5LAPA

P53 cancer mutant y220c with cys182 alkylation
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
195
structure length
195
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Cellular tumor antigen p53
publication title 2-Sulfonylpyrimidines: Mild alkylating agents with anticancer activity toward p53-compromised cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lapA00
3D07A 3IGKA 5G4MA 4L0YA 2ATAA 2BIPA 3TS8A 5LGYA 2J1XA 1UOLA 2X0VA 4LO9A 4IBVA 2GEQA 4KVPA 4IJTA 2J20A 4AGMA 3D0AA 1LJMA 1EANA 2J21A 3VD0A 3D06A 3WTUA 1CO1A 2MEJB 4L0ZA 2IOOA 4IBQA 2OCJA 4IBUA 5BUAA 4IBSA 3WTSA 2J6WA 2YBGA 3Q01A 5G4OA 4AGLA 2XWRA 4L18A 5A7BA 3ZMEA 2BIOA 2ADYA 4G82A 2X0WA 3QYMA 1HU8A 3D08A 4AGPA 3WU1A 2J1ZA 2BINA 5ABAA 3VD1A 4IBWA 2BIQA 1E50A 3VD2A 5AB9A 1GZHA 3Q06A 3EXLA 2FEJA 1EAQA 1TUPA 4AGQA 3US0A 1EAOA 5LAPA 1IO4C 2XWCA 2P52A 4GUOA 5AOMA 3QYNA 5AOKA 5AOJA 1GZHC 3KZ8A 1T4WA 4GUQA 4AGNA 4LOEA 3EXJA 3KMDA 5KBDA 4LOFA 4IBTA 2H1LM 3WTVA 4G83A 3Q05A 2J1WA 3WTXA 4A63A 3IGLA 1HJBC 2BIMA 2PCXA 5AOIA 3WTYA 3D09A 4IBYA 3WTWA 2VUKA 5G4NA 1HJCA 4MZIA 1H9DA 5AOLA 1TSRA 3US1A 1CMOA 2WGXA 4MZRA 4IBZA 2X0UA 2RMNA 3WTTA 1YCSA 2AC0A 3D05A 2J1YA 1KZYA 4QO1B 2IOMA 4AGOA 2AHIA 4HJEA 4XR8C 5ECGA 2IOIA
chains in the Genus database with same CATH superfamily
3SGEH 2XG5A 4HAGA 1RUAH 4YDLB 1NC2D 4X9HA 1FL6A 1QX1A 2KL6A 3CLFL 2P42B 3EYVB 2ENYA 4X4XA 1IUZA 3KBHE 4Q52A 4LNRA 2Z9TA 5F89B 4KI5E 2YLKA 1ML0A 5EOQH 2AS5M 2WYTA 4N90E 3EJJX 1UXMA 3PFQA 3RWFB 4PREB 3D0AA 4GRLD 4F8TA 4Z7WB 3I85A 4XXDB 1YDPA 4HC1A 2IANB 1RZFL 1NMBH 3MNWA 1TJMA 5J6SA 1KJVA 2X42A 2L7UA 3SKOB 4BH8A 3K74B 1N8ZB 2NXYD 1QEWA 1ASPA 2VQ1B 2FCBA 5DEFA 3UZQA 3O41A 3Q13A 5GRXG 2C1OA 3T8MA 2HTLD 2F5AH 3ZBMA 3HW7A 4P5TA 4RMWA 2WLLB 2JJTA 3GJFA 1KV3A 4ODHH 4PJAB 4OVVA 1XF3B 2MKWA 5E8EA 2GT9A 4AUYA 3CHRA 5ES4B 3VXQA 4BH7B 1NFIA 1VEPA 1N4XH 5D7IB 2A6JA 1JPTL 4TQEL 4DAGH 3F7KA 4I1PA 4BFBD 1FUNA 2AV1B 1EAJA 4UB0L 1ZDQA 4PY8I 3HC4L 5PCYA 1R34A 4EMZA 4H13C 3FBKA 2AK1L 4S0SD 2FBJL 5HGHA 5EC2B 1DQLL 4U6TA 5IB3A 1ZWIA 3LEYH 3RNKB 3P54A 4FULA 5KW9H 2Z31D 3IPEA 1SYSB 1XH3A 2DQHH 2X1OA 4JRYB 2JJSA 3MUGB 43CAB 1QSEA 4M6OL 4HS8H 3ZR5A 1J9QA 1S78D 1X7SA 3BJLA 4G7YH 2BP5M 4H20H 5B4MC 2VDOB 1CD1B 1XQ4A 1A1OB 3M1CA 2V33A 3EOAB 4Y7MA 3ULUH 4XPAH 5DZVA 2A99A 4ZI8A 1EBAA 2RJMA 4JFYA 3WIHL 4P2AA 5KBDA 3D9AL 1IGCH 4Y7OC 1U8OB 1XF2A 2YAMA 1BM7A 4MX7B 3CH8A 1I7RA 3EF4A 3ARRA 1NEUA 4E41D 4BSJA 3O4OB 4MXVF 1O75A 3L7FA 1LNUA 2UXFA 3AG3B 1MZZA 1NGXA 1FNAA 3OAYK 3QIWA 3VWJD 3ZVVA 2ITCB 2AXFA 1FZJB 2YQBA 4IKIA 3RFZA 3BWUF 4B95C 1KCUH 2CM5A 1O6TA 1GYAA 2HP4A 2G3NA 3F7YB 1G7IA 1S46A 5D4QA 3V79C 3DO4A 1AS7A 3AREC 4IKLA 2XVLA 3CTTA 5HXMA 4YN3A 4TRPL 1T20B 4ZMXA 1NGPH 1HILA 4XC1L 4PJBE 5TK4A 4LVHB 2YA1A 3I9PA 4Z7VF 5H4ZA 1AD9A 3LXUX 1SMOA 3NQKA 3QQ4B 1NC4B 1LO0L 1ULVA 2ATKA 3FQ1A 2I9LA 2LTQC 1F4XL 1DDHB 2FBRA 4P2OD 1JVLA 3BOVA 4AW4A 5I1JH 3ZZQA 3CDCA 4OCXL 1C12A 1XXFC 5K59E 1Q9KA 4JE4B 4GAYB 1GAFL 1MLBB 4Z77B 4QTFA 4MRBA 3L95A 4M6AA 4XVSL 3V4VA 3CSYA 2NSQA 4NO2A 4DPRA 1M7IB 2YR3A 4MQXD 3OJMB 5FYLD 1YEFH 3T0EB 1QTPA 3FRPG 4K5LA 5HI3C 4KY2A 2VAAB 1KGJA 3RPKA 1FVDA 4IJ3C 1P7KB 2ZYRA 2ADJB 4AGLA 2Y6TE 3DSNA 1IL1A 4IRJB 2NY5H 2FIKA 2PW2B 3WE6B 3FB6B 3C6SB 3PGCB 4OZ4A 5HHMB 2J12B 4X42A 4HZ1A 4EUPH 2B8OT 5IB1B 3GK8H 1BG9A 2QSVA 4HKXA 1WBXB 3C75A 4MMZB 4A04A 4GRWF 2JI3A 2IAMC 1HZHL 4LASH 5FGCB 1AMYA 1X7QA 5CZXC 2AABL 2L7QA 4QGTA 1OGAD 1SRDA 2HN7A 1A4KA 1S9YB 1UACL 4PYGA 1ZEAH 4U1NB 3DX2A 1MZYA 4NQXB 5JDSB 1AC6A 1BD2D 3LHPH 4O51A 3SE3A 5DZLA 4F58L 4YX2L 3US0A 4MDIB 4P2YA 2ENQA 2HZHA 4XOCA 5FOBA 1WGOA 3O3EB 2OSXA 4N5UA 4YE4L 1VFOA 4KHXL 1S5HA 2DI8A 1L9SA 4WGVB 4C56B 5BV7H 2DQEH 3DUHA 4MJ5A 4AIOA 4CBZA 5C97A 5IMMA 1U21A 3GMPB 4IDJL 1IBBA 4XI5C 1HINH 1WITA 3SGDI 3ATEA 3SOTA 2CO1A 3IDJA 3H2WA 5FM5O 3K6SB 2RQ8A 3U2IA 1N5AA 4LK4A 4CMHC 1YRKA 1GR7A 2I7SA 2WCGA 4ZYKB 5FS5A 3P0YL 2DI9A 1HHJB 1JWMA 1VZIA 2DL2A 3UPAA 2GTZB 1GXEA 2RMNA 3RTQA 4HKBA 4M93C 3MXVH 1TF4A 3QNXB 4P4RA 3B2DC 5FKPA 4KUCF 3BHBA 4C4BA 2C26A 2ZWSA 1QBML 2A6IB 3FQTA 1A5FH 3FB7B 2MCMA 2X9XA 2YAEA 4L0YA 1Y1UA 4LIQE 4JRXA 1C7SA 1O5PA 2DN7A 4Z7VA 2X70B 4NRYA 1FGVL 3FTZA 5H2BA 1NSNH 2FX9H 2XVGA 3GHEL 1PPIA 1N70A 3RBGA 1KTKE 2G0KA 5I1DB 4OV5B 2IQ9H 4ETQA 3QULB 2OYKA 2V7HB 3H9SE 2BOCA 5C7XL 1D6VH 2ZCKL 4M6NH 3CHPA 4WV1C 2XVKA 3GXIA 1R6VA 4Y2DD 2KERA 2FTAA 1G84A 1X5LA 4KKBD 2B1AL 5AW7B 3KLKA 3FN9A 5E2TL 3NGBC 3QDGD 3ZOAA 1T1WB 4EO5A 4AXWB 4YSQA 3K71A 1J8KA 4XNUL 5J12C 4MNGA 4DGYL 4F27A 3VWKD 3CV5A 5C6TL 4X5PA 1CGYA 3FO1A 2D31A 1M4KA 3F01A 1T03H 4JN1H 3CUPA 3DYPA 4B9KC 3EO1A 2C4XA 2WMPB 1ZHBB 1IGML 1IM9B 4YDZA 4GMTL 3GFUA 1BZ9A 3MRGB 2MRYA 4MD0A 3DOIA 2IO5A 4A2DA 1AZUA 1NDMA 2YWZA 1BIHA 3CFCL 4BJLA 3WU1A 1A66A 3E1F1 2P49B 1WWAX 5EU6B 5F7KC 2A6KB 1RD6A 4GBXA 3UL4A 3PHAA 5DJ0A 4FFWD 2VDML 4PP2A 4S1SH 4DJMA 3MA9L 2X4SB 4HIJB 2DQUL 1S5IL 2CR6A 4Z7NB 1F42A 2GSIA 4UCFA 4W9FC 2EDFA 1F11B 5ECJE 1ILSA 4Y5VB 1P4UA 3TWCL 1ND0A 2Y2WA 1V55B 5ISZA 1PG7L 3KM1A 3PP4L 4L8SC 4DKTA 1T4WA 1KLGA 