2WP3T

Crystal structure of the titin m10-obscurin like 1 ig complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
b'RGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIRSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OBSCURIN-LIKE PROTEIN 1
publication title Structural Insight Into M-Band Assembly and Mechanics from the Titin-Obscurin-Like-1 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/structural protein
total genus 21
structure length 99
sequence length 99
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2wp3T00
2ZSWA 3S34H 4LLAA 4Z9KB 3FKUS 4MXWL 1I9JL 2AK1L 5E6YA 3UAJD 4NNPH 4I2XB 4YBHA 1N4XL 2WUBL 4GG8A 1OD9A 4NKIH 3M07A 4G9FD 1I7TB 1P9MC 3TBVA 4G6KL 4N1EA 4TNVF 3L3JB 3VFNA 4DOHB 4YDKH 5F7LB 5TQ0L 2NX5E 1NC4A 5B22A 1YQVL 2Y72A 3W39A 5I1DB 1G7HA 4L4TE 4P9HL 5FKAA 1CGSL 3L3KB 3NCEB 2NY0B 4X6DA 1DQLH 1NLDH 2IWGA 2XZCL 3ARFB 4RX4A 1R0AH 4ZUSA 4Y1AE 4ZXBB 3FHAA 4JY4B 5ANMB 1J87A 2AKRB 1Q1JL 3B43A 1K3ZA 1OSZA 4X6FB 2HFEA 3FO2B 3SDCD 3DYPA 1D6VL 4RGMC 4JM2F 4K7PY 1CQYA 5FYKD 1RAMA 2ICWI 4NWUH 5KG9A 4OB5H 4QLRA 2BNRD 4AJ0A 4PJDF 4Z7WA 5FM8A 2J4WL 1AFVL 4DW2H 4F8TA 3QPXL 5FM5O 3I50H 1U8NA 4KKAC 3QUXD 1S7XB 5A2KH 1Z0NA 2V9RA 3FOMA 5GGVH 4XX1G 4JKWA 4X99B 2R9HD 3V4VH 3FN3A 4MNHA 3TZVD 5J6HB 2EEBA 2WANA 3TIDA 3B9KC 4X7TB 3SDAC 2ED7A 1U8MB 32C2A 4NCDA 4TUJB 1GPOL 3OJMB 3U4EA 2DLHA 2NLJA 5HY9A 4NYLB 3RDTC 4ZPTB 2IJ0C 2PYEA 3TO4A 2QL1A 3PP4H 1CT8A 4P5MA 5E00A 1L0QA 3C5SA 2NXZB 5E1HB 2VQTA 1T1WA 3MV8A 4FA8A 3RUGB 3GMNA 1OGAE 1Z9SA 3D48R 5C09B 3QQ9C 5C0ND 1ZANH 5D72H 3QDGB 1MEXH 4C56B 2ZPKL 1AKJB 1SQ2N 3UYOD 5IBLD 3UPCA 3WIHA 2NX5D 5GPRA 5I19L 2D0GA 1G7MA 3RL1A 2NW2B 1G7PA 4L4TD 5F9DC 2AS5M 1KNOA 1GVIA 2VITB 2YSSB 4ZTPL 5C3TA 1MJ7L 4Y1AD 1NGXB 4WW2C 2AXGA 2OL3B 4QXTA 1MCKA 3VXPA 3MLRL 5F9AC 5IEHA 4JLRB 1LEKA 3QNXB 