2WP3T

Crystal structure of the titin m10-obscurin like 1 ig complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
RGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIRSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/structural protein
molecule keywords OBSCURIN-LIKE PROTEIN 1
publication title Structural Insight Into M-Band Assembly and Mechanics from the Titin-Obscurin-Like-1 Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 99
sequence length 99
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2wp3T00
2NY1C 4HWZA 1Z5LA 1WV7T 3B2UC 1D7FA 2HG5B 1IKNC 1KLUB 3NOIA 5EORH 3TO4B 3RL2B 4X0KB 4Q9QL 1FZKB 1FZJB 1SJXA 5EBLA 5D7IB 4J3OC 4HH9A 5JDJA 3IXAB 1VERA 4LVOC 2OM5A 3U82B 4PB9L 4R90H 1GRWA 4G8GE 4CL7A 3QUKB 4HMDA 5IFHL 1I9RH 2VDKL 5GRZA 4C83A 1MCWM 3DRQB 3ISWA 1RZFH 2IQAA 3BZEB 3CAFA 4D3CH 3BUYB 1B4RA 4NNPH 2FECL 3FMGL 4WEBH 1AIFA 5K59F 3D69A 4KPHH 3TVMA 5K9QI 4OT1H 5I74C 3X12B 2BY1A 5E5RB 1PLGL 3SDCD 3X14A 1HSAA 5DJCB 5D7IE 3QXWA 2EYSB 5DT1H 1CDBA 2OI9B 4PGEA 2GHWB 4PJDE 3ARGB 3LD8B 3WN5C 2YN3A 1KIRA 2FIKA 4XMPL 5JPMB 2DWDB 3WJJC 1F2XK 1LEKB 5D1QC 2VLRA 2X9YA 1DFBL 4R7DA 1O7VA 5E2UL 1NQBA 1U0QA 3FN0H 1FJ1A 2AJZA 5FO9A 1P4LA 2NY6C 3I6LE 4RFOL 5CJXC 1HQ4A 1S5HA 2Z4QB 5IM7B 3RVWD 4E42B 1HXYA 1J0YA 5L8LB 1A6WL 4WDIB 4P2RD 4LLQB 1CK0L 4RAVB 43C9B 4B0MM 2A83A 5BO1H 1ES0A 4JM2F 4HCRH 1AO7D 2UVFA 3ZE1F 4IRSD 1CL7I 3QRFM 1I85C 2ESVB 3LV3A 3S98A 3GJFA 5DD5H 4LIQE 1KLFA 4FNLH 5DC4B 5GSRB 1IZKA 4DTGH 1OWRM 4MSWB 3EYFB 3PWPD 4GW4A 5FOBB 4QOKB 2BXYA 1IGIL 1ZTXH 4OCRL 1AKJA 2NY1D 3VFOB 1ZVSA 1EGJH 1D5IH 1A21A 5AYUH 3E6HB 5CKAA 3B2UD 3D2UB 3HI6H 2C3GA 4W4OA 4OGXL 4YHPA 5HDBE 3BPCB 2Z92A 3HUJB 3WFDL 2ESVE 3K4DA 1RMFH 5I16A 4LCYA 1JHLL 3QDMD 2FATH 2OK0L 4XBGB 1SJVA 1DSFL 5EFIB 3WFZA 4QOKE 4EQ2A 2WIIA 5E95B 5E70A 2YKLL 1KBGL 5EU5A 1WGOA 3ZL4L 1T4KB 4FQPA 3L7EB 5IT2H 3I6GA 4LLDA 4OSUL 2E6JA 5SWZE 1QSED 1EEQA 5KSAC 2PW2A 5DD0H 4OLVH 3KPSB 5L2KD 3MRGB 1BF8A 3DX6A 1EEZA 1S7RB 3O45A 5CP7B 5DFWH 3GIVB 1QPXA 5D1QD 4KQ3L 1QBLH 1IAII 3VXUB 1X9QA 4WNQB 1YNTA 3W5NA 4I8DA 4LKXA 3EIFA 3DVFA 3RTQB 2Q3AA 1U8LA 3DROB 4M7ZC 4U6YB 2VXUL 1HKLH 1J5OH 4NUJB 4GO6B 2NY6D 1HZHL 1A7PL 1F5WA 3V52H 3KPSE 1HHIA 3DNKA 5JA9A 3NFSL 1GPOL 1QSFA 2CLVB 4R97C 4RISL 4FRWA 3FRUB 1A64A 1TNMA 3RWEA 1VHPA 4NHUA 5ENWA 2C4XA 3VXUE 3PGFH 2WUCL 5IFJB 2ICES 5ANMA 5D93C 2XQYK 2OP4L 4NYLB 4ZFZB 4DZ8B 3VXPB 2OZ4H 1JZ2A 2Y25A 4YDLB 4U1SB 4HUMB 4OLYL 5EU3B 4HZLB 3CPLB 5H2BB 4D9QE 2R39A 4GSDL 2JCCF 5C0NC 4CGTA 4N9GB 3RA7L 3MOBH 3GZKA 5TF0A 4OTXH 1R3LA 1NCUA 2RFXA 3HZKA 3C09B 3BMVA 2ED9A 1IEBA 1OD7A 1MAKA 1SBSH 2V5MA 5JLZA 3S4SB 1FFQA 2AXHA 4NQVA 3BT2H 5DMGC 5KN5A 3O9WC 2AK1L 5EN2B 4KY1H 4QY8B 3DIFA 1INQA 1X5LA 4JPWH 5DA0B 3MYZA 3FB7A 4ONFL 2W9DH 4ONHA 3NZHL 4Z77A 3D25A 3VFMA 5I1CL 5DURD 3GSXB 4B7LA 2A9NL 1JGEA 3I85A 2XPGB 2IQ9L 1CGUA 2QSCH 3GSVA 2KQMA 4JM4H 1MFAH 4Z8FH 4JFDE 2VLKD 3TESA 5DFVC 5KSAD 5I30H 3QRGL 1YNKL 3UTTD 2B7DT 3BZ4B 5I1AB 4LL9A 4TVPE 2QQNH 3DMMB 3JUYA 2BOCB 3QFJB 3QO1A 4K94H 3UX9B 2EXWC 1JUFB 1EEUA 2IPKB 3B43A 1S7UB 4G6MH 1MCPL 2VXTL 4D8PB 2IMMA 1XF3B 3I3DA 5HGHA 3EOAB 5EO0B 5ICZA 4BH8B 2D7QA 5C0BB 1A7RH 1MCRA 1DQDH 4L3CB 5TE6H 4R2GC 1J86A 5T1LA 2J5LB 1PQZA 4CADA 1FLTX 2FL5A 4XNYL 1QPPA 1RVFH 2K7PA 2V2XA 5LCVL 3WS3A 1IAKA 2XKNB 3QFJE 3MXVL 3WIHA 1MCNA 1Y6NR 1FG9C 4PJFA 3QIWC 3OZ9H 1TIUA 3QEGL 5C0BE 2GFBB 5LGJB 3FB8A 5KVMC 3K46A 4LEOA 1C16A 4HPOH 5C0CB 1J05B 2P5EA 3AROA 3FFCE 2HFFB 5AAWA 3MO1B 3OJVC 4S0SD 5C0ND 3DGGB 1EO7A 1FRGL 1U41A 5E6IB 3UTSB 4S10A 2BC4B 5DQ9A 2XFXB 3QWOA 5KVDH 3MSPA 3OR6A 4FFZH 5I71C 4EI5B 1G0XA 4GKNA 4U1GC 3B9KB 4X98B 2FEEI 2UYLB 4RMTA 4KROB 2E9IA 5T3XL 3B83A 5DMGD 4PJ8C 4PJ7E 5GS1B 1CFQA 5BZWB 1Q9WA 3RKDC 3BDBA 5CBEA 3GB7A 5E03A 3GSUA 1AC0A 4M6ML 2BERA 1GAFL 4XP4H 3UTSE 3CU7A 3LN4B 5TPWH 1VGEL 1RZ8B 1SYSB 2SEBB 3QG7H 5F1OB 3TBTA 1R3IL 3NPZB 5JOFB 3D48R 3MJ8B 4GRWH 3M8OL 1I8IA 1QSVA 5HPMA 2NNAA 4N8VB 5DD1H 5DFVD 5SWSD 4NO2B 4XXDA 1Y6MR 1MHPH 4OCWL 5M95B 4KHTL 1AGBA 2R9HC 1KB9J 4Z9KB 3T77A 2X4QA 2Q3ZA 3BPNC 1X5XA 2EXWD 3VWJC 4WI2A 3QCUL 4N1HB 5EU4B 4GAYB 5GGRY 3VFRA 1AGCA 3C60B 4HFWB 2R69L 1NGXB 4MJ2A 3MGOA 3VXRB 1UM4H 1UA6L 5GGRA 4R2GD 1K5NB 4Q6IA 1HYRC 2A38A 1Y18A 1NCAL 3U48A 4NNYB 3K2UL 4JGUA 4RGOL 4L8DB 5CGTA 4E0RB 5HDLA 3FQRB 4OZFB 4M1DH 3QG6B 5D70H 3DSFL 1QACA 4S1QH 1CZ8L 2Q8AL 4ZUVB 3QIWD 3ZKXC 4JM2A 5K93A 5T1DH 2R8SL 1QFPA 1W8NA 3O2DH 4Y4FA 4DKFL 2GTWB 4R3SB 3P30L 4Q0XL 3VXRE 3CLFL 5DWUH 4LFHD 1W0WB 5HHMD 4M62H 2YN5A 3ZO0A 5IW1A 4H88H 4UOW0 4HS3A 3WFHA 1S5IL 1XAUA 43CAA 1H3VA 1DE4A 4JHZA 4N0YH 3P3YA 1I1YB 1YN7A 35C8H 2EXYC 1OCWL 5EA0H 5LAXB 2GTZB 4BH7A 1CU4L 3T08A 1UACL 1SVCP 2ADJA 3L5XL 2HRLA 5HVWA 2ZUWA 1X5YA 1FFNA 2PF6A 3EYQD 2XA8L 4H5SB 3H3BC 1MUJA 3AXLB 4PJ8D 1KPUB 5CWSA 3TIDB 5ICXB 4J8RA 3RKDD 5MEND 1AHWB 3FB6A 1NGZB 5JZ7C 4O58L 3W2DL 3L3KA 3DX7B 4EXPX 2NY5H 3WNLA 3RNQA 4D2NA 4M1CC 2AV1B 2VIRA 3HNTL 2EC8A 4ISVA 4P4KC 3BFOA 3WD5H 3KPNA 1UKQA 2G9HB 4IRJA 1D5MA 3D39A 3ZZ1A 5I1EH 1ZE3C 4PRHD 4FXGB 4KUCF 1CL7L 1N64H 1P5VA 