5LAPA

P53 cancer mutant y220c with cys182 alkylation
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
195
structure length
195
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title 2-Sulfonylpyrimidines: Mild alkylating agents with anticancer activity toward p53-compromised cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 47
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lapA00
3QYNA 1HJCA 4IBZA 4LOEA 5AB9A 5AOIA 1HJBC 3KZ8A 1HU8A 1EAQA 4IJTA 1IO4C 2WGXA 2H1LM 2AC0A 4IBSA 1TUPA 2XWCA 1GZHC 2YBGA 2BIOA 5G4OA 3ZMEA 4AGLA 3WTTA 2IOIA 1UOLA 3VD1A 4MZIA 3D07A 4G83A 5AOMA 4QO1B 2IOMA 2ADYA 3Q01A 2X0WA 4L0YA 4LOFA 5LAPA 4AGNA 2RMNA 3TS8A 3EXJA 4KVPA 3D08A 2P52A 5KBDA 1CO1A 3D05A 1LJMA 1T4WA 4AGPA 3Q06A 4GUQA 5G4NA 1EAOA 1GZHA 5AOLA 3WTXA 4AGOA 1KZYA 3WTYA 5BUAA 4IBUA 3WTWA 2J1ZA 4IBVA 2MEJB 2BIPA 2X0UA 3WU1A 2AHIA 3WTUA 5G4MA 4L18A 3KMDA 4HJEA 3IGLA 2VUKA 4IBWA 2ATAA 2BINA 3IGKA 1H9DA 2J1YA 3D06A 2PCXA 4IBYA 4MZRA 1YCSA 5LGYA 4AGQA 4L0ZA 4AGMA 3QYMA 2J1XA 5AOJA 1EANA 4LO9A 4G82A 2J6WA 5ABAA 3D09A 3VD0A 1CMOA 2GEQA 4IBTA 4GUOA 2XWRA 3US1A 3US0A 2OCJA 2X0VA 4IBQA 3WTVA 2BIMA 3VD2A 5A7BA 3WTSA 4A63A 2FEJA 1TSRA 3Q05A 5AOKA 2J20A 4XR8C 5ECGA 3D0AA 1E50A 2J1WA 2IOOA 2BIQA 3EXLA 2J21A
chains in the Genus database with same CATH superfamily
5D4HA 1HJCA 4UU9A 1PIGA 1GOHA 2OJEB 3HUJB 2CDGB 3KWTA 3MJ8B 3JWNH 4Y5VB 4PV1C 5D2LE 1HXYB 1OF2B 5DR5H 3QUYC 5HHXL 4KKCC 2OSLB 2WLJA 2CJTA 1P2CB 1KXTB 1AO7B 4IRSC 4KOCA 4BFFA 3K2KA 4UTBL 5DTFB 1MFBH 3QXUA 1OAUL 1ZXQA 3TZVD 4WU5B 3EOAB 4M3HA 4NHUB 5E8EA 1J0JA 3LXCA 2R0LL 4TYUA 2YD4A 5CCKL 4X6EB 4X50A 1MFNA 1CF8H 4KKPA 4OV6F 5E4EB 1OGAA 2IALB 4L4VA 4NFDA 3RWJA 2Q2EB 4PEEA 4KTDH 3ZUCA 4PJIA 3X3FL 2CKBH 5ISZB 2PO6B 3CXHK 3EYVB 2DI8A 5EU5A 3FU7B 1SUHA 3FK3A 5EHFA 1CQYA 2IEPA 4JB9L 2CWRA 4MNQD 2WVVA 4N1HB 1SVCP 4QHKJ 4PVBA 3TNNA 3BGFC 3ULUL 4GG6E 1UVQA 2RJMA 3BHBB 4EZKA 2EDTA 5JPMB 1I8MA 3FQRB 3F8UB 1HAWA 4JG5A 4L1SA 5IP4A 3T6QC 1EJFA 2A9BA 3F58L 3T0AA 1T20B 1CFTA 3IBOA 4MVBD 1DVFD 2YK1L 3N3EA 4PM1A 2WZAA 2A74A 1VGEH 1OT1A 5DCCA 3VH8B 3FU5A 2B4CH 3BEWB 3MUHL 3OQRA 2O6PA 5L2JB 1TZAA 4ZMNA 2WSPA 1JXGA 1QBBA 3SDYH 4E41D 1KTJA 2NR6C 4FZ8L 3RZCD 1UXSA 4AQ8C 4N2LA 5IMLA 3VXRA 3RTLA 1X5LA 3QEUB 4PJEB 4O02B 2ICWJ 2DWTA 2BNRA 3QCVL 4UI2A 1KPRB 3ARGB 2OQJA 3L3DB 1KB9K 4JG0H 5D1XA 5AZ2H 1AZCA 3KNBA 4WGVB 4LEOB 3WEBA 3O45A 2MNWA 2VT0A 3U1PA 2XIIA 1MAKA 4FXKA 3RWDA 5B7MA 1TTBA 1YEHH 4PGZA 2EIBA 5D72H 4AL8C 1NOAA 1I8IB 4W9JC 3B5GA 1SYSA 1IBHA 2YOCA 1ZA3B 2A4EA 4WNQA 4I85A 3H0TA 1UJ3B 4NN5C 1ZV2A 2FCBA 3WFBL 1P7QB 4E9TA 2YPVL 4HJTA 1UWFA 3U0TB 2YC1A 5C7XL 1SMDA 3HZ3A 5I8KL 3HMWH 1TFHA 3GI9L 5C2BL 5JO5A 3KGRA 2TSBA 3VJ6A 1MJUL 4FFWC 2CR3A 3IDXL 3N1FC 1P7HL 2F53A 4GLRI 4KH9A 5F3BB 4WCYL 3OHMB 3MHZA 4CVWA 2X1PA 5FOJA 4JPIA 2I25N 3DJTA 1M2VA 4LQ1A 5L4FA 3QWOA 3Q44A 2WLZA 4XNYL 4NPKA 4NDMA 4TTDD 3VMOA 3NCBB 3UBXB 1DL7H 4X5RA 2NX5A 3RJOA 5BO1L 5AOMA 1VCAA 5F3HB 3DARA 3FFCD 3FFDA 4JY5L 4UQ3A 4ODSL 4ERSL 1XCQB 3IDMA 3ZSTA 1OW0A 2W0LA 2OL3B 2EACA 4P2OA 4LQFL 2DLEA 5CR8A 5C0RH 3PWLB 1OP5K 3PHOB 1WWCA 2YD2A 2EYRB 1NEZB 3OKKA 5LXGH 4O5LH 3QI9C 2XI9A 2XXGA 1S8DA 1XH2A 4G6JH 4XRCA 1GZPA 2ESVA 3DGDA 1OF0A 2VLKD 2XHNA 3IJEA 2IWEA 3VYPA 1L5GB 3PGDB 5ALCL 4DP1X 2CQVA 2LU7A 4J3UA 4I9WD 3U25A 4GEIA 1JDDA 3QDGE 1XGTA 4BKLA 2C3GA 1UM5H 4RRPA 4PRAB 5H94B 3SQBB 3MYJA 5INDB 4IDJL 1PZCA 2XLLA 2Z7UA 2Z7WA 4EI5A 3KPSE 5HHPA 3H7BA 1A6UL 1MUJA 5DD3L 3VGGA 1JNHA 4M61A 4NBXB 1A3LH 1FN4B 4OLYL 4WI7A 2RAMA 3RTQC 4YWGL 1AHWB 3LVEA 3FB7B 5JOPD 5FKAA 4ENZA 1AH1A 3GXNA 3KD4A 4MKMA 5F9AC 2IDSA 4NO3A 1MI5A 3FRPG 2WXFA 5BV7C 1AI1L 3BE1H 1P5UA 1ZT7A 4Y4FA 3QEGL 1KB5A 2CK2A 1J8HB 3EOBA 4FQXC 2MHAA 4TM9A 1WG3A 2J6EH 2Z31B 1KLGB 1HHKA 3JT0A 4RMSA 1EHLH 5BRQA 3SDXB 1GXEA 4D9RD 5FB8A 3TU6A 5I5MA 4EQ3A 2PW2A 3KAAA 3PNWB 4NKOA 4W9HC 1HL9A 4GUPA 4M9PA 1H3PH 5EULV 5FM8A 3FAXA 1KOAA 4P4RB 5I74B 5IMOA 2B59B 4C4BA 5DR5L 1SM3H 2CA3A 1H0DB 1CK0H 3JYCA 1CT8A 4XP5H 1JZ3A 5CBEA 1CFQB 3EO1A 1QMUA 4QRRE 4AV4A 4ZNEA 5G5DB 3R1GH 1MFBL 1Q1PA 5G55A 3D39D 3JVGC 5FOBA 1I7TB 3GC3A 4LLQA 5PCYA 4AITA 4JRXB 5EZOH 3CFMA 4H4NA 1CF8L 1X4ZA 1M6OB 3JZYA 3LV3B 2AJZB 1QLFA 4NQXB 4U3CA 5BJTB 1ASPA 1QW8A 1HCVA 2QPSA 2W95A 4KTDL 2CKBL 3RWCA 4D0BB 4FQJH 3CUPA 1OTUC 1P53A 2QDWA 2X6CA 5AB0A 3LOWA 4WJG3 1W91A 5B39B 5CP7A 3LQZA 5IQMA 3DNKA 1TEFA 1AHMA 2Z92A 3HNVH 4MQ7B 1LK2B 5I24A 3AREB 1UYWH 3PHAA 1KDJA 3TPUA 4LNVA 2B4CL 3WMSA 1QBMH 2J56A 1VFMA 3O8XD 3QUXA 4HUMB 4OLZH 2IH9A 1F4XH 3SDYL 5I66B 1QASA 4ANUA 3QO0A 1CYXA 3FPYA 1BMGA 1JZJA 2VUYA 5I0WA 1QTSA 2IH8A 4EUPH 3WUWB 4JG0L 5AZ2L 4QF1B 5KEZA 1AD9B 2W0FB 5JHDB 2ENSA 4L3CB 3RWEB 5I16B 4PRPD 4CN6A 2UWEA 1SDDB 1WFTA 2FDBP 4Q74A 2H0PA 1XL6A 5T3XH 5EU7C 1L0XA 5I6OA 2OTUB 1LEIA 5EUKB 1ZWIB 5EN2B 2JJSA 1MAMH 5D72L 3CPLB 4V11A 5CLWA 1AR1D 5D7LA 2EC8A 1M57B 1JWMA 3ASNB 5D7JD 4JDVA 2PLTA 3WY3A 3QCTH 1N67A 2V6HA 4WSJA 5HYEA 4L9LA 2XRAH 3F04A 3QPQC 1ETB1 3P69A 4FJYA 1J88A 4ZX6A 3U9UB 3HMWL 2X4PB 3SGJA 3MZTA 4AOFA 3LKRB 4AG4H 3GSXA 