3W5NA 3H2WA 2GUOB 1E4XI 5L2KB 5SV3A 1ZLUH 4NNYB 3B2VH 1GGBL 1KV3A 1WC7B 2CPCA 1KJVA 3DX8A 4W4OA 1G9MC 4LASH 1SEQH 4JFZH 2C1PB 3CFBB 5J1AA 3LRSA 3O9WA 4EDXB 3IRPX 5T1LD 3NFNA 1EJ6A 3IJHB 2C4FU 4XPTH 4N90E 4UT6L 1DQJA 3ARSA 2FHFA 3IF1B 5AZEH 1KGCE 1KJMB 4M7KH 2NNAA 1CQKA 3QI9D 3GMRA 3TT1H 2D2OA 2E7BA 5A16A 3MODL 3S35H 3SKJL 3ELAT 1ONQB 2EC8A 4HDIB 1MIML 1MUJB 2A6KA 1P4BL 1Q0YH 2HTLD 2XWTA 2HRPL 1WCQA 1UEMA 4P9ML 4QRQB 1QNZH 2IH3A 4QNPE 2AQ2A 1Q72L 3SE9L 4HGWA 1ORQA 3G6JA 4OT1H 3BMVA 4PJGB 1MFCL 1M71B 4NC0B 1GZPA 3FT4A 1G1YA 4N0YL 5T1KA 4K94C 4IMLB 1T04B 1CU4L 3WNKA 4KV5F 2XTJC 2YWZA 1TIUA 3VWKA 2X4SA 3X3FL 3DVGB 3MCLH 4OFKA 1Z9LA 3QFDA 5ERWA 1G6RH 4HPYL 3PHOB 4PBWD 3KVQA 3Q2CA 4GT7A 1N5YL 1YPZA 2BVPB 3L7EB 1N8ZB 4HZAA 1RHHB 1OB1A 1ZLSL 5E2TH 3VXQA 3BN9D 1PDKA 1IM9A 4NBXB 4QOKE 2FECL 2HJKA 3IU4L 2XRAL 5KVFL 5AWNL 4TSBH 4MMXC 3MBXL 3GRWA 3QUKA 1JZ4A 4WEUD 1CE6B 3G5ZB 5DHVH 3T3PE 3OG4B 4J1UB 2N1KA 1H3XA 3O6KL 4L4VE 5ICYA 1W0WB 2Y5TB 1RZFL 2J3SA 4F9PA 2HT3D 5KVGL 5J11B 2HLFC 3O6LL 1KC5H 2E7MA 3U1SH 3OKOA 4X0KA 4GRLB 4Y4FA 4PRNB 5D7LB 1QLEH 5TGBA 4I8DA 2P24A 3BEWB 3BVNA 3H8NA 3HPLB 5A43C 4N90D 4TVPH 3LRHA 4JVPA 1KGCD 3AB0C 1Q9WA 4JN1H 1RJYB 4FQCH 1FG9C 4LSTH 4JQVC 1U8HB 1F58H 3INUH 3IDGB 3RGVC 1FO0A 1SY6L 3D0LA 4FP8L 2QBWA 4UTAL 4APQD 1UWEH 2AEQH 1LP9E 2GSIB 2H45A 1DTUA 4I0PC 4M7ZC 3M45A 3GK8H 1UFUA 2XN9E 3C09C 4PJHE 4YK4B 4OGAD 5DMIL 3U9PH 1VHPA 3GMPB 4OQ1A 5T1DH 5FFLA 3MLSL 3QUZD 2OYPA 1BWWA 1OL0A 1RJCA 4CRPA 3TA3B 4R6UA 1L4IA 4WJ5A 5AAWA 5DRNB 4LSPH 3AXLB 3KPSB 4GG6B 2W60A 3WDIA 5TE4H 3MRJB 1F6AB 2V5RA 4KK8C 2WLZA 4V1DB 4MD5B 3FB7B 5D9SB 5K59E 1FNFA 2DMKA 2BFVH 4HJGA 2X70B 4PV9A 2H41A 1FNAA 1FYHB 4WVRA 3ETBF 3OGCB 3LEVH 1ZWIA 4F80A 4U6VH 4MLSA 3N50A 3QG7H 2R1YB 4OFVA 3BJLA 1VFUA 3TBSA 5D7IA 4JCMA 1U8IA 1CD8A 4QOKD 4YHKL 5EU4A 4RQQB 1T20B 