1MRCL 1WC7A 5GGTA 3QT2A 3MLXL 1T20B 5BJTB 4I9WE 5HXMA 1YEEH 3QI9C 3MJ7B 5FYKH 4F8QA 2R9HD 1YEJH 1P7QB 2F9BT 4CDGC 1ZHLB 4NKOB 1T5WA 1XGQB 3VWJD 1V7NH 3LZFL 1SVZA 3PGDA 4XVJL 5GGVH 4UB0H 3KNBA 4CMMB 4PJXF 3CMOH 3VFUB 3QQ3B 1VCAA 1YC8A 3WXVL 1EK3A 4LFHG 1H0DA 4G8EB 3DV4B 3H9SB 3KAAA 3HG1A 1MJ8L 3RWJB 3QA3A 3GMRB 5CGYC 1ZS8A 4NOFA 2CDFA 3UDWC 1MCLA 2BNRA 5K9OA 1U93A 3H0TA 4KZEH 4C55A 3IS1X 1H15A 2CXGA 1J8HB 2NY2B 1QQDA 3PNWB 2A73B 3V6FB 4GQPH 3FN3A 4NQDA 3LKNB 3IJHA 5IHZA 3FO9A 1PKOA 1SEQH 5GZNC 1J1XL 5I1HH 2CDGB 1OT2A 1BZ9B 4M1GH 5D2LE 1CG9A 1CDYA 1GGBL 1MCDA 2WWMD 1XIWB 1Q9KA 1R5IA 2JCCA 4PRBA 1I7ZB 4J3XA 3S7GA 2EXYD 3TJHC 1XGTA 1MLCB 4JO1L 2H1PH 4K7PH 4YR6A 3VCLA 1CGSL 4I2XB 4JRXB 2NY4B 2CRYA 1KCRH 4JY4A 1QLFB 2VDQH 4PJCB 3IDNB 4LLUA 2QEJA 1ED3A 3TYFB 1MCSA 5JZ7D 2AJSH 4P9HH 5BRZD 3BQUD 2AK4B 1GHFL 4G43A 4TN9A 2YPVH 1L0QA 4M1CD 4M00A 1EJ6A 3FN9A 4P4KD 4OM1H 5ID1B 4GJTB 4O02L 1D5XB 1FE8L 1KJVB 5CD3B 5L8KB 5EOCL 3BGFB 4JRXE 2Y1VA 1BJMA 2BSED 3BIKB 4UIMA 1MI5B 3WYRA 4FP8H 4GAGL 5F7NC 4HJGA 1T2QH 3G6AA 1BZQK 3K2MC 5C3LD 3QR2A 5KSBB 3QI9D 1TFHA 2CR6A 2AQ3A 2X09A 4G8IA 4LHUA 1LK3H 1DLHA 1JVKA 2A0LC 5DK2B 5DUMH 5T3ZH 3ZYJA 3GHEL 1T22B 4I3SH 4HQQL 3HA0A 5FK9A 1CT8A 1SMOA 1JF1B 4TSAH 4ENEC 4I5BA 3EAKA 2E9BA 3VMPA 4XWOC 1PYWB 3WFCH 4MNHA 2KUTA 4YHZH 3P0YL 4JDTL 1HN1A 1MI5E 3SDAB 2K3TA 4ZTOL 4KK5C 5FEBA 3HE6A 2DQFA 5CGYD 1DLFH 4OM0L 1DN2A 1JGVH 3U0TA 3QXAB 3MRMA 3VFGH 5KBNC 1JHKH 3V6BR 1JMZA 4KUZH 4IRZH 1BFOA 2AABH 1UWXH 4PRIA 5JXEA 4S2SB 5D2NE 1QG3A 3MLYL 5GZND 4CW1A 4RGNC 3IU4H 3FFDA 4G6JH 4GXUM 3LEYL 1ADQL 5FUOL 3I75B 3RUGB 4LASL 3GSOA 2AJ3B 1UC6A 3TJHD 4JAMA 4BJLA 4ETYA 3HAEH 1U8JA 2MCPL 1IFHL 3RAJH 1ZGLM 3BO8B 1MCOH 4K9EH 3BKYL 1A3RH 5DYOB 1NEZG 3N50A 2L4OA 3TH2T 1NAKH 1MSPA 4OLWH 4LIQL 4JKPL 1VFAB 3MNVB 2PR4H 1L7IL 3T3PF 4JKWA 2J7LA 4JRWA 1P84K 3IYLW 3VI3E 1HQRB 1VEPA 2VRAA 3OR7A 2I07A 4Y2DB 1AXTH 5DJ2A 3MV9E 5C0FA 4YFDB 1NC2D 3CVHH 5F7EH 3ZTNL 4ZFOA 1IBGH 3MLTA 1KPRA 4JFEA 1CCZA 5IHLB 3DUUA 2R15A 5HHVH 4OF0A 1F11A 4HG4J 3LN5B 4MHHI 4WY7H 3TH3T 4PJGB 4PJIB 4NC1E 3MRDB 5LWYL 3Q0HA 4HIIA 4TUKH 2XZCL 1U8IA 3T0AA 3JVGC 3SBWC 3ZT7A 4MA3B 3RI5F 3IXTA 2EIBA 1UB6A 4C56A 3SCMC 1OGAA 3TFKC 3P77B 1I9IL 2IPTL 4ENED 4PTUA 5DMKA 3D3VA 4XBPB 2NQCA 1KN2H 2DJSA 4ZUSA 5JW3H 2QSTA 4XWOD 1YUHA 1F58L 3MUY1 1KTRL 2FX9H 4KK5D 3VXMB 4CVWA 4YK4C 5HI3C 1MNUL 3IRPX 5GGUA 1FO0B 3SDXF 5DJ6B 5D6CB 4TSBH 4H26B 5KAQF 3RVXC 4OLZL 2GY7B 3LQAH 3MREB 2YOCA 3RGVA 3EO9L 1WBYB 5HDOA 3G6JF 3FQTB 2HRPL 3RZCB 2CMRL 5E8DH 4FQ1H 4HIJA 4PG9A 5F3HB 1NAMH 4BQBA 1OPGH 2J8UF 4RGND 2PW1B 4Q9CA 3VXME 5EIIA 3LPGA 4OUUB 4TTDC 3L3JA 1AD9B 2GJ6D 5MI0C 3J7HA 3G5YB 5D7IF 3O6LH 1YMMD 1XR9A 1FL3A 5HHOA 3I9GH 3LEXA 4N8CL 1NGPL 2JJTA 1KCVL 4R8WL 5E8EA 4CMHC 4LLYA 3SDDB 3TCXA 4YZFF 2ZUTA 4DGVH 3U36A 3H6JA 3H42L 4DGIL 3HS0B 4H1LA 4MB4A 1B0RA 4L3EA 1J1PH 4I48B 1P9MC 2KQNA 4AM0A 4S1RH 4OQ1A 3GMNA 5EPMA 5TDNB 1ZHKA 3WS6A 4LRIA 4WI8A 4GKSA 5FB8A 3U46A 5ALCL 3OKLA 3G5VB 4G6FD 4PGDB 1ZKAA 5ESVB 3AVEA 1U91B 3NA9H 3SE9L 2BK8A 2YC1B 4DK6A 1CLZL 1FFRA 2VNCA 2EICA 1QP1A 3RWHB 4HCRL 4MQXC 1BD2B 4JQIH 1Q94B 1H5BB 1UCBH 4JJ5B 2D0HA 3JXAA 1M05B 4X7DC 5HI4C 5IJVB 3WKML 3K0WA 1IQWH 2RJMA 2JB6B 4ZNEE 1HHJB 1IAIM 4HK0B 3TFKD 1OAZH 4XNXH 2VZOA 4YQXH 5DJYB 2OR9H 3R0MA 3STZA 4PJXA 1DQML 4IS6B 1MAMH 1AO7B 4P9ML 1FG2B 1D9KA 4C57C 3ZMRA 5DHVH 4F7EA 1FGVH 4MA7H 4E41A 1F4AA 3PE9A 5HI3D 3SE3A 4AENA 3GRWA 1RIUL 4TVPL 4YDKH 2X1PA 3TNNB 1RMFL 5HDBF 4UTBL 3ZLQC 4UT7L 1EAJA 4PV8A 4L29B 3RVXD 3GKWH 2NY1B 3KPQA 4QRRA 1GGYA 5BVPH 5D5MB 4P2RE 1G7PB 1U8KA 1JZ4A 1QHPA 3EFFB 4YE4L 5KW9H 3OPZH 1AO7E 4YIQB 4YHOH 5IT2L 4FQQB 4F58H 1T89A 3BDYH 1PG7H 4NKMB 4NO3A 2CLRB 3KXFA 1ZGLA 2V5YA 2YA1A 4XAWH 4HUUA 4TTDD 4NRXB 3PWPE 2R2HB 4IEFB 3F5WA 3HUJF 1RHFA 3VD7A 4C4KO 2P42B 2PTVA 5D5ME 2F5AL 2VLRD 4YGVA 4UTAH 5JQ6L 2CJUH 2ADFH 1R0AL 1LO4L 1AR2A 3QEQB 3T8XB 2V7HB 4ZS7H 1AE6H 3F6LA 1D5ZA 3ARTA 1WSST 1XGYH 4G8FA 1QSEB 4P59L 4QEGA 4WI7A 5F8QC 5E8OA 1XCQA 5F3BB 1TJGH 3H8NA 3QDME 5I1LB 2R4SH 3QQ4B 3WN5B 5FYLD 3KLAA 2W0LA 2IWGA 2VLMD 2AJYL 3MUJA 4Y8DC 1UYWL 2G75A 3IF1A 2CD0A 1MWAH 2NW3B 2GY5A 4Z7WF 1WAAE 4MQXD 2CIKB 5E2WH 2X70A 4LP5A 2KPNA 5IVNA 2NY6B 5GISH 5HI4D 3L1OL 2XV6B 3RY6A 1QSEE 4XMLL 5L2KE 3RI5K 2YUWA 3TT3H 1QEWB 4LSSH 1GH7A 3MA9H 4XPTL 4ZUUA 2AJXH 1AKJD 5T1MA 4MWFA 1MCJA 1NMAL 3O3EB 4G9FA 1N26A 5FKPA 1TZHB 3SKNB 3O4OB 4GW5A 3RBSA 4F7TB 2XWBB 3GK8H 3MRKB 2YPLD 3CXDL 4J3SA 3BW9A 4JY5L 3UC0L 5DQJA 1Z2KA 3JTTA 4FQLL 3MPCA 2D7NA 4LAQH 5HGDB 1CR9L 5GS0H 5GZOC 5D9SA 3QNXA 3R06B 3C5ZC 3O6ML 4BZ1L 2W9EL 4I3RH 1HEZB 2G60H 4M5YH 1WWAX 4IMLB 2X2YA 5B38A 4P2QB 3HMWL 4OCNC 4ELMB 5IG7A 4QTHB 3L3OA 4QRPA 4UDUA 3P4NB 4QGYA 4NDMA 3FT4A 2NY0C 3FOLA 1A3LL 5BV7B 5IB1A 1DUZB 4JFQB 2QSCL 1A6UH 3PWNB 4NO5B 5J06A 5HHQB 4QCIA 2WP3T 1DVFB 5KJRH 1RD6A 3WE6B 4JE4B 4X6CB 3V95A 1DANU 4O4YL 3MRIB 5IKCB 2QQNL 4HEPG 3V6ZA 5D7LA 3E1F1 3IDMA 1IL1A 2XWJA 1VB9A 1ZT4A 3KPLA 2FD6H 2VR5A 3B6SA 1P1ZB 4HHAA 4WHYH 2X10A 1A22B 4U1NA 4JB9H 4MA1C 4X9FA 4OCLC 3BH9B 4EI6B 1A7RL 2IMNA 