5LAPA

P53 cancer mutant y220c with cys182 alkylation
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
195
structure length
195
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2-Sulfonylpyrimidines: Mild alkylating agents with anticancer activity toward p53-compromised cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Cellular tumor antigen p53
total genus 47
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lapA00
1UOLA 2BIQA 3D06A 1TUPA 2GEQA 4AGLA 1T4WA 2IOIA 2J1ZA 3WTTA 2XWCA 2AHIA 4KVPA 3VD0A 5ECGA 2FEJA 3EXLA 4G82A 4IJTA 1HU8A 3TS8A 4IBUA 4LO9A 4AGPA 1H9DA 3D08A 2J21A 2BIMA 5LAPA 4IBTA 4AGQA 2IOMA 4MZIA 5AOMA 5A7BA 4IBZA 4GUOA 3QYNA 5AOJA 2X0UA 1HJBC 2J1WA 4IBQA 2J6WA 1GZHC 2RMNA 4LOEA 1E50A 2J1XA 2OCJA 2ADYA 3ZMEA 3IGLA 5AB9A 2J1YA 3VD1A 4G83A 1EAQA 4XR8C 3WU1A 3US0A 4HJEA 2PCXA 5ABAA 4MZRA 4L0ZA 2J20A 1HJCA 4AGOA 1KZYA 3D07A 4AGNA 3Q01A 3WTWA 3KMDA 4IBYA 1TSRA 3VD2A 1GZHA 4A63A 1LJMA 3US1A 4L18A 1EAOA 2H1LM 2IOOA 4L0YA 2BIOA 5AOKA 4LOFA 4IBVA 4IBWA 3WTUA 4QO1B 2MEJB 5G4MA 3D0AA 5KBDA 3EXJA 2AC0A 3KZ8A 1CMOA 3Q05A 5G4NA 3D09A 1CO1A 5LGYA 1IO4C 2BINA 2P52A 3WTXA 3QYMA 2YBGA 1YCSA 3WTYA 1EANA 2ATAA 4IBSA 3IGKA 2VUKA 2BIPA 5BUAA 3Q06A 3D05A 2WGXA 2X0VA 3WTVA 5AOIA 5AOLA 4GUQA 3WTSA 4AGMA 2X0WA 5G4OA 2XWRA
chains in the Genus database with same CATH superfamily
3EH2A 2GBTA 1G7LB 4QTIL 5HY9B 5J11B 1J0ZA 4WW1B 3RVXD 1YPZE 4N5UA 5EEYA 4AQEB 4C4KO 2K7QA 3TC9A 5C09D 1MAMH 2CE6A 1C1EH 4BK4A 3RPBA 4WENB 2HKAA 5K9OA 1E8ZA 1JGIA 4U4BA 5HHXH 1R3JB 3ULVD 3CIAA 3UEZA 3GPEA 3AT8A 3MGTB 3V4UH 4GQZA 4YFLI 3VWJB 4AEIH 2JB6B 4NUGL 4WI4A 1JMXA 4MXVE 4AMKL 4KNTA 4M1GL 5TQ2H 4M5ZH 4X2UA 3MBWA 4TLUA 3GMMA 1N70A 1B0WA 3C8HA 2R56H 3RIAF 3HB3B 3RVXC 1KTJA 2GBVA 3G6JF 4OLXL 4TVUA 2WIIB 3QNYA 4JFQB 3BE1H 1T1WA 3W0WA 3PHAA 4MXVF 1G7HA 3HZ3A 4K3DH 1EFXA 2H6PA 1KTRL 1URIA 2G3MA 3KLAB 3BQVA 3MDJA 4H20L 1MFDH 4KTDL 5HD8D 2DS4A 3ELQA 1QLEB 4KQ0A 1FHGA 4RGOL 4I48A 4ZXBC 3QAZC 5GRUL 4X7SH 4JGMA 4NCDA 2B5IB 3SGDH 5EOTA 4PWGA 2A6JA 5FYJD 1JK8B 3VXUD 4PS8A 3T1FA 2NTSP 3OF6A 2MCPH 3L7EA 1V7NL 2IXQA 4JL1A 3II2A 3BPCA 2D7MA 3HI6L 1MHHB 1MNUH 5D96C 1BIHA 5DMKA 1X9LA 4HSCX 2W38A 1GSMA 3VI4F 3UAJC 1JZGA 3BUDA 4J3XA 1RZKC 3NP3A 3O4LD 3D0AA 5L6YH 5KBDA 4P3WA 1GRWA 1PX8A 3PE9A 5A6LA 3N1PC 2BPBA 1JI1A 3DIDA 1U8LA 3K8LA 1U3JA 1IGTB 4HUNB 4WIQA 1K4DB 1E28B 3QQ9C 2IFFL 2AJVH 2F61A 2YPLD 3TEYA 1EEYB 1C5BH 2ZX5A 2A9CA 4ZFFB 1CL7I 1J0HA 2ATAA 1AG6A 3V6FB 4MMXB 4YWGL 4ZMYA 5LBSH 2YN3A 1CLZH 1AGCA 1KIPA 4X7TB 5C6TH 1NSNL 3LH9A 3TBTA 5BQ7B 1C5DB 1J9QA 5EBWA 1JFQL 2WTPA 1TVBB 4QAWA 2MKWA 1UTDA 4HFWB 5ESAB 1ITCA 3MXVL 1Q38A 3RA7L 4F57L 3FFDA 3M46A 3C6SA 2F7RA 3QDGA 4IS6A 4KQ3H 1CQKA 3GXIA 4YHML 5IW1B 4C4KT 4PJDF 4U0RB 3D9AL 5ESQA 2IXQB 4XMLH 3ZDYB 3KCWA 1GMIA 3FU5A 3QS2A 3FN3A 4YHOH 3X1NA 2J12B 3WDHA 5ACZA 5I1JH 4B0MM 2AABL 2Z35B 5AZ2H 1T6VN 2Y07L 2ZOLA 4G1EA 1UB5B 2EDTA 1HCFX 3O6FC 2XWBB 4N0UB 1WLHA 5MHSE 2AKRA 2FJSA 3ESNA 4DEPC 1I7UA 5JO5B 3V55A 1CXHA 4DW2H 1JZFA 4KKRA 2DQEL 2XG4B 1F6AA 1OE2A 4XP9L 4K07A 4YDLC 4HISA 1EZVX 2O5NA 3GFUA 2ICWB 1E2ZA 1IGTA 4NFCA 4YHOL 3OLGA 3FTSA 2WVVB 5K59F 3ZE2F 4MJHA 2CJTA 3GDCA 3GMPA 3MNDA 1AHWA 4K71C 4OUUA 4U3HA 1E4HA 3TCLA 2H26B 4PRID 4K9EH 1CPUA 2Z93A 1ZV2A 2OS7A 2BIHA 4FNPA 1RK1A 1DQJA 2GJ6D 3LXCA 1O75A 4R26L 3MRPA 3MC0A 5B39B 4FTVB 2YXVA 2A0LC 1KGCD 4Y4KC 1DJZA 4JFXB 5K59E 2Y25A 1D5IH 1DLFL 4KK6C 5BS0D 1XH2A 1NC4B 4LHUD 3S4SA 4DPRA 3APMA 4XNXH 4P2RB 3BH8B 3SD5A 5B7FA 2I60L 3SCMB 4M43L 1ZTXE 3MJGX 1YQVL 4KPHL 4GG6E 4TUUA 4Y4FC 1MJJA 1SXZA 4Y19D 4NQSB 2G2RA 4CSPA 2YUVA 2GB2A 1NGWB 3N85H 3ASNB 2YAFA 2E5EA 3C5ZB 4LSPL 5T5NG 1CFMA 1TVHB 2R2HB 35C8L 3WY4A 1I7UB 1MJUH 2BIOA 5DHDA 4MRBA 5IM7B 1J05A 1CXLA 3EGSA 2AV1B 3FSZA 3E6HA 3MLWL 1AZUA 3PUUA 4TN9A 3EXJA 4UOQA 1OSPH 4NI3A 4EI5D 4NRYB 1D5MB 5FFGA 1FFOA 1XEDA 4ATTA 5C71A 2XQYK 5FM4A 2QSVA 5KSBA 1ZA6A 2BRRL 1BVLB 4EZLA 5ABDE 3DHMA 3NUKA 1DQJB 1ZIBA 4X6DE 5AAMC 3VI4B 2B1AH 5HDWA 1T89A 3O9WA 4Y19B 3OMIB 4HMDA 3MCKA 2VUOA 4S0TD 4NYLB 4MCYB 4POZC 1R46A 2NXYB 3EJSA 1BJ1H 3HE6C 2OI9C 2ADGA 4AQ8C 4E5XG 1REIA 5A40E 4E41E 2DQ6A 4I2XB 3M86A 5F7UA 1TNMA 4NQSA 3GI9L 3E6FB 3OAZH 3NA9L 3PFUA 1FV1B 1PZAA 5TGBB 3P40A 3LQAL 4O4YH 4MJ6A 5I6XB 4OVVA 5FX3A 2EIMB 3BEWA 4GG6A 4HCIA 5B1JC 2AEOA 4YMPA 4XMTA 4XCCH 4A2FA 4JFPB 3IDYB 1ODUA 5BO1L 4NB7A 1JGVL 3LEXB 4RFOH 4UQ9A 1YY9C 5CMAB 1T03H 4ZOAA 4LEXH 1HKFA 2O5XH 3AG4B 3VGDA 4PJDB 3HNVH 2OW7A 2GITA 5F7EH 1JWMB 2BIMA 1LWRA 1D2PA 3ILEA 5HI4D 3S5YA 4D8PA 1C1EL 5FF6B 4E5XB 5F6IB 2N7BA 3H42L 2WXJA 4F33B 1QBBA 4GW4B 4JK0D 3RDTC 2GT9A 4WNSA 4CNIB 4KPHH 4B41A 4EPSA 4DK3A 3UIZA 3A6BL 1BWMA 4MAUH 2F58H 5HHQB 1WICA 1UKSA 2AQQA 2X9WA 1B88A 4WO0A 1JPFB 1J8RA 1UOWA 4LASL 4U1NB 4UU9A 3RWDB 4P04A 3W9EA 3NPZB 3WN5C 4AZ8B 2GTWA 4X0KB 2A5UA 3QFGA 3PGCB 1CDBA 1DVFA 3O8XD 3L1GA 5LDUA 4YHPB 5ID0A 2RFXA 3P0VL 1MRCL 4TNWK 3UBGA 3UO1H 1YAIA 4XHJC 4LLVB 1L6ZA 5F1IA 5KANG 4E41A 1W8NA 3QUXC 5AKTA 4JB9L 2GJ6E 1DDTA 4Z9KB 4UB0H 1CU4H 3VXME 4F24A 2V9TA 2ZPKL 3B5HA 3H8NA 3FQUB 