4X8JA 3PWJA 1BVKA 2I27N 1RUMH 3GB7A 1OP3H 1EHXA 3MXVL 4LLWA 4KC3B 4L4VD 2H32B 4WWKD 4BK4A 1RULL 3GMLA 3A6OA 5EUKB 2H2PC 5K9OB 3I6LE 5F7DB 2YN3A 1BBJB 3REVA 5JIHA 4GQ9L 5IIEB 4UDTA 4LEOA 1NCNA 3T65B 4G8GA 1MHPL 3QDME 3WFDH 1KJ2A 4AL8H 1ITCA 3LCYA 1ZTXL 5E6IB 4HFUL 2HN7A 3CVHB 4Q97A 5ACZA 1J5OL 1QSEB 1EERB 4M1DL 4NQDE 1WWAX 4D9LL 1QBMH 4GO6B 3LKOA 4TPRH 3QCUH 1GIGH 1FN4A 3FZUC 5HJ3A 1WJ3A 1MCRA 1UCBH 1ZHNB 1ZVYA 1IC7L 4U33A 3BKCH 1VGKA 3VFRB 3LIZH 5DQ9A 3L9RB 1RZ8B 5JIIA 2FBJH 4MDJB 4PJ7E 4U6XA 4CADB 1I1FA 4PJIE 4NO0A 2DJSA 2ZG3A 4YXKH 1WEJH 1UZ6F 3H3PH 2XN9D 1ZA6A 3DXAA 3D25A 3QPQC 2XQBH 3WKMH 1AHWB 1EMTL 1MFNA 5BOPA 1CL7I 5DHYA 4LRIA 1B6DA 3GI9L 4XBPB 3U36B 5AD0A 5IKCA 4U1NB 4JREC 4F33A 2R2CA 4XVJL 1FLRH 1UM4H 3T0EA 1U2CA 3T0VA 3VFGL 2FZ3A 1V7MH 2DQGH 3CC5A 3BO8B 3HTLX 3ULSA 4FNLL 4L3EB 4H1LB 1MQKL 4WFHE 4LSSH 2F19L 3PF2A 2B1HH 4Y5XB 4JRXA 4KVNL 5EC1B 3K4DA 2RQ8A 3ZE1F 3BGAA 4BSWB 5BXFA 4HUXA 4ZQKA 4F58L 4N0CD 4N8VG 4L3CA 2Z92A 1HNGA 1HH6B 5FHAL 4ZFGL 1KCVL 5IWLC 3GIZH 5DS8A 3DUUB 1DANU 2OL3H 2X4QB 3BH8B 2IQAB 1H3UA 1A7QH 4ZUWB 1AY1L 4B7LA 3KPPA 1FJ1B 3VXSB 3LHPL 5GGRA 2XACC 5IF0B 4L8DA 2NY5L 4QHLB 3RTQA 4N5EC 3PDDA 3I6LD 4BUGA 1BOGA 1JRHL 4Q58C 3LD8C 2OP4H 4U1SB 3QDMD 4J8RA 1QZ1A 3MX0A 1OTSD 5IVXE 1EO8L 4NZRH 3GMMA 4AEHH 1KFAH 1J7VR 5EU3B 2ARJA 1WLHA 3D6GA 3EOAA 1EGJH 1ZVSB 1S9WA 4NQDD 1CFNA 1U8PA 1VFMA 3KLDA 4U1IA 2EYSA 3U6RA 4KTYA 4LHUG 5IK3B 2WBJA 4LCUA 5D1ZB 3QNZA 3X13A 2ZCHH 3WJLC 3KWWB 2DIJA 1A6TB 4C55A 1QPXA 4M7LL 1ROWA 1Z5LB 5D1QD 2V7NB 1AIFA 4KPHL 2YOCA 4RZCA 3IDYB 4ZUTB 1OAZL 1OGTA 4DK6A 1KTLB 1WSST 3C60D 2GT9B 1OWRM 3TM6A 4OIIH 5JOPE 4JZOB 5FOBA 3IDIB 1NFDE 4A6YL 1HHKB 2DQHH 3HMXA 3O6ML 3C2SA 2LABA 2JJSC 3G6DL 1MELA 4PLKC 3MJ7A 3RWJB 2JTDA 1F90H 3ZDXF 5SWZE 1AO7B 1YNTB 5GGTH 5HHOB 3SE3C 2CRMA 2Z8SA 3P0YL 5HDLA 1WVZA 1OSPH 