3KDMB 1GJIA 3PHOA 1DN2A 4JPQA 3DX7B 1SUHA 3UAFA 1DQQB 3DK0A 2N56A 1B90A 3QJHB 4P2RD 3QPKA 3RFRA 2V2WB 4O9HL 3D4CA 4Z18A 4UQIM 2UWEA 3LB6C 3TVMC 2NY3D 5HHQA 1QR4A 1CYGA 3C8DA 2DD8L 3FNKA 4ZUTA 3VFPA 2IDTA 5HHOE 3QFJD 3CMOH 1IMHC 4ZS7H 4FI8A 4HIPA 2F5BL 2VERN 4OB5H 4EZLA 2PTUA 3U7AA 4O4YH 5IROD 4YDVB 4PB9H 2H7WA 4KGJA 5F3BA 3LKNB 1F56A 2WNXA 5AKVA 1BQHA 4DESA 4KUCD 4XPFH 3JWNE 1X3DA 4JVPA 3PWPE 1JYXA 1BEYL 1LO4H 4K9EL 2ZPKL 3EO9L 3S3CB 5LGKA 5EZIL 4EI6B 4LPUA 2VDKH 3OKOA 4LPYA 5CR1A 4HOZA 2RB8A 2A6DA 5T5FA 1DBBH 2MKLC 3UGXA 3ZHDA 1K2DA 3M8OL 2WPGA 1LO5A 1WAAE 2O6CA 5D70L 2EEBA 3U6RA 2DIAA 5E51A 1NAML 1GL4B 5I28A 3WUWA 1J5OH 3NCMA 4JY6B 4EQ2A 5K9KA 1N12A 4JDVA 4WFED 3QUYA 1J0YA 4HHWA 1R1CA 3QZWA 3I3DA 1HH9B 2H2SC 5EOTB 5I5IA 5I8CB 1BWMA 2N3JA 3D0LA 4J8RB 1MREL 5E6ZA 2XIIA 3GRGA 3CQPA 4Y19B 4QOKE 2YA0A 3OXRA 2ED6A 2DEWX 4XBGA 5EU3B 1QLRA 2C9QA 4OF0A 1HN1A 1WE5A 4C4KT 5EDXA 4CNIB 4Q6IB 2O72A 3B9KC 3PQYD 2OYPA 1ZGLA 5BRZB 1UJ3B 1IFRA 4KTDL 1T21B 4MXWH 3U9UA 1J8RA 5F7FA 2CCLA 3APFA 4QT5B 2E7DA 2X12A 3C5JA 2DEXX 3GHBH 1D5BB 4R96A 4E9SA 3T77B 4PJBA 3IFPA 4JCWA 4NENA 3PDOB 2CR3A 2ZKWA 3KL5A 2IXQA 4HDIB 4LLYB 1DVFC 3WE1A 1NEZA 4X50A 1O6SA 2GHWB 4YIQB 3UTTE 3B7TA 3FHEA 2HT4D 1A7QL 4OM1L 1JERA 3NCYS 2B3IA 4HIIA 1PU0A 4ZAKB 1KV7A 3ZL4H 4RSVA 3TBVA 1UEYA 1W72B 3KS0J 1FFOB 4JO1H 1A47A 2JH2A 4PJFF 1KZQA 5F7LB 4W9CC 1JV2B 3QYNA 2XXFA 2C3WA 1FLTX 4WU5B 5LBSL 3VTTA 1MY5A 2XXGA 1AKPA 4FAAB 3VFNB 1TETH 3UIYA 5FA4B 1PD6A 1YEEL 3T09A 5J13C 1GYCA 4AYFA 4FL4B 3GXPA 4OLVL 4Y9GA 4NBYB 4CADA 4YHIA 3CLEL 4L9LB 4XCEA 2AANA 4CGTA 4HKZA 4KJWD 1RZ7H 1T4KA 2EDDA 3MRHA 4N8PA 2CHXA 2GBTA 2PCFA 5CNHA 5EU7C 2VO8A 3GIZL 4GMSH 5D1ZB 3AT8A 3Q9QA 4HPYL 2ZUQB 1A25A 1UD3A 2HJKA 2H9GB 4LARH 5SWZD 3JTBA 4AH2B 3F5WB 4FMKA 4NFCA 5DD6B 3MUY1 2ZYIA 1FP5A 2IOIA 3FUJA 3DC0A 3SDXE 1AIFB 5JXEC 4IKKA 1GTFA 4DIXA 3DHUA 2W0FB 5G4MA 3E6FA 1HL5A 1BZDA 4U3XA 5ITBL 3HI6L 4I5BB 1E3FA 3CXDL 5IEHA 1INEH 4KKLC 4DKEL 4UINH 3ZO9A 3CFDB 2G60L 4P4KA 1BM3H 4TTGA 3O8XA 2H8PA 2K8MA 4TUUA 2HVKA 3RWGB 3Q9PA 2WN3A 3WN5C 3WY3A 4WY7H 3PNWB 1HL9A 3KPMA 4I1RA 1CVRA 1R3IH 4FFYA 2YMTA 1JDCA 1M2VA 3FYIB 4QHUA 1MAMH 5AVWB 1E27B 1KFGA 3EFOA 4OIBA 2ENPA 1SOQA 2RGSA 3F00A 3L16A 4YPGB 1Q4NX 2CPUA 1F6LL 1HHGA 3D18B 5CZVL 5B1BB 3MI6A 1OPGL 2CDGB 3X11B 4DEWA 3QZBA 3TGXA 3GSWA 4WO4B 1ZT1B 1A9EA 2OXHB 2R8SH 5KJ4A 4LMQE 4MSWA 1O7SA 4WW2F 1I1FB 1I8KB 1MRFH 2WKGA 2I5YL 2Z92A 3ATFA 1T5WB 1SZNA 4LLVB 4PJ5A 4NNYB 5JHBA 2I60H 1WZKA 5JPMC 3GYRA 4GG6B 3EYOA 4FJYA 4PIRF 1MNUL 2QSTA 3RU8L 1MFNA 4OZHE 1URLA 2ZXWB 3GS0A 1HXMA 2IF7A 1XF4B 2UX7A 2XFXB 3N1MC 5DA4A 5GRVL 3O6KH 5ABAA 1RUQH 4JZNA 1VGKB 3VD2A 1K4DB 4I9WD 1DDTA 4MNQB 5H8DA 1T83A 4IGBA 1IFGA 3MCYA 4K3EH 1U3HB 1IGYB 3MRNB 1VFAB 2IH8A 5I1AA 2QGEA 1IKOP 5EBMB 1KJ3L 1MLCA 2F9BT 3DOSA 4PJFA 5TDPB 4EDWL 2ADGA 5ACLA 3P4NA 2K9UA 3W11C 2EEAA 4KFMA 3RUGB 3FO2A 3RWDB 3SDYH 3SDDA 4M6ML 5F7WC 5JZ7D 5F8QC 1YYMH 4F2ME 1FN4B 1U2YA 4JFPB 3BZ5A 4MJIB 3ZJAA 2P7TA 4FTVD 1BOGB 3QDMA 4MMYB 3X1FA 4IM8A 3S7GA 3H85A 2L7EA 3I9GL 1JPFB 2XRAH 4XWGH 5E6IC 2PYEE 2YXWA 4POYA 4APQA 4W4NA 5ID1A 1TZIA 3II3A 3PWUA 2AC0A 1MHEB 2BNRD 4HJEA 4OKDA 4KJYB 4WHYG 1I8UA 1KGUA 4FXTA 3BH8A 2K3TA 3HG2A 2HRPL 3ZTJH 3PRZA 2YPLD 5EO0A 3QFGA 2BOLA 3N1PC 1J1OL 3G6DH 2J1XA 2H5UA 4W9IC 3KYKL 2XQBL 2ZP8A 4V1DB 2OZ4A 1RH8A 1HWWA 1ZHLA 4I1NB 5EG6C 3RB5A 2DLTA 1OP4A 3HMXL 4LF3A 4IJTA 1HOCA 3INUL 1LP9F 2N7AA 4K71B 1RUMH 4LKCA 3B3IB 1GC1C 4IYKA 4LLDB 1EFXA 2NXZC 1B3IA 4KH2A 1ZJBA 4JDTL 4L1DA 2WHVA 3V55A 3WTUA 1WZMA 2ALWA 2FEEL 5AVTB 4DPBX 5BJTA 2VQUA 3HUJF 1OAYH 4ZW6A 1CE6B 1LK2A 3V6FB 3FONA 4QWWC 4K5PA 3ENEA 3GMMB 4JFQB 4QRPE 4IBSA 1MJJB 4GI9A 1KOAA 5HHOA 5IJDC 4ESKA 1IAKA 3HS0B 4XN5A 4FA6A 2K4WA 4Q9QH 1RY7B 4M1CD 5HHVH 1A14L 5TF0A 3OWEA 4NAMA 2CO6A 4KX8A 9PCYA 4ZW8A 5CXPA 2R7EA 3S35H 3PWJB 4WW2A 3TNMB 1G9NL 5C07B 4NI6A 1NICA 3PWPA 2A4CA 5JMRA 3UJTH 4RZCB 1R3JB 5EMYA 1N64H 1I3VA 4LCWE 5B21A 3BZFB 1GOGA 2WBKA 5F44A 4GKNA 2Q86B 3HKFA 4L3ED 3HG0A 3NCXA 1LD9A 3ARFC 5IM7A 4WWKA 1WAAA 4WFFE 5AB9A 1YEKL 5BV7B 2V5YA 3EYUL 2ZSVA 4OZIF 4ZTEA 4RGNB 4AZ8B 1IO4C 1HKLL 1K8DB 4FF9A 4P3DA 2X89D 2AJ3A 4PB0H 4L8BA 4OIIH 4XC3L 1U8HA 3A47A 3N04A 2I24N 2UZXA 4UM8A 1WCBA 3Q5YA 1F4WL 2LVCA 3B1TA 5F6IB 2NT0A 1CU4H 5C0FB 5I5MA 4A6YL 3SPHA 5C0JB 3GSQB 3GXDA 1RHHB 3T1FA 1EA9C 2GJRA 1ZVHA 4YC2B 4ISVA 2FWOB 2H0JA 1F2XK 3ZKSD 4WI7A 3MLSH 4F33B 3FSVA 3TC9A 1GS6X 3MVSA 4WTXA 2FL5A 1WP6A 3I2CH 1DO5A 3D34A 4LLWB 1U8LB 3IU3B 2MTPA 3BVVA 1N10A 1PZBA 4R7DA 5CSBA 3BQUB 2E6PA 5FXCH 4QNPF 2RCSL 1YECH 2OQJB 3QEGL 3S37H 4XH2B 4FZEL 1ZVYA 4D9RE 4BINA 1Y0LB 3MRCA 4Z7QE 3UTTA 3DV4A 5DD5L 2YMXH 3UO8B 4B5ZA 4HUUB 4PU2A 1F5WA 5B1JC 1BREA 1QOKA 4PD4J 1T0PB 3MBEA 4KPHL 1AFVH 3H2PA 2AK4D 1KXTB 1ZMYA 4ZXBD 3BVNA 3WUWG 4L3FA 4A68A 1PFCA 5T1KD 5K1JA 4AYSA 1F4YH 5DUPH 3SO3B 3LEVH 4L29B 5E2UL 5K9OA 1LJMA 4OFIA 3QZWG 4A7QA 1VKXA 3SBWC 2EIJB 2L04A 5DVMA 2CRMA 1NPNA 4K3DH 1LLAA 5CCHE 1NFDE 5AD0A 5FB8A 4LGPB 2Q7YA 2BHZA 2CCWA 4WI9A 2Z65C 4G8GB 5J6HB 3L2LA 3MTXA 1XGUB 4IIQA 