1DQLH 3UBXB 4JY6B 1U8OA 3SYOA 4L0YA 2P1YA 1U2HA 2G5RA 4HWZA 4FLQA 3CN3A 1JXDA 3OMZA 5CO1A 5EBMB 3ECVA 4OFKA 3O45A 4PG2C 1S7WB 4XNQA 1KCVH 4JDEA 3UTQA 4XPGH 2VN3A 4YO0B 1MVYA 1A3QA 1QR4A 4PB0L 3RWIB 3O6FA 2VRKA 1MQKL 5CN3A 2MNJB 3VA6A 2WO4A 4PN6A 1XF5B 4RFEB 5JHLA 1P6AB 1QOKA 4NRZB 2BXZA 5A6IA 3L95B 1KC5H 2RTTA 1ORQA 4JDVB 1BQLH 3DPBA 2MCG1 1NGZB 3UZEA 5SWQA 4JUSA 3UTOA 3K6SB 2MPAL 4FXLA 2FL5A 3CHPA 1EDQA 3REVA 1FN4B 5E6YA 2EDWA 3BZ4A 4MHHG 4QXTB 1JYWA 3WXWL 4ZX6A 5GXBB 1ZTXH 4JZNB 1XGQB 1UFUA 4F15C 3CFJA 3TT3L 2WSPA 3GTTA 3KGTA 5I1KL 2ZTBA 1RSYA 4JCLA 3CU7A 1NBYB 4OI9A 2RACA 4YXKL 4GPVA 1J48A 3QUZC 4DVRL 3HC4L 1RJCA 1XF3B 3GK8L 1H3WM 2JV6A 3ULAB 4ZZKA 1ZLUK 1CZ8L 5HHME 3OV6A 5IBTL 4GRLC 5HYSB 2DJMA 3KBPA 5DHEA 3M6DA 5EOQH 2OTUA 5C6TL 4PJXB 1TLKA 3WTTA 1RV6X 4M5SA 3CFEA 1PAZA 3LKOA 3MOQA 2O1AA 4KC3B 1KPRB 3VXMA 4DO5A 2FGWL 4WHCA 4J3SA 3H7BA 3FQXB 5J3HD 2A77H 1I1AB 5AUMB 5IVZA 1K85A 3LEVH 5FO9A 3MLRH 3TPKA 1KLFA 5KYYA 5DFVC 2K6YA 3EOAA 4PVNA 2PWEA 5JPNB 4QXUL 3L4YA 2ZX9A 4KZCA 1N26A 5D1QB 3X14B 4MMZC 4MAYC 3SKNB 5LXGH 2PXYA 3L3KB 1MCKA 1R3KA 2D2OA 2IOMA 2UYLA 1SOSA 2ZOWA 4C4UA 2VUYA 1J7VR 3P77B 1U3YA 3HA0A 4QRUA 2BRRH 2KDGA 4HUMB 3PU7A 4JE4B 4DFIA 4G6ML 4HAKA 4EDXA 1XGQA 1BWWA 1VB9A 5IB2A 3ULVF 3BPOC 2ALAA 5IMLB 3Q48A 4FYRA 2BY2A 2HP4A 5FCUH 5FM5M 3EYUH 1OXYA 1JF1B 1WCBA 3SYQA 3CH8A 1MFEL 1CDGA 3K91A 3VQMA 1CLCA 1D7DA 3JWOH 4L8CA 1Y18A 32C2B 3GBML 1F86A 4L5FH 2K70A 2NDFA 2EDMA 3G3LA 3SBPA 5GS0D 2ZKWA 4B53A 5E6UB 4JRLA 4J7RA 5L8LB 1NIEA 4L1DA 3ULVE 3IFLL 1ZLEA 2P5WE 1UC6A 3CC1A 3SE9H 3VFRA 3H7BB 1H8LA 3X3FH 4U1IA 1NL0L 1JL8A 3PXJA 3KS0J 4X5WA 5AW3B 4MJ2A 2BNUA 5E6IA 3EOAB 3FUEA 3SKOB 1CICD 1I7TA 3WIFA 3VB9A 2YBRB 3GSRB 2MPVA 4I1RA 2XFXB 4NGHL 1AO7B 3L3KA 1WZAA 5I8CB 4MNHA 2WNWA 4N90E 4XMUA 2XKUA 1N3NA 5JXEC 3O0LA 3L5WB 2ZCLH 1P7QD 1JPGB 4C56B 3ARGA 2FWLB 1UOVA 5IJCC 3M8OH 3H4FA 3R1GH 3GBNH 4IDLA 1XHHA 3GI8H 2OR9H 4JHVA 4S1SL 4XCNA 4ZFOA 1YEGL 4PV8A 3QEUB 2OK0H 4DOHE 1AXSA 4LSQH 1IBFA 1Y6MR 3WD5H 3MR9A 4ODWB 5AOLA 4YDVA 1QNZH 1YNTB 3B3BA 3GSWB 2Y0SA 4F37K 3BZ5A 3S34L 2E27H 4R4ND 3CX5J 4XOEA 4NZRL 4BWWA 1OW0C 2P48B 4AT6A 5EOCJ 4FI7A 4N2HA 1Q9WB 2AEQL 3OMNB 3UTSA 2VZSA 2XWJB 1IEBA 3EUDA 3NRFA 2FWOB 4XP6H 2DD8L 3OWRA 4D94A 3HCVA 4QI3A 2VRQA 1ERNA 1KNOA 5DD1H 5GSVA 4H25B 3U2SB 4GG8A 1GS8A 2X89A 3F7PC 4DAGH 1NEPA 2BOLA 3D3VE 3DX3A 1PNDA 3D18A 4WWPA 5KSUA 2PYEB 2H0EA 1KJ2L 2CO6A 4WUKH 2BLFA 1BM3H 2CK0H 2QKIB 3QZLA 2NR6A 4M3JA 5HGDB 4EN3C 1EUTA 4XCNB 3DDFA 5DEJA 1BX2A 3RFRA 4QJ5B 5FLUA 3PABB 2A74C 3QEGH 4NQQA 4OAWB 3F7LA 4N26A 1IAOA 1N12A 3H0TB 4U3XA 5T5FA 3T2OA 3HUJA 2ZUVA 4P49A 1AYRA 3VGEA 4DEWA 1BFTA 4L4TD 2EYTB 1TZHA 2AI0L 3DOIA 3HHSA 4PRPA 1FL6B 2IAMC 4U31A 1A1MA 3DBXB 5EV7A 5AVQB 1CT8B 3AS0A 5IHBA 1N5YL 4X9FA 2FEEI 2FZ3A 3BAKA 5JIIA 5D71H 1ZPUA 3AABA 4HYTB 3OR7A 4B7IA 2ESVB 4G42B 4YHKH 2EVFA 4PRHE 5C07E 3UCRA 1L9RA 3GMLA 3O8XA 4UF7C 5IB4A 5D6CB 4HDIB 4TSAH 1HT6A 1NCIA 4U33A 2PR4H 3UTSE 1SJXA 1WFUA 2G5UA 3RY6C 2XN1A 4XCFL 4I1PA 2HG5B 4L9DA 4PY8J 3G5WA 1DL7H 3MLTB 2AXFA 3O3DB 3VRJA 2NY0B 3PHQB 4J3BA 3ULUC 1UB6A 5KSAD 3KPLB 3S98A 2AC0A 2XCMC 3WXWH 3L45A 4N8CH 3WS3B 3RFZA 4F8NA 1J9SA 1YMMB 3O81A 4NI6A 3SPIA 4FA6A 2AJ3A 4BWTA 3T0BA 4BE6A 2DH3A 1LL1A 4JFOB 2BY1A 4GS7B 2DI8A 1CGSL 1YY8A 1ORSB 4YZFE 2FEEL 5KW9H 3B7SA 1U6AH 4H8QA 1DVSA 5GRXG 5CJOL 5L2JA 3W39A 1AZRA 2BDNH 3GZQA 2KZKA 4G9DA 3FQ2A 1DBKL 4L8DB 4R5XA 4HWNA 5F3HA 2R4SL 1PIFA 3FH7A 2IANB 2HKHL 5I30L 4L4JA 4PV9B 1JD9A 3KH4A 2F54D 4Z1PA 4WI3A 4R96B 3ZTEA 1XGUA 3FUJA 3LKRA 4ELME 4CW1A 5AENA 3QGVA 3L2LA 2E75C 4XO3A 1GY1A 3P73A 5JHAA 3CVBA 2O5YH 5CZVH 4QRPA 2ARJB 3RWEB 3KPTA 1A6AB 3A4EA 1J8HA 3E80A 3G08A 5IJKC 2PTTB 3ATAA 4UMGA 2XQYA 1U8QB 5C0IB 4KVPA 4WI7A 4CBPA 2F15A 1FRGL 1LP9B 3BP5B 4PBWD 1HEZB 1HHGA 5AWNH 2B8OT 5FB8B 3FK3A 4Z7QB 4QCIA 4EUPH 1R5IA 4N8PA 4GXVL 2OMWA 3QDJE 4PG9B 2GCYA 8FABB 4YK4B 3EUUA 2ZYIA 3OGCB 1WT5C 2NXYD 2X2HA 4WZ9A 2F19H 4OD2B 1K3ZA 3ZKXC 2R8SL 1FH5H 3MBED 2GK0A 3DV4A 4FKKA 1LE5B 3WE1A 1H0DB 2VOTA 3F6LA 3HI5L 4IHOB 2A7BA 1F1DA 1EDYA 4HUCA 3CZFA 4RBPH 4RDBA 3TBTB 4XC1L 1DR9A 4XX1E 2VYRE 3M8OL 5H8DA 4XNYH 3P2TA 1UXWB 3CBRA 3QW9A 2V2XB 4L1LA 4AYFA 5AKSA 1OP4A 1AE6L 3T09A 2D31B 3EG9B 4QPEA 4X98A 3B2VL 4Z0XA 5CHNB 2PPAA 4DEUA 4FYSA 2CKBL 3QUZD 2ZUWA 3WU1A 1GZQA 1U8PB 5F1KC 4MB1A 5JIKA 2HFGH 4ACPA 4B0MB 1O5DT 2PCXA 1MCPH 3FL7A 3NCBB 1ILUA 4AYSA 1ADQH 3HG0A 4OM1H 1FRGH 2KPWA 4TUJB 3C12A 4Z23A 2AKRB 3TV8A 1AZVA 3F58H 5D2NE 4MJJA 1EXHA 1HXYB 3QA3A 4KXZI 3U82B 4YAQB 3ECBA 4PVMA 3U4BL 5BVJB 4JPVL 1SLWA 4KMLB 1WBYA 2ZG3A 1GOFA 4NKDA 3LAFA 1XTMA 3KW8A 4ZX3A 2HXAA 2Y5QA 1X44A 4PRHD 5C07D 1BSIA 4GO9A 1GCFA 4WWKA 4PHZA 1MCOH 5HBBA 3SPGA 1UWEL 4AUJA 4KI5E 4E9RA 1Y0LB 2QFPA 3CZFB 1KELL 3ARDC 3WCYA 4QF1A 5F89A 3SBWC 2VR7A 3IKCA 4HBCL 2VUKA 2LTQC 3I75B 1OSPL 4WNJA 1MF2L 4ZOCA 4XO8A 1VHPA 2EIKB 2HJKA 3E8VA 2PW1B 3I50H 4RMRA 4CU7A 4XN9A 4QYOB 4Y16A 1KJVA 2ZWSA 1U8IA 4ZTPL 3T65B 2YRZA 1P1VA 3OKEA 4FFVC 3C5ZA 4NUJB 4FXKA 4ORGA 4YSAA 1A4CA 2G3ZA 4GP8B 3FSAA 3QEQD 4FZ8L 5HGBB 