5LAPA

P53 cancer mutant y220c with cys182 alkylation
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
195
structure length
195
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2-Sulfonylpyrimidines: Mild alkylating agents with anticancer activity toward p53-compromised cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Cellular tumor antigen p53
total genus 47
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lapA00
1IO4C 3D09A 2GEQA 3D05A 3D08A 4AGMA 2FEJA 3KZ8A 4L18A 2VUKA 3WTUA 2BIMA 4LOFA 4LOEA 4L0YA 2IOOA 2X0UA 4IBWA 2BIQA 4IJTA 3WTWA 1GZHA 3WTYA 2MEJB 4AGLA 2RMNA 1TUPA 3WTTA 1YCSA 4IBYA 4G83A 2H1LM 3IGLA 2XWCA 2J6WA 2IOMA 4IBZA 3US1A 2J20A 5LGYA 2IOIA 1H9DA 5AB9A 2P52A 2X0VA 2XWRA 3VD2A 3Q01A 1LJMA 4IBQA 2OCJA 2BIPA 3D07A 2BIOA 4KVPA 4QO1B 3WTXA 3EXLA 2AHIA 1E50A 2J1WA 4HJEA 4IBTA 3VD1A 1TSRA 2BINA 1HJCA 4MZRA 2WGXA 5A7BA 5ABAA 1EAOA 1KZYA 3D06A 1UOLA 4G82A 1HJBC 4AGOA 1GZHC 3WTVA 5KBDA 3WU1A 3WTSA 1CMOA 2J21A 3KMDA 3IGKA 3VD0A 3US0A 5AOKA 5G4OA 3D0AA 4IBSA 3Q06A 1CO1A 3Q05A 2AC0A 4XR8C 1HU8A 1EAQA 5G4NA 2ADYA 4IBUA 4L0ZA 4AGPA 3TS8A 5AOMA 2J1XA 5AOLA 2ATAA 2PCXA 5AOJA 5G4MA 3EXJA 4AGQA 5AOIA 3ZMEA 3QYMA 1T4WA 4IBVA 2YBGA 2J1YA 4LO9A 3QYNA 4A63A 1EANA 5BUAA 4GUOA 5ECGA 4AGNA 4MZIA 4GUQA 5LAPA 2X0WA 2J1ZA
chains in the Genus database with same CATH superfamily
2HFEB 4M62H 4AV4A 4G8AC 1DVUA 3GI9L 2PF6A 1E6JL 3RFRA 3FO2A 5F1NA 4QRSA 1U33A 1KJ2B 1LHZA 1IC4L 1WZLA 2XPZA 4Z3HA 1SHSA 1UENA 2OJZL 3KJ6H 4XBPA 3UBXA 2V3FA 3C60D 4X4MA 3DROB 3AG1B 1IBHA 1BVLB 1R3JA 3TT3H 3V0HA 2EYRB 5DWPA 4XCEB 3MNWA 4GKSA 1KG0B 1ZV2A 1OY3B 2EUXA 1B3IA 3K8MA 4WU7B 1HNGA 4MSWB 2X9YA 2XC8A 3NCYS 1V05A 4E42A 1WZKA 1EEQA 3NVQA 1KXTB 1FC2D 2ZX9A 5IHZB 4HIEB 4LVHC 5CD3B 2G0KA 1TEYA 4P9HC 1Q9LB 3HKFA 1G7HB 2WYTA 1R5IA 1G7IB 3DJSA 3O81A 2Y36H 5C0BB 3CN0A 4P2OA 4OKVA 1JHTB 4OBSA 3BKCH 4JQIA 4UNIA 4N1EA 4OH2A 5H37H 5F0MB 5A2LH 1IIIA 3ZKND 5IMLB 1IKNC 1N70A 2J4WL 4ETQB 2AJVH 2V5TA 3MLZL 3VRJB 2V8LA 3BH8A 2E7BA 1JGIA 3JWDC 1C5DA 3AS3A 4OD3L 3RDTB 1D7BA 4RGOL 3FTVA 5JNYB 1IBZA 2ZCKH 4RQQB 4KQ0A 1DQTA 2YPVH 1EJ8A 3WOVA 3NTCH 2UXGA 2EE2A 4I13B 4M48L 3B2MA 2QPEB 1SUHA 2YARA 5FGCE 5KVEE 1X5GA 1D7FA 4KK9C 5LXGH 4EIZC 3LRKA 2NYYC 2ZUVA 5EN2B 3BMWA 3C09C 4RAUA 3VQLA 4JKKA 5D72L 4FQQA 4QNPF 2BVUA 4F5CE 3VYOA 3FFCE 4BK5A 5C0DA 4LVOC 3EZ8A 4CMHB 2MPAH 3W0WA 1NCCH 3B2PA 5C71A 4MJIB 2CLVB 5BMFL 2V2TA 1CLZL 3NAAH 5CZRA 1AGDA 4ZUUB 4JKMA 3RKDC 3VAEA 3N85L 4DFIA 3BI9X 3LZRA 1VB9A 3MRFB 4ZAKC 4F2MB 3R1GL 3LH8A 3SDDC 2HLFC 3VWJB 4HBCL 2YN5A 2A6JA 3DIFA 4N86A 4XRCA 4L8CA 1MREL 3J7HA 1REIA 2BVPA 1AKJB 2UUDH 3GMRA 2VISB 2I85A 4JFED 1KTDB 4WO4C 5CINH 2EDQA 4AYMC 4HKXB 4GAYB 5DQJB 5FYJE 4GW1A 5FV1L 2H0JA 4QLWA 1MNUH 1YJDH 1CYWA 4MNQA 1G7QA 3FTWA 3KAAA 4KHTL 3QR1A 4MDIA 4NKDA 3ULUF 4KO5A 3MBWB 4WUUE 1A7NH 1PJWA 4LXFA 4X5RA 2QKIB 1ZK9A 3JVGA 2AABH 3ARXA 4HULB 2R0KH 3MRCB 4MD5A 1U8IA 4I0CC 4A2LA 2D3JA 5PAZA 4L8DA 2OZ4H 4C56B 1W6LA 4BWTA 2IEPA 4XN7A 3E1F1 4LAJH 4HWZA 3L08A 3HCVB 2X4TB 3OD3A 1DL7H 1ZLVH 2B1AL 3UTTD 3L5XH 3QXDA 2A9NH 3PWLB 5DS2A 4A6YB 2VMDA 1UWXK 5CN2A 3FB7B 4M1GH 4XVTL 3GLEA 2OJZH 1Y6KR 4KI5E 5GGVY 3DV4B 4IBLT 4IRJD 1T5XB 3L1FA 2FO4B 4DQOH 1EFXB 2GPZA 2XN1A 1EO7A 2TRYA 1KIRB 3TBVA 3OKYA 1SXSA 1S5IL 3K5RA 1QR1B 3V6ZA 4U1GB 1FNGA 4G7RB 1ZK5A 4PBVC 2J55A 2LE9A 3L7EA 5E2UH 2UZYA 2ZX8A 4MQSB 3B3IB 4C4KO 2YAHA 3LEVL 5BZXA 4GW4A 1KYOK 4U7KA 1G84A 4OZ4A 3FH5A 2H1PL 4NBZB 1NL0L 2BP0A 5I6OA 2VTFA 3QNFA 2XY2A 2G2PA 2VAJA 2YEZA 4GKSB 1QSZA 5ADPH 5IIEB 4QHNA 1NSNH 5LBVA 3TP4A 2G9KA 4NO2B 3MC0A 4Y16B 3VD0A 3MCKA 5BS0A 2HYMA 1R9FA 1IM3B 1NFIB 3PNWA 2HMIC 1Q9WB 3Q06A 2VDQL 3GMNA 2Z7UA 1KN2H 1RIHH 4CDGC 4CVWA 2HA1A 4IRJA 4IJ3B 3ZW3A 2V17L 3IXAA 5LG1A 1UXSB 3TF7C 2QL1A 4LVEA 1QSFD 2VDQB 4CMMA 4B95C 2WVUA 1JHTA 1GMEA 5CKGA 1TETL 1TYEB 3K2UH 4Y16D 5IMLA 4F9LA 4ZFOL 1BM3H 1IM3D 4PJXF 1QWNA 4XWGH 4NJAH 5D2NA 2FCBA 3DYPA 3B1TA 4Q9RH 3U46A 3ZIYA 4XMKL 2L8AA 4HAGA 1ZHBB 4LEOB 5AOIA 1QSED 1A8JH 3T6VA 3PHQB 1IC5H 5CJ5A 1YEJH 2G4GA 2O26U 5JPNB 3VGBA 1WAPA 2A6IA 2JB5L 1S7SB 4WHDA 3U7WL 3UYOD 3GBDA 5ITFA 2FJHA 3PPEA 2WO3B 3RZCC 2XBTA 3VFVB 1F90H 4HIIA 2GSGA 3CVHA 3HNVL 1I7TA 5F7EH 3UX9B 3QFGA 3VD5A 1G0YR 3U4AA 3KL5A 5J9PB 2BIMA 4WWID 1T20B 1A66A 5AW0B 2BW4A 2BC4A 1WAAA 3V4VL 3VI3E 4AKOA 4L2YA 5CJ8A 5FKPA 4J8RA 4YDIH 3F5WB 3QUHA 3FONA 2GVYA 1IAII 3Q2NA 4GPVA 3EJUA 4LE8A 4A2GA 2FATH 4R4FL 4U6TA 4ZZKA 1W8OA 2DM4A 1JGDA 4QYOA 2N3JA 3FSAA 4BSVB 1AZNA 3VGAC 2D0HA 3QYCA 4D8PA 3GMRB 2LV4A 1NUGA 4WJKB 5F7BA 4YDLC 3FFDA 1NBCA 3MR9B 5DQJA 2DQTH 3QRFM 1GZPA 2Z35A 4KAQH 4XMZA 4UT7L 4UMSA 4BSWB 5TQ0L 4AQEB 4ODBD 4TNVF 2CCWA 4U1KB 4NNPL 4XAWL 4O58H 3V8OA 2HUHA 3MRRA 5F0PB 4KKBD 5IMKA 1DEDA 1AD9B 2NQ3A 2WUCH 5C0JA 1EBPA 3EJTA 2AFNA 1NSNL 4L4TB 4GMSL 1J0YA 3C5SB 2P8PB 1GJWA 2EIKB 3LEYH 3MGOB 3AROA 1E27B 4BV1A 1Z5LB 4EUPB 3OKOA 4JFHD 5IEHB 2VIRB 1CXEA 3OAWA 3Q43A 5DEGA 3ZKSD 1R5WB 3T0EC 2ZOLA 1YEWA 5GJSH 4FL4C 4HUCA 1RURL 4Y2OB 4IHBA 4P23B 3BUBA 3CFDB 4GSRA 3VTTA 4PS8A 3FRUA 1GVIA 3DURA 5DC2A 