2DMBA

Solution structure of the 15th filamin domain from human filamin-b
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
124
structure length
124
Chain Sequence
GSSGSSGTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the 15th Filamin domain from human Filamin-B
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Filamin-B
total genus 9
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dmbA00
1NCTA 1PJ9A 1A47A 3DROB 3GBLA 4Y16C 5CJQL 4M7JL 1MIEL 3BD3A 3BH8B 3LPGA 4OQ1A 4KTEH 4F7PB 1KELH 5MEQA 1FVCB 1G7HB 4Y89A 1BLNB 5DHXB 4TVPD 1C7TA 2RIKA 3WIFB 1OCWH 4APQA 4DKFH 5L9DL 5T1LD 4PUBH 1S78C 2IGFH 3BPLB 4U6VL 3ARDA 1MH5B 2NY4C 4MQSB 4RISH 2OTUA 3HR6A 4K55A 2A6KA 1SHMA 2GKIA 2E8YA 3TPKA 1EEQA 4OD2A 2B1AH 3JV6B 4M9PA 4RMUA 3S96B 3ZTJG 4H88H 4ZUVB 1MAKA 2FATL 5EU3B 4OUOA 5GGSB 4F7TA 1I7UB 1D9KC 2DDQH 3C8KB 5TQ2H 3RTQA 2VZOA 3VFWA 2O5ZH 3FAWA 1N8ZB 4KHTL 5TDNA 2YPLA 4JFHD 1F6AA 3ZL4L 4NRZA 3O0RL 4PYGA 4ENED 1F8TL 2QHRH 2MCPL 1YEHH 3Q5OA 1DBAH 3IXTB 1NCNA 4YX2H 4PYHA 4U05A 4WEBL 5DVNA 5H94B 1HHIA 2QQNL 4FXGB 2DQCH 4Y19D 3HE6C 3ZDYF 5C1MB 2A9MH 3HAEB 5A2FA 5INCA 3QJFA 5BXFA 2VOTA 4IRZH 1KENH 3O2VL 5EPMA 2VZVA 4HH9A 3PQYE 2D3VA 2IBZX 3WIHL 4WWID 3X13B 2PYED 1DEEA 4U7MA 5CJBA 1C8PA 4NC0B 1KJ2L 2OTWB 1TENA 2H3NB 1X5LA 3AY4C 5TH2B 3FHQA 3RUGA 3T2PA 1S7XA 2Z31A 3RWHA 5HY9B 4OZFG 3TJHD 2EYTB 1LDPL 4C83A 1ORSB 2AJSH 4Z18A 4WW2A 5IHZA 2IF7A 1BVLA 2HFEB 2VITB 4JPIA 4Y4FB 1R5IA 3E3QC 1E6JL 3RWCB 1K4CB 3VXME 2AJZB 1J8HD 4PRIB 1ZOXA 4ISVA 4CVXA 3MRFB 2VXSH 3DGGB 3UTSD 3F12A 5BW7A 1T0NB 1GIGL 3ZSTA 3A6CL 4MD5B 1U0QA 4W4NA 5E2UH 3DVFA 4HS3B 4JANA 4IOFD 4OM0L 5SWQB 1ND0B 1RZJC 3QFDB 4XXCA 1F58H 5AD0B 3QIWD 2LQRA 5EU7C 2G75B 1ZLWH 5I2IA 1LNUA 1BQHG 4JO4H 1TXKA 1NBQA 1A7QH 1I8IA 3K1DA 4GXVH 5F9AC 5DD0H 5C07A 1F02I 3WFDH 1J8HB 2DRUA 2VXUL 1MHHB 5F1SA 5HPMB 1ULVA 1YEEH 2DM2A 4PRIE 1MCFA 4WIQA 1NGQL 5D1QC 1FFOA 3BISA 4NC1E 3VXMB 4KKLC 3EOBB 4WFFE 4H1LG 1ZHLB 3SE9L 2A6DA 3T0EC 2I60L 2DICA 5GRUH 2VDPH 2R0KH 4WEUD 3KNBB 2FWOB 5CGMA 4L9DA 5EO1A 3QIWC 5I16B 5IUSA 3GKWL 5B8CC 1FIGH 1MJJB 1XF2B 2BCKB 4LLWB 4HF5L 4RBPH 5HYSG 4QLRA 4LVHB 3ULVH 5FKAB 3O6KH 5C0BB 2EIBA 3T4AB 1H0DA 1Q9WA 3HE7D 3KYAA 1N6QH 1G7JA 3EFDH 2PUQT 1D3CA 4LHUB 1FYTD 2ZSWB 3PWVA 1TQBC 4QTIL 1YMMB 2JE8A 4UIKH 4HK3J 1CFVH 4LGPB 2VQUA 4XP9L 3KYMB 2V7NB 4MA7L 5L2KD 3PXHA 4PJCA 2WAHA 3CVHH 1KB9J 1R5IB 5KVFH 3HTLX 5FV1L 1YY9D 4X98B 5D7LA 3RVWD 4BZ1L 2HA1A 5BCAA 4OZHA 1MAJA 2DMBA 3GNML 4XVJL 5FCSH 4MJIB 1KGCD 3TZVD 4ORGB 2ICEA 5DR5L 4WU5A 2LV4A 4ZO7A 4AENB 5KANG 1RK1A 3IDXL 3O3DA 4HBQA 4R0LC 3MBXL 4BSWB 1EEZA 4NHUA 3QIBC 3P4MB 3ESUF 1CLOH 1RPQA 2AV1B 5MENA 4Q58C 4WDIA 3VE0B 4JRYB 3JTSA 2X70B 1E6OH 1N4XH 5D2NC 5CJOH 32C2B 2DYPA 2O61A 3QUZC 3IFNH 5DI8A 1EDQA 2V17H 1DFBL 5E56A 2GEEA 3W5MA 4NQCE 4FQQA 1MCHA 3QA3A 4BZYA 4HKBA 3VJ6B 3ULUL 1HHIB 2R0WL 3ARGC 2QKIA 3VXMA 3V7MA 1XH3B 4PJFB 3S37L 2EXWC 4PJEE 2A6DB 3MLPA 2J5LB 5EC2B 3KLAB 4M02A 5D9SA 4KV5E 2FJGA 3DV4A 1LGVA 1ZA3B 1G7LA 1GYAA 4J1UB 4MJ6B 4GAFB 3MXWL 2XQYG 1XEDA 5FYJU 3U30B 5FIEA 5CWSA 1YY8A 3QUZD 2DQGH 4U1SB 3QEHB 2D0FA 1RZFH 3MV9A 3UX9B 3FQTB 1FNEB 1A6VL 4ZFOL 4EQ3A 2X4OB 3MLWH 4JO4L 5GGRB 2RQ8A 4PRPA 3WXWH 3AU1A 4J3VA 4KPHL 3KS0J 3GGWB 4ZD3L 4B50A 1INDH 1XGQB 4MAYD 1GGTA 3QDJD 5GZND 3ARFB 4HIJB 4BH8A 2DWEB 1BREA 4XXCC 4M7LH 5C0RL 3I6KB 3C5SB 3MACL 3R8BB 3RWCA 5CD5C 2Y5TA 1WWAX 2BOCB 1UFUA 4IMLB 2AJZA 4MNQD 4N0RA 1KB5H 1A1OB 4GRMA 1BLNA 4V2CB 3UPAA 4YPGA 1S9VB 3FN0H 1A6WL 4AQOA 1T4KB 3MOBH 3RVTD 4MD0A 4U33A 3SGEI 5B8CB 2EDFA 1WFTA 1AR2A 1A6TA 2Y06L 5J11B 5C7XH 1RIHH 2OP4L 4XNUL 4NHUB 4OFDA 4NUGL 7FABL 2CO7B 2D4FA 4X4MA 3OAYK 2NTSP 3GKZA 3GMNB 4X7FC 4EUPG 4MA3B 3VG0H 4QRUB 1DBMH 4YHLH 4MYWB 1RHHB 3FQNA 1CDYA 4L4TE 1V3LA 5I1DA 3N85L 4AH2A 4X7TB 1RUKL 4EBQL 2EDNA 5CHNA 3NA4A 1BBJB 4RWHA 4Q9RH 2ID5A 4M6MH 3EYUH 4MB4A 4QEGA 3LDBB 3CXHK 3TH2T 4KTEL 4L8CB 2H6PA 4YDVB 3N50A 1AXSB 4KDTA 3M1BA 1K3IA 4NOBA 5F3HB 1IMHC 3VXSD 5HHXH 1UZ6E 1M6OA 3I85A 1DBBH 4M7LT 4XBGA 1JMZA 3GBML 4K3JL 4IHOB 5KVEL 2APXA 1BBDL 4MJ2A 1R3KA 2HJKA 1R5WB 4MDJB 5HI3D 3SJVE 4UV7H 1T22B 2ZCLH 1BMGA 4PGDB 2NY4B 4YK4C 2WSKA 1TFHA 5L2JB 2FO1A 3C9NB 1YUHB 1E6OL 2HFGH 1DCLA 3U48A 3PP4L 4LLMB 1XIWC 4DGVH 2YD2A 3E6FB 2DN7A 3RWEB 3VGFA 3OTTA 1IAIH 3LZFL 4QHLA 2O93L 2VL5A 5DHVB 4HIIB 3V6OE 1F58L 4LVNC 2YPLD 4H25A 1TZIB 1I3RB 4U1NA 2VL4A 2BVYA 3CLFL 3HUJB 4N90E 1FNAA 1KCRH 2XZAL 3Q1SH 5T1MB 3RY4A 2VC2H 2NZ9C 1MVUA 4IRZL 1P4IL 3BPCB 3HMXH 3Q3GB 3N1QC 4W4OC 1G84A 1NAML 2F53D 4JKPH 2VWEC 4JM2C 5GSVA 4LCIH 5KSVA 2NY5C 2BXZA 3P4OA 5KSUB 3D39D 5I8CA 1H3VA 1RHHA 3TBVA 1U8OB 4N0FA 4U1JB 1IC7H 1AO7B 4NP4H 4M61B 1ZS8A 1IAKA 4YHYC 2OXGA 2VAJA 5ENWA 1QFUH 3EJYD 3HG1E 1IM9B 3B2UD 4NQEA 4NWTH 3UYOD 4WO4D 1MI5E 1HHJA 4FABL 1QSED 5D1ZB 2EDHA 1AP2B 2G2RA 3QDGA 1ETZB 2AK1H 1HH9B 1OTUC 1DP0A 3ULUF 4D8PA 3CAFA 3CDFA 3NCYS 3GMLA 3WCYA 1DBKH 1X4YA 3HPLB 3UO1H 3O9WD 1MCOH 4U1SA 4IDJL 4HK0B 4X4ME 1IEHA 1IBGL 2OP4H 4XNUH 1FRGH 5T3ZE 4K8RH 2Q86B 3S7GA 4JY6A 5T1LA 1F6LL 3D85A 3GRWH 5SX5H 4Z0XA 