1DQLL 3HC0B 2X4RA 5E6YA 4GKZA 5DVOA 3TVMD 4HXAL 4UTBL 3ZTNH 3QIWB 3IKKA 3HR5B 1U8MB 5EC1B 5M7QA 4LOUC 4HC1A 5EOCJ 5BV7L 2ED9A 3IDMB 1TPXB 2LE9A 5C6PB 4ZQKB 4PR5B 2APTA 3I50L 1IAII 4LEXL 1MFBH 4R90H 3STBA 4LPCA 1NAML 2ZCKL 3ECBB 2H32A 3O3UN 3GI9H 4P46B 2OJZL 2X70A 3MTRA 4R7DB 5HYJD 2OXGA 4P3CL 2VDMH 4Y4KA 4PJHE 2CLVB 5D1ZD 5B39G 2GJ6A 4JFYA 3T8XB 2HLAA 3QUXB 5E7BA 4PRIA 1AXTL 1DQDH 3BZ4A 3L5IA 2YKLH 1I4FB 2Z8SA 1OVZA 3O41B 1U91A 2JE8A 3JV6A 4NQVB 5C0BA 4NNXB 3DSFL 2WQRA 4XNUH 5F7WC 1DFBH 1TJHL 5I19L 4F7CB 3LV3B 4B53A 4PLJC 2VXVH 4DVBA 5HGHB 1XGUA 1E27B 2Y36L 3O4LE 1RZ7L 1EMTL 3NFPB 1H3VA 4QXGL 4LIQL 1J9CT 4WW1B 2EE9A 4ZMAT 3VG0L 1KUMA 1RFDH 4NFCA 4AENA 1UGNA 5EOTB 5GZNC 5C9JA 4Z9KB 4Z7VB 4O5LL 1AD0B 4J3SA 2C3VA 5ISZE 5D1QA 3FOMA 2AERT 4WW2F 3W9DA 4OZHF 2Y7QA 4LSTH 2FEEL 3FN0L 4PJXF 3QSKB 3TNNB 1G6VK 3RIFK 1DEEB 1MRCH 2ZSVB 1F2XK 4FFWD 3QXAA 4F9LC 1UG9A 1FGNH 4XPBL 3QWOB 4JFDB 1MSPA 4PFEA 3DUUA 3TJHD 1MLCB 4N90D 3NN8A 2X9WA 1CR9H 5DQ9A 3IVKA 5I75B 4HQQH 5IOPB 3WNOA 2X4UB 4M61A 1A2YB 5T3ZL 2QJDA 2B39A 4R4BA 4UV7H 1ZTXL 4HIIA 3VXSA 3PV6B 2P4AB 4FP8H 3P9LB 1VPOH 1ZANL 4MCZA 1DVFB 3ZKMC 1ZS8A 4LSPL 4JM4H 1T4KB 1W0YT 3SDYL 5C07E 4Q0XL 4KK9C 5J9PA 5D7KE 3MSPA 2E6JA 3QIUD 3OB8A 5AG9A 4HT1L 3FB6A 4P23D 3TN0C 4CADB 2WMPA 1FYTA 4MMXC 3K8MA 4TSAL 5T33L 2F19L 1ZHLA 3JWNC 3KYMB 4GG6A 5AUMB 5JW3H 3QI9C 4G6MH 5E4IA 4RNRA 4CVXA 5JO5A 3SCMC 3D3VA 4DCQA 3OKLA 2HG5B 1INDL 4HPYL 1CLCA 4YPJA 3DV6A 3C60B 2OI9B 4IIQB 4NO0A 4X0KB 5IMLA 1LO5A 3B9VA 4G6AC 4S1RH 4FMFA 1W0WB 2BJMH 5F9WC 4TNVK 5GXBB 3MQIA 1ZVHA 4DGYL 3OKMA 4ZOEA 43CAA 3KPQA 1TVBB 3ES6B 1OP5H 4ZS6C 4N0YH 5F88A 3F58H 2OP4H 3G6JA 4P57B 5C92A 1YPZB 1AGEB 5D93C 4TSBL 1A6AA 2Q20A 3IXAB 2ZCLL 1MAMH 5TDPB 4BQCA 1GAFH 2IQAB 1TZGL 5E99H 2QQQA 1FPTL 3F7VB 2E8ZA 2XQYG 5F8QC 4OUOA 2X4NB 4GJTB 4PV9B 1FVEB 3MZTA 1VFAB 1P7QD 3NZ8A 4PBWD 4R26L 4WI2A 3EJYD 5IW1A 2WM0A 3BQUA 1C1EL 2K1MA 2OLDA 4G6FB 3D69A 2YR3A 2BXYA 4HUVB 3ESVF 1IJ9A 1T0NA 1U3ZA 4PRIE 2FECI 1DLFH 1S9YA 1QFOA 3QNYA 4KKCC 5D2NC 4LDOB 4WFHE 2VDOL 1BAFL 3HZYB 1QUNA 5C0BE 2YPLE 1FQ9C 1G9ML 3HZVB 3FQXA 4XP9L 1CE6B 1ZA6A 5FA4B 5DYOA 3AC0A 2OSLB 2Y06H 3TIEB 4Y4HA 2ID5A 3MJ7B 1YY9C 1JI2A 2H3NA 2HT3C 1VFBA 3T2NH 1OT1A 2FGWL 4GBXC 3IDIA 5D7IB 5DRNB 4LLYA 1GVIA 3SO3C 1PGRB 1QFWL 3ZL4H 4XI5D 3BZFA 4DVRL 3PIQA 5FYLE 1B90A 4GW5A 4XXDB 4XH2B 4HV8A 3UXFA 2G60H 2CUMA 5JQ6L 4HKJB 5TF1L 3GM8A 5JZ7C 4Z5RB 4TVSa 4LFHD 1WIOA 3DXAD 4M93B 1JFQH 3L3DB 3AVEA 4JRYA 4TSCL 4JO1H 2HKHH 3DVIA 3MRDA 3X11A 4HK0B 1ZEAL 2P8PA 3RWFA 3FO1A 2QTEA 1L7IH 3CIQA 2PXYB 4ZFZA 3GBNH 1Z5LA 4KXZI 3QEHB 4G9FD 3O3BB 5L6YH 2RBLA 5FYKE 2C1PA 4WWKC 2YC1A 4ERSL 1MI5E 2X4SB 1JPGB 2N7AA 4XVSL 4KV5E 4R0LB 2FZ3A 4JR9L 1RUAH 1SYSB 1PEWA 1U8PB 1I8IB 5IVOA 2DLTA 3ARXA 1EGJL 2Y25A 3BPNC 3VXSE 4Y1AB 4NPYA 1L0XA 4PJGF 3DV4B 4K94L 2EEBA 3EYFA 4N0UB 4BJLA 4J3OC 5HGDB 4WUUB 5FYLH 1RZIB 2R29L 4PYGA 2OR7A 4ELME 3IDYB 3K4DA 1ND0B 5F21B 2DWDA 1CLZH 2HKFH 1KPUA 3SKUD 2I60H 3W9EA 4W4OC 1TCRB 3VFMB 1IAIM 1X5YA 1FYTE 5D1ZC 2A6DA 3GIZH 3TCXA 1MIMH 5JMOC 5I73C 1NFDA 4AMKH 1K9TA 5JDJA 1PYWA 1SJEA 4J12A 1KTLA 3G08A 3D3VE 3O8XD 5FYKH 3ULUE 4PIRF 4DJMA 1M7XA 2AI0H 1CIUA 1G9NC 4LHUD 1KJMB 5A2IH 1KJ3H 4LCUA 4JRXD 5E6ZA 2W0PA 