3ECBB 3SN6N 4KUCD 4DGYH 4UINH 1GZPB 5KVFL 3UDWC 2G2PA 3A6BH 3KYNB 3N1QC 3AXIA 4KUZH 1J5CA 2WXRA 1GS7A 1OM3L 5IJKA 4QO1A 3EO0A 4CJ0A 1AANA 1OSEA 3IDNA 1MG2C 2OXGA 4MS6A 1UD2A 2PMZA 3MJ8A 2NCMA 1WA1X 4XN4A 1TVBA 3QORA 3N06B 5ESAA 4N68A 4OCSH 5HYQB 1HJBC 1T22A 5MENE 4DQAA 1MOEA 4DVBB 1R19A 3VXSA 4CADA 3RVUC 2WJ5A 4WWKD 4NFBA 4YIQB 4OUOA 5ANME 3KWWB 1ID5I 3DMMC 4LCCB 2J5LC 1QEWB 3R06A 3SDCB 4JKMA 5T1DH 3FO0H 2Z35A 3ZMRA 3NFPB 4P2AA 2VN6A 5FO8B 2UY6A 4YHYB 4GSXA 2DQIH 2UVEA 2C7UB 1GA2A 1WD9A 3O6LL 2V2TB 4M1DL 3K46A 3D25A 3MUGA 4HF5H 4S10A 4E9QA 4QAMB 3VXPB 1N0XH 1ZXKA 4H0HB 3T9WA 3L1FA 4PJGA 2P8LA 4AXWA 2YGQA 4J4PA 3AT0A 3FT2B 4NJ9L 3V4VH 3VSVA 1I9JH 3L5XL 2F1AA 3BX7C 3K7UA 1AJ7L 4W9HC 4UILL 3FRPA 1GKEA 4QMEA 3HC0A 3HRZA 2IPKA 2WXGA 1PZBA 4ZK8A 2ZXQA 3HBPA 3X1BA 1BZ8A 2PCPA 2WXKA 3IMBA 3AY4C 5T1KA 4JG9A 1P4IL 1QFUL 5IVXB 1VERA 1UXSB 2YPLA 1XD0A 4HCGA 3ZKND 1TG8A 1RIHL 3U9PH 2OK0L 1OM9A 5DJXA 2XA8H 4MA8L 2HSIA 3MGOA 2IBZY 4JPWH 4RMSA 4UT6A 3RWHB 2BP3A 4KTEH 1IBYA 5KBMA 3BJLA 5KYUA 3DVIA 1JNHA 1NOAA 2CJUH 2CR6A 5CN2A 1XMWA 5SWSE 3V79C 2OMXB 5DD5L 4J6RH 3UIYA 3GJFK 5DURD 1AD0B 4FFYA 1T2QH 1EFXB 2H6PB 4HCRL 3RZWA 3L9RA 1ZVSB 4DPBX 1BYOA 3ZZQA 1A6WH 2E9BA 3CXDH 1SJHB 3IDGB 1CXIA 4P23D 1RIUL 1OARH 2BNQA 2CDGA 4QXGL 3Q3GB 1J87A 4LU5L 2LU4A 4HV8B 4OZHE 4CC4A 2YXWA 1OLZA 3K72A 3S36H 3SCMD 3EO1A 3HMXA 2W88A 4L5FL 4W9CC 3ZZSA 5EU3B 2C1PA 4GBXA 5DYFA 4NRZA 1Z5YD 1BXXA 1I82A 2XVBA 3EYUL 4G5ZL 2WWNA 3CVHA 5KS9E 1BYNA 3REVB 4Z76B 3DMMD 3P0GB 5AOMA 5J6SA 1NMCB 1HVXA 3ARFB 3OL2A 5CJXC 1NIDA 2QZQA 4AENA 3BSHA 3FUDA 3KAAA 4L37B 4M5ZL 3VWKC 4XPTL 5BOJA 1ZANH 2ICWI 3MRGB 4AQAA 4F5CA 3K0YA 2R1XB 2ADYA 4GRWB 3PQYD 2WN2A 1OOAA 4FQXB 1FORL 4YHMH 4JFHE 5IQ9A 3BLPX 3LPFA 2ZZUT 3U2IA 2QPEB 1RZKL 1XTLA 2FATH 4PJ9D 5E4OA 2AXWA 3UAAA 2R0LH 2Z8VC 1ZS2A 2QGEA 2R0KH 2D3LA 2WQXA 5F70A 3GSXA 4OFYA 1J0IA 2WLZA 3DXAE 3PLYA 2WY3B 3FTGA 3BAEH 3V2AR 4RWYL 4TOYH 2PNDA 3OF6D 5EO9B 3FYIB 4YWGH 1ZLSH 5IJVB 1F3DH 2JVUA 1CD8A 4UUJB 5TTRA 1A1NA 5FYLD 3VD3A 4OFYD 2AQPA 3P2BA 5DMGC 5L8JB 4IEFA 2AJZA 3VFTB 2YMXL 4EN3B 4FMFA 4URTB 3ZL4L 5PAZA 4YXKH 2V7HA 5I1HH 1EAPB 1J86A 3WFHA 4OZ4B 1UHVA 1I31A 4K9EL 3RPKA 3PHSA 5TDOA 5FKPA 3OX8B 3UAJA 4M62H 1SJEB 2IIJA 5FEBA 2PPFA 4LCYB 4BCYA 2R1XA 1MFBL 1V3MA 4EUPB 1B4JH 4QTFA 5F96L 4MWFB 1OPOA 3ARVA 4Y4KD 1NC2D 3AADB 1YEEL 4N2DA 2X4PA 1TZIA 2RIKA 1MFCH 4XMPL 5IR1A 3S97C 4FG0A 3OKMB 3GQFA 4K9EC 4HWBA 1J8SA 2AK4D 1VGEL 5E2TH 3MLXL 4ZMZA 1SYVA 2QGCA 5FKAA 4W9DC 4NDMB 4ZDHB 1RHHA 3ZZ1A 3PIQA 4JO4L 3THMH 1M1XA 1T2JA 4KKCC 2K7PA 3MX0B 5J1AB 3X12B 5E2VH 4A6YA 2A83B 2YA2A 1PF3A 2YN5A 1PU0A 4IJTA 1LK3H 1PZ3A 4J3OH 4B3EA 3AY4A 3DECA 3OKDB 4PJFE 2NPLX 3D6GA 1EJ8A 4OZ4A 1YMMD 2DM3A 4I0PD 2RBLA 2AERT 3FFCD 4LSRH 4M7LT 2I85A 2AP2A 3B3IB 1TDQA 4BCXA 2XTJE 4LQFH 5DDHA 1URZA 2N0KA 2Z4TA 2EDNA 3BP4B 3AMLA 2AV1A 5CLYA 1MIEH 1RZJH 4PRAB 5FHBH 3V9CA 4DP4X 3B9KC 4PD4K 4Q7DA 5SX5K 3EZ8A 3ZDWA 1NAKH 3EH4B 4FG4A 5LN8A 1FFOB 3MLZL 5F1SA 2A73B 5IR1B 1OAKL 2J8UE 1CFBA 3H42H 5FW7A 1MJ7H 1MHPL 1ZANL 1XB3A 4IU2B 1BF2A 2YGVA 4NZTH 1OP5H 2NX5B 2XZZA 5E4EC 4KJPD 1XIWD 2ARJQ 2ZQKA 1W91A 3T08A 2A9DA 4JN1H 2DQCL 3TTYA 2Z31B 2MIZA 4XCCL 2Y22A 4XWOD 2NCEA 3FFOA 1UACL 2Y7QA 4PJHB 5M95B 1X5YA 3H54A 1FIEA 5FYLH 4B97A 3K0WA 1Z6JT 2R1YA 3VFUA 3DX6B 3S35L 3WLBB 4KTDH 4LCWD 3HMWL 1U30A 2NW2A 3GSNL 5DLLA 3FJTA 5DJZB 4PJFA 4AEFA 5IHZB 1U2YA 4HIXH 2H1PL 3FRUA 5TE7H 4JQVC 2EDLA 5FYJH 1NCDH 3C60C 4BH7B 1S3KH 3HE7A 2DWYA 2NX5D 1U8MB 1OK0A 3SJVA 4ZUVA 2LW3A 1BG1A 3OKLA 3UROR 2R1WB 4ZS6D 3WAJA 2AV7B 2UY7B 32C2A 3QH3B 4FXKC 3H2PA 4LRIA 4DWHA 5H37A 3CXDL 4OF7A 2VLJA 4TS6A 4KZDL 3MRMA 1FDLH 3VW3H 4KITB 3ARZA 3FQRB 5C09B 4BXSV 1BF8A 2VDOL 3AQYA 4NPYA 2Z31A 3QUMH 2WCGA 1YEKL 5IKCB 2CIKB 3U30C 1RK0B 2AQTA 2ZYRA 4KROB 4BZ2L 3EKCA 5FYLL 5AVWB 4K8RC 1D9KB 3WHE0 1QSFD 4QTIH 3QXUA 1Z9SB 3L5HA 2YPKA 2RFXB 4KK6D 3VRJB 4B7LA 3WLBA 1TQWA 1AR1C 1XO8A 5I17B 1ROCA 4UQ3B 3PWPE 3L4UA 4WGWB 2KH2B 4KY1H 5ALBL 2XXMB 3HR6A 4AE1A 5DJZA 4PJCB 5PCYA 4LP8A 3BI9X 1Z7JA 3ALWA 2B9AA 1AIFA 3UABA 1T1YA 4Y9BA 5F44A 4GKNA 4NQTA 5A7EA 4O00A 1F4YH 1I75A 5F1NB 5JW3H 2GY5A 3FBQA 4HWZB 3SBQA 3ZKXB 1UJ3A 4JJ5B 2WMPB 4X4ZA 1F41A 2EIEA 1BZ9B 4DCQB 4YS4A 1MCBA 3IF1B 4LCWA 4NUMA 5F93C 1OE1A 4UOJA 3EHBD 3PHOA 4FQCH 1N8ZB 4W9IC 2P5PA 4C8XA 2WUBL 2ZSVA 5T33H 3GO1L 4BZ1H 3L4VA 5FA3A 3M1BA 4XODA 5GISH 5LNGA 4UOZA 2DQIL 3ROLB 2ORBL 3MACL 2GC7C 3I02B 4HGWA 1U95A 1UH2A 1ZV9A 2APFA 2ZCKH 3FO0L 1JV2A 3TCXA 6TAAA 5BRPA 5D4HA 3T0VA 3OXSB 1LO2L 1QUPA 1AMXA 1LJMA 1ZTMA 3ZOAA 3MBEC 4JREB 2VW4A 3INOA 3IE4A 2CSPA 2DQJH 3MUJA 12E8L 4FQJL 4NKMA 3VWJD 1WK0A 1RUAL 2FD6H 4F2ME 5D1ZI 3RB7A 3UTTA 5F0JB 3K81A 2WWMC 3Q5OA 3Q05A 4KFZC 4QD2E 1CFTB 1QA9A 2NY0C 5F7WC 4X80L 3FONB 1ND0B 3RHWF 1YEEH 4QHKJ 1AOZA 4IHOA 4FERA 3EO9H 2VXSL 3NQIA 4PJ7B 3WE6A 4G43A 2WWKT 1RUQL 1UZ6F 2VSMB 3KYMB 4HKZA 3F3HA 3I9PA 3X13B 1EERB 4HC1A 4AYFB 4QIRA 3FCTB 2B39A 4G80B 4LCWE 4PRDB 1P84K 3K2IA 3C5ZC 4WHTB 3K2UL 1NPUA 3EYVA 4OZGF 4ZO9A 4KO6A 4YSOA 5B7EA 3T1FB 3VNZA 4ZODA 4KTEL 2PCFB 