1TNMA 4U1HA 4JG1L 4LDLB 3BP4B 4L3AA 4OGYL 3B2UC 5DD1H 2DDQL 3DXAE 5E6IB 3A67L 4D9QE 1U8LB 1MFCH 1P69B 4FMFA 2F54E 2BSTA 3N1PC 3L5JA 2NY7H 5I15H 4QXTA 4HC1L 4QY8A 3LN4A 1YEEL 1CGTA 3RP1A 3RX8A 1LMKA 1REIA 4P9MH 4EI6B 2DIJA 3MLXL 1TQBB 3LEXB 1J5OH 3E1F1 3G9AB 2EIZA 4MQXC 1GGBL 3L3GA 5D7IE 5ESQA 1XF4B 5I8KH 3JUZA 3P0GB 3P4MA 3OXRA 5C0DA 1IGML 3SCMA 1RVFH 1YNLH 4Y1AE 1G0XA 5T5NF 4PG9B 5FM5O 4Q6IC 3M8OH 5MERB 1JZ7A 2X1WL 3O6LL 4PJEF 1OARL 4QKXB 1FG9C 3ZDZF 1W72B 5MI0B 1KLGA 2O5XH 5D7IB 3T08A 4GG8A 4LAQL 3RPIB 1GPOH 1PZ5A 2HWZL 4PGEB 2BRQA 5AWNH 1HWHB 4EI5B 3U2SB 3QUYB 3LZFH 3QDMD 3HPJA 4GQ9H 4WU5B 3MV8A 3KPSD 3QIUB 5IB5B 5IW1B 3KLAA 4MNQE 3ILPB 1GGIH 5EFIA 3OPZL 3HZYB 1WT5A 2GY5A 3MJ9A 2QR0A 1MWAH 4Z7VB 3D0VB 5D6DA 3MRKA 1XIWA 3GSUB 5GS2H 5EZJA 4YHOH 3KPRA 4XNYL 2MWCA 4XC3L 1MIMH 1VKXA 2YBRA 3O6ML 5GGTL 4X80L 1CDUA 2F53E 1OTTD 1GCFA 2A6JB 3MOQA 4J3XA 2DYPB 1BOGA 3RGVB 5C71A 4KKAC 4UUJA 2BVPB 2EICA 3K8KA 3IYLW 1KB5L 2WINB 2GT9B 4G8GE 3BX7C 4Q9QH 3OF6D 4B0MM 4PJIE 5CEYB 5DEGA 2FDBP 5ID0A 3BO8A 3W39A 4MB5A 2R1WA 5D1XC 2I5YL 2XFXA 5GGVL 4Y88A 3F5WA 5F6HI 3GMPA 2VE6A 2IEPA 3CFCH 2VXUH 1T66D 4RQQA 3QAZC 3VH8B 4KJQC 5CILH 2R2EB 4GRLA 1YECL 2IPKB 1Q1JL 1QSEE 1MI5D 3SE9H 3NCBB 2UWEB 5EZLA 4UTAH 4KROC 4F58L 2PXYC 1ZGLM 1ORQA 3CH8A 1XGYH 2UZXB 3KVQA 4OI7A 1BFVH 5JDSA 3PV6A 4MQ7A 3EW3B 3VFGH 3TF7C 5GRVK 3S88L 2E9WA 4P3WA 3S98A 5KSVB 5F44A 1YNTA 4IDJH 4D2NA 4HWBL 1SM3L 3UBXA 5LAXB 3T8XA 4F9LC 1X5IA 1K5NB 4Q7DA 3P4LA 3R4DA 4XI5C 2UWEE 4Q0XH 1VPOL 2DJSA 3ZDXE 2APVA 4OAWB 2UVEA 1AQKH 3QA3B 3I3BA 2H32H 4PJ5B 1T4KA 5TF0A 2E9BA 4MNGE 4QYOB 4OKDA 4UT7H 1XGPB 3RGHA 2DQTH 2XI9A 5DVKA 2G5BB 3QULB 4RCAA 3MROA 3PGCB 4ERSH 4PJCE 3NCFB 3MFFA 3I3EA 2BXYA 3JV6A 3S96A 2NNAA 2W92A 1AGBB 3FQWB 5AD0A 4TUOB 3O6FD 1QBLH 2CUHA 1YEKL 3FQXB 4PJBE 3TT1L 3MLZH 2HFTA 1KJMB 4UZGA 1XF3A 5ERWB 5DR5H 2C3GA 1YMHA 4OCNC 3RU8L 3CFEB 4Z7WE 1S9WB 1YPZA 3QO0B 2P8PB 1R3IH 2FEEI 2XKSA 5I17A 2ZCKH 3IFOA 3VFUA 4ETYA 2C3WA 1OL0A 5HYFA 4LHJB 4ONHA 5MENE 1T6WA 4HD9A 4GMTH 4HDIB 4KJWC 3ECBB 3FB6A 3UTQA 4JEGB 2QQKH 3GI9H 4ZUSA 5CJOL 4IOFC 5J3HC 5C2UB 4PRPD 3M1BB 4MJ4A 5L8KB 2IPUG 5FYJL 4MVBD 3ZL4H 4Z77A 1RZIB 5DGQA 2JJUA 4PRAB 3K7UA 3NAAH 3OXSB 3ULUH 4ELMB 1DBAL 2QEJA 1U58A 2P45B 4JQIH 5IB3A 2IMMA 4KUCD 1AH1A 1T20B 4HWEL 3ULUD 4PRBA 3GSNB 3MRGB 5D7LD 3G5YA 4WJ5B 1IJ9A 1MVUB 5JHLH 1MPAL 1IC4H 3GK8L 4O5LH 2UY6A 4HHAB 1A02N 5DEFB 4MXQC 1JBJA 4CRPA 1PQZB 2NLJB 4Y2DB 4UV7L 4M62L 2ARJQ 2YWZA 1LO2H 4XT1C 3B9KC 3AB0C 3MCKB 4AYFA 4ELKA 4G6MH 5GGUB 2D0HA 3BP7B 4G8IB 1N0LA 3CVHB 4X4XA 5F1IA 4ZQKA 1KG0A 5I1EH 1VGEL 4PJEB 2KBGA 4TVSa 3TFKD 3S35H 5D2LA 2ZUUA 3O3UN 4NO2A 5IVXE 2ZKHL 2I9TB 2IAMC 2XG4A 5TPWH 2BNQD 3DGCR 4G7VH 3REWA 5CP3H 1KCUH 2VDML 5FYKL 4Z78A 5E0QA 2JCCA 4OD2B 4F57L 4C4KT 5HGBB 2VXSL 1T7YA 5F72S 1AGEA 1QVOA 1PLGH 1ZEAH 1XF5B 1YEDB 4M6OH 1BQUA 5D71H 3EO0A 1T3FA 3ZKMD 1G7MA 2GHWB 5DI8B 2WINA 2L7JA 1OSZA 1NANH 5TDPB 4OF3A 4ZAKB 5I17B 1DSFL 1NGPH 4GW1B 1UQSB 3MXVL 1Q0XL 2FGWL 4RZCA 3TZVC 4ONGL 1CI5A 4WI3A 3VXUB 2P42B 4TPRH 3DRQA 5JIIA 5GRWA 3IU4H 4RQQB 2G2RB 3QDGB 4XC1L 3LRSA 3ROLA 2CQVA 5F8QC 2CXKA 3MLYH 5BVJA 1EO8L 5KAQF 2YMXH 4ODSH 4X4ZA 1A6UL 5L88H 1G6RA 5DJYB 5L2KA 5KSBB 1AGDB 4JFQB 5JO5A 3BKCH 4HLZG 1JL8A 5JIPA 4LPUA 1QBLL 1J1OL 1D5ZA 4KK9D 2ZSWA 2HH0H 3AFLA 5CBEB 2WQRA 3F65A 4UTBL 1CS6A 3DUSB 3G6DL 1KJ2B 2IG2L 2WZPD 3T8XB 3T2QA 2GUOB 5ALCH 1XFPA 3PNWB 3DUUA 2JB5H 2NLJA 5JOEA 3C2AL 3V9FA 5JLZA 3U82B 3RA7L 4KK6D 4R9HA 1G6RL 3PV7A 3C5SA 3KR3L 5EU6D 4MZ3A 4X9GA 1INEH 1T1ZA 1X5AA 4FFWC 2P5ED 1A7PL 2FBJL 4LPYA 2D7NA 1I1AB 1KLUB 4CVXB 4Y1AD 3WNNA 4MAUH 5DMJB 2Q87A 4HC1H 1NFDF 4Z9KB 5HYSA 1BECA 5KSAC 4FTVE 3QQ4A 5J57B 3JZ7A 3F58L 4ZUVA 5IHLB 4QRRA 2AJXL 1SVZA 5GZNC 2HKHH 2ZCHL 4K3DL 1T7XA 4QCIA 2FD6L 4ZAKC 1FNHA 2A77H 4AEIL 4C56E 1I8IB 1N8ZA 3CFCL 2WBJD 5IFAL 4PRNB 4N0UB 5FGSA 2B8OT 3CNKA 5C07D 4NZDA 2DMCA 1FL3B 3FT4A 5IR1A 4XCEA 4YHIA 4J2XA 1L0XA 5LXGL 5IKCA 5C0FB 2R4RL 1X5ZA 2V17L 4PBWD 1A8JH 1W72H 4RRPG 3G04A 3QHTC 1XR8B 4KJYA 4Y4KC 4E42A 2DLFH 5EPMB 1F3DH 2W91A 3MRMB 3VXQA 1XF2A 2R0WH 3LSOA 1E4XH 2IPKA 1I1YA 1ERNA 5K93A 3CPLB 4XNMB 1GGIL 1WZ1H 4LDEB 5TDOB 3RTQD 4NUJA 1T7WA 4OGXL 3D18B 3RY6A 3S35X 5K59E 1WISA 3U1SL 3BI9X 4HWZA 1MFDL 4Q9RL 4Z76A 3V8CA 1QQDB 4G8GD 4I48A 2Z8SA 5C92A 2JJVA 4F3FB 1C12A 5DDHA 2AJUL 1OLLA 1A6VH 2F5AL 3NZHH 2AP2A 1EEYB 3BP6B 2EH7L 3MBEC 4LVNB 3SN6N 4EVNA 4R96B 5CD5D 5I1IL 3DGGA 4P2QB 3U2SA 3SGKA 1CFNA 4OZGB 2YHGA 1X6NA 1OAZL 5EC1B 3S5LG 2ENSA 1G0DA 4ODSL 2LABA 1DN0B 2BSRB 4DEPB 5H35A 3QDMA 1SMOA 3A6BL 3E2HB 2Z31D 4QRUA 3MOBL 4CN6A 4JQVC 3SO5A 4WO4A 3LV3B 4P4RA 2YN5A 4EN3D 5A3IC 2R1YB 3NFPB 2CLZB 3VWJC 3DIFB 3MLVL 4CVUA 2OR9L 4UTBH 2I26N 4HIHB 4RZCB 5EA0L 3QXWA 3S36X 4XVUD 4HULB 1FLRL 1ZANH 3KXFA 5T3ZH 4YXHH 4CDHA 3HE6B 3MSPA 4JFDB 4LLYB 3QQ9C 4N8VG 3TT3H 3UTQB 3DXAD 3S34L 1KCRL 3L3IA 2P5EE 1EO7A 3N85H 4Y8AA 1I8KB 5E8OA 3HC3L 1BP3B 1A7BA 1WCBA 1AGCB 3CMOL 3FQRA 4ZUWB 3GSRA 1BZ7A 2X44D 5AWNL 5GJSH 3ARBD 5JXAH 4M62H 5C09A 1G0YR 4OLEA 1TZHA 2CDEA 3HC4L 