4FA7B 3C5JA 1NCAL 4ZUSA 1TENA 4JAMA 3FCTA 1IEBB 4G9DA 4M8QA 5CSZA 3W81A 3VG0L 2JMRA 5DMJB 4LDLB 3VXME 3ZKXC 3T6XA 3TBVB 5I6XB 4DQOL 2V2WA 3L3HA 4XNXH 1IGML 2Y5TA 1P84J 3B9EA 4P5TD 4XI5C 2H7WA 5IBTL 3R18A 5ICZA 5I8OL 1BQRA 4U3HA 4EIBA 2J8UA 2VSDA 3IETA 3RY6C 1PL3A 4G7VH 4PJ8B 3RY6A 3ZDXE 2VC2B 3IPFA 1RZFH 1LP9A 4XBEL 1RK7A 3G5VA 4YHZH 3IKCB 1JD9A 5JDSA 3SY0A 3VWJC 3MKKA 2MOQA 5LLIC 3GIZL 5EU3A 2D73A 1K5NB 1EDQA 3ARVA 4Y9BA 3RKDD 2SEBB 2DRUA 4RMUA 1CL7L 4W9HC 1R34A 5AOZA 4CU6A 4FAAB 3FTYA 1PEWA 3FUDA 3GMMB 4POZC 4CUCA 3GRWL 3AG4B 3E3QC 1VPOL 3VXQB 1IM9D 1DVYA 5EBMA 1EUTA 4KGLA 2HTKD 4IQHA 3REWA 3FUNA 5IJVA 3F7YB 4JKNA 4LSVH 5GISH 4HS3B 1RP8A 3U0PA 1FLTX 3BWSA 2Z6FA 1I1RA 5FYKH 3OKKB 3G5WA 5FO8B 1A7RL 1SBSL 2X9ZA 2WBJD 4JUTA 1FYTA 4X9FA 1Q90A 3DX8B 4JDZA 3UPCA 1A1NA 4OT1H 1MHPL 1T0NB 5D2LE 1GHFL 3WNNA 4Z7VB 2QSVA 1BZ7B 3SDAB 1MFBH 1WA1X 1R19A 5IB5B 5I6XC 1G7PA 3CVHB 2W65B 5KOMC 5AG8A 1P7KB 2P24B 3U0TB 4NZFA 1MIMH 2FIKB 2F6AA 5JDJA 1Z5YD 4AEHL 1B2WL 4JHVA 1HIML 4GSDL 1JYVA 3ZKQD 1TVBB 4TVPH 5EBLB 3FONB 2OSLA 4IU2A 3HVDA 5E8OB 2NW2A 5ADPL 5MEOA 3WFDL 1ORSB 5IQ7H 1AO7E 1IC0A 2B8OT 3A6BL 1EQWA 2XNAA 2NPLX 1SEQL 4V2BA 1F1GA 4Z7WA 4P46A 5C0AD 1IQDB 2H2SC 4K7FB 1N12A 1HXYA 3KMDA 2Y1YA 5HDBB 1HCZA 1EXUB 4PJEF 3QNYA 4JPVL 2ADJB 3HMXH 2CRIA 3W1ZA 2P80D 1OSZB 3OC5A 1LTXA 2L7QA 1Q9KB 3AAZA 4G7VL 4PLJC 3BP4B 1N18A 3GRBA 3HTLX 4O51B 3MRHB 3F7VA 4WEUD 1FE8H 3QA3A 4IBUA 1TLKA 3K6DA 3QEUB 5F6HJ 1K2DB 3CLFH 3ZTEA 5C0JB 4X7SL 4E9VA 1KV3A 2AI0L 3HLAA 5TPWH 4ZS6D 4E41D 1IGIH 2BERA 1H3GA 2CJUL 2OFQA 1N0XH 2CRMA 2EO1A 2ICES 4IW4C 4DWHA 4D9QE 5GZOA 1ZGLM 1FZMB 3STZB 3HIZA 5ECJE 5C0FA 3C6SA 1WS7A 3HW7A 4YK4C 4PWGA 2R2BB 3QFJB 4V33A 3D18B 1HAWA 3O8XC 1A3QA 4WKXA 2F74B 2JV6A 3O0LA 4F9PC 4JRWA 4H0GA 3LQAC 3ISRA 5EIVA 1WICA 2MRYA 2V7HA 4PJFF 4FNTA 3RWFA 3TA3B 3EBGA 3X17A 5KYXB 5BVJA 5FWRA 2HH0H 1VEPA 4M5ZH 1B0WA 4XNZB 4MSWA 1AD0A 1B4TA 2YPLE 1RUQL 5CJBA 2JH2A 2CNYA 4L0YA 3ZR5A 3ARGA 1ZD6A 1KEMH 4XODA 4WWNA 3QBTB 1UKTA 1MJ8L 4V1DE 1JVLA 2P5ED 2PTTA 4PJ8A 3D50A 2IBZX 3NSFA 4NSKB 3DO3A 3ARRA 2C9SA 5KSAA 1MCPH 1O9WA 1VAHA 2A0LD 5H37G 3WG7B 4XMTA 4S1RH 5FUOL 3LNIA 5K1VA 3CX5J 3V5DA 4UOJA 4JG0L 4GAFB 1MLBB 3WAJA 1CF8L 1JWSB 3D4ZA 1ID2A 1TPXC 4HEPA 2H9GB 4N2IA 5F1IB 2I60L 5ICUA 1Z2KA 1TCRA 2EDKA 5CGYC 2UZXB 3FSOA 1OOWA 4DCQB 4BXVA 2DKMA 5J6GB 2L04A 2DQHL 1USQA 1PX4A 1DQDL 1VADA 4KVPA 4LEXL 5EBMB 4W93A 5FK9B 1YC8A 2KDYA 1MVFA 1WYJA 2Q5BA 2WYZA 1T89C 1TU2B 3HG4A 3HNVH 3MV9E 4RAUB 4RZKA 5EZLB 5IJVB 3RZCD 3WO4C 4H1LG 5D6DC 4IK6A 3IAGC 3OKKA 2O5YH 5GHWL 2EE0A 3QNZB 4H13C 3U30C 1UFUA 3CGTA 1LILA 4GAJH 1ZTXH 1ETJA 3MRFA 2WXOA 1H19A 4GKLA 3AUWB 4BUHA 1SMOA 3T4AA 1IGMH 1J8SA 1QNIA 3CZLA 5K9QI 1X5XA 5C07E 4XZ4A 3TBTA 2Y6SC 1Q0EA 1NCDL 1P7KA 2WQAA 4RVBA 1KTDA 3CDGA 2WQ8A 2A9ML 4OBRA 1SLVA 4BFBD 2W95A 5JW3L 4BKLA 5B38B 4A7UA 1N2RB 3F12A 3V6OE 1G6VK 5D55A 3QAQA 4UIMB 4QHPA 4QJ4B 3CVHH 4OR1A 5LJYH 2IG2H 1U3ZA 2E46A 5LBSL 3OJVC 2UXFA 4K07A 4YH6A 5C2BH 5E5MB 4JFSA 3VACA 4IGBC 3WIIH 5DZNA 5FS5A 3I6GB 5I24A 4NENB 3T1WA 4WCYH 5IEKA 1NM4A 5L4JA 1XL6A 1YA5A 2AQQA 3O4LA 3OJDA 4RBPK 2HPOA 4KKPA 1XIWA 2B2XL 3LHPL 4HWZB 3FFCA 3HCVA 3FJTA 1Q9KA 1NFDE 2IGLA 5F1NB 1P0SE 2VXVH 4H8WC 5T3XL 3VQ2C 4WGVB 4H8UA 1NC2A 4KMTL 5F9JA 1OE3A 2ED9A 4BFKA 1ZXKA 1QFPA 4YEEA 1DN2A 3QO1B 4Z7UF 5I15H 1GYVA 2BJML 3HZVB 4ADGA 5SX5K 2BNRD 1HEJC 1M05A 2DJSA 4RMSA 4S2SA 3RZWA 1KUMA 2V3DA 3EBAA 4RX4D 4L0PB 1OAZL 3BLKA 3D18A 1VJSA 3OKMA 5C08A 4OV5A 1OAUL 2OQJB 2BCMA 1YEIL 4MYPA 4QRPD 1NICA 5IOKA 5JUEH 3UGXA 1HCYA 3EYVA 4PB0H 4EIGB 1YJDC 3GNML 1CICB 2EZ0C 3P9MB 4YAQB 3FCGA 1QLFA 4KKRA 2F8VA 2FEEI 2A9DA 4HCGA 1KV7A 3FQWA 4L8SB 1X9UA 1ZRUA 4ZAKA 1A6TA 4MX7B 3VCLA 2YC1A 3F64A 2N1TE 3VRJA 2Q10A 2YGOA 1T2JA 4UV4L 2BS71 1KIUB 1YJDL 3K8LA 3H42H 1A6UH 1FGVH 3L3OA 4I5BB 2WGNB 1ZMYA 3OZLA 5JW5B 2D3VA 5ENWB 3RVVD 2GABA 2JIXB 4GO8A 3FQNA 1P1VA 1JZ3A 1WBZA 1JZJA 1VEOA 5E2VH 3HUJE 2ZSWA 4RDQF 5IT2L 5EB9A 4PD4J 2WXNA 3HG3A 4FJZA 3CXHJ 1I82A 4P5MB 2XRAH 3T04D 3DX7B 4YX2L 4Z7WE 3PHQA 2DIBA 1WIPA 5DUPH 1DO5A 3I9PA 2W1NA 5FDWA 2VW6A 4IOSA 1IBFA 4XCCL 5L8KB 1DFBL 4E9LA 4TULH 4B97A 1H0DB 3MRBB 1P4LB 4KWUA 1MFDH 4YSAA 5JZ7D 3QQ9C 4U3SB 2MQCA 4EDXA 5JOPE 2UYLB 4ZW7A 2IALB 5FA4B 4QTHA 4N2NA 4OZIF 2QSQA 2XKSA 1TJXA 3Q48A 2DQDH 5JHLH 2WSKA 1QRKA 3ZE1E 4NQSA 4IDLA 1HEHC 4J8RB 1RULL 3N40F 3MRPA 4Q6KA 5HDQL 4NQCB 2BXZA 4GW1B 1G4RA 2ROXA 4WK2B 1NQBA 1ZLDA 1J5IA 3TX4A 1FYTE 2AQ1A 3K5SA 1DQML 2HXAA 3VSQA 3I6KB 4F9LC 1O6TA 3B2XA 3FAWA 3BP7B 1T1XB 2DWEB 3C9NA 1CWVA 3IU4H 3CDGB 1MG3C 1MRCL 4MD5B 2Y36L 1C08B 2NW3A 2OR9L 4R3SB 4C56A 1AZRA 1WQVT 4AKPA 1M3JA 2OJEB 3UTSD 2PO6B 3MYZA 1NIAA 3OR6A 4BUGA 3NCBB 4G8FB 1R3LA 3Q3GB 1IC7L 1N5AB 3JWNG 5K9QG 4U1SA 2OI9B 5SWQA 1J5HA 5DWUH 1L5GB 2K7PA 3R06B 2FO4A 4B41A 3EOBA 3LMJL 3NABL 2NY5L 4LCYA 4WI3A 1GGCH 2P48B 1BYNA 2DQMA 2XHNA 5EU4B 3FFCB 4FYRA 2Z8VC 3BW9A 2ZSVA 4AQ1C 4P23A 3HPJA 3MUJA 5KVFE 4KO7A 1YDPB 1V27A 1IC4H 4K7PL 2XWXA 1T7WA 3GK8L 4J12A 3MRDB 1PGRB 3OL2A 4LP8A 3VWKB 4TVUA 2CBPA 5DVNA 5I6MA 1AC0A 