4U0RB 1EVUA 4UB0H 3TYFA 4LVHC 3C6LB 1WZMA 1GGIH 5CIPA 4XCFH 3HNSL 4PGEA 1XF4B 4BZ2L 2JJVA 2A38A 3KS0J 4ZYKB 1TFHA 3G6JE 3MUHL 4MXWH 2DQHH 2HVJB 4ZNEE 4LDEB 1FBIH 3ZE1E 3BJLA 4MNGB 1MCEA 5IMOA 5I66B 5JXAL 1MJUL 5I1KL 3C9NB 4KTYA 1O7SA 3HC0A 2CRMA 1RJLA 1NKRA 2V9RA 1EV2E 4XAKD 3HUJF 4YFLI 3LKQB 3QPXH 1MCSA 3W0WB 5DR5L 1QSEE 4FFWC 5H37G 4LSUL 4LGSB 1GGBH 3HR5A 1U8MA 3DECA 2QQKH 5EC1A 1ZE3C 3TJHC 3ULUH 2MFNA 1JN6B 1SYVB 1CD1B 1WBYA 3GKWL 5DWUL 3HAEG 1T04B 3IDMA 3OSKA 4PYHA 4OCYH 2IMMA 2IANE 2H41A 4XP1H 4PR5A 1T7XA 4PJAB 2FB4H 2Y5EA 4X7TB 5DHVB 1N59B 5DURD 1A3QA 3ECBA 2R9HD 5A2JH 4P46A 4R7DA 3HNVH 3N85L 2OZ4A 3CFJA 4EXKA 4GXUN 3SDDD 3VDAA 3QIUC 3TJEH 1WCQA 2Q87A 1QLFB 1G7IA 3RDTB 1ZVSB 3T8XA 4P23C 3QUXA 3GK8L 1M7DB 2WIIB 3BOVA 4GQPH 3G5YB 1I4FA 1FVDB 3FO0L 3I9GL 5H94A 4H1LB 5JW4Q 4NNXA 3P0VL 3QCVL 4GG8A 3HLAB 1AHWA 4JRYE 2E3VA 5T5FL 1N6QL 4WTXA 4F7CA 1WVZA 3LV3A 1E27A 2EIEA 3CH8A 3NFPA 4FXLA 3DOSA 1MCHA 4R6UA 4PJIF 1NCAH 2HLFD 5CEZE 5EOTA 4RDQF 32C2B 4RFNB 3QWRD 4KMTL 4Z7VA 3OKNB 1AD0A 5CP3A 4M9OA 2GSIB 1AI1L 3N1MC 4OFKA 1QLRB 2CDEB 3EIFA 4QXTB 4HFUH 2W91A 5JR1L 1BECA 4YXHL 1DEEA 3CD4A 1VACB 3GSVB 2ZSVA 3RWCB 1K6QL 5EBLB 3HE6D 1UM4L 3M17B 3QWOA 1BEYL 4JFDA 3F7RA 4JPKH 4AG4H 1AY1L 3MO1B 2D7MA 2X89A 2XYCA 3GJEB 4LPTA 4XB7A 1CL7L 4MQXD 5IOPA 2VLRD 5E2TL 2EICA 1A2YA 1NFDE 3L3HB 4P59L 5KAQF 3QYCA 1X9QA 2CDGB 3PV6A 3P9LA 1DVFA 2B1AL 1I9IL 1Z0NA 1T4KA 1JNLH 2MPAL 4CVZB 3JV0A 4YHOH 5CEZH 5F7EH 1IZJA 2XRAH 3ZDZF 4KPHH 4RGOL 1NC4B 1PG7X 3IB4A 5DK2B 1NCWH 5ALBH 1EHLL 2Y23A 2W0FB 4M48H 1UA6H 4CADA 2R56H 4PP1D 1WT5C 4K7PL 3CGTA 4UQ2B 4XI5C 4PS4L 1X5IA 4MXVF 4BFGA 1CE1L 3KYMA 3P0YL 3MC0A 1MFCH 5AUMA 1HK6A 1TCMA 1EPFA 1NBVH 2HG5A 2CXGA 4U33A 3U7YH 2FD6H 3C60A 3D6GA 4LCWB 3T0VA 1HHJB 5J12C 4IIQA 3OAYH 4Z78B 1MLBB 3U1SL 2GSGB 4Z7OF 4KZDH 1L6XA 1WTGT 1I3GH 3EHBD 12E8L 5IW6B 1AC6A 3LDBB 1MQKL 2GY5A 2ZUQB 1DL7H 1TVBA 5BQ7B 3ES6A 4F33B 4P57A 4WGVB 1AGEA 3G5ZB 5HY9B 3V6OA 3EKCA 5TDPA 2UUDH 2IQAA 4K71C 5C0CE 3F7VA 4MAYA 5CIPH 3ARFC 5JIIA 2X4NA 5I8KL 4PV9A 1X7QB 1FVEA 4YX2L 1VFAA 4XRCB 4M8VA 2AABH 5CILH 1DBAL 5CGTA 5GS1C 1CVRA 4K3HA 3ARGB 2JIXA 4HUVA 5CMAA 4OFYA 5TGBB 4QT5B 1IQWL 3QHTC 1S78D 4ZD3H 4QOKB 4XGZB 4YZFF 3MUGB 5DUBB 1WWCA 2VDQL 5C08D 5KS9F 1LMKA 3OAUH 2XG5A 3HZYA 4UOW0 3HZVA 5LGHH 4JPWL 2NW2B 3LEVH 2JF1A 1UKTA 1CE6A 4JKWA 2R0WH 1J88A 3PXHA 3O8XC 5FA4A 4ZG1A 3UPRB 2RJMA 3TIEA 1MWAB 2OSLA 4M03A 3VH8B 5I15L 3B6SA 2WUBL 4L8CB 3MJ7A 1OLLA 2VDNH 3O9WD 3V6BR 2RGSA 3NPSC 2Q8AL 2A9NH 5D7IA 5DRNA 5FHAL 2KKQA 4F3FB 4M62H 4HK3J 5K59F 2QLVB 1ETZB 4MQSB 4U6HB 5D6DC 1TLKA 1XGQB 2J8UB 1P4LB 2XZCL 4XH2A 4POZD 3ZZ1A 4XP6H 2H26A 3V5HA 3LKOB 3SKJL 4XPAL 4HKJA 2AJVL 4Z5RA 4WDIB 4G7YL 4PREB 4RWHA 2VQTA 4GW1B 2FJFB 4MZ2A 2GW5A 5DHYB 4FQXD 3QDJD 2NZ9D 5C0RH 5HD8D 4HK0A 4JB9H 2AGJL 2PXYA 2Z91B 5F44A 1R5VB 4YHKH 1GGYA 1LP9B 4X6CF 3QEHA 3O3BA 4L9LC 3BSZH 3S96B 5HVWA 4JFDE 2X4SA 1JPGA 3S5LG 5DMIL 2FBOJ 3ARTA 2NY4B 4R0LA 1CF8L 1SYSA 2I5YL 1I8IA 4S2SB 5D70L 5DEZA 3AY4A 2EDLA 5J0BA 4OLUH 1D5MA 2QQNH 2DQTH 4YHLL 5ADPL 1BM3H 3DV4A 2DKSA 4N0UA 3SHSA 2X1WL 5HGDA 4WUUA 2R9HC 3HC4L 3T2OA 3WJLC 3P73B 3VXTB 4OV5B 5HGBB 1ND0A 1ULVA 5E4EC 3WYRA 4NHCH 3OAZH 3LRGA 3SDDC 3K46A 5EBGA 1TCRA 1EAJA 