4GIPD 1YEIL 2IWKA 4HJUA 2X4TB 3N55A 2FQGA 4K15A 3I84A 3HUJA 3MRDB 4JKPL 2XA3A 3BP4A 5FO9B 3PP3K 3IMBA 2B39A 4S1RL 3RDTC 1ODUA 4D3CL 2CUIA 3GMNB 1J87A 1UWEH 3DIVA 2N7BA 4X83A 3NT0A 1M53A 4PTTB 2NNXA 4LSTH 4IKJA 4PBDA 5DK2B 4QRSA 5ESAB 5KBMA 3WFBH 3BH9B 3LZQA 4QRQB 3TN0B 3WMSA 3SDXA 3U0TA 4PJ7F 3IAPA 4IRSB 2EQDA 5EF0A 1S7UA 5DFAA 1YN7A 1U41A 4G42B 1KPRA 1NCCH 4KXCA 4J3BA 3Q6GL 3KJ6H 1CIUA 2P47B 4YDIH 1RJCA 4PJ9D 2VAJA 1ICTA 1UA6L 2BH0A 3P0VH 2MHAB 5AG8A 3HBPA 1JCVA 4G2AA 2VLMD 3L17A 3QIBA 5MERB 3KLQA 3MRFA 1FIGH 1I3GH 3ZDYE 4B50A 4N8UA 4LU5L 1TJXA 5E8OA 1A4AA 3M1BB 5EPMA 1H3TA 4WUUB 3CFIC 1E5YA 3C5SB 5B38G 4FQ2H 3HI5L 2NY4D 2OL3L 2YUXA 3HR5B 4XMLH 1A8ZA 3QEQE 1DVSA 5MENB 4M4PA 2HJLA 3C5ZA 1ADWA 1BDYA 5EBLB 4W6XB 1HI6B 3ESNA 3DUSB 5C08D 1ESOA 2DLFH 5I76A 5IB2A 5BMFL 3MROA 4MDRA 2FB4H 1AP2B 2D4DA 1KBBA 1A22B 1KB5L 3MLZH 3SYPA 1JZ6A 1BLIA 4I87A 4Y4HD 2WZAA 1GYVA 3QNYA 5DZPA 1L7IH 4NWUL 1TSRA 2VDKB 1A6TA 4E0RA 3FU8A 3HPLB 3MLTA 2VDRH 3VDCA 4F1SA 4OZHA 5FECB 1SLUA 3GC3A 2CKBB 2PXYB 4A55A 1X5GA 3V0WH 2V2TB 3MCLL 5B1CA 1QHPA 2XWXA 1JV5A 3BEVA 1YG9A 3KVQA 3HN3A 4QRFA 5J3HD 2IH3A 1A9BB 1TNNA 1NGZA 3DXAE 3ZKQD 4M3JA 3VDAA 2OK0L 5CCKL 4KZDL 4TVPE 1I4FB 3NJHA 2YBRB 4X6EB 2FUQA 2PPFA 2R0LL 5I74B 1GC1H 4HLZG 5BUPA 4HV8B 3DVIA 3NABH 1MHHA 2VZSA 5ESVB 1U4EA 2OMVA 1IC5H 4DZBB 2F61A 3C6LA 1AVAA 3ZE2E 3RL1B 1R5VB 2EXTA 4F2MA 1FZKB 1BCIA 1WA0X 1QRNA 4G80B 2OCJA 1G5GA 1RK1B 2X53A 5IVXB 1PKQB 3LIZA 1U30A 1H3XA 3JUYA 3QI9A 4AV5A 2BFVH 2PYEA 2WTRA 3FT1A 2FLMA 4Y5VC 4B0MB 1NFKA 3QH3B 4G8AC 5FO7A 4N25A 4ZFZB 2UVFA 2X87A 1TXKA 4I0PA 4CDHA 3A6OA 4PRAB 3ARYA 5AYQA 1MSPA 2AEIT 3L3IA 5DK0A 4D9QD 5DQJB 5LN4A 3WFDH 3WS3B 2EEXA 1ZK9A 2MOQA 3GSNA 4FLSA 4OSUL 5DHVA 2NY1D 4YHNA 2VM9A 4P9ML 2GUOA 1SY6A 4JBSA 4HS3B 3RWCB 2ESVE 4WW1B 4UM9D 5E8PA 1M6OB 4NLAA 3ALPA 1VADB 5KVGL 2A83B 1R75A 1SJEA 4I3RL 4DP1X 3BDBA 1EGJH 5B39B 1F90H 2XN9D 3S34L 4NQEE 2BSEA 1XWVA 5F9JA 3KGRA 4HJGB 3MXWL 4QJ5B 4W9JC 4HQQH 3QO0A 1AD0B 2AERT 4LBEA 2IBBA 1NLBH 1N0LA 4TSAL 3GLEA 4IDLA 4NQDD 4HF5L 3MV11 3KXFB 1CN4A 1U0QA 5I0WA 2CK0H 1AHWB 3P4MB 5GRYA 3SDYL 1YPZE 3IGUA 4DGIH 4GKOA 2WVVB 2DWEB 5E2WL 4QRPA 3UIZA 2BHFA 2MNWA 3GRWA 2G4GA 3AWGA 3S88L 5B8CC 4Y5XA 4LNVA 4ZX4A 5KSAC 1DSYA 1RK0A 3WELA 1HYSC 3P4LA 3QARA 1RZIA 2CXGA 4QCIA 5JUEL 3VXSB 1HIML 4N2FA 4PJIE 4QDGA 4RCAA 1U8QA 1AY1H 3T4YA 4PSRA 3VGBA 3X1BA 1WF5A 1EO8H 1B4LA 2YSSA 1XH1A 1EHLL 3IRPX 4JQXC 5I30H 2F68X 5ETUB 4L5FL 5EEWA 3G04B 1CFSB 3FUKA 3DX6A 4MCYB 4LCWA 2EE0A 4NX0A 4WLCA 1OWWA 4KXAA 2LOEA 4JY4A 2VJXA 1XGTB 5C0BB 3AC0A 5B4MD 3QA3B 4FA8A 1XZ0A 1JHTB 1REIA 1F8TL 1RP9A 1LEGA 2APSA 3M1OA 4HMDA 1SHWA 1H8OA 4TUKL 2QDWA 1IBHA 3UTSD 2CLVA 2ETWA 5DLML 5FKAA 1J1PL 4PRIB 3F7QA 3PG2A 5B7EA 5EOCH 2JJWA 5C09A 1D9KA 1XB6A 1BJ8A 1VFBA 1OB1B 1UJ3C 2ZNWA 1R33A 3OKDB 1HSAB 1NPUA 5A3ID 3BD3A 1KCRL 2VXQA 4PV8A 4EDXA 1DP0A 3IXTB 4TV3A 2VDPB 1SJHB 3G5VA 5F21B 3BPOC 4I88A 1JFQL 3RZWA 4PBWD 2W65A 3UC0L 3X17A 1HEZB 3KGUA 1H3PL 3UO1L 3ARED 5CILH 4M3KB 3UERA 4N2IA 3VRLF 1MRCH 4LESA 3O3DA 1QSZA 2M8XA 3T3ME 3MYZA 4GW1B 2Y1AA 2R0WL 4MAYB 2QVKA 5IHBA 4E9TA 2EVHA 1FVCB 2GKIA 1KEML 5INCB 3T08A 1ACCA 5KVFH 3IE4A 4H26B 2CO3A 2WCSA 4G82A 2YQ3A 1MAJA 2ZF8A 2CJUL 2X4PA 4QHLB 1JGLL 3UBHA 4A2MA 4UT6H 4XP5L 5HYSG 3SKUD 3EZJB 5T1MB 1NCAL 4EIGB 1NMAL 3QUZB 5E8DL 4NDMA 4L9LC 3CBRA 3ZE1F 1UCTA 3N0PB 2EIBA 1NKRA 2Z8WC 3BYYA 5E94A 4I2XB 2Y23A 3IDNB 4GI8A 3QJVB 5D93B 1EAQA 5MEPB 4N86A 3JVFC 4YO0B 3ESPA 2EIEA 3V5HB 1FFQA 2ZUQC 4BZ1L 4QRRD 4ICWA 4WSJA 5F3HB 5I18H 5KWYC 1VPOL 3GSOB 3T0XA 2PO6C 4GKSB 3LHAA 2VITB 5TD4A 1FPTH 5ABDE 3QQ3A 4NS0A 1X5ZA 1CZ8L 1OLZA 4EZMA 3S9DB 4PGBB 5CZXD 1Z9NA 3QZPA 4XZUA 3QUXC 5DD0L 4ATWA 4HG4K 4LT7A 5DD1H 12E8L 2FNBA 5DFTA 1OY3B 3G6JB 5TQ2L 2CO7A 3NIGB 1HHIB 1ZD6A 3LTVA 4N22A 5A16B 1GHFH 1UM5H 1UWGH 2F58H 4KUZL 3L3KA 3LKQA 1R46A 4M61B 2EILB 3APCA 1DHKA 2IG2L 3KAAA 4WKZB 2PW1A 3WEOA 2ZCLH 4QPEA 1JMZA 1TEGA 2HLFC 2XFGB 1FNHA 2VN4A 4E41E 4YS4A 4IHBA 1SHMA 3RIKA 1AXSA 2E7MA 1N0XL 3ATBA 3EGDA 2MCG1 2EIKB 3K2KA 3O45B 3L48A 3CVDA 3D85B 4NHUA 1A7PL 4XI5D 5F7DB 1E42A 4Y16C 1ZV2A 5IW1B 3DIFA 2NY2C 3QEQA 1QLEB 3PV7A 4KOBA 2HG0A 1BSIA 4M4RA 1JNHA 2JJTC 4CVZB 1J8HD 2D7PA 3KHQA 1KJMB 1M57B 3LN5A 1S7WA 4FQJL 5KUKA 1T7VA 2ZIDA 2ID5A 2VQ4A 3H54A 4OUUB 1U8NB 3E80A 1CDYA 2G2NA 4UTAH 1EMTH 3Q3GB 4X5WB 2BRRH 4E5XB 6FABL 3EYFA 1M7DB 2EDRA 5LLIC 1P1VA 5FYLE 3LIUA 1S7VB 4G1MB 2Z64C 3R7RA 5DHXB 2VDOL 4YDJA 4YHOL 3TBBA 1RIHL 2AP2A 2TSAA 3DXAA 4RRPG 1KYFA 1V7MH 3V4UH 1KMGA 2B2XL 1S3KL 2FD6L 2LR4A 1JXDA 1ZA6A 2NY0D 5DJDB 3UG5A 5KBNC 1WT5C 1WC7B 5GQBA 4BIKA 3IFLL 4XMKH 2VR5A 1OEZW 2R1WB 4PGDB 5GGUA 4FXGA 1V3LA 3US9A 2VISB 4XT1C 5ELIA 4OLXL 1OGAE 3PLYA 4HWEH 2F8IA 1XCQA 4WI6A 2WGNB 1AS8A 4TNWF 3VGGA 4B9GA 5BRPA 1PAZA 1BD2E 3CXHK 2Y6SD 5F6HJ 4NT6B 1FZOA 4IQHA 2B59A 1TLMA 4DKFH 3NH7H 1BBDH 1GGBH 3MRKA 4YFEA 1NOLA 3NCEB 3TV3L 4JM2B 5EEVA 1BEXA 1C5BL 3FU0A 4HYTB 4R4BB 1ED3B 3IFOB 4XNZB 3UPCA 1ZT7B 3FAWA 2ZOLB 5IQ9B 2Y24A 4R2GD 4WWID 5GZNA 1MI5D 4WGWB 4X7TB 3TOPA 1JTTA 