1I3GL 2VLRD 1UJ3C 3NZUA 4I0PA 4TN9A 5DJCA 3WCYA 5J12B 2VERA 2Q76B 3MV9A 4BRJA 2KQMA 1M05B 2MCPL 1N0LA 5GS1C 3GRGA 4WI7A 1OM9A 4Q58C 5E8DL 3WU1A 3GIVA 4U1JA 1G7LA 3BVNA 5DD5H 3MROB 4JY4A 3I75A 2GAZA 4EI6B 3OKMB 4PG9A 5GS2H 3L17A 1Z5HA 4XO8A 3CUPA 1NFIA 3US0A 2K70A 1ZLVK 2RQ8A 1Q1JL 1KB5L 1MCWM 3L4UA 3R7RA 3NIDB 1TYRA 1UXWB 2GITA 3IXAB 3WNLA 3G6AA 1GHFH 2RBLA 4GFTB 2XWBA 2CIIB 4OB5L 1BA9A 3ZZSA 1DFXA 4IYKA 2XYBA 4OT1L 5H35B 1ZT7A 4ZTEA 4N5EC 4HCRH 3NN8B 1HQRB 2B1OA 2VR7A 1CGSH 1LO0L 4N0UB 3VFUB 3AACA 3G7TA 4CC4C 4OCSH 1T66D 2ID5A 4K9EC 3C2AH 4DKTA 1KIUA 4PJ7E 2CE6A 1ZSDB 1YMMD 3M46A 3RWHA 2Z3FA 5D6CA 1JRHI 2NTFA 5AD0A 1LE9B 4OD3H 1G87A 1UT1A 4AJYV 4WWKC 4K3JL 2A6IB 1EK3A 4R26L 2EIEA 1PG7H 4N8VB 2X4UA 1X9QA 3HG5A 1CFSA 1YVLA 4G7SB 2XXFA 2EXWD 4HXBH 5ITFB 2QQQA 2AEQH 4XN8A 1E4XI 3X1NA 5TF0A 5I18H 4UU9B 2RALA 4WKZA 3IJ8A 3EJSA 5AB2A 4AJ0A 3TTSA 5CLWA 1T4KA 5GGQH 4YHIB 5I8CB 3RY5A 1NCHA 3CPLB 5FDWB 2PR9A 5CIPB 4G70B 3VWKC 4PR5A 3SD5A 4FG6C 2VABA 3QIUD 2OMWB 4GO9A 4JDTL 4FXGB 3L1OH 1WAAE 4WUUA 1RZJL 3MRBA 3UOAB 1NDMA 3SO5A 4QTHB 1A14H 5F6HI 1EEYA 5I1IH 3CDZA 5FECA 4ODTH 4D8PB 4OW6A 4IBZA 2AW2A 2OSLB 5E8OA 5A16A 3IBOA 3MR9A 1U2CA 1FZJA 2B20A 4HD5A 4ICWA 4YSQA 1DZBA 1WFTA 3TASA 3K0YA 1T89A 3JWDH 4F1ZA 1JNJA 1G9ML 1IT9L 1PQZB 3X11A 1B6DA 4UQBA 4X98A 4A7TA 4X6DB 4CMHC 4CVXA 5BNXD 5EOQH 2WZPD 2A1WH 1S7TB 1CGXA 4LCCA 3G5ZA 4LCCC 1VIWA 2FWOA 1T0OA 2ZCHL 4R3SA 1RZGA 1DDHB 5T1JA 5EUKB 1N59A 5AAWA 1BF2A 1D6VH 2UXVA 5M7QA 1QP1A 4JLRB 1MJ7H 4I85A 3JTTB 3M17B 4U1SB 4BFGA 3SE4A 5K33A 1C7SA 4GSUA 2VLKE 1UA6H 2HKHL 4HG4K 2YXFA 2HTLC 1I9RH 1G9EA 3VQMA 2X12A 1BZ9A 2FX8L 1A6ZA 3RIFF 1L0QA 4S1QL 3N1PC 5F3HB 1MFEL 3B6SA 3GDBA 3HUJF 3DHPA 1DSWA 1F4WH 1YMHB 2GCYB 3G5YB 5IFAL 3LAFA 3C5ZB 5DZVA 1CZ8L 2LLNA 2G75B 3CSFA 4XPGL 3U48A 1NBVH 4LQFL 5JW4R 5K9OA 3KYOA 4HCRA 1QQDA 2Y2TA 8CGTA 1JXJA 3PL6C 1HKLL 4BKSC 2VLLB 3QI9A 3MJ9L 4H7VA 3UTQB 5G4MA 4M3HA 1YPZF 1GOGA 2ICWI 3TIEA 1UCBH 2GAZB 2AV7A 4JJ5A 1JZFA 1F2XK 2CR6A 4PJBA 5SWZB 2IXQA 3S36X 4YSCA 5KYWB 3C60B 3EJRA 2APTA 5D1QC 1MI5A 2L7UA 4XAKE 4AE0A 3B9DA 5DUML 4AOFA 2VM4A 1W8EA 2IPUG 4M56A 2IWEA 4ACTA 4FS0A 4RIRA 4ACPA 4TNFA 5ANHA 3C12A 4ZYKB 3CFBB 4PJDF 3FO9B 5AW9B 4B9CA 5JXAL 5KSBB 5CJQL 4FEIA 2CBQA 1TMCB 2NXZC 3R8BB 2IQ9H 3X1GA 3IDUA 4JG1H 3LQAH 3FUEA 2VDRH 4M6NL 4QOKD 3OHMB 5EUOF 3CV5A 4HS8L 4XE5B 2K45A 5HJDA 3QJUB 4IEFA 4O9HH 3DTUB 5KOVC 1AGEA 2ENSA 4NO0B 2NZ1A 5AW5B 4QXUH 3KVQA 3VFSB 2XTJE 1MDTA 2ZNWA 4X6FA 2VN4A 1MW1A 1OP3H 2CU9A 3FSZA 1MJJB 5CO1A 1DJYA 3EGDA 1IAIM 1TU2A 3FU9A 1JZDC 3LKOA 1CFSB 1LLAA 2PR4L 3S96A 5A6MA 2AJUL 2UUDK 1NUDA 3OPZH 1OPGL 3AMLA 2C34A 1I3RB 3DUHA 3I6LE 4BM7A 4E36A 1JXFA 3WS6C 3QJZA 1G7PB 1BGXL 2BZDA 2F1EA 1EO5A 2C3VB 2W65A 3CVCA 2X4PA 3NFNA 4OD2B 4U31A 4YOKA 2Q8BH 1I9RL 4MVBC 2R0ZL 3J2PA 1F4XH 1RCYA 2NSQA 4PS4L 1M56B 2DOCA 1JTOA 4WJG3 5EOCL 4KXZH 4NKQB 3WFZA 4D3CL 3RP1A 2NW2B 4O02A 4KTDH 1K8DA 1GYUA 2B4CC 1G9NL 1E5BA 3TBTB 2NTSP 3APNA 1ROCA 2HFFA 3X1EA 1R1CA 3O3EB 4XNQB 5C9JB 4Y2DB 3TO4B 4GQZA 4OF8A 4P5RA 1CFTA 1IKFH 1U3NA 4D9LL 1BDYA 1SY6H 2B4CH 2HLEB 3PHOA 1PZAA 1OHQA 3TFBA 4LHUB 4JRYD 3OMZA 4N9GA 3QIBA 4MA1B 1OSZA 1K5WA 1DQLH 1F41A 2A83A 1MAKA 4PJHE 4WVRA 2VC2H 2W60B 2D03H 3INUL 1DYZA 3CMOL 3BPOB 3V6OC 5J1TC 3RLSA 3QWOB 1ZLWK 5CIPH 3S34L 1Q1PA 3U4BH 3GSNL 1IBBA 3HMWH 4MKMA 2F19L 3U9PL 1K2DA 4HJJH 1LWJA 4PJBF 2XLLA 5E1AA 1OM3H 2FBOJ 1AO7B 1FNFA 1M7IB 4GINA 5KVGL 1N59B 5EC1A 5HYJE 1TZIB 5D7LE 4P5KA 4HMEA 2EDOA 5DT1L 1Z9OA 3SE3A 1T1YA 3KYMB 1PY4A 1YC7A 3B7UX 4U6YA 5E08L 4UINH 2LU5A 1VFAB 2MKWA 3P4OB 4BHUI 4IKKA 1OK0A 4PTUB 1WG3A 2ZOUA 1AACA 2CO1A 2O6PA 2XWDA 3KBPA 3F85A 3U0WL 3FT0A 3IXTA 4AVJA 2XVLA 4OLYH 1A65A 2DW5A 4PWKA 5L0QC 4MQ7B 3ASOB 1AR1C 4UYPA 1FL3A 3WE1A 2MCG1 3BYYA 1M9WA 1YMHA 3QEGL 3B2VH 3MUGB 1V7NH 5TF1H 5I1HH 2XY1A 5IFJA 1ZVSB 4WIQA 1HZHH 1IE4A 1QBBA 4JN2A 4MMZB 5EZOH 3DSFH 3H55A 5BQ7B 4QOKE 5CCHE 4L8BB 4FA6A 3V5DB 1PZ5B 5MP6L 3GRWA 1S4IA 4DZBB 4BH8B 1W72B 4R96B 2PPAA 5DMYA 5DJYB 3ARBC 4TV3A 3CE1A 1ND0A 1GC1L 1RSFA 2CDFA 1HTYA 4ZUVA 3U1SL 1KGYE 2X1PA 3FQTB 2UZXA 1G9HA 1WV7T 1RK0A 4LSRL 4QOKA 5F89A 5FYKL 3UJTH 4Z7NF 1JYXA 2NNRA 3DVIA 2ZOWA 5BOPA 2FB4L 3Q01A 3BAEL 3II2A 2QVFB 4ORZC 5C0CB 2OSYA 3JV6B 1KB5H 1WFOA 1YUHB 4QO1B 3CZGA 4K8RD 4FERA 5EZLA 3NTCL 4NLHA 3I3EA 3S3BB 3QRGH 2EIZB 2X7LB 4HIJB 3QJQB 4IKLA 5FUZH 4U6XA 3HC2A 1A1OB 3ZDYB 5GS1A 3F2LA 3M86A 3N50A 2GFBB 2AJVL 4KC3B 3DPDA 5FLUA 1J05A 3X2QB 1FFRA 3HC3L 1XF4B 1KCKA 4WFGD 4XTRC 4NZTL 3V4UL 1WP6A 1JD7A 5E56A 4ZW8A 4LLAA 4YHZL 4GRMB 3ZYJA 4N6RA 3ZUCA 2FLBT 1GAFH 3BGAA 3Q44A 4ZTOH 4KFMA 4Q0XL 2F54E 3OKDA 3AXLA 1HU8A 3WDHA 2BMKA 5G55A 3IJ7A 3B9KD 4G43B 3CIAA 4LLYA 3OSVA 2AQRA 1RZ7L 4L29B 5EG6C 4NQCD 1SLXA 5GGRY 5G5DA 1IL1B 2JKRM 2WLIB 3S34H 1YNTB 3RURA 1HZHL 1OQOA 3IGAA 1KTKE 3VFPA 4WFHE 2D03L 3FCUB 3INUH 4NC0B 4NN5B 4OUUB 4TNGA 3OWRA 1F6LL 1OPOA 4UOZA 4JE4B 2DWXA 1PSKH 3KPLA 4MNHA 3HN8A 5DHXB 5JW4N 1MFUA 3TNNB 1QLEB 2C1PB 2BSTA 2VXUL 4NENA 1AQHA 2OR9H 1MQ8A 3PHOB 4DTGL 5A40E 2JKXA 3EH5B 5L88H 3HB3C 3NZHH 