3TV3H 1NGYB 1DQDL 5F1IB 5CEXA 3HE7B 2BMKB 3MRRA 1P2CB 5TE6L 4P3DA 1AR1C 3L3IB 3NFNA 3JTSA 5DZNA 1QSFD 4PGCB 4DQOH 4IHOB 3MV8A 4R9HA 1XZ0B 1X7QA 2X9WA 1LO3L 3IFNH 3S5LB 4Z0XB 5ACZA 5FYJD 4MJ6B 2DI7A 2VZ3A 3MTRA 1GIGL 4PBVC 1WBXB 4M7ZB 1IARB 1CDGA 4KQ4H 1HWHB 5IR1A 1LWRA 4XGZA 3W39A 2DTMH 2VLKE 3SE4A 3E6FB 3UTTE 5A43C 2NY3B 4G5ZL 4FMKA 1KT2A 3FT2B 4KKLC 4O9HL 4R97B 3CZFA 3VFPA 3FQNB 5A2KH 2ID5A 4HC1L 1VFMA 1U8OB 1W0VA 5D93B 2YBRA 3EFDH 1MCIA 2R0ZL 2V7NA 4KVCL 2DL2A 3N1GC 2DLIA 3C5ZD 3VJ6A 4HUVB 3SDXA 2IH1B 4ZDHA 5JO5A 1RZJC 1TQCC 4JFOA 4C58B 3VA2C 4G8GA 3G6JA 2YHGA 1KB5L 3FKUS 3VWKB 2NY0D 1DBKH 5DF0A 2HKFH 3NIFF 2X4PA 5BMFL 2J8UA 3KJ6H 2BDNH 3O9WB 1UM6H 2NY7H 5C0AD 4FOMA 2HG5A 1HHGA 1KLUA 3T0EB 3TO4A 4WEMB 4X0KA 1FZKA 1FZJA 4Y1AA 3I02B 3GHBH 5D7IA 1WUNT 1F00I 3PG2A 2X4UB 1EMTL 1FGNH 3BAEH 3IXAA 5KTEL 1RURL 3OKMB 5FOJA 1SJHA 3QUKA 1NGQH 1RSFA 3T2QA 1CIDA 3BZFB 1G7HA 1A7OH 1J1OL 3DRQA 3BZEA 5FGSA 2YMXH 3BUYA 1CLOH 5SWSB 5IB4B 4ODVH 5I19L 1H3PH 4Q6IC 4WTZG 4BZ2L 1FVDB 1AR1D 3NN8B 1OP3H 5IROC 3X12A 1ODAA 3EDFA 5DJCA 4QHNA 5SWQB 1YDPB 1RUPL 2EYSA 5TFSL 3A67H 4PR5B 3LN9A 3E3QC 5D70L 1OAQH 1QKZL 4LPCA 4JM2C 4D94A 3ARGA 4PJBE 1RZKH 1QFWI 4Y4FC 3RGHA 4HX1A 4LDOB 5T1DL 5JPMA 2DWDA 5SWSE 2DMKA 3S96B 4Z0BL 4XVUC 1TVDA 2RCSH 1WEJH 3MCG1 5C3TA 3RX8A 4PPTA 1ITBB 2Q86B 4M62L 2CDEB 2FHBA 1KN4H 4WTXA 4OUOA 5MEOA 3HAEG 3A6OA 2Z4QA 2L7JA 3QIWB 5IM7A 4E42A 2DLEA 3QUZA 4NKDB 1X5KA 5ALBL 4XI5C 3U0PB 4Z7UB 1A4JB 4RAVA 3SEPA 43C9A 1PEZA 3BKCL 5HHMB 1X5ZA 3CLEH 2WNGA 5HVGB 4XMKL 4XNZC 1A7NL 2B5IB 2ESVA 2XIDA 3AMKA 3UROR 5DUPH 1KJ2L 5I6XC 1S78C 5HYQB 1K4DA 3IDGB 3PP3K 3EZJB 1D5BB 3ULVH 5GSRA 1A6VL 4MSWA 3EYFA 3DYPA 4MQ7B 4IRJC 1OGTB 1IILE 3ILQC 4QOKA 1UJTA 5FOBA 1FFPB 3VFOA 3C6LC 1JRHH 4PJ8B 1ONQB 2R1YB 3E6HA 1NLDH 1Z6JT 4KZDH 4XC3H 5HHME 3BPCA 3WIFB 4K3DH 3HUJA 5FYKL 1UH2A 1CFTB 2QQKL 3BXNB 1FDLL 4Y5XC 4XBGA 3T3MF 4PRHB 3G5ZA 5EFIA 1OTSC 2XQYG 1IGFH 1H8OA 4UB0L 3S36X 5FM5M 25C8H 1J0IA 1J0HA 1T4KA 2PETA 3L7EA 4RSVA 4TVSa 1MVUB 3RJQB 4AEEA 2PO6B 3VWJB 1AD0B 2DQIH 3WNMA 3S8WA 5EG6C 3KPSA 3MRGA 2YSSB 3CFBB 3EKCA 4JM2D 2J3SA 4Z7WA 4PRHE 4Y4FD 1A5FH 3UTPE 3FHQA 3O6KL 5CP7A 5HPOA 2UY6A 3GIVA 4M02A 5C7XH 1T1YA 4GQ9H 3VXUA 4XVUD 3RVTC 4LSVL 4OLXL 4WNQA 3VDCA 1QLEH 2RBLA 5I1HL 1DEDA 3RTQA 3L3GB 3H3KA 3QWQB 3DROA 4U6YA 5FCUL 4NUJA 4K3GA 5ESQB 1ACZA 3QUMB 3T1FB 5GS0C 3ULUH 4WFGD 3ZKXB 3BHBB 4XI5D 3GJEB 4KXZI 2YRLA 4XPGH 1BEYH 1R24B 2CLVA 1T1WB 1UADC 3WDIA 5KVGL 3IAGC 3FRUA 3ZKSD 3NIGF 1S7QB 4ZD3H 5IEHA 4AQ1B 5IFJA 4NRZB 2Y23A 3OKOB 3IAPA 2JTDA 5HJ3B 5C6PB 4NYLA 4ZFZA 5D1XB 4DZ8A 3E2HC 3VXPA 1S78D 4JREC 1T66C 4EIZC 4U1SA 4KRNA 4NWTH 4IRJD 4HZLA 3D39D 5EU3A 3CPLA 3ILQD 5H2BA 5TDPB 3AGVA 4N9GA 4MMXC 3C6LD 5JIHA 5K9KB 1TMCB 5FIEA 3C2AH 4UQ2B 5A40E 1SBBA 2Y7QB 1B3JA 1N0XL 1OAYL 4NPYA 2P44B 5DS8B 1ZLSH 5BRZB 3ARFA 1T2QL 5GIRA 2NYYC 3ARXA 2Y4SA 4PJCF 2A6KB 4POZD 3S4SA 2O26U 3NGBB 4P4KB 3DI3B 3A6CL 4XNUH 1KULA 2DN7A 3B2VL 5EN2A 4QY8A 4I3SL 1UH4A 1NEZB 3IFPB 1WFNA 4ONGH 3EOTL 1OTSD 3GI9H 2XA3A 2VLLB 4HF5H 1CD1B 4HT1L 3GSXA 2JELL 5SX4H 4UILL 3HG1D 3LEVH 3HE6C 3VXNA 4U1MB 3OAYK 4JVUA 2XPGA 4RMWA 2VUOA 3BMWA 5BRZE 2JLLA 2MOVA 4ZFGL 5J56B 4OI7A 3PXHA 4PD4J 3VRLF 4KTDH 1DLFL 3RBGA 1KSRA 4UT6L 3W5MA 5KSBF 3WSQL 4M93C 1XGPB 3BZ4A 5I1AA 3VXOB 1QNZL 5JXEC 3OKEB 2AABL 3DMMA 2BOCA 3CX2A 1JUFA 2IPKA 3RVTD 1Z9SA 1S7UA 4D8PA 1XF3A 4X8JB 3IU4L 1BP3B 3EOAA 4BH8A 2J4WH 5A2IH 3Q6FB 4F9PA 2APWA 2E7BA 3THML 5GS0D 4L3CA 1ZANH 5AZ2L 3RDTC 3TIEA 1JFQL 1OQXA 1FSKC 1F8TH 4YHKL 3U7WL 1A3RL 3WLBB 4MZ2A 1MLBB 2HWZH 3AM8A 2VDNL 2YZ8A 2XKNA 3QCVL 5B8CB 5ADPH 4I18B 1QOKA 2P43B 4CU8A 1QYGL 2LVEA 5IHUH 1G6RH 2GFBA 5LGJA 5E99L 2P24A 1T66D 3F12B 5C0CA 1J05A 2XZQH 4M7LH 2HFFA 3RUGF 3CSYA 3MO1A 5E6IA 1IBGL 3UTSA 2LFGA 2BC4A 4RA0C 1P7HL 2XFXA 2P45B 4DAGH 4B53A 1OP5H 3S35X 4EI5A 3UPRB 4WY7L 4NM4L 3U4EB 2YXFA 1XGUB 4XP6H 3SPVB 3B9KA 2NYYD 1AJ7L 4X98A 3QEUB 3BD4A 2UYLA 2IJ0C 4TUKL 5F6HI 1T7WA 4HKJB 3JZ7A 3CMGA 1CBVH 3QDGD 2FEDC 1CQKA 1NC2B 2UUDH 5GS1A 4KJWD 2NXYB 4HGMA 5BZWA 4HIHB 5DTFB 4HFUH 3ULSB 4WHDA 1PZ5A 2X9XA 2NZIA 2VN4A 3TWCL 1RZ8A 1UQSB 3HE6D 1TTFA 4RMQA 1SYSA 2SEBA 5GPRA 5KANI 1QA9B 3Q48A 5JOFA 3UTOA 1REIA 3C8DA 3KPTA 5IB3A 4N8VA 3KG5A 4NO2A 4PJGF 4PJIF 4TSBL 4UT9H 2Q87A 2XZZA 2AW2A 2DQUH 5J7CC 4PRID 5JXED 1SY6H 1TCMA 2EDJA 1JZ5A 1G7JB 4OQTH 5EU4A 4GAYA 1KOAA 2ZG3A 5CJQL 5E56A 3C60A 1Q9LB 3DYMA 4HFWA 2YK1L 1NGXA 1YEFH 1J87A 2GCYB 3VXRA 3MNWB 4OZ4B 1K5NA 3RDTD 3KDMB 5DD3H 2XXMB 4X80H 4LQFL 4NNYA 3STLB 4L8DA 1NANI 2FX8L 4E0RA 2EIZB 3FQRA 4MA8L 4OZFA 3X3FH 1NMCB 4RGNB 3QG6A 5J9PB 1KYOK 3NAAH 3BKJH 4DGVL 4ZUVA 2GITB 1YN6A 4HMEA 5J3HC 2GJ6B 3TEUA 5CIPH 3WS6C 5BVJB 2GTWA 2Q1EA 3OKKB 4LRIC 4S1RL 4XBEL 5CJBA 2ADIB 4PJEB 4X6EB 1W0WA 5E7FA 1E6OL 1IT9L 5JHLH 4GLRH 4LPWA 1MQKH 1K6QH 1GOHA 1I1YA 5DJXB 4W70A 5J1TC 3OXSB 4CJ1A 4RGNE 1JWUB 5LAXA 5FA3B 2NCMA 4XPAH 4GRWB 2GTZA 3V9FA 5I2IB 5DJ0B 1A2YB 5J11C 1UCBL 3P0VL 1GC1C 3SKMB 4YHML 5EB9A 4IDJH 2GJ6E 4H5SA 1L7TH 2FEDD 3AXLA 4XVTH 5CEZH 2VXSL 2Y9RT 3TIDA 1YMME 1IQWL 