3E9UA 3H7LA 5F88A 2A9DA 1NIEA 2Z4QA 4KX9A 1YUHA 4M6OH 3LDBB 4Z7NF 1HCZA 2C7UA 3MRLA 1R5WA 3QORA 1R5IA 4I0PD 4Y16B 4X42A 2AQNA 5I9QB 1E50A 3VXUB 3LRMA 3WXVH 1WGOA 1U3JA 2X7LB 2LW3A 4NQSA 4DOHE 1Z5LB 1J12A 1DL7L 3EUDA 4Y2DB 3BD3A 2MMXA 2HKAA 4PJGB 4KAQH 2DJ4A 1G9NC 2P7TB 4JM2C 4RAVB 3UTTD 2WYIA 2KDGA 4W6WB 2Y6SC 3DIVA 3S4SA 3V79C 5C0RL 1BQUA 1G5GA 3HZVA 1YYMH 1UG9A 5LXGL 2FECL 4O5LL 4JRFA 5TF1H 1BW8A 4BK4A 3MROB 4F3FA 4Z3JA 4XE5B 4G6JL 4XO4A 3G9AB 4JFEA 5IKCA 3UTPE 1T0MB 5E9NA 1B4LA 2YAPA 3MZGB 4HYTB 1H8NA 1MCDA 3ARFB 1QTPA 2D7OA 5HGBA 1NCIA 4A2MA 1TT6A 1OEZW 2H3XC 2YQBA 3DXAB 1CVRA 1UM5L 2VC2H 4JFXB 4NZTH 2KZKA 4MAYD 1A25A 4NBYB 4PJHF 3MV8A 3KEDA 3PLYA 3LXAA 4OI9A 2ZPKH 4R4NC 4FE9A 1MVFA 1RK1A 4CN1A 4Y4HD 4CDHA 3LKOB 3MV7B 3AT9A 1KELH 4JQXA 1A3LL 1I85C 1UKQA 1KGCE 2J8UB 1R3JA 1SHMA 3GMOB 4WFFE 4J6RH 4XMZA 3A0OA 2RIKA 3M45A 3WY1A 3OBAA 3BE1L 1ZLVH 4IU3B 2R29A 3FOMB 5F7FA 4LSTH 4B5EA 3MUUA 3A6CH 1SZNA 4ZYKB 2J6EL 3AQYA 3NIDB 4GO9A 3SJVA 5C0JB 4NN7B 4ZSOA 3S34H 4K3DH 5LGYA 1F18A 3KYNB 4XMPH 3T04D 1EHLL 3I9AA 4FQQB 5I1GH 4EJ1C 3OD3A 4W9FC 1MKFA 2DQCH 1RK7A 4FOMA 4HIXH 2IH3B 4HZLA 3S35X 5ANMB 1YHPA 1XD0A 3UADA 1BCIA 3ISYA 4YSTA 4IOIA 2HVKA 4PJXB 4F33A 1H3PL 1XT5A 2XKNA 5AAWA 3LRSB 5LGKA 2AQQA 1SM3L 2YD7A 4GYBA 1CK0L 3ULUD 4L4VD 1OPGH 4QRUB 4YZFF 2OMXB 2YRBA 4XP5L 2CUHA 2WZ0A 2VITA 4MCYB 4TULH 2PXYB 3R1GL 5ETUB 3HUJA 2CDGA 4HUWB 2KLTA 2ZAIA 3VD3A 3TEYA 1HXYA 1DQDH 3MLUH 1TPXC 1IKFH 1FNSH 4HC1A 1QFWM 2CD0A 1M1XB 5EZOL 2R69H 4KKAC 5F97E 1AO7A 3LB6C 3V6ZA 4BZYA 1RP9A 3E6FA 1HWHB 4MMZB 1J5IA 4WU5A 2QGEA 1L3WA 2RB8A 5EA0H 4NHUA 1CXFA 4FQJL 4BDVB 1P9MC 2YUXA 2DYRB 1KIUB 1D5XB 3MO1A 3Q48A 4UV4H 4X6EA 3GSQA 2WD0A 5E9DE 4U1MB 3HJEA 4MKTA 3AY4C 4MNHA 3LPFA 2UUDK 1T21A 5ISZA 4G83A 4D0CB 1E9PA 2IBGA 2DQTH 3HNVL 3VXRD 1CICA 3CZKA 3TYGL 4XB8A 3W5NA 2UZPA 1IRAY 3U1QA 4ZUUB 2ZOKA 1UYWL 4PS8A 4YOKA 4PWHA 2BNRD 1WITA 1A47A 2J7LA 5JPMA 5D1XD 1QBML 3FQRA 1QFPA 4WFEE 3VXSE 5CCHE 1CG9B 4ZO6A 1SY6A 4OLZL 1VESA 3M7FB 1F4XL 3QZNA 5CHNA 2F19H 2HLFD 4W9IC 3ZE0F 3BVNB 3EZ8A 4UNTA 2F7OA 2D4FA 3BEWA 5EZJB 1E9OB 1NKGA 3US9A 4DEWA 4FG2A 2BDNH 3ALXA 4NO0A 4UV7H 2BP0B 4ADIA 1KMGA 3Q6GH 1RULH 3U4EB 5CN3A 2EC9U 4GSRA 4BFIB 1ZJBA 3FUHA 5GRXG 3QEUA 4PJEA 2FJGA 4MNGE 1QLEB 5T3XL 2F74B 4O02A 1RZ8B 2C4XA 1MAML 3ARGA 3CJJA 3QXWA 3VRJB 1LO5A 1YN7B 2G75B 1FFTB 2F53D 4GW1A 3BAWA 2JQZA 1QHOA 2WBXA 4WWPA 2HKHH 4Y5YC 3KS0J 3QCTL 3SE9H 4WWKC 2XRAL 3T77B 3I75B 4PJDB 2AQSA 4NB7A 4W93A 4R7NB 3F7YB 2NX5D 3V7AG 4AG4L 1ZA3A 3DDFA 1UA7A 3BH4A 4TNFA 4IOFD 5JHLA 4ZRGA 4M6OL 3PWVB 4JRYB 4P2OD 1P7QA 1V3JA 3CVHB 4YVUA 1GR7A 3WXVL 3MRBB 3RKDD 4HGWB 4YMPA 1KZQA 4YAQA 4HX1B 1WC7B 3BZEB 2GJZB 3ZIMA 4QRFA 2ESVD 5L0QB 4X6FB 2AABH 1QRNB 5EF0A 4RZCA 2HVBA 2AEOA 4Z7UF 3SPCA 3W5MA 3R18A 3I3BA 4TPRH 1TYEB 1AXSB 1LDSA 1OSEA 4WTWA 4NP9A 5EEXA 2VW7A 1YYML 2YPLB 3G08A 3SDAC 3AQXA 3M17B 3QYCA 1A9BA 3GSRB 4NCC1 5TF1L 1CYGA 1WA0X 3CZUB 4GQRA 4PAZA 3UEQA 1Z66A 3GD1C 3BUBA 3BKCH 2AMUA 2RHEA 1IAIH 5AYQA 2OL3A 4KJQC 3DPBB 3HMXA 4XNUH 2CDFB 2XKUA 2WTRB 3PHOA 3PWLA 4BFBD 2G60H 5I6KA 4PB9H 2VDNB 3T65A 2GQHA 3MRNA 1MW2A 4XH2B 4G80B 1YC8A 2VC2L 4NZTL 2JLPA 1NFAA 4HFUH 3MV01 1MI5D 3FTXA 2ZPKL 2EICA 4ZX3A 1NCOA 4N1EA 4Y4FD 2P52A 1KELL 4U1NA 1A1MB 1CE6B 1RK0A 2H2SD 3DHJA 3DYPA 4LGRB 4NQCA 1HOEA 1KUMA 2QADC 5INDA 5KSUB 4PSRA 4DTGH 4J6RL 1N12A 4LCWB 1PLGH 5K9QI 1UD5A 4R96B 1NBZB 1WBXB 1GZHA 4Z7NE 3OPUA 1FN4A 4DFHA 3S3CB 3QJRB 4JW3A 1ZTXH 3FUEA 1AHWA 4LSTL 1ZT4A 3VA6A 4OGXH 3KLHD 3PP3K 2MEJB 3A6CL 1U0QA 3UAJC 4WW2F 3W11C 3L1OH 2EUWA 2FJHB 5FDWB 4K3DL 3S34L 5C86A 5IB4B 5EEZA 4XMPL 4MB5A 1OAZH 4WTQA 5I1GL 4R0LA 2X1OA 2DQCL 1EK3A 4N0RA 4HIXL 2ZT9C 1OGTB 3DX8B 5DMKB 1PG7W 1EVUA 1J8HA 3H55A 3K3QA 5TDOA 4MBOA 2HX7A 4AX3A 4NM4H 3KVPA 1XMWA 4A2DA 1OPGL 3KGSA 4OLWH 1PKQB 4LLYB 4JFPA 4UTCA 4EBQH 3NTCH 4ZMVA 3PNWA 4HQQH 5LLIC 4TULL 2CA4A 1IGYB 4RSYA 5IB1A 3D69A 4P4RA 1DQDL 1E2WA 2DI9A 1IKFL 1FNSL 1H0DA 3B2VH 3MLUL 1OSPH 2O5NA 3IPEA 2R69L 4PUBH 5EU3B 2R15A 2J88H 4UAOB 2NYYD 1C5BH 2E3VA 5G5DA 4MD5B 1MCQA 1VPOH 1Z1WA 3MLYH 1PBYA 2AKRB 5EA0L 1BM7A 3IFLH 4LPCA 3BSGA 1I7TA 3EBGA 2AEWA 4YHIB 1LMIA 3RNKB 4WRLA 2MTPA 4UV4L 3HG3A 2W94A 4DZBB 3TZVC 3SDCA 1GAFH 3QUXD 3LV3A 1S9VB 4LAJH 1HX0A 2AJZA 5IHBA 5BJTA 4AQ1B 3W0WA 4LBEB 2DQTL 4H40A 3ATFA 4M00A 1Q0XH 2X4QB 4N0UB 4I8DA 1RPUA 4NQEA 3BQUC 2UXGA 3DETD 1GC1C 3BIKB 5B39A 2XWJA 2AGJH 4AMKH 1FDLH 3VU1A 3J27A 4TNWK 4HUVA 1LK2A 2CCLA 3CSBA 3AREA 3WCYA 4PMFA 2F19L 3ABKB 1RY7B 4PY8I 4KVPA 1GGTA 1NGXA 4PGBB 2WLIB 3CN3A 1JTOA 5D7LD 2ODIA 2BDNL 4UV7L 1IEBB 2WOYA 3LKNB 1DVFC 5LG1A 5C08D 3Q6GL 3ZE2F 1RULL 5I66A 2CUAA 3OJMB 3FO0H 4X9BA 5DRNB 5FW7A 4K7FA 3L3GB 5HVHC 1HZHH 1PPIA 2CXKA 2OBGA 4YHMH 3ZZLA 4DF9A 6CGTA 1ODUA 3RL2B 2YUZA 3WUWA 4PLOB 3RZCC 2ZP0T 4YE4H 2W0FA 2ZWYA 2XPGB 5E95B 4JFDB 1TCMA 5FS5A 1AGBB 5I16A 1GYAA 3QORD 2HKHL 3LSOB 3O6MH 2C9AA 2PTUA 3SE9L 4GKZB 1ZWIA 2JCCF 1MELA 3F2LA 5EN2A 5CCGE 2VWEC 1U8LB 3CPLA 4CU6A 4HJEA 1DQTA 1U8JB 2XN2A 5AYUH 4BCYA 4B50A 4C59B 1E4WH 2NDFA 3ILQC 1QFWI 