1U91B 4D94A 4P2QE 2QQNL 4JHWL 1SEBA 1L9MA 1CDGA 4RFOH 5JOFB 2VLRE 3QH3B 1QEWA 2ZJSH 4KDVA 5HGGS 5CEYB 1UJ3A 1WZMA 2Q7YA 4ODSH 3UCRA 3HE7C 5F6IC 3WNMA 1N7MH 2K1MA 1JTPA 1CD9B 3KLSA 4HEPG 3RNKA 2R69L 1EBPA 2HYMA 4JY6B 3C2AL 1FNGA 1UH3A 4LCYB 2NCMA 3G08A 1OP9A 4NZUL 1CGXA 5MEPA 5CIPB 2J8UE 3TWCH 1QYGL 2BOCB 3LB6D 5CFHA 3PJSA 2J12B 3CFEA 1S5IL 5IJVA 1I7UA 1KPVB 4RNRB 2AP2A 2CMRH 3V4PL 1T5WB 1HEZA 3K46A 4MXVF 1IAKA 3LS4H 5FECB 1T5XA 1INDL 4LEXH 5KS9A 4XAWH 4DN3H 1KIUA 2GTZB 3PIQA 4NKDB 1E4WL 2ICWA 4X4XB 4MNQE 4ERSH 1IC4H 4KUCD 5CZVL 4EI6B 2QQLH 4LFHD 2BRRL 5F1SA 3F58L 4HC1L 4OM1H 1FZOB 4HG4K 1U41A 5JQHC 2H8PA 3E6FA 2R1WA 1R24B 4UQ2B 1AD0B 4EUPA 4AM0B 1XGYL 2UYLB 1RUQL 3OX8B 5EIIB 1N3NB 3R8QA 1V7NL 1J9CT 2C1OA 3U0WH 3GZKA 3K1KC 4HUUA 4MA3B 4MWFB 3CSYB 5DZOA 3CMGA 3HRZA 1T1ZB 3DYMA 4OGYL 5JHDB 2YHGA 3X14B 3WV0A 3SDCB 2QQQA 5CKGA 5HGAA 2OR9L 3N9GH 3O2DH 1I75A 3A67H 3O3AA 5T3XH 1YQ2A 1T1YA 1SYVB 1BM3H 4LAQH 2BNRB 4TSCH 5I8EB 3FT2A 3TN0B 5E8PA 4FABL 4XMPH 1TQBB 4P2QD 5I15H 2F53B 1WQVT 4ZUUA 5EN2B 3QUXB 3PL6A 4PJXF 1VCAA 1FFOB 1JV5A 4X7EC 3P3YA 2WNGA 3Q6GH 4H25B 4J6RH 4NQXB 2VLRD 2H32H 2FCBA 4LSDA 3KNBB 4PS4H 5IVNA 1KPUB 3QEGL 3BWAB 3AAZA 4JFEE 2XG5A 4Z7VA 3TZVB 5C9JA 5DFVC 2DQIL 5KJRH 5I1HL 5BW7A 2EE6A 1RSFA 3V7MA 3PGDA 3FO9B 3BP4A 3KPRB 1MPAL 3QXTA 3EZJB 2VNCA 4WI3A 3QDHA 1Q9LA 1S7QB 3MLVL 4WUUB 4Y4KD 2MSPA 4D0CA 1RV6X 2A9NL 1LEGB 5DJZA 4LNRA 4YHIA 1CLCA 5JZ7D 2BDNL 4G43A 2VO5A 4BKLA 4RCAA 2VDNL 3THML 5KTEL 4IS6B 5HTSA 4K8RC 4KXZH 1CFVH 3OG6B 1F13A 3GSNA 2Z31A 4MNQD 1CLYL 4Z0XA 1X7QA 3KPOA 5HYJA 1DSFH 4G3YH 1D5MB 2NX5B 2QADD 1KPRA 5EZIH 5JQ6H 4CVUA 3SDYH 1AR2A 4L4TB 3RWCA 2NY6D 1MCPH 4R0LA 1ACYH 3VGBA 4JZNB 5E2VH 1OARH 3S88H 3NGBC 4R8WH 5IGXL 4WWID 3SGKA 5J9PA 4H1LH 4UV4H 2HJFA 4M61B 2OS7A 1QRNE 5DRZB 5L8LB 4PJ8C 2XIDA 2AV1B 1FL6B 5KN5A 