5ICXA 4LSUH 1RK1B 1WLHA 1AHWA 4DWHA 1XCTB 1NGZA 3RWDB 1NUDA 4YQXL 3DX7A 5FKAB 4J3UA 1BLNB 1IGCH 1T21B 4FFWC 2HFEB 4UIKH 3SE3C 2R0LL 1I4FB 2Y36H 1FZOB 4HJJL 4NQSB 2G9HA 2HJFB 4MA7L 4OJFH 5KVEH 3L6FB 4FXGA 2D7MA 2FJFB 4YDKL 4OF3A 2YWZA 2HFGH 4ZODA 1NBVH 5DZOA 3SCMB 1G9NC 1T20A 2ZUUA 4JKMA 3U0WL 3L95B 1H9VA 5BJTA 4QF1B 3MJ7A 5BVPL 3MRHB 1P7QA 3VD3A 1ZHLA 4NKOA 1XGQA 5B4MC 3ULUC 4OF6A 5C6TL 3OPZL 3OQ3B 1KUMA 1T89C 3V8CA 5JIPA 1ND0B 2YD1A 1Q0YH 1CFSB 6FABH 1FBIL 2ED7A 4CMMA 4C83B 1NFDA 4HSQA 4NZRL 3VFUA 3QQ3A 1J0ZA 2NZ9C 1KCUL 4MXQD 4LPTA 4G8EA 3DV4A 3H9SA 1GOGA 1HDMB 3RWJA 4QRTB 3GMRA 2GUOB 2VDPL 5EZOH 1YQVL 3BJLA 4G7YH 2MSPA 3OJ2C 5DJAA 4YFLF 2AJVH 4MLIA 5GGQH 3P40A 4XXCA 1HSAB 5C0GB 5IVXB 2ZUYA 4J6RH 5D5MF 2YD4A 1J8HA 4L3ED 1JYVA 3GEWB 1IVLA 2A73A 3PNWA 3SQOL 3QXUA 3F8UB 4U3XA 5J3HD 5EIQA 1A4KB 1HI6B 5MI0B 3BISA 3LKNA 3CDYA 3H7LA 5EBMA 5E2VL 4OLUL 3KYNB 1WZKA 2CDGA 1BQLH 1BZ9A 1HCVA 4LSPL 4L8BB 4FG6C 1XIWA 3C08H 2WIMA 4KUCD 5CJOH 3V7AG 1I7ZA 5HVHC 5DR5L 5TGBA 1MFCL 2DYPB 1MWAL 4YXLH 3RPKA 1IGTA 1MLCA 2W9LA 1S9VB 4GOSA 5IVXE 1YEHH 3RY6C 1AFVH 1S5HB 5E2WL 4I2XA 4JRXA 4O5LL 4PJCA 2H2SD 5ILTH 1WAAF 2VE6B 5HYSA 3IDNA 2AP2A 4UV4L 2Y06L 2RQ8A 4XP5H 4LSSL 2R1XB 3MA9L 3TYFA 1B88A 2A83B 2VLRE 4XVSL 1T6VN 3MZGB 2DQCL 2AK4A 3T2OA 5F8RC 2WW8A 2OL3H 3IAQA 4FFWD 3LV3B 2V17H 1TPXC 4JQVA 1QR4A 3B5HA 5GRUL 5ID1A 2WWKO 1D5XA 3GBNL 3DSNA 1KJVA 3EDDA 1L0YA 5CD3A 2FGWH 3P9MB 4WI5A 4U3HA 4HUWB 5FYLE 3BIKA 2O5ZL 1AKJB 1MI5A 4LHJB 3AY4C 4QRRD 1U3ZA 1G9MH 3QISA 4I3RL 2VLME 2G60L 5KSBA 2LU7A 3UPCA 4U05A 5DK2A 4KK9C 1H3WM 2YPLB 5B4MD 2WBWB 5FO7B 4H1LG 2ATPB 5AG8A 4H20H 4MD5B 5ADOL 3KXFD 4Z95H 1D6VH 4J3WA 4WV1B 5TE4L 5IMMB 1JF1A 2UZIH 1U9KA 4KMTL 2VABB 5I75B 2QSVA 1T2XA 2NZ9D 3F7PC 1PYWA 2Y07H 4EDWL 3SDAA 1FYTB 3HR6A 4JHWH 1DP0A 3I6GB 1JPST 1VSCA 4AG4H 2V9QA 1XR8B 5F7LB 1YJDC 1MRDL 5IMOB 4NN5C 2YPLE 1HWGB 3QXAA 3EYUL 4ELMF 2FD6L 1RFDL 5HYJB 5EZLB 1DBML 5D6DC 3HPLB 1EEZB 5CILH 1JWMB 4S2SA 2ZSVB 4JPKH 4H8WH 1A14L 1MREH 3IDYB 4ONOA 1DANT 3W82A 4J1UB 4ERSH 2ZCLL 3I75A 3RUGA 4Y5VA 3IFNL 2AJ3A 1LO0H 3EDEA 1KF9B 4X6CF 3BO8A 4U49A 5DYOA 2BHYA 3C87A 1BFTA 1W0YT 1ORQB 2AGJH 2R23B 1C8PA 3B5GA 1A6TB 1VFAA 4HDIB 1S3KL 5C0RH 3MNVA 4MYWB 4G9FD 4GKOA 3QUXA 1JPSH 2J6EA 2VQTA 1MIEL 1OB1B 2J1KA 2ZCKH 2N7AA 4HWEH 3AFLA 3JBG7 3LKOB 1HQRA 1J9CT 4Z5RB 3DO7B 4P3WA 2VUYA 4Y2DA 1KFAH 2QQQA 4DKEH 3WEXB 3PHSA 4ZAKC 3R0NA 3UYRL 5IP4A 3L3DA 4U0QB 3WJLA 1VPOL 3HPJB 1TDQA 3GSNH 1R3LB 1QSFE 3L3HB 4PJGA 4PJIA 2CH8A 3MRDA 4BYHA 3DX9B 1CDCA 1ZXQA 4KK6C 4QRPD 5FYJE 3BZDA 4KK9D 4MA3A 3HMXA 4AYFA 4YNYB 1YC7A 4KKCC 7FABH 1KEGL 3P77A 3Q1SL 3C5ZB 3N1QC 2BDNL 1UM6L 2NY7L 2MJWA 1INQB 2BCKB 1GYAA 5I1DB 4KTYA 5GJSH 3VXMA 3S37L 5D7LD 4QTIL 1ZGLP 1PKQB 2NY0B 3HAEB 1FO0A 2UVEA 5D6CA 5I8EB 4H26A 4J3VA 1L0XA 4M5ZL 3MREA 5C0AB 3PXJA 1WBYA 3GSWB 2YMXL 1DBAL 2VC2H 3FQTA 4L8CB 5FV1L 3RZCA 5EZIH 1OWWA 4RQQB 3MRQA 4HS8H 3W11C 5F3HA 2EEDA 1UKSA 3HI1B 2PW1A 1TNNA 1RIVH 4OUUA 4N68A 5DZLA 1AD9A 1PKQE 2BP3A 4JDZB 3ARGC 1J18A 2CKBH 3CVHB 5DVKA 3G5YA 4WENB 1LO2L 2DM7A 4MA1B 3IDXH 2V9RA 3HFMH 1VFBA 2B1AH 1ETZB 2XTLA 3LMJL 2I9TB 5C0AE 3JWOC 1BREA 2E6PA 5D71L 1S9YB 3SDDA 4I77L 3N1FC 3LRGA 4EUPH 3NABH 3IKCB 3HS0A 3PF2A 4B41A 3LRHA 4I48A 5CGMA 4TRPH 3FO2B 1IC4L 3ZE0E 3QUZC 1CN4A 4ZNEA 5TDNA 4K3HA 5I15L 3DWTA 1UH3A 4FQHB 4LEOB 3G5VA 4PGDA 1UJ3B 5ESVA 5I1IH 1U91A 4ZAKD 4EEEA 4N90D 2HH0H 4JFFD 2YC1A 3GBML 3BP7B 2CK0H 4O2EB 5I1GL 3T0VA 1CTOA 3RWHA 1BD2A 1Q94A 1H5BA 3UO1H 5EOQH 4JJ5A 4KK6D 1M05A 4BUHA 2BFVH 5IJVA 4MNQB 3FO0H 1DBJH 5HHPB 2VTFA 2ZPKH 2JB6A 2HTLC 5B3NA 4KKCD 1HHJA 4HK0A 1OSPH 5F9DC 3P9WB 2VZUA 4FQ2H 1TZGL 5DJYA 5ETUB 3H2WA 4PREB 1NAMB 4IS6A 4AIZB 3GSUB 1TQCB 1FG2A 2IALB 4Y1AD 3SO3B 3OL2A 4RIRB 3MLSL 1IMHC 4R0LB 4Z7UF 4XCFH 1MCCA 5GGTH 1RUKL 1CFBA 2BVEA 2ZJSH 4GXVH 4HLZH 3TNNA 5JOPD 1HYSC 4X5LA 5C92A 2IBGA 4HBCL 2WZPD 4HXBL 3MODL 4L29A 1TJHL 1INEL 2GQHA 4MLSA 3P2TA 4GMSL 1G7PA 2KH2B 5K9JL 1IGFL 3K8LA 4Q9QH 5DRZB 4K2UL 1NCWL 3EFFA 1X6LA 4UOW1 4H0GA 4PB9H 3MFGB 5I66B 4YIQA 4FQQA 1TXKA 4WI3A 2VDKH 4NKMA 5LJYH 3WMSA 2CLRA 5SV4A 1AH1A 5K59E 2D7PA 4WW1B 1VACA 1X4YA 4ZXBB 5F7YC 4NRXA 3ARGD 1UENA 2R2HA 5F44A 1PAMA 2KZ1B 3FMGH 4NQXA 5GGRB 3T04D 3OMZA 5A16B 4M48L 4WHCA 2HMIC 2P8MB 1PLGH 5KAQG 4FHBD 1D3CA 4GQ9L 1WAAA 3QEQA 3T8XA 3RTQC 2V7HA 2FH6A 1QLEL 1MY5A 4RRPA 1QSEA 2KDGA 5F3BA 1NGWB 2WQ8A 5I1LA 3QUZD 4XMPH 3QQ4A 3WN5A 1CDIA 1JGLL 1GGIL 5HDQH 1G9MC 5ISZB 2A6IB 1DFBH 5E2UH 4FQXC 2V2WB 5C09D 3WFHB 5DHVB 4OFIA 4PLJC 5I17B 1G9EA 4ZD3L 4AMKL 1OTTC 2ESVD 3BPLC 1XFPA 2CIKA 4R26L 3HRZB 3HLAB 4YDLC 1A6WH 3UP1A 4WI9A 3QIUC 5E08L 3E3QE 4RBPH 3HCVB 3PWVB 3BD5A 1QEWA 2HTLD 3TBWA 4I0PB 3QULB 2FO4B 3O3EA 1TZHA 3ALPA 1JPTL 3X13B 5KVFL 4NWUL 2QR0B 2D7TL 2CKNA 3L3KB 4F7TA 3VW3L 2XWBA 3ARFC 1E4WH 4XNZB 1JBJA 1I85A 3OXRB 5J13C 3TC9A 1QRKA 4EKXA 3MRKA 3DURB 5I6XB 1BHGA 1HYSD 5HGDA 3NACL 3AREA 4OCRH 3D39B 4WFGE 5GRVL 3R06A 3RX7A 1KELH 4ORGA 5IK3B 4S1SL 1HEZA 3C6LB 4IMLA 3SE8H 4MJIB 4P2QA 2DBLL 1RK0B 3EJZC 3SGEH 1CDHA 4ELMA 3MYJB 4QTHA 3P4NA 