5MI0B 2EQDA 1IUZA 4Z7VB 3EFOB 4JFQB 5A3ID 4ZK8A 4ZW8A 1COBA 4CBZA 3MNZB 4OCRH 5LBVA 2CE6A 3MXWH 1PNCA 4L1DA 4WUUE 1DQQB 5A2IH 2X4PA 2GIYA 1FA4A 5EO9B 4CW1B 5IUCA 3D09A 4HOWA 2VR3A 4P0DA 1TR7A 1U91B 3BRFA 4JFED 2AABL 4CVZA 3EGDB 4U6VH 5DUBB 3TV3H 3ZT5A 2OXHA 1I7ZB 1NLDH 4HUXA 2JXMA 3BP4A 4OZFH 4TPRL 2OTWB 3VXUA 4QTHB 1SBBA 3FUDA 3SKMA 3UO8B 4Y2DA 2EZ0D 3MV8D 3VNZA 3CLWA 2G4GA 4LCUB 1AKJA 5F2FA 4RAVA 3BKCL 4XMUA 2Z1KA 3B5TA 1H3GA 2XZQH 2ADGB 4U33A 4DEPC 2FB4H 1IAIL 3O0LA 4MHHI 2C9VA 4XNUL 2R2HB 1E4JA 1X6LA 3FB5A 3TO4B 2G60L 3ZJAA 4PB9L 4N0FA 2ICWI 4E9SA 3MROA 4RWYH 1KGXA 4HFUL 1EPFA 4H8QA 4UIMA 1T0MA 3GQFA 1MW3A 4P46C 1U93A 1A6AB 4R8WH 1NWPA 4Q4IA 1ZHKB 1C1EH 3FU0A 4KK6C 2YXMA 5HYSB 4I13B 1V27A 1OP4A 4YO0B 3SJVD 3MTRA 3L48A 6PAZA 2LVEA 4DTGL 3S4SG 4F2MA 1E4XI 1PLGL 2AANA 2XWXA 4LLAA 4OVVA 5IEHB 3FL7A 2KLSA 3KPRB 3K46A 1BV8A 2WWKT 4I5BA 4UMGA 2NY7H 1WBZB 2OS7A 1GPOH 2VISA 3GSNH 4H7VA 1ZTXL 5TFSH 2J8UA 4OGXL 5H4ZA 4YGVB 4UB0H 1KTLA 4PTUB 4JZOB 4ATTA 3L1OL 1T5WB 4DVRH 2I07B 2VN4A 3NA9H 1OAZL 5AOLA 2HXAA 2P26A 4IU3A 1IX2A 3FOMA 1BIIB 3VVVA 4E9WA 4FZEH 2ED8A 1DVTA 4ZYKA 1R9FA 3LNHA 4WHTA 5IWLC 3DYOA 3SDDC 4RGMB 2X6VA 4NM4L 3KYNA 2WBJA 3NMEA 2VIRB 1AO7D 4OLWL 3ZZSA 1OM9A 4EBQL 1FYTB 4JE4B 4PYGA 3NTCL 3P2DA 3MCKA 3RILA 5ANMA 4HQQL 3UG3A 4NRXA 4BSVA 5BOJA 2CBPA 5C0NC 2GK2A 5EU6B 3NCCB 4IYKA 3APFA 4P23B 4FG6C 4IKKA 3B2VL 3RPIA 1EANA 1OSPL 4PCYA 5E6IC 2OMXA 4H44C 3V4UH 1NFIA 3U7AA 4PUBL 5ISZD 1T3FB 1X44A 1R3LB 2J88L 4MCYA 3NPSC 5KZCB 1AXTH 4AEFA 1C5BL 5ETUA 1IBBA 1CICD 3PGFH 4HUWA 3NEXA 3T0EA 1VPOL 5FF6B 3QVAA 3IFLL 4LVOC 3QFJD 4WNJA 1M1XA 3ZDXB 4NEHB 1OE2A 1PD6A 2NNCA 1GAFL 1JZDC 2UV3A 3UTTE 1QPPA 3VFMB 4EI6A 3RVVD 4AM0B 1BPVA 1Q0XL 1D5XA 4CU7A 1NL0L 5T3XD 3EKCA 3NFNB 1M42A 2J72A 3ROOB 3IMBA 4U1MA 2JKTM 1SMAA 4NO0D 3WLBA 1BZDA 2XG5B 5DZJA 4QJ3B 1D9KC 5KTEH 3UACA 5DJCB 1IGIH 2AGJL 3GS0A 1FDLL 4P5TA 4AMKL 1T83A 2P5PA 3OB8A 5F1SA 5HY9B 4ZFGH 1AGDB 2G2RA 3QPKA 1T7VA 4ZUUA 4X6CB 4C83B 3E1ZA 4OB5H 5GGVY 3D85B 4M02A 3ARGD 2FEEI 4J27A 5BUPA 3VD1A 1PX8A 2FR4B 5BOPA 4UM8B 1OGSA 3AABA 3OC5A 3QUKA 3U46B 1ZCRA 4O2FB 2DD8H 3BFWA 1SLVA 1PGRB 4L0YA 3ARRA 4OF7A 5D55A 1DVSA 4KZEH 5DHYB 5GRJH 1FO0H 5HHQB 4QRQB 3FO0L 1J9SA 4LGPB 1ESOA 2XVGA 2K9UA 3BVNA 3O8XC 1KB3A 1HZHL 4XPFH 5EZJA 1E9OA 1T0NB 3B6SA 4OCWH 3GUTB 4PP1C 4QO1A 1NANH 2V2XA 4P99A 4WSGA 2BP0A 1HKFA 4H8VA 4YE4L 1KXQA 2WZ5A 1TXKA 1CGXA 4Q0XH 5IV2A 1BVKA 1P7QD 3HNTH 4BFIA 4TQPA 2AXJA 3O6ML 1X3DA 4L3AA 1YEWA 5D93C 2ZG2A 2QPDB 3VGDA 5AYUL 1OT4A 1YN7A 3IJ9A 1E4WL 4W6YB 4J8RB 5A7EA 3GMPB 1JYXA 5HDBB 1J1OH 3Q2WA 4ZOEA 4BA0A 3X13B 1T89C 3WJJA 4XX5A 3MV11 1AR1C 3JV0A 4E9QA 4OCRL 3MXWL 3IGLA 4WIQA 1TQVA 5D7JC 1S7UB 4R7NA 3F7YA 2HRHA 4ELMA 1BZ7B 5AKSA 2RQ8A 1OO2A 4P2QB 5E8OB 1RIHH 3FU3A 3TEZA 1T04B 1OGAE 4L4VE 5C0CE 4U6VL 4JRYA 3TV3L 3NIGE 4WI0B 3CVHA 3II3A 4G11A 1NLDL 2ROXA 2QHRH 2K0RA 3MRBA 4G5AA 3GBDA 4HGWA 4F7TB 4AJ0A 3N1QC 4BK5A 4HX1A 3S35H 3P4OA 1JPSH 3HCVA 3NCXA 4XMTA 1QRNA 5DI8B 4I0PC 4N86A 4R4BA 2WQWA 4XNXH 3UAAA 4X8JB 5AB2A 2XZQL 1WISA 5J06A 2FB4L 4JUSA 4I3RH 2YPLA 3ZE2E 2XTJE 3GSRA 4NQCD 4XAKD 3MXVH 4XP6H 5CKGA 5D1QB 5JIHA 3V0DA 4RWYL 4M5YH 1WD8A 3OLEA 5K1VA 2Z1PA 1C5DA 4MZ3A 4AT6B 3C5JB 2BC4A 4DFIA 2CDFA 4WWNA 4R8WL 2D3NA 3UG4A 1QO3B 4XBMA 3TEWA 4J3XA 1RSFA 2JJTA 1G9HA 1MY5A 4YFEA 4ORZC 2JV6A 1INQB 1ZPUA 4XH2A 4G80A 5EBWA 1S6NA 3L9EA 1X7QA 3RL1B 3QJOA 1HK6A 3D4CA 4Q56A 4U4IA 3OLGA 4YE0A 5D1XE 5JNYA 3MRHB 2G2NA 4N68A 3CFDB 2NY7L 2BSCA 1GPOL 2X4TB 2MOGA 1J8HD 1W16A 2MRYA 2ZUQC 1EZVY 3GSNL 1OOWA 4PRIA 5ITFB 5TFSL 3IT8D 5KSUA 2GSIB 2AJXH 4UB0L 3AWEA 5K69A 4Y4HC 3NG5A 4LCWA 1U58A 4XCFH 2LOEA 3F05A 4HT1H 1NBZA 1OVZA 3BKMH 4DVRL 3NA9L 4KKLD 1A6TB 4AQAA 2EXSA 5BW7A 3L4TA 4O2CB 5I6LA 2P9RA 2ZE0A 4LGSB 4QIRA 1GGUA 2EKSB 1JGDB 4M6NH 2JKWA 4FZEL 4ZAKB 4PLJC 5L9DH 4LPXA 3QEQB 4KNSA 5FC9A 5KVFE 5IB4A 3IETB 3N41B 2DLTA 3TWCH 2HTLC 4K2UH 1IM9B 3WFZA 3ZKSD 3NCFB 2R1YB 1OGTA 1QVOB 3AM8C 3DX8A 1MFEH 5DMKA 3GGWA 3QZLA 4PJ9C 5CINH 1BJMA 5E5UB 4CGTA 1ZLWK 4XCEA 3SDCD 1I8LC 4LLYA 3MC0A 2AF2A 1JWSB 3V4UL 1HS6A 3DVNA 3GMNA 1AXTL 1MCPH 5CEYB 3W0WD 2AJUH 3PGFL 1IGYA 3ULUC 4P48A 3GINA 3GJEB 1N9PA 3ZDYB 2X38A 4NQED 3QR0A 4U1GC 2C9PA 2YD0A 3BZFB 2Z93B 2A9AA 4JANA 4U1SB 3HBGA 2HH0H 3TP4A 2YSSA 3FUNA 3V9CA 4D7PA 3BH9A 5KVFH 4MD5A 2VDPB 3V0EA 2DH2A 5LN4A 3TBVB 2AKRA 4OF6A 1V8HA 3MSPA 4RDQG 2BHYA 4AVJA 4YHIA 5DQJB 5BRZA 3RNKA 4HS6B 3VI3B 2DB8A 4JHVA 2NPLX 4LMQI 5E6ZA 2NNFA 4F9PC 4YL4A 1WICA 5KTEL 1IGIL 1EBPA 2GKIA 2FSEB 2F61A 1HWGB 1CS6A 1R6VA 2H1PH 4ZFGL 2NZ9C 4JMNA 2EH7H 3IMWA 3TFKD 5FCUH 2X4QA 4N0UA 2WVTA 3LPGA 2CGRH 3PJLA 4R3SB 5AW8B 4CC1A 4HP5A 1YUKB 2YGOA 4LOEA 4OB5L 4AK1A 2WP3T 4FCAA 1A7QH 3BIKA 2VZVA 3G6AB 2EDKA 2CO3A 4E0RA 1HZKA 1ACZA 3LNIA 1UA3A 4QTIH 4YDJB 2DD8L 2ICEC 5D1ZA 2B1AH 2HRGA 2XKSA 4WFGD 5GRJL 4DZ8B 1FO0L 4KZEL 5C71A 3EOTH 5FWRA 4X5XA 1JZ4A 4RGNE 5SX5K 3FTUA 4PGBA 1QUNB 2C3VB 1OCZB 2WLIA 3K72B 3AT0A 4OCWL 1FV1A 4XPFL 2BFVH 4WWOA 4AVHA 5EO1B 3LKNA 1T03H 4JFUA 3TA4D 4Q6KA 4IRJA 1XGZA 2WTPA 4ACTA 4Q0XL 