4MMXA 1OCOB 3IU4L 4M5YL 3V0VB 3ARQA 5C7XL 5LAPA 4G8FA 4UANA 3VXTA 2K4AA 5B22A 1N5AA 3UBXI 1CFNB 3JWNH 1JXGA 1KOAA 2ZKMX 3OXSB 5IBUG 1MAJA 1MPAH 4P2AA 2GTWB 1DANU 1TVHB 1TOXA 3CHOA 3NJHA 4GS7B 2BY3A 4LESA 3UG4A 2R8SL 1T2QH 2A74B 1G9NC 1U41A 2LTQB 2GI7A 4UTBL 4RCAA 4LP5A 1SJEB 4KAQL 1BGXH 1BZEA 4X83A 2X40A 3T2NH 3ISWA 3H0TB 2NY5H 4PV9A 3WKMH 3CG8A 5L2KB 1QBAA 3P3TA 4FQJH 3KYMA 1SJHA 4H88L 5ACZA 1OGAA 3TV8A 1IKOP 4IRSB 5F7WC 3VWKA 4CW1B 1AS7A 3LXBA 3V4PA 3MJ6A 3M8OL 4I0PB 5DJCB 3MBEB 1CE1H 5E4IA 3WJLC 4OY9A 2X09A 3VU1A 3SDCC 1JV5B 3P9MA 1T6VN 3GIVB 3QUXD 1G7LB 3BVNB 4OUOA 4U1JB 4YAQA 5KAQF 2JCCB 2MH4A 1V7MH 1WC7B 3FQWB 2F1AA 4L8SA 1F58L 4KO9A 1A6TB 2BIPA 4R0LC 3UG3A 4E9WA 4F37F 2GTZA 4Y1SA 1TKWB 4PUBH 4HT1L 2J1WA 4Q9QL 2BO0A 3N40P 3KS0H 1AI1L 2WTRA 5D2LF 1YMME 4HZLB 1DQMH 5JW5A 4M7JL 5ENWA 4PS7A 3AM8A 4EQ2A 4ZQTA 1I1AC 4P07A 2NXZD 3S37L 3TBWB 2EUZA 4KV5E 3N1GC 2I25N 3ZYOA 5CLTA 4KXDA 3U1QA 4ECNA 1YEHL 3HLKA 3FQTA 5F89B 5BV7C 1KENH 2IAMC 3VWKD 3WI9A 3NZ8A 4U1IB 3SB3A 1FBIL 2JI2A 4X6BB 3MRMA 4AM0A 4TXVB 4HVBA 4NJ9H 1UM5L 3AWFA 3CFMA 3K2UL 4WEEA 3Q8AA 4HX1B 1MW2A 2APSA 4X7TB 5B3JE 1J5CA 3L7FB 4NNYA 4MA7L 4P4RB 4ZO6A 3QFJE 4U3SA 1CBVL 5AZ2H 3QZLA 3V7MA 4DP1X 2F15A 4RWYL 1UD5A 4JG1L 5LQBH 2FJUB 1BXVA 4YHIA 35C8L 5CJQH 3ZYZA 1CDIA 3P30H 4ODWA 3OAUL 1U95B 1NEZB 2X89A 4MQTB 1I7UA 3QUYB 4XVJH 5LKNA 1FDLL 3IJHB 3PIQA 3T09A 1Y18A 1L0PA 3LRGA 2MKLC 5DVLA 5C0CE 4G6AD 1NLDL 2X2IA 3PDGA 4U2ZA 1F6AB 3OZKA 3TZVA 4GRMA 3KL3A 2NY4C 3CDZB 5I8KH 2J1ZA 2FT8A 3OKDB 3RIFK 1JZEA 4RRPG 1GOFA 1ICTA 1MCFA 3S35X 2NW3B 3QXAB 4QRRA 1CFMA 3O3BA 4ZPVB 4IIZA 3L3JA 4JHUA 2QQKH 3V52L 3RU8H 4HJIA 1L3NA 2I69A 2FDBP 2VN6A 3FCBA 5DLML 1CLYL 3WENA 3NIFB 3TNNA 5KAQG 1E5YA 2ZICA 2WAHA 3VSTA 4DW2H 4MNGA 5EORL 1RZGB 3QAZC 1LEKB 3P2DA 4P49A 4KKLC 3HRZC 4Y5YC 2VLJB 3HEIB 1U91B 2ZD0A 3HR5B 3MUZ1 2J8UF 4XNBA 3NACH 2VQTA 2BHFA 4P46C 4Z7VE 4UTBA 4F8LA 2CIKB 4KRNA 3D3VE 2GIMA 4X8JA 5EMYA 2NY3B 4OZFG 3ILQC 4N8CL 3QIWB 1X9RA 2CG9X 3C87A 3OXSA 4I3GA 5GS0D 3S88H 4LKXA 2MFNA 4YHLL 3H56A 2PN5A 4XOEA 1H15A 4YDKL 5JXED 4HJEA 1UJ3B 5J12C 2HFGH 4C4BA 3IJYB 3VDCA 1PLGL 3GHBH 4FFYA 4XXCA 5E4OA 2N4IA 1XDTT 4QF1B 2HN7A 4EDWH 3B6SB 4RMTA 4OF3A 1WA0X 5EF0A 4AQAA 4PV9B 1AG0A 3AQYA 4PREA 5L2KA 2DQUL 3C5ZA 1MQKL 4EZMA 3QULB 3V0EA 3L5HA 3KH4A 1JF1A 2HSIA 4CW1A 3KBHE 2E4FA 1KCSH 3MLXH 3S48A 1NANH 3B1UA 4PP2B 2VLRA 2OBGA 1PAMA 1MHCB 3QH3B 4ZFGL 3SQBB 4GKNA 2K9FB 4NWUL 4WW2B 4QKTA 2P5WD 1RMFH 1MRDL 2F5AH 5H2BA 1R17A 2FRGP 3K74B 2OV0A 5HYQB 1S78C 4FFVD 4N0UA 2DQIH 4X0KA 2DWYA 4JO2L 4WFFE 2CJSA 2GQHA 1GOHA 1QTSA 4G8EA 1HQ4A 4ADJA 4PRID 1CUOA 2B1HL 3HN3A 4Y1AE 2PYEA 3BD4A 1LD9B 3C6EA 3PQYA 4Z0XA 1I85C 5TE4H 2IAMD 2CNZA 5DGRA 4UNVA 1FZKB 2YA0A 3A6OA 2CO7B 4GSXA 1KPVB 1FP5A 2FSEA 3IWVA 4EXKA 3W37A 3DC0A 5JHDD 5E03A 4IEFB 3DPBA 15C8H 1U93A 3CCHB 2O6CA 4L48A 2ZONA 3NZ8B 2ZOKA 2WJ7A 3H9SE 2NY7L 2YRZA 1T83C 1NOFA 4EI5D 3SYCA 1D5XA 2DM3A 1EZLA 3QHZL 5J11B 4A2EA 3NCJL 4AENB 3GEWB 2OMWA 1TG8A 3K6OA 4X7TA 2OL3H 1DDTA 3L7FA 2PNDA 3ROOB 2OYKA 2Y7MA 1I3RA 2XTJB 1UYWH 3FK3A 3QWRA 1BWMA 1XBRA 3PDOA 4QHLB 5SV4A 1P69B 1KYFA 4QXWA 4P2RB 4QAWA 3EHBC 1IBYA 1UWGL 2XG5A 2DJMA 2N56A 1TUPA 4HUNB 3WTTA 3P2BA 2ZUWA 3QORB 3WLWD 1A6AB 4Y4HD 3V5HB 3CZJA 1I7UB 3QUYA 1IGJB 3DHMA 4A55A 2A5UA 2IAMA 1WD9A 2YUWA 3E6HB 4WUUD 3RJQB 5DZ9A 2WNKA 3AB0B 1XGTB 3BWZA 2BP3A 4BINA 5I0WA 3VQ1C 3MBEC 4Y19A 3BPOC 3C08L 5C09D 4X0NA 3TO4D 2DLFL 1M71B 3VXRD 2A99A 2HG5A 4TSAH 1ZT4B 4NZUH 1MAMH 1XF2B 2Y0SA 3G5ZB 3OAZH 3GBML 3UGEA 7FABH 2EVIA 4S0TD 4JRYB 5EU5B 4X6EB 1KBPA 4NP4H 3ULVL 3GSQA 4X4XB 3A24A 2MNWA 2DQGH 1DSFH 2R7EA 1P1ZA 5C0EB 7FABL 3F6JA 2XXGA 4H26A 3FT9A 4JDVB 2QPUA 5DHYB 3VXRB 3CWGA 5HGBA 3KD4A 4G8IA 3PF2A 1HCVA 4NRZB 4PJFE 5EC1B 1FVEA 4L9LB 2DDQH 3ELAT 4AMKL 3AB0C 1T1YB 2E6JA 3S4SG 1XGYH 3OTTA 3UL4A 1E9PA 2FJGA 2AF2A 4GAGL 4LGPB 4I4WB 3J07A 3DX9A 5G4NA 2OK0H 3ESMA 4HFWB 3DBXB 1JDAA 1RZ7H 4LSSH 2C1OB 4ANVA 4MJ5A 1OTSD 1BD2E 1SMDA 4CSTA 3OJ2C 2IDUA 1ORQA 4MQ7A 2X4QA 1DJSA 4TTDC 1OP5H 3QQ9D 3VXSD 4PB9H 2D3LA 5JHMA 4G59C 5KZCD 2EO9A 4KZEL 2AQSA 4L3EE 1BW8A 4QGYA 1MW3A 1R47A 1P5UB 4H5SB 3GLAA 3HC3H 3L4WA 2QLYA 3W3BA 2HVJB 2ATPB 1J9QA 1NGWB 3JV4B 1LDPH 3F7LA 5IVZA 2MJWA 1HWHB 3HJEA 3S2AA 2EKSA 3EJYD 3UBFA 4GNKB 2BY0A 4R0LB 4RESB 3KPPA 3MRJB 1WISA 1TTGA 3DX0A 4L4VB 3GSUA 4RMQA 4RWHA 4MB3A 5JIMA 2I9TB 5C07A 2EXSA 2H2PC 3CFBA 4LDOB 1KC5H 1KTBA 1OSYA 3CFJA 4YBLC 4ZUTB 4E9YA 3GDCA 1UZ8B 1A4JB 5EC2A 3SDYH 5EWIL 4UZUA 2HB0A 3COOA 2H41A 1H3PH 4PJEA 4XCNB 1AKJD 2ZX5A 2QGEA 3DXAA 2GBAA 1A21A 3IMSA 2EDFA 4P2YA 2H45A 2C3WA 5D93B 3SOBL 1HDMA 1UT2A 3OKLB 3KCWA 2D31B 3PABB 1CICD 4FNLH 4NZ8A 2IANA 4DEUA 1B4JL 2IWKA 1QO3B 5DS1A 3AQXA 4MRCA 3T2PA 2Q8AL 2RACA 1O9VA 3LKOB 1IUZA 3S96B 3QWRD 2F5AL 2NYYD 4LIQE 1BV8A 4AZ8B 4TKWA 1X5YA 3P0VH 3KM1A 1NMCB 3CBRA 4YSTA 5KBMA 2PCPA 1CLOL 3G6DL 2X1OA 3NFSL 1SVCP 2IJ0C 2JIXD 3FU7A 2W94A 1QFWH 1TQCB 4HU8A 1XF4A 4ZDHA 2P9RA 2QZ5A 1S7XA 4RGND 4EDWL 2WLNA 2YFOA 2HJKA 3WIFB 3MUY1 4TUKL 2ZUTA 1PLGH 2WAQA 1E5AA 2WZ6A 2WGXA 