2VRKA 3U7WL 1XIWB 1USZA 2D0GA 4L4VE 1J88A 2ESVA 3DVGB 3KPOB 2VZ3A 4MXVE 4GSRA 4Y9FA 5CU5A 2E27H 2VZTA 3WBDA 4NQEA 1IFHH 2Q6WB 4JO3L 1OSYA 2HT2D 1G0XA 1C16A 3ALXA 4OF3A 2PUQT 5ICZB 1CIDA 4N0RA 1FFTB 1IKNA 2WY3B 4WQOA 1QWUA 3LB6D 2J7LA 3VI4E 5DJYA 3WSQH 2YGVA 5I1CL 3DURA 2XN2A 4B97A 1AC0A 4LLQB 1YPZA 1SEBA 1S9WA 1E5UI 2GY5A 2WZ5A 3FBQA 1L0PA 3OKYA 4KKCC 4YDKH 4OTXH 4PJ8B 4HWBA 4OV6F 2AAAA 4LKXA 1QSFD 1GGIL 3EG9A 4P46B 2XPGA 1GW6A 1VFUA 1CGUA 1XL4A 3A67L 4GIAA 1GS7A 1LO3H 1UOVA 4M7ZC 4N2EA 3ZE0F 4OGYL 3VG0H 3L5WA 1T5XA 3DBXA 3OX8B 1KCKA 3K7UA 3CQQA 1RIVL 4HIEA 4RWYL 5I6OA 4Z76B 2MPAH 1NINA 1XTMA 1V3KA 4PBXA 3H1ZA 1FRGH 4MJ6B 2EE3A 4MQTB 4ZOCA 5TH2B 4R8WH 3RPIA 2VIRA 3HNTH 2J6EH 2YAFA 3HHMA 3QDGE 4EN3B 2BW4A 2K70A 3NFNA 2YK1H 1I85C 5DRNA 3TZVB 1BZQK 3MV7B 4ZD3H 2K78A 2YGQA 4GO8A 3UTQA 1JZ7A 1AO7D 4YHMH 2A4EA 4YC2C 2NX5B 3VFUB 2VC2B 1FIEA 1ZA3A 3DI2B 3E3QE 1CDGA 4B0MM 3CFKA 4RAUA 4Z0XB 1NBZB 5MHSD 1RFDL 4ZMWA 3HEIB 2VDLH 1SQ2N 3S8WA 3GRBA 3OB0K 2V17L 4B9PA 4AM0Q 2D0HA 5SX4I 1HCZA 3MCG1 4OBSA 5CJQL 1IARB 2ZAGA 3QORB 5DJ6B 1EXUB 4P2CG 5HJ3A 1UVQA 3J7HA 1E6OH 3WJJA 5AUMA 1UCBH 5ESQA 4DN4L 3H4FA 5KYYB 1JZ3A 3FB5A 2WYZA 4FFTA 1QFWI 4MZIA 4ZX5A 1ZS2A 1U8IA 2WNWA 1X5AA 3KYMB 5D1QC 3C87A 3ECUA 1GPOH 4P2RE 2C9VA 4IW4C 1OQXA 4GAJH 3AGWA 4QTIH 1M7UA 2Y22A 1N5YL 4MLIA 4QRAA 5IF0A 3KW7A 2VRQA 1TNMA 4HC1H 3ZKMC 3N85L 4MA1B 3G5ZB 1QFUH 3QFJE 4FQXA 4DO6A 3REWA 4NOFA 2VLKD 2BX5A 1MDTA 2DY2A 1MRDL 1BMZA 3K6OA 5J9PB 3QHTC 1SLXA 1V10A 4LCYA 3VH8A 5EV7A 4OZGB 1D2OA 4Z7OB 1Z0NA 2CALA 5CBAA 2HFGL 4NKOA 5DMKA 2J3SA 1JP5A 4TNFA 3TN0C 3GJFH 3S37X 4IRSC 4CKQA 3BAIA 1N2RB 2APXA 2NY7L 2Z7ZA 2ZKHH 1DLFL 4ADJA 3LKOB 2ENJA 2Z91A 4G7RB 2Z7YA 2A9CA 5HY9A 2YPKA 2WW8A 5JXED 2P5WB 1LE9B 3QFDB 3PUUA 4M8RA 3T2LA 3AVEA 4WFEE 4F20A 3OKKA 5IV2B 4HEPA 3UH8A 3BCFA 3JWOC 4MB1A 3MJ9L 1SNRA 4KKLD 4H25B 5GISL 4FKEA 4KI5C 5DLLA 4PJAF 5C0CB 3ULVC 2EKJA 3WN6A 1U8MB 4Y1AD 4E41A 1U8CA 1HYRC 2IC2A 4UIMB 1OAXH 1NCWL 1SEQH 3LKSB 1DZBA 3NZUA 1ONQB 4Z7UF 1AMXA 1DFBL 1WA1X 1LQSR 3D48R 3PQYE 3QC6X 3CFBB 4JO4H 4ODUB 7FABL 5MI0C 4PRBB 2PR4H 5CWSB 2GJ6B 3BN9D 4U6HB 4K3JH 2F8XC 4X6DB 4L23A 5I17A 5DYFA 1F0LA 3EGXA 2RHEA 4G72B 3W9DB 1TVHB 3IDGB 3V0EA 3NMEA 2PXYC 4EZKA 2YQGA 4HSQA 4GNKB 1NCJA 2ZICA 1Q9LA 1RJZB 4M48H 5C6WH 5I1LB 3A6BH 1XVSA 1XHHA 1A3LL 1UXWB 1CXLA 4GAAA 4HUVA 4HXAL 4XVUC 4OIAA 4JFXB 2OR9L 4QLWA 5BZWA 2ZZUT 3DRTB 1AXTH 5FFOA 5TQ0L 1OCOB 2NW3A 5JTWA 2D9QB 1WYJA 2BO0A 3BUQA 3D09A 1ZPUA 3EJPA 3NRPA 3H0TB 3DMMD 1T04B 2IGLA 1T3FA 2MPVA 3L1OH 1J9RA 1PIGA 4NQVA 2P4AB 2XZZA 1K6QL 3KPLA 5HDQH 3W39A 5E9DD 3S36L 5L9DL 3WO3B 1YNKH 5ACZB 4R97C 4GO6B 1MIEH 2P5EA 3N50A 5HBBA 5AW0B 4D0CB 4P99A 3T5WA 3WL9B 1QR1A 5AYUL 4MD4A 4BDVA 2HLAA 4YNYB 3I75B 4MCNA 4JGJA 1QFWH 4FLRA 3V4VH 4CU6A 2H2PC 4L37B 1DLHB 4FQ1H 3FQUB 1JPSH 1U3NA 4Q4EA 1J1XH 1A2YB 1NM4A 3V9EA 2ZOKA 1JUFA 1WFOA 5SWZE 3TIDA 1AOZA 5D8JH 2CA4A 3HHSA 4NUJB 1OGAA 2BP8B 3ZDZF 1PZ5B 3OV6A 1LILA 1G6RA 3UJJH 5BOZG 2JLLA 4ODXA 1JWUA 2DMKA 4FXKA 1BD2A 1KLUA 1TT6A 2IAND 4KK8C 4HK0A 4XMWA 3VD4A 3B9DA 3HCVB 1EJ8A 1G7QA 1KXVA 2NZ9C 3ARPA 4AUUA 2QQLH 2HVJA 1GH7A 3JV5A 4LZKA 3VRIB 4OD3H 2KUTA 2QR0A 3FAXA 1DBKL 4NXKA 3UCQA 5I66A 1DL7L 1GGCH 5DTFA 1Q9OA 1RQ5A 2BMKA 4H2AA 1W72L 3NN8A 4ZOEA 4L4VA 3H2QA 1P84J 1AHWC 1MFAL 4MJJA 4AQAB 1CD0A 4ELKB 2BK8A 3NTCL 4JDEA 5LAXA 5A40E 4CRPA 2YA2A 4XNBA 2AQPA 2XU9A 3RQ3A 1MW1A 1JK9B 4G8EB 1DBAL 1QQDB 3GQFA 5EB9A 3D69A 1IV8A 4MYPA 1NIBA 4MNHA 1IGIL 3VI4A 1IKFH 4GAGL 4M7LT 4QWWD 3TEWA 3RGVA 1H5BB 4NUGH 2X1PA 4C4UA 1PYWA 2QV2A 1KJ2B 3HMWL 3BEWA 3KYOB 4X4YA 3VXTB 4HJJL 4JRYD 5HYIA 2Z93B 1N9PA 1PLBA 2JCCA 3SQBA 4MDJA 2WNGA 2KC0A 3HHRB 1P6WA 3BXNA 2FE0A 2VR7A 3L4UA 4I9WE 1FVEB 3ZTNH 1L4IA 1PGRB 2XWDA 1IJ9A 5CINL 3U9PH 3GJEB 2WK2A 1JF5A 1XGRB 1OSPL 3O9WB 3AQYA 4PRPB 4RMSA 3BQVA 1W0WB 4Y2DA 4HX1B 3GBNL 3KW8A 1AGEA 1B0RB 4PJEE 1UM6L 1MF2H 3UZVB 2G9HB 3OJVC 3PUCA 5AVXB 3TIEB 3D2TA 2PLTA 1AYOA 3VWKA 4OCWH 2WXOA 3IJSB 4XP6L 4PW9A 4XCFH 3O0LA 5D6DA 2APTA 2X2IA 4FTVE 5IFJB 3D0VA 2EDNA 1MW3A 3O8XC 3D30A 2D8KA 5GJSL 1YJDC 4HIXL 3MNVA 2BSTA 3MFFB 2AQ1A 3OLGA 4EOWL 1PVHA 1NCBL 4AQEB 1HXYB 1NC4D 1KCSH 5F7AA 3TJHC 1AJ7H 3B5HA 4JGNA 2KI6A 3HPJB 1UEMA 3SGKA 2BNRE 3MLWH 4OGXL 3HN5A 1FYHB 4EVNA 2VLLB 3VXNB 3K2MC 2YD8A 3FH7A 3QG6A 3ZYZA 2AEPL 2YPLE 4HCRL 5IEKA 1N8OE 5J11C 1W15A 3LEYL 5DGRA 4JFOA 4JZJB 2VABA 3FQRA 3L3OB 3O6FC 4OCYH 1AACA 2DQHL 1NCUA 3T0ED 4MMXA 3HE7A 2J2ZA 4HLEA 4IMKC 5F9OL 3ESOA 4H20L 1NBQA 3AXLB 3ULUL 1JOIA 5D93C 2LU3A 3V4LA 4XPAL 2GK0B 4B6ZA 1XR8B 3MUHL 2N01B 1D7DA 4IRJD 3TX4A 5F7EH 1MW2A 3PP3H 2P80A 4N68A 3WGUB 1MFCH 2OW7A 2ATPB 3PHSA 3U46B 3S96B 3WY1A 5HHMD 4YXLH 4LVOC 2XZCH 3MNDA 4XX5A 3GMQA 5GRUL 5IHZB 4P57A 2EYRA 5DUML 1Y6KR 4NLHA 1KG0A 2CRIA 2PP7A 5LG1A 1QMUA 2GTWB 4JO2H 4F7KA 2OSLB 2XY2A 5EN2B 5HGDA 5IROA 2QHLA 3SQOL 4TUJB 5HYJB 5EEXA 1YUHB 4IRZH 2CE6A 4U6XA 2DYPA 3WG7B 1AR2A 1YEDA 3HNSL 5F88B 3JWDL 1MCOL 4F9LA 1UWFA 3K1KC 4O02B 3L9RA 2VXUL 1WPCA 1CDBA 3VU1A 5IQMA 2PPCA 3G6AA 4F5CE 4MAUL 3T3PE 1YN6B 1KFAH 