4JX0A 3HNTL 2WKOF 4NC2B 1Q9LB 1LNUB 4O9HH 4X7CC 4DP6X 1QLRB 2IAMB 3RL2A 1N8OE 3HG2A 4Y9FA 5IR1B 2XPGA 3BO8B 3KXFE 3AB0B 1G4MA 1J1OL 2B14A 4JFDA 5C97A 1AGBA 2BPBA 5FM5O 1OCWH 5GXBB 3LSOA 1HOCB 1F6AB 1MCEA 3VXUD 5KSBF 1NUGA 4GKZA 5GGSY 4WK2B 4QAMB 5BZZA 1U8LA 5DRWB 2BWDA 2NY3C 1TZOA 1AKJD 1IBZA 2V7HA 4LPWA 3W9DA 1RIHL 4GBXA 4JFQA 2OMYB 5DA4A 2CLZB 3C5ZA 2LT9A 3MNZA 3OKOB 2LQRA 3Q6FA 3LZLA 4LCCB 4PSPA 5GISH 4ANWA 2HX8A 2VUKA 2QHRL 5JOFA 5JTWA 3L95B 4IOFC 5I0DA 3S35L 4P2OC 1N5YH 1JPSL 1W0WB 3SGEH 4Y19A 3CTTA 5HJ3B 2C9UA 5DUBA 2CLRB 4XNXL 1KGYE 4U3SB 1I7ZA 1JF6A 4FJ6A 1F11B 3ERXA 2OTWA 4I3RL 5I1AB 4KRNA 5AG9A 3FSZA 5ID0A 1PDKB 4KQ0A 5GS1B 3APNA 3MXVL 2YJLA 4XP6L 2YOAA 4M5YL 4LCUA 2A0LD 3GXMA 1OCOB 1WVZA 3DX6A 5AD0A 5AVVB 2ADGA 2EDEA 1LE5B 2GW5A 3APCA 4FGMA 2WLYA 5EBLA 5E1QA 1MCIA 5EIIB 1KCKA 5HPMB 1ZV9A 2YGQA 3EJUA 4HXAH 5DO8A 3HI1B 3MA9H 2D2OA 3S7GA 2VNCA 1FNEB 2ADJB 2VR4A 1XO8A 3ULVH 4ZMXA 5L7XL 1CXIA 4F15B 1E5YA 1TZHB 3VTTA 3LH8A 3DKHA 1PZDA 5JLZB 4JKNA 2AJXL 3V0VB 2WBJD 4XCFL 2PCPB 1TQBB 3DRTA 4KZ0A 4HT1L 5IEHA 5D2NE 1NIBA 3ARXA 3BKML 3KPRA 3WY2A 1NOLA 2P5EB 1OAQH 2HX9A 3K8MA 2H2SC 1ZTMA 4HLJA 2ADIA 5F44A 2PWEA 3IJSA 3DPDA 4DW2H 3JWNC 1NJ9B 3O4LE 1G94A 1NMCB 1Q94B 8PAZA 4YGVA 4C4KT 4M6NL 3QG7H 1JPST 5L9DL 4PTUA 3LH9A 3BC9A 4JZOA 4MB3A 5FUCE 5I0VA 3BEVA 3QPXH 2I07A 2JNZA 3KLDA 4UDUB 2H6PB 4JVWA 3DUUA 4OZHA 3GHBH 3KLHC 5I6PA 4K2UL 1W80A 4N87A 3TWCL 1BIIA 4UQ9A 3VI4A 4N0CC 3T0ED 4HGKC 1MFEL 1KDIA 2QKSA 1RLBA 4B41A 5F9DC 3LNGA 4J5VA 1WHPA 5CINL 5J6SA 1I1YB 4F7PB 2XBTA 1TG8A 4NQTA 4M7KL 1TCRB 1MWAA 3IEAA 3SD2A 1XR9B 1J7VR 1YQVH 3ES6B 3L81A 5JW4R 1FP5A 1MCPL 2PR4H 1RZKH 1DEEB 2AJUL 5ESQB 3V9FA 3FCTB 1NTDA 3WTUA 5EU6A 1LWJA 2QSCL 1CJYA 5EU4B 5IBLD 4P23A 1CDHA 3KYOB 3B1TA 5L2KB 5HYQB 4RH4A 4DP7X 1S5IH 3SDXF 4L8BB 1CUOA 1K3IA 1YNLH 1KACB 2WZ6A 3QZWA 2OFQA 4UMSA 4HW6A 2VDRB 4JFEE 4P5TD 5I71B 5JW4Q 2HH0L 1KNOB 3JWDC 2GK0B 2CMRH 2VM4A 3AXHA 5KVFL 2E46A 4F8PA 3B3IA 5FF6A 2QR0B 2B4CC 5CZXD 3WEXA 2BVPB 2Z4TA 4NBZB 4RX4A 1LO0H 1U8OB 2NYYC 4P2YA 1P84J 3TF7C 4HIEB 3VFTA 5GGTA 2CGYA 2P3YA 5JQHC 3US0A 4L4JA 2BVUA 2DKMA 2H1PL 3F85A 1ICTA 3FO9B 2EH7L 3LD8B 1AGFB 5FCUL 2X89A 1HNGA 1V54B 3QUXC 5A40E 4XNBA 3WEAA 2CGRL 3NFNA 3V4VB 5AALA 4UZGA 3IAQA 4I1NB 5J1AB 2OK0H 3MUGB 2XG5A 1A7QL 3E2HB 4JO5A 4OJCA 5DJCA 2LAAA 3I6GB 2ICES 1C08B 2MQCA 4QYAA 4QTIL 3P0YH 4M1CD 2XN0A 5CP3A 1AGDA 3DX1A 4NO2B 1PD1A 2B1AL 3L4VA 5MENE 3K0YA 2ITDB 3WJLA 5DHVA 4X6CA 3EOTL 4GI9A 5EOCH 4HKJB 4FP8H 4PG9B 2G0LA 4H88H 3SJVE 1RZQA 1IAKB 2FR4A 2BFVL 3IJ7A 3M1CA 4UM8A 3S3PA 4BZ1A 4JN1H 3B5HA 1HNYA 4O2FA 1T03L 3L1FA 5G4OA 5DHYA 3SKNB 3STZB 5JW5B 4A6YB 4O9HL 1OV8A 1CI3M 1JP5A 4W4OC 4B3VA 4BHUA 2VLRB 2WXJA 5C9KA 1BDYA 5IOPA 2O6DA 2N3JA 4POUB 3ZKQD 3BXNB 3GUTA 1TQWA 5FGRA 2WNXA 1NGZB 5GRWA 1S46A 2KZ1B 4KHXH 1J9TA 5BQ7A 2COVD 4N2NA 1I82A 3EH2A 2XN9B 3QH3A 1CGUA 2BNQE 1OCWL 3SGJC 3CN0A 4YHZH 3HUJE 2Z8WC 2GTZB 2BXYA 3RX5A 3LN4A 2WMPB 4XNQA 1JN6B 3EDKA 4J8RA 3GMPA 5I6XB 1ONQB 3QUZB 1FVEB 3ETBJ 1NM4A 1AO7E 2V3EA 3MLRH 2YPLD 3ZUNC 4MJJA 5GISL 3CU1A 3UBGA 5F9JB 1BZ7A 3RIKA 4AH2B 1N5YL 4B27A 1T04A 2BP3A 3GBLA 3GM0A 3V5DB 3WGUB 5ISZE 3V4PB 3B9DA 1BFOB 3U4KA 1UC6A 4F7TA 1DDHA 1LEGA 1SHXA 5KUMA 3T8XB 3L16A 3OC8A 3QEHB 4YK4C 5DI8A 3UYPB 2OR8A 4X8JA 4Z1PA 1EJ6A 4B0MB 3EBAA 2K45A 3TIEB 4KTYA 1MCKA 1UOWA 2HG5B 3MRJB 3TPKA 1GKOA 4PRID 4B7LA 4HXAL 1NFDB 4HJ1A 3BSZA 2P42B 3MA9L 4AENA 4LCWD 1BJ1H 4PJGF 5AB1A 2DWDA 4KDVA 4XNMB 5K33A 3VD9A 1HFUA 4JQXC 4URTB 5AAMC 4AT6A 1C16A 1F8TH 3FQYA 4PGCB 1QO3A 2NY2C 3OAYH 3ULVL 1ZK5A 4A7GF 2J5LC 1SDAB 3EYSL 2XUWA 1INQA 3MRMB 1FVCA 4PJEE 4M7LH 2BK8A 1D5IH 1EVTC 1G6RH 4QRTB 3RL1A 5E2WH 4UTAH 3QAQA 5LNDA 1KIQB 4WAFA 1IE4A 5CJBA 5DJYB 2VRKA 5C2UB 1OAQL 4I48B 1DUZA 4DUVA 3CFDA 1I7RB 4K15A 4DW2L 2X4TA 5H35A 4JO4H 4EIBA 3NA4A 4HV8B 5FPIA 3QG7L 1JYWA 1JNNH 4XN8A 3QPXL 4TS6A 1UOLA 1A6TA 1IGJB 2NY4B 5MEOA 1WWAX 3GHBL 4O2CA 5GSRA 3V6FA 3NK4A 2BVQB 1T1ZB 1AZUA 2YHGA 3KPPB 1G7HB 2D0FA 2EKSA 2YKKA 4KVNH 3WN5B 4ZAKA 3B8SA 5CSGA 1KTKE 2R1WA 4RISH 1S5HB 5CZRA 4H2AA 5ESVA 1H6EA 5KG9A 4ZS6D 2A6JB 4PJBB 1YQVL 2ATKA 2ZUTA 2PR4L 3LZFH 2HT4C 3NIDF 5IQNA 1CGSH 5BRZD 4GSXA 3U79A 4Y1AB 4AGOA 1S5IL 3ILEA 4FA8A 3CLFH 5CEXB 4ODBD 1YNLL 2J1ZA 2WQXA 1JZ7A 1HQ4B 1VCBC 4P3DB 4XX1G 3TNMB 1O6VA 2CMRL 3QUYB 5CEYA 3ARDA 2QLVB 4PJXF 3GJEA 3IMTA 2I24N 3BSHA 4LP8A 4OT1H 3MBEB 4IRSB 1AJ7H 1JZFA 5LDUA 4IBWA 3BZFA 1LO0L 2A2QT 2KC0A 3AADB 2CDEA 1SLWA 4H1LB 2H3KA 3SY0A 3K6FA 1RJZA 5FO7B 5D1ZD 3CLEL 3TBVA 4LSQH 1CD9B 4KK9D 4BD4A 4NXSA 4XI5C 5CJOH 3BVVA 3F6IA 3L9YA 1S7VA 5DQJA 3VAEA 4HS6A 3VI3A 4NC1E 1YMMA 4WW1A 4QRAA 1EWHA 2OK0L 4XN1A 4ABQA 3BPCA 3HI6H 3P3TA 3RVVC 4IRJD 2AXFB 1Q8MA 3FQUB 4NQDA 2FSEA 2C9XA 2R2BA 5IMKA 3P0YL 3QJHA 3BGFB 4I1RA 2X12A 4P9HH 5ABDE 3KWWB 5EOCL 1ZGLM 1Y6NR 3JV5A 5K93A 4FP8L 4ZFOA 1PKOA 3NH7H 4H88L 3DX3A 4K9EH 2XETA 4JFDD 3L3IB 2IPKA 4YLBA 1MFCH 3LZRA 2ATPB 4JN1L 2IBZY 4YDJA 1NDGA 1M7DB 3VG9C 2ILLA 3RVWD 4QOKB 3ELQA 3RUGA 5GSVB 1MLCB 2QGDA 2ZAHA 4GO8A 2YKLH 1J8HE 2C3VA 3UJIH 