5HYEA 5IMMA 2YD5A 4ZJ9A 4Y2DA 4AQ8A 1HXMB 2WUBH 2BVYA 3D85D 2ARJB 3NSXA 4ONHB 1QTPA 2R4SH 2LQRA 1I7RA 3H8NA 1J87A 4H8WL 3LH2L 3EOTH 5E2WH 4PJ7F 4AKQA 4HISA 4IIQB 1GGIH 3CFNA 3LB6D 1CQKA 3CLEL 1H6EA 4Y5VC 5EO9B 2CZNA 3GIZH 4NFCA 3BVXA 2FWSA 4KUZH 4N2CA 5GS0C 3WLBA 1UOWA 5KVFL 5D1QE 4Q2ZA 4S0SD 3KG5A 3L2NA 4JFYA 1Y0LA 2EKJA 4HBQA 3AVEA 1NGYA 2B15A 2CJTA 4W4OA 2J6EH 1BQ5A 4UT7H 1WE5A 4AUJA 1WEJL 4OI9A 4BD4A 2EDNA 2WCPA 4DO5A 1MCKA 1T04B 4K3DL 5D7LD 4JRYA 4LNVA 5EU5A 3EDFA 3NJJA 4CL7A 3OVUB 1A3LL 1TZIA 5E6RB 1NIEA 1KCUL 3FOMA 2BSCA 4PJIB 4LAQH 4ZW6A 4TSCH 3QIUC 4PTUA 5HDLA 1WK0A 4GKZB 4OFQA 1Z7JA 1SJEA 4HUXA 4MJ4A 5DDHA 1GGUA 4EBQL 4YXHL 2FBRA 2ZKHH 3QXTA 4JFPB 3WIIL 5KVEH 5SV3A 1E4KC 1F4AA 2WWMD 4H8QA 3LV3A 2VKWA 3O3AB 1VLXA 2J72A 4RGMB 2FJSA 4TTGA 4IM8A 2YBRB 4XPTH 1S7UB 5LQBL 1FFPA 4IBWA 1FG9C 2WMPB 2BDNL 3UTZB 5D7LA 1RZKL 1NJ9A 5MENE 3TCXA 1T0PB 2MEJB 4X7FC 1WUNT 4B9KC 2GTZB 4PW4A 3UPRA 2JKTM 2ZWSA 4FTVB 1ROWA 4BQ8A 3VTMA 3GKWL 2WTRB 1L9MA 4QT5B 3CFQA 3EFOB 5E6ZA 4HHAB 2EKSB 1QSEA 4MQXC 3O6LH 2Z31B 3G9VA 2BS9A 3MV7E 1R0AH 3MRJA 4L4VA 5IWLA 2WQSA 3GSUB 1YEHH 2H26A 4LBEA 2VDRL 4M6NH 4P5TA 4CKQA 3CDYA 5J1AB 4QO1A 1YEDB 1KTRL 2ZUXA 2WW8A 1NGPL 1VSCA 1U8NA 2QBWA 2DTSA 5KYNA 3Q0HA 4HJ0C 2GC7C 4X6BA 5HGHB 4JZOB 1X5AA 1CG9A 3T2LA 3DK0A 5ALCL 3H7BA 5A7BA 4XVOA 5GS1B 3VW3L 2RR3A 3R7QA 3MRGB 1KXQE 3W11C 1QBLH 3NIGE 4WTXA 2RAMA 1FFNB 1NL0H 3KLAA 4GUPB 3QS3A 4MA8L 1QO3A 3UIYA 5M94B 4E0RA 4PJGF 3LKQB 3WXVL 1WRFA 2EACA 2FGZA 5F7MC 4WEMB 4X99B 4ZO8A 4YHKL 3O41A 1PD0A 5HJBA 1GGTA 2K0RA 3GM0A 1OSEA 4GRWF 2FYYA 4XPAH 2HLAB 3IJ9A 3PV6B 3OLEA 1UH4A 3VM5A 3IMWA 3WN5B 2R69A 4ZMXA 1MELA 4FADA 3L3DB 3O2DA 4WI9A 5G5DB 1IL1A 2PYFA 4QRSB 2VXSH 1A7BA 2F8OA 4Y4KC 2VWEC 2FSDA 2K8MA 3VFPB 4XBPB 3GXFA 4YFEA 3LKPB 3W56A 2HMID 3HHSA 1OTTD 2MQ3A 2OKMA 3RBSA 1DJZA 3QQNA 2BSTB 4UOW0 2ICEC 5I5MA 3WFBL 1DBKL 1NFKA 1BQHB 4QEGA 4UDTA 5CZXD 5EUOE 4U6VH 1MIEH 4YHNB 1NFDB 5IVNA 3KXFB 2BNUA 2BSRB 4OSUH 4E42B 1LE5B 1SEQH 4EN3C 1SDDB 1PJ9A 1Y0LB 1QHQA 1T7VA 2L7JA 4RAVB 4BEIA 5HYIA 1YMMB 4WSKA 1TTAA 3S7GA 3WEBA 5DJAB 5E2UL 1AMXA 1WZ1L 2VLJA 3PL6A 1RHFA 4LOEA 2CGRH 4P2OB 4PLJD 1FO0L 5I73C 1YQ2A 2PP7A 3IVKB 3Q9QA 3HFFA 1C5CH 1FRGH 1XSIA 4YPGA 4EI0A 1T83A 1UH3A 4MD0B 1G9MH 3FBQA 1MCIA 3OR7A 4HDIA 4RRPA 5C0AA 3QDGB 5ACZB 1H8NA 2F5BH 2OTWB 1BP3B 4OU3A 2BFVL 3SE3C 3T77B 2ICEB 2HWZL 2R59A 4G5ZH 4HOXA 3AS1A 1XH0A 1IBDA 3ZRCC 4ZOCA 2DWDB 4H1LA 1JK8A 2WWNA 4R97C 3WHXB 2VRKA 3WO3B 3MRNA 3HMXL 4PJ5A 4Y1TA 3VM7A 1PF3A 4YMPA 5EBWB 2EABA 2E47A 5KVDH 3P4MB 1BXAA 2QPFA 2A38A 1S7VA 2HLFD 3HRPA 3OX8A 1FORL 3N0PB 4PP2A 2PWHA 3Q8EA 1QFHA 5LXGL 1UWYA 4PRDA 3LS5L 1CXHA 2CGZA 1JWUA 1RI8A 5D7KE 5DD0L 1KULA 3K72B 2ROYA 5EF1A 3BZEB 1D5RA 3UTZA 1DTUA 5FAAA 4I3RH 1AOHA 4F33A 1I9JH 3BQVA 2FQFA 3SO3C 3ESPA 1TQWA 4PY7A 3R4RA 1PG7L 3TPUA 1JF5A 1MFBL 3EGXA 1CDHA 4AYFB 2F7PA 4OM0L 3FQXA 4BQ9A 1L4IA 3TJEH 1IBGL 1S3KH 3TWCH 1URZA 2N0MA 3D69B 1WWBX 1FL6B 2O1AA 4HKXA 4CADB 3ESVF 3REVB 4HXAH 3T2OA 1EIBA 4HX1A 5C1MB 5J11C 2A2QT 2FSEB 4XNYL 5EO1B 3V0AC 1FC1A 1GW6A 1SBSH 2QKSA 1JZ8A 1XV8A 4P3DA 5DRZA 4K7PY 2Q7YA 4XNXL 2BH0A 3VTAA 3MLTB 1F3JB 3KPTA 3M7OA 3AU1A 3NJNA 3RWEB 1ID5I 3C8KA 4X8XA 3H7BB 2ENJA 5IBUB 4ODWB 5DZJA 1NEZA 1TEFA 1U0QA 2GBTA 2FH8A 3IU3A 2A4ZA 4M6MH 4W1TA 4AGQA 3HRZA 5E2TH 3PIQB 5L8LB 1CXIA 2X4TA 4HH9B 4A6YA 3RRQA 4WI0B 2YBGA 3D9AH 3WL9A 4AUYA 2VH5L 2PXYD 5KJ4A 5LGJA 4WY7H 1E6JH 4DIXA 5ETUB 5HGAB 4ANKA 3MO1A 1B0IA 5DUBA 1YAIA 5CJXC 5FOBA 3ULSB 3PV6A 1LEIB 5T1KA 2X89D 4B6ZA 1CQYA 4DPRA 3ZDXF 4M7LL 5F7KC 2HTLD 2FUTA 2Z8RA 4DO4A 4NRXA 4B9ZA 1BOYA 4FI7A 2Q6WA 1H3XA 3V9CA 4NZUL 1J5DA 3G04B 4PYGA 1KGCE 1HN1A 3GLZA 1JV2A 1XH1A 3FO0H 4HPYL 3CC5A 4LEBA 2DN7A 2CCVA 5DFVC 2H6PA 1YCSA 3PXJA 3ZQ9A 3QDJA 4ANXA 3CC1A 2BRRH 3A4FA 3BKML 3QI9D 4PSRA 2MPVA 4V2CB 1UA3A 3KXFA 3O4LE 3BVWA 4M00A 3WJMA 2BY2A 3QUZD 3US1A 1BZDA 1BOGA 1KDJA 3WFCH 2Z4QA 5ESAA 1P1ZB 4K0OA 1A25A 4NI6A 3WNIA 5AALA 3HR6A 4JDVA 5DHYA 2CDGA 3DDGA 3UZQA 1KCRL 1NBZB 3A21A 5DJAA 2JCCF 3QORD 4NRYA 5D96C 4NRZA 2WLLB 2HRPL 5HHVH 3AUVA 5AUMA 4LPVA 3O3UN 2H6OA 4KRPC 4QYAA 1KLGA 5FW8A 2BHZA 1G9NH 1E9PB 2FJGB 3J8F7 5ALCH 1TSRA 4KRMB 3KWWB 4NC1E 1HESA 1DVFD 3CXFA 2CALA 4HWEH 3MJ8A 2VSCA 3DX9B 5K59F 4XOBA 1NLBL 4EZLA 3BFQG 2DYPD 2OMUA 1JF1B 4QXTB 3HA0A 4HIHA 2FHBA 2ITCA 2YK1H 4X5WA 1UEMA 3QCVL 1NDGA 2F7OA 1ILSA 5JXEA 1SDAB 1U8QB 1W6WA 2BVOA 3A5VA 5BJTA 4JPSA 43CAB 1J1PH 4PJ5B 5DMIL 1JFHA 1IFHH 1SOXA 4JVWA 2V6HA 1PIGA 2L7EA 5AKSA 5HYQA 3BUQA 4HIIB 1I7TB 1DLFH 1OF0A 3RDTD 5JR1H 4XCCH 3MRLB 4H8HA 1T20A 2HKFH 3WKQA 4DPBX 3JWOH 4R0LA 8PAZA 5TE6H 1NMAH 3WGUB 1LD9A 3PQYB 3WEOA 2E76C 3HC0B 2YD1A 1J8HD 4YX2H 2MOGA 2ED6A 4YE4L 4ELDA 5FCUH 2O61B 4I3SH 5E2VL 4GLRI 4RSYA 3EDJA 3DXAB 5AVUB 3VXMB 3F58H 3LZFH 4B9JA 1BD2A 2YSSB 1HDMB 3E8UH 2A0LC 3S5ZA 5TDPB 3FN0L 1JMXA 4YUEL 4PVBA 3PQYD 4XP5H 1HYSC 1GZPB 3SD2A 4LLUB 2EDHA 4E5XG 3WNOA 1I8UA 1QR4A 4HHWA 3LPWA 5ALBH 3INOA 5HHPB 3PYCA 4Z7QE 4OQTL 2VDOH 4IHOB 1UHVA 5FM5O 1KN4H 3WTUA 1QX1A 3GJEA 3PDOB 4AVKA 2H47C 4YHLH 3O8XB 