3SKMB 5K9QG 2AQ1A 1MCRA 3DRQA 2OYPA 3SE4A 3BIBX 3RTQD 4QGYA 3BFOA 4JN1H 2DIBA 2WLYA 1YEDB 3L3KB 5AZEL 1N8ZB 4YEFA 1R6VA 3U2SB 3MBEB 1J8HB 5I8CB 2R0ZL 3BXNB 1Y6NR 5HYEA 2ENSA 4QRRB 1FZOA 1NFIB 4KMLB 4FZ8L 4L8DB 3RRQA 4YLQT 5TDOB 3MRMB 4RMVA 4XPHH 2HFFA 3QUMA 5HHXH 1DBKH 1EEZA 1OSPH 2BNUB 1A7QH 5H37H 5I0DA 3CPLB 1NCNA 1SY6A 4KK5D 1UCTA 4Y19D 3WFZA 1V5JA 4ZYKA 4OLWH 3M8OH 2F58L 3HAEH 2WBJB 2HVJA 4X7SL 1KGCE 1BF2A 3V6OE 2QSTA 3LIZH 4MNGA 1CXHA 5I66A 2BNRE 1DLHB 2B20A 5I2IA 4HWUA 1CK0H 3C9NA 4WI9A 3MJ9L 2DD8H 3RPIB 3ARBD 3HR6A 3VWKB 1NPUA 3LKQA 4WFGE 2CKNA 5ILTH 3W0WA 2VXUH 2HH0L 1X5ZA 1X5JA 3RVTD 3SBWA 3ZKSD 3DX6B 4LLUB 1K2DB 5EOQL 3H7LA 1JJUA 2X2YA 3GRWL 4AM0B 1JMZA 1RUKH 4MQXC 3H9SA 1SYVA 1T5XB 1CD1A 4ZUTB 3S3SA 1T04A 1Y6KR 4NKQB 3P30L 5CJ8A 3BKCL 1JK8B 1KBGL 1DBBL 4PJAA 4ODWB 5DHVA 2NY6B 1HINH 1N59A 2AEQL 4KKNA 4UT7H 1NMAL 1MCBA 4WV1C 3P0GB 4J6RL 3ZKNC 3DBXB 3ZYJA 3QQ9D 4JO4H 1I7TA 4WCYH 4LHJB 5D7IE 4KWUA 2EKSB 2BY1A 1QLFA 3KPSB 3RDTA 3D48R 1RI8A 4QRPD 4PP1C 1M7DA 5L9DL 2WIIA 3U0TB 2HTLD 4QHUB 5FGBA 4IRZL 1FGVL 1A6WH 4H25B 3G5YA 1FVDA 5BVPH 5A43C 1QPPA 4H1LA 3GMOB 3EZ8A 5HHMB 4UV4L 3UO1H 3IF1B 1UJTA 4OLZL 4PRPE 1BQSA 3ZYZA 2PKDA 1A6VH 3NCJL 5TFSL 4YHMH 3GJFK 2DLFL 4RGNB 4TULL 4MXQD 4PBXA 2Y4SA 1AR2A 4NO3B 1IT9L 4JJHA 5MHSE 4M8QB 3QUZA 5GJSH 3W5MA 5EA0H 2QADB 2EDOA 5DJ6B 3WXWL 4WUKH 32C2A 3KPRB 4FQ1H 5I74C 5EU4B 3OKNA 1AR1D 3DROB 5LKNA 3DIFB 2EH8L 3ME0A 2GSIA 1KPVA 3F62A 4ALAL 1QLRA 1A02N 2CDEA 1X6LA 3FRPA 4QXTA 3RZCD 4WUUE 1Q72L 4MA8H 1A5FH 4NN5C 1NGQH 5KOMC 5LWYL 5EUOF 2XN9D 3QRGH 1VACA 3IDXH 2D7TL 3GSVA 3SE9H 3RWCA 2RFXB 5EBLA 4ODVH 5C09D 3M17A 1N4XH 3TT3L 3VFPB 4P5TB 3MO1A 3GJEA 4AQ1B 3ZDXE 1S78C 5TJWK 3U0WH 3L3HA 3QNXB 3ET9F 4OCSH 1A14H 5IIEB 4P0DA 2CDGA 5GRJH 1YC8A 2EIZB 2XXMB 5CFHA 1IARB 5MP6H 1D6EB 1Y18B 5DMGD 1PD6A 4ZSOE 1N5AB 1C8PA 1HNFA 1NC4A 3BAEL 5F9OH 1YY8B 5DK2A 5E00B 4J23A 1MREL 2W0FA 4HUKB 4KTEH 4S1SH 4Y2DB 5HDBF 5DD0L 4NWTL 4BM7A 2AXFB 5EIVA 4UQ2A 1D9KC 4BZ1L 2BOBB 3MR9B 1ZT7B 3L6FB 35C8L 4WEMB 3B9EA 4POZC 5T3XD 5FCUH 4TUKL 4NWUL 4OLVH 4DUWA 3BP4B 3HG1E 3VFNB 4PJEF 2CKBB 2WK2A 1J1XH 3R8BB 4LCWA 4QHMA 4W81A 1BLNB 4F15B 2OBGA 2G2RB 1HHJA 4FQXC 4Z78A 2QKIB 1MLBA 2NZ9C 3KPOB 2GSGA 1M05B 1SM3H 2JCCE 1RIVL 2VLKB 4JFZL 4Y8DC 1IGTB 1MHHB 1TTFA 4HKXB 3L5JA 5IW6A 1VEOA 5FECB 1XGPA 4Y5VB 5BQ7A 1CD0A 4E41D 3H9SE 1JUFB 2M8XA 3G5ZA 4K2UH 5HY9A 1O5DT 4PJ5B 4JY6B 3OV6A 1C7TA 2BNQB 4A6YB 2R23B 1PDKA 2DM4A 2Y1VA 1O7VA 1CU4L 1OAXH 1YMHB 2D9QB 4J1UB 2ZG1A 2DTMH 3G5VB 1T7VA 2ZUYA 5J4MA 3SDCB 1EJOL 1JHKL 1FVCB 1LK3L 3BEVB 3LAFA 1X7QA 4IDLA 1KT2A 4I18C 5IQ9B 2NY2B 5JXEC 4XRCA 5IHLB 1QRKA 2FEEI 4NNPH 4UNVA 4JCMA 1JZ7A 3MLSH 3ARGA 3I6LD 3Q0HA 1A4KB 3NCYS 5TGBA 4MAUL 4QT5A 1DUZB 4OAWB 1MCNA 4MQTB 5FO9B 2ADFH 4IMLA 3H2WA 3VWJB 2BZDA 1FIEA 4QOKA 4XGZA 3MUGA 4WNQB 5DUBA 4KY1L 3HHRB 4YHIB 3V4VH 3IJSB 4JFFB 4NZDA 1BVKA 3RTQC 5F1NB 1QHOA 4JPVH 3UJJL 3SQOH 4L3EB 1I1FB 2NW2A 1HILB 3P11L 2NXYD 4OIBA 1CDGA 2Q7YB 1RZ8B 5I1GL 3V8CA 3UPRA 1MWAA 2VLME 3VH8A 4F57H 2GI7A 2OJEB 4L8CA 3INUL 3RA7H 1JYNA 1T0MA 2W9EH 4ONGH 1EZVX 4OCMC 1I1AD 2HFGL 1ETZA 3QEQD 1E4XL 4U6HA 1XGQA 2J8UA 4YUEH 1DQJA 2YOCA 3B9KD 4PV8B 4PJHF 2IBZX 1QSFB 3LKOA 5SX5H 2VSDA 4C58B 3WFCL 