4NNYA 1OAQL 1ICTA 1AR1B 2DL2A 3K6NA 3MBEA 1PLAA 1FFPA 1BJMA 5T5FL 5D7LE 1MEXL 4GLRI 1CR9H 3KM2A 1BV8A 5ISZA 5JHBA 3AXHA 2GPZA 4HWUA 3DJTA 3KVPA 1D5BB 1NDMB 4BHUI 4EMZA 2EH7L 2F7PA 1MELA 4DGVL 4LSRL 2B59B 3ULSB 4RMQA 5HVWA 4B3VA 1BHGA 2X4QA 3MCG1 5KN5A 1MHCB 1OGTA 3IDJA 1I8MA 1CZ8H 4Y2NA 3DVNA 5DMGD 5CCGE 3RWJA 3NIGE 5FHAL 3DOSA 3KNBB 1F4WL 4PLJD 2VW6A 4XVTH 1S7UB 2Q20A 1MCOL 2W60B 4LCVA 1I7RA 1N0XL 1ZHBB 3I9GL 4LB8A 4Q4EA 3BN3B 2W9LA 3ZJAA 2VSDA 3A6OA 3QUMB 5DQ9A 5IY5B 3TASA 4BQBA 3RGVD 4X7FC 3SIKA 1FP5A 1OCWH 2JELH 4X8JA 1NLDL 2UZIL 5CP3A 5JIPA 5I8OL 1JGDB 4QHMB 5J1TC 2XQYG 3ZX1A 3QPKA 4GW5A 2PW1A 4LZKA 4E0RB 1S8DA 4XE5B 4ADJA 3I3DA 1CR9L 5C0RL 3QCUL 2JJWA 1U8IB 1INDL 2CCWA 2ZOLB 2SODB 3AAZA 1YYCA 1KFAH 2W0FA 3FB6A 1ED3A 1IILE 3SZ6A 2Y5TA 3LHPL 2GABA 4EIUA 2WW8A 3BAXA 1HSBA 5BJTA 4LF3B 3DMMB 4JANB 3B9EA 5ISZE 2ICWA 4H1LH 4K15A 5JTWA 3CPUA 2VQ1A 5I5MA 4DZBB 4LDOB 1QWHA 1L7IL 1MLBA 2VCOA 2R7EA 3QDJA 1RU9H 1A3LH 4YR6A 3CV5A 2FCBA 4FG6C 2W92A 4UAOC 5LO7A 3V4VA 4WWKC 3I6GA 1ZPLA 4QKXB 3ZUNC 4GSDH 1RUML 3MRPB 2XACC 4NAJA 2RA1A 5K9OB 2Y7OA 4U49A 1CICC 3EJQA 4LL1A 2WHVA 5CZKA 3MRQB 5AWNL 3UTPE 3F62A 4G8EB 1EGJH 4YIQA 4BD4A 1G7PA 1S7SA 5EF0A 2DQJL 3T2NH 2UWEF 3ARDB 4FTVD 3C5JA 3AB0C 2X2YA 4S1DD 5DURB 1A6VH 3HHRB 1JVLA 3MLVL 4DGIH 3BUYA 4NP9A 3IXTB 1QTPA 1U6AL 4WK4B 1T1WB 1I8KB 3Q13A 5BVJA 1G7HB 1DJXA 1RCYA 2DIAA 2L0DA 3N40F 4FMKA 2WBJC 2ZP0T 1F11A 3L7FA 1K3IA 4FAAB 2P8LB 2CKBA 1H8SA 4MBOA 4WO4D 1U8NA 3LVEA 4YR6B 2C9UA 4OKDA 2IAAC 4G82A 4XRCA 1Y0LA 4KRMB 4MCZA 2FIKA 3TX4A 1UCBL 5G55A 3GHPA 4P9HH 2WINB 2A6JB 4R97C 3ULUE 1RURL 4DEPB 5DJDB 1JZ4A 1X6NA 1DUZB 4I3RH 3U0WL 2B4CL 2NY5H 3SKUD 5C1MB 1BECA 2YGOA 2YOAA 3GC3A 4NUQA 5GJSH 4D0BB 1AGEA 3IU4H 2CLZB 4QOKB 3ZYZA 1G84A 1ZT1A 1Z5LB 1L0QA 2HJKB 1X4ZA 3G6JB 2AXFB 1T83A 3O3DA 4H2AA 5D71L 1ZD6A 2ADGB 2IG2L 5GS0H 1CE1L 5D6DC 3GXPA 5E9DA 3CE1A 2B2XL 4FNLL 4HT1L 2LLLA 2NMSA 1CGTA 1KJVB 1GYVA 1IV8A 4RQQB 2BSTA 1V10A 1MVUA 2EDQA 4I9WE 1R3LA 4UM9D 4F7CA 3OJVC 4HKJA 4JFEE 3IXTA 3O4OC 4LL9A 4X6CF 3LPWA 2B5IC 4RAVB 3KWTA 3MO1B 4XX5A 4OZGA 4PGZA 5IT2L 1LE9A 3CSTA 4WF7A 2AI0H 5JHMA 2AMGA 4R3SA 3MCLL 4M9PA 3H9HA 3CFCL 5DUPH 5IUSA 4MNGE 2XSKA 3RWGA 3AQXA 3CVDA 4M5YH 3UJIL 5HSFA 5JQ6L 4HFWA 3US1A 1GC1H 2FIKB 2EDDA 3SPHA 5DTFA 3CLFL 4GXVH 4OB5L 4MD0B 4FNRA 1R3JA 4UAHA 3P73B 3I9IA 1WIUA 2X4NA 4GKZB 5F7MC 4PGEA 5TE7L 4P0DA 3TF4A 2ZKHH 2YMTA 4N9GA 4J28A 4JQIA 1CGXA 4QOKA 3BGFB 1ZCRA 4H5SA 1JP5A 2IADA 4ANWA 1E8XA 1HNYA 4N0UA 5FB8A 1A4AA 2OQJB 1EO5A 3VGBA 1GGCL 2VDNB 3BN9D 3ULVC 1NC2B 2GCYB 5ID0B 1A2YB 3QUKA 2LQRA 1OP3H 4GRLA 2OYLA 4PS7A 2A9ML 3NZHL 3BSZL 2AEQH 4NN7B 4P5TB 2E8YA 5KAQF 1CFSA 3WJMB 4FULA 3L81A 2KLTA 3ZBMA 4JFEA 1SDDB 4MD4A 4Y16D 5FYJE 3VXUE 4R3SB 4YXLH 5L7XH 2UXTA 2N01B 1CLVA 4QT5A 4P59H 5DQJB 2GBUA 4PJGE 1SLUA 4OZGE 2QLYA 2DLIA 3F58L 1FNGB 4HJGB 1SDYA 3ZO0A 2AHIA 1MLCA 3FU6A 4S11A 2OR9L 1NAMH 1NWPA 2IAMD 4S1SH 3WLWC 4YX2H 4V11A 5KJ7E 1S78D 1KCSH 1MJ8H 2NR6C 3ZSSA 4EN3A 1P6WA 5SWQB 3K6SA 4X7DC 5F6HJ 3T5WA 2AITA 2MCMA 3TXAA 2A6KB 5DHVH 2OL3L 4PTTB 1GPOL 2C9QA 2GI7A 2I5YL 4Z77A 4QXTA 2FAUA 2ICEC 2YPLE 4O2EA 2EINB 3CBJB 5C0DB 5IEKB 3LKSB 5C3IA 3S9DB 4IDJL 1ACCA 2R51A 1KG0A 4TL4A 3QHZL 3NRQA 4Y5YB 4MWFA 3HHMA 1NFDB 3FUFA 4W9FC 5C0CE 43CAA 2X4OB 5SWSA 2DRUA 4DP7X 5JORA 5I1LB 3U2JA 5ADPH 2QPFA 1PYWA 1BA9A 1G6RA 1ZSHA 4WHDA 1YHPA 1VEMA 1JHLL 1IGCH 4YL9A 1PSKL 4A1RA 1JGUL 1S9VA 1RSFA 3LZLA 4JVPA 2RHEA 1TZ8A 1CGWA 3K8KA 3DA0A 5SX4H 3MPCA 2C7FA 4XOCA 4NQVB 5MHSD 1EMTH 3OZ9H 1FZKB 4FG2A 1V7NH 4J3OG 5EIIB 2B15A 1G5AA 1SQMA 4MLSA 2A74B 5FAAA 3JWDL 1QFWI 2YRBA 3IBOA 2WXPA 4PREB 4WFGD 3DHUA 5J9PA 4G1EB 3KGUA 4MAYA 2ADFL 2GW5A 3A6CH 4FQHB 1KPVB 4Q4IA 3RNKA 4MNQB 1P7BA 5C0DA 5IEKA 1SN5A 4XO5A 5K9KB 3NABL 4UBDD 3VDCA 2HKHH 2YJQA 3STZB 4PGBA 4PRAA 4YSRA 4OBRA 4NUPA 4NQEA 4WFFD 1WCBB 2WKOF 3PJNA 4XNXL 2PP8A 5JORB 4N87A 2E74C 5FV2A 1SBSH 2BIPA 4TQ8A 3RX7A 2LT9A 3Q06A 4JQIH 1BPVA 3QUGA 4CN6A 2ZF9A 1HSAA 4KQ4L 3QEQE 2V17H 5C0CA 2R2BB 1A65A 4I3SL 4R8WH 2O26U 4BQ8A 5ADOL 3X3GH 3FTGB 3HC3L 4QRPD 5EN2A 3O2WH 1EHXA 2R29A 4PJAA 1RZPA 2YKLL 1B0RB 2G5BA 4M8QB 2MPAH 3QUYB 2HMID 4R4BA 3NH7H 2AMUA 3DXAA 3CVHH 1T4WA 1RZIA 2W9DL 1DJGA 2HJFB 1ML0A 4IEFB 3DSNB 3LZFL 3IAGC 2ZUSA 2XFXA 4UTAA 3ZHLA 3RKDD 3PNWB 4HHAB 3TN0A 2DQTL 4S0SD 1CF8H 2XTLA 3N50A 5E99H 1KCVL 4PJ5D 4IK7A 1W9XA 3RNKB 1UXLA 3NZUA 4ZD3H 1H3UA 4TXVB 2PR9A 1T1XB 1HQRA 1NEUA 1NQBA 1AXSB 1IC0A 4LRNL 4ALAH 3U7WH 2V0AA 3VG9B 3L3OC 3SY6A 5DUMH 5KOMC 3LCYA 3B5TA 1MFAL 4F91B 1YNKL 2IALB 4YXHL 1JD7A 4X5RA 5C9KA 3MV7D 9PCYA 1CXEA 4QY8A 1J0YA 3TCTA 1LO0H 3J7HA 2QZ5A 2DLHA 3RDTD 1Q72L 3CN2A 3E2HC 3TBCA 3WFBL 1UWXK 1DQTA 3D69B 3HNTL 2PCYA 4OGAC 1G94A 4UOW1 3AG1B 3TJHD 3FHEA 3BISA 3GRWH 1ZHLB 3Q9PA 4XXWC 1RULL 3C9NA 3UYOD 4Y1AE 3F7VA 4CGTA 3BZ4B 5E1HB 2OMYB 3OG4B 4O02B 5CCJA 1KZYA 1HJCA 3PL6A 2BSEA 4AYMC 2QADD 3L3JB 5JLZA 3QFDA 5IB5B 15C8H 3TN0B 4GRMA 3CSPA 1EUUA 3T04D 2F8OA 5E70A 3BPOB 4OCXL 1FSKB 3GSUA 3QNXA 4G9FA 1CICB 2DQDL 2XG5B 3H85A 4NLAA 5AQ0A 3X2QB 4JY4A 5BS0E 