3UAJD 5EIIA 3QHZH 4L3EE 4PJDB 4P59H 4JFEB 1M05A 2QSCL 4C56D 2WQ8A 2BIIA 2CSPA 2YMOA 2ZWYA 4LSDA 3MREB 1KBGL 1B2YA 2GY7B 3BZ4A 3WFEL 1ET8A 4DVBA 4DK3A 2ZOUA 4FE9A 5GGVH 4ZUVA 5AZUA 4GG8B 5L4JA 5E08H 4XOBA 2VLRD 1FGNL 4AIEA 3CIAA 2X4RB 5JPNC 4NOBA 1RU9H 2JE8A 1KLFB 1YEFL 2ZKMX 4X8JB 2AJXL 3K72A 1GOFA 3MV8B 5F8RC 4BZYA 3RVWC 3S4SA 3PQYA 4H1LH 4BGDA 3CFTA 3QZNA 4YHKH 2P24B 1AH1A 4NPYA 3VCLA 1DBML 3VM7A 3VH8G 3L5XH 3BIBX 2C3VB 4Z8FL 1HZLA 5JO5A 5GGSY 1S7RA 4OR1A 5HVFB 3O3AA 5CP7B 3EADA 1X5XA 3DVNA 4NHCH 1LEKB 1ETA1 4BFOA 3ZY7A 1GTNA 3HZYB 5EFIA 2DQCH 4P9HC 4JANB 2WN2A 2GAZB 4BFRA 1ZEAL 2KYIA 43C9B 4HIQA 3BLPX 1TENA 1BJ1H 1X4ZA 4LEEA 2E4TA 2AK4E 4NZTL 5DURB 4ZS6C 2GUYA 2ZSWB 3MNZB 5IBTL 2CDFB 1OTUC 4OLZL 1NLDH 5MEOA 4XCYB 1FV1B 3RWEA 3QJFA 1PEZA 3H3PH 5BV7L 3MLRH 3EYSL 4GW5B 1XGPB 5D7JB 1BX2A 5KYUA 5E99L 4CA4A 1I9JL 3NJVA 4WWKC 2ERJC 2DOCA 3FFOA 5KTEH 4LHJB 1IM9D 3GMLA 2CIKB 2ICEA 3P2BA 2YFNA 4Y9BA 5D2LB 2IPUG 4TNWK 5TF1H 4DP4X 4L1BA 1BPVA 4DUWA 1XL6A 4PWKA 3ZMNA 1CL7L 2XA8H 5CSZA 4JM2C 2YOCA 5EU6D 2A9ML 3ROLA 3UACA 1CFNB 4PEEA 4TYUA 3NPSB 4MA3A 5EORH 3CSGA 3WIHA 4XNZC 3MXVL 2G5UA 3C8HA 2YRPA 5K1NA 3OWRA 4JN2A 3B3BA 1A5FL 1ET5A 1XIWC 5DI8A 3DA0A 3S2CA 3SN6N 1CFTB 1J86A 3TYFA 1DQDH 3RKDC 2VMFA 3KYNA 2JJUA 3FTXA 1RZKH 4NO0B 2EO9A 1H9VA 4WHTB 4X4XB 2XYBA 2Y07H 2Q8BL 1BQUA 3EO0B 1B6UA 1PLGL 4LNRB 3ARBB 3R0NA 2VLME 5IW6A 4XNMB 4AQZA 2R27A 2X2YA 4OI9A 3TNNB 4ANUA 4GIOA 2XKNB 3WKMH 3SDCB 1BVLA 4AEFA 1XR9A 1A3ZA 2Z0UA 3BJ91 4LFHD 4PJHB 4PCKA 3VSQA 2N7SA 4X6FA 1YDPB 4JG1H 2WZPA 4NZRL 5I8OH 1A65A 2H6UA 4NEHB 1NAKH 5C0NC 1KJVB 1NL0H 1BAFH 5C08E 1MUJA 5BZZA 1CI5A 5KS9F 4BH8B 1GVIA 1G7LA 4HZAA 3HC0A 3UZQB 3E9TA 2C1OB 2IOMA 3G5XB 1YJDH 5DQ9A 3UEZA 4NC2B 1E4XI 1A3RL 1EQWA 3BW9B 1KELL 3QRGH 4LRIC 3RIAK 1IVTA 4R7LA 4XGZA 3LNIA 2JNZA 1JGDA 4WI2A 3S36X 4APXA 3IU4H 4FFYH 2GT9B 5D7HA 1SMDA 3VXQB 1NFIB 1AGBB 3WKNA 3P4OA 2MSPA 2ZJSL 3KG5A 5D1XA 3V5DB 3F64A 3NIFE 1UZ6E 3GKZA 3NA9H 1FNEA 2GC7C 4HJ0C 4NO5A 1JWSA 1KUMA 1O7DC 2COVD 4FQLH 3T65A 4XB8A 4NIKB 1IAII 5DEGB 4FQIL 2PMZA 1TYEB 2KZBA 2P8MA 3X3FL 3AT0A 4FJ6A 5ALBH 1JF1A 2QKIC 4LIQH 1XH3B 4Y19D 3TURA 1U58B 1UKTA 3GXMA 4AE1A 4AI7A 2EVGA 1I1RA 5D7KD 2IAAC 2PP8A 1BWWA 1H3WM 1WBYA 2FBOJ 5DR5H 4ODTL 5D72H 4KO6A 4JHUA 1AQDB 5BRZD 2O26U 2VNCA 3LEXB 3JWOL 1OP5K 2PCPB 3NRQA 3HKZA 4FTVA 1XF2B 3EW3B 4QXTB 4PJ6A 1A7NL 3QQDA 5I24A 1LTXA 4K8RL 4GG6F 4K94C 3S5YA 2GG1A 4ZUWA 4FNLH 2I7OA 4OB5L 5KJ7E 4BCYA 4MS8D 1NGXB 1L3NA 3QIWB 4PB9L 3WFCH 4N6QA 5CN3A 5J57B 2XTJB 4KVCL 3C5ZC 1EJOH 2AXFB 4FMFA 4PJ7E 5EWIH 4D9QE 4XPFL 4ZNEE 3RFZB 5T3ZE 3ULUF 4XHQA 4TL5A 5J1AA 1G7IB 4HSCX 2P8PA 3I6LD 1NBVH 3SO5A 1HHHA 2VDKL 3C8KA 4J3OC 5E5LA 1CYXA 4U4BA 1HL8A 4HAKA 1G9MC 2XN9E 1ZIAA 2CKBL 3BE1L 4FNRA 4P8QA 5EHFA 4MXQC 4KK6C 4YGVA 1C1EL 1XTLA 2X6CA 4NP4H 5KN5B 4MCZA 2G5BA 2HT3C 1MIML 4HJTA 1EEZB 4MASA 3BAEL 3FTGB 2B14A 1FO0B 2EINB 4NQDE 3ETBJ 4PTUA 3V8OA 5FDYA 1ECZA 4M7LH 3JTTA 4MAZA 1Q9KB 4YFDB 2YC1B 3H55A 4YXHH 2KZ1B 4FG6C 2OZ4H 3TA3A 1IGJA 2FSEB 3MOBH 3QZLA 2XTLA 5D1ZD 5INDA 4Y5YB 2WQVA 4ELMF 2UXVA 3UP1A 1CGWA 1QA9A 5KS9A 5IZ7A 3E8UL 3VFVA 2AHIA 1FVDB 3ZO0A 2GBUA 1TVBA 3DSNB 5DDHB 1IL1B 3FT4A 3V7AG 1T6VN 1YHPA 2EP6A 1S7QA 2GCYA 3C6LC 5IT2H 1E6JL 5ALCL 1UOLA 3AADB 3QUMH 4OZ4B 5CZRA 2HH0H 1Q94A 4F5CA 4XPGH 4CC4A 4NNPL 4L3EA 4JFHD 3OAUL 2CJTA 4XNXL 2F7QA 1E4XH 3QC5X 1X7QB 4BSWB 4F7TA 2EUWA 3UTSE 3FCUB 1XCWA 3BUDA 3OL2A 4XPBL 5AVSB 2P46B 1ORQA 2HN7B 3JWNH 5IOKA 2HLFD 4NO3A 5JW5A 2A74C 4KXZI 4JO1L 2HKHL 3A6CL 2CUHA 4W9GC 5SWQA 1BFVL 3J2PA 4L8CA 5AVYB 1OCWH 4N0FA 1IGTA 1TJGH 3FOMB 1Q0YH 1HSBA 5DGQA 1HCFX 4F7MA 1IAIH 4JY5H 3HOGA 1S5HB 3QBTB 4Q89A 4WO4D 2JWYA 4FG2A 4X0NA 4Z7AA 5GS2H 1NCNA 1SXZA 1XB8A 4HISA 4Y16D 2PP9A 2E6QA 3KCWA 1GGUA 3IWVA 4MJ5B 3UCRA 5IMMB 2O30A 3MRBA 2DMBA 1KIRA 2GPZA 2AEQH 4GFXA 4AMKL 5F0MB 2HFEA 4LMQI 3QJOA 4JCLA 3IDJB 5T1LB 4HALA 4MHHG 3X13A 3DJZA 2P48B 4M1GH 3N3EA 4F15C 5IFAH 4NZJA 1JK8A 2D2OA 4FCAA 3ULUD 1PAMA 3P9WB 3WEXB 5HGBA 2KH2B 4MNQD 1F13A 2BZDA 2EICA 2Y2YA 3ES6A 4OLWH 3TT1L 1EAOA 1U3HD 3WMQA 2JKSA 4ZMYA 2P52A 5F97E 1CDHA 2Y06L 1VB9A 3BHBB 4YZWA 5AW4B 4G5ZH 4YLBA 1LYQA 2AK4A 4ZXBA 4ANVA 1R0AH 2NNAA 1IGFH 3OKEA 4JG0H 2ISDA 5T1KA 1INEL 2FQDA 1OF0A 3SYOA 4Z7VB 4NRYB 1Z0MA 2QMJA 3FT3A 4X7DC 3UYPB 4X5XA 4PRHB 1C7TA 1A4JB 2AMGA 3AM8A 4WWPA 3MODL 3IKCB 4MJID 5D2NB 4QRRE 4ETQB 5D5MF 1N59A 4ZX6A 2C9XA 2HUEA 5I0XA 1J9CT 1MFUA 1DN0A 2R1YA 3W5NA 1MAML 3FO0H 2ZP9A 2OA9A 1UGNA 3CN4A 2VDPL 3EDFA 1NBYA 1DBJL 5HYQB 1NM9A 2MCPH 3MPCA 2HLEB 3BP5B 4PS4H 2X4OA 4N4YB 5I19L 3SODB 1RZJC 1NAMA 2B0SH 2APBA 3QPXH 1OARL 1MRFL 1EVUA 2PABA 4ONHA 3O2DH 1FI8C 1RVFH 4K23H 2D31B 4YPJA 3CC5B 4V1DD 5LWYL 4OT1H 1W0VB 4R26H 2QVMA 1DUZB 2ED9A 1BZ9B 4KXBA 4Z95H 2WQUA 4PJ9A 2C7FA 1NDMB 4TF4A 4GRWB 4JDZB 4I77H 5KOVC 2FT6A 1WVZA 3JTSB 2EE9A 2BCKB 3TT3H 4Y4KB 3STLA 5DJ0B 2AI0H 5C0DB 2WSDA 4K3EL 3K4ZA 2MOVA 2YKLL 3CG8A 4XB7A 5CGTA 2GSIB 2VERA 1H5BC 4F7PA 1H6FA 5DO2C 1O7VA 4LAQL 1P4LA 4PPTA 3EFFB 5E5MA 4PBVC 4MA8L 5AZ2L 1J8HE 3GSUA 4G7QB 4N85A 