4WDIA 4PREA 1YEJL 3JWOH 5CINH 4MD5B 5BV7B 1NL0H 4GW1A 2FJFA 5F6IB 4JG0L 5DHYA 1HE7A 3WFDL 1X4XA 2MQ0A 2NX5D 4OJFL 1W8NA 2Z91A 3ARBC 4I0CC 1R5VA 4N0CD 5GS0L 1AGBB 1LP9A 2VN7A 5L0QC 4IRSD 1YN6B 2DBLH 3T0WA 3UYRH 3S96A 4Y4FB 1JGEB 1YEFH 1LDPL 3RVTC 1D5XB 5DT1L 4KQ4H 3VW3H 5IKCA 2O26U 4AJ0A 3MMEB 2I27N 4S2SA 2NW3B 3CDGB 2R2EB 3NA9L 4X6EA 4Q9QH 4XVJH 4OT1L 4X6BB 1WCBB 1REIA 1CTOA 2DI8A 4MNQB 3B2VL 4UT6H 3RWGB 1FIGH 3QJHB 4I0KA 1BBDH 3WCYA 1LO2H 5IFAH 2NY5H 3QQ9C 3P73A 5C8JB 4OV5A 5HGBA 4TUJA 3VXOB 1U58B 1RPQA 2X4PB 2LAGB 3SKMA 4NZRH 3NBNA 2NYYD 2B5IC 1S5HA 5DD6B 2NTSP 2R8SH 3BP6B 3O2VL 1KOAA 1YEDA 1LQSR 3L3KA 5L7XL 5E9DB 1N8ZA 3N9GH 5I1JH 3KPPB 1J8HA 5I8CA 4WRLA 1KB9J 3BXNA 4QNPE 4QRRA 1NFIA 5JNYA 4ZAKD 4O9HH 4NZTH 1B4JL 3E0GA 4L8DA 1JYXA 3ILQD 1A21A 4F37F 5TDOA 3MRMA 3TGXA 1IM9D 3HC3H 3MA7B 2OL3H 4X4MA 5EBMB 2BNUA 1PZUB 2HT2D 4MXQC 3CPLA 2AJXL 2JJSC 1I1RA 4E9LA 5K9JL 1HWGB 1QFWI 3QBTB 4HIEB 2W65B 2DKUA 1MY5A 3N1GC 2VJXA 4L4TD 5IB2B 5IT2H 1FL5B 2WBJA 3RU8L 3RVWD 2EDNA 1AR1C 2ADJB 1GOFA 4YXKL 1NBZB 1FC2D 4XMPH 1DLHA 1SBSH 4PJ8D 4NQEB 4IMKC 3NTCL 2WQ8A 4ORZC 1YC7A 1P9MC 3T3ME 2X9XA 4RX4D 3RPIA 3RZCC 3VWKA 2NY7L 3V4PL 5ESAB 4DGIL 2MSPA 4W6YB 4Q97A 3DX6A 4MB4A 4LLUA 1QRNA 1K2DA 4ODSH 4AM0A 3FTGB 1R0AL 4QOKE 5KTEH 1T5XA 4LARH 4ZUTA 1S9KC 1JK8A 1FNHA 1MH5B 3ALPA 3KNBB 4M6OH 1WBXB 5I30H 3HS0B 3N1PC 5CLTA 4ODWA 4HX1B 3ZTNL 5I71B 3TA3D 5DMGC 4Y7MA 4M6NH 5DRXB 3QDGD 3MV7B 3CFIC 5IMMB 4G6JH 2EKSA 3TT1H 3JWDH 3KPSA 4F2MB 4FG6D 5T1KB 3RWEA 5C0AB 5J6HB 1U8KB 3MV9E 4HBCH 3U46B 4M7JH 3U0TA 4QHUA 4R90L 4H25A 2DQUH 1BOGB 5I16B 4YBLC 2OR8A 3GI9L 4YIQB 4MLIA 4EZMA 1MIEH 1RUPH 2B2XH 3CVHH 2VDML 4HCRH 5D4QA 3DMMD 3IF1A 5KZCD 1VCAA 3U30C 5CUSL 1A7NH 1DQDL 3MJ6A 4D94A 1MFAH 2DQEH 2YKLL 4NO3A 4GO6B 4M8QA 2EDJA 3V4UH 5D7SH 5DJ6A 3ZSTA 4BSVB 4XNUL 3PDDA 1Z0MA 2APFA 1IFHL 2P5WB 2VXVL 1B0GB 4R8WH 5DD3H 2AK4D 3DIFA 5KSAB 2R1XB 2C3XA 2P8LB 2APVA 4PJFB 3U7WH 5SWSD 4ZTOL 1RFDL 2BERA 5MEOB 3TO4B 5EU6B 4OUUB 4OCWL 3ELAT 4G8IB 4NQCB 3PL6D 3F6IA 4JO3H 4P5MB 3K2UH 2RFXA 1X5GA 3HMXH 3VFPA 4P5TA 2E8YA 3WNNA 2IG2H 1IKFH 3OF6A 1RJYB 2H1PH 5DRWB 4LSTL 4K8RL 5IIEA 4HXBH 3P40A 4G42B 4N8VB 2EIZA 4YBHA 4I0PB 1RD6A 2VZUA 2P7TB 1HHKB 1Z3GH 1M6OB 2NXYC 1KJVB 2H6PA 4I77L 4YQXL 1N5AA 1PKQB 2DJSA 5FDYA 1CR9L 4X9FA 1YY8A 5BW7C 5E00A 4X4ME 4KJPD 4M6ML 4Y2DA 3GNMH 4ELMF 4UV7L 1U95B 1BF8A 2AXFA 3IS0X 1I1AC 4FP8L 1B6DA 2BOBA 3GMMB 3MR9A 1VPOL 4KROD 2FX9H 1ZT7A 3B9KC 4MJ6B 3N50A 1YN7B 1F6LL 1YYMH 4GXVL 4CUCA 1NCDH 4AIXA 5GGTH 2IQ9H 1JGVH 3BP4A 5HPOA 3VFNA 4UTAL 3RGVB 3LD8B 2Z35B 5LQBL 2CKBA 2DS4A 1BLNA 1ROWA 4NHUA 1BQLL 2G2RA 4HWBA 2QKIA 3KPOA 4XBPB 4EN3D 5CZVH 4KGLA 1M05A 3ULUF 4LSRH 2ZNXA 3VGBA 2VLKA 4N9OB 1IGTA 1NCUA 4HUMB 4WI3A 3O2DH 4HKXA 3PWPD 4IRSC 3V0VB 5FECA 2D3VA 1BPVA 1QRNE 4FS0A 4Y5VA 5JOPE 3C5JB 1T5WB 4PBVC 1JUFA 1JZ8A 2QQLH 2DMBA 1OCWH 4CN6A 2FYYB 4PJ5A 3BUYB 2VRAA 4JY6A 2BNQA 4A6YA 5C0JB 3B4NA 3VXNB 4J1UA 4S1RL 1YMHA 4RAHA 2EYSB 4G8GE 4MJIB 2FWOB 3OR7B 4X5WB 3SDCA 3ZE1F 4L9DA 1FVCA 3BEVA 2YD2A 4CMMA 4WW2B 5D9SB 4OZHB 2WBKA 3SEPA 2OP4L 1LE9B 3GHBH 3V52H 1A4KA 2E9JA 4OAWA 5FO9A 3MROB 1MAML 1GAFL 3VWJA 3D9AH 5E99L 2NYYC 4WNQA 4TVPD 4YHIA 4HG4J 4JFFA 4MQ7A 3VRLE 5F1NA 5BOPA 3VXRD 1CL7I 