2V9UA 3AU1B 3C5SA 1UXLA 3LNDA 4KNUA 2QMKA 3FU7B 2VXQA 4XPHL 1AXIB 5IMOB 2C7UA 1ZTXE 2QMJA 2DBLH 3C5ZC 4JMNA 2ZYIA 2VR8A 1J8HA 4XPBL 2V17H 4M1GL 4XVTH 4Y5VB 3HE7D 4CN4A 5J0BA 1KBKA 2B1AH 1KN2L 5JOFB 1LNUA 5FF6A 3NIGF 1XSKA 3HAEH 4L37A 4ZQKA 5DLMH 4H2AA 2ZJSH 6TAAA 3ZDZE 2AEIT 2NZIA 2B9BA 2HG5B 4PMEA 1OGTB 4RNRB 1F6FB 4UTCA 4XB7A 1IU1A 1H5BC 3EH3B 3I50L 2W8CA 4HU2A 3ECBA 3L3OC 1SRDA 1SHWA 3GSVA 2R0LL 4IOFC 4M5SA 1NOLA 1XIWD 4BYHA 3K6FA 3RDJA 3GXUB 1PTZA 1A7NL 3D0VA 1DLHB 4Y0GA 3NOIA 4RGNE 2DM7A 5TGBA 2FX7H 3MPCA 4QIRA 1AY1L 2H1PH 1P5VA 4Z7NB 2YD9A 3SPJA 3TEZA 3ZTNL 1HZLA 1S8DB 4A6YH 4MDRA 3LEVH 5F7LB 3A67H 4ZFZA 5C0EA 2B2XH 3G5VB 5J5EA 1FGNL 1HHIB 3SY0B 1NLDH 3ZGIA 4I9WD 2AXGA 5DD3L 4QNPE 2E9GA 3HI6H 5D7IB 4K3EL 3TN0B 2YPKB 2GJZA 4FYQA 5JW4M 5LN4A 1YN6A 5I16A 3O3DA 4KHXL 5HPMB 3DUUA 4XMPH 4J2XA 3N2JA 4PGBB 4IRZH 4KZDH 3V6FB 2QR0A 4G9FB 5LVEA 2VXTL 1JN6B 1DL7L 4I1PA 4AQOA 1SOQA 4F7TA 5MEQB 1B4JH 4AGPA 1FA4A 4PRBB 4ZPTB 3JYBA 1W0VB 2KLRA 4JX0A 1D5IH 3IDXH 3WKPA 3F7YA 4APQC 5JHBA 4XP6H 3OB0H 4XH2A 2Y7OA 5L9DH 3MJ8B 2ATAA 1I8LC 3EIFA 3NJFA 4R84A 1J1PL 5H94B 4FMFA 1RJZB 5HBBA 4BWWA 1JVOA 3MLVL 1JNNH 2GY5A 3B4NA 3KDMB 4BFNA 1Y07A 2R23B 1LMIA 4TL4A 1A9BB 1BFSA 2YLHA 3UO8B 4BFIB 4ZMYA 5GS0H 4LLQA 4M29A 3M45A 1ZHLB 2B0SH 4MJHA 1T7ZA 3PWNA 5LGHL 1DBML 1XZ0B 2CD0A 4NYLB 4NGHL 4KU1A 5EBGA 1X5FA 1LO5B 1AQ8A 2VUKA 2NXYB 4GUCA 3EYOA 1SOSA 3EFOA 4Z9KB 2FEDC 2H8PA 1F4YL 1YYLL 2FAUA 3MV9D 2XQYA 4ZS7L 3FT2B 4F15B 3BH4A 2D31A 2J73A 2IANB 2KS0A 3AT0A 3RTQC 4UNTA 1L9OA 3ECQA 2XNAB 1E2WA 2XFXB 5J3HD 4Q6YA 2WM0A 4AUUA 3RUGA 2V5RA 1A2YA 4B27A 4F3FB 2EDMA 3UZVA 1CD0A 3LDBC 3QUMH 4F8QA 2MNUA 1B0RB 3MRGA 3II3A 1BIIA 3DARA 5H8DA 2OLDA 3QHFL 5B39G 4ISVA 4JB9L 2EH8H 1EDYA 5AB9A 2IAND 1CT8A 3RB5A 2C8NA 3HNSH 1U30A 3BVVA 3NFPB 1SEBB 5CJOH 1KLFA 5GJTH 4IHOA 3H6AA 1KEML 4BE6A 3TESA 4JFVA 3O41B 2Z64C 1NGXB 2B5IB 3MXVL 1RUQH 1OE1A 1KPRB 4YHPA 2F7IA 5SX5H 2K7QA 3HLAB 3UBXG 4PRPA 3LEXA 4KRLB 1W0WA 3AWGA 1RLWA 1U6AL 3VXRE 2HJFB 1AJ7L 3CSBA 4N8PA 2LHAA 5C09E 2C7UB 2WKOF 2DH3A 3MUHL 3QUXB 1PKOA 2Q3ZA 1JNHA 1CU4L 1KYDA 2VDLL 4YR6A 2QADB 2N7SA 3FH8A 4Q2ZB 3E2HC 5IUSA 2AQPA 1CVSC 1LO2L 3VNZA 1U8LB 1RV6X 4ELMF 4HIQA 2EDDA 3RWFB 3TA3A 4PP1D 1XO8A 1Q38A 1LK2B 4JY5L 3GMOB 4GYBA 4KROC 1NFDA 3O9WD 3S2CA 1NGQL 2AZAA 5F7UA 4UBDC 3KWTA 5AZEL 1GS6X 1UUSA 3IEAA 1A6VL 2Z0BA 1RD6A 5KYYB 5FR3A 1CJYA 4JREC 3ARBB 4KFZC 5KSAB 1TVDA 3FQRB 4Q74A 3ZL2A 1F1DA 4QHMB 3V4UH 1OLZA 3FN3A 4CJ1A 1RUML 1RPQA 3SPVA 4L4VE 1BXUA 2VR6A 3IFNH 4NN6C 2YPKA 3DLQR 2AJZB 2HRHA 4FG6D 3UPAA 4G6AC 4F9PA 4YQXL 4ZMLA 1OAXH 5ECGA 2B08A 3ATEA 4P8QA 4WY7L 3RTQD 2OTWA 3RKPA 1NEZG 1NMBL 2QR0B 2ZQKA 4POZD 5KSAC 3OJMB 4FQ2L 3L5JA 5J6GA 4H1LB 1B0GA 3A4DA 1XCQB 3KM2A 4PRIE 3FT1A 1WO2A 4WFED 4F7TB 5MEQA 4AG4L 2XSKA 1UOVA 4PYHA 2K8QA 2QELA 4JFHE 3KR3H 4JHBA 2IH1B 5KVDL 1Y1DA 3GJFA 2NY0C 3QG6A 4W81A 1ET5A 4OQTA 3QIWD 2MCMA 4J39A 1MKFA 2D8KA 4X2UA 4HUWA 2KC0A 4OJYA 4GI6A 3VH8A 4QHKJ 3IDYB 1BAGA 4LLQB 2OMYB 3FHAA 1F4YH 3JYCA 2R27A 4OD1L 1XZ0A 2QHRH 2Y1ZA 3M7FB 5D1ZD 2G2NA 3KLHC 4OF6A 3W38A 2UVFA 1NFAA 2VR4A 1PW3A 3AC0A 3LVTA 4N2EA 3VRLE 2AJXH 2Q9OA 4Y16C 1E30A 4LLWA 4TNEA 2N01B 3SDDB 4M6OH 4WNQB 3GHBL 3HBGA 1ZIBA 3V4LA 3KXFE 1DEEA 1OGAE 5K39B 3KLAB 5EO1A 1GCYA 4DZ8A 5IHBA 3U0WH 3BPNB 4H25A 3QDJE 5C3IA 3AGWA 3BD5A 5B1JC 3QJVB 4LVOB 1OT2A 2Q7YB 3QUKA 1Q4NX 3H3KA 3MLTA 5J89A 3T8XA 1D5ZA 1KGUA 3UZVB 4EZKA 2PCFA 3JV5A 1WFNA 2NNXA 3BGFC 3BH9B 3HBZA 4PB0L 3X1FA 3O4LB 3OJDB 3K7UA 4AL8L 4C58B 4XOCA 5BRZB 1UTDA 4HWUA 3IE4A 3BIKA 4XC1H 4XBEH 5DEJA 1AOZA 4WI0A 4NCC1 3CFCH 4ONFL 3UAJC 4TYUA 1FLRH 5A2AA 5B7MA 1OB0A 3TEYA 2F5BL 2YQ2A 4ENZA 2DEWX 2AJ3B 2OP4H 2WZAA 3MUUA 5GZNA 1KPRA 3GEFA 2XQBL 4NOFA 3KYNB 2CDEA 1TZ8A 3LRMA 1RIVH 1ZS8B 2HFEA 3H9SD 3W82A 5BRZD 2FO8A 1DQLL 5D7HA 5LAXA 3L6FB 4K15A 4XHJC 5FA3A 4KMTH 3EXJA 4YHKH 3S3SA 4YR6B 3CFTA 2ETWA 5FPIA 1PG7X 1UWFA 1AHMA 1IKFL 5C08B 4D9LH 3N42B 4FZEL 2R1XA 3WHE0 3MREB 5AZUA 3PUUA 4OLUH 2ZWLT 1YECL 1RU9L 1PS3A 5TH2A 5EZIL 2EDYA 4L1BA 1CICA 1AIFB 1RZIA 2V8MA 1A0QH 3ESNA 2XQYG 3QFJD 3DMMD 3BAKA 1GSKA 1VFMA 4HIEA 4MX7A 5CD3A 4RFOL 4DERA 3GS4A 3HB3B 3U2SB 5E5LA 4DP8X 5LNGA 2JK5A 3L3OB 4JQXC 3EJYC 2X6VA 4P3CH 2DBLL 3H9SA 5CR8A 4NKMA 1JK8B 2ADFL 3WHXA 1OTUC 4MCYA 3VSUA 4ETQA 3DYMA 4Z1PA 4FABL 1NPNA 4JJHA 1C5DB 4NQUA 2BSSA 4FLOA 1HT6A 3BJ91 5I76B 4YXLH 4GT7A 1FNSL 4WRLA 1C1EL 4WENB 1GJIA 3LHAA 4XXCC 4Y2DD 4RQQA 1T6BX 4GBXD 3QCVH 3VFTA 4PJHF 4N0YH 4PJAF 43CAA 3TOPA 2ICWB 1YY9C 2VDOB 2BIHA 4IBTA 4PJ5D 4HWEL 4DN4L 4NO3A 1TTFA 3IRZA 2IH1A 5JIKA 3EO1B 4F33B 3RDTC 1XX9C 5FA4A 5LB1A 3BSZA 3LKSB 5DK2B 4PY7B 4Z77A 1KFAL 5C0RH 1M1XB 2LVCA 2ZAIA 3TA4D 4HUWB 1BLNA 1NCWH 8FABB 1KGIA 4CADA 4YWGL 1DBBL 2ZKWA 5FHBL 2I60H 1JF6A 4WQOA 4M3KB 5KBKA 1OF2A 1IIKA 5KW9L 1DUYA 2VDML 3ULUC 1F11A 3FO1B 5D7KD 3UAEA 1X4XA 2I07A 2Y2WA 1QSEE 5IOPA 1I8MB 1D9KA 5FM8A 1OAQL 1I8LA 1I8AA 5IVXF 5AAMA 5T1LB 4P05A 4CGTA 3C9NB 1NC4D 4HLJA 3QCUL 3QJFB 3T3ME 5AFAA 2L4OA 1CGTA 1ZPLA 4WNQA 2WQUA 2G9HA 2OMNA 2HX7A 3DA0A 5HHPA 1EJOH 1MVUB 