5ISZB 1G4RA 2MH4A 2E86A 2ZXDA 3VB8A 3VRLE 1YYML 4DP9X 4HD5A 4J6IA 4KXZH 4RNRA 5C07D 1FWXA 2HFTA 4Y4HA 2GSGB 4N9GA 5G5DB 3ORJA 2UWEB 4GRMA 4ZG1A 4KKCD 4OZFA 1R24B 2IJ0C 4KKRA 4ZUTB 5IW3A 3FSZA 5LBSA 3I9IA 3OHXB 4JM0A 4DQOH 3BPNB 3O9WC 1AE6H 1CC3A 1DEEA 4MZ3A 4KKZA 4K7FB 4HBCL 4YSAA 1W0YT 4OFKA 3Q44A 2CMRL 2BXZA 1UA7A 4HFWA 1HVXA 5F3BB 5EEUA 4RGND 3GNML 1LL1A 5ID0A 1ZJAA 5CLYA 5T33H 1G9MH 5I15H 2YOAA 3QHFH 8PAZA 1EZLA 1HZKA 1J8SA 5L0QB 1T1ZA 4OCSH 2C9PA 3NFSH 3SZKC 5EU4A 2VSMB 1JD7A 4JO8A 3TBTA 4RMBA 3MBXH 4UQCA 1G7PA 2JB6A 3MYJA 5L88L 1OSEA 1EJFA 4UOQA 1MPAH 1RUML 3TPUA 4PVNA 4ANKA 3U6RB 3DARA 3OMIB 2DWTA 3B7YA 4KRMB 3WUWB 4XHJD 3RPBA 1E7VA 3NFPB 4ZW7A 1OD7A 1DO6A 3THML 3QZWB 1ASQA 1BVKB 1FE8H 4K73A 1EEYA 2Y7LA 5DWUL 1QLEL 2CH8A 1ITCA 3BQUD 3HAEG 5K39A 2IGTA 2WLJA 5IMOB 4FNTA 3L3OC 4POZC 3UYOD 2XWBA 4DVRL 3ATAA 3W0WA 2BY1A 5A6LA 4XNAA 5DRXA 2OMTB 1OP3K 4XBGB 5K9QI 1QLRB 2G5RA 2NY6C 4JQVC 1I8IB 1FH5L 2Y7QA 5GGTL 1MI5E 5D4IA 4ZNEA 1ZGLB 4GEJA 3G9VA 3TS8A 2R1XB 5E23A 1FL5B 2O93L 4D0BB 4Y0GA 1JZEA 2VZOA 1UT1A 4UM9A 1A6VL 3HZVB 2Y1ZA 2WV3A 5ABZA 3C5JB 4L1LA 4OM0L 3AU1A 3MKGA 5I75C 4P5MB 3FQWA 5EO1B 4YHLL 4NENB 3P11L 4NKMA 2XN9A 4JFDB 4KNQA 4FABH 3VI3A 4DUVA 3FOLA 5E00B 1CICB 3BYTA 3DGCR 5CGYC 5DSCA 4F2EA 3SYAA 2AXGA 1RJLA 4FEMA 4G8GD 3KBPA 3T0BA 1H6UA 1M7XA 2ZKYA 3GSNH 4HIIB 4I9XA 5DHVH 4FA7B 4ZNCD 5M95B 4WU7B 3NQIA 2OMUA 4NKDA 1SY6H 4JVWA 4KY1L 3WDHA 3O11A 1MWAB 5E5RB 2BJML 4GP5B 1OGSA 3ILPA 5GZOC 4GLRI 4KNTA 1QSFE 4OJAA 2EDTA 2CJ3A 3TCTA 2VXTL 3FO9B 5B38B 1MCHA 3LS5H 3ZU8A 3R19A 2XQYG 2EUXA 5T1JA 1HH6A 5HI4C 3TN0D 4AYFB 3I6KA 4OQ1A 1D2PA 1ORSB 1UB6A 4IRSD 3VQ2C 2EYTA 1JTPA 3K6FA 1CQKA 4X6BB 1T1XA 4YHIB 4YDMA 5FUZL 5ANHA 5IMKA 4CADB 5CM1A 1QKZL 4XCEB 4HKZB 2PCFB 1JTOA 1E50A 4ZK8A 3BKMH 3FQXB 2XBDA 4DP8X 1YEHL 2Y1YA 4JQIH 1OALA 3LKRB 1S8DA 2HJKB 4L1TA 2W80C 3UTSA 4OCNC 2BNUB 3RVVC 5ICYA 3GBEA 1XEDA 2WYHA 3NZ8A 5IKCA 1AFVL 3WIIH 1ADQA 3KZ8A 3QEUA 5MEND 4K8RD 5C2BL 5GZNC 4ALAL 1OTTC 1N18A 4X6CF 2BY3A 3SE8H 2GBAA 4YUEH 1SOSA 5EEZA 5CKGA 4ENED 2X4NB 3LZLA 4P4KB 3MOAH 5CBEB 2H8PB 4A2GA 4UAOB 4K3DL 5F0LB 1AQKL 2ZG3A 4GI6A 4Z0BH 3HC3H 2OP4H 1PSKL 3AREA 3B43A 3KPQB 1CFBA 2X1WL 4LE8A 3SE4C 3BP6A 1T89C 5KVGE 3KPMB 1OIOA 3VDBA 4MZRA 1RMFH 4N3TA 4MWFB 3EFOB 5DMIL 2VXQH 1CT8A 2PXYD 2ZNXA 3HMXA 4OJFH 5K9JH 1ZLDA 2FJFA 4EI5B 1KDJA 3DJSA 5BO1L 4O2FB 4TQHA 3IF1A 3M7OA 1A9EB 2IPKA 5I1HL 4XVUD 4A2EA 3WFBL 4PJ5B 1MCSA 3L9EA 3QRLA 5JHDB 1FH2A 4ONFH 3VGAB 1I7TA 4QTHB 2R0ZH 4MJ2A 1YEJH 5ITFA 3SCMC 2R0KH 3EYOB 5A2KH 3CC1A 4G43A 4BUHA 2D03L 3AWEA 3Q5OA 2HG5B 1DQTA 2FECL 3KJ6L 2VL5B 2VLKE 4ZJ9A 1AZNA 1HXMB 2J21A 4FRWA 1ODAA 4LAJH 4IOIB 2Z35A 4NBXB 4JZNB 4NCC1 3GMRA 2XQYK 4U1MA 2BVQB 5IMLB 4XP1L 4HJIA 4CVXA 2O5XH 4PCTA 3KLSA 1S7XA 4AEEA 4L5FE 4KQ4H 2VC2L 4QRRA 3TBWA 3B5GA 4G6FB 2D3LA 5I1AB 2R4RH 5DCCA 1B0IA 4HAFA 4PJFB 3KPSB 2J43A 4RH4A 3RIFF 3FPYA 4PYHA 4XN7A 5IG7B 3FT2A 2A9NL 1VJSA 3FO2B 1W2KT 3V0VA 5TE4L 1UT9A 3SDDB 2MTAA 4GKZA 4NM4H 3LRSB 15C8L 1S7TA 4TLTA 1MY7A 3HJ0A 4ZUUA 5C7ZA 2XNAA 5I6XB 4R3SB 1BQLL 2FX8H 3CLWA 1UD4A 5HGAA 4GLRH 1QW8A 1QBLL 1WDAA 5GGVY 3QDMB 4FQHB 4K94L 3F84A 3QEHA 4UZGA 3LJ3A 4HUXA 1GZQA 4Y1AE 1NCTA 4FHKA 2AAVA 4MYWB 4JREC 4PMFA 4A6YA 4APQB 4M1DH 4C83A 4AJVA 5ID1B 1FAKT 1T0MA 1TZIB 4GRLC 3EXLA 5ILTH 1MH5B 3L5IA 2ZG1A 1TEYA 1TJHH 3VSVA 4YSUA 2FYYB 2LU7A 3BH8B 3KXFD 3U0PB 4AVIA 4GP8B 4A7GF 1YNTA 2Q76A 3ML8A 5EO0B 4CU8A 1CLYH 4K7PH 2NXYC 2WVTA 2Y3AA 2JKRM 3KCPA 1L9PA 3Q8FA 1ZHLB 3JV6B 4G83A 2OLDA 3VFOB 4N8VA 5JR1L 5GJTL 1LMIA 3SQRA 4B9ZA 5HHPA 3IGLA 4GKLA 3VXSD 3ETBF 4KVNL 4LKCB 3ZQWA 3OLDA 4PJXE 1EFXB 3RZCB 1WUNT 1YMMA 4HD9A 3RJOA 2YEZB 2DWSA 5FLUA 3NIGF 3Q5TA 5JIDA 2KDYA 3FN0H 4M62H 1SUJA 1BQRA 1QG3A 3I50H 4FGMA 4YL4A 5BJTB 1F4HA 2VXVL 2HMID 1LK2B 5CJOH 1OGTB 3NK3A 5C0BD 1ZANH 3BRFA 1LWHA 1IAKB 4ZODA 5DMYA 1A7RH 2J8UF 1X6LA 3FRUA 5GGRA 4ZZKA 1IILE 4HP5A 1D7CA 2CO6B 2YD6A 1SHSA 2ZCHL 3NACH 5L2KB 2R7EB 2Z31C 4PRID 3WFDL 4WW2B 2VE6A 1Z1WA 1KC5H 4WV1A 1L9NA 4XMPL 1MCPH 3LN9A 2W0PA 3BMWA 1S78C 3DX8A 3VTAA 1JPGB 1ZT4B 2NT1A 4AZUA 1AKJB 1OCCB 1RLWA 4GKNB 3ZKXC 1F58L 5IM7B 3VW3H 1PNCA 1I7ZA 1KSRA 1SGKA 4WCYH 1JZGA 4M5SA 3SY6A 3NSXA 2EDWA 3A0OA 4H88L 1MHPH 3ABMB 1A6WH 3MA7B 1NUGA 1KENL 1CR9L 4H0IA 3F58H 4Z7WE 2D7OA 4EUPG 2CO4A 4RFNB 1QRKA 4P3DB 4MAYD 1HDMA 2IANE 4OVUA 4TVPH 4L8BB 3VWJC 5GIRA 1T2QH 1U92A 3BP7A 1U8HB 1G7HB 5L2JA 1JZDC 1ZSDB 2UZXB 3CVHA 3OVUB 4UM8B 2XCMC 1WCBB 5TDOB 4OD1H 5I0YA 3WHE0 2KQNA 1ZE3H 1K5NB 1PF3A 1YEGH 3SDAB 3R4DA 3BFQG 2X9YA 1MFEL 2NNRA 1OW0C 3FDWA 4JFZL 4N2KA 4AIZB 1E4WH 3SPCA 4ISVB 1J11A 4P5KB 1MI5A 3AS0A 5TGBB 3PDDA 2XQ0A 5H37A 5EA0H 3QR0A 5I73B 4AYBA 4PJAE 4U1JA 2OL3A 2WLKA 2FL5B 1X5HA 3SB3A 4P2OC 4XXWC 1AZVA 3QUZD 3TL5A 5D7IE 4OKVA 3NSCA 4U1SB 3KD4A 1AZRA 1CXEA 3C08H 2O61B 1KBWA 3A4AA 3S5LG 1QHOA 2XWCA 5HHNB 3MRCB 1KB5A 3CN3A 3UTTB 2D2CC 3DV4B 3MBWA 5AOKA 4MQXC 3TVMA 3V9CA 5DD3L 3MBEB 1PG7W 4K2UL 1CF8H 4ODVH 4BKLB 3HNVH 4D9LH 2EDEA 3UG4A 3BVNB 2A9DA 4UT9L 3UGEA 1K9TA 3PIQA 5F1NB 4TN9A 4Q7DA 