1MNUH 5IHLB 1YZZA 2P8PA 3K72A 5E8PA 5J7CC 4H26B 3D2TA 3CN2A 4JFFB 5EO1A 3WFCH 5B1JC 3SDXE 4GBXD 3PWJB 2R27A 3DI3B 4KHXL 3WS6A 1KLUB 3C2AH 5I1LA 2PN5A 1IZJA 4V1DB 1CBVH 1Q9LA 1LNUA 3C5ZD 2YO3A 3ORJA 3OHXB 4KRPC 4XTRC 1R5VB 1QLRA 2NY0C 4YHZL 4JY6B 3ESVF 4G8IB 1SN0A 4R2GB 1TETH 3BLPX 1A22B 2P5WA 4Y19D 3BO8A 2AK4B 5KYUB 4QI3A 5LJYH 2D7MA 2OTPA 3MLRL 4P5KB 3HLAB 3UYOD 3D05A 4GAFB 5DRWA 4NN5B 1MFVA 3RWFB 5D7SH 1R75A 4DO6A 4JRXE 2Z0UA 4L1HA 4YXKH 1OXYA 1O0VA 3GHEH 1FNGB 1U30A 1GZQA 2EH8H 2OMYA 2CLZA 5LBSA 3BGMA 2YD6A 3TA3C 2X2JA 3OKOA 1HEHC 3PFQA 5E9AA 3BUPA 4JPQA 4Z0XA 4PJDF 3DSNA 3LKQB 5DZAA 4OV5A 4P07A 3L95A 4GKSB 4Z77B 2B3RA 2FBJH 5DHEA 3KPNB 4CMHC 5I6XC 3REWB 4NN6B 3ZDZB 3GRWA 2A99A 4HJSA 4U3SA 5I2IB 2LE9A 5LQBH 3FT2B 3FQXA 2L0DA 2FT6A 5FGBA 1CD8A 1PDKA 1ID5I 5BCAA 5AWNH 4TQIA 3D06A 1NCHA 4U0RB 4JHZA 4AGQA 4P2RB 5CJ5A 2GUOB 5CN1A 1K8DB 2C1OA 3KPRD 4AMXA 2FWLB 3QI9B 3T3MB 2KI6A 4GY4A 5GQBA 4E68A 1VENA 1UXWB 1ZLDA 3DMMC 3EADA 5EIIA 3GI8H 5HPMA 2DOCA 4QHLB 2IGTA 3T8VA 3MLSH 3DV4A 4EKXA 5B3JE 4M7LL 3VGBA 2X3BA 1D5IL 1G6RL 4H8HA 1VAHA 5E2WL 3VNYA 4UTAL 3VDCA 2KQNA 4NZJA 1IC5H 1FNEA 1MFMA 2ADJA 3QC5X 5IM7B 4X9FA 5JHDE 2XXCB 3AU0A 3F5WB 5C70A 4PVMA 4XCYB 2JSFA 4MS8C 5T33H 2DLGA 5T1MA 5IW6B 2XBZA 4JO4L 1R4XA 4R0LC 4G9FD 2G4EA 1T6BX 2PCPA 3QYNA 2F7QA 1JNNL 1BQRA 3RTQB 2NMSA 2BY0A 1FHNA 4X80H 2JKIS 3N40F 2P49B 1NJ9A 4WK0B 3CN4A 1Q94A 4P3CH 4YDLB 2JKSA 5EU6D 4AYMC 1KBWA 4KVNL 3CHRA 4LPTA 4NOFA 2JQAA 4KKLC 3RBGA 3RP1A 5BV7B 4KVCH 4OCSH 4NQVA 5KN5B 1ITBB 2VL5B 3E38A 3P73A 4RISL 2X4SB 3B3BA 1E5UI 3KBHE 3T6VA 4KUCF 4LSDA 2X0WA 1ANUA 1G7MB 1QRKA 3DOHA 1PZSA 4IK7A 3VXUE 3ME0B 5EDSA 3LZFL 5E6YA 1OWWA 1WV7T 1CGSL 1NCCH 2GHWB 5CGTA 4RX4D 4F7PA 1OOAA 5F0MB 4LRIA 1TCRA 5C1MB 5I73B 5C0AA 1NCBH 3CLFL 4J28A 4PJGE 3WJMA 1H15B 1Q90A 1F0LA 3HN5A 4IU2A 4TL5A 3SPGA 3O3UN 3ES6A 3K91A 3ZT7A 5ESQA 3FCTA 2CGZA 1G0DA 2X89D 3QW9A 3NABH 4Y7MA 4OT1L 4B9KC 3UPRB 2O61A 2GC7C 1DJXA 3ILDA 4M3KB 1AJ7L 4L8BA 1QEXA 5AKRA 4FG4A 1S2EA 4FAAB 1GTFA 4UBDC 1AQKH 4X5QA 1KNOA 3DUHA 2GK0A 4YZWA 4GQ9H 1MSPA 2QJDA 4HETA 4W9ZA 3UTSB 4J3OD 4LSQL 1A7OH 3B9KA 3DXAE 1SNRA 5CJOL 1QI5A 1AZZC 1E3ZA 3SPVA 5I28A 1U8OA 2IADB 4NKQB 3QXTA 4XCNA 4A2EA 4U1IB 5C0BB 3ZMRA 3BH8B 3I3DA 4PJFB 1KFGA 3UAFA 2AQTA 3HI6L 4ZFZB 5KYWB 4YHNA 4HWUA 1PU0A 4AQZA 4ELKB 4JJ5B 3EUUA 3MV7E 4FQ2H 4Z3IA 3FO9A 4FFZH 4HOXA 1WFIA 1TTFA 1AGFA 4P9HL 4CRPA 4E42A 5IY5B 2J8UE 3QZWG 3ZRFC 3WIHA 2R2EB 1CGVA 1EFXB 4TSAH 5CCJA 5FFOA 1I9EA 1YNTB 2LABA 3NH7L 3QWNA 4RESB 4RMRA 4K9EL 5AFAA 2BNUA 1MFCL 3ZKMC 5E8NB 3RDTA 2GJ6B 3OX8B 2DRUA 2ZOUA 4Z5RB 1CTNA 2BMKB 1K8IB 3FHEA 4EI0A 5I1CH 3ARQA 5EV7A 3MUJA 2AMGA 4HKJA 2YKLL 5JZ7D 1O9ZA 3UJIL 3NIDE 1IAKA 4RQQB 3UGEA 2FHFA 3FO1B 4R7VA 1YY8B 3WFCL 1NZRA 3IRCA 4HCRA 1PW3A 5MHSD 3C2AL 4HPOH 1SEBB 3SKNA 1KGJA 3BWAB 5T1KB 3BRGC 2VMEA 5JW5A 4LRNH 3FCGA 3Q1EA 2Z34A 1KIPB 3NJNA 2A3TA 4Z78B 1H6FA 4PJXE 4OZ4A 12E8H 4QRPD 4PJ8C 1TETL 2FX8H 2FECI 3RZWA 5FYLE 1NGZA 5TK2A 1FH5L 3ARSA 2XN9A 3FH8A 3LN9A 4J3OG 4KJPD 5JW3H 2VRQA 2NNAB 3ATEA 3BUDA 5F6IC 5J13C 4ISVA 3SO5A 2ZWSA 2NW3B 1GOFA 1LYQA 2M26A 2WMPA 5C9JB 2X4RB 2JVUA 3PY9A 2CRZA 4U7KA 5D7SL 2CU9A 1FVEA 3QUZA 5HI3C 3A23A 3FO2B 4YXKL 1ZSHA 1L6PA 2EH8L 4OD1H 3UL4A 5HDOA 2JIXB 2IV8A 2OI9C 3QUMB 3TV8A 3I50L 4TTGA 3ULVD 2P80A 2ZX9A 5FUOH 3QZMA 4LLUB 4RAUA 5F9JA 4TSBH 1CPUA 5TDNA 1E9QA 1AIZA 2YPKB 3QJVB 2FBJL 4I4WB 4AQEA 1MDTA 4Z7VF 3KR3H 4M8VA 5KYXB 3TWYA 4MLSA 1GRWA 4X7SH 3V5DA 5HI5C 5LQBL 2K3HA 5FYLH 3V4PA 5CR1A 3C75A 1PFOA 2D3LA 4GFXA 4JM2B 5AWNL 1ND0B 2N1TE 2DM7A 5LCVA 3T8XA 3ZW3A 3ILPB 4B5ZA 1RJLB 3KCPB 4OJYA 2K78A 4PJ7B 2WCGA 3TIEA 2VQTA 2XZCH 4OGAC 4YDVA 4JLRB 5A6MA 3EHBD 3BMVA 3MRJA 1D5MB 1QAWA 3GI8L 3HB3C 4OAWA 4KRLB 4A7VA 2HMID 3MLSL 3D7PA 1NFDA 2LU3A 3HAEB 3CQFA 1ZLVK 1J8KA 3DJ9A 4L0PB 3PXLA 3VWKB 5FO9B 4K5LA 1IC5L 3NUKA 1MIEH 1TJGH 1VFAA 2VXVH 1MHEB 4PGCA 5HTSA 3U4BH 2GEQA 1KXQE 1KJMB 5I8EA 2FD6H 1HKLH 1N3NB 2XWRA 2HFFB 3VE0A 4QXTA 4GW5B 2KLRA 1CLCA 4ZAKD 5T33L 1SN2A 4BE6A 1YEDB 4QXWA 5DFVD 2ICWB 3QRGH 3GMLB 2DMCA 1Z9SB 5DC9B 1OT2A 2N0KA 3B7UX 5E94B 4X6DB 5DJYA 3E3QE 1KCRH 1HH6A 4TNWF 4X80L 3Q2NA 4Y5XA 3P2BA 3VWJD 4L4TD 2WBJC 4P3CL 3L7EB 3BAIA 1RUMH 4K23H 5C8JB 2DPKA 4PJDE 1HXMB 1O5DT 2AVFA 4KVCL 1EX0A 3PWPB 1YQ2A 4OCSL 1OL0A 5KOVC 3CMGA 1EA9C 1IGJA 2XJLA 1NAKH 3CC5B 1IQWH 4J39A 4H0LC 2BVQA 4JRYE 2OSXA 3GO1H 4PLKD 4I3GA 3ARDD 3EYQD 3RFRA 4K3GA 1J87A 2OMUA 4LT7A 4S2SB 3ARBB 3APDA 5ENWB 1NCCL 2HJLB 5CJQH 4C4UA 5LGJB 1QRNE 1NCBL 1QLEH 3DSFH 1IAIM 1X4XA 1UXLA 3KBFA 4FFYA 4KMQA 5AW9B 2A6JA 2VDOB 2VM3A 2YPLE 2M83A 5HYFA 3JV4A 1GCYA 3NABL 1YMMD 3K6OA 2VZTA 2YAMA 1TKWA 4DN4H 5I17B 2H4EA 4X5LA 1AQKL 3PDGA 2DM3A 3ATAA 4NQDD 1IC1A 4Y4KC 4P3DA 1TPXB 3QUYA 4GQ9L 1IMHC 1NKRA 3HI5H 5C6TH 1AVAA 2O4EA 1A7OL 2VMFA 4KUZH 4IRSA 3PAZA 1ZE3H 1T83C 4QHUA 1S9YB 3BWSA 2CALA 3DHMA 1BFTA 1J5DA 5TE7H 3IKKA 3LNDA 5FO7A 1N8ZA 3F65A 4OGYH 4AIEA 1A6VH 4GXUM 2ZG3A 4FQ2L 4FFZL 3V6BR 5BVJB 1CLYH 3ZDXF 3Q13A 3BVXA 3Q2VA 4HS8H 1SJHB 4LCWE 4TSAL 1FORH 4ODHH 2BSSB 3VM5A 