2W9LA 3GSUB 4H20H 3MLXL 4L3EA 1I1FA 4FABH 1HILA 5HHME 2Q7YA 1RZ8A 4UQ3B 4M7LT 3KLSA 1BQHB 5TPWH 2OJEA 4YK4B 3ILQC 3LRSB 5EZLB 1DLFL 2O93L 4GH7B 2F53E 1NC2A 1A1OB 2YWZA 1J86A 2HT2C 5IVXF 4PV8A 1TQBC 4XNXL 1QSFA 3VFSB 1NKOA 5EDXA 1BD2E 1FJ1B 3QFJD 4K9EH 3UROR 2Y06L 1T3FB 3IRZA 5L2KE 3RVWC 3T2NL 4MD5A 3RZWA 4AT6A 2GKIA 2KH2B 3IDJB 4PJ8C 3VMPA 3ZL4L 3PHOB 1QFWM 3MXVL 3IAQA 1AGBA 3H3PH 1FZJB 5J8OA 1YN6A 2ZJSH 4JO2H 3RUGE 4Y4FA 1JGEA 5IW3A 1D5XA 1JFQL 2J8OA 3UMTA 3WIFB 2PF6A 3MMEA 4D0DB 1UWGH 4JO1L 2HKHL 2NW3A 3CDGA 2R2EA 4QY8B 1YYLH 4X6BA 1OAKH 1WCBA 4AYFA 2FNBA 3GBNL 2F15A 4MNQA 5L6YL 4MHHG 4GRLB 2XZZA 3RWGA 3KYKH 3QIBA 4I3SH 3QJHA 3SE3C 3TA3C 4O51B 5C8JA 3KWWB 1RUAL 3S6CA 1U58A 2ICEB 3EYOB 4Y4KD 5EU7E 1CDUA 1PKOA 2X4PA 3SY0B 2GJ6D 1U8OB 3QZWB 5DFWH 5LAXB 4FG6C 2EEAA 4LAJH 5DD6A 2NY0D 2X4OB 4M00A 4DWHA 5FYLL 5E9DA 4UI2A 3KPPA 2DYPB 5DO2D 1NFDF 1CLZL 3OWEA 1CGTA 2HKFL 2I60L 3DMMC 5F8RC 4NN6C 1CT8B 1CFNB 4MCYB 3KAAA 3GIZL 1KCSH 3MA7A 4H88H 1MIML 2H45A 5LGJB 1XR8B 1BJ1J 3WLBB 5EBMA 4MSWA 2ARJQ 2VLKE 4AMKL 5TE6H 4ZDHB 1QA9B 2P1YA 4HIEA 2W65A 5IHBA 3CXHK 5FYKL 1XEDA 2XACC 4JHWH 5IB2A 1FL5A 2AI0L 3L1OH 1OQXA 2ADJA 1KJ3L 1UH2A 5INCB 5IWLA 2L7UA 4OZIF 1NBZA 1DQTA 5D1QD 4GOSA 3RHWF 4NQEA 3R0MA 4UB0L 1L9MA 2QEJA 4XAWH 1R5IB 4KJWD 4ONFH 3VA2C 1GGIL 4XCFL 2P5EB 5ESAA 4YO0B 3PL6C 4MXWL 2DQHL 1X5KA 4N1EA 1T83A 5DC4B 5C0GB 2YD1A 1AH1A 3FTGA 3OBAA 5ENWB 3FQRB 4XVTH 4JFFE 4HWBH 3S3PA 1MH5A 3KNBA 5IFHH 1WBXA 3FQNB 3HS0A 4XT1C 3QPXL 3VXSD 4HLZG 5L8KB 3O6ML 4HX1A 4OZ4B 4OZFB 3IJHB 4FMKA 7FABH 2QQKL 3JWDC 5DRXA 3F5WB 3ULUL 4PJGB 3MV7A 4F58H 4XX1E 3C2SA 4KJPC 4WIQA 4HSQA 5CCKH 5GGUA 3MFFB 4F2MA 4XP1L 5T1KA 5J6HA 3L3IB 2VQ1A 1XAUA 1U8KA 3U46A 3I02B 2FB4L 3Q3GB 4MJ5A 4KROC 2YRLA 3ZT6A 1B0RB 1BOGA 5I16A 4K7FB 5CZKA 2F5AL 4YIQA 2Z9TA 3HNVL 4PRHB 3WIHH 3ALWA 3D3VD 3HKFA 4Z0XB 3TJEL 2EYTB 5GPRA 2J6EA 1I8LC 3MRBB 1KYOK 4YDLC 4UNUA 5DLML 4NO0D 1OLZA 2PR4H 5IJKC 4EN3C 1AQKH 4XPFH 1IGML 5CD3B 1LE5B 3AFLA 4OF8A 2HFTA 4LCCB 5LJYH 3EOTH 4X7EC 4BSVA 4EDWL 1J0ZA 2P5WA 1I7RB 4QGTA 1B0GA 1UVQB 3CUPA 2Q6WB 4DKAA 5KSAA 2R1XA 4N0RA 1XGTB 2P8LA 4PJFA 5GRUH 3ORJA 2NPLX 1MFDH 4YHPB 1NCAL 3KJ6H 5GGQH 5D1XB 5MEOA 2AP2A 3TO4A 5EU6A 4OUUA 4G8IA 4P5MA 5DDHB 2A6KB 5I8OH 3SOBH 3R4DA 1YEGL 5JHLL 1PFCA 4MA3B 1GSMA 1RJYA 5DRWA 3ULSB 2GTWB 4HFUL 1RK1A 4X5XB 1WEJL 3KXFB 1AO7D 1YNLH 5FM8A 3ZHKA 4N8VA 4I0PA 3RKPA 3ZYIA 4OFDA 2VZTA 1HHKA 1M6OA 4LK4A 1KJVA 2CK0H 3N0PB 2C3GA 4R97B 3VGDA 1KJ2H 4JPKL 4AG4L 1PKQA 4Y4HD 4GMSH 5A1AA 3T0EB 1PSKL 3OPZH 3SGJC 1N6UA 1CCZA 3KHQA 5IV2B 2AKRA 1U95A 3HE7A 4RMRA 4NUGH 5E24E 4MJ6A 1YQ2A 1J0IA 1E6JH 1AXIB 1FG2B 4YHOL 5CEZL 1YN7A 4MA1C 1H15B 4KPHL 3IFLH 4ZUVB 2Z8RA 3P2TA 1SVZA 3RGVA 1NCWL 5ALBL 2Z35A 2YUZA 4JRYD 4NQEE 1UA6L 3CNKA 1EGJA 4H8WH 1JL8A 4DKDC 2R56L 2VWEE 4Z8FH 4LCIH 4NKMB 3F12B 5B3JE 1T20B 3FB5A 1MFCL 4P99A 5TE4H 1NBVL 2ADIB 3O6KH 2X6MA 3V0VA 4HUWB 3C5JA 3U7YL 1WJ3A 2FD6L 4PJIB 2VLJB 1NMBH 5GS2D 2FYYA 1RIHH 4CN4A 3BUYA 4PJBA 5C0JA 3VXNA 5E2WL 4M02A 4KZDL 2EYSA 2MQCA 4F7EA 4U2YA 4MJIA 2FWOA 1I3GL 3OR7A 4X5WA 3WFHB 2WUCH 5J3HD 2COQA 3JBG7 1DL7L 4WW2A 3BMWA 3MV7E 5D9SA 3C8DA 4DFIA 4FTVD 4Z77B 2E7CA 4EXPX 3ULVD 1U41A 1LE9A 4EI6B 1P84J 4Y4KC 3MROA 1JI1A 