3T0DA 4KQ4L 4HH9A 1RKRA 1WD8A 3FKUS 5HYJA 5AKTA 3T0WA 5T1LD 1EZVY 5GZND 3ABMB 4TL5A 5CEXB 5IKCB 3P9WB 4NN6B 1K4DA 3HS0B 4PCTA 1OQXA 1R6VA 1J8HB 4AIZA 2WLZA 4LFHG 4N2LA 3ATBA 3BPLB 3CZEA 2Q6WB 3I9GH 1RL1A 1SF5A 3MBXL 5IY5B 1CPUA 2WBXA 1EV2E 3IFLH 1PSKL 4R2GB 3UBXB 4TLTA 5I1LA 5L7XH 1NPJA 5B38G 1XB6A 5JQIB 2IFGA 5ANME 3KYNA 1EGJL 3IGFA 4E9XA 1RIVL 2PYEE 4L4VD 4R7NA 1PNDA 3NJIA 4WU7A 2ORBL 2W9EH 3HBPA 3QDME 3RL2B 2ERJC 5BS0D 4F58H 5BZDB 2XZAH 2IOMA 1HOCB 4OLXL 3FU6A 3LSOB 1GPOL 2VZ3A 3O8XD 1D6EB 3QEHA 5IB2B 2BP0B 3R19A 3I3BA 4FNLL 1XXFC 1JXKA 1NBZA 5FGSA 1UWEH 1HILB 4I9XA 5D7IA 1HZKA 3F8UB 4G6JL 4OKVB 3LH2H 1U8HB 4OGZA 2NNFA 1KLGB 5EIIB 4Z8FL 1YN6B 1XWVA 4IOIB 3NN8A 1N68A 3KWWA 4FQXC 3MLSL 1FFOB 4ENED 4TQPA 4OLZL 5I75B 3L1EA 1BVOA 5J7CC 2FEDD 1PKQE 5GGTA 1S9YB 1F86A 1L6XA 1V3JA 4WHYH 3ALPA 1ZSDA 5DCCA 1E90A 3RWHB 3KPQB 2ZOTA 5DJ8A 4K73A 1AQKH 3LS5H 1UOLA 4D0BB 3K91A 3FU8A 2P42B 2VOTA 3QWQB 4PRBA 4OFKA 3BHBB 1GKOA 3OG6B 1E9QA 2OL3A 5JA9A 1MREH 3FFOA 3QZPA 4N28A 2ZXBA 1E65A 5EOTB 3ZHKA 1QFUL 3N55A 5E9DE 4M8UA 4G42A 1JPTH 2YSTA 4FQQB 1RJZA 2AXWA 3QXUA 4PJAE 1SPDA 7PCYA 5I9QC 3TF4A 5AVWB 5DZOA 5IHWA 5CLZA 1MDAA 1XAUA 4R7XA 2Q8AH 1CGWA 3ZE0E 2BFVH 4KI1A 4L0ZA 4JN1H 2G5BA 2J44A 5DO8A 3DETC 5AQ0A 2YKLH 4B9FA 1BEYH 4D9RE 4F2MA 3QIWC 3SOBH 3DJTA 3U83A 4BZ2A 3HI5L 4XVUC 2M2DA 4M6AA 4AG4H 4AYBA 5IQMA 3IDGA 3FTGA 1EXHA 2ZAHA 4M48H 2CUAA 3FUKA 1T4WA 3D85A 3RL1A 1I1AD 2HT2D 4HEPG 5DI8B 3WJJC 3GF8A 3SDCD 4WFHD 2XFXA 4ZMTA 3SCMC 4Y1AB 1FORH 3GZPA 1A2YB 3KDPB 3D09A 2ESVB 5L2KE 5A6IA 4X6DA 1NCJA 4OZFH 3QJTB 4CVXB 3ISYA 3BKCL 1HSAB 3T9WA 3GK8H 2CJ3A 2YEQA 3TH2T 4J3SA 4DP7X 3FTSA 2WKGA 2FBJL 1VHPA 1ZIAA 5JO5A 3BEWA 5IMOA 4UCFA 4PJ8C 4AQEA 4X6DE 4OLWL 4B5ZA 3ETTA 1JHLL 3MTRA 1NGXA 4WFGE 4NQVA 3KPRB 4QRTB 4E9SA 3Q13A 4L37B 4XO5A 5IK3A 4I7ZC 2AJYL 5IKCA 2BOBB 3EUUA 4LVNC 2WBWB 4X9BA 2VIRA 2DDQL 1TTRA 4OZFA 4GQ9H 5MHSE 1KIRA 2HJLB 1SGKA 1DQVA 3QHTC 3SDCA 5JIPA 1E3XA 4ETYA 3TU6A 5BOJA 3BX7C 1FNGB 5T3ZH 3WXVH 5ADOL 2VW7A 2MHAA 5TGBB 4BCXA 3KPRD 1LYQA 2D7PA 4JE0A 5E6IA 3ZDYE 1A7QL 3H85A 1JGEB 2LFGA 4HK3N 5DUJA 4XGZA 5IHUH 5KYUB 1ZANL 5AVSB 3FCTB 1EO8H 2FK9A 3LXUX 4YVUA 4G9DB 3KYOB 2Y23A 4YBLB 1F3DH 2IH3A 3O11B 4K5MA 3BUYA 2VLLA 1M2VA 4U7MA 2A6DB 5C6TH 3TCLB 4PJBE 3RPBA 4QHNB 3U4EB 3C5XA 2E5EA 2K3TA 4KXZI 1MHEB 3BT2L 2CPCA 2E9WA 3L3IA 2W5PA 2APFA 4JFWA 5E95B 4PJBB 5SWZA 3DUUB 3ARDC 1ZA3A 3FPYA 4WI8A 2AZUA 2Y2YA 4FHJA 4P57B 4TRPH 1F3DJ 1ZLUK 4G9FA 3WIHL 1SFDA 3IFPA 4FLQA 1T7YA 2NYKA 4NC2B 2YD0A 3B2UC 3GMPB 1UXSA 4O5LL 3RVVC 3Q6FA 4JCMA 1W91A 3W9DA 2E6PA 4QHUA 1QRNE 3B9KC 1UA7A 5FYJL 5EIIA 1AC6A 1MUJB 4GQQA 4UDUB 2CRYA 4EKJA 4GG6A 1NTDA 5ILTH 4XO9A 1VKXA 3WY4A 5FO7A 2EUVA 4JQVA 5E6ID 2V37A 4ADIA 2WBJA 3B9VA 5H94A 2AQ2A 2EICA 1U8PB 4TUJB 3QJHB 1AGEB 1ZHBA 4LEOA 4NO0A 2E9BA 4AC2A 5HD8C 5I1CL 4QRUB 2OL3L 3DYOA 2E7LC 4MA8H 4Y88A 3B9KA 4YXKH 5JPNA 3GD1C 4KX9A 3REWB 1NKGA 3LN4B 4BFIA 5D5ME 1E9QB 2OL3B 4BZYA 2C3XA 4NEHB 2EXWC 3TWYA 3U0PB 2I5YL 4NPKA 4YHOH 2W07B 2GSGB 1EZSA 2X87A 1WBYB 1O9ZA 3MXWH 2EYTB 3P3RA 5J9PA 4HWNA 5I30L 1ACXA 2E8YA 1FFTB 3KLSA 1J1XH 4Z5RA 5JYLA 5AW6B 3FT2A 3PP3H 5EH1A 4MJ6A 1T0NA 2AK1H 2CK2A 2BIQA 3KLHD 2PUQT 5FO2A 1LQBC 3WGVB 1HHHB 3U30B 3SBRA 2NY3D 2X1WL 2Y7SA 5F0LB 3U7YL 2GY7B 4PIBA 3OZ9L 4F3FA 2WN2A 4PJ9B 4X6CA 3FQYA 4BWUA 3BDYL 4HGWA 1TQSA 4YE0A 1KYUA 1RZKH 4RFEB 1DE4B 2WC7A 4FKEA 2R69L 4N24A 5DI8A 4FFZH 5K39A 4ISVB 2VJ0A 4N9GB 1JZ7A 1THAA 4CN1A 1ITCA 3RFZB 4BSWA 2JLLA 4PWEA 4Q14A 4BK5C 4R5VA 5L4FA 3DJ9A 2ZT9C 5HHMB 3UXFA 1C5BH 3EADA 5T5FH 5EZIH 4MAZA 2DYPA 5AVQB 3GSXB 3D07A 3QNYB 5CU9A 1T80A 2W9LA 1RU9H 5FGRA 3V7AG 5GZOD 5E1AB 1TZHB 2RCSH 3B7SA 1S7QB 3G5XB 5DJ6A 4FZEH 2VLJD 3BEWB 4XP4L 1M6OB 3X13A 5FB8B 4ZUWA 4RGMC 5DS8B 1AXTH 3QUXA 2VSMB 3MRHA 4OV6F 2A1WL 5I71B 3OGCB 3CFDA 2HX8A 3DURB 1VRSA 3P73B 3DROA 4XOAA 3B83A 1BVLA 1PCSA 4J4PD 3VA6A 4DGVL 1WH0A 3F65A 1ZANH 1ZS8A 4DP5X 3NK3A 5ID0B 4ZFOB 5IUCA 3D2UA 2BOBA 1T2XA 3F7QA 1LK2A 1DVZA 1FVCA 2AEOA 5T5NF 5C0FB 3C6SB 4WK0B 5HI4D 3SGJA 1WEJH 3WJJA 5E1GA 4KMQA 2V2WB 4HIXL 1ITBB 5IROD 3BVUA 2ISDA 2ADYA 1J86A 3KHOA 5ICZB 1BFTA 2MHAB 4XX5A 3WDIA 1R3IH 4BCZA 2N7BA 1T21A 2V7HB 4YC2C 4EPSA 1NCDH 1JOIA 4W4NA 5KYUA 4D0DA 1AG6A 1UM5H 1ZVSA 2WIIB 3TFKD 3H3PH 3O4LD 2CKBH 3WDJA 4CDHA 1JDCA 4BA0A 3MFFB 5JDSB 4L8BA 1JNLL 1YYMH 4YK4B 1WIOA 2Z7ZA 1H8SA 3VI3F 1H3PL 2JKNA 1MZYA 1KN4L 2AXFB 5E99H 5CHNA 3L48A 4Y2DC 1JYNA 1CL7I 2WYHA 2WHVA 5GGQL 4HUKB 2JTYA 3V4VB 1RZ8B 4PWFA 3L3GB 1HL9A 3BSZL 2Y07L 4QOKB 1OSPH 1F97A 3IFPB 3DSNA 1ZY9A 3GI8L 5LCVH 1KLUB 1PLAA 4JL2A 3F58L 5J57B 1TCMA 2X41A 4XX1E 4A7SA 4MCYB 4XB8A 4XVJL 1MEXL 3L4TA 3IDNB 1GY2A 4LCWB 3NPSB 4YDJA 4N90E 5D9SA 1TCRB 4LKCA 5KBNC 3R1GH 5C08D 4XMUA 1VKXB 2A73A 4CNIA 3MJ9A 2CSPA 5MERA 4QR7A 2WP3T 2GT9B 5BMFH 1WTLA 4UQ9A 4EI5B 1SXBA 2A9CA 4NHCL 3UO1H 4GW5A 4JG5A 5FYJH 4GXUM 1HYSD 3MJGX 1R33A 4OIIH 4X9GA 4X4ZA 2J8OA 3LN4A 1HK6A 3VWJA 3EO1A 2Z34A 2ODHA 5GGTH 2FT7A 2Y7QA 4G7YL 2Y1AA 3ZR6A 1AXSA 3LNGA 3LRSA 4N2DA 1QFOA 3PV7A 3RILA 2G3XA 3QJSB 4JR9L 3U0TA 