1V54B 2EVJA 2CPCA 2P24A 3PPSA 2BSSB 1KEGH 1JXJA 1ZVSA 3N41B 1O6TA 4NOFA 4KNQA 2ED8A 3LH8A 4N0CC 1P4LB 4Y2DC 4U3SB 5E51A 4LSVL 3RBSA 1VFOA 2X2UA 3IMRA 1VJSA 3QC6X 3GMOB 4G6KH 2E47A 1QSVA 1JGVH 3LY6A 3PHOB 4WSGA 3N44B 5AUMA 2XV3A 2NOYA 2B2XH 3HS8A 4HT1H 3TF7C 4FQ2L 3IGAA 1WZ1H 4NO2A 2FT8A 2J8UA 3S5LB 2APWA 3AXLA 5EDXA 4FLHA 3P9WB 3N40P 2BCKB 1DANT 3DNKA 5DRNB 4YE0A 3QJSB 2VITB 3VRIB 4AIXA 2PXYB 1NCHA 2ENJA 3KJ4B 4DN3L 5K9QI 2QQLL 3O6LH 2Z7UA 3ML9A 4JPVH 4KV5F 3P77A 3QI9A 4JO2H 4A68A 2R0ZL 5HYSG 4RVBA 4ZMQA 5F8RC 2HVKA 4TPRH 1KGCE 1NJ9A 3CVCA 4UV4H 3NCYP 3WKYA 3VFUB 1AP2B 1LO2H 2VQTA 4EIGB 1PZUB 5DJ6A 4OM1L 5HVGB 5EF2A 4G9FB 1E42A 4AYEC 3FXIC 5E6IC 5I18H 3CDGA 5EEXA 4Y89A 2BMKA 3LJ3A 4GXUM 4PJXF 3DURA 4C56D 4XN2A 3LB6C 4WFED 4YN3A 4N2BA 5E2WL 3RURA 1JSYA 5EWIL 4KO7A 5EO1B 2NY4C 2WO3B 4EIBA 3ARDD 1ETA1 2V3FA 2YD6A 3WMPA 3V4UL 3ILDA 1U8OB 1AR2A 4HZAA 2PWHA 5SV4A 2VLMD 3GT6A 3TWCL 1XGRA 1S7WA 1J5OL 1BF5A 4TYUA 4MCMA 5BZZA 4YO0A 1TZOA 1E9PB 2VABB 2XV2A 4K5LA 4MS8C 5BVPH 4Y5XA 1MW3A 1P1ZB 3GJFH 1YJDL 1DE4B 5HYJB 1I3RB 1S6NA 4HXAH 3VFPA 5JW3L 5EEWA 2QR0A 3SKMA 4Z7WB 4ILDA 4U1KA 1G7IA 1CLOH 1EZSA 1U2CA 4TQEH 1GZHC 2CG9X 2VLJE 2VE6B 1R75A 3KPNA 3CDCA 4PR5B 5CBEA 2KHAA 3NJVA 5DO2C 2ZUQB 2PABA 4J4PC 4XWGH 1YN7A 1CI5A 1P7QB 4B9PA 1U3HC 3KGSA 3AG3B 5FUZL 3D4ZA 2FYYA 3NBNA 1A6TB 4RMUA 3ABZA 2AAAA 2FX9H 1L9NA 4D0CB 3TIDB 4UIKH 4XP4L 4QWWC 1OZUA 1JF6A 4XXDA 1M71A 1TSRA 1B4LA 1MFMA 2VC2B 3D4YA 5EZLA 3FULA 1OQOA 3KEHA 1R47A 3GMQB 3EH3B 3NDYE 5HYSA 1IM3D 1DBJH 4KI5C 2VISA 4LCUA 3QULB 3HS0B 2IAMB 1EJ6A 3ISWA 4N20A 3BRDA 1TCMA 2LFEA 4NERA 5I30H 3WTUA 1EDHA 4K23L 1KFAL 3O6FD 4DVRH 4M6OH 2HH0H 1PVHA 2Q87A 4ZDHA 4E9LA 3QRLA 5D7JD 4I0PC 1YEIL 2JMRA 5TDNA 2I9TA 1AZZC 2NXYC 2OA9A 2MTAA 1DUYB 2A2QT 2IH1B 4QRTB 4GRLD 3PGFL 3MV8E 5DFTA 5LGYA 3LQAH 5DR5H 1S3KL 5D1QA 3BP7A 1HYSD 4S1QH 2ERJC 4YDKH 2LV4A 3QEHA 4N8UA 1MFEH 5FW6A 3N41F 3N1FC 4PP2B 4G8GB 3W1ZA 5CIPH 4P2QB 5D2LF 1LMKA 1EGJA 2CO4A 5TF1L 3WFDH 4C55A 1VDGA 1USQA 2QVTA 3LKNB 4M8RA 2ZOKA 1YNTF 2XNAB 2ZSWB 3NZ8A 1IKFL 2VAJA 4APXB 1CK0L 2Y2YA 1JCKA 4UTAH 4DP9X 4LLDB 3B6SB 2IDTA 1WBYB 1QASA 3QZWA 5J89A 3HJ0A 3TLRA 3EFDL 1MI5E 2IAMA 1G6RH 3KHQA 4B9FA 4UQBA 5J57B 4RAUB 1E4JA 2WTRB 4I1NB 4NKIL 4DZ8A 3O2WL 1YN6B 3DO4A 4JM0A 2VXQL 5I1EL 5ESVB 4U3CA 2YLKA 3CG8A 4NNPH 4N90D 2CBMA 3F6IA 4BZ1A 1UADC 2O72A 3KEDA 5B3JE 3LS4H 4CU8A 4OT1H 4PJ8D 5FYLE 1QAWA 2NY7L 3I75A 4GSRA 5DVKA 1F18A 5TJWK 3EYVB 3WFCL 2NUPB 3VDAA 3QEHB 4R7LA 1FI8C 2Y7LA 1MSPA 1A6PA 4BA8A 5DRXA 1S7SB 1BPLB 2HRGA 3MV8A 4X4XB 4ZUWA 5GS1A 2JTDA 3QG7H 4DKEH 2P5ED 1QSFA 5IB1B 3FCUB 4UDUB 2IPTH 1CURA 4GLRH 2JFCA 2X1PA 4FE9A 25C8L 3N9GH 3I3BA 2EE9A 2FX8H 3RDTA 1N2RB 4JFOA 5F7NC 3UH8A 3KG5A 4XHJD 3O2VH 5HGBA 3X1FA 3QUML 5GGRA 5CD3B 2FHFA 4FJZA 2HTKD 4UT9A 4JO3H 3MXWH 3D07A 1BOGA 2GUYA 1CXKA 1SZNA 1DVFD 5BCAA 2H3KA 1MREL 1H15B 1D5ZA 1F4XH 4BKSC 5JHLL 4J23A 3EO0B 3GLZA 4KI5F 2VZOA 4JAMB 5DD3L 4CW1B 3S96B 3KLDA 3G04B 4ABVA 1HEJC 5IMOB 2AJYH 1L9OA 4JY5H 3RTQA 5I73B 5CSBA 2OYKA 2P49B 3BZEB 1IC7H 3BWUF 1QO3B 3U25A 3NJXA 1I1FB 2FVNA 4M1GH 4NO5A 4I7ZC 1AI1H 2D7TL 5AZEH 4ONHB 5SWZD 3V0HA 1LP9A 3BP5A 4IRZL 1PPIA 2IH9A 4QHLB 1IO4C 3HMWH 5D7IB 2P52A 1WIPA 5FOBA 1JGLL 4I87A 2QMJA 4BGLA 4AUUA 5E0FA 4N6RA 3DETD 3A22A 4MKMA 1QPKA 2W0FB 4P46D 2LABA 1GPOH 1PKQE 2KBGA 3FB6B 3P30L 1OARL 4FGMA 2VXUH 4QXGH 4U1LB 5D72L 1A7OL 1QSFE 1JZHA 3HBQA 1BZ9A 3FQ4A 1IC4H 3RNQB 4OCYL 1HDMB 1PX4A 4PRBB 1UOLA 1DBMH 5F88A 1ZMYA 3FT1A 4Z8FL 1UXWA 3BOVA 2HFTA 4Z78B 3TBVA 4YZWA 1S9WA 5H37H 1IGFH 3I6GB 2ESVA 4G42A 2EEAA 1AFVH 2FBJL 3G04A 4QEGA 3U1SL 2Y6SD 4FEIA 4HOZA 1JK9A 1U8HA 4MD0A 1LEIB 1QFWH 2XN0A 1UXSA 2P5WD 1T3FA 3C08H 3HPLB 5F9AC 3CH1B 3MRJB 1MHHA 4R5TA 5IQNA 4PJBA 3SKJL 1PDKB 2ITCA 3TNMB 4CILA 1VKXA 5L88H 4P4KC 4F15B 4S1RL 4RMVA 1G7PB 3CLEL 4G8GD 2L7EA 3SDDB 5SV3A 2EYRA 5D7KE 3VUAA 4PRIB 1EMTL 5I0XA 1OPGH 1KCLA 2QJDA 1RJYB 1A3RL 1G43A 4AWJC 1HXYA 2D3JA 4WNQB 3UC0H 4MQSB 4DTGL 3BAWA 2CO1A 2DEWX 5HJDA 4ODHH 3AM8C 1PSKH 3LDBB 4P2YA 3RGVA 4GUOA 3UTTB 1TEFA 1S7RA 3V0AC 3VFNB 5D96B 2UXFA 1TQBC 4IRJD 2F54E 2D0FA 4J3OD 4P2RD 2QQLH 1D7CA 2GG1A 1AGCB 1DO5A 4ZS7L 4PJ7A 4N2AA 5DVMA 1MH5B 4GAYA 5K9QG 1CCZA 2E27L 1C5DA 1VZHA 1VGEH 2B1AL 5AG8A 1HHJB 3IN2A 4IK6A 2UV3A 5HHVL 3MV01 4AIOA 2PYFA 2WKGA 4L8BB 2BK8A 3C6SB 4IS6B 2LHAA 5D93C 5HHOE 3RWFB 5I28A 4A63A 5ILTH 2R9HC 3D0LA 2WYZA 1G0XA 4NNYB 1NUDA 4JG0H 2IOOA 2WAHA 1U3HD 5JUEL 4A2LA 4N85A 4ZUTB 4Y16B 2J71A 4Y5XC 3QUXD 1UB5A 4PRIA 2J57A 4LPXA 5E9DB 4F57H 1KXVA 2ED9A 4LVOB 3QJQB 1NCOA 5HI3C 4UYPA 4LLWA 3G5YA 2L7JA 3X3GL 2JKIS 3MYZA 1FH2A 3DUSA 1MHCA 5FM5O 2WZPA 1H5BC 4NWTH 1U3NA 4P59L 3RZCB 5TH2B 3ZIMA 1XMEB 4E42B 4R7NA 1YCSA 3MRDB 2PP9A 3D1MC 5BRZB 2C5DC 1BVNT 4LCIH 5F6IC 3BH9A 4H26A 4HS3A 3RGHA 3K5SA 4KXBA 4RZCA 5J6GB 1I8UA 2XX1A 5CINH 1GSKA 3HZVB 1HINL 3ZTNL 2BZDA 3AU1A 3QUYD 4DAGL 4Y1AD 1EIBA 4ENED 4POUB 1HHJA 1KJMA 4GUQA 3GJFA 4CU6A 1TTCA 2VDNL 1DEEB 4ODTH 2R2CA 4X98B 1YNKH 4YXHH 3N0AA 3NESA 1M2VA 2NZ9D 2R29H 2VR5A 4JO5A 3TA3B 3T2LA 3V8CA 1ZSDA 