5EUOB 3FONB 4ZMTA 2AXFA 4Q2ZB 4R7LA 3BZ5A 3K6SB 4QT5B 3IFOB 5KSAB 3FQ1A 3FRUA 3QG6B 2MQGA 1U92B 1T1YB 2FJFA 3KWWA 4JHAL 2VDQB 1GGBH 3TM6A 4APXB 1VERA 3RA7H 1W72B 3L13A 5L8LB 3NFSH 1IQDA 2IAND 2P5WD 2UUDH 4KY1H 4ONOA 4RVBA 2WZPA 4F5CA 2VDNH 1A7PH 2BIMA 3L3IA 5SV3A 4WU7A 2ATPA 2UY6B 1PZ5B 2GAZB 3C87A 3RX9A 1M7DA 3IAPA 1LD9A 3OMAB 1SXZA 4HPOL 4A63A 2YD8A 4PQXA 1FNLA 1ZA6B 1XR8B 3CFBB 4LRNL 1LDPH 3IPBA 1GA2A 3U6RB 3BISA 12E8L 2NR6A 2FX8L 4JFFA 2AITA 3UCRA 4AQ8A 1FL3B 2VR6A 3PWJA 4XBGB 5HHOA 1KLUA 1PKQE 3B34A 3H9ZA 1DVXA 4V1DA 3O3BA 5JW3L 5DD0H 1XF4A 2CHWA 5D70H 4IJTA 2P47B 5AVTB 4G8IA 1TUPA 4Y5YB 4HKZB 1AHKA 2I60H 1EV2E 4LKXB 5DU7A 5JHDA 3ML9A 1U33A 4HUUA 3QZPA 4UAHA 4MB1A 1XAUA 2J8OA 2AW2A 5DMJB 4OD1L 4QYOB 2H6OA 4P5KA 2D3JA 3HLAA 5DURB 3TN0C 5C0FA 2FSDA 3UJTH 1E30A 1CLVA 3H4FA 5FUOL 4TSBL 3L5WB 1BPLB 2V9UA 3RWFA 3EXJA 1ET5A 4PY7A 3I6LD 3GXFA 4EVNB 1JRHH 2H26A 2V3FA 3D08A 3GUFA 3KDMA 3O2DA 3KR3L 3QJQB 4F80A 3MLTB 2VO5A 4X7SL 3T1FB 3WI9A 1JXKA 3ZRSA 1UT2A 5FYLL 4OY9A 3G6JF 3LKQA 4N0UE 1YECH 4AIZB 4Z77A 2OJ1A 2DWXA 2L3BA 3B2UD 3BOVA 3KPNA 1BZ9B 4POZC 3V0HA 3UERA 4HIHB 5BNXD 4UILH 5I2IA 5JR1H 1A8JH 1OSYA 3FT2A 2EVGA 3PL6C 2XZCL 3OKNB 4N8VG 1FIGH 1I3UA 4CKQA 1A4AA 3DRQB 3LQAH 1BXVA 4P2RA 3T6XA 5AOZA 5B3SB 2I9TB 4FKHA 1B2WH 1MIEL 1TJGL 2VXVL 2HA1A 3U4BL 3VXQA 1UXWA 2J1YA 2FD6L 2VR7A 1HKLL 1Z7JA 4L5FE 1A02N 2FX9H 4LNRA 2EIDA 4QHLA 5F8QC 3HPJA 4XVOA 2V5YA 3IMUA 1MXDA 1VFOA 4LO9A 5GS0H 1TITA 4YSUA 4MWFB 4CJ1A 1BBJA 4JFDE 3CSTA 4IHBA 4OIAA 3F5WA 1KCRL 1BQKA 3X14A 2QADB 1A21A 5EPMA 5IHZB 4XCYA 4RFNB 3S3DB 4UQCA 4OW6A 5F7HA 1RUML 2H32B 4K23L 4NLHA 4JPWH 1H3WM 4QCIB 5C0AD 4WFHE 3RTQA 4PJAA 5F6HJ 4R7XA 5AOKA 2MWCA 4Z7VE 5BZXA 1D5BA 1NAKL 1IQWL 2VLJB 2L7QA 3GO1L 2H41A 3QDAA 2I27N 3EXLA 4F7MA 3BKJH 5DHMC 5KN5A 1XGRB 2VL5A 4L5FH 5E24E 2X4SA 3DURB 3D4ZA 1JHKH 1MCWM 1PEZA 1M53A 1PJ9A 1V5JA 3AT8A 3FZUD 1H19A 3PUUA 1XGPB 4FQXA 1QLEL 1HSBB 3QHZH 2F7IA 1ZDQA 3DSFL 2A4ZA 2Y23A 1G7MA 3ME0A 3D3VB 2WXLA 3AG3B 3B9KD 3AXIA 4Z76B 1ZOXA 3D07A 4ZS6C 1AOZA 1V7MH 4DN4L 3N41F 1H15A 2A77H 4J2QA 4GP4B 3MNWB 1E3XA 3ISWA 2HRLA 2ZWKA 1KPUB 3HI5L 1BIHA 3N9GH 5C6TL 1NOFA 2K70A 4KUZL 1D6VL 1YPZB 2DYPA 3CPUA 3ECVA 4OFDA 2Y5TA 3QIUC 4CNIB 2ETWA 1NDMB 2X70A 3RDTD 5HSFA 3JVGA 1RFDH 5TE7L 3RHWF 3ZYIA 1FGNH 4OGYL 3UTSA 1A6VL 2EYTB 2J71A 4HZ1A 2F08A 5IF0A 5DJ0B 3TZVB 3GSVB 3NOIA 1CLYL 1GW0A 2F8VA 5C0BA 1CWVA 1LP9F 3HNSH 5D1ZC 4C8XA 1T80A 3BH8A 2QVIA 4HS8L 3E6HB 4PJFA 4ABWA 1FORL 4ZFZA 4ODHL 5KYWA 2QZQA 3KPRE 4WW2C 4JDEA 2BW4A 5GGRY 4JJ5A 4ELKA 3BQUB 3J07A 4XNZC 3WXWH 2K8QA 2R1XB 4N90E 2Y1YA 5FWQA 4APQA 4Y9GA 2CBTA 5FCSH 1GGBL 4IRJC 5SX4H 3RA7L 1EFXA 3NFSL 4KY1L 4MNQB 3NFPB 3BPLB 1A7PL 5MP6H 4LP5A 1IGCH 2XN9D 5E8NA 3OX8A 1YJDH 1BEXA 4Z5RA 3O41B 2BMKA 1K8IA 1VZIA 1HHHB 5FXCH 2VR9A 1Z9LA 4FABH 1LDPL 3LZPA 3CVBA 1DVFB 1HL4A 4GG8B 3NJVA 2DTMH 4CADB 1QA9B 4OJAA 5ADOH 5TQ0H 3SO3C 2IXQB 4Z95H 1I4FA 4PYHA 1TF4A 1S9XB 3FO1A 2E7BA 3QUZD 4PHXA 2E5EA 4UOW0 3A6BH 5HVHB 2AJ3B 3QDJA 1I7UB 1FZOA 1OAKH 1SEBA 1VIWA 2NQDA 1FYTE 1KYFA 5DD0L 1IAII 4E41B 5D70L 1EHAA 1PY0A 1KIPA 2P80D 3RZCB 1JPEA 1AQDA 4U3XA 5EU6E 3R4DA 2YN3A 5ECGA 1F6FB 1V3MA 2WXRA 3JXAA 4GXUN 3BUYB 4GP8B 3LKSB 2NNRA 2I60L 3C5ZC 4MXVE 1I8AA 5DJXB 5DS2A 3VXMA 1B2YA 3FOLA 4HXBH 1M2OA 1B88A 1INEH 4J3WA 4L48A 3IAGC 4KMLB 3D52A 5CJXC 4J1UB 1B3IA 5IJVB 1JV2B 2NW3A 5DK3A 2LGNA 4U7MA 3UJTL 5C9JA 3SB3A 2Y5QA 4ZD3H 3EH5B 3IVKB 1BFSA 3ZDXE 3L4CA 4MD4A 4LPUA 3BIBX 1Q0YH 2J5WA 1JRHL 3MLVH 3IDNB 4RMQA 4AW4A 1YDPA 1EEQA 3KPOB 2Z65C 1F41A 3QUMA 3RVUD 3CDYA 3SBQA 1E2VA 4HWBA 4D9QE 5AKTA 3DX4A 2YPKA 1YECL 2HYMA 2QQKH 2R7EB 3MBXH 3Q2LA 3QJSB 4I4WA 4YGAB 3B2DC 3UFIA 3PWNA 4DKFH 4I18A 3GMMB 3VD5A 4RA0C 4MJ6B 4UILL 5JR1L 2MKLC 3ESUF 4XBEH 2XIDA 2WGNB 2HRPH 3M46A 3FRPB 3IMVA 1FFPB 4FMVA 4JM2A 1ND0A 4R90H 3LQAL 4X6CE 4DEPB 1S7RA 3CBJB 1JD9A 1D5ZB 3FQ2A 5KBNC 3DTXB 1XIWD 4IIQC 1FL5B 1G7LB 3WHE1 1JHLH 3CFUA 4HMCA 5I1DB 3FFCB 2BIPA 1B2WL 3GFUA 3L7FB 3WNJA 4N5UA 2Z8VC 3ARUA 5BPPA 4HIJA 2FX9L 4EDXB 4Z7QB 4ZUWB 1CI5A 2AJVH 5GS0L 5J6GB 4P9MH 2UX6A 3I2CH 3PDDA 4ZMPA 3MX0A 5KVEE 2NUTB 2NY4D 1TYRA 1MHEA 2VLKB 3QAZC 3CDCA 1Z5YD 1KJMA 3K74B 4J7RA 3RJQB 1N3NA 1RHFA 1YCSA 2HFFA 2QVTA 1AS7A 4CMMB 1A9EB 1H8LA 5D4IA 4GW5A 1JERA 3SHSA 3C60C 4PW4A 1YEDA 1WCBA 2ICWA 2VXTH 4HEME 4LKCB 1MRDH 3GMLA 3TYFA 2MOQA 3GSWA 3GIVB 2XA8H 4JPWL 4NPJA 3V52H 2BSRA 1I85A 4X6DA 2NYZA 2CPCA 1KIRB 1ZSDB 5EF2A 1ZPLA 4GRWB 4IBLT 4GXVH 1HDMB 3L7EA 4Y1SA 5C8JA 1R24B 4MD0B 5D7IF 1KBKA 4FXGC 5KAQG 1KEGH 3DUSA 4KKBD 3BKJL 3PWPA 2YZ1A 4ETQB 4L5FL 4P2QE 1Z2KA 3O4OB 1JHKL 4WZ9A 3CC5A 3MRIB 3ZE1B 3QHZL 2VQUA 4NUGH 3WIIH 3SDDB 4E36A 2XYBA 2HPTA 4S2SA 1XCTB 1F02I 2BOBB 4U7SA 2BRQA 5JORB 5ENWA 1HJBC 3PAYA 3SODB 5KS9F 4OSUH 1V7ML 1THAA 3EDEA 2A77L 4LLMA 5D6CB 3U48A 3DO3A 3I02B 4LE8A 1LLAA 4QNPE 1JPFA 4LESA 5IVXF 2BIIA 2E9WA 5F72S 1D6EB 2PTTB 3VA2C 1G1CA 3DI2B 3N9GL 1UACH 3RAJH 5D1QE 1URLA 2FAUA 4JUTA 4F7CB 2N59A 3FN0H 3M86A 4Q4EA 3KLAB 3VQLA 3L5JA 1E67A 3QRBA 2H45A 5AG8A 5HYJB 2ARJA 4HCFA 1UT1A 