1MCWW 3KPPB 3WFDH 3EDJA 4K7FB 5F9WB 4BUGA 3U4BL 3V5DB 1DUZA 4JFQA 1UWGL 4PY7B 3PWNA 1DSFH 4NO5A 2H9GB 2C26A 4Y5XB 5HHQA 3B3IB 1DVFA 4ZPVB 1NL0H 3D39E 3WE6A 1KBGH 4X6CA 3ZL4H 2LVCA 2B0SL 3MRIA 1YY9C 5IKCA 4OSUH 1NBYB 2HMID 5AEAA 4I0CC 1AGDB 3O3DB 1PSKL 5H35B 3RTQD 4OBRA 1P1ZA 1W72A 3CUPB 4EI6A 1NGYA 5KSUB 5F1IA 2BVOB 3BX7C 3RVUD 3HE7A 2BMKA 4UQ3B 1LDPL 4KQ3H 5IHZB 4PGCA 4IHOA 3AM8C 2DB8A 4FQXD 2C5DC 3S5LA 4Z0XA 4HWBA 4QXTB 2H32H 3WKNA 4PLJD 2VXUH 4MJ6A 4EN3C 2DM2A 4PRBB 1KACB 3V0VB 1WBXA 1HZHH 1OTTD 4HH8A 2J2ZA 3KS0H 1A7PH 4XZUB 2XN9B 5TF1L 3MA7B 2I60L 3QIUD 2VL5B 3NFSH 3E6FA 4X6DB 4KAQL 1GPOH 4RISH 5E6IC 4Z7OF 4M7LL 5BQ7B 2A9ML 2QBWA 3FT2A 2WUCH 3FQNA 3ZTJH 1ED3B 4WFED 2OP4H 3RNKB 1F6AB 4KWUA 1F4YL 3ARFD 1U8OA 3B9KC 5GS2D 1R5WB 4RAHA 1KIQB 1JJUA 1G0YR 4KROC 4OLYH 3KYMA 4GSDH 5E7BA 3AB0C 1S8DB 5DVOA 5GS1C 4HUVA 2IH1A 4HD9A 1S7SB 1U3JA 3EJZD 2B1HL 4OI9A 2ZWLT 1WWCA 2NR6C 1T5XB 5E1AB 5L7XL 3LB6C 3VWKA 1CI5A 3M07A 2AK1H 1BQHG 1OY3B 3QDGB 3O9WA 1JF5A 4S1DD 2QHRL 3NCJL 2ZSWB 2YA0A 3NZHH 2E7LC 1KEML 4XTRC 4UT9L 4JFZL 4O51B 3T0EA 5CLTA 5I1CH 3KLHC 5F72S 2A9NH 1I3RB 3REVB 5C0DB 3I02A 4ZQKA 3DMMD 4BFIA 2X4UA 3MRBB 2IQ9H 3OKMA 5B21A 3MXWL 5E00B 4KI5C 3BZFA 1WQVT 4IM8A 4YAQB 1JN6B 2F8VA 1YYLL 3QRGH 1YNKH 5FFLA 2QADC 5IB4A 3QDGE 1YEFL 5IFAL 1CGYA 2X4SB 1WICA 2C4FU 1FVDA 3NN8A 4PRIB 3OHXB 4PRPD 3DLQR 1MCPH 2VXTH 4K55A 2FBOJ 1KXQE 2F8OA 5SWQA 1OTUD 5C9JB 4N1EA 2EIDA 4W68A 4PR5A 4EN3D 5IV2B 3QXDB 3S4SG 4JR9L 1OLLA 3BKJL 2WINB 4BA8A 5DJDB 1WF5A 5DMIL 4RZCA 3UJTL 5C0CD 3RDTB 1PZUB 5LCVH 4UINL 5E6ID 3E8UL 5J89A 4L4TB 2Q86A 1X5HA 2C1PA 3MXVH 4PRIE 2P5WB 2CDEA 3NCMA 5E5MB 5JA8B 5DC0A 1MPAL 3DI2B 4JY6B 3F6IA 3K8KA 3QEGH 5ECJE 3QIWA 1QO3B 3B9KD 2EE2A 3NFPB 4NKDA 1YEIL 3U0PA 3H3PL 4KROD 4V1DB 4Z7UA 1A4JA 3VGBA 1FRGH 1RV6X 4XPHL 2HP4A 4FQJH 1L7TL 5CEZL 3KS0J 2MPAL 2CGRL 2YEZB 4D9LL 2X4OB 1LE9B 2NR6D 5HYQA 3LKQB 4NGHL 2EDTA 3IDGA 3LB6D 4PJEF 5DO2C 4GXUN 1D5BA 5IBTH 1LMKA 4YPJA 3O3AB 1QVOB 4MQ7A 4NZTL 1OGTA 5TE7L 1FFPA 1FZMB 2ERJC 4PJ8A 1ONQA 1OAKL 3D9AL 2R1YA 4WUUA 2BRQA 4M6MH 2A2QT 1GAFH 4GRWF 1MHHB 1VGEH 4ZUSB 4TSCL 3KLHD 4N5EC 1YUHB 2VH5L 3C6SB 4R6UA 1B6UA 3BN3B 1MEXL 4HV8B 3WIFA 2Q7YB 1R3IH 3UCRA 4KI5D 1ZLWK 1CFTA 4F9LA 5GGUB 3BXNA 1OF2B 4PRAB 3P9LB 1EXUB 3SJVB 3L9RB 4LKCB 3CFKB 2QADD 6FABL 2DQJL 3VFWB 2X6MA 4OCWH 4M9OA 5E5UB 4KHTH 1CIUA 1BBDL 4LOUC 2DQEH 2EECA 3QCUH 3SQBA 1MVUA 3MACL 2PO6A 2B2XL 4R7NB 3VWJA 4OGYL 4XXCC 3V7AE 2E8YA 4XPBL 3O8XC 2VZVA 2R69H 5C08B 2AJVL 5GGQL 1Q72L 2NY2C 2YSSA 3CFBA 3CDGB 2WBJB 4J6RL 1UA6H 1QSZA 1JNNH 4U2ZA 1NCAH 2XQBL 3K2UH 1AGEB 4RGOH 1NLBL 5FYKU 1N7ML 5GGSB 3L3GA 3DSFH 1CZ8H 1TJIH 2Q8AH 3C08L 1ZHNB 5A1AA 1INDH 2R8SH 12E8L 3QUMA 4H1LB 3T1FA 4HKXB 5FXCH 4DKFH 2EE9A 1OVZA 4JFXB 3P30H 4Q0XH 3BHBA 4TNWF 4AM0B 3CLFH 1EGJA 1YEHL 4N8VG 3VGDA 1ZHKB 1R24A 5FB8B 3K1KC 5IVXF 3OKLB 1S5IH 1T1WA 5FYJL 4I9WD 2AQ2A 1S7QA 1E6JL 4Y4KC 2YXMA 1MCFA 3IJSB 3MRCB 4LCUA 4XP5L 4EUPG 1OCWH 3LPFA 3OKOA 2MNUA 5M94B 5HJ3A 5D1XA 4YUEL 1CU4H 1UACH 3L5XH 2ORBL 4JQVC 5DO2D 2W65B 3GM0A 4ZTPL 4L3EE 2XA8H 3QCTH 5TDPA 3SOBL 3M17A 2CXKA 4Z7QF 1NSNH 3EW3B 1P84J 5CJ8A 5K9KA 4YJZL 2FGWL 5CCKH 4IOSD 4O58H 4UQ2A 3W2DH 3BIBX 5D7KD 1UEYA 2Y7QA 2APXA 3ZDZE 5DS8A 4N5ED 1LEIA 5BRZA 1EFXA 1P7QD 2V5RA 1MFEL 3HNTH 4L4VB 2A6KA 4TTGA 2WBKA 3HNSL 4POYA 2QQLL 1N59B 1CL7H 4U6TA 1MRCH 1JMXA 1NEZA 2YD7A 3IFPA 3H9HB 3MLXH 2YD5A 3QNZB 2VLLA 1EO5A 5F9JB 4QRRB 5AWNL 4P0DA 3LRSA 3H9SD 1MRFL 2Y07L 4LOUD 4U1MA 2E6QA 4PJXE 2VDML 3LZFH 2F53B 4HLZG 1I7RB 4N9OB 4OCYL 1UT9A 3ZE2E 4K8RD 1J8HD 3KXFB 3OGOE 4LLWB 2NY2D 2MQCA 4Q58C 1XGPA 3VXOA 4BFEA 2O5YL 4KFZC 3OKEA 1EEYB 4MS8C 5DVMA 3GO1L 4QRRE 1Y0LA 1PGRB 4Y5YB 4YGVB 2AEQL 4MDJB 4X8JA 3UDWA 1XH3B 4Y5VC 4BQ9A 1DN0B 2OZ4A 2LTQC 2F53E 5I8OL 3Q6FA 5DRWB 1HH9B 3ULUE 4WGWB 4LRNH 3VMNA 1BMGA 5D4QA 1BF2A 4NCC2 3VXSD 3KXFE 5GRJH 3KLAB 1J1XH 3WLBA 4MHHG 1MLBA 2DJ4A 2AGJL 3WIHL 1GGBH 2DD8L 2NTSP 4Y4KD 3QUXC 5B8CA 4I18A 4X9HA 3HZMB 2EYRB 5D7SL 1Z9OA 1IAIH 4UMGA 4JO1H 5HVHB 4QHLB 2AK4D 4QHUB 3VDAA 3RPIA 3HHRB 5I73B 4HWEL 4AL8L 1CGSH 2I27N 3F12A 2APFA 5J6HB 5E9DB 4P2OC 1CVSC 4U7MA 1G0DA 5BS0B 4MWFB 2Z31C 3ARBC 3OJMB 3WJLC 4G9FB 5LQBL 3UPRA 1G1CA 1GHFH 3GMOB 2C1OA 2DM3A 3U4EA 1XGUA 4OKDA 1MFNA 3QEUA 2XTJC 4F15C 3KLDA 4O02H 3F7RA 1FE8H 4IOIB 1TPXB 4HKJA 3BW9B 5EOCH 5IQ9B 1NC2A 1Q1JL 2G5RA 1RZJL 4HIHA 5DTFA 3ZDYF 1OAXL 3ULSA 5GHWL 1JE6A 1FL5B 5MEPB 4KRMB 5BS0E 1UQSA 2B4CC 5IG7B 3HZYB 1VEOA 4G9FE 1QA9A 5GJSL 3LAFA 4HKBA 4NDMB 3GHEH 3FT4B 4HQQH 2J88L 4JZOA 1VGKB 3UYPA 4OB5L 3S35H 3ARSA 1F3DH 1S9XB 1H8NA 4U2YA 3P0YH 4JDTH 5D96C 3RZCC 5HYSG 4ZTOH 1MCBA 5J6GB 5BW7C 4MS8D 2FYYB 1G7JA 4NP4L 3BIAX 5EDXA 1LQSR 4OM0H 1CD9B 4JKKA 1BVLB 1Q9LA 1G6RB 4QRPE 1IC7L 1NFKA 3RL1B 4OZHB 2GCYA 4NN5B 3EOBB 1EV2E 3CDFA 3MNWA 2EYTA 4OZ4A 3KDMA 1RULL 4TNWK 1PBYA 2AI0L 5TDOB 1JRHI 3MLYH 3MRRB 3STLA 3NFNB 1KLGA 3LEYH 1ADQH 2GEEA 5E94B 5EO9A 5FUOH 2EIZA 3SDDC 7CGTA 4LASH 1A6AB 5J9PA 3QUXD 5D7LE 1J11A 2MCPH 4GBXC 1IFHH 5SX5K 3TBSA 1CE1L 2GJ6A 3BKYH 1EBAA 1OSZB 4OZHE 1BOGB 4X5XB 