4V1DB 2NY0C 5IQ7H 3GSUA 2YPKB 1F8TH 4C83A 1S7XB 2AABL 4NSKB 5CILL 4KHXL 4UQ3A 1IE5A 1VSCA 2FLRT 1MCPH 3ARYA 4J4PA 1BQHA 5J89A 5HI3C 3UEZA 1I3UA 5J1TC 3G9VA 1OD9A 3LRSA 4ZD3L 3AUVA 5EZLA 1UXSB 1WAAA 5IGXH 4BK4A 4CJ1A 3OAUL 4OGAD 4RIRB 4K9EC 5LGHL 2AQ3A 2N7BA 3V5DB 3LEVL 3QWQB 1H3GA 3NA4A 3VFSA 2R0WL 2VDPH 1FJ1A 5F1IB 3UAJD 5F97E 1T03L 1T3FA 3RKDC 3JTSA 2VDNL 3C87A 1NEZG 2A9NL 5F7NC 4QYOB 2PETA 3TF7C 1HOCB 4M62L 4PJFE 3IDJA 1EJ6A 1LGVA 3A6OA 3PHOA 4HAGA 4HS6B 4LGRB 4H1LG 1JV5B 4KJWC 4FFVD 4QRUB 4NQDA 3AREB 4HFWB 1YEKH 1FZJA 3LOWA 1JZ6A 3QULB 1LNUB 3CJJA 3QIWD 3UTSB 1A1NB 4XCCH 3PWVB 4D0DA 5EC2A 3OX8B 1OQOA 5C0RL 1BFVH 4YDKH 5ERWB 4L8BA 4JB9L 4QY8A 4WFFD 2C4FT 1T1ZA 3KPNA 5EWIH 4YHKL 3LQAC 4GRLA 3AB0C 2P8MB 4YWGH 3TNMB 2IBZY 4NUJB 5HHOA 1PKQE 2VL5B 4P46D 4O51A 5GSRA 1Q9OB 3BW9B 3KWWA 2V5SA 1P7HL 2ICEA 3EYOA 5I1HH 4JHBA 3SY0A 4F37K 4OLUL 1B0WA 1Q94A 1U8OA 3QZWA 3QUXD 3LKSB 3DVFA 2QQNL 1JPST 1BM3L 2VQUA 1J87A 2A77H 4PGJA 2F54E 1JGUH 3VFVB 4HGWA 1N2RB 3MRNB 3SGDI 4BA8A 1Q8MA 2DYPA 3D2UB 3ZDXF 3VXPA 1MHEB 5JW4N 3BD4A 2R0LH 1JF5A 1OP3H 1CFNA 4OCNC 4MCYA 1QFPA 4FFYH 1XR8A 2FLBT 1KIPB 1LO0H 4JN1L 4MWFB 4R9HA 3EZJB 3QFDB 1CGXA 2ZPKH 4ZDHA 1QA9A 3TBYB 1IKNC 1E4XI 2LTQB 1CXKA 1RULH 4XP4H 1T7YA 2Q8BH 1JHLL 3BN9D 2WW8A 4XPHL 1U6AH 4PJBE 4FQQB 5INCA 5HHXL 1NGPH 4HLZH 4MD0B 5KN5A 1RUMH 3WNLA 1A7QL 1R5IA 4MJIE 2LABA 4CDGC 4IJ3C 2D7NA 2P5EA 5J13C 1WISA 1MHPH 4FRWA 4OLWL 3M8OL 4PB0H 3VG9B 4YO0A 1RZJH 2X7LB 4JFDD 2JCCF 5C0GA 4PJ9B 1IAOB 3LIZL 1TETH 1DCLA 2X89D 2AXHA 5ENWA 1CK0L 3FQRA 2Z4QB 2P43B 3FQNA 1OF2B 5ILTL 2VXUL 1UXWB 2LAAA 2MTPA 1DVFD 4OZ4A 4OZFA 3IJHA 1OTUD 3S9DB 4QWWD 3F5WA 1RUKL 4NGHH 4LRIA 1WAAE 4LSQH 2BVPB 3MFFA 1WGOA 2X1XR 1KCRH 3L3IA 3MLTB 3PQYB 3WJJA 3I02A 3Q3GA 1HINL 5CS7A 1JZ2A 2SEBB 3EAKA 1B0RA 5B38G 3BIAX 1G7HB 4K7FA 4JO4L 3GJFH 3RPKA 4EI5C 4W4NA 1VEMA 4PRHA 4WCYL 4Z0XA 2EYTA 5JIHA 4KTDH 3MRBA 3C60D 5HHVL 3ESUF 4X8JB 5F7LB 2YRPA 1IM3B 4MB3A 1KG0A 2APBA 4NQDE 3VMNA 1A6WL 5CD3A 1WWBX 5BVPL 4F7MA 3MCKB 4Y2OA 5F7YC 4LCCA 2R1WA 2R15A 4JFOB 1M71A 5SWZB 4P2OB 3CFKB 1I3VA 5E1AB 4TTDD 1I7RA 5BVJB 5ITBH 1A6VL 1UVQA 3ILPA 4PRAB 4XWOD 2Q6WA 1N0XH 4JFEB 4YHML 1IVLA 3M45A 1XGTA 3CK0H 1U8IB 3VFTB 3HI1B 5EBWB 1CFTB 4GKOA 4YHPA 5GJSL 5FEBA 1QR4A 5EA0L 5D1XA 2CO6B 5HHOE 2EDFA 4WUKL 1AGDB 5J3HC 4FQ1L 5J11C 1OGAB 1UWXH 4CL7A 1F42A 5DDHA 2A6KA 4PGBB 3BKJH 2ZG3A 3ULVC 4G6FD 3PWJB 5B21A 2X1QA 2VDLH 4HWEH 2XTJB 4IRJB 3MGOB 4PD4J 3QUKB 4MA3A 3IGAB 3ULSA 3VGAC 1OAUH 2GTWA 2D03L 4X5XA 2W9DH 3KXFA 5GRWA 4MA8L 1A5FL 1NGQL 3QRGL 3IDXL 3ARZA 3V7MA 3SE9L 4EUPG 1RU9L 4IEFB 2ZUTA 1N4XL 5E8DL 4HULB 3DETD 4EIGB 3FFCE 4HZLB 2J7LA 4PLKD 3EW3B 3T0EA 4LHQB 4Z95L 5I18H 2MHAB 3HNTH 1MRFH 5DUPH 4OCSL 5IV2A 1A14L 1F4WH 5ESQA 2JELH 5C2BH 4O2FB 4OGAC 1HQRB 5MP6L 2XTLA 1FG2A 3VI3F 4I9WE 2ATKB 3UAJC 1KTKE 1A6ZB 3EJJX 1A22B 2DAVA 1CQYA 2IEPA 4KTEL 1JTPA 4CVUA 3WSQL 4L4VE 5BRZE 1BFOA 3QCTH 1QO3A 2BSTB 1FNEB 4NCC1 3OJVC 4NKMA 4QNPF 2VO5A 2P5EE 2PXYD 4M4RA 3DVNB 3HRZB 1T20A 3H3KA 4QHLB 5FCUL 4OLVL 3WD5H 3L5WA 2ADIA 3BO8B 4TNWK 4WWKB 3QIWC 4HUWA 1U8HB 2WIMA 4FA8A 1OOAA 4JDZB 4PJIA 1E4KA 2VLJA 1W2KT 1XH3B 4FXGA 1E4WL 3WE6B 1WZ1L 1TPXC 1SM3L 1AGFB 1HNGA 1CG9B 4LSSH 3QRFM 4Y1AD 3BPNB 5F72S 