1T1YB 4EIZC 2XA8H 4LGRB 1D5XA 1S7SB 3U46A 2AEPH 3MRCA 5ABDE 4OF6A 2R2HB 4GG6E 4LPXA 4O02L 2A77L 2YR3A 4XPGL 4QWWD 2XN9D 4HFUH 1K5NA 1BBDH 2XICA 4K7PX 2O5YL 4FFZL 4XPAL 3S36H 3QUKA 2P5EB 4MCZA 3BQUB 4Y4HB 4LK4A 5IBUG 2PR4H 3LKOB 4HIXH 5CSBA 2R2BA 3VRIA 1J87A 2AQ3A 3BFOA 3W2DL 4WI7A 1FV1A 4L8DA 1OGTA 3OKOA 3L5XH 2V5YA 2QQLL 1DBKL 1R3LB 2VAAB 1BFSA 1OPGH 3N9GL 1Q1JH 3P4OB 5DGRA 3CLFH 1EBAA 3EBAA 3IJYA 3NCYP 5EBLA 4DAGL 4JFOA 3FFCA 4J3TA 5MEQB 3EOTL 4X6FA 5I1DB 4XC1H 3KYKH 1W72A 1ZS8B 3NZ8A 5LGJB 5I15L 3GMQA 1WWCA 3VFOB 1A9BA 4LSSL 2XXMB 3V52H 4AG4H 4Z7OF 3P73A 3U4EB 2MTPA 4JR9L 3V6OC 5L7XH 5I76A 2GCYB 4LRNH 4D8PB 3G6JE 5DK2A 1YA5A 1C08A 5F7FA 2EC9T 5C0AE 3OR7A 2W38A 3PWNB 4NJAH 2Q7YB 5IEKB 4M48H 5JW4R 1KGCE 3DYMA 3LD8B 2J8UA 1DJSA 1QZ1A 1IL1B 3MR9B 5DJ6A 1JHLH 4Y8DC 1NAMA 3LMJH 4U4BA 2C3VA 5DRXB 2V6HA 1H3PH 4PJBA 4V1DD 4Z7VE 3LKRB 1MJUH 1CGUA 1ACZA 4ZSOB 5E03A 4LLQA 3BSZH 1FRGL 5IQ7H 3TPUB 1KB5B 3U0TB 3GHEL 3BP7A 4G8IA 4AQ1B 1T03H 2BNRB 4JG1H 1OTTC 4P5MB 4Y4HD 4NWUL 1PG7L 5DFVC 4NO2B 3QEGH 3ULVF 3HC3H 2IANA 2NX5E 2D9CA 5J12C 4G6FB 5AYUH 2P24B 2AVGA 3SGJC 1BD2E 1P7KA 2YMXL 5IJKC 4PJDE 4I4WA 4XWGL 3NAAL 1MNUL 3I50H 4NOFA 2DLEA 2E7HA 4F33B 5DF0A 2X9WA 3HNTH 5IG7A 1AKJD 4LSTL 4O58H 4MA8L 3M07A 2K7PA 1QA9A 3BZFB 4YUEL 2I5YH 5IFJA 4EOWL 3VA6A 2AJYL 4P4KD 5CHNB 4QRPB 3L5WB 1U93A 4OCRH 2DJ4A 5F97E 2R15A 4YDJB 2JB5L 4H8WL 3WKML 1UKSA 3JV0A 3NPSB 2HAZA 3IDJB 1RFDL 3MV8B 1P9MC 5IB5A 2LU7A 3MRQA 1JYWA 5IWLC 5ANME 5JOPE 4RGOL 3GI8L 1ND0A 3DXAB 5GPRA 2NW3A 3SGDH 3FQWA 3TCXA 1GHFL 3GZKA 3C5JA 4TULL 5IVOA 2HMID 4NKMB 5KSBA 5GRZA 5TDOA 4BUHA 5DMKA 3D18A 3ULUE 2DQEL 3VCLB 1JYNA 1ZTXH 2P4AB 1M7DA 4AT6B 4NKOB 1FDLH 3U36A 3QWRD 2XZZA 1LO4L 5D7SH 1PY4A 3OB8A 1RULH 1Z3GH 4OZFB 1FO0A 1FYHB 4UT7L 3QZWG 5DMYA 1FORL 3OG4B 4JPVH 2Y25A 5EO1B 3FB5A 3L9RB 4R7NA 5EBWB 4U1MB 4YFLF 4P2RD 2VSCA 3VGAB 1QRKA 1RZKC 5HI5D 1Q0XH 2FGWH 4N1CA 4PJGA 1OB1B 1MCQA 2CDFA 1D6VH 4LLWA 3UDWA 3FN3A 2HTLC 2VDPL 4WENB 1FVEB 5KZCD 2B0SH 5DT1H 1NDGA 2NQCA 4P5KB 3B6SA 4MQXD 1WC7B 2A6KB 1HHGB 3ZLQC 5T3ZL 2ADGA 1KF9B 1RZKL 5F9WC 3LS5H 4N8PA 4F7TB 1AIFA 1P2CA 1YN7A 2W07A 2XZCH 3DO3A 3SY0B 4L29A 1IT9L 4MVBC 4ZFGH 3QFJE 4FZ8L 3UTSB 2X89D 5FOBA 3IAQA 4OFPA 1MFAL 3KGRA 1F6AB 1CR9L 5CSZB 2NZIA 4UMGA 3MZGB 1KG0B 1RZGA 4DZ8B 5CD3A 4ORGA 2DWDB 3CVHL 2AJUH 4AMKH 3BYYA 4LPTA 2C26A 1FE8H 4OV5B 3NZHL 3TN0B 5INCB 3B9KB 3R8QA 2EC9U 3GJFB 2AXHA 4OIIH 3F6LA 4F7EA 4O5LL 3RWFA 4X83A 3MREA 2OX5A 4FZEL 4YBHA 4YXLL 2A6JA 4PREA 1T3FB 1FL6B 3DX9A 1HK6A 4DFIA 5EB9A 2VUOA 3I50L 3ES6B 3MODH 2EKJA 4JO2L 3H9SD 3BIBX 5C0GB 1N4XL 2FIRT 5BQ7A 1YEKH 1KPUA 4RA0C 1MUJA 1XGQA 4IRSB 1QR4A 3SGJA 3VFPA 3RBGA 4NZTH 4RMWA 2L4OA 1ED3A 2GQHA 4UU9B 2V2XA 4LFHG 3GMPB 1CDCA 1MLBA 3B5GA 4GFTB 4JHWH 5GHWH 2OJEA 2ZWLT 1UENA 5E1AB 2QADB 3CFBB 3RVVD 4KTDH 1EK3A 4XPFL 4C56B 4JREB 1QFHA 2MKLC 1VCAA 2WUBH 5K9KA 1I1AD 1JNLH 2X4RA 5J1AA 2A9NH 4ZOCA 1D5XB 1S7SA 4JFDE 1DLFL 1M4KA 1HHGA 1FZJA 1NANI 1L6XA 1B0RB 1JZ4A 3VFSA 4IRSD 4XNQB 2C1PB 3MNZA 1MLCA 2DQHH 2HLFD 4KHXL 4EEEA 2DWEA 1AGFB 2AI0L 4V1DB 2ADIA 4M3JA 4TOYH 4MDIA 2JK5A 1JI1A 2A74B 3GSXB 4YEFA 4H1LA 1CLZL 5EO0B 3I6GB 1CICD 1D9KD 3L6FA 1I9IH 2F19H 2CO6B 4KRPD 4WFED 4YPGB 3PQYD 3DMMA 1OW0A 4L4JA 1BX2B 5FF6A 4HFUL 3B9KD 3F12B 4IRJC 4XRCA 4LIQE 4JPVL 3SKJH 1ZHLA 3DX8A 2R1XB 2W9DH 4DGYL 1LO2L 3QXDA 3DECA 1CGXA 4MWFA 4L9LC 4JM2F 1JI2A 4J6RH 4XMPH 3TFKC 4Y16B 1L9NA 4L3EE 3BKCL 3QFDA 4IRSC 5EN2B 1X5KA 3HUJE 3DBXB 4PJ9A 4TUOA 3GSRB 5ESAA 1H3PL 3D25B 5F8RC 3G6DH 4AM0A 1L7IL 2DLIA 5ADPL 2ORBL 1EVTC 5FA3A 2NW2B 1RZKH 1M7DB 1X5XA 5ECJE 4YPJA 1JWUA 1QLFA 5I8OH 1K4DB 3B9VA 2N1KA 4Y5XB 4RAVA 5SWSB 1G9EA 3MC0A 1RJYA 1WFNA 3O8XD 1A3LL 1NCCL 4Y19A 1U8NA 2O5ZL 2VE6B 3SKOB 2EXWD 5CIPA 2CPCA 4R6UA 4HQQH 1S7TB 2Q6WB 4ESKA 3U0WH 3MXVH 5ICZA 4U0QB 4JR9H 1RUAL 3KXFE 4O58L 2DB8A 4HMEA 2FJFB 4BH7A 4LLDB 1MHEB 8FABA 3Q6GH 4RBPK 1NCUA 4XCFH 2VAAA 1BWMA 3NCJL 5FO9A 3MMEB 1YJDC 3O2VH 1P53A 1EEZB 4JKWA 4M1DH 3FFDB 5DMGC 5GZOC 4ODTL 5IVXB 4NCC1 5DHYA 3T65B 5L88L 1UCBL 3LAFA 1VGKB 3S4SB 5EORL 3UJTL 5IM7A 3EDDA 2A6IB 1UKQA 5MHSD 3QO1B 3L95B 4NZUL 4GQPH 1V3KA 2HFGL 5IT2L 5D7LB 3GUTA 4U31A 2N7BA 3N1FC 5DURB 1JYVA 3D9AL 3NIFF 4ZUTB 1X5GA 1MJUL 5F7EL 4S10A 3RTQC 4JHBA 1R3HA 1D5IH 3CDGB 3DX8B 4NJ9L 5DMIH 3LEYH 3T2NL 4WUUD 3QQ4B 2IFFL 3D1MC 2AXGA 3G08A 4DCQB 3ME0A 3MA9H 4L8BB 4R8WH 1A6AA 1QPXA 4TSCH 1OTSC 4UAOB 5E4EB 4HAGA 3V5KB 4GAYA 5GRXG 5I1LB 1U91A 3X12B 1NEZA 3QNXA 4I8DA 2FHCA 2EXYC 3C09B 3FONA 4KKBD 1AKJB 1JPSH 1WITA 1MRDL 4Q6IA 4QOKD 2X10A 2AJXH 5JORB 1A4JA 2OZ4H 2X9XA 5JR1L 2B0SL 5DT1L 3IJSB 4S1RL 1BD2B 1EBPA 5MP6L 4PJDB 3C60C 2MSPA 4X9IA 4ZXBC 1JGVH 4UINH 4FQXD 2A83A 5F7DB 2Z31C 3QG7L 2KL6A 1KJVA 1ZSDA 1WT5C 3EGSA 4OUUB 5TQ0L 4KVNL 4KI5C 4L3EA 5EULV 3RWIA 3SQOH 3GSOB 5GS0C 5JMRA 2APBA 2PW1A 2J12B 2Z8VC 4X9FA 2P49B 1WFOA 2Z4QB 3LN5B 5IMLB 1UC6A 2K3TA 4BUGA 5J56B 2NY0D 5F6IB 3T77B 2FIKA 1AXIB 1QQDA 3Q2CA 1MHPH 4J7RA 5IW6A 5J9PB 1EXUB 1P2CB 4QXTB 3ET9F 2XZQH 4H26A 4M93B 2JIXB 4BFGA 1ZAGA 4D9RD 2CXGA 4HSQA 