3OKKA 3QDJB 2B39A 3VH8B 2A6DB 1NCTA 2ADIA 4PJEA 4LIQH 3VRJB 4X6EA 4JKPH 4P2OD 1X5IA 1M1SA 3ZE0F 5BCAA 5FA4B 3ZSSA 3T3PE 3GGWB 3LPWA 3V5HB 2WV3A 1EBPA 4NO0B 3S3JA 1WZ1H 2IBZY 1M7IB 5I9QB 4JDVA 3OXSA 1JWUA 4R96B 1H5BC 2AVGA 3T0DA 1NCDH 4KMLB 3LKRB 5I2IA 5DJ0A 1A2YA 3F65A 3QXVA 2R0WL 3UO1L 1G1YA 2XTJD 1OHQA 3SKMA 3BEWB 3ZTNH 3NCBB 3OB0H 4MGXA 1DBJL 3WUWB 2ITCA 4G7VL 4ZAKB 4JFFB 1XCTA 3RWDA 5JR1L 4FQ2L 1I1FB 1VEMA 4XC1L 5LWYH 3MNZB 4JFOB 1RU9H 1T21A 1BOYA 2J8OA 2XZCH 1U95A 3PL6C 2HFEA 5JW5B 3HZVB 1FZOA 5F7WC 3FTGB 2HJFA 4NQSA 3SBWA 5GGTL 3L6FA 4LLVB 2FJFA 4Y8AA 1I9IH 2IPTH 4U6XB 2C7UB 4O2FB 1U6AL 3LHPL 3SCMA 2ZOKB 4YH6A 1HHGB 3L95A 1F58H 1WITA 2LE9A 1CYGA 4N90E 4QF1A 3ZKNC 4JFFE 4HIEB 3RZCD 3MRHA 2AJUH 3SDXE 1T1XB 5EOCJ 1MNUH 2BVUA 4Y1AB 2OTPA 1MVFA 1N6UA 3HB3C 2Q76B 2E8ZA 2EDDA 1SJHB 1XF5A 1ND0A 2CUIA 3O2DA 3G6JE 1CFSA 1K9TA 5CIPB 4OLZH 1G7HB 3SY0B 4X6BA 1DTUA 2VDOH 3EO9H 9CGTA 2J8UE 2HRPH 4NNXB 1OL0A 2CMRH 1BFVL 1HDMA 4QRTA 2GUOA 5DGQA 5F89B 3KYOB 1JI2A 2DOCA 3SDDD 3K81A 4DW2L 1F3DJ 4Y1AE 4QHNB 5C0GA 5IVXA 1CQYA 5T3XD 4WHTB 3CCHA 3OAUL 4GBXD 5JOPE 1BQSA 1A4KA 1HI6A 4I4WB 5F1NB 2BJML 4CU7A 4HX1B 3AS3A 4EVNB 4YZFE 3KYNA 3T2NL 1FAKT 3MJ6A 5HDQL 4N8CH 1NGPH 1KCVH 4YBHA 4R8WH 4L8BA 2DF3A 5DMJB 4X4ZA 1KIUA 3BGMB 4PJHB 3VFVB 5TH2B 5DC9B 3O2WL 3H42H 4DGIH 5SX4I 4APQB 1U2CA 2DYPA 4PP2B 4XCCH 2P8LB 1BD2D 2C9AA 1S9VA 1IAMA 4YXHH 3CSGA 5MEOB 1P9MA 1RUML 3SGDH 3QUZB 2BVTA 5ALCH 3U9UB 2VE6A 4JLRB 1HINL 3JV0A 3SE9H 4FABL 1CLZH 5GGVY 3FRPA 2R1XA 1YEGH 5C09B 5T5FL 3O4OC 4KMQA 5KZCB 5H37G 1JPFB 3PL6D 3SHSA 5DSCB 1RJYB 3MOAL 3WKMH 2Z93B 1E4WL 4BKLB 1K4DB 3AREC 5FCSH 3P9MA 3BE1L 1SQ2N 1K8DB 4HUWA 1KELL 1JNLL 1DQMH 3QZWG 2J8HA 3IDUA 4P9MH 3SE8L 4Z78B 3FHAA 2IAMC 3PJSB 2HN7B 3QHZH 5C09E 3MLRL 4DFIA 2G5BB 2XICA 1RIUH 4TVPH 2YPLA 5FO7A 2NMSA 3MV7B 5BV7C 2ATPA 1UWXK 3HB3D 2VLJB 3O6FC 4UTBH 4MD5A 1DBBL 4UT7H 5IW6B 4WV1A 5IMMA 2VABA 3G5ZB 1DVFC 1KENL 3LY6A 4K7PY 4WO4A 1NL0L 4YE4H 1FYTA 2WSKA 4UUJB 3MX0A 5B3JF 1H3UA 3QEQD 1XR8A 5IMOA 2P4AB 3HUJE 1FVCB 5LG1A 5HYJA 2VLJE 4OFDA 5EZLA 2OR7A 1RQ5A 3MFFA 5EU6A 3HPLA 4Q6YA 4Z7WB 4PLNC 3HE7C 5DMYA 1JWMA 2ZSVA 5FM5O 2F5AH 1GZPB 5JQ6H 1R0AH 1H8SA 1LO4H 3OG4B 1T1YB 5J57B 4J1UA 3FQXB 3BSZL 2OL3B 3O3BB 2O61B 4P59H 4EOWL 1QHOA 5IB5B 4Y88A 1BQHB 2AV7B 2DKSA 4F3FA 4GT7A 1ORQA 4RAUB 2A74B 2R23A 2AJYH 2NY3C 1A6TA 2Z35B 1JGUL 4DEPC 3CK0L 4Z7WE 1UYWH 4HDIA 5HVFB 3MGTB 3AU1B 4FQXB 4X7TB 1VADB 3FZUC 4NFBA 4GW1B 1RPQA 5IEHB 1OB1A 4X8XA 3LKOA 4Z5RA 3DO7A 3BPLB 3L1OH 4ZFOL 4JANB 4XMLH 3WEXA 2XKSA 3BYTA 4NN6B 4WFHD 3CVIL 3GDBA 4M3JA 4XPTH 3QIUB 3ARED 5HHNB 2Q7NA 3LVEA 5C2BL 1NMAH 1JZ3A 4WTZA 2X42A 4LK4A 3HPJA 4GRMB 4P2QD 2HKHL 3L3HA 2L7UA 1FHGA 5GRYA 3DX9A 1TZIB 2IAMD 3VMOA 2APVA 4NPYB 2FJHB 3CXDH 4X6DF 1IGML 1EUUA 2VWEC 3VWKC 3ARFB 4JY5H 5GIRB 3UC0H 4EBQL 5J13B 5AD0B 2DLFL 1VA9A 4FQLH 4RRPG 2D9CA 1CR9H 4YNYA 3O6FD 3I6KB 3RVVC 3O6MH 4BZ1H 2W9EH 4NT6B 5CD5C 3U7AA 1DVFD 3C5ZA 3PQYB 4RCAA 5EU7C 3HMWH 2NLJB 1E4XL 1ZSDB 2BCKA 3T0EC 5DQDL 5I1DA 3OAYH 4HPYL 5IMLA 4DK3A 2WUBL 3VXNB 4W6YB 4RMSA 4WFEE 1A3LH 1PKQA 3HAEA 5I8EA 1WZMA 3WHE0 3BOVA 2D03L 4L9LB 1G7MA 4ALAL 5C0AA 3GSWA 4L8CA 1B0GB 3HE7D 5AUMB 4RQQA 4O4YH 2NW2B 4JN1L 3LKPB 5JIKA 1ZEAL 1FL6B 4U31A 4MQSB 3HI1A 4HEME 5FUZL 3P4LA 4JGMA 3FO1B 3GMLA 4QXGH 4JDZA 3CVHA 2DQGL 4WJ5A 5I1KL 2VJXA 4LQ1A 1RJZA 1ETZA 4OZFH 2I9TA 2GIYA 3TIEB 1ZLUK 2ZCHL 4O00A 1T3FB 2IBZX 2NY3D 5DEFB 3MJ9A 3GSNB 2C4FT 4X9BA 1LO3H 1S9YA 4PRPB 4QLRA 1OOAA 2X89A 1J88A 3FZUD 3IKCA 3ZDXE 1GIGH 5C0EB 4EN3B 3FO2A 3PP4H 2JB5L 4PJ5A 1JK8B 1VKXB 5E6ZA 3UJIL 2P24B 3ME0A 4FQHA 4G5ZH 1UJ3A 4TQEL 5CUSH 4O9HH 4FTVD 2EO9A 3CSYB 4K3JL 3BP7A 1JI1A 4O2EA 4FQJL 1N5AB 4JRYD 5MEQB 4HC1H 2B5IC 4PRPE 5IW3A 1EJOL 1GC1L 3VWKD 2DS4A 1CE6B 4MNQA 4DCQB 5HHPA 4ETQB 2R0ZH 5IBTL 4KVCH 5FO8B 4P5TC 1BPVA 3RVVD 3AAZA 3O9WD 3AB0B 4A6YB 5ETUA 5CD5D 2VAAB 3ALWA 4PREA 5C0CE 5C71A 1NAMA 3DV6B 3T0ED 2C3VB 4AIZA 2GK2A 2IALA 3NIFE 1PZ5B 3GRWL 1KB5H 4RIRA 4R0LA 1GSMA 3S5LG 3IB4A 3Q5TA 3QBTB 4MAYC 4F9LC 5BMFH 2CKBB 5CS7A 1IEHA 1G9NL 4NJAL 3T09A 5IB3B 3VD9A 4EZMA 4D0BA 4LDLB 5DRZA 5CSZB 1HXMB 1YYML 1EMTH 5KTEH 1RURH 4EUPB 5I66A 4RMVA 2DQEL 2PO6C 1U8HB 3O41B 4RFEB 4PJAB 1J1OH 4WW1A 2ZG2A 4ZXBA 3MLUL 3BEVB 3RU8H 1MELA 4M4RA 2A1WL 2QADB 4ORZC 3OKDB 5I19H 2NX5B 4BSWB 3LS5L 1E27A 4BZ2H 3C8KB 5A16A 3EYSL 1JNNL 2P8MA 1QBML 5IROA 1RUPH 2MQ3A 5TFSH 2RGSA 4NKIL 5IUSA 1TVHB 3DETC 1QKZH 1CFVH 3S36L 1TJIL 4KI5E 3IDJB 1NGWA 1INDL 1YN6B 1CF8L 2OQJB 4NM8L 5LGHH 3K3QA 3QAZC 2YA2A 3V79C 5ISZA 4XNMB 4YHNB 2VDRL 1MHEB 3HRPA 5L0QB 2A6IA 4Z0BH 4KK8C 1P4BL 3RHWF 3TN0C 4KH2A 2OLDA 2V2WA 3A6BL 2FDBP 5DHVA 4KDTC 4NN7C 5I17A 1FNAA 2PUQT 2W60B 1KCLA 3MRLB 5D1XC 1P7KA 3HRZA 4GRLB 5INDB 3HLAA 5ALBH 2BZDA 3F7VB 3HCVA 3PWVA 4P5TD 3QCTL 1LO5B 3BKCH 2FX7L 2XRAL 4I0PA 3QULA 2FO4A 4WUUD 4PS4L 1NSNL 4DFHA 4XMKH 4MXVF 3X13A 2QR0A 5CCKL 1A7NH 2EO1A 2DI8A 1KJ2H 1PY9A 4A2LA 4OI8A 1VESA 1X5JA 3OXRA 1BGXL 3G08B 5LXGL 3DURA 1A6VH 4FZEL 3NGBC 4LBEA 2RB8A 3ZDZF 3DRTB 4K7PX 1V05A 3UTPD 2Z8RA 5IK3A 5D7JC 