2NTSP 5GGUB 3GT6A 4K07A 4LVOB 4U2ZA 1RFDL 4JNXA 1FGNL 2DQUH 1F1DA 1T5XA 4XMWA 4OZGF 3D0VB 4JBSA 1KYOJ 1LJMA 3CV5A 1S9YA 3D39B 4PN6A 5GS3A 2WZPD 1BX2A 3HNSL 5TE4H 4NJAH 2X6UA 4J3OC 1UEMA 3WJLC 5DSCB 5H2BA 1P9MA 4LAQH 1B0IA 2PPDA 2V2TA 1UASA 4XVJH 3PQYA 3WXWL 5EBMA 4A2LA 4ENEC 1UWYA 4U05A 3IWVA 2EIKB 3MRDA 5BVJA 1BVNT 2YFNA 4Y2NA 1D9KB 3UGXA 2FBOJ 1OARH 4IMLB 3AY4A 3SZ6A 2XICA 2P28B 1R3HB 2VH5H 4JFFD 3P4NA 4QHNB 1SJHA 2J43A 2DKUA 4KK8D 5HHOD 3TH4T 3WHXB 1F86A 4HZAA 1DLHB 5FAAA 3FONA 5F1OB 5MP6L 3SCMC 1IGCL 4V1DD 3K6SA 1YJDL 3IFOA 3IU3B 3P4MB 2WXHA 3ELAT 5DJ6A 1T1YA 3W39B 2YQ2A 4FABL 4APXA 4NKDB 1CDGA 2O6EA 1O9WA 1W72A 3P9MB 1HEJC 1G7IB 4N2EA 2DTML 3MJGX 3WKPA 3QEQE 5TQ0L 1U42A 5ADOL 4Z95L 2VJ8A 2WVSA 3R4RA 5I8OH 2UY6A 1QD0A 2GAZA 3A6BL 2PMZA 4N25A 2ALAA 2EUZA 1OAKL 4UZUA 3O8XB 1FC1A 3WL9A 2QV4A 1IAOA 2EVIA 4NNYB 5GJSH 1XR8A 2XVBA 2TAAA 2VERN 4XVSL 1MVYA 2C9RA 4BBWA 2IC2A 3PG2A 5LO7A 3U6RA 4NS0A 3AGVA 1MW0A 1WT5C 2GY5A 4K7PX 2YAEA 2VYRE 5DQ9B 3HR6A 3VFRA 2XQYA 4E5XB 3MGTB 4BH7B 2TSAA 2ZSWB 2FLMA 3O81A 3QDMB 5SWQB 4FADA 5D93B 3EJJX 5ICZA 2GTQA 2RH0A 4HXBL 4AE1A 3EF7A 1INEL 3ALWA 4PRPB 2J20A 3QP3A 3HE6C 3ZDYE 5E0FA 4ZD3L 4Y5YA 4YSEA 1E0OB 4YFLF 1MN4A 2I7SA 1Q0YL 4WWKA 1AR1B 2I9LB 2P4AB 3ESNA 3MLVL 2RBLA 3QIWA 5D7JB 4BQ9A 4FXLA 3WD5H 1S7WA 4MGXA 5DVKA 4AEIH 1OZTG 1NBYB 2ZXEB 4JFVA 5IROC 5FYJE 1U6AH 4MA3A 2VXUH 3IDIA 4YSDA 2ORBH 3AUWB 3L5WA 4ZMZA 5LVEA 3MBXL 2QQKL 1SXAA 3VI3E 2CM6A 3DV6A 1U8CB 3K8LA 4HEPA 4JFTA 1L0QA 2D31A 1OTTD 3QNFA 4DKFL 3MLTA 4XHJC 3ULVC 1PTZA 1DZ0A 1H5BC 3Q01A 4TLKA 1M4KA 4PV9B 4XBEL 4ZMQA 4OZIF 1KG0A 2HRPL 1P1VA 4I0PB 4PFEA 2UY7B 4AIZA 1HC1A 4Z7WB 4A67A 3QO1A 1FZJB 4HIHA 3O0RH 3SDAA 1ES0A 2C4FT 1JHLL 3MODH 5IG7B 1T4WA 3L2NA 3CXHJ 3P9LA 2VLLA 3AVEA 4DJMA 2X2UA 1JI2A 3DRQA 5EN3A 1VSCA 3FN9A 1ZK9A 3C09C 4MRBA 2B2XH 2JKXA 5IFJA 1PVHA 3MRRB 1SBSH 2AJVL 2VDPH 4HKBA 4P9ML 3I2CL 3RTQD 1S7TB 5FYKH 1NIDA 2VM9A 5FYJH 4FNPA 4WGWB 3W81A 2LTQC 1U3YA 4LZKA 4LPYA 4XPBH 3H2PA 5SWZA 1A3QA 2EDXA 5E1AA 2KYIA 2E7MA 2PPEA 2OW7A 5CXPA 1G4RA 1NGYB 2VXTL 1MRDL 3NESA 1F6LL 2WWOA 3M7OA 1URIA 2XA8L 4MWFA 4MAYB 3V52L 1UJTA 5C7ZA 4FQXD 5J11C 2YGNA 5IHZA 5DFVC 1OD7A 1ZHNA 4Y4HB 3HOGA 1BVOA 4U1KB 1NCGA 4H5SA 1EO7A 4GXVL 2EDJA 2WQ8A 2AQ2A 5GRVK 3CFTA 3RYMA 1KEGL 1U8MA 4UANA 1KB9J 3VWJC 5GS2H 3MRPB 2Y07H 1NUNB 2WINA 1RAMA 4HLZG 1AE6H 5FUCC 3MJ6A 1ETA1 4ZS7H 5CIPB 1HHIB 1Z9NA 3UAJA 3S9DB 4K5OA 4PRBB 2AV7A 2XG4A 4NUGL 3WIIL 1T66C 5IZ7A 5ID1B 4P4KC 5GPRA 2XWTA 1UURA 3EGXA 2JE8A 2WN2A 4WI2A 4LEEA 2DYPD 1UH3A 5DUJA 1XGRA 3DURA 3N43B 1AZRA 2XJKA 4PLKC 4CN4A 3GJFB 4PJ9B 1HSBA 2AXWA 3C6LC 3IF1B 4HA1A 4PP2A 5TPWH 1UH4A 1YEEH 1K4CA 4UUJB 1IFGA 3D3VA 2OYKA 4JQVC 1F2XK 4YBHA 1E4KC 3ZGHA 1UACL 3RAJL 2N0MA 5E8EB 3BW9A 3GXUB 4Q52A 5C0BD 3FN0L 4AW7A 4F27A 4ICXA 4N85A 4UT9H 1NANI 4OLVH 5JHAA 5CLZA 1OTUD 4WI9A 2QPEB 4PJBF 4OIBA 3P77A 4U1GB 2DAVA 4PJIB 3E0GA 3WLWC 4APQD 5E5LA 1MCCA 2FQGA 2OA9A 1PAZA 2XQ0A 4K3HA 5IQLA 3T5WA 1LO4L 5I75B 5EU5B 5K9QG 2AEPH 5I1KH 1YPZA 2A4CA 2WLLB 1EFXD 5TGBB 1N5AB 2WVVB 4CNIA 3TNNB 4F37F 1NDMA 1UVQB 1KC5H 5TE4L 4NJAL 3ASOB 1I8MB 1CL7H 2F8OA 4LAQL 3IMSA 4EIUA 5F1IA 2E8ZA 2EYTA 4XVJL 1RKRA 1WTGT 4WLCA 3JV6A 2LHAA 5DJ0A 3TZVA 1CFTB 3GSVA 1Z3GH 2WAHA 1OARL 3DIDA 3EAKA 4G7QB 4G9DA 2VH5L 1BYOA 3MGOB 3BT0A 1XXFC 3X1FA 4K8RH 1JV5A 3QDJD 2G3XA 2XNAA 2P5EE 2WYHA 3NJJA 3BQUA 2R1XA 3CVIH 1CTOA 4PJCA 1N10A 1QBAA 1XTLA 4LPVA 4AVIA 3VXRB 3WS6C 2F54B 3MV9B 4G5ZH 2RGSA 3V8CA 4A7SA 3AWFA 4MNQA 2WYZA 3NFPA 5LNEA 2BNRB 3J2PA 1EO8H 1QSZA 2OQJB 5I8OL 3VXMD 3KNBB 3K5RA 2L04A 1W9XA 1BYNA 3O45B 3MOAH 4XPTH 1HHHA 3L5HA 3M8OH 4PJ6A 5E7BA 5GJSL 1MH5B 2XY1A 4K4KA 4GG8A 1IGFH 1N70A 5DHXB 4BFGA 1DJSA 4AGMA 4CADA 1XF2B 4G8AC 3KJ4C 5E5RB 3QPQD 1SYSB 4JQIH 4P5RA 4E9LA 2AJ3A 4XMKH 4WNQB 4A38A 4AC2A 5SX5H 1T2XA 1GCFA 4E41A 4B97A 3L3JB 1QWHA 3RZCA 1T6VN 1MIMH 2VB5A 5B1KA 2YC1B 4XO3A 5F7LB 3HS8A 3SKUD 5L2KE 5A7BA 3BUYA 2DQIH 4Y5VC 4LCIH 4UQBA 1WAAF 5I30H 3VJ6B 5EB9A 2X28A 2F53B 1YSOA 4W6XB 3RB5A 1NC4A 3TURA 2F18A 1EERB 3WD5L 4J1UA 4JPIB 4AEIL 1JV2A 2D4DA 4HWZB 3ZYZA 2OZ4H 1NWOA 3CU7A 4JM2D 4OM1H 4N26A 1U6AL 3UEZA 2VXUL 3IVKA 3IM1A 2ORBL 2Y6SD 4NWUH 2YLHA 4NDMB 2EDWA 2HFTA 1MPAH 5E23A 4CVUA 4ZUVB 5DDHA 4L3FA 3IDNA 1QPKA 3SEPA 2XACC 1PLBA 3KPOA 5E4EC 3IDMB 4PBVC 2KBGA 2BOCA 4P2OB 1OAXH 3GWJA 2VABB 3JWOH 4ACPA 3OKKB 4G8GE 1F3DJ 2R7EA 3QR2A 1B0WA 4Y9EA 4WEMB 2D73A 2UZIH 3RVXC 3MI6A 1S8DB 4CUCA 3NACH 2VUOA 2XWEA 3GMMA 3BP6B 2ESVB 2DIAA 3O0RL 4MJ6A 3FT4B 1QSEB 3IJEB 2HT2D 5BS0B 3MODL 2WXOA 5JYMA 3ARVA 3X1EA 5HBBA 3U9WA 2VDRH 4R4ND 1MG3C 5D2LF 2DMGA 1XGTB 4BKLB 2B2XL 3S36X 5J89A 1D5ZA 3MYJB 1SBSL 1OAJA 2VDPL 3DTXA 1FL5A 1G7LA 5FYKL 4KO7A 5FYJL 1CXLA 3EYOB 3DROB 5HHPB 1EQWA 3EYUH 4AEHL 3U30B 3E8UH 4MYPA 1BLIA 1MUJB 1EIBA 3GSOB 4M61B 4XPBL 1SOKA 2VLRE 5HGHA 3FB8A 4P46A 2A9MH 1NBCA 1QFUH 2NQCA 4LEXH 5FKAB 1TQCC 1QATA 3FTVA 4FNLH 4NO3B 1MI5B 2XN9E 2NZ1A 5FK9B 3NCEB 3O11A 1E8XA 3S37X 3V4VH 1MCRA 4DT2A 4AVKA 2VLMD 2WLKA 5KANG 1FPTH 4LKCA 4N2OA 3ZR6A 2MHAB 3FYEB 4GG6F 