4KI5D 1YJDL 2VDLH 1JPST 2DTML 2WUCL 2RJMA 2D7OA 1I4FB 1BVKB 5AEAA 1UA6L 3OKOB 1HQ4A 1T7ZA 3CFJA 5KSAD 5D96C 3HLAA 4YHZH 5SWZE 2V5TA 4J8RB 4QGTA 4Z8FL 3CXDL 1C5CL 1VFBA 5LBSH 2XA8L 1T03L 5C0DB 4KY1H 2AEPL 1WTLA 3C09C 1EA9C 2IBZY 3NIFE 5CP7B 3T0EA 3RIAF 3BQUC 1GGBH 5HHNB 4JQVA 4NN6C 4MSWB 3UC0H 4U7KA 5AUMB 3VGEA 5I8KL 1I8LA 1FZOA 2E8ZA 1HDMA 1OSZB 4XNXL 4OLXH 1OP5K 2WBJC 1JK8A 3RGVD 1A7OH 4XPHH 4Y2OA 5BS0A 1Q9KB 1Q9LA 2MKWA 3VXSA 4LLYA 1U95A 3MCLH 2GFBA 3AMLA 3MUJA 3SBWA 3O6LH 4OZHF 3QUXC 1JP5A 1Z0MA 1DFBH 4OIBA 5D7KD 1QBML 4PIRF 1NFIA 1S5HA 1BFTA 1V7ML 2DKSA 1AGCA 4L5FH 3TO4C 1C08B 3RQ3A 2MJWA 4PP2B 5BMFL 4JFZL 5J8OA 3L7FB 4EI5D 1UZ6F 1UYWH 1IAIM 1JPFA 5E8NA 4JGUA 4NKDA 2ED7A 1DE4B 4JRXA 4TOYL 4PREB 1HZHH 4UUJB 5ESQB 1T22A 1CLZH 1NLDH 4NRXA 1MCBA 3RHWK 1AI1H 2Y36L 2AJ3A 2OJZL 4LU5L 1NGXB 1XMWA 3O6MH 3BXNB 4R90H 4KMLB 2WNGA 4YXLH 1DUZB 3HHRB 3V52L 5KVGL 2VTFA 3MRLB 4L4VD 2ICWI 1ED3B 1TCMA 2NZ9D 5HYJA 1MJ8L 3IFPB 3O41A 3G5XB 3CC5B 4P48A 1JV5B 4CW1B 3GBNH 4I1NB 4PRIA 2ICCA 3IDNB 5E1AA 1WIUA 3EJZD 1PZ5B 2F58L 3MO1B 3EDKA 3OKMB 4Y5VB 3CD4A 3ARBB 4Z0BH 3U7AA 3L1OH 1QFOA 5ENWB 2DQDL 1ZLUK 1OGTB 3GJEA 3KJ4B 4XBEH 4P2OA 3TNNA 5C70A 2VN4A 2R29H 1QRNA 4LSDA 2VLME 4RRPA 4RDQF 3MACH 4WFGE 1F3RB 1QRND 2Z92A 1JIBA 1HYSC 2Y07L 4MCYA 4B53A 4PJGE 5B38G 4JFDD 1CBVL 1W8OA 4JDZA 5BJTA 2NTFB 1PAMA 4KKCD 2ED8A 1T5WA 4TUJB 5B38A 3BE1L 2XT1B 5CEZE 3L5XL 4F15C 2JK5B 3VFGL 2HN7B 4X5XA 1OAXH 2AGJL 3QO0A 5MEND 1CTOA 1ES0B 4MNHA 4Q9BA 3BEVA 1U93B 5LG1A 3VFNB 1NCDH 2UV3A 1PX4A 3BPLC 4QYOA 2I24N 1SYVB 2EDYA 5B22A 1RURH 3OHXB 1EO5A 4R4BB 4ZO9A 1BF2A 4S1DD 4QHNA 1CYGA 3ARZA 5D2NE 5F89A 4RGNB 1QSEB 5D1ZD 2WV3A 2ERJC 4PLOB 4M6ML 2DD8H 5CSGA 3RY5A 4QGYA 4EJ1C 3VD3A 4U1GC 1SJHB 2WBWB 5SWZA 1RZJL 4MD4B 5C9JA 3IDYC 1QYGL 1Z2KA 5E99H 2O26U 5DUPL 2VXVL 3PWJB 1JTOA 5J0BA 3K0WA 1D6EB 5C09B 1XCQB 4TSAL 2AQ2A 4ZFOB 3MV9B 4WTXA 3L3GB 1F4AA 1HKLL 4XMKL 3VGHA 4XVSH 5EDXA 3WS6C 4AT6A 2N56A 4Z7QE 4HUKB 4MS8C 4K3JH 2BC4B 5SWSD 2XOTA 4YH6A 4EUPA 4NJAL 3WL9B 2FR4A 4XNXH 4GW4A 1UGNA 4XP5H 1U8JA 1MSPA 4JM2D 2ZCLL 1X3DA 5FAAA 3QIBB 1UKTA 3QISA 2Q8AH 3GI8H 4JFFA 4P4KA 4OZIF 3WHE1 1A3LH 1X9QA 1I8LC 4GW5B 4I18A 4X99A 2BFVL 5GGTA 3OJVC 2KPNA 4AENA 3WDJA 1MHEA 8FABB 4ZNEE 5IVZB 5JXED 1M7IB 2E5EA 4JKKA 3RRQA 3MGOB 3EJYC 2FECI 3JSSA 4APQC 1BQSA 4WDIB 1ZTXL 4N5EC 4BQBA 2NY4D 2YD5A 4OGAC 3V6FA 3ARDC 3WFBH 4P3DA 3EYSL 1J88A 3G6JB 4OCXL 3TA3B 1P1ZA 1CVSC 4GLRI 4UQ2A 2MQ0A 1W0WA 5GGSY 1UZ8A 2KUTA 2ARWA 3QSKB 1EZVY 2HRLA 1H8SA 4XVTH 6FABL 5J6GA 2JKXA 2VLJE 5DA0B 3VXSB 4ZUTA 1FNSL 5DYOA 4AEFA 3N0PB 1WUNT 4RFNB 3L3JB 3MGAA 3HN3A 4JFEA 3SE4C 2BERA 3O3BA 5D9SB 1T0MA 2OL3L 5D7JD 5FDWA 1YEIL 3MYZA 2ZPKL 2QSCL 1IFHL 2XWBB 5KSAA 3HNVL 1QFWI 3V5KA 3KYNA 1DVFA 5JHDA 4I77L 3TBTB 2R4SH 2V7HA 4MDJA 1DBJH 3MRIA 3EYOB 4ZAKA 1J05A 5IMLA 5A2JH 4FZ8H 4MQ7B 3DVGB 2OR8A 2QSQA 5FO7A 1SBSH 5L9DH 2VZUA 4M6OL 3OSKA 4U6VH 3W5NA 1UM5H 1PQZA 4K7PY 4Y2DA 5K9QG 4YDIH 1T2QL 4JN1L 5ADOL 4QOKE 4RISL 2YUZA 1JPSL 1RAMA 2ORBH 3MRHA 2R8SL 3DARA 5E4EC 3RHWF 4ELKB 3SE3C 1I8MB 3QCUH 5C08A 3RDTB 1Q9OA 2DM7A 3GIVB 2Z35A 4WUKH 4L1DA 1MI5B 2R69L 5DQ9B 4JN2B 3LN5A 1MCRA 1KTLB 2KDGA 4J8RA 1Z5LA 4RA3A 3S3PA 2A1WH 5HHMD 3H7BA 4HPOH 3VI4F 1VFMA 2AXFA 4JVWA 2ERJB 2YEZA 3DSNA 4I0PA 4KMTH 5JLZB 5EWIL 5DWUH 1TPXB 3RL2B 3DSFH 4K8RD 5HHPA 3BN9D 4NZTL 5CMAA 4H1LB 5I9QB 1ES0A 5KTEL 2FSEB 4GW1A 1PSKL 1JGDB 3L3HB 3VA2C 2XXCB 1DQDH 4BFEA 1FH5H 4HBCH 4OZGF 5D93B 4QT5A 5ALCL 3M17A 2IJ0C 2BDNH 2OSLA 2DQJL 1I4FA 3RL1B 3RA7H 3I75B 4LKXA 1CD1B 5IB4B 1UH2A 2XZQL 2EE2A 3LHPL 1FGNL 2OZ4A 3MV7A 3MRQB 2M1KA 4O00A 4I2XB 3LRSB 3ROLB 5LGHH 1DQQB 4J4PA 1XGRA 3PJSA 4O2FB 4XMLH 1AO7D 4K23L 3DO7B 4P46D 5CCKH 4H20L 4L3EB 5ESAB 2YRZA 3PWJA 1F4HA 4C57C 2APWA 4GQ9L 1YQ2A 1NMCC 1C5CH 3T4AA 1MVFA 2VYRE 2PW2B 3GBNL 2HKHL 5EG6C 4NO0A 1OP5H 2C9AA 2EDQA 2HFFB 2DQFA 3C6LB 3ZE1F 1G6VK 1S78D 4X80H 2GFBB 4P23B 3MV8E 2RAMA 4HH8A 3O9WC 1GZQA 4F3FA 5I19L 2E7LA 2X5PA 3KAAA 5DHVA 4F7MB 3I6KA 2JELL 1FNSH 4OM0H 4PLKD 4PY8J 3U83A 4JFFB 4PRAA 4CJ1A 3MRMA 3VXQB 3P2TA 5C08B 1JZ3A 4PJGB 1J0IA 2YPKA 1P84J 1JPFB 2R4RH 1MI5A 2P1YA 1U8HB 5D2LB 2OTUB 4JG0H 1A9EB 4U6YB 5DJ8A 5C0AB 1KBGH 3KPOA 3TYGL 3B6SB 3BGMB 5DJ2A 2ZG2A 3RVWC 4HKXB 1MHCB 5FHAL 4WUUA 4YZFF 3B43A 3PE9A 2ITCB 4CNIA 2AV1A 1B0GB 2XN9A 4PGBB 4CMMB 5I6XC 1MLCB 4KTDL 3RNKA 1KLFA 4YXKH 1FSKB 1MWAB 1DL7H 3HRZA 5IF0B 3OB0K 1OAUL 4M7ZB 1JNLL 1YEDA 5JUEL 3NFPA 1XGYL 1S7UA 3HE6D 3ULSA 4ZTPH 1L6ZA 5C08D 5D6DC 1MFDH 2DD8L 1NFDB 3QDHA 1INQB 4H1LH 4K7PH 1RY7B 4NNXB 2D7PA 3EYFB 4LNRA 3O11A 2B2XH 5E99L 1CK0H 3O3AB 2GJ6A 2BSSA 2FBOJ 3WHXA 4M43H 3L3DA 1J1PH 1HH9A 1U8KA 3MOAL 4PJAB 4HZLA 4JFXB 3PWUB 5DJZA 5HGDB 5EUKB 1I7UA 3REVA 3TBWB 3OG6B 4ZTOL 2N7AA 3ARGA 3PL6C 4L3ED 2ED9A 2YD7A 5FKPA 2H8PA 3HG1B 3RWDB 1XR9B 2BHYA 2NW2A 3DLQR 3CXDH 4Z0XB 1J7VR 1XT5A 2Y07H 3MRRB 3V0WH 2GT9A 1OT2A 2UUDK 4HS8L 1WVZA 4GSDH 4FQCL 1FFPB 3BE1H 1RJYB 3D39A 1GC1H 4LCWD 2WK2A 1ZT1A 4M93C 1N64H 4RGMC 5FUOL 2L0DA 4MJIE 1NCBH 4YQXL 5E00A 1R3IL 4MXQD 1HH6A 5D5MF 1AD9A 