2ERJB 3C6LA 5IJKA 4MJIA 3ARRA 1RK0A 3BESR 4ZOAA 1FFOB 2PN5A 1TLKA 3MYJA 4XP9L 4O2CB 3T3ME 3KPPA 1EHNA 4K7FA 2PO6D 4OF8A 2QQKH 1FDLH 3V5DA 5JNYB 1NDMB 4PY7A 1N4XL 1WT5C 3PGCB 4YBQC 4TPRL 2H9GA 4Y5XA 4UI2A 3B3IA 2R0KL 4ZPVA 1NFDB 2JKXA 3WNNA 4P46C 4X7CC 5IF0B 4EXKA 2APTA 4Q74A 3UEZA 2B20A 2FLBT 4MX7B 1FH5H 3ZE2F 3JV6B 3FAWA 3NCCB 1NBYA 5D7KE 1AGDA 3O3DA 3ROOB 2ZOLA 3BH8B 5H35A 3TLRA 2OTUB 1K8IB 5DJAB 2GKIA 3DETD 5JMOC 2FWOB 3CUPA 3O8XB 5KSUA 2AXGB 1WFUA 3O6KH 2BVOA 2H6PA 4LRNL 5IIEB 3PV6B 4UQ3A 3REWB 1NFDE 3HR5B 4TUOB 2MHAB 2EC9U 4KK8D 4ZPTB 5EBMB 5GRJL 1UXSA 3IFOB 2Q6WB 4ODSH 4LSVH 4OLXH 4PFEA 3ULUF 4M6NL 5E6YA 4A2MA 3N9GL 2IANA 1DEEB 2P48B 3CX5K 4G9DB 3H9SE 4U6VL 4UNUA 4ODHL 2VSCA 5B8CC 4I18C 1I75A 4QXTA 5CZXC 5FCUH 3WXWL 1I7TB 4ZUTB 3V0VA 2R56L 2MWCA 2BY2A 2M26A 5TGBB 4XZUA 3WCYA 1XGRB 1IGTB 2XN9A 4TOYL 4U1LB 5D1XD 1IAIL 1T83A 3GIZL 3Q6GH 1T7VA 4NBXB 3DHMA 5F7DA 1A1OB 3MA7A 3BD3A 1J8HE 2AEWA 3NIGE 2VL5A 4X6DA 3VXSB 5HGGS 1KYOJ 1O0VA 1I3VA 2J6EH 5FDWB 5F7MC 5KVGH 5BQ7A 2R1WB 5HYSB 4AH2B 4NQCD 5KANG 2B8OT 4Y4KB 1T0NB 4I3GA 3RNKA 1F4HA 1F6AA 4MAUL 1EFXD 2QLVB 4MVBC 1R5WA 4MD0B 1KIQA 3T65B 2FSEB 1FORL 4LSRL 1S8DA 5CP3H 5HI5C 2NXYC 3VXSE 3UTZB 4I2XE 5D7JD 5F88B 4EQ3A 1IQDB 1WCQA 1S7SA 4K94C 4PJCE 3HC0B 3FT3B 1N0XH 1OAYH 5DUBB 1MCHA 3OF6A 1T5XA 5E1AA 3V7MA 3NBNA 1U8MB 4YHLL 3C5JA 5GJTL 3A6CH 1NBQA 5I8CA 3R8BB 3BWAB 3B2VH 2AK4E 3QDGA 4NC0B 4YBQD 5F7FA 3EOTH 4OGZA 2ZSWA 1YA5A 3CC5B 3S35L 4P46D 4O51A 3CH1B 4HT1H 2JELH 2CIIA 1I3RA 3JV4B 1VENA 4UILH 3REVA 5C0DA 1K3ZA 1LP9B 4J2XA 3MRBA 3VRLE 1A0QL 2H32B 5E00A 3V6OC 4CNIB 5HD8C 4ZFGH 1N6QL 5KSBE 3JWDH 4F57H 4JHAH 4YAQA 1JN6A 2QHLA 4UT6H 3TCLB 3WSQH 3D1MC 5EBWB 3QJFB 4QRUB 4WU7B 1QNZH 2X4SA 3KR3H 5DK3A 3RHWK 3P4OB 2VKXA 5KOVC 3OHXA 1T03L 2F5BL 2RHEA 1LP9E 1NMCC 3ORJA 5C9JA 1TVBB 5EUOF 4QHMB 5CZXD 4Y5VB 5IV2A 3QXDA 1A1MB 3THMH 2LTQB 5CZVL 5JDSB 1MIML 2WINA 2P1YA 2X4NB 5AZ2H 5DJDA 1X4ZA 1JFQH 3JWOL 4YHKH 3U7WH 3RDTA 1JZ6A 1N6VA 1JNJA 2XY1A 1T7YA 4LVNC 2VDNH 4L4TA 2F54B 4OZHF 2P5WA 2Y5TB 3QCVH 5E5MA 3MLZL 1FCGA 2FJGB 4JY6A 2W0KA 3QUXB 1SM3H 5ABDE 2LABA 1QYGH 3QO0B 1RUQL 4HXAH 1NCNA 1WZ1L 3U83A 2IGFL 5E99H 1QO3A 1F90L 3RUGE 3NFPA 4MVBD 3DXAB 1UXWB 1NCDL 4WU5B 1T0MB 4V1DA 4LVEA 2MMXA 3BP6B 4FFYH 5GXBB 5HI5D 4X7EC 4P2OB 3ETBF 2IFFH 2NXYD 2X1XR 3DUSB 3L3DB 2DLHA 4P3CH 1P6FA 2YEZA 2X4OA 3ARBB 2Z31B 2XY2A 1YPZB 2X4TB 4NM4H 1LE9A 1P53A 2VR4A 3M1BB 5D72H 3SKJL 1AJ7H 3F7YB 3LKQA 1X4XA 4JCMA 2ICWB 4Y16C 3EJJX 1RU9L 15C8L 5BXFB 3O3AA 3DVNB 1QVOA 2I25N 1KC5L 1DQQB 2XTJB 1FNHA 4F15B 2A0LD 5C0JB 2QTEA 3ARUA 3GNML 1FLRL 1FZMA 1C5CL 1UEMA 3U9PL 1V3LA 2WLZA 2FEEL 1MHHA 1Q38A 1LEGB 4TULL 3C6SA 3TWCH 1U3YA 3CFDB 4HV8A 4K71B 5C70A 2Q7YA 2AJUL 1YPZE 2DKUA 4PJGE 4PJIE 5HD8D 3SO5A 3DARA 1OF2A 4PRAA 3P9LA 1EXUA 1BIHA 1E4KC 4Y0GA 3SJVA 5HGBB 2XTJE 1TQBC 3L9RA 4LKCA 3CFKA 5KS9B 4F7CB 3VFWA 4NUGL 2C3WA 4XB8A 4M7KH 2VDOL 4KVNL 5DLML 1M6OB 4N5UA 5D96B 3MLWL 3MRQB 3DUHA 4TNVF 4R7NA 5CJQH 3VG0L 4X7SL 3CIQA 4DKDC 2I9LB 2YK1H 5C08A 5EOTA 1C1EL 1BBJB 3CDGA 3IDIB 1J12A 2DQTL 2WBJA 1BJ1H 3S3SA 5DGRA 1KIPA 3QP3A 5GGSY 1JIBA 3VI4F 2VZ1A 1VFBB 4LQFH 3CFEB 2DDQL 1AGEA 3QZWB 2FX8H 4MA8H 2NY5C 3TZVC 3SGEI 5GGSA 2X1WL 3BJ91 4ZSOA 2DM4A 1AI1H 1ZHNA 4ZOEA 1ZT1B 3UBXG 4HKXA 3WFEL 1PG7X 2Y5EA 4DVRL 2FZ3B 4GBXB 3CJJA 4XCCL 5JHDB 4JFXA 1U58A 3VFTA 4YXHL 4XBEH 5F9OL 3DBXB 1ZT7B 1E6OH 4WUKL 1IT9H 3LQZA 1R3KB 3ARZA 4XPFL 2DBJA 1U36A 1A02N 1EA9C 4PRDB 3IJSA 3MRCA 3L5IA 5IGXL 1DCLA 1YEGL 4RNRB 2X40A 3PABB 3P0VH 4FXKB 3QPXL 3NCEB 2W65A 4YHMH 5T3XE 3BUTA 3NIDF 4HS6B 4PJHF 2W0FB 5FAAA 2VXSH 3UMTA 3KPRA 4S11A 3SCMD 4LP4A 1F3JB 5CSBA 2VO5A 2H41A 3U1SH 4MDIB 1ORSB 4Y19B 4L4VA 3QHZL 2R0LH 1F6FB 3PL6B 1X6NA 4HJJH 1AP2B 4GFTB 3ELAT 1BD2E 1N59A 3TT1L 4WV1C 5TQ0L 3FOMB 5I75C 3H9HA 3QNZA 3U0WH 2RAMA 1C08B 3RQ3A 3U7YL 5F9JA 5FYJU 2VXVL 3K4AA 4FZ8L 3ARDB 4WO4C 2R2BB 4IIQC 4EJ1C 3T4YB 5C6TH 3B9DA 2F53A 5F6IC 2ZG1A 4Y19E 1I7RA 1FBIH 2A77L 4NC1C 4NZRH 4LLWA 4WCYH 1VACB 1KCUH 5JXAL 3D85B 3LCYA 4UOJA 5D1ZB 1U92B 4PJ9C 4G80B 1EEYA 3G6DH 4NQXB 2VDPH 3IDYC 1YQVH 4Y5YA 4P9HC 3QWRA 3RKPA 3GUTB 1E4JA 4MDJA 5ICYB 1XH3A 1H3TA 3TZVD 1DN0A 5TJWK 3TH4T 1NBZB 3NH7L 5L6YL 2DYPD 1K2DB 3MJGX 5DRWA 1HH9A 5DI8B 1KV3A 2LAAA 3SQOH 1CFNB 4JVWA 4YBLB 3AC0A 2C3HA 4C4KT 1CXKA 5E2VH 5ITFB 4OLUH 4NFDA 4LSPH 2V2TA 3VXQB 2FLRT 4HZAA 3H9ZA 3QSKB 3MLVL 5FYKD 2DLTA 2EDYA 2N7BA 1I9JL 4YHYC 1BJ1J 3IETB 4U6HB 3HZMA 2EYRA 1MFCH 5DR5H 4X5WB 4JZNB 5E2JA 2L0DA 4QHLA 3MRPB 4QHUA 3QEQE 2PYFB 1N8ZB 3BI9X 2PXYC 1T6WA 4HUKB 2P49B 4LPVA 2ICWI 4O5LH 1GXEA 5J6HA 1RI8A 5E9DA 2DQHH 4LNRB 4OD3L 4UV4H 4YGAB 2Y06H 3UJJL 3RWCA 1JTPA 5BS0A 3TBWB 5C8JB 4XVSH 4CN1A 4KXZH 2DQCH 3GMOA 4BZYA 1J0JA 4CVUA 1G7IB 5GRUH 4BSVB 1S7XB 4IOIA 3GBNH 3NMEA 5IQ9A 2VR9A 3T0XA 2WQRA 2YS4A 3AREB 2O5ZH 3CXHK 1A9EA 1RZIB 4ORGB 4D0DB 1YEDB 2AAVA 3AY4A 2AXJA 1FL5A 4WO4D 5MEPA 4KC3B 1FYTD 5FGBA 1UWEH 3HZYA 2IAMB 3H7BB 1N2RB 2EDFA 3DX8B 4TNVK 1VGKA 5ADOH 5JW4M 5TE4H 1ERNA 4K9EC 3UPAA 3O6FB 4KMTH 3SDCC 4NRYB 5HYJD 1DR9A 5EUOA 4WFHE 1XF4B 