1HHKB 1TIUA 2Y07L 2WNGA 3HZYB 5DHDA 1AE6L 2APXA 4L0ZA 1VDGA 4KJWD 4ZS7L 2CM5A 4KTGA 2JMRA 3IRPX 2YQ3A 1UJ3C 3P0VH 1HDMA 1MCHA 4YDNA 1X5XA 1R24A 4NKOB 3CFEA 3TJHD 4XXWC 1MAJA 3BIAX 2G3MA 4GUPB 4ETQA 2MSPA 2QBWA 4A6YH 5FR3A 3WV0A 2C26A 3FH7A 3G04B 2NQ3A 1CT8B 3QFDB 1FLTX 3H2WA 5IWLA 4HG4J 3SDDA 2P43B 5TPWL 3EO1B 5EOTA 1YEEL 1XCTA 2FUQA 4PG2C 5JXAH 4KKAD 2CKBB 3LB6D 5H37A 3R8BB 1OCCB 5FOBB 4W9CC 2R8SH 2ZCKH 5D6CA 5DS1A 4ADGA 4FL4C 4UT9L 5I1JH 4OLVL 1QLFB 3PQYD 4JRLA 5E6IA 1HHGB 2ISDA 1E65A 3CUPB 2AEPL 1NFDE 5I1KL 4ES9A 4K9EC 4G8EA 4LVEA 3KLAA 1F13A 4KKRA 1MFAH 3WIFB 1KY6A 5HYJA 1KC5L 5GGUA 3AAZA 3LQZB 1CL7L 1JPGB 1QHQA 3RURA 1HH9B 3U0PA 4J4PC 2Z92B 4JKMA 1BECA 1ZAGA 1Z3GL 2E86A 5DFWH 2N7AA 2C5DC 2NY6D 3PAUA 4KC3B 3IDUA 4WHCA 2HJKB 3RVTC 5F6HI 5IMMB 5DSCA 4K8RL 1BZOA 1A7BA 3QUXB 3S3JA 3LIZH 5T1LB 2DQ6A 3CVIL 5DRXB 1D9KA 3QO0B 3T0WA 4IMLA 3GDBA 4G5ZL 4QHNA 2K7QA 4I0CC 3TASA 1T2JA 5KWYC 3WKNA 2DBLH 1DLHA 4M62H 1AAJA 1EO8L 2ARJQ 3SGEI 3EJYC 1HEZB 3P4MA 2TRHA 3VMPA 1DHKA 1KENH 4RA3A 4XPTL 3MOAL 3JYBA 1Z32X 3M8OL 4MASA 2UWEB 3P9MA 1G7IA 1KTCA 4BFOA 1IGFL 3GRGA 1LEIB 1YNTF 2CHNA 4PREB 1CE1H 5BOZG 2E4TA 3V0FA 3H85A 4WWKD 4JQIL 5D7LB 2Z31C 3BDYH 4XMKL 3RWHB 1JWMB 3IGKA 1F1AA 5E2TH 3QIWD 5GZOD 4KQ3H 4R9HA 5C08B 1OANA 4YSCA 4PJBE 1WA2X 4YQXH 4WTXA 1MIML 1ZV5A 5IW1A 3ZKXC 1UUSA 1JWUA 5LB1A 3ZMNA 3C8KB 4Y1AE 2DQIL 2WVUA 4BH7A 2JCWA 4LCIL 2PWFA 4E5XA 4N8UA 1J5OH 3QDMA 5SWQA 5I30L 1J18A 2AV1A 1YUHB 3QARA 2OCJA 2C7UB 1THCA 4HS3B 1KTRL 1R5WB 1R5IB 1NQBA 1AS6A 2Q20A 2OZ4L 1YMHB 4NQSB 2BWQA 5L4JA 4M5TA 5CGMA 1ETZB 4NWUL 1T89A 1NEUA 4PJ5A 3SDAD 1MPAL 2I9LA 5ES4B 2OYMA 4X0NA 4PB0H 2FEDC 2KZBA 2YMXH 3S4SB 3QA3A 4M4PA 1NIAA 1OAXL 2Y1AA 4UM9D 3MNDA 3JWOL 1CD0A 2QSQA 4KJQD 4N2CA 1NBVH 2UZIL 4F3FB 2DEXX 1WTLA 3QZBA 3UZQB 3P3RA 1VJSA 3NACL 4DK6A 4NUPA 4TVPH 1MY7A 5HPOA 1DVZA 2B9AA 3HVNA 1BOGB 4PV9A 4U49A 1JTPA 1A4KB 4LIQH 5SWZD 5HGBB 3ZL1A 2UY7A 4AGLA 3NN8A 3SKOA 2EAEA 2VDRL 2K4AA 1ZLSH 1SXSA 4XNAA 3WAKA 2CAKA 4I3SH 4WHYH 4EOWH 2YRPA 1GGYA 1FZJA 1KY7A 4F5CE 2ZYHA 4KFMA 3MV8B 4KI5F 5SV4A 3PREA 1KT2B 5DD1H 5IG7A 4BQ8A 2QADD 3VQ1C 1G9EA 1XSIA 3EYUL 4WJ5B 1Y7VA 3E8UL 4QOKE 1NCWH 4HEPG 4H1LH 4LDCA 1XIWC 3M07A 5KBDA 1R3JB 4QWWD 5C07D 4JFFE 2A9ML 1QFUL 4LEXL 4PJ7F 1ACYH 2J5LB 3VD7A 1WAAE 2YAFA 2MCG1 2ZNWA 4FNLL 5HDRA 3UAJD 3W11D 3K6NA 3QUGA 1P4LB 1DE4A 1WDAA 2Z35A 3VXNB 2ZKMX 4IEFB 4H25B 3V95A 1FPTL 1NGYA 2XVKA 1B3JA 4ZSOB 2WQRA 2AK4E 2V7NB 1N6UA 2HAZA 3G5XA 3MMEA 1WZLA 4JG9A 2I32A 3W9EB 3BCDA 4UOJA 3WGVB 3D3VD 1IV8A 3P0GB 3P0VL 5E1IA 3GZQA 4HZLB 4M5ZH 4QXUH 1W8OA 2A1WH 1L9MA 2E7HA 4GSDH 2FQEA 3B2PA 4PY8J 2XKNB 3MRPA 5F93C 2J55A 4A6YL 4JAMB 2BO0A 2PTVA 1JNLH 1N68A 2FO1A 1M05A 2WUCH 3HPLB 4XPAH 4JFOA 2VITB 3II2A 4JHBA 5ID1A 1ROCA 4UTBA 5D6DC 2L8AA 2VE6A 2X53A 5JXAL 1KCUH 1MRCH 4HK3N 3PAVA 4M93C 3PXHA 5GGSA 5B21A 3AM8A 2R8SL 1V3KA 2X88A 2XTSA 3GJFA 4PJ9A 3ZDZE 1NLBH 2ZCKL 2WXIA 3IF1A 3TF4A 4K7PH 1UZ8A 1YRKA 5CWSB 1BP3B 2QDVA 4D0DB 3V6ZB 2P8LA 5I1JL 3T0DA 2HFGH 4UUJA 3E6FB 1I8LA 1RUAH 3BVUA 4MJ5B 4BM7A 1S9WB 1AKPA 2Y7OA 4P2RE 4TKWA 1P84K 3MO1B 4MCZA 1DUYB 1MFAL 3GSQB 4NKMA 3BQUD 3T3ME 2XPZA 2NY1D 4MNHB 1T21B 3QQ4B 1E9PB 3ARFC 1CICB 1OD9A 1SVBA 2BZDA 2WLLA 1I3VA 1P0SE 1FNHA 5TGBA 1N5AA 1QG3A 2O6FA 2ZOKB 3DVIA 4QTFA 1BXXA 3QFJB 2B5IC 4FRWA 3DGCR 5GHWH 4EUPB 1ROWA 2VZ1A 1BG1A 2VR5A 3VFWA 3LIZL 1DCLA 1YEFH 1IL1A 1RUPL 5CHNB 4F9PA 2UVEA 4UWQB 4UQEA 4KFZC 3QUHA 3MGOA 3BAXA 3QB7C 1FFOA 2DBLL 4M62L 3K7UA 2QKIA 4DO5A 4NO0B 5D9SB 2O1AA 2MPVA 2FIKB 4WSKA 1KENL 1D7BA 1QI4A 4KK8C 2F54A 1URZA 5E4IA 2FJGB 3MV9A 4M8RA 3NJLA 2ICEA 4RIRB 1CE1L 1LHZA 2IBBA 4MA1C 3FH5A 5EUOF 4B9ZA 4YIQB 2VRAA 1LO5B 3UBHA 5IJBC 4GW1B 1NC4D 4G6MH 5E2TL 1UADC 5B38G 1J48A 3ILQD 4KQ3L 3L4UA 1MH5A 4WI4A 4KI1A 4GRLC 1XF2A 2YPVA 1J0KA 2E47A 4OBRA 1QZNA 3VX0A 5SWSA 3POCA 4KRPB 1J5OL 2NY0B 3UBFA 4KROD 1K85A 1G0YR 3L3JA 1RURH 1T4KB 4FQ1H 3TTYA 4U6TA 1SJMA 4TUJA 2PXYC 2Z7ZA 3IXTB 1XFPA 5DD5H 5IGXH 2VW6A 1P1ZB 4YAQB 5KYYA 2VN5A 1CFVH 4UNIA 1FAIH 2M8XA 4RZCB 3NZSA 3UZEC 4HDIA 4PB0L 4M7ZC 2YMXL 3UTSE 4HWZA 5DT1H 2ZF9A 2EUXA 3G08B 1A9BB 1IKOP 3TA3B 1NBVL 5JPNC 3CZNA 5C0BE 2CBOA 4NQUA 4ZUVA 1ECYA 3W38A 2VC2B 4I7ZC 4PJFE 5DMIH 3EYFB 3A4FA 3EDJA 4TVPL 1NSNH 2VZUA 1A64A 1JGLH 1KLFB 3MCG1 3D4YA 4R5TA 4Y8AA 4CMHB 2ID5A 2VABA 4LIQL 4U4BA 5E6RB 3V0JA 4B9IA 1NCDH 3T65B 3AS1A 1OTTC 3NSXA 4P46D 2WK2A 3MRNB 1ZLSL 4EOWL 4I3SL 4KK6D 2P1YA 3QR1A 4FX5A 4HBCH 5MEPA 3BP6A 3QC6X 1NAMH 2W92A 3FT4A 3PV7A 4AV0A 1QSEA 2DIJA 5BS0A 3H3KA 1O7SA 3O6FC 2GJ6E 3N04A 5DD1L 2JH2A 4XB7A 2FWSA 2X4UA 2X6AA 3O9WD 1KSRA 1NCWL 3F83A 1BQHB 4U1NB 3VYNA 5EC2A 1RK0B 4NQCB 4PPTA 3JQOB 4LOFA 5AVZB 3OAWA 1ACYL 3MRQA 3EYOA 3DROA 3DO7B 2CCVA 4QPEA 2C4FU 2CRMA 1WYJA 4XMXA 3GSOA 3LS5H 4UOW1 3NIFB 1JK8B 1PZ2A 1ZT4B 4JDZA 2Y2TA 4BFNA 4LXFA 5D5MA 3PHQA 4Q6IA 1L9RA 3S0PA 4JM0A 1E27A 2B1OA 1OK0A 5EU7E 3TLRA 5FK9A 3SDDD 3CVCA 1C7SA 4H8UA 4R0LB 3LXUX 3S48A 3RX8A 3N06B 3V0WL 4FYSA 4ZFQA 4M5ZL 4QXUL 2A1WL 3O2VH 3OKDA 4GSDL 4JN2A 4LSRH 3R06B 5TDOB 2GBVA 1LTXA