4FQHB 3BGFB 4G9FD 3RPKA 3DHMA 3MNWB 3KS0H 3O3EA 3QNZA 5HGAB 2YZ1A 2J6EH 3X11B 3VXSE 4BFBD 5DQ9A 5LGHL 3ARTA 4YHML 3QJHB 5C2BH 5JQ6H 3GSNH 3RI5F 2RCSL 1BOYA 1RZ8A 2ZUVA 4QHMB 4PJXB 4GRWH 1CE6B 3H7BB 2J8UF 1MRDH 4R7DA 5JXAL 3U0PB 2EECA 2G75A 4KJQD 1Z9MA 4NQCB 5IBTH 4XNQA 1T5WB 2PTTA 2DYPD 2AEIT 4FQXC 1HZHL 1LQSR 2JIXD 5D1QB 1P6AB 3FMGH 5C07B 3UTTB 1VESA 4LU5H 4OCMC 5EO0A 3I6LE 1JGVL 4OCYL 1TVHB 3KXFB 4OBRA 4OZ4A 2MNUA 3D3VB 4IRJD 3ZT6A 1JGUL 1SYVA 4WEMB 4R4BA 3UJTH 1A5FL 2RR3A 4MHHG 4G8FA 1UVQA 5DLMH 3WN5B 1Q72H 3P0YL 4U3HA 4G5ZH 1L4IA 5ID1B 1RZ7L 4ZUWA 5EU3A 4LEXL 5E2VH 1AC0A 5GQBA 5HYJD 2Y7QB 4X5WA 5MEPA 3EUUA 4JHAL 3SHSA 1P1ZB 4KDVA 2H2PD 1J0JA 4LQFL 1NGZB 4R2GB 4HUNB 4UT6L 4BQ6A 1LO0H 3R06B 4YBLB 5L2JA 1N3NA 1FN4A 1H15A 1YMME 1UWXH 3GMMB 1I3GL 3TV3L 5J6GB 1KC5L 5FYJD 1GGYA 5D2LE 5D71L 1T0MB 25C8L 4LCUA 1XZ0A 4ZFZB 1HSAA 5FUZH 4ZXBA 1MLBB 1BQLH 2IAND 4QHUA 3QHFH 3TBYB 4CU7A 5I66A 1CXFA 4HCRH 3WSQL 3BWAB 1LK2B 3QRFM 5CS7A 1FAIH 2FL5B 3U4BH 1LHZA 4LRNL 1QFWM 2VQTA 5K9OB 4GBXD 5HDQH 4NUJB 2BVOB 3HC0B 4R4NC 3C2SA 5EC1A 3O3DB 1PSKH 2OTWA 4KUZL 2K7QA 3UJIH 3IRPX 4NQXB 1ZVSA 3BW9A 4Z7WB 4PFEA 3L3OB 3K46A 1N7ML 4WFGD 4PGBA 4R97B 4XP6H 4CMMA 4M9OA 5DJDA 1KXQE 5GZOD 1A6UH 1UT9A 2BVUA 4KVNH 4U1GB 5I8CB 1TVDA 1MCNA 5E8EB 1JUFA 3FO1B 1TTFA 3NABH 4ZG1A 3TPUA 3L6FB 3NCEB 3IRZA 3OZ9L 2A9ML 1U2CA 4ZAKD 5C0JA 3VW3L 2B39A 5SX4I 1SY6L 4ZODA 1QUNA 4LSPH 2NXYD 5BMFH 4XRCB 4U3XA 3QULA 3O3BB 3GJEB 4H0HB 3VWJD 1JCKA 5D7KE 1ZHNB 2DM4A 4NM4H 4U0RB 3QUMA 3UMTA 1NBVH 4KVCH 4QO1A 2Q76A 5F7UA 1UB5B 2Q7YA 1S7WA 4MSWA 3PF2A 4HUUB 1V8HA 3WS3A 4TUJA 5B38B 4H0GA 4XWGH 2ZOKB 1A14L 3L3KA 3BMVA 4XBPA 2YUVA 1HSBB 1WBXB 2X4OA 3B3IB 4N9GA 3KHOA 3BEVB 1B88A 1FFPA 4MA8H 1KN4L 4NO0B 2LFGA 4F8QA 4PJFA 1IC5L 3O2DA 5E8DH 5ETUB 3QPXL 4PTTB 4AJ0A 3C60D 4AEIH 2XZAH 3Q1SL 4A6YH 2EE9A 5BS0D 1NAMH 4Y4FA 1S7TA 2Q6WA 5A40E 3QEUB 2DBLL 3FRUB 1UB6B 4FQXA 4QRQB 5EUOF 2VLJA 4ODWB 5A2IH 1U8IA 1TQCB 3IDYB 1GZPA 1N0XH 3F7YB 4L3CB 1Q72L 3P0YH 2HYMA 2P24A 3H3BC 2H1PH 5CINH 4MJ5A 4ZS6C 5ITBH 4GXVL 1GHFH 4H20H 4LLVA 4ODVL 2NCMA 1HWGB 3VD5A 3EYQC 1NCDL 1MQKH 1JRHL 1YMMA 4KMQA 2R4SL 2H2SC 1J0ZA 1M1SA 5F9OH 3B9DA 3GSQB 4S1SH 1IQWH 2R0KL 1LE5A 3UTZB 4XAWH 4P4KB 3NCCB 3ZE0F 1NC2B 2XTJD 3L7EA 4ZFFA 4A2LA 3BDYH 3DRTB 1FNGB 1BFOA 3AUVA 1QSFD 2XYCA 4JFPB 3WSQH 1AJ7H 3WUWG 2BY0A 4TSAH 4S11A 4X6EA 2EH7H 1XIWB 3GSUA 2PXYB 4K07A 4KUCF 4KROB 4TTDD 4G6FD 1AGBA 4QRRB 1K3ZA 5DK3A 1ZKAA 3VXRE 4WRLA 5EU7E 3FQNB 2QADD 1CGWA 3MGTA 4OZHE 3VXMD 3OB0H 1HEZB 1UCTA 1FG2A 4L4TB 4ODXB 3JV4A 5CEZH 1Q9WB 5D72L 5JPNA 1NBZB 1IGFH 4LIQL 1A2YA 3H7LA 4LMQI 1DLHB 3R1GL 2QKIB 4U1KB 4W6XB 2ZOLB 4KZEH 1WIOA 2CJUH 1CR9H 1OY3B 4LEOB 2PTVA 3EHBC 2F54D 4I3SH 4N5ED 3DV4B 5I9QC 5I1CH 4DVBA 4W6YB 4JY5L 4Z7NF 1WBYA 3SDDB 1QLEL 2RBLA 2KH2B 3MJ9L 5JZ7C 3WLBB 2Q3AA 5F21B 3BIKA 3MUY1 4PRID 1J11A 3MBEA 1CFBA 4MJ5B 4G9FE 4CL7A 4XH2B 1NGYA 3FJTA 2O5XL 4KI5E 3SJVA 4WI4A 4MAYB 1HHKA 4RWYH 3VWJB 1OWWA 1LK3L 3QWQB 1P84K 1IGIH 3VE0A 5DFVD 5KSUA 12E8H 4D9LH 4DOHB 1D5BA 4PV9B 2J8HA 1E0OB 4CDGC 2NY6B 2E9JA 1FVCA 5D1QA 1DTUA 3O2WH 3T3MF 4E5XA 1KN4H 2BOBA 1G9NL 4FRWA 1AQDB 3MLTB 4EXKA 4PJ7B 4LNRB 1Q9OB 1IEAB 1T83C 15C8L 2W60A 3QR2A 3WV0A 5I30H 1NCBL 4YQXH 3CFJB 1HN1A 4LQFH 5B8CA 2LU3A 2EH8L 1JWMA 1SYSA 3BN3B 1NMBH 3MROB 3QEQB 3L3DB 5DJ0A 5FO8A 3H9HA 4PJ8C 3BVNB 2CMRH 1X4XA 1G7LB 4JDTH 4JZOB 3VI3E 1I9RH 1MAML 4OFYA 2BFVH 5AUMA 4JKMA 1YMHB 4LBEB 3WNMA 3EO0B 2Q1EA 5LCVH 1HE7A 4QRPA 3BAEL 4ZPTA 4K2UH 1DUYA 1P5UA 2IPTH 4ONHB 5IR1B 4PTTA 2IPUK 3SDAA 1TIUA 1OAUH 1LP9F 4J12A 4OF7A 5HHME 5C6TL 2RHEA 2XQYK 2BSTB 5ICYA 4PRHD 2XWTB 3J7HA 1KCVL 4RNRB 3WN5A 3PWLB 1MCLA 1RIHL 3LY6A 3QNZB 4GAGH 2A1WL 3KWWB 4YHPB 1EHXA 1JNHA 5F7MC 4DVRL 4K8RC 2VKWA 4J6RL 1JZ8A 1KPRA 2SEBB 1DVFC 3QZWA 4HV8B 2JJTA 3MRGA 1E27A 1AGDA 2R0ZH 5ANMB 2ITDA 4G5ZL 1MRFL 2VDRH 1FGVL 4KC3B 4WI6A 3NTCH 1AQKL 4HAFA 1A64A 5IBLC 4EDXB 4POYA 3QUZA 5GISL 5HDBF 3WJJA 2BDNL 1UJ3C 2AK4B 5IM7B 3E6FA 3Q6FB 3BEWA 5T5FL 4MGXA 4XPBL 5I66B 4Y5YC 1KC5H 5C0BD 4WCYL 3SE3A 2VDKL 4PJ9D 4NO3B 4GSDL 5BRZB 2VRAA 1UH3A 2VDOH 3I3DA 4YBQD 4TNWK 4XHJC 3ETBF 2R1XA 2HT3D 1T0NA 4IBLT 3V4VL 2DI7A 3CDGA 4J23A 5KN5B 3QIUA 2KKQA 3TIDB 3GDBA 4YR6B 2EYRA 2JJSA 5H2BA 1RUAH 3B9KA 4KAQL 1CZ8L 3IF1B 2R23A 3BPNC 2VWEE 3NACL 1QFWL 5DUBA 1NQBA 5DD6A 1BM3L 1KCSH 2J6EL 3V6OA 4GMTL 2NMSA 1CFSA 3HB3C 5D1XD 2A6IA 4A6YL 3IDUA 5MERA 2D03H 1JGDA 3DVNA 3QH3B 4UQ2B 2MQ3A 1NBZA 4IMKA 1QTYT 4PRDB 5FXCH 3ZKXC 1IGTB 5L8JB 3AS3A 4KRPC 3W39B 4U1KA 3CUPB 1I1CA 2EDTA 3ISWA 4QNPF 3RUGE 5ETUA 5IVNA 4X6DE 5IW1A 5E70A 4JDVA 4NQSB 2Z8WC 4X7SL 3VFPB 5L6YH 3RWEA 4YC2C 4YEEA 4OF0A 1NSNH 3OMZA 4WWKD 1K6QH 4HKJA 4OCRL 3LH2L 1I7RA 1U3HD 4MNQA 3OR6B 4NQED 5A16B 1P6FA 2CGRL 3HE7C 3S5LB 4PGCA 4ODHH 4WY7L 3LSOB 1S8DB 1VENA 1R5WA 1GGCL 1LO5A 4CMHB 1T83A 1HSBA 1WBXA 2GITB 5SV4A 4C59B 1KEGL 1JFQL 3GIZH 1FZJB 5D6CB 3C9NA 3RX7A 4F80A 1LD9B 1VGEH 4OLUL 2EE3A 3ZE2F 1MEXL 2AKRB 3OX8A 3FFCE 4HJ0D 2B2XL 1H9VA 2AK4A 2ZKHH 3R0NA 5ACZA 4M7KL 3QUXA 4LPWA 1W0YT 2J88L 1HH6B 