3EO1A 4JPVL 3IAPA 3UBXB 3VRLE 1D5BB 3IFPB 3CU1A 3LKPB 5C0AE 5EU6A 3MRBA 3LPWA 3OZ9H 1I1AA 2CDGA 4QHMB 4Q9RH 4AEIL 3ULVL 1LDPH 3S36X 3LKQA 4WW1B 5EBWA 4PJFF 3CUPB 3M1BB 1FRGH 3SDXE 3WNPA 4U1LA 1HXYA 1S8DB 5IOPA 4CNIB 4DZ8A 2WK2A 1RIVL 1U3JA 2ICEA 1QG3A 3D39A 1XGRA 5I71C 2XWJB 4HWEH 4X98B 4JFED 5TPWL 4DEPC 4GW5B 2AK1H 4KDWA 2X4NA 3BMWA 5GRYA 2PW1B 4IRJD 4JG0L 5EOTA 2J6EA 5IB4A 3PP3K 4G6KH 2H9GB 3WLBA 3WL9B 1FDLL 5TQ0H 1UENA 1EK3A 2WV3A 2HG5A 3FL7A 4UT7L 4EN3C 4G7VL 4P9HH 1CICB 4OSUL 3EYOA 3PWNB 1E27A 2XZCH 4HIEA 3OXSB 2FJGB 4ODUA 1MAJA 1OGAB 4WO4D 1Q1JH 3VJ6B 5ELIA 4I5BA 5IMLA 1QLRA 2YMXL 3MO1A 5CBEB 3JV4B 3MLUL 5JA9A 3Q5YA 1D6VH 5F3BB 3V5DB 4MSWB 4PRBA 1MWAH 1U3HA 2XZZA 4ZFOL 5DF0A 4C83A 3QXUA 1PZ5B 2ICCA 3PWVB 1YJDC 1ZHKB 1IGCL 2WBKA 2J4WH 1AFVH 1AQKL 3DIFA 3QPXH 4HJJL 3VFVA 1KIQB 3CD4A 4CMHB 2XKUA 5LGJB 2HWZH 1A7OL 2WWKT 4PG9A 3QULA 4XNXL 2V17L 4IJ3C 2BHZA 3AVEA 1Q8MA 4Q6IB 1QRND 1FH5L 5IQ7L 1L6XA 1FIGL 1JGEB 4PP2A 5MI0B 1CD1B 5ALBL 2BVOA 5C0AD 4ODWA 2XZAL 3G6AA 5D6CB 4YEEA 2XWBA 1R5IA 1G7IB 1NPUA 1GPOH 1U93B 2AJ3A 3S96B 2NW3B 4PJEF 1FBIL 4MD4A 4OLZL 1TZHA 4APQB 3MROA 5EU7E 4CVWA 1SJEA 3VFMA 3Q0HA 3R0MA 5CIPH 3ARBC 4KKAD 4GRMA 4JDVA 4UDUA 4MJIA 3TNNB 5LXGL 3ARPA 1MAKA 2IH1B 5EZJA 5H37G 3V52H 2ZPKH 4HFWA 5TDNB 1HILA 5I19H 5CBAA 3ARTA 4YHOL 1K5NB 3SDAD 1MJ8L 4X7DC 2VLJB 1EEYA 5EORL 1ADQA 2JCCF 1I9EA 4S1RL 4I48B 1MJ7H 1H5BA 2Z91A 3HZMA 5DK0B 1T21B 3MLRH 4PG2C 4MQTB 2O93L 3RDTD 1W72A 3N85L 3LS5L 2YPLE 4PRHA 3VI4E 3RI5F 4PJ5A 1ITBB 1OD7A 1F45A 3IVKB 3RIFK 2G2RB 1GGBH 5IB1B 3TYFB 4P99A 3NZ8A 4QOKB 4PJAF 4ZTOH 5D2LE 3VWJC 3U0TB 1P4LA 4B5EA 4F7CA 1AXSA 1B0WA 4LPCA 4UT6H 2N56A 4KTEL 3SDDD 3BPOC 3IKCA 4HX1B 1T3FB 4WWKB 5D6DA 5BRZA 4TRPH 5FYKH 4OLEA 1T66C 5DVOA 3MODH 3WO3B 4JVUA 1D7FA 3UTOA 3LMJL 3SKJH 1NAMA 3W9EA 1KENL 4PRAA 5CUSL 3VDAA 1MIMH 