1CDJA 1RERA 3NJLA 3MOBL 4GT0A 3EJRA 4P3CH 3F85A 3TBSA 4I88A 1Q8MA 4OVUA 3FU8A 2NNAA 4QJ3B 2EO9A 3E3QE 2DWEA 4NIYE 1I9RL 4XN8A 3ASOB 1C7TA 3CDZA 5T1JA 4UOW0 1QBAA 2A6DB 3WNMA 3KJ4C 2OMVB 3QARA 5IBUG 3B4NA 4LF3A 1A7BA 4AYDC 1L5GA 3QISA 3NPSB 4HFUL 1D5XA 4QXUH 4N0UE 1IKNC 3CFDA 4BFBD 5C97A 3NMEA 1YG9A 3RRQA 3HBGA 3CSGA 1UM6L 3AZUA 2X4PB 1PNCA 1FE8L 4MS8D 3POCA 2LVEA 3TURA 3WKQA 5JZ7C 3L6FB 3IJEA 4FOMA 1FIGL 3ZTDC 1HSAB 3KD4A 2BCMA 4HMCA 5IHWA 1Z2KA 5EUOB 4HUKB 1PX3A 1TEYA 3LEYL 5I1AB 1OKEA 2L04A 4M93B 4QKTA 3Q2NA 2FSEB 4NDMA 4ODVL 3BQUA 5TQ2L 2PLTA 3CZUB 4GIOA 3QFJA 3MRQA 5LGJA 1AXTL 1EH9A 2CDFA 3L1OH 3WG7B 3GZOA 1P5UB 4L4VA 3DTUB 4XWOC 2DH2A 2WLKA 3GZKA 2HTLD 5CILH 5DHVB 5EZJB 4XCYB 4ZMAT 3TO4D 3CZLA 2Q3XA 2ZWZA 2OMUB 1VGKA 3QJVB 4GQ9L 4V2BA 2FSDA 2NZ1A 1U42A 1CJYA 3ZPDA 4AQ8A 4FXKB 2DN7A 1JPEA 2YSSA 3LKQA 1AGFB 2UZYA 3TFKC 3FTXA 3APCA 2OJZH 2R4RL 2B9BA 5AW1B 1FZMA 5AYUH 2WD0A 3LEXA 2E7DA 5CNHA 3TBYA 1IFGA 1JIBA 1OTTD 3FQNB 1K8DA 1BQHG 1JV5B 4CMHB 5MI0C 3VH8G 1XSIA 4TNEA 4DHLA 4MA3A 3O6KL 1MW1A 3HPJB 2WQUA 1ZA3A 1BBJB 4OBSA 1MNNA 3LSOB 3BIAX 1DJYA 3QZNA 3NT0A 4HP5A 4RGOH 3UJTH 2FB4L 1JZJA 3MKGA 1OY3B 2XIBA 2E6PA 2VXTH 3TO4B 2P7TB 4JPQA 4CVZA 3P9LB 1LM8V 2C9AA 4HX1A 4BRJA 3QFJB 5BVPL 3SDCC 4A7GF 1MDAA 3RVVC 3P4LA 3WSQH 5T5NF 2ED6A 5DHVA 4Y19E 1I1YB 1QFHA 2XWRA 2OMYA 5JMOC 3VG0L 3PL6B 2A74A 2H2SD 5C0BA 2OM5A 4YDNA 4FHBD 3MSPA 2ICCA 3NP4A 5IZ7A 4KJQC 4JPKH 3ECUA 2FLRT 2NW2B 1SBBA 1FL5A 1LDSA 4U0RC 1T4KB 1Z9PA 1U93B 4RRPA 1WWAX 3ETSA 3H7LA 4JM4H 1P0SE 3B5GA 2VN4A 3FRUB 5D70L 4YH6A 2Z34A 4WUUE 2K6WA 2CLVB 4ZUSA 1ADWA 1MDTA 1P4LA 3TT1L 3TBYB 1L0XA 1UATA 1KN4L 1QFOA 3LEYH 2CGYA 1DBAL 4QR7A 4XNZB 1ZK5A 2B1HL 1ZLUH 3F05A 3H6JA 1UKTA 1E6JL 1WV7T 3TN0D 3GMOA 4QYAA 1JHTA 1DCEA 4R2GD 4NQEE 2PPEA 3VYPA 5E5MA 3LSOA 3MJWA 4RFEA 5KJ4A 3S0PA 3GXDA 1FVCA 2E4FA 3DDGA 1KTLA 2YAQA 4XCFH 3QEQA 4KMQA 4HX1B 4OV6F 4L4VD 3MGOB 4Y9EA 4DESA 2HJFA 4XPGL 3DPDA 4PJAE 1RMFL 1D3CA 3ZU8A 1OCRB 1IJNA 5FO7B 4AC2A 5F71A 4O58H 3DKHA 3DX7A 3MJ7A 4XBEH 2XV0A 5I17A 2IDSA 5FK9B 1WTGT 4QHNB 2CM5A 1OAUL 3G6AB 4ENZA 5EUOF 1DVQA 2HTKC 2R29L 1L4IA 5E1QA 1TZIB 3BFOA 3DX1A 2CO2A 3SE4C 3V6ZB 3HAEB 1XX9C 2EDHA 1S9YB 2C9VA 4N0CD 1T1ZB 3LNFA 3NN8A 1Q9OA 4LOFA 1B3JA 3OM3B 5L0QB 1I8AA 2DJSA 2J88H 4UTAL 5C7ZA 1KFGA 2MQGA 1P2CB 1BQKA 3FQXA 3TBBA 1OGAE 1GC1L 4NO0A 3MNZA 5E5MB 2B0SH 1DZ0A 5HI5C 2A83A 2ZKMX 3U0TB 3SOBH 2C3WA 4POYA 2P5EE 5GHWL 5HHQA 2H9GA 2VH5L 3FCSB 4OFQA 2JF1A 3ZE1B 2DKSA 3EHBC 3JWNC 3FU3A 1BAFH 3WN5B 5EF1A 2QLVB 4MSWA 3SQOL 4KKQA 4YHPA 1DL7L 2IF7A 2J1KA 3HG1E 4I5BB 5CZRA 2WXOA 3GSUB 4U1MA 2YLHA 3WEAA 4DKDC 1ULVA 2GJZB 2WBWB 1QMUA 3CFUA 2D9CA 2D3VA 1Q0XH 2ZJSL 5CP7A 1WZLA 1IT9H 1T0MB 4K4KA 1KLGB 4KFMA 1DBJL 5GRJH 3U4AA 4ANXA 3PQYB 2JSFA 2V5RA 3MNWB 4R26H 4IIZA 5EBMA 3E38A 4GAGL 1EEQA 2KLRA 2PYED 1J8KA 4XMKH 4AG4L 4JRFA 3SB3A 1FE8H 5EO9A 1AOHA 3HTLX 5A6MA 3NH7L 5F7KC 3QUZB 4KX8A 5T3XH 1IGMH 2HAZA 3IGAB 2IC2A 4ZQKB 4NQVA 5FUZH 1V27A 4UIMA 2R8SH 5DZJA 3QCTH 5EBGA 1OGAA 3RKDC 4H1LA 2A9NL 15C8L 4M1CD 4CVUA 1JDDA 1TU2A 3VXOA 1KN4H 4DQOH 2R1YB 2J72A 1CGYA 4G72B 3T0EC 3WFHB 3STLB 3T3PF 5AOJA 5TDOB 1BM3L 1JI2A 2CK0L 5DJAA 5EU7C 4ABQA 2Y23A 1Y07A 3H2WA 3CFJB 2OCFD 2CGRH 1QZ1A 5BZWA 1TSHA 2IAND 2WV3A 2EICA 4EQ2A 1HILA 3RUGB 3CC5A 1I1CA 5FA4A 5F7DA 4ZAKA 3ZE2E 3A23A 4MX7B 2J56A 1UASA 1WBZA 4F58L 2QDWA 3HG1A 1NIAA 3O0RL 2VDPB 1UACH 4X0NA 2VN5A 4LARH 3HG2A 1WE5A 3PDGA 5DC9B 3RZCC 2Q76B 5A2KH 3WNPA 1WP6A 3S88L 3PV6B 4JN1L 1ZWIB 4EDWL 4P46C 1JDCA 3A0OA 4KJPC 4R4FL 3WKPA 4NZUH 5EZIL 5DS1A 4M4RB 3CHRA 2P4AB 1P1ZA 3KDPB 3RX9A 1M7IB 4B50A 5JQIB 4G8FB 1P4UA 2F2HA 1ZXQA 2A9NH 3PREA 4MJIE 5T5FH 5KVDH 3WUWG 4IMLB 2BERA 2ZYSA 1AQDB 3QIBA 4ZTOL 2ICEB 1WDAA 4WY7H 4HKBB 4HHWA 4PGCA 3WNJA 2PKDA 1C16A 3UTZA 2VL5B 2H0FA 5EU5A 4B5ZA 2R2EB 3X11B 2Z0BA 4M4PA 1T80A 4IBSA 5EA0L 3VE0A 4K8RD 1U9KA 2O4EA 1DQQA 3I3EA 1TO4A 1Z9OA 4LT7A 1ZDSA 1FYTA 3VSUA 5GGRB 2OFQA 3GIVA 4JFDA 4YHKL 1QVOB 3MREB 5B38B 3C09C 5BJTB 5KSVB 2YGNA 3MRIB 1KGUA 5F7AA 4Y5VA 4FADA 3L5JA 2Q8BH 4ES8A 5E9DD 1MLBB 2NY6B 5I1JL 1G7QB 1VADB 1TUPA 4EBQH 2VMDA 2W65A 3QJFB 2VLKE 3TNNA 1L0YA 1IVTA 2COVD 2ADJB 3GJEA 4BFFA 1T5XA 2WBJB 2MOQA 2XTJD 4JDZA 5KTEL 3IRCA 4JPSA 4KV5E 4PJ8C 3II1A 2GHZA 2L7QA 4HGWB 3IJ9A 2X4TB 4HEPG 5CZVL 1ASQA 3GKWH 4PJCF 4PWFA 5E8EB 3ZRSA 1RD6A 2V9UA 2C1OA 1YEHL 3E1F1 2Q6WB 3IJ7A 1RULH 5DCCA 2NUTB 2Q7YB 2QTVA 4G8GA 1FC2D 5EU6B 1IQDA 5FOBB 4G6FB 4YBLC 4JO1H 3NIGB 3S3DB 2ZX8A 3B7RL 1YMHA 3HEIB 4R4NC 1D7BA 3QNZA 3FH5A 4L3EE 4QRRE 5DI8A 3WMQA 3IFNL 1D2OA 2V2WB 4WO4B 1A7NH 2K78A 1XT5A 1QA9B 3H9ZA 3R7RA 3SDDC 5IJBC 4LLQA 3LRKA 1M7DB 4Y5VB 4YFDB 5KZCB 5C2BH 5F21B 3TO2B 5I2IB 1PZSA 1ZVYA 4CDGC 4BXVA 5F3HB 4LVNC 3IFOA 3REWA 4Z8FH 1UA7A 4JFDE 2RQEA 4K94L 3WKML 4MB3A 1EJOH 3O9WC 3V52L 1RFDL 4XRCB 5IFAL 4LNRA 1AQKL 2AF2A 1B6DA 2XOTA 4A55A 2D7QA 2O5ZL 3F00A 3VXRE 5TE6H 1HINH 5HDLA 4ZW5A 2CIKA 1IFHL 3VNYA 4L18A 1XL6A 2V9QA 2JI2A 2VJ0A 3BWAA 4Y4HC 3W56A 3ATFA 5IQMA 4PJBB 1JPSH 2F58L 1ZJAA 5CSZA 1R3HB 1Z9SA 4BFKA 2JCCA 4OV5B 4IBVA 