1S9XA 4N0UB 5EU6D 4EDWH 4JG1H 4P57B 3I50L 4R4FL 1IC5L 4TYUA 4PJ9D 5J6GA 4LVHC 2BSSB 4GAJL 2PKDA 2FYYA 3FRPG 5IQ7L 4P2QE 3TNMB 5HSFA 4FMFA 4ELME 2V5SA 2ZUVA 3MRFB 4HW6A 1BVLA 4LMQE 1G6RA 1MRDH 2HJLB 3U30C 1LILA 2PTTA 3RL1A 4OZHA 3EYUH 1RFDH 3EOBA 1DBMH 1MFBH 1W72B 4M6OL 4QXGL 4XRCB 1R5VB 4CRPA 4FN0A 4QHKJ 5D6DA 3R8QA 5L88H 4X4ME 5LGKA 1A14H 5TDOA 3RIAF 4Z6AT 2N4IA 5IBLC 2ZCLH 2DQDL 5E94A 4X4XB 1X44A 4X6CE 8CGTA 4X7FC 1A6AA 1ZA6B 1RIHL 2JF1A 5T3ZD 5EC2B 5A2JH 1OSZA 1BOGA 3PP4L 2PXYD 4X5XA 1Y6KR 3QDJA 3VH8A 3ZDXF 2A6DA 3VRJA 1ACYH 1UJ3C 2IF7A 1S3KH 5FA4A 4DEPB 3GGWA 3ARQA 4KKAC 5FF6B 3V5HA 5CUSL 1FN4B 1YY8B 4NO0A 3KYKH 1M7IA 1MIEH 3QUYA 4R96A 1UCTA 4M4PA 5L2JB 1NMBL 1P4IH 3KJ4C 3LKRA 1F45A 1HCFX 4F2MB 1FV1B 1I9EA 4YEFA 3BEWA 4WWKA 3LQAC 3FJTA 3WUWA 5IOPA 4RFNC 3KYMB 2W1NA 4P99A 3UYRH 1Z0MA 3CDCA 4NJ9L 4ZAKA 5GZOD 1SY6A 4JFFA 4FTVB 4PJDB 1VPOH 4L3AA 4KU1A 1I1FA 5E8NB 3M45A 4YFLI 3MNZA 4JRYB 4OQTA 1M71B 2ICEB 3SO3C 3HTLX 4YDIL 4R0LC 5JW5A 2W91A 3HZVA 4P5MB 2ZKHL 4PG2A 3MC0A 3FTGA 2X7LB 3QJHB 5JUEL 2KZWA 4XNQA 2YD3A 1B4JH 4LLVA 1KEGH 3PDOB 5B39G 4U6XA 2C7UA 4O2FA 3Q1SH 3G9VA 5M7QA 2HA1A 2ZOKA 4NCC1 1SYVB 5ITBL 3VG9B 3TA3A 2H8PB 4HIEA 4FTVE 1HOCB 3OTTA 3X3GL 3S37H 1T1XA 5E2TL 4P23C 4QTIH 4ZQKB 4YWGL 4OZGB 4BFIB 4JRYE 5FUCC 1L9NA 4RX4D 3QNYB 3W0WD 3HNVL 2Q76A 1IKFL 5C0IB 1T80A 3UYOD 4FA8A 3R4DA 5CIPA 4ZXBC 2VWEE 3ESVF 3SY0A 2PCPB 4M5ZH 3S97C 3S9DB 4LHQB 2UWEA 4UV7L 3QDAA 1DBAH 2CO7B 2DAVA 2P46B 4LCIL 4NNXA 3RU8L 1C12B 5F9AC 5EU7E 5F89A 3KYOA 5IBLD 4XT1C 3UZEA 3OAZK 3T0EE 1YNLL 3S34H 4K8RL 2X89D 4JEGB 4OZGE 1OARL 4WHTA 4Q9BA 1LO2H 1CFVL 4QRQB 4PJ5D 4YO0B 5F1NA 4I4WA 2CRIA 4JJHA 2W0PA 1R3HA 3LMJH 1HKFA 2VQUA 5LGHL 3WBDA 2EH8L 4EVNA 3PWUB 2BRRL 4RZCB 4KI5F 3WFBL 3MBXL 4PJAF 5EWIL 5D71H 3QUMH 4I77H 3BGMA 4KKAD 4PJHA 3VFVA 5TH2A 2C1PB 4APQA 4KKLD 2G2RB 2GAZB 4PP2A 2P8LA 4QXUL 1IC4H 4PIRF 1NANH 4UDTB 4Z7NE 2HAZA 3Q3GB 4MNQD 2FBJL 4H0HB 5I15H 1N3NB 4OFVA 3U9UA 1HK6A 3GMMA 4JLRA 1S7VB 5SWZB 2VXQL 3GBMH 4E5XB 3S88L 4I0PC 5I1GH 5C09A 1JPFA 1UB5B 2DJUA 1IEAA 4AEHL 1KCSL 3VGEA 3SGKC 5DSCA 1RJYA 4ELKB 4QT5B 2Z93A 4P4RB 4BKLA 4LMQI 4URTB 3IGAB 3B9AA 3KPOB 1DJSA 1K8DA 1ROWA 1TZGH 4P5TB 3VRIB 5DJ8A 3VFNB 4OD2B 5IJKC 3X11B 4WUUB 5L8JB 2Z0BA 4Z7UE 3TYGH 3OG6B 5CEYB 2ADGB 4Z78A 1M7XA 3PJSA 2E7MA 2HN7A 4DOHB 3MLSH 4NQTA 3VD5A 1RUKH 4RMRA 4P23D 4M7JL 2G5BA 2R4RL 1ZLWH 5JOEA 5F9WC 3MV7A 1Z3GL 4HBCH 4HXBH 2VLJA 3MODH 3QIBB 5IW6A 4MAYB 4ZXBD 1TJHH 1INEH 3O4LD 1AXIB 4GMSH 3EGSB 3BGAA 5K9JH 2CQVA 4K2UH 1WIUA 1NCWH 5IWLC 4LSTL 3EYVB 4WUUE 2Q8BL 1E0OB 1FH5L 3RIAK 4UUJA 4YHIB 3WL9B 3WV0A 4U1HB 4M43L 4DOHE 4Q9RL 2DL9A 5F6HJ 2N56A 1FVCA 1LGVA 1E28B 3V0WH 1X3DA 5ISZD 3J8F7 2CLZB 3OKNA 5ELIA 1FNGB 1GZPA 4M48H 4PBXA 4GG6B 5CMAB 1OP9A 4HUXB 2VQ1B 4YDVB 3FQXA 4ODSL 1I8MA 3G04B 2OL3A 4H0IA 1NFDF 3KVQA 1F42A 3O3BA 2O61A 4LCCC 5IB5A 3PWJB 1SEBB 2OMBA 3EO1B 4CJ0A 4LARL 4DZBB 1T83C 3B9EA 1BQHA 1GGIH 1JGLH 2D4DA 4MJ5B 1GCFA 1U3HC 1GGUA 2AV7A 1JYWA 1UM5H 3Q6GL 3QAZB 2A74A 4RAUA 3RX5A 4XH2B 3U6RB 2Z35A 3ILPB 4JFDB 4NFCA 3TN0B 3MGTA 3AU1A 2EC9T 4KV5F 2J6EL 4I0PD 2D31B 4FQXA 4P2CG 1AQKL 5E8PB 4XCEB 4GG6E 4X7TA 1VADA 1AGFB 4GW1A 3P11L 1KTLB 3C9NA 4NQED 4AMKH 2P8PB 4LCUB 4NN7B 3SKOB 1HILB 2PYEB 4R26H 3BPOC 4JANA 5E08H 4JQXA 4ODTH 3DGCR 3QIUA 1LE5B 5HHNA 3M17B 2CR3A 4WEUD 4JFYB 1JPTH 4IDLA 1BFSA 5KVFH 2W07A 1CLYL 4GRMA 4MJID 4NWUH 2D7TH 3NTCH 4I0KA 4NQCB 3EBAA 2UV3A 5CHNB 1TZIA 2VYRE 3VW3H 3UZVB 1CXIA 5JTWA 2FJHA 1LEIB 2YRZA 2FR4B 2P47B 1EFXB 5E4IA 3HMXL 5AD0A 2PYEE 2XWTB 3NACH 1RZGA 4HWUA 3I6KA 3RP1A 3TPUB 4BSJA 4NT6A 4S1SH 1HIML 4GMTL 3U2SA 3PQYA 3KWWB 2DBLH 3WO3B 3MRJB 5D7JB 2NLJA 1ZSDA 2B4CL 3QDHA 5DVNA 5IBUG 1WIOA 4LGRB 3LRSB 2O5XL 2XI9A 3FFCB 2EEAA 4NQCE 1FO0L 3NPSC 1DL7L 2DIAA 4ZMAT 1A1NB 3U4BH 3BP4B 1UWGH 2D2OA 1MH5B 3CNKA 3JWDL 4L9LA 4F57L 4JHAL 4YEEA 1B0GA 4P46B 1OM3L 5AUMA 4M7LT 2B0SH 3OJDB 2NW2A 3QQNA 1FIEA 3IS0X 3KR3L 3LKPA 3ABZA 5GRXG 1F2QA 1FL6A 4PJ7B 1Y0LB 1PSKH 2IAND 5A2FA 2JIXB 3LIZL 1OAUL 3UTQB 2BNQA 1K3IA 3FO1A 1FVEB 3ES6B 2HLAB 2KKQA 3KHOA 2XN9D 1LP9F 3JSSA 1LDPH 1U3HD 1NEUA 1BECA 1FNFA 1KGCE 5T1KB 1T3FA 5DEFA 4U1JB 3GSNA 5LBSL 4L1DA 4DVBB 4PRPA 3EYQC 3G5XB 5C9KA 3MR9B 1CDJA 4G3YL 5C0EA 4EN3A 5TF1H 5MP6L 1SM3L 3TJEH 3CFCL 1JK8A 4HXAL 3RJDA 1VKXA 3RPIB 4Z7OE 1I8LC 2I60H 2OSLB 4KAQH 3ZT5A 3RWFB 3W9DB 1GGTA 1BIIB 2A9MH 1L4IA 4FFYL 5I1JL 1IM9A 1NUNB 1N5AA 2IFFL 5MEQA 2E27L 1VFOA 32C2B 5J12C 4P3CL 1F4YH 1RY7B 3OF6D 2C1OB 2FRGP 1CE6A 4DCQA 1DQLL 5D72L 4UU9B 4ETQA 4KHXL 5FO8A 1G84A 4CVZB 4A6YA 2I5YL 2YWYA 3PHQB 2VAAA 5DD6B 1WTLA 1UZ6E 2B1HH 2VITB 1AXSB 3DV6A 2C3VA 1GGCL 1QFUL 4AY0A 5L7XH 2OXGA 1OLZA 2VDLL 3UBXB 2YD9A 4V2BA 4HKBB 1IGYB 2QV2A 2EDHA 2CKBA 1RZKC 4ZO9A 5C07A 4JZOB 5EZJA 2QHRH 2D9QB 3NCJH 2R2EB 1YPZF 3SGDI 1KEMH 4OCSH 4JFZH 5HHXL 1J0KA 1HSBA 1SHMA 2E7LA 5CSZA 1BAFL 1HXMA 1JP5A 4M7KL 4YDJB 4EUPA 3MXWH 3ZHDA 1U8HA 3O41A 1AY1L 4RFEA 4PJAA 1YYLH 1QLRB 2R29L 4YXKL 1NKRA 2WWMC 2VSDA 2WBJC 3BEVA 5IFAH 3PHOA 3OKDA 1UFUA 2NX5A 4BSWA 4RWYL 2EYTB 4ZG1A 3C8KA 3K7UA