2BSSB 2EC9T 1YNLH 2VW6A 4UQ3B 1QSFA 5K9OB 5HDBF 3U82B 4GQPH 5JW4M 4YXKH 4AVJA 5E6UB 4JFFA 4QRTB 3GZKA 4UDTB 2J88H 4XCCL 3F3HA 1VDGA 4O58H 1XO8A 1WISA 2RR3A 1NKOA 3HUJB 3QUHA 2DQIH 5E95B 1OM9A 1BBJA 2IDSA 5FX3A 3R8BB 1FNFA 4AE0A 3UAAA 1MEXL 1Q1PA 1KCVL 1RZJL 4HWBH 1J05A 2J8UA 2WTPA 4P23B 3O2VL 3U2SB 3D85D 1EHKB 6PCYA 4PAZA 3WNMA 2IPTL 2K0RA 1H15A 4XBPA 5D7SH 4RGOL 3VXPA 5EIQA 3DX0A 3AACA 4AITA 5B3NA 1YN7B 4HMCA 1Y18B 4A66A 1JHLL 5A2LH 3CIQA 1P5UC 1A0QH 1ZTXL 3BGFB 1ZGLM 4XPTH 2QELA 3EJZD 3KGTA 3F12A 4N87A 3FKUS 3MRFB 2RTTA 4OZIB 1N67A 3N43B 3IDIB 2JCWA 1CK0H 3K2UL 4GXFA 3BWUC 5CJXC 2AJYL 1KJ2L 3LZOA 1NFAA 1U91A 1FPTL 5IQ7L 1DVFA 2QQKL 4I8DA 4JFWA 5IK3A 2BS8A 3T0EE 3MX0A 3RA7L 1ZVNA 4X8XA 4JHWH 3WEBA 4UOW0 5IWLC 4M5YL 1CDCA 3PAZA 5FUCE 3EJRA 5F1IA 1UWGL 5A43C 1XX9C 2RIKA 3AROA 3GM0A 1TPXC 5D71H 4M9PA 5LDUA 5HHME 3ZZLA 1TTUA 2XDHA 3QUKB 1OTUD 5J0BA 2J8HA 3TF4A 3SOBH 1IQWH 1RP8A 3I6GA 4LSPH 2AXWA 3VXRA 1PCSA 3FB8A 5JW4Q 4G6MH 4X9GA 2VLKA 4ZQKA 1JNLL 1GZPA 3IMTA 5FGCE 2I25N 3D4YA 3IJEA 4ABVA 32C2B 3HFML 3JV0A 1FL3A 3FL7A 4WDIA 4KBPA 2YKKA 1P4BH 1JV5B 4X9BA 1J48A 5CF3A 4Y2DC 5IHHA 4H5SA 4FYRA 1NGZB 2I85A 3ET9F 4ERSL 1WRFA 4MFHA 3FULA 4NM8L 2NUTA 2YPVL 3HS9A 2R2CA 3PAUA 3C5XA 3CPLA 1JDAA 3PWLA 4JM2D 2C3XA 3D7PA 4KDWA 1ZPLA 2AJUH 4F37F 5D6DC 3D4ZA 2BDNH 2OMVB 4XNYL 4C56E 3FU3A 4PRNA 5CEZL 1MN4A 3DX9A 4U1KA 1UUNA 5JXEA 2CHWA 3BT0A 4JJHA 2BVTA 1SXCA 1QRNB 1BW8A 3L3DB 1AR1C 1SMAA 1XIWD 4UTAL 3F7RA 3D12B 1N6QH 4B96A 5J89A 1CYWA 4U1IA 5DJAA 3RKDD 4CBPA 4LSRH 2E9IA 2ITFA 2BRRL 2VLRE 4FQQB 4RBPH 4TTDC 2HX7A 1WEJL 2WJ5A 3QI9B 4N1HB 4OIFA 1L7TL 1RUKL 2XOTA 2WTRB 1AZZC 4Y1AA 5IHUH 4D0DB 1F3DH 3G08A 4F8PA 3UX9B 3VXUA 2WBJB 3KM2A 5BVPL 4AUJA 5BVJA 1ETZB 3MO1A 3WN5A 2JJVA 1QO3A 2FLBT 3VACA 4QGYA 1SN2A 3L3IB 5DK0B 5I82A 5DHVB 1UHVA 4OZGF 4Z7OF 4YHNB 2WLZA 3DJRA 4RFOL 4YQXL 4V2BA 3TH2T 2FWLB 3CFMA 2ZX5A 5C0ND 4UU9B 2W60A 2RQEA 1SJEB 4PJ8D 2EH7H 3F7VA 4P46D 3LQAH 4K3HA 1HCYA 2ARJB 5F9JB 3OHXC 3QO0B 4NC1C 1UASA 2NY3C 3VGDA 4PJXA 5DS8B 4W9ZA 2IH1A 1N0LB 1E9OA 3ARSA 4ZFOA 3ESVF 1M6UA 1YMHB 5JPMA 2PF6A 1N7ML 3JUZA 4O02L 5LDSA 1PD0A 5IROC 3ZMEA 3PJLA 1O0VA 4UWQB 1S2EA 1TCRA 1B6DA 1BBDL 2AJSH 4HJ0D 5E6RB 4M5TA 4Y5XB 2QMKA 4PHXA 4X4KA 4YBHA 4EN3D 4QCIB 1RZIB 2LAGB 2Z6FA 4LLUB 2D7QA 3TZVD 1KYOK 3MV7D 1E4KC 3MLUL 2ODHA 1H0DB 3MOQA 3SE9H 3WJLA 2NX5D 3CH1A 1IIIA 4PJCF 3TFKC 4Y1TA 3WXWL 5DFVD 3ARTA 2VZVA 2W9EL 2VH5L 5FF6B 5SWSB 2MNJB 3HI1A 4E68A 2QTVA 3DX6B 4TPRH 3L5JA 1LMKA 2E27L 4PGEB 2FATH 4DW2L 1XGYH 3LZFH 1XZ0B 4AL8H 5FYLH 2ZKXA 4HFUH 1LEGB 3DNKA 5F89A 2C5DC 3FMGH 5EU6E 1BF8A 1SQMA 1SYVB 2F0CA 2VDNB 3QORD 1FLRL 4S2SA 4JGUA 4C8XA 1IT9L 2EYSB 5I9QB 1L6ZA 3DUUB 3TEXA 4PREA 2ICWB 2NQ3A 2F74A 5C09B 4Z7NE 4Z7WA 1VFBB 4XXDA 4JRFA 4AW7A 4Z3HA 4KITB 2V3FA 5T5NF 5FWRA 1GSKA 3E2HC 5HTSA 3BUYA 3SKOA 1T6WA 1EZVY 1ACXA 1AZCA 4W6YB 2W65B 5EBGA 2F7IA 1LO3L 5J06A 1CICC 2PR9A 2WLLA 4XP4H 3VG0L 1I9IL 4J3OD 4B9FA 3ZXAC 3O3DB 3CNKA 5KVMC 4BH7A 2HT4C 3GLDA 5I5JA 5D7IA 5E7BA 4PJGE 2OSYA 3QWRD 4KK6D 2OI9B 1A9VA 3L3GB 2B4CL 2KHAA 1RULL 2HT3D 4YWGH 2AV1A 4NXSA 5F7UA 5DJXB 1U8KB 2YK1L 1TQTA 2X4PB 1GYUA 3H9HB 1EEUA 5B22A 3V10A 1TZAA 1R3HA 2BC4B 5EC2A 5IB5B 2NW2B 3HB3B 5I71B 2JKLA 4FG6D 1SXSA 1U6AH 3REVA 5FV1L 1OL0A 4UV7H 3UOAB 2VDLL 4JLRB 3MGTB 1W16A 1J12A 1S3RA 3JT2A 3OLEA 3X14A 3H4HA 43CAA 4B53A 5EC1A 5KEZA 1A7OL 4CL7A 1CD1A 3EOAA 3LRLA 2P5WD 5HDLA 3HBGA 1Q72H 2ICEC 4XBEH 3QZMA 2CAKA 1VGEL 2BSRB 5F9WB 1U8OA 4EE2A 1GIGL 1IAIM 3KH3A 3CCHA 4FOMA 3ARFA 4Y19E 2OMYB 2XN0A 2NOYA 1VAHA 2J8OA 3VXOB 5ADPH 3EOTH 5D7KE 5I8KH 3ZHKA 3BGAA 2ITCA 1FZJA 5GRJH 2Q3AA 3VD3A 4G1EA 3WFZA 4J3XA 4EXKA 5BRZE 3F7YA 3O6LH 1L0QA 1GJWA 3LKQB 1QFPA 1JJUA 4QTIL 3S0PA 1X9QA 2ADFL 2GJ6D 1DTUA 1Q9WA 1T20A 4LRNH 4JPVH 1TTGA 3EFDL 3P30H 3AG2B 5I6MA 1E40A 2HKFH 1YO4A 3NK4A 1H19A 3ILEA 3QQ4A 1NC4A 1DJHA 1LO2L 2E47A 1UA3A 4EI5C 3P1VA 3EGDB 2R56L 3HZKA 1DDHA 4V2CB 3TH3T 5KZCD 3I9AA 4PG2C 3UROR 4AGNA 1V5JA 4NGHL 3VFSA 1KBPA 1VERA 2XUWA 3VFGL 3I6LE 2A4ZA 5KSBE 4WJKB 1NCDH 2EACA 4Z77A 1SFHA 1L9QA 1E30A 3DIFB 2ITDB 1RAMA 2XN1A 4LQFH 2DLEA 3WNPA 5JW4R 2CHZA 2JXMB 2ZKHL 4RIRB 1A4CA 2HPTA 5AVUB 1A6UH 4M4RB 5G4NA 4A7SA 3T0EA 1C5CL 4XO8A 2H32H 2B1OA 2VAAA 5B1JA 4GT7A 2Y36H 1LM8V 2WQAA 2ZX6A 3Q2LA 4XOEA 3ZTJG 2AQ3A 2IV8A 5CMAA 4PHZA 1DJIA 2VXSH 5E0FA 3U4BH 3MRPB 5I1EL 2CD0A 4IRJA 4F8NA 3TU6A 4ANWA 1IX2A 3QK0A 4W9KC 2VDQH 3H42L 3O6MH 5D6CB 3WE6A 3C6SA 3B34A 3KPPA 4H8VA 5I8EA 1P5VB 1GCFA 2OTUB 3CK0L 4PIBA 1VCAA 5CD3B 2SODB 4KO9A 1JRHI 3EYFB 3VNYA 3IDYB 1BF2A 4OQTL 1DVYA 3TEUA 2WP3T 2AVFA 3B2UC 4I0CC 3CU1A 4MRCA 1HFUA 3UC2A 1S9YA 2QLVB 4J39A 4U1NA 2O5ZL 5JDSA 1SBSH 1QFOA 4HHAB 2ORBH 2DBLH 4QIRA 4R5XA 3RDTA 3KEHA 4QKXB 4K3JL 4TXVB 4MDIA 2VB5A 3IMUA 2JQZA 3TBYB 3UAJA 5GGSA 3LPGA 1NIEA 4JFHE 1TQBC 3ABLB 1B4JH 3ZE1B 4JNXA 4WEEA 5GGUB 4FXGB 5D7EA 3ZQXA 3LMJH 1ROCA 6PAZA 1ZTMA 3R06A 4HJSA 2VT0A 1XCQB 2W9DH 5DJ2B 3F6LA 3GMPA 1FYTA 1UKSA 4FI7A 2ADIB 4JRWA 4UT6A 5FA3A 1TSHA 1QYGH 2E8YA 2A1WH 1AXTL 1L9MA 3HE6C 3KNBB 1OZTG 4RRPM 