1QD0A 4RLDA 3SZ6A 3SDAC 5B3NA 4G43A 4PWIA 3E2HB 5AW4B 1N7ML 2QGDA 3P9LA 3MHZA 1U3JA 5C6TL 2IBBA 1DUYB 2AJSH 2ZKXA 3QSKB 5J4MA 4AYDC 1Z3GH 2W91A 4OUUA 2GYSA 3CBKB 2BY1A 4P2QB 3ZY7A 3TM6A 2NUPA 3ROLB 1AQKL 4ZOEA 5IROC 3FBKA 5ELIA 4K7PH 3WTSA 5DVMA 4BKLB 1Z0NA 4RFEA 1ZT1B 3ARDA 3MOBL 4UIMA 2APXA 5I0DA 4N2KA 4GAAA 2NQCA 4BSJA 4KDVA 5BRPA 3VWJD 3ABGA 3QUZA 1IGIL 5TQ2L 2WLJA 4O51A 3T8VA 3ZT7A 1DHKA 2QPSA 3D33A 3NIFF 1V8HA 2C9AA 5HJ3B 3BKMH 3DXAD 3CLFL 2IH8A 2JKWA 4W9DC 1QA9B 3QCTL 4PJAB 3FB8A 4KUCD 2D2CC 4KKAD 4DKEH 1S7QA 4H8PA 1QR1A 1ACZA 3QDAA 2NLJB 3EGSB 1P4UA 4JFTA 4FQIL 1PVHA 3LRLA 5F9JB 2WCGA 3IF1B 2J56A 4GW4B 3FMGH 2OZ4A 1KXTA 4U0RC 4IRSA 2ALAA 4M5TA 3HMXA 3QO1A 4YBQD 2HG0A 4JO3L 3SEPA 2NY7H 3QYNA 1QYGL 2JNZA 4R7NB 1R5IB 3CX2A 3IFLL 5AG9A 1OAJA 2BX5A 3AXIA 3GBMH 4TPRH 1MWOA 3QRGL 1ACYL 2EH7L 3MCKB 4KK6C 5BS0B 1OAKL 5JIDA 3D08A 3U25A 2VXUH 4OV5B 2ZCLL 2VGLM 1MCOH 4KTEL 1Q9WA 5TK4A 5MEPB 5IV2A 2YWYA 2QV4A 1AGFB 3U2SA 3STBA 3HZMA 1IZKA 3RDTA 2CBTA 2JK5B 5LN8A 5D5MF 5IJBC 2YAQA 1E9OB 3CFKA 3UJTL 2AGJH 3N42F 1DUZB 1DO6A 2EDBA 4IOIA 4N90D 1AS6A 1JWSA 3VXUA 3HE7C 2XV3A 3L1GA 4L9DA 4KX8A 1OVZA 1RZ8A 2WVVA 4B0MM 4ZTOL 3E7JA 1IGFL 1FZOA 4HXAL 4NWUH 4KY2A 1ZAGA 1J1OH 3QCUH 1JPTL 4I5BA 4UB0L 1IGYB 1CK0H 5E1QA 4D0BA 4LL9A 2FECI 3HG1D 2VLKA 3DSFL 4DCQA 3IT8D 1NAMA 4WJ5B 1QNZH 1AGDB 4ZUUA 2XKNA 1S7SA 1XGRA 3CU1A 3CZSA 1IRAY 1L9SA 5E6IC 3OB8A 4MMYB 1EJ6A 1JGVL 2ZWYA 4P5MA 3V0FA 5HD8D 2X2HA 2F7QA 4XRCB 1NC2D 1COBA 1SLUA 4AIXA 3FUHA 4TOYH 5IB3A 1BVNP 5MERB 1AKJA 3S3DB 3T0EB 1N4XL 1TJGH 5DK3A 3A6CH 2EIDA 5I6NA 5IG7B 1DJHA 1RJYA 5FOJA 1D5MA 5TE4L 3KS0J 2BNRA 3NCYP 4ZNEA 4DP9X 1RHHB 4OGYL 3H9ZA 4JO1H 3HS8A 3TBYB 3U36B 3APCA 5CP3H 4LRIA 3FQUA 2VUYA 3SGKA 3N44F 4MBOA 4YSDA 2YPLA 3PJSB 2D3NA 1R3IL 2DMHA 2DMKA 4UM8B 1E4WL 2XJLA 1I1FA 3RL1B 2QKIA 1HXKA 3WHE1 1QI5A 3DX3A 3PGFL 3TYGL 1E8YA 1YEFH 4QRRB 5D6DA 3OKEB 5B38A 5I1KH 3O2VH 2Z1PA 1I9EA 3CN3A 3MGTB 3DI2B 2DMBA 3ULVC 2XUWA 4EE2A 3RGHA 2VXQL 3D1MC 4QRFA 4MCMA 1AD9A 4TNWF 5E6SB 1T1XA 2DWEA 1QWHA 4L4TA 1DN0A 3KPOA 1ILUA 2VXVL 3C8HA 1EFXA 1E27A 1Z5LA 1ZT1A 4FZ8H 3OM3B 1LEKA 2VDNL 1H8OA 4F2ME 3LHPH 2Y06H 5EDSA 4A63A 4GI8A 2PO6A 3F7KA 2FGWH 3QPQD 4ERSL 5AB0A 4OFYD 4F24A 2RHEA 4H0LC 3LX9A 2FZ3A 1I3UA 3WKNA 1O6SB 1OB1A 1JHKH 3QIWA 4PFEA 1LEGB 5IK3B 4EO5A 2N59A 4OZ4B 4JAMB 1KWGA 4D3CH 1QA9A 4PJAA 1WFIA 4I0PD 3EH2A 2IG2L 4YNYA 2Y06L 3EJJX 1BWWA 2GJPA 3LRHA 3LJ3A 3MAWA 2R0ZH 4UT9H 5DD1H 5EV7A 3X12A 3I9AA 4G7QB 1KCVL 3P11L 3PP3K 1MOEA 1TDQA 3M1BA 4N0CC 4PJ7A 3GMLB 4S2SB 3RPKA 4IKJA 2H3KA 1OT4A 2VZUA 5I71C 3WXWH 3JUZA 3MLYL 1THCA 2BW5A 3IETB 5IFHL 3VGAB 3WY3A 3GZKA 1P2CA 5B1BB 3DJRA 1YPZE 1ZA6A 1AYOA 2VLRB 3MV9B 2A6DA 5EU3B 3U4EA 4V1DA 3HI1A 3KL0A 4BZ2H 1MHEA 4WK4B 1U8HA 3TBSB 3MROA 4JHAH 1SY6L 2B4CL 4JY4B 5IVXA 3MXWL 1AH1A 3V6BR 3VXUD 5C0RL 1BBDH 2XV0A 2KUTA 3LD8B 3MNVB 7PAZA 2XIIA 2AHIA 4LDEB 1E4JA 3B2UD 1HJCA 3ZSTA 3I84A 1IMHC 2VM3A 3Q5TA 2BPBA 4QRBA 1KCLA 3CN2A 1DUZA 1CS6A 2W0FA 2YAFA 4JFQB 1HQRA 4GOSA 3VFUA 4TOYL 3N06B 1OALA 4PRHD 4GG6B 4G1EB 3VXUB 1P4BL 4OF0A 5FO7B 4G42B 3APMA 3VFVA 3JQOB 4O02H 1GIGL 2FD6L 1CXLA 3SODB 1PLCA 4YL4A 9CGTA 1LE9A 2PP9A 5ACLA 1LO3H 2X4RA 4ZMPA 3HFML 3RWIA 4I77H 4NQEA 4ONOA 4UI2A 4BK8A 1QBML 1I85A 1ZEAL 1ZV5A 3NK4A 4FNPA 3V5KB 1J5OL 1KBBA 4V1DD 4UILL 3WIHH 3CHRA 4WNJA 4LPCA 1AQDB 4UU9A 1MFEH 1T6WA 2VYRE 4WW1B 5T3XE 2YPLD 2IALA 5C97A 5LWYH 3QQDB 3GO1L 3GQFA 1ODAA 5CAYB 2JVUA 2IC2A 4TQ8A 1AZZC 2AV1A 5K9JH 1TVBA 2ZIDA 5EFIA 3NIDE 4YDVB 5T8IA 2Q1EA 3MRPB 3QXWA 5A2KH 4FXGA 4MQXD 1W15A 5KBPA 3TBYA 5EF2A 1JBJA 1DCEA 3ARED 1QW9A 1DVSA 2XWEA 2JKSA 1MCJA 1GJUA 1HHHA 2IV8A 3BXNB 3DMMA 4K5OA 4UQEA 5EULV 5F44A 4JKWA 2F08A 4U1KA 1ADWA 4P46B 4I2XE 5MHSD 5ES4B 3T0XA 4PJ9A 4L8SC 2VAAB 2WXKA 4X6CB 4GXVL 2X4SB 5EO0B 3W9EB 5FYLL 5D1XE 5ITBH 1HE8A 1E5CA 4DEWA 3BGMB 4K94L 1PYWB 5JO5B 4XHJD 2AS5M 1JPGB 2EIBA 3T4YA 4F7KA 3SO3B 2DYSB 1MXGA 2WLHA 1BEXA 3IM1A 4L3AA 2XVBA 2JXMB 4ZTPH 3BZ4B 4PIRF 2OXHB 3F6LA 2YFNA 1YEKH 4ZOAA 2OX5A 4JHWL 2YQBA 3TYGH 2P8MB 4QRAA 1KNOA 2FECL 1J11A 2FLMA 1M6OA 4ZUWB 4IMKC 1EHAA 4IMKA 4U4BA 1FIGH 4AJVA 3DMMC 4IGBD 4K71B 2QDVA 2OZ4L 3HPJB 4GY4A 4NZTH 5GGUA 4JPWL 3HZ3A 4GRLD 2ADIA 4U1LB 5B39A 1NH6A 3H1ZA 4XTRD 1XR8A 4EUPG 4PJFB 5ID0A 1LP9B 1WJ3A 5KANG 4JPIB 4OJFH 2Q87A 4YNYB 4ZFOA 5KYXA 3A6CL 1EHXA 3BUYB 1DJWA 5EIQA 4KHTH 1IVTA 5IJCC 3TCLA 3ARFD 1A6ZB 2KYIA 4JFXA 5F3HA 4JL1A 2PLTA 1HHGA 1SUJA 2J5LC 3P54A 2E27L 3V0IA 4H5SA 1PAZA 2GCYA 2G75A 1VGEL 5EUOA 4BQCA 1NGWA 2JELL 5BV7L 3W57A 1F3RB 1IT9H 2X4OB 3RPIB 2VZSA 2O5XH 3TO2A 3KPPB 5G4OA 2DB8A 2H6UA 5BZWB 2BWQA 3V79C 4PBXA 5F8QC 5DFWH 3KEDA 3U1SH 5I19L 3UJJH 1EAQA 4L05A 2AV7B 4XNUL 5C0ND 4A68A 4DAGH 3GS7A 4ABQA 4OZHB 4ZMQA 4HS3A 12E8L 1XGZA 2APBA 4PJEB 1MI5B 5HDBF 3ZBMA 2XV6B 4GG6F 5FC9A 4CILA 2WZPA 1Y1UA 4FD0A 2BVTA 2NTFB 4JDTH 5AD0B 1V3LA 5CILH 3HZYA 1J48A 4K5NA 2DI7A 2CK0H 3PGCB 4NT6A 1E4XL 3L9RB 3JT0A 3RIAF 2XTJD 3MLUL 2PCYA 3FF8A 4FG4A 3ULVF 3OMAB 3IBEA 5F88B 3CK0H 2ZXCA 4AYID 5HSFA 1KELL 2MCPH 2QSCH 1IQWL 4HQQH 4FFZA