1NC2D 2XTJB 4HXAH 5EO9B 4K3HA 3BGAA 4S1RH 1LP9A 2R2EA 3OKKB 5E8DL 4PJAE 5MP6H 1UWGL 4PR5A 4YNYB 1LE9B 4I18B 3DTXB 2GSIA 4ZO6A 2B7DT 1Z3GL 3X11A 3GSVB 5I1AB 2COQA 3FB8A 2DS4A 3O45B 3VRLE 3UO1L 4DWHA 4JN2A 5BV7L 3LIZH 4JZOA 1IBGH 2YKLH 4OLZL 3UROR 3NIDF 3KPQA 2D7MA 5C0EA 2QQNH 4QCIB 5IWLA 4DK6A 1QSFE 4HK0A 3A67H 5HVGB 3BOVA 1B9ZA 1U6AL 5LGJA 3AROA 1HQRA 3FTGB 4XB7A 3ARRA 4XP6L 1MHPL 1YQVH 3P4NB 4FQJL 1QHOA 3BP4A 3QDJA 3V0VA 3MRBB 3VXTB 2A38A 5DFWH 3GM0A 5TE4L 4AL8L 1H5BC 3VWKB 5FYJE 5HYQA 2ILLA 1A3RL 4NQSA 4UBDD 4ALAL 4MNGA 1EAJA 5M94B 1KNOB 1BZ9B 1ONQB 3CU1A 3IU3B 3K8MA 3EGSB 2DKMA 1WJ3A 4P9HL 2EDRA 2IWGA 3CFKA 1XF3B 4ZDHA 5KS9F 1YEGH 3EOYG 5DD5H 1KXTB 2F5BH 3G9VA 1AJ7L 5E2WL 1JHTB 2NX5A 4L3CA 5B4MD 4PB9L 2PW1B 5HHVL 4NO5A 3U79A 1A4KA 1UACH 5FYLL 5F6IC 3IKCB 1UWEL 3U46B 5GS1B 2W59A 5JPNB 2E6JA 3RWGB 4DUXA 2FB4L 1KTKE 4GBXA 3ILQD 4NZJA 4KJPC 4D0DA 1A21A 5BVPL 4PJGF 4LAQH 1NGWB 3PDDA 1NAKL 3BP5B 3A6CH 1II4E 3QXAA 4J3WA 4WW2F 4XPHL 2FO4B 2FH6A 3I6LD 3SDXB 5SWZD 2H9GA 1U3YA 4ZXBD 2PYFB 1EHLH 4KZDH 1YDPB 5DMGD 3OAUL 3T0ED 3OKKA 2CK0L 3EAKA 1IC5H 1L7TH 3GIVA 3KPNB 1TZGH 2G9HA 1C5BH 3SKMA 4ETQA 5I18H 3BIKB 1SVCP 4L5FL 4E41D 4PLJC 1ORQB 5IESL 4K94C 4Z78B 4PJXA 5JDSB 4ZS7H 4NFBA 2D7TL 5DK0A 1Q8MA 1BF8A 1KPVA 1DUZA 4MCYB 1B2WH 1F00I 3GMOA 1CL7I 2PTTB 5DQJB 1ZLVK 1QA9B 3VGAC 2ZUQC 3VFWB 5GRUL 3SY0A 4M1CC 4B41A 3IFPA 1CT8A 4UAOC 5L8LB 5FB8A 4G7YL 5HDBE 3KHQA 3DX6A 3NA9H 4NCDA 5DJAA 5IQ9A 2B4CC 4HS6A 1J12A 5AZEH 4R4ND 2V2TA 2HVKB 1CDHA 5DJ0B 1S5HB 1Q0YH 2ESVB 4S1SL 3QIWA 2N4IA 1MREL 1DQTA 3ZHLA 3UJJH 4OCYH 2WM0A 2FCBA 1GIGH 1N7MH 4CVZB 4GRLB 1EJOH 2VKXA 5FYLE 1FYTE 3ARGB 3AREB 4GKOA 4P99A 4TVPL 3WS3B 1KFAH 4J3OC 3QUML 3LEVH 2DBJA 1OD9A 4NRXB 4YBLC 1CQYA 5TJWK 3ZDXF 1VFOA 1XIWD 1CF8H 2VQ1B 1YPZB 3GMMA 1CBVH 3U36B 3TESA 1VSCA 4LCCC 1KIPB 5D7JB 1CWVA 2R1WB 3MLUH 4FTVB 4JPWH 2V5RA 1M7XA 3E0GA 5FUCC 4LCUB 5J06A 3PP3H 5GGRY 1YMMD 2F8VA 3CC5A 4YHYB 1C1EH 1TCRB 1LO0L 1LEIB 4NNPH 1CZ8H 3U0TA 4PJDF 3QXVA 3VRJB 1LE9A 5E24E 4X7EC 4AL8H 4P57B 1BM3H 1KCSL 1G6RB 5DJYA 2R0LL 2BVOA 5M7QA 2D03L 1E27B 4PBXA 2X7LB 2GTZA 3IFLL 4WFFD 1KB9K 4XCCH 3MA7B 4TUKH 4CVWA 3W82A 4IRJA 4JY5H 4WEBH 3HNSL 5C0CA 5E8EA 2WLYA 5CP3A 3UTSA 3BRGC 1MCWM 3BEWB 32C2A 4UILL 4CAGA 5CBAA 4WNQB 3P40A 5EIQA 5KG9B 1XGTA 3UTZA 2MCG1 5EU5B 4U6TA 5HD8C 3EZ8A 3RVXC 2C5DC 1CN4A 1UCBH 5IQ9B 3IAPA 1A0QL 1K8IB 4XXDA 2G60H 4NT6A 4FFYL 1PDKA 2E7CA 3RVUD 5GRVL 3HLAB 4NZUH 2ICES 3REWB 1XCTB 4LGSB 1VEMA 3K4DA 5I8EB 1IC4L 3GK8H 2NW3B 2B1HL 3VDAA 4MNQB 4XPGH 2XTLA 2BY3A 3MYJA 5CP7A 5C09D 1DVFB 3UZVB 2Y7QA 4X5WB 4JFHE 3T2NH 2JTDA 4NKMA 2D7TH 4PJ7E 4F2MB 2YC1B 2CLVA 4HXAL 1B2WL 1KELL 4AIZB 1H15B 4F9LA 2AJVH 3LQZA 4WHYH 3MV7D 2JCCE 4OJFH 2GW5A 3X3FH 3VXUA 3G6AB 1RI8A 3BDXA 4PJCB 3VRLF 4KQ3H 1WBZA 1ZGLP 2Y06H 3SDXA 3MLSH 5C7XL 3BAEH 3ZE0E 3G04B 1IGYA 4QRPE 2HLAA 3ZKNC 1UXWA 5BRZA 4YGAB 3KPNA 3L7FA 1OM3L 5EZIH 4YAQB 4CADA 2NYYD 2MFNA 5DVLA 2P44B 5BRZD 3O8XC 3NIDE 4HUVA 3LQAH 3BPCA 2DI8A 5TQ2L 3LH2H 4HJJL 4LARH 1CE6A 3QG7H 2R39A 1BJ1J 1S7XB 3ZZ1A 4LSSH 4YC2B 4AG4L 1KFAL 3QIUD 3ALPA 1HOCB 4O4YH 4I0PB 1QVOB 2ADJB 1CF8L 4N8VB 1D5BB 4NC2B 3OKEA 3G5XA 1I8MA 3MCKA 3OF6A 4DK3A 5KG9A 3IU4L 2P8MA 4OZ4B 4D0CB 5CSZA 4O9HH 1IKFL 2FX8L 4XXDB 5C6PB 1C1EL 4X6CB 2ZUXA 3DNKA 4GJTB 5CJQH 4Q2ZA 2AERT 1H3TA 1UM4L 1X5FA 4YLQT 3K2MC 2OMBA 4XPBH 1IQWL 4DCQA 1A6WH 4JZNA 5DVOA 4WCYH 1DQQA 4X6BB 2YOCA 5HGHB 1J1OH 4R2GD 3GJFK 5KBNC 2CKNA 3F7QA 4CU6A 3TBTA 3S6CA 3QDME 3V4VH 4S1DC 2CDEB 4G6JL 3LOWA 3V7AE 5BV7H 1QD0A 5T1LB 3MV01 2QADC 5GS2D 4LHUD 4ZSOE 2F74B 1UEMA 3VG9C 1FFOB 5E6IA 1ZT7B 4UT9L 2BZDA 3JWNC 2W9EH 3U4AA 5KTEH 2GUOA 4FQIL 5E6ID 3SDAD 4U1IA 4HWNA 4WW2B 1OGAE 1CDJA 4MNGB 3IDXH 4OB5H 3H9ZA 4K9EC 3X14A 3UTTD 3WO4C 3WDIA 5F88A 3IDGB 4ISVB 1CVRA 3AXLA 3U9UB 1A7RH 3K80A 2X4QA 4JZJC 1R3JB 2X4PB 4BKLB 3VU2A 1QSVA 4FQ2L 4N0UE 1OTUD 5FKAA 1QHPA 4FXKB 4QHKI 3IKCA 2P8LA 5C09E 5HI5C 4P9HH 3MGOA 5EOCH 5EZOL 4LRIA 3FHAA 2EZ0C 4MAYA 5F1KC 4LHUA 5CAYB 1IEBB 5EBMB 2CGRH 5B39G 3CU7A 4IS6B 5B21A 1G7IB 5HTSA 3WIHA 3UEZA 1N26A 2X1QA 3KLDA 3L95A 1MCCA 3MUGB 1AO7A 3UTPD 3P30H 5DJCA 1KCVH 2G5RA 3T0VA 4ZOEA 5TFSL 4A6YA 3X3FL 1GOFA 5KVDL 3V5DB 5KW9L 1DVFD 2W60B 2XTJC 4FQLL 1T5XB 3O2DH 4NT6B 5KVGH 2P5WB 4HS6B 1RJLA 1WAAE 3MLSL 4N90D 1F6FB 1R3LA 3LEVL 4G8GA 5E2TL 2GJ6B 2EDJA 2AXGB 3G08B 1MJ8H 3VFMB 3TN0A 4K8RL 2F54B 2D9QB 4Y16A 3MNVB 2EZ0D 1WIPA 3WXWL 1B0GA 1LNUB 3DETD 4KJYB 5D8JH 5HGDA 3TJEL 4M4PA 1R0AH 1CGSH 4GG6F 4N0CD 2VC2L 5DRWB 1G7PB 3U1SH 2BY1A 1QBBA 4NPYB 3LRGA 1S7UB 5I30L 2R29L 4M7LL 3LIZL 5DRNA 3DVGA 2EKSA 1INQA 2F74A 4NYLA 4LSQL 4JCMA 5BQ7B 2ARJA 2WWKT 2X9YA 3PWVB 1J5OL 3TWCL 1GZQB 4PUBL 4QRRD 4NQTA 1MCIA 1NC4A 4RNRA 1BZQK 1U6AH 2VL5B 4JRYE 1YPZF 2H9GB 3LN4B 5LQBL 1RZIA 2W0PA 4E42B 3BT2H 1A1NB 1RJZB 3IDMA 3F7VA 35C8L 2UWEA 4PGCB 3A6BH 1AHWB 4U6YA 2I60H 4UILH 1RD6A 1CFNB 3ARFC 3N06B 2RGSA 4OD1H 4MLSA 4WU7A 4X9BA 3HA0A 3ZDZE 1KUMA 5EUOA 4R7DB 5H35B 1YNKH 4KFZC 3LKNA 5KS9A 3MNZB 5IW6B 2VIRA 4O2CB 3RJQB 4DGIH 1DDHB 3MRHB 2OYPA 5DDHB 