3VD4A 1RVFH 3WFHA 4GRWE 4P46C 1T1XB 4KUCF 5CWSB 4Z77A 2X10A 1V7NH 1U8QB 4K2UL 2AK1H 1BBJB 1IEBB 2DMKA 4EI6A 1WLHA 3WHXB 4YC2B 4AK1A 3QUML 4ZUSB 5EUOB 5SWQA 4OM0H 4V1DA 2DTML 3QUXC 1Q1JH 3Q1SL 4QRSB 3VXMA 4KFZC 5I73B 2YPKA 5C71A 1S7XA 4NNPL 2OR9H 3FFDA 4ZXBD 3MLSL 2EC9T 4HZAA 5E8OB 2NY1B 3BYTA 4PTUB 4R7NB 3V4VL 1UXSA 2A9MH 2BMKB 4JPVL 3MJ9A 4G9DB 4RIRA 1BFTA 4PGCB 3SQOL 3ABZA 3C6LD 4GAYB 4TPRH 1FFPB 2DLHA 1BGXH 1I9JH 5MEPB 3GSOB 4O58L 3IDNB 2R4SH 5F1IA 3UPAA 1LO4H 4GRWH 4BFEA 1H3PH 4F57L 1EHAA 3RA7L 3GRWA 3BN9C 4Z76B 2W9EL 4ONGL 3KG5A 3V6ZB 1HOCA 2ESVD 2XG4A 1NH6A 1HXMB 2V2WB 1QFHA 4XMLH 4HS6A 1OAZH 4PG2A 1JV5A 2YD6A 3DO7B 2HJFB 1MCIA 4QRUA 3AREA 4HFWA 1UT9A 4HWZB 3W0WD 1HKFA 1B6UA 4D8PB 4Z7UB 3QULA 1WV7T 1LNUA 3NVQA 3JWOL 2AJSH 4M7KH 5CINL 1A1NA 1NL0L 1FAKT 1ODAA 1N64H 3PWVA 5E6IB 5DJYB 5E7FA 3OX8A 5I75C 5ERWA 15C8H 3FHQA 1KC5L 4KVNH 2UYLB 4PGDB 4JZNB 1CVSC 4P2RE 3NIGE 5DA4A 3VFWB 1DVFC 4IOSD 3TNMA 2XQYK 4JREB 1YEFL 4DEPC 2VR9A 4NUJA 4KQ4L 1ORQB 3VW3L 5DJXB 1G6RH 4OGYH 3BW9A 2FIKB 1ZA3B 4QWWC 3MUY1 4YDVB 3WKNA 1NAKH 2B4CC 1V3JA 5IR1A 5E8NA 2AVGA 4Q9QL 1ZLVK 4XVJL 3BPOB 4JN2B 3ZE0F 1CWVA 2Z93B 3RDTD 3LKSA 1HSAB 4C56B 4LSVH 4EKXA 5GRVK 3QH3B 5D7JB 1FDLH 4UT6L 3WLWD 4OGZA 1FIGL 1BBDL 1N2RA 1LO2L 2NY5L 3MRNA 5IFAL 1FZKB 2ZUSA 5DJ8B 2UUDK 3D2UA 1GZQB 1MHEA 3K3QA 4BUGA 2D4FA 5EFIB 4HJGB 4NKIH 5IP4A 1X4ZA 3OJMB 1XCQB 2OI9C 5C6WH 4IIQC 3KPTA 3GSWB 1X5LA 1XF3B 2R8SL 1KIPA 3F6LA 4MWFA 3CSYB 2O5ZH 3QFDA 3IKCB 4JM2D 3N9GL 1J1OH 4XNYL 5I1JL 3TBYA 4KK8D 1ZT1B 4LKCB 1YEIL 3KYAA 1CS6A 2M2DA 3SDXF 3HI6H 4O9HL 2X40A 4NZTL 4NOBA 4JFQB 4HBQA 4TTDC 1SEBB 4PJHB 3HC3L 4FQQA 2OL3L 1Z6JT 4ZO6A 5BMFH 4MD0A 5KVEH 3H7BA 1ITCA 1CICB 2BK8A 3DTXA 4Q6IB 1AFVH 1YMMB 5EB9A 3MLYH 3T0DA 5IT2L 2X7LA 3U7AA 4PJ9A 1IAOA 2HRLA 1SBSL 5JOEA 5T1MB 5F96H 3VXME 5F71A 2GK0B 3O4LB 1YNTB 3QO1B 1OF2A 1Q9KB 4K7PY 2XKNB 1UXWA 4N1CA 5DK3A 1FCCA 3LVEA 3UZQA 1B2WH 3DETC 4ODSL 2H2SD 5JDSB 3TO2B 4LARL 1AXSB 5ISZB 2JLLA 2VXTH 2BVPA 1A9EA 4M6OL 3MLTA 3PQYA 5I30L 5GGSA 4QRQB 1FORH 4AH2B 1C5BH 3S4SG 2SEBA 1G7HA 4TOYH 1SBBA 4M6NL 4XC3H 1HH9A 1J12A 1CXEA 3VGFA 1PG7L 1IGJB 3MODH 3VRLF 5FOJA 1YEHL 4PLOB 5HXMA 4G6JL 2MCPH 4X7CC 3TT1L 4N5ED 2XZQH 4LCWD 4X8JA 3LPFA 4HBCL 3T77B 5FAAA 4M7JL 1IM3A 1UFUA 1N26A 2PXYC 1DTUA 3DPBA 5BZWB 2DQUL 3MCKA 2R69H 1CLYH 1MIEL 1RUPL 4G9FB 2DQCH 3TLRA 3CVHL 4HCRL 5C07B 4JFOA 5SWZA 4X80H 3P4NB 4P2OA 3CFKA 4R0LC 3BP7B 5E1AA 4H0HB 1R3KA 3B8SA 5FYKU 5BVJA 4PRAA 3NPZB 4UINH 3M1BB 4JFEA 3AY4C 4HD9A 1A7NL 5IEHA 1U8IA 3VFTA 5DMKB 4X99B 2O5XH 1MFAL 2DQEL 1CFTA 5EBWA 1MNUH 1MVUB 4EUPH 5E03A 4WI8A 3AMKA 3PGCA 3PWUB 5D7SL 3L3GB 3V4UL 5E2VH 1P4IL 1AGDA 4PUBH 3ARFB 2Y72A 4KKBD 3IDYC 4PGBA 1KCVL 1RQ5A 3LEYL 4R8WL 4POYA 5MERB 5DD3L 3ARGD 5GS1B 4IRJA 2CUIA 4XMKL 3QUKA 4H26B 5IB4B 3U7WL 3WUWB 4QOKD 3RUGF 3IGAA 4K3GA 4P9MH 4G3YH 4GKZB 3HMWH 4P3DB 1I9RH 4YZFE 4JO3L 2VZ3A 3K2UL 3HMXL 1NLBH 4ZXBC 5AYQA 1DBJH 2IG2L 2VZOA 3D39D 4HZLA 5I8EB 5JHDB 5HVHB 4PRDB 4TYUA 1QLEH 1ZLWH 1MJ7H 3IFNH 1QR1A 4KMQA 2ZUUA 4Y0GA 2H1PL 3D87B 1RURH 1A0QH 2MHAA 1II4E 3T09A 4U0RC 2HTKD 4HXBL 2VDKL 4WHYH 5KANI 1KN2H 3TC9A 3CU1A 4O2FA 3RWJB 1HQRA 4YR6B 3C6LC 1Z3GL 1L4IA 5DQJB 5B8CC 2ATKA 2PO6B 1HIML 4GRMA 1A6ZA 