4NRZB 2VLRA 4UUJB 5CEXB 3K6SA 1RL1A 1UYWL 2B59B 4X5QA 3MRKB 3HG1D 2LU5A 2Z7WA 1R5WB 4ZO8A 5MP6H 1BVOA 2GTZA 3OR7A 5HDQL 1K72A 2FT8A 4TSCH 1L9RA 4YLQT 3V0FA 1TZHB 4S11A 1FO0L 3RZCC 3QNXA 4DN3H 3VRJB 4N0YL 1BZ8A 1ZSHA 3D39B 5AB0A 1OAQL 5KVEE 4GG6E 2A6IA 1MCEA 2ZXCA 3FB7A 4DFHA 4DZ8A 2H26B 2VR3A 3IJHB 4J6RL 4MTMA 3S98A 2JTYA 3V4VL 2DICA 2AZUA 3CLFH 5EZJB 2X70A 2ZT9C 1EH9A 2EECA 2R2HA 4NQEB 4I3GA 4PJDF 1J1XL 5AKTA 1C16B 5DHDA 3N42F 2QEJA 3UTOA 4MNQE 4LOFA 2VSKB 3A5VA 4U6VL 4N2AA 3U36A 2QHRH 3UJJL 2W38A 3Q05A 3CPUA 3IFNL 3O9WD 4PRPD 1RZFH 1OAKL 2OS7A 1S9WB 1PKOA 1AGFB 3QXAA 4OJDH 3PCYA 2EH8L 3RUGE 3TYGH 4GSDL 2BP0A 4K5MA 2CGZA 5FGRA 3EG9B 1T1WA 2XPGB 4NCDA 4AXWA 3FTWA 5L8LB 2BVYA 4DGVL 1QACA 4K7PX 2JI1A 4MJIE 1FZMA 3AT9A 2NNCA 1I3RA 4NFDA 4Z3TA 5C9KA 2UZYA 3L5WB 3DBXB 3NCFB 5A1AA 2X2JA 1P6FA 1ZHBA 3JQOB 1MJ7L 3KYAA 4RFNC 1JI1A 1JPTH 4TQEH 4QRBA 3WLWD 4DP2X 2VIRB 4LDOB 1YYLL 1X7TA 3IXAB 1TLKA 1Q1JL 1VRSA 1W6WA 5CEZD 2DS4A 5EU6A 4NN7B 2A6KA 4UB0H 3HC4H 4X5LA 5DRNB 2AK1H 1TDQA 3BRGC 2FBJH 2V5SA 4KAQL 4NI3A 5IB4B 3T2OA 4L4TE 1ZA3B 2WIIB 5J1SC 4HIJA 1JRHH 3DV6A 3CFKB 1B3JA 4RAUB 5GXBB 4ZMAT 1ID2A 1F11A 4V1DE 5I73C 4Y5VA 4POZD 2Z7UA 3F65A 4JGMA 3W2DH 5GS0C 5GHWL 4M6OH 4AVHA 2LGNA 1U3JA 1UT2A 1OAZH 4YGAB 4BZ2L 4X98B 3J8F7 1KGIA 3DX7A 4KNUA 3WOVA 1DQQA 5GSVA 5HJ3B 3WIHH 2NUPA 3LH9A 4PLKC 4AEIL 3NVQA 5AUMB 5ESQB 1Z5HA 1G0DA 3UMNA 4AYEC 5FYKD 4R4NC 3V6ZA 3FF8A 2UUDH 5BQDA 2AGJL 4PJGA 5D2LF 4GUPA 4J5VA 3FB5B 1BLNB 4YDVA 1DQKA 4HT1L 5HYJD 3LKNA 3R1GL 5FCSH 2O5YL 5C07E 2FQEA 4HVBA 1DVQA 1SLWA 5F1KC 2E7CA 2K6ZA 1JN6A 5DZAA 3ZR6A 5IF0B 4TRPH 5LAPA 3QRBA 2M2DA 4IBLT 1A6ZA 4WI4A 4XC1H 2GW5A 4ZDHB 1RI8A 3WO4C 1OF2B 4K9EC 4FQXB 4JFED 5E4EC 1F00I 4PWGA 2J25A 3CWGA 4TNEA 4DPCX 1LO0H 4UAHA 1O5DT 5J6GB 4CUCA 3CXFA 4RISL 1F4XH 3BKCL 4RGNE 2IIJA 2FNWA 4JQXA 2A0LC 3VH8B 4P23C 4JY6A 1UQSA 4YHYC 1KCLA 5CBAB 4U2ZA 4OCXH 4FZ8L 4JS7A 4QRUA 4NKOB 4ODSL 5I6PA 3AY4C 1GAFH 4UDUB 5I8CA 4XVSH 4J8RA 5JW4N 4B9CA 1MELA 4JJ5A 4OCYL 4GY4A 3MQIA 3DOHA 1UKQA 1KTCA 2TSBA 1MXGA 3MV8D 2Z91B 2Z3FA 4M02A 4J1UB 3BGFC 5HY9B 2CUAA 2YPKB 4M8UA 2ILLA 1SVZA 1TYRA 1UJ3A 3GEFA 3ZE0B 3HR6A 1HK6A 3IDUA 4X8CA 1T21A 1TKWA 3OKKB 4FXLA 2VLJB 1YYCA 2IALB 1D5BA 2AXJA 5I6NA 3CVCA 3BISA 3OQRA 5ICXB 3PDOA 1DJXA 3LN4B 4LHQB 2QKSA 2J5LB 5JIMA 4HDIA 1PZ2A 1XCXA 2PKDA 3OAZK 4U0RB 5JDJA 3X12A 2YXFA 3TO2A 2NY4C 2AABH 2YGNA 1Q0XL 3EH3B 1J0HA 1KWGA 4BELD 5BRQA 2ARJQ 1UACH 5KSBA 1EZSA 1EO7A 1W72A 4LQ1A 4U1GB 1CO1A 3QJZA 5DURD 3QJXA 4F58H 1JV2A 4XNQB 4IOFD 4WU5A 1F4AA 1UENA 3QHZL 1KN2L 1PJWA 3T0VA 4KHXH 3STZA 5FA4A 3B2VH 3FU7A 3LH2L 1E3XA 1Z9SA 4NN6C 1MJUL 3N44B 3GHPA 3DIDA 4G8GE 5D7JD 3C09B 2JELL 2L8AA 4J3UA 3ZHLA 4HUVB 1G43A 3DX1A 3CX5K 4WNSA 2ZX8A 3I02B 4IDJH 5E08L 3U4EA 4L9LA 3QAZB 1KY7A 1I75A 3A21A 5T5FL 3L6FB 3P3SA 5C1MB 3H9ZA 3WIAA 3A3YB 3P0YH 1T3FB 5AW3B 3BLBA 5D55A 2PPEA 4NQVB 2FLRT 4AH2A 1QNIA 3KPLB 3F5WA 5HDOA 5DD6A 3K1DA 4HWZB 2B1HL 3KWXA 4F37K 5FC9A 5KBKA 3GKWL 4UQEA 3WHXA 2P5EB 1QAWA 1YQVH 4BFFA 3NCBB 1QBMH 1QR1B 4XCNA 5AOMA 5KVDL 2HLAB 4I5BA 3JBG7 2VR4A 4DK6A 1EDHA 5LCVA 4NO0D 3CFDA 2ZG2A 3F62A 3N1QC 4GB9A 3B56A 2V9UA 4HG4J 2VKWA 3ARBD 3Q7JA 4RA0C 3TIDB 1JUFB 4KDTC 5IR1B 2WBJC 5T5NG 3RWGA 3HHSB 2NPLX 1LDPH 3SDCD 1G6RB 2EZ0D 3IMWA 1BFOB 4TQ8A 4BE5A 5C7XH 3ULVE 2ZCKH 1JWUB 3WEMA 1UFGA 3B8SA 3HZMA 4HK0B 3HRZB 3EJUA 1G7QB 2B1AH 1BOYA 4HGKC 2CIIA 2CJSA 2NY1C 4GFTB 1V3MA 1GS8A 3PXJA 2VR9A 2CHNA 1P4IL 4JJOA 4XNUH 5H94B 4DGYH 2V5MA 2OBGA 1I1FA 3MLRL 4Y16A 3NJJA 4D94A 1T5WA 3VFMA 3BWZA 4NAQA 4HCRA 5EUKB 3FTUA 1E4HA 3NJKA 5DXWA 4Z3EA 1Q9OB 2BMKB 2CLZB 2R39A 4J23A 4L4VB 1ZK5A 1IGMH 1THAA 1MWAL 4KK9D 4GMTH 4UZSA 5MEQB 2DKUA 3BO8B 1YY9C 4JDEB 5LAXB 5IJCC 1VGKA 1KEGH 1QEXA 3CFCH 3QZOA 5EEYA 5GPRA 3FTVA 1K4DA 1JGUL 4YLCA 2WCPA 1AQ8A 4ACTA 4MNQA 4Z7UB 4LHUA 1ZLVH 1MG3C 2VDMH 1LEIB 3LYRA 4PLOB 3RGVB 5EBMA 2DQUH 1S5IH 2CPCA 2JKXA 5LG6A 4RMVA 2DLGA 3BFOA 3DGGB 3TWCH 1DQDL 1B0GB 2MQGA 1P69B 4QHMB 5A2FA 3N1GC 4X0KA 2JCCB 4E9XA 1RZKL 3SQBB 4MDJB 3PP4H 1ES0B 1J5HA 3GI8L 1IC7L 2B3RA 3INOA 2DWDB 3KR3L 1F45A 4MJIA 5TE7H 4O9HH 1NGYB 5IVXE 1FNGB 1PKQE 5I9QC 1BOGA 4WFHD 4XBMA 2G2RA 2LHAA 1WT5A 3R4RA 4MMYA 1CBVL 3D08A 5IBUG 4RSYA 1JPFA 4JG1L 1E5CA 5I8OL 2DD8H 2W59A 4KZEL 3IETA 3B9AA 1AGEB 2F5BH 2GFBB 1CWVA 5FIEA 3WHE1 3KEDA 3QIWD 1MHEA 2AEWA 2BM3A 2XTJD 5A3IC 3MJ6A 2J1KA 4WK0B 1BEYH 4K9EH 4OGZA 2FUTA 2ZPKH 3EO9H 4L4TA 2DWXA 1X5MA 5EZIH 4V1DA 1PFOA 2X6MA 3CXHJ 3CZEA 3APDA 4DP7X 5CLWA 4WKXA 3STBA 3N40F 1LK3L 4RFEA 5F7HA 4GS7C 5DU7A 1NAMH 4FQLL 3GXNA 4OLYL 2YRBA 3QO1B 3OXSB 3KXFE 5AOIA 3QG6B 1NUNB 2J73A 3ZDZB 3T8VA 3DO7B 3HB3C 4BK5C 4MD5B 5LXGL 3ZHNA 4X8GA 2VABB 3FQRB 1MREH 1DJGA 1UURA 3OG6B 4ZTPL 5C9JB 3HE7B 3VXSE 1D5XA 2VYRE 2Y4SA 2VM4A 3PWJA 1QTSA 2WOBA 5F1OB 4ES8A 5DR5L 5JORA 4MA7L 3TNMA 5C07A 3SKJL 4NUQA 2R4SL 4R7NB 3QQ9C 4KTDH 4AIXA 4RZCA 1R3JA 1TU2A 2C8NA 5B1KA 2YSTA 3OKNB 2YAPA 5FO8B 1LWJA 4JFTA 1BAGA 1G9NC 2L4OA 1W9XA 5C0BE 2VGLM 2FO8A 3GMQB 3T8XB 3FFCE 4ZFGH 1E0OB 1KG0B 4NNXB 1NIAA 3TTYA 1R3KB 1S7SA