3I02B 4D3CL 3UZQA 1XF1A 5IFJB 4WGWB 3U30C 1UWEH 1Z9OA 1LEIA 4CW1A 2F8XC 5HI4D 3QQ3A 3QXTA 4RIRA 4WFEE 4Y5YA 4EVNB 2GYSA 3ZMRA 4KKLD 4UIKL 3DX7B 2HVKA 3SE8L 1CLYL 3O81A 1VB9A 4W6WB 4P3CL 4PJ8D 2GY7B 3NN8A 4X6BA 1P7QB 5E9DE 3OAUH 4F33A 2JLLA 3EJZC 3FCTA 3O4LD 1JPGA 5D7JC 2XKNB 1L7TL 4YHMH 2YUXA 4GAYB 1MCKA 2XV6B 3D2UB 4KQ3L 3TCLB 3PDOA 2DMKA 4L4VA 1E4WH 4QXUL 4L9LA 4OCWH 1HQRB 1XGTB 2APTA 5DJXA 3M17B 4AIZA 5ISZA 1TJIH 4WFHE 3GHBL 4HGMA 3NACH 2EEBA 2ZSVB 2W0KA 5KJRL 2HTLD 3M8OL 1ZGLA 5J13B 4X8XA 2VLKB 2I9LB 3PWPB 4WTZA 4MA1B 2Y5TB 2FWOA 1NCAL 5GGQL 3WS6A 3IGAA 3L5IA 1GPOL 3S88H 1WSST 3AXLB 3FL7A 3NFSL 4Y5XC 5BVJB 2FEDD 3B5TA 3F8UB 4P49A 5AZEL 1S8DA 5EOQH 1QRNE 3PWPD 5E1HB 1D6EA 1EFXB 3QHZL 3PIQB 5GSRB 1VACA 5INDA 4S0SD 3TVMD 4N8CL 4IDLA 4PGDA 1FLTX 1A6ZA 3VMPA 1S7RB 4OKVB 4JHAH 1NAMB 2GK0A 4XCYB 3VWJA 2OQJB 2HJFB 1YQVL 4FQJH 4LLMA 1KN2L 2H32B 3QI9C 4OCLC 3HFMH 3QFJD 3QUMH 4GW4B 1U8PB 1HSAB 1T89C 3VXOB 1DBJL 4OGZA 2E3VA 4Y4HC 2AJVL 3IDNA 4OBSA 1X4ZA 2CKBH 2VUYA 3W9DA 2HLAB 3SGDI 3CVHA 4MQTB 3U9PH 1G7QB 5F1NA 4OLYL 3V5DA 2VLRB 1JGLH 3SDCC 2PNDA 3BKJH 1T1WA 3TO4B 3BN9C 4P5MA 3STZA 3HPJB 1RUML 3KPSA 4TRPL 1QP1A 2I9TA 5EIIA 4JRYD 1WC7A 5C0IA 4F37F 2IANB 4G43A 5CGYC 3ZYOA 1SEBB 3EIFA 5CILL 4NN7C 43CAA 5DC4B 4D0BA 1QG3A 5FGRA 3HI1B 2E9IA 1ADQH 2FX7H 5EUOE 4NSKA 1BFVL 3WXVH 3C6LC 4N8VA 4HXBL 5SX5K 4YDKL 1IL1A 1GL4B 4NGHL 4Q97A 4M61A 4PB0H 1I3UA 1TPXC 1JK8B 1BGXL 2PN5A 2IANE 4ZOBA 5KVFL 4O4YL 2HKFL 3QNYB 3DWTA 1MCWW 3D87B 5I71B 2VR4A 2CK0H 1DBML 4CMHC 4FMKA 2QBWA 3WHXB 3QUMB 3VW3H 3PHOB 5F7DA 2NXZC 1WEJL 3IDMB 1VEOA 4IIQC 2B5IC 4NBZB 4ZUUB 3REVB 3IDGA 3HMWL 4EQ2A 3TA3D 5FHBL 4RMQA 1I85A 1U3HA 3IDIB 3GSOA 4LCIL 4Y0GA 5I71C 1S9YA 3HNTL 4XBPB 2LU4A 4G6AD 3PIQA 2KZ1B 3QJHA 5GSRA 4N9OB 1PG7W 1IC7L 4ODUA 2XA3A 2AJYH 4GUPA 4OKVA 4XCYA 4NQCD 5ITFB 3ARED 3NA9L 3QPQD 2P43B 2Z93B 3QAZB 3OX8B 2ADJA 5E2WH 4PJCF 1TMCB 1LEKB 4NWTL 4F7PA 3INUH 4ORZC 4NN7B 4PY7B 3CFIC 3FB5B 5HPOA 2VLLA 2YD6A 1FZMA 3QUXB 1ZLWK 5GGUA 4OI9A 1NC2A 3L7EB 1NLBH 5K9KB 2NY3C 2M2DA 4NQEB 1T21B 4Z5RA 5E08L 3VXUE 1EJOL 3VG9B 3KDMB 4CUCA 3C5ZD 3ULVE 4EN3C 5A3ID 1J9CT 5DA4A 5E5RB 5IOPA 4HMDA 4KKNA 5F96L 4NM8L 3LDBC 5HGHA 1IEBA 2P5WD 5EBMA 4HWEH 3RUGF 4QNPE 2WLZA 4GRWF 5B39B 3JTSB 3ARQA 5ILTH 3B4NA 3HG1D 3HPLA 4K7FB 3S3SA 2DL2A 5C0BE 1OAKL 5DQDH 2E6QA 1CXKA 3RL2A 4J4PC 5LQBH 5ACMA 3DX6B 1Q9KA 3PL6D 1JMXA 3FTGA 4PPTA 4U1HB 2DQIH 5D1XB 3HFML 3OGCA 4G80B 3T1FA 1CFTA 1EFQA 3DRTA 4KK6C 3UYRL 1H3XA 2BHUA 4M5YL 2X4UB 1GOHA 1OCWL 3AVEA 4LEOA 3FRUA 3RGVC 4JLRB 4ZXBB 2X09A 4KV5F 2WBJA 4PJ8A 1J1XH 2ZUTA 3U9UA 3UTTE 4X9HA 1T89A 2DLTA 1M71A 3CX5K 5DO2D 1F90H 3V4UL 3UZEA 5E5MB 5ICXA 2PTUA 1T1YA 1FG2B 3KR3H 4L4TA 5IEHB 4FABH 1FCCA 2OLDA 3MBEB 5D8JL 5H8DA 1INEL 5D6CA 1OARH 2X41A 5TE7H 3BXNA 4JE4B 1ZEAL 1KIRA 2Y23A 1VFAB 4HT1L 3MV8D 2DAVA 3CH1B 4Y19B 4PRHE 1U92A 4TVPH 1G7HA 1DSFH 1F8TH 2MCPH 2QHRL 4JHZA 2C4XA 3D6GA 4YX2L 4U1MA 3T04D 4LSQH 1OSPH 3VH8G 1WGOA 1FZKA 3IJHA 4FG6D 4HS8H 5DD3H 1K8DA 4ZQKB 2EO1A 3AS1A 3MV7E 5F1OB 3HCVA 4OLVH 3FB8B 1RHFA 1MFEL 5DJ8B 2IAMD 5M95B 4PLKC 3OXRB 1FVDA 4XAKE 43C9B 4WHYG 3BHBB 3DURB 3PQYA 1JPGB 4PG9A 4CGTA 2BP3A 4M1CD 2VZSA 4JO3L 1MCSA 4I0PD 2QQQA 2VDNH 3WFCH 1J8HA 4NQDB 4PP1C 4ZPTB 3NFSH 2CKBB 5L0QC 3NIGE 5CEYA 5BOZG 2Q7NA 3EYFA 4JQIL 1E4XL 1QSZA 3RI5K 1MUJB 1IM9A 4XPFH 1OOAA 1ACYL 1YEJL 3MBED 4UDUB 4F58H 1I8KA 3RZWA 3HKFA 3MRPA 5TE6H 3IS1X 3KPRB 4KH2A 1Q94B 3FT2A 4MAUL 1BZ7B 3F7VB 4GOSA 3TBWA 1MJ7H 5JQHC 4L8SB 3QNXB 3D25A 1WWBX 2APFA 1BOGB 4N1EA 3KPPA 4NFCA 4GMSH 1SM3H 4PD4K 5DTFA 2P48B 3OPZH 3RY6C 4LHQB 4YJZL 1VDGA 1ZVYA 4G6ML 1I9RL 5HHMB 5BW7C 5GJTH 3BD5A 3KJ6H 3T77A 4YHOL 4PG2A 4HWZB 4C83B 1MIML 5GGTH 5CEXA 5FYKD 5LCVL 1NMAH 1OAZH 3PGFL 5IFAH 2FLRT 4F7MA 5D5MB 4NKIL 5FYKH 1KB5A 2DLHA 1TJIL 3OAYH 4X98A 3TV3H 4PJ5A 5JIKA 3O3EB 5HGAA 3PGDB 2NY2D 1EPFA 1GZPB 1R24B 4HV8A 5TF1L 2EYSB 3O8XA 4AY0A 1CDBA 3UPRB 4N1HB 3HS0A 3RU8H 5F7WC 1YEHL 4YGVA 2VXQH 4LLUA 4RGNE 4CN1A 1YEFH 1F90L 3TJHC 1F2QA 4P4KC 3V79C 1OM3H 4CKVX 4OGXH 1CXEA 1URLA 5HDQL 3V7AG 3QCVL 3S4SG 4L9LB 2YPLB 5BO1L 4OB5L 1WEJH 4PV8B 1Q9LB 2NY5H 5F1IB 4YHNB 3BKMH 4FS0A 1TTUA 2ZSVA 2OSLB 4DN4H 3BZEA 4G9DA 1ZGLB 3D3VA 2DM3A 2HTKC 3VFMA 2VJXA 4ELME 5ISZD 4X6EB 5C0ND 2R23B 3MRDA 1A6AB 1FHGA 1GXEA 4H5SA 5EOCL 5EZOH 3IS0X 3S3JA 2IG2H 3FOMA 3FRPG 3C5JB 5E5MA 5ICXB 2DQTL 1S5IH 1YY8B 1CIDA 1FZOB 1Y6KR 2EDOA 4KAQH 4DZBA 4XX1E 1J05B 3EHBD 5JA9A 5INDB 5TH2A 4HUWA 1JWUB 1QLFB 2A2QT 1IGTA 5JOPD 5JDJA 4URTB 2FLBT 1AD0B 5JW5B 4Z7UF 2PO6B 3WFCL 3NGBB 4PJDA 1U8NB 4DKAA 3F5WB 1VHPA 1OW0C 1WBZB 5LKNA 1IARB 5DURD 4HGWA 3X3GH 5TPWL 4UDTB 3S37H 4DUWA 1KJVB 1QACA 5F9JB 4PJEA 5CKAA 1EIBA 3VD7A 2DTSA 2QQKL 3GI9L 3L5HA 1K6QL 2CRMA 1L0QA 4JPKH 1ADQA 5FYJH 3CMOH 1FVDB 1NGYB 1F45A 1FC1A 1I9JH 3ZDYE 1U3JA 4P2RE 2AEQL 1YN7B 2NY2B 4FQ2H 3D0LA 4GBXC 5J6HA 4XHQA 3N1GC 4JRXD 1FQ9C 1KEGH 1G7MB 1QR1B 1K9TA 3QI9B 3QG6A 1KULA 4PRPE 1Y6NR 5JHLL 2QSCH 1MHHA 4DJMA 1J1XL 4PR5B 2LVEA 4GG8B 1UJ3B 4OFIA 4Z5RB 2VR5A 4NKIH 4ZPVB 1WZ1L 4YBQC 5J1TC 