1ETJA 3QS3A 3JT0A 2ZCLL 2H3XC 3TFKD 4XN1A 2DEYX 2G75B 2BVTA 3H3PL 1A9BB 2DLEA 3RG1C 4P06A 3KCPA 1QRNB 3LD8B 1IAIH 4XAKE 3RTQD 4QTHA 1BQLL 1BIIA 3IAQA 1DHKA 4G6AD 4Y9CA 3KNBA 2VMJA 2WMPA 4ONFH 1NL0H 3HUJB 2FK9A 5EWIH 4QRRA 1QBMH 3F04A 3ZDZE 3HHSB 4PRPB 4NQCE 2X6CA 5FGCB 3ML8A 3DOHA 4M7JL 1H15A 5FR3A 3JV0A 4HIPA 1I9IH 4NN5C 3BDXA 2AQRA 4NO3A 1N67A 4L8BA 4OLZL 5I5IA 2ZCHL 1IZJA 2YFOA 2KLSA 5DK0A 3UC0L 2ATKB 2AK1H 5D2LE 5AW4B 4PBDA 1E5ZA 2K3TA 2VB5A 5IB3B 1URLA 4UT9L 1QFPA 1AVAA 4GIPD 4AOFA 5D7IA 2JIXD 3WL9A 2Z7WA 5CLWA 4JFYA 4A7VA 3S8FB 4BJLA 1NCCL 2X6BA 3ECQA 1M71B 5LNEA 4HHGA 2EE2A 1LP9E 3KVDD 4ELDA 2X53A 5BW7A 5TH2A 4E42A 1IM3A 2YZ8A 4WHYH 3R0MA 4P5TA 4OFDA 3MCLH 2WC7A 4BZYA 4WU7A 1JN6B 1GAFH 1KMGA 3BVDB 1YEKH 1I8LC 3SE3A 3RNQA 2NY3B 1PKQA 3V4VB 1MJUL 3C09B 3QXDB 5LCVL 4Z3IA 3L2NA 1OHZA 3X13A 4KZDH 4QT5B 3K4AA 4RISL 3TBVB 1XQ4A 2VGLM 1E30A 2F68X 4U7SA 1NGYB 1R0AH 4CKQA 5BZDA 1E27B 1HIML 3BWUC 2NY1C 5D7JC 2PCFA 5E2WH 5J13B 2NY2B 2ATKA 2IH3B 4ZUUA 5GS1C 5CJ5A 3MBEB 2GHWB 4JREC 1RZ7L 1UM5L 3CFKA 3TT3H 2FJFB 3BPLB 2XICA 2OMZB 4HK0B 3TBWB 3TYGH 2DMGA 1U8QA 5C0IA 2WZ0A 2ZOKB 3SDDA 5D1XA 3BVNB 3WKNA 4L4TE 3NZ8B 4KX7A 4QCIB 1NDMA 1F13A 1GCYA 2H41A 3E1ZA 4WQOA 5J7CC 5E23A 1RUPL 3GMMB 5IQOA 1A0QH 3ZKMC 1WFMA 2J6EH 4OD2A 3RP1A 1XBRA 3QAZB 4YDJA 4ISVB 3SO3B 2CKBB 1IBHA 4HWEH 2XIDA 1W72B 4YSDA 4R83A 1ZEAH 1UD6A 3CZSA 5DXWA 3FU9A 3GMPB 3VI4E 3DBSA 1LE5A 3QDMA 3MZGB 3MLSH 1JDAA 1UWFA 1ES0A 3G5XA 4F2FA 1YN6A 3QDAA 4FG6D 3FB5B 4K2UH 5GSRA 2I69A 2K8MA 4FQIL 5IQ7H 2EXYC 2H8PB 5LAXB 1WG3A 2B7DT 1FNEB 3B9VA 1MCWW 3MLVH 5DQ9B 1FFTB 3Q43A 4K7FB 1X5HA 2P8PA 1BZOA 2WP3T 1OAJA 4I4WB 1XFPA 4LOVA 5DZAA 4NNXA 3BZDA 3EYOB 3DO7A 1S8DB 2AAVA 2EC8A 5EEZA 2Z0UA 2F8VA 3T6VA 3VYOA 5HHPA 3D50A 4JFZH 3HUJF 5IMMA 2V8MA 3MV9D 5ADOH 1F97A 2F5BH 2HFFA 4RGMB 1I7ZB 2ZXDA 5I5RA 1CI3M 4M61B 1TVHA 2HT3C 2R2HA 4X6EA 3DX9B 1OAXH 1ID2A 3HFML 3IBEA 5FGBA 4JPIB 3GRWA 4EN2A 3WSQL 1K4DA 3C60A 1U8CA 1AXIB 3QO0A 3FT2A 1BD2E 4RWHA 4MCNA 1TQSA 5LBSA 4NKOB 4AVKA 2H0JA 4YHIB 1RQ5A 1U41A 1ZS8A 2OTWB 3EOBA 3P4OB 4YGVA 5BQ7A 5BNXD 2JQMA 2BJMH 2DJ4A 2XZQH 3ME0A 3QDME 4FABH 1U8JA 4KXDA 5CF3A 3P9LA 2QBWA 3E0GA 4R4BB 1FCGA 1NGQL 4V1DD 3TZVA 1KPUB 1SFDA 3PWJB 2Z4QB 3QJHA 2QSCL 2D73A 2F8XC 2R4RH 3V6OC 4WJ5B 5MENB 4X6CB 2DL9A 3EHBB 2AQ1A 2QADB 5D5MF 5DFAA 5C7XL 2QHLA 5E5RB 1CIDA 2CMRL 3HMXH 3K8MA 4X99B 3QQ4B 4GQQA 3IS0X 4KU1A 2J73A 2PWFA 1EHKB 1ZVHA 5ETUB 5DGQA 3D9AH 5D7LD 3U9WA 2JJSC 4QRAA 3SPCA 1RPQA 2XFGB 3VFWA 2X6UA 3N42B 2CLVA 3DETC 4P2QD 3BE1L 1SMDA 4LXFA 5IQLA 2Z7YA 2EDXA 2VJXA 2APTA 4JDTL 3QO1B 1RZGB 4HAFA 3IMWA 2VLRB 4HC1L 1BQSA 5FGBC 3EDDA 1XB6A 1EHLH 3JSSA 2WXQA 1BD2A 2BM3A 4AKPA 2WINA 2XUWA 4Z0BL 1S7VB 5G4NA 3EADA 2PPDA 1X3DA 3MLWH 1XH3B 3PJSA 5JW4N 3LZQA 3BQUB 4MNQE 1A7QL 7FABH 4OFPA 3MGAA 1FL3A 5GGSA 3MLUL 4I9WD 1NLBL 2J4WH 4B60A 2IBGA 2Y7SA 3DIFA 4XC3L 3F7VB 4KJYA 3I50L 4DP0X 4O02A 4OM0L 5L4MA 2NY1B 1HCZA 1N4XL 3KW7A 3S7GA 1NGWA 4UNTA 1HQ4B 4HOXA 4RA3A 4OJFL 4KI5D 1CICA 4P4RB 1WGVA 4RFNB 4PJEF 2C9SA 2KUTA 4JY4B 1K6QL 4NZFA 1F90H 3MTXA 2CGZA 3BDYL 5F0MB 2EVGA 2BFVL 2NY3C 3TO4C 2OL3B 2E7CA 1XR9A 4KOBA 1FNSL 1MXDA 4KRLB 4ONOA 5KS9F 1IGCL 5BO0D 3EAKA 4K3JH 1V8HA 1WFOA 4PLJC 3LRSB 5AW6B 1A4JA 3SGEH 3O6FB 5ENWA 1RUPH 1B2WH 4JGUA 4XPBH 1E5UI 1KXTB 1E4XI 3MODL 3K71B 2ATPB 3HJEA 1XH3A 3PJSB 3W57A 5CBAB 2H9GB 1I3GH 4TULH 2VSKB 2VITA 4XNBA 2YGPA 1ADQL 2FL5B 4YNYB 4RAHA 4PV1C 5MP6L 5J56B 2F18A 2NT1A 1YDPB 4PCSA 3BT2L 3VG9C 2WBXA 3OX8A 2XPZA 4S0HA 2QTEA 2AABH 3WIHL 1KB5L 1IGML 3V0VB 5KSBF 1Q1PA 3A24A 4AVIA 4R7NB 1U93A 2WQWA 1VLXA 4JPWL 3T0EE 3T3MF 3BUPA 3FUMA 1PS3A 2GYSA 2OP4H 5FO2A 1EHAA 4GRWE 4HS3B 1YEFH 2DLFL 1SPDA 4OLUH 3OKMA 1LNUB 5B1CA 2IBBA 1MAKA 2BNQB 3DVFA 5DC4B 1JVKA 4LK4A 4A7GA 3LKOB 4G7RB 3QSKB 4P3DB 3OD3A 3T8XB 5FKAB 5FF6A 1HS6A 2XV6B 2XQ0A 3P54A 3QG7L 3QQXA 5EPMB 3WV0A 5ENWB 4DKEL 4XNDA 3QUYA 1MLCB 3MV9A 3M7FB 2ALWA 5SX5H 4ZTPH 1II4E 1NDGA 5JPNA 4XB8A 1TZAA 4F7TB 5BUPA 5I19L 1Q94A 2NY5L 3CVHB 1NKGA 3I6LD 3LRGA 3RAJH 4Z3HA 2VDKL 1AS6A 3R4RA 4IYKA 4PEEA 5DHYB 3V0IA 4KJWD 4BFOA 2JXMA 5C2BL 3C87A 3QIWD 5D7KD 1GGCH 1NMCC 4I8DA 4O2EB 1IM9D 2BIIA 3QYMA 5JO5A 1TETH 4XOAA 5FO7A 5J6HB 1INQB 5IHUH 3AUWB 4NM8H 3AGWA 1CB4A 2D7NA 5FHBL 3CZGA 4LLVA 1SXAA 3D05A 2Z92A 3U4EA 4KMTL 2FNBA 3TEZA 1Q72H 1A02N 4PUBL 3CFQA 3JV6A 2TSBA 1AHWB 1IUZA 1QBML 4UQIM 2DPKA 2QQKL 3QZBA 2IV9A 5DZPA 4WJG3 3ILQC 4Z3FA 5I1LA 1QFWL 4HIEB 4R9HA 4AIZB 1EHLL 3NIFE 1EHNA 4ATWA 1WEJH 5I71C 4XNQB 5TD4A 3PWLB 5F9JB 4KH2A 3N55A 2OULB 1S9VB 1QLEL 2K1MA 2OJ1A 2A4ZA 1AKJB 4TUKH 5EFIA 1NGXA 3VD4A 3QJUB 2NQCA 5SWSD 3H9SB 3KPRD 5MEQB 3MV9B 4PS4L 1SYSA 1MFVA 3HE6D 1P5UA 3L95A 4I0PB 1PLGL 1BGXL 1IC5L 4HJJL 3PFQA 2PTUA 3B34A 3GSOB 2I27N 2G2RB 1VA9A 4G70B 2WQRA 1X9QA 1FN4A 4RDQF 3DSFL 3O9WD 4FLSA 4FQHA 3N04A 5FKPB 4AGQA 4MA1B 3LKPB 2ROYA 1JGLH 2XPGB 3HS9A 1B90A 4MHHI 5GRZA 2EE6A 3V52H 5JIQA 2XLLA 4A7SA 1L7IH 2QGDA 1DFBH 2OZ4H 4I3RL 3U0WH 5GS3A 4ZX5A 1U8MA 5E5LA 2X4RA 4LOEA 1D5RA 1XF3A 4GQRA 4P48A 3CMOL 3GD1C 1MN4A 5HYJE 2ARWA 