2XI9A 4XC1L 3N1QC 3GNML 2DF3A 2BSTA 2EXYD 1FNEA 3TZVB 1RZGA 3BZ4B 2VXQH 5L8LB 5A16B 3WS6A 1NANH 3DVNA 3HRZA 4GKNB 1OM3H 5F9JB 4QHLA 1U91B 3DYMA 2YPLB 5C0BB 1YYML 1S7VB 5GGTL 2IQ9L 1JGVL 4WWKA 2DLEA 1U8HA 2NY4D 2FEDD 3CSPA 4JDZA 4M1DL 4M43H 1XH3A 3QAZB 1XT5A 2OCFD 1UWEH 5FKPB 3WE6A 4LSRL 1AGFA 1CG9A 4OD2B 2VERN 5HI5D 1UACH 4N8CH 3O2DL 2LVCA 5C9JB 3BZDA 4RQQA 2A0LD 4ODTH 5DURB 3DGGB 3ZHLA 3MLRH 5T1LB 1SHMA 1T1XA 5CWSA 1CTNA 2QQLL 1OCWL 2C3VB 2LV4A 1BBJA 1IEBA 3KR3L 1KTDB 3WHXA 2V2TB 3NCCB 4ZUSA 3SDDB 5EUOA 4W4OA 3RDTC 5HHQB 3GM0A 4CRPA 4DW2L 4QRSA 4D0CB 3WLWC 3QQ3A 4KI5D 3MBED 1J8HD 5MENE 1MI5B 3V7AG 1VKXB 3V52L 4QRRD 3QUYB 3NMEA 3GMNB 5DJ0B 5E8OA 1EFXB 1TITA 3D9AL 4PTUA 4YAQB 4R7NA 2HT4D 2ZG2A 5DHXB 2ZUWA 2BMKA 3LQZB 4HIIB 3N06B 4HH8A 5IB3B 2KZWA 4G9DA 4PGCA 2IBGA 4EBQH 4H20L 5ID0B 4JM2C 1ZS8B 2O5YH 4FABL 4YJZL 4NP4H 1FFPA 1IC1A 5MEPA 3R8QA 2NTFB 3GSOA 3IDNA 4ELMB 5I76B 2Z31B 5TPWL 1MFEH 4RFNC 2WBJD 1A64A 1KACB 4OFVA 4Z76A 3EO1A 3V6ZA 3QXWA 3CDYA 3AS1A 2W1NA 1HXMA 2DL2A 3B8YA 3MOAH 2V2WA 2KQMA 3CCHB 1TZHB 4HEPG 3DO7A 1JWUA 2HJFA 4W70A 3VWKD 3CX5K 4HWZA 4D8PA 4Z7UA 5JO5B 2K3TA 3ZYOA 5BJTB 5JOPD 2I9LB 5E6IA 5DJYA 4JFHD 5IMLB 4R2GB 4TTGA 1CFQB 3AU1B 1BWMA 1QEWB 3KGRA 1S9WB 2UYLA 2DRUA 5D2NE 2V5MA 3K0WA 4NRXA 4PGDA 2I25N 3H3PL 4NKDB 4JZNA 3VFWA 2NY6D 2ZJSL 3UTPE 4JO2L 5D7LE 2F8OA 1ORQA 4WV1B 5DJXA 5F88B 2DQIH 1ZA3A 4YDVA 2H2SC 4X7FC 4APQD 2W60B 4L5FH 4JN2A 5IFJA 3KPSD 1YYLL 1OAKL 3C5ZB 1HSAA 4C56A 1F3DH 4WU5B 3QH3A 3JUZA 5D7JA 3Q5OA 2IC2A 3KYKL 4I3SL 1WC7B 2GUOB 4CGTA 3JTTB 3NZ8B 2QSCH 1FZKA 5DJ8A 1QSEB 1GZQA 2V17H 2CRIA 2IPUG 4KDWA 5EFIA 4HJGA 3OKOA 4CW1B 4LKXB 1KEGH 4JDTH 1XCQA 4XPGH 1A3RH 1Z9SA 3WUZA 3GSWA 2IANB 3CLFL 4RGND 4YBQD 3CSYA 3GI8H 3IKCA 1QBLH 2XZAH 2QADD 1IQDB 1JGDB 5FYJD 1JNNH 1A1MB 5AG8A 3MLWL 1ZT1A 3B9AA 4K55A 3LDBC 4DAGH 3KPRD 2X44D 1X5HA 1HKLH 1D5ZB 2FJGB 5IVXB 5CJOH 1SEBA 4PJHA 4B7IA 1KCSL 1GCFA 3I6KB 3DO3A 2GIYA 5FKAB 5J7CC 4Q2ZA 5TE6L 1CICA 1RAMA 4Q6IA 1J8KA 4HV8B 1YMMA 5HSFA 3IAPA 5KW9H 2BP3A 4H0IA 5LBSH 4NO5B 1XIWC 4WJ5A 5FHBH 5HYJE 4TQEL 4FQIH 5B3JF 4P5TD 5K9KB 3ARGC 1OT2A 3NGBB 3MRDB 2B1HH 3OF6D 5SX5K 3S35X 3NFSH 5T1MA 2Q3AA 3VFGH 3FO1B 2GK0A 3O4LA 2NQCA 1Z5LB 2VR5A 2WAHA 1Q9KA 4LHUG 2XKNA 4U2ZA 4RGMB 3K1DA 5KJRH 1ZKAA 2FZ3B 4KDVA 1V3LA 1CFBA 4HWBL 1TVDA 3EO9H 3LHPH 5E56A 5J56B 2HTKC 4FQ2H 3S88H 4QRQA 4AH2A 1C12A 2NCMA 1WT5A 1D9KB 3U79A 4K3DH 1AD9A 7FABL 1TJGL 2XY1A 4JEGB 3RAJH 5B22A 1IGJA 5JORB 2R1YB 4F58L 1EVTC 3UTOA 2PTUA 5CCKL 1RHHB 3PGDB 5C3LD 2EXYC 3T77A 1H8NA 1FV1B 2ARWA 1GGCH 4HWNA 2VLKD 3GMPB 2CH8A 4BH8B 5BZWA 5HTSA 4BK5A 2EKJA 4Z7UE 1A4JB 3K8KA 4G9FA 4HK3N 1FLTX 2DQDL 3NZHH 1J0HA 1NAMH 2NY4C 3P4NA 3FB8A 3BP7A 1OAQH 4N90E 2J2ZA 3TV3H 3MRGB 1P69B 2VITA 3M1BA 1JP5A 4PJ5D 1G9NH 2PR4L 1BVLA 1DQML 1LDSA 2BNQD 1AQKL 5DMKA 4X99A 4XPFL 4XXCC 5CIPB 1MVUA 1E6OL 5ICYB 5HI5C 3PWUA 4MVBD 3L3GA 3SDCD 3VA6A 3EOTL 4OZIB 1S9VB 3GEWB 4EQ2A 4PJFF 3ARFA 2NY2D 2A0LC 3DGCR 4I18B 5MERA 1A3LL 3DSFH 5GS1A 5I1CL 1NQBA 3UX9B 3VWJD 1TJHH 1RJLB 4WVRA 4H26A 4JKKA 1CQKA 5IB4A 3WUWA 4C56E 5I19H 5GRUL 1MFDL 4ETQB 4F80A 4X7DC 3MNVB 3KJ6L 2EDWA 4JFXB 1QFUH 4P3DA 1RZ7H 1IC5H 4L3ED 4KI5C 3GIVB 3MBEC 5I8OL 4JQXC 3SOBL 5JHDA 5I8EA 1WBYB 4PRDA