1JNJA 4LFHD 1HCFX 2DI9A 1KXVC 1KACB 4PG2C 3SQOL 5J89A 1N6QL 2FYYA 3IVKB 4XAWL 3KPQB 3QB7C 3IU3A 2MQCA 5SWZB 4DEPC 3BKJL 3MQIA 2WIIA 3BRFA 2XKNA 2XWJB 1YNKL 3IDIA 3PWNA 4PY8I 3ARYA 5IEKA 2X40A 1TETL 3T0WA 3JWOL 2HJKB 1IILE 1GRWA 1OAQH 4NO5B 4N0CC 5TDPA 1IQDB 3HB3D 6CGTA 3CFEA 3T3PE 2HT4C 3CX2A 2B1AL 4WI8A 1VPOH 3BO8B 3OGOE 2FIKB 1X7QB 4X7DC 1S9XA 1I75A 3EOTH 3CH1A 1FCGA 3B8SA 1KJ3H 3SE8H 3W81A 4PJHA 1EHAA 3T0EE 1YYML 3WNOA 3D3VE 1S7VA 1N6VA 3JXAA 2WBJB 1UB6A 4QHKJ 4K3EL 3CFKB 1I3VA 1IVLA 4M5YH 2XG5A 4ELMA 4E0RA 2Z8RA 4HGKC 1FJ1B 2ZCHH 4K3DH 2GSGA 5EOTB 2X4RB 4JO3H 1A4KB 1F42A 5KN5A 1HILB 4DKEL 1JVKA 4NZRL 1ZVSB 3BW9B 1VACB 4Z7WA 2BSED 1YPZE 5J13C 3ELAT 1EO8H 2VDQH 1JZ5A 3V4UH 1S5IL 1G9ML 3WFZA 4OLWL 5EBLB 4L29B 1OWRM 4K7FA 3JBG7 2V7NA 5GS3A 5J6HB 3TBVB 2FNBA 4GKZA 5HYJB 4KROD 1A22B 4MHHI 2C1OB 4J3SA 3QQ3B 3PWPE 3W9DB 2MMXA 1CU4H 1K8DB 3SKUD 3QP3A 1DQJB 5BVPH 4K23H 5HJ3B 5HVWA 1U8QA 1NAKH 5CCKL 1LDPH 4LKCA 1LK3H 5EH1A 4P5TD 1EGJL 3O3AA 4JFFE 4OV5A 2H2SD 5EOQL 3PGCA 4LOUD 2DQEH 2YA1A 1BQHB 3GNMH 1I7RB 2E7BA 3DVIA 3GMOB 4ZMAT 1INDL 1WAAF 1OAYL 3LPFA 1G7PA 2XNAB 5AYUL 1B90A 5C0RH 3KPPB 1HDMB 2B20A 2P8PA 4D9RE 4PRNA 1F3JA 2VABA 4K71B 2K1MA 4JRWA 3F58H 3VJ6A 2NY6D 3A6OA 3AU1B 3LKPB 3SKNB 4W4OA 3LKRA 4JFDA 2VLKA 3G5VA 3KPMB 4LLQB 5I1KL 1NEUA 4IJ3B 2QSVA 2A0LC 1RK0A 4HJGA 1NFIB 4OCSL 3PL6B 4OCWL 4QTHB 4ZO8A 1ROWA 1ZVHA 4JFEE 4YO0B 4FFWD 4R26L 1KCUL 4P2OD 5A16A 4WWKB 5IB3B 4NQEE 1JYXA 3NGBC 2I27N 4F57H 1YEJH 1Q0YL 5F70A 4QXGH 1U3HB 3CSYA 1LO5B 1ITBB 1C5DA 1RUKH 1MFAH 4EBQH 2Z9TA 5FO7B 4YDKH 2GI7A 2VNCA 1SJVA 2NPLX 3RWHB 3FFDA 3W11D 5EA0H 1M05B 2AXFB 4NFDA 5IMKA 5AG8A 2HKFH 1KJ2A 4XB8A 1RZFL 3BZFA 2NXZB 3ZYIA 3GRWL 4TPRL 1QKZL 4GKZB 1N6UA 2MHAB 4WHTA 3BP6A 5IB1A 4QOKA 3S34H 3L3HA 4HG4K 4Y4HA 3SBWC 3FN9A 4D9QD 2YD8A 4PJHE 3ARBA 3DTXA 3HZMA 3TLRA 3SDCA 2NX5D 3IT8D 2BRRH 3I75A 4LKXB 2ZJSL 4UV4H 4Y2DD 2YXFA 5GIRA 1RZJH 3DX7A 3SDCD 3WIHH 5FUCE 4BK5A 3QCTH 3JVGC 3C87A 3R0MA 1JHLL 2H26A 5CJXA 1FL5A 1DN2A 2F5AH 4JVPA 3DBXA 4PJ9B 5EU4B 4FQCH 4LCYB 2YBRB 1KSRA 5DRWA 2HH0L 3H0TA 2B4CH 4LNVA 3UPCA 1H5BB 3VWKC 1UH4A 5LGKA 5HHOA 2ZUQB 1H3WM 2HMIC 4FN0A 4X5XB 4Z7UE 1BHGA 2CLVB 1YYLL 4FA8A 5DRNB 4P2QE 3PG2A 3GMQB 4ZNEA 4N9GB 1X7QA 1YUHA 3AB0B 3LKPA 4GBXB 3SKNA 2JJTC 1QPPA 1Z9SA 1AXSA 2R56L 2ATPA 1DLFH 1RK0B 3ABZA 4HJGB 2RCSH 2OL3B 2ZP0T 5C0AD 2NY5L 1RU9L 1J8HE 1IGJB 3IGAB 4AZ8A 2FEDC 1MJJA 4H25B 1OPGL 2LVCA 2DQHL 4XI5D 1FBIH 1TJHL 5E94B 3WD5L 3CPLA 4XNMA 3GMRB 1A7QL 2Z4QA 4P23D 4NP4L 3FO2A 4DN3H 5MHSE 1VERA 2PF6A 2Z31B 5HY9A 5EBGA 3T65A 3GMNA 5FCUH 1B0RA 1J0KA 1QFUL 5C0CB 3WFHB 1E4KA 4UQ3B 1GH7A 1PKOA 4I48B 4PV9A 3SDDC 4GMSL 3FO1A 2C1OA 1U8OA 5JHDE 2AK1L 2MHAA 4WHTB 4TNVF 3CZJA 5EU6E 1ZLSL 2R2BB 3ALXA 3KJ6L 4I0KA 1IEAA 4OZHB 1RZ7H 4I0CC 5IBLD 1FFRA 1K8IA 4X6DB 5DJAB 3G5ZB 2DLFL 3DV6A 1EERB 4MD5A 2EC8A 5GS0L 1CD9B 3X3GL 3MJ6A 2GK2A 3Q3GA 2IALA 4F37K 4IMKC 5CGYD 1E6JH 1MFNA 1X5YA 3PWUA 1Z5LB 5DJZB 1UB5A 5IP4A 4PJ9C 1F5WA 1FDLL 3EO9H 4F8TA 3RIAK 1NLBL 4WUUE 4UI2A 3BIAX 2AK4E 5E08H 3RTQB 4K9EH 4I3GA 3K74B 2XN9E 4HJJH 4LARL 4XP1L 4JN1H 4JFYA 5FA3B 3T0DA 5FB8B 1BQLL 4NUGH 3LQMA 4NC1C 2XQBL 4WTWA 2VXQL 2Q20A 3OGCB 4G80A 4OSUL 1HCVA 4O51B 4J4PD 1K4DA 3KYOA 4ODBD 4YHLL 2I9LA 3QUYC 2A83B 3NCJH 4KJPD 4KUZH 3LB6C 4I18C 1KIQA 5JNYB 5EUKA 3PABB 3RDTD 3MBXH 3PHQB 3SKJL 1U36A 5HHOD 4X0KB 5H37G 1QBAA 4HPOL 3QYCA 1IM3B 2J8UB 3QCTL 2Z35B 4NN5B 2A73B 2CIIA 1TZHB 2ITDB 5J1AB 4KRPB 4KMTL 5CZKA 1IQDA 2V5SA 2VQ1A 2X7LA 2AJ3B 1CTNA 3IFNL 4WWKC 3V5HA 3D9AH 4ODUB 4OFKA 2UWEF 1DQDL 1I1RA 1FC2D 4MB3A 2GTWA 3QUYD 3ROOA 1C12B 4PB9H 5I0DA 1FE8L 3D39E 3O6KL 2ZCKL 1UACL 3FB7B 1MWAL 3DMMD 4BSJA 5JOFA 5DJCB 4CJ0A 1J0HA 5TE7L 1XGUB 4MJIA 2BVQA 3AM8A 4OIAA 3SE4A 2OTPA 4NHCH 4F7CB 4LVOB 1RJLB 3S9DB 2PXYD 3DOSA 1U42A 2BNQE 5AZ2H 5D1ZA 3NFNA 3Q48A 1VFBB 3BSZL 5C9KA 4P9ML 4ZYKB 3MLXH 3FO9B 1RV6X 5ID1A 5KAQG 5DD3L 5DD6B 4NDMA 4LVHC 1H5BA 2NTFA 3Q6GL 2Q8BL 1CQKA 4LHUG 3TO2A 1ZLUH 4UNVA 4OLVL 3WDHA 3JV5A 1RULL 1EH9A 3DVNB 2X2YA 4OCSH 4GKNA 4Y7MA 3KXFD 1FORH 3PXJA 4ODTH 4XPAH 4X6CF 3S36L 1P4LB 4JO1H 1PKQB 4HUMB 2CRIA 1GAFL 5ELIA 1A9BB 1UADC 1YECH 4RAVB 4NNYB 5SWSA 5E8PB 5BZDA 1S9XB 2W0FB 3C60A 4U1IB 1D6VL 1EZVX 3NMEA 5CIPB 5I76B 1ZA3A 4FP8L 3ZSSA 4G7YH 2EDKA 5CINL 3VFTB 1BQHA 1BZ9A 4JFFD 4XNZB 5I1EL 1LP9E 2VO5A 4JFXA 3S35L 4ZUUA 3ZHDA 3EO1A 1S3KL 3MFGB 4RAUA 1ZV5A 4G7VL 5DO2C 3IKKA 5HHQA 3HC0A 1FNEA 4HKZB 4DAGH 1CDGA 2ESVD 3H3PH 1NGXA 4JM2B 1R0AL 2GJZA 3F7PC 3V5HB 4DQOH 2BVTA 3GGWA 4HMCA 2WQ8A 2C7UA 4P0DA 4KJWD 3BDYL 3MV9D 5CFHA 3G5VB 3KPMA 4K7PL 4PJHF 3JWOH 3ZE1E 4DGYH 1NGPL 4L1HA 4OF5A 5DS8A 5CLTA 4ONGH 4YO0A 4RMVA 4OAWA 5IIEB 4M7ZC 3ZTJH 5IB2B 5IFHL 1TTGA 4JPWL 5CD3B 3GSVA 5I1AA 2B4CL 4G8GB 3ULUC 1B6UA 1A9EA 1ZHNA 1RIVL 2EEAA 2NXYB 2H26B 3S37X 2F53B 1QFPA 5IMOA 2E27L 3OKDA 4K3EH 2WWKO 1CXHA 4QXGL 5MENB 2YD4A 2R0LH 5DUBB 2C1PA 3MJGX 3T0EB 3I02A 3ULSB 1HI6B 1AR1C 4X7TA 2OBGA 3QI9A 3LVEA 4QOKB 1P7HL 1F3JB 2VABB 5FUOH 1NFDA 1QNZL 2CLRB 5FA4A 5IQ7L 2J7LA 2E7LC 4UNTA 5D5ME 3T1FB 1IGMH