2OYPA 1R24B 2V3DA 4WW2F 2A6IB 2YEZB 3IE9A 4NENB 4HS8L 5I1CL 2ZUYA 1BBJA 3HE6B 1HH9A 3LNDA 3MRMB 4HZLB 5EN2B 2FO1A 1QQDB 2DMCA 5E5UB 3NCYS 4N5ED 3SE9L 4Z7NF 5CR1A 4KQ4H 1FO0L 3K4DA 4OU3A 1KJ2H 4JQIL 3HFMH 4OCMC 3KPSB 3SGEI 3LDBC 2W0PA 1FGVH 2BH0A 4HH8A 4QRFA 1T66D 5AOKA 3T6ZA 5C0BB 2KQMA 2JKWA 1AIZA 2X42A 3LIZH 2ZCHH 3GXNA 4X4XA 3SPVA 4JFFB 4FQLH 4Z7NE 3BEWB 4Y2OA 2VDOH 1NDTA 1JF5A 3NK4A 4XP6L 3NABH 1L9SA 5IROC 4K7PY 1NCGA 2Q9OA 3GXTA 3K5RA 1CO1A 3QIBD 3LV3B 3FBKA 4P46B 3VD9A 5LN4A 1QUNA 3K74B 4EF3A 1TYEB 4LKXA 2MFNA 4OJDH 1XBDA 3MUHL 4O02H 3C5SB 3MV11 1IBDA 4FFZH 3RGBA 1LK2B 5DMYA 4OSUL 4XMPH 4PMEA 4OT1L 4Y1TA 4FQIH 3OZ9L 4D8PB 5INCB 1MCCA 1JHKH 1SEBA 2X7LA 2XZAH 2R56L 3QAQA 4TSBL 3CQFA 2NY2C 4U1JA 2VDRB 2O6FA 3KXFE 2V3EA 2MNUA 3QCTL 1ONQA 1JGUH 2X87A 3W81A 4F37F 5I8EA 1TJMA 3NSDA 2XVGA 1UWGL 4P5TD 4J8RB 4M7ZC 5IMOA 3BVTA 3BZFA 4U1NA 1H5BB 4UU9B 5DEFB 4XBGA 3FU7A 2N3JA 5T3ZE 2NZIA 3NCCB 4S2SB 5ACMA 3SE8H 4R7DA 3EGDA 5JYMA 1AD9B 5CSZB 5I1HL 2ZX6A 3FCGA 1AQDA 3QIBB 4KHTH 4GQPH 4ONHA 5CJ8A 3AY2A 3UGUA 4P4KD 3NVQA 4OIBA 4Q9RL 4UZSA 3QDHA 4WV1A 2G75A 1OF2A 4X5QA 2VXSH 4ZSOA 1U33A 5AVXB 1DBBL 1N7MH 4QRBA 4PS4H 5T3ZL 3WHXB 5C0EB 2NT0A 2JKTM 3LNEA 1QPPA 3N43F 3B83A 1EJFA 4UQEA 1TO5A 3EGXA 2AEIT 3SCMC 1K4CB 1KDJA 3JWOL 1KEMH 2HN7B 3VM5A 3H56A 1IE5A 1JFHA 1AG0A 4B95C 1G7QA 1VADA 1FYTE 5T1MB 5SWZA 3EBAA 3VI3F 3RPIA 4TVPH 1KGXA 3FQRA 5I8EB 5EO0A 3BP7B 1AR1D 3MRKB 2EEDA 3MAWA 4U6VH 1B4TA 5DK0B 5GSVB 2NXZB 3Q2WA 3J8F7 3QIWB 4AH2A 3CH1A 2GBAA 3MRJA 3EGDB 3C2AH 3ZKNC 1PD6A 3L5XH 3M88A 4AK2A 2LE9A 2OW6A 1B6UA 3ERXA 4GYBA 3VI3E 3PWPD 3DYOA 1IQDB 5SX4I 4JFYB 5A3IC 4X6FB 2WLIA 5FS5A 4GSUA 5FGSA 4RWYH 3KL0A 3MLXH 4WHYG 2VDLB 3OLIA 1S7RB 2ZWLT 4LU5H 3L3DA 2OTUB 3CU1A 3VCLA 3H0TA 4WU7B 4YBHA 4JJOA 3VFSA 1GKOA 2Q3ZA 2WTRA 3K4ZA 1KIQB 5DJCA 4X6BB 4B5EA 2GSMB 3HW7A 3QK0A 4TSCH 4UTBL 1CXFA 3LIZA 4WI0B 4YC2B 3US9A 4N0YH 4NQED 1QBLH 4E68A 2OKMA 1HZLA 3VXNA 1Z1WA 4CRPA 2WQSA 5BUAA 4KXCA 1VPOH 4Z7WA 5EU6D 4ELMF 3AWGA 5KVMC 1BFSA 4QHMA 3MV7E 2LOEA 4HGMA 2VERN 2APXA 2PO6B 2VDRL 1CE1H 2YMXH 4F8TA 2YAEA 3ZKSD 4ZUTA 2OMZA 3CVIL 4YDZA 5GGTH 5C70A 1ZJBA 1EEUA 2M26A 3Q1SH 4GI9A 1HILB 3RUGA 2HCZX 5IW6B 5CLTA 4KHXH 2W0KA 1A9BA 1N19A 1TF4A 2X10A 4BKLB 2JCCE 3FO2B 3MRHA 2IG2H 5GS0L 1NCAL 3FOMA 2W0LA 2GTZA 1DDHA 5JA9A 4DZBA 3B7TA 4IKJA 2ZIDA 1RVFH 3SGDI 3V6FA 1J5IA 2UXVA 3PV6A 1Z3GH 3L9BA 1G9NH 4PAZA 1NM4A 2V5SA 4HF5L 3ZL2A 3ARED 5TDNB 2I9TB 4K8RL 3UEQA 4PJIE 1GGIL 3VXNB 4RNRB 1Q9KA 1KN2H 4WCYL 1NUFA 2K9UA 4NQCA 1RHFA 4NSKA 3ZTJG 3QUHA 4JNXA 2BVOB 1TTUA 1Q4NX 4EZJA 3ARDA 1NIBA 3MFFB 4EKJA 5FFLA 1NA8A 5HVHB 2XIIA 1J8HB 3G08B 3UTZB 4R90L 2TRYA 2VMFA 2WCPA 5BMFH 3OHXC 4L8SB 4P57B 1ZLVK 2ZUQC 5ERWA 4NP4L 2XWBA 4ICXA 5JMRA 4XVSL 5EC2A 4U1LA 4Y0GA 3WL9B 2XDHA 3S2CA 3ULSA 5CCHE 4PG9A 1RP9A 1THAA 3JV5A 3MRHB 3MRIA 3MVSA 5ICYB 3QNFA 5T1LD 2L7UA 4NGHH 3HZMA 5LWYL 1FCCA 1NICA 1NOLA 4LEXL 1EEZB 4HEME 3SDXE 4PRHB 5C07B 1G87A 4WFEE 4WW1A 5FUCC 2Z91B 4N8VA 4KBPA 4QO1B 4NC1E 4BSWB 2A4EA 1UVQA 4OI7A 3UTSB 5KVEH 2R69A 5I66B 2ISDA 3Q1EA 4MD5A 1JPST 5TE4L 5D7IF 3O4LB 2FR4B 5TDPB 1DUZA 1YY9D 5CHNA 1E4WH 4YDMA 1KWKA 1NC4A 3S4SB 12E8H 4XZUA 4N2KA 2YXFA 2VLLA 3AS2A 2MOGA 2BWIA 3CFMA 5T8IA 4BSJA 1LGVA 1CD0A 1RJYA 4NQXA 1NCWL 2HT4C 3EYQC 1I8LA 2VR4A 1UURA 3LRHA 4UDUA 5IV2A 4RQQA 5J0BA 2JH2A 3AFLA 2VLJD 2OCCB 4Q97A 1NLDH 2GAZB 4IMKA 1N2RA 3HFFA 5JDJA 4WLCA 4ZQTA 1JWSA 1KV7A 1XAUA 3L9YA 1FFQA 3V6OA 2XQBH 3BHBB 5IESH 4FXGC 5D1XE 1E6OH 2OSXA 3N91A 1XGZA 5EIVA 2D7PA 3LVTA 3BQUD 5KVFE 4ABUA 2BVUA 5LLIC 3IFOB 1QSEE 3REWB 4BCZA 2E7LA 1MFBH 4C58B 1IBGH 4HWBL 3VMPA 2FZ3B 3PDOB 4JB9H 3HS0C 4TRPL 4L0PB 4P23B 4AVJA 4ZO8A 3BKCL 1TQCB 2HLFC 1XSKA 4D9LL 2VT0A 5IB4B 3O11A 1KT2B 5EOQL 4AUYA 2ZKHL 1QYGL 2P7TA 2OSLB 1G9NC 3GRBA 1A4KB 4UQ2B 3ZL4H 2BY0A 4GAFB 3TU6A 5K1NA 4RSVA 3D0VA 5DMKB 5CUSL 4FTVE 1G7MA 1YNLL 1CVSC 2OPCA 2I60H 1DP0A 1UB6B 5KOVC 4PJAF 4U1SA 3KGRA 4PP1C 2DLGA 5HVHC 3EBGA 1XIWA 3U7YL 3KWVA 3OKEB 4V1DA 2MKLC 4X4ME 4ZW8A 1CDIA 3TZVD 1AQHA 1LK3L 4HXBH 4TVPD 3WNKA 4P2OD 1YY8B 4GAJH 1EAQA 1S7TB 3INUL 1I4FB 4JKKA 4WKZA 5C6WH 1RZKH 3W11D 3DC0A 1F11B 3L7FB 4YUEH 4HS8H 5I1CH 4IJ3B 2ITDA 3T4AB 3ZDXE 3QDGE 1G7LA 5HY9A 3N2JA 4N5EC 4KDTA 5CIPB 4R96A 1H3VA 3O3EB 1JHTB 1NCBL 2XKNA 3IDIA 5E9NA 3WXVL 4XZ4A 4HJGA 3ARBB 2GVYA 4RESB 1PJWA 4IOFD 4PPTA 2HKFL 5IFHH 1NCDL 3D51A 5L9DL 2R59A 2GUOB 1WHPA 3TZVB 2J7LA 5TPWH 4KUCF 5E1AA 4FQQA 3WAKA 2X70A 4Z77B 2AJSL 1OCOB 1UCBH 2NZ9C 1IC5H 1A0QL 1JGEB 2AXHA 4GY4A 4RSYA 2X9ZA 1S7QB 1KBWA 3BLBA 5TE4H 4IKKA 3GSNA 3NAAH 4FQ1L 1T7VA 2OR7A 1JFQH 2WWMD 4XE0A 3CFDB 4QGTA 5FK9A 3KPPB 3CFBB 2MQ3A 5AD0A 1BP3B 2GK0B 1I4FA 5IQ9B 1QSZA 4BQ6A 1OPGL 4LRIC 2BW5A 3HKZA 2BHYA 3AG2B 2PPCA 1LNUA 2ZE0A 5CEXB 2VXQA 3QDJD 3GSVA 1QACA 2V2XA 4ZMNA 3WNNA 2EDFA 1YUHA 4BZ1L 3T8XA 1P2CA 1F8TH 2FSEA 5CJQH 4XVSH 1GL4B 4KMTH 2PYFB 5D5MA 3MNZB 2ADIA 5F7LB 3ARBA 2P26A 3U1SH 1A1NB 3Q2LA 2PCPB 3NACH 4P2RA 4BFIA 2D8KA 1NDGB 2I7OA 3Q5YA 5MEOA 2GFBB 3R8QA 1BCIA 2QVMA 3EJZD 3GGWB 1J18A 1R5VA 3SQRA 1O6SB 3V4PB