3GEWB 3PHQB 3QSKB 5DGRA 1P4BH 2E7LC 3ZYIA 5J6GB 2HRPH 1R3HA 3W11C 4P9MH 2APXA 4OJFL 4R4FL 4NPYA 2X4OA 1Q72H 3SE9H 3GUTB 3BIKA 2R2HB 3QIWC 1MFCH 4NN7B 7CGTA 1CIUA 4N0YH 2CXKA 4U49A 4JY5H 4KHXH 2P5EE 3RZWA 3SCMC 2V2WB 1CU4H 1QFWI 4ELMA 5I1IL 2Z4QB 4H8WC 1YC7A 4OLUL 1LP9B 2X89D 3X3FH 5JXED 3DSFL 5L9DL 1CBVL 4ZAKC 1K6QL 5LCVL 1E6JH 3DV6B 3ZHKA 4YHYC 1SJXA 3MFFB 4A6YB 2XN9B 2EYRA 3D9AL 4HPYH 4PJHB 5I30L 1ACZA 2JB5L 3WEXB 3QXVA 1C5DA 1N5YH 1JK8B 1IE5A 1BLNA 3H9SA 1FNEA 5FYLE 5L0QC 2ADIA 1FCCA 1CXIA 4PGBA 1XCTB 4HXAL 3IU4H 5KVFH 3DX6B 3MRFB 3MBXH 3BT2L 2EYTA 3RX8A 4K7FB 5BZDB 3VXRB 5DJCA 3O6KH 1MFEL 2V9QA 5HDBE 5BJTB 2KZ1B 1I1CA 4KJWC 1RZFH 2IC2A 4M02A 1H0DA 3K0WA 1ETZA 2YPLD 4NBZB 4PJ9A 5GIRA 2DQUL 4YJZL 5KVGH 4A2LA 1EJOL 4LSQL 4GKSB 1XZ0B 3O6LH 3OKMA 2VDQL 5AZ2L 4WNQA 5CZXC 1A7RL 5J12C 3BZEB 1QQDB 3IAGC 4FXGA 3TBTB 3MJ8B 3O11A 3FONB 3CSPA 1WFOA 4LF3B 3B3IA 1J05B 4RSVA 5F7EL 5JPNB 4OZFG 5DEFA 4OLVL 4BZ2L 4AT6B 1JNLL 5I8CA 2H3NA 2XXCB 4YC2C 4LCWA 2AK4B 4DK3A 3WLWC 3BN3B 3ZE0F 1SY6H 4FP8H 3HE6A 1CFQA 1WK0A 4X6EA 3BQUA 3UTSB 1U58B 4PB9H 1SJHA 1P2CB 3QDMB 2VISA 3MV9A 3V9FA 2YK1L 4OCNC 1MSPA 3MV7E 4NSKB 4XVUC 3MCKB 5DMIH 4LU5L 3QAZB 3SBWC 3FQUB 3JTSB 4JM2A 1NBZB 2HLFD 3Q5OA 3VFUA 3QO0A 4NQDB 1DZBA 4OLXL 2BY2A 4NJAL 4G9DB 1BX2B 2OJEA 3FO1B 3X12B 1IM9D 2AJYL 5L88L 5C2BL 4HWNA 2P5ED 9CGTA 5IV2A 2ZUQC 4KQ4L 1ZV5A 1KJ3H 3VDCA 1I7ZA 2FGWL 4PJ7B 1P9MA 3MBEC 4O9HL 5CJ5A 5DJ6A 2ZUUA 3WIHL 3L95A 3NA4A 5CP7A 3RWIA 3KYMB 3C60B 3WIFB 4BSVA 1J0ZA 3SY0B 2VJXA 5FM5M 5FYLD 3QXDB 4FXKA 4XBGA 3W9DB 3LV3A 4I0PD 5F1KC 2YPVH 1C1EL 3NCJH 1NMCC 4JANA 3P4LA 2EEAA 1TVDA 4U3HA 3TFKC 3Q5TA 4NDMB 2P8MA 3HI5L 4OD2A 3P9LA 2FL5A 3MXVH 4FQQA 2DWDA 3MRLA 4MJ5A 1YECL 1RULH 5MERB 3IU3B 1WAAF 1EX0A 1YC8A 3CFDB 3W0WB 5F7YC 5FDWA 4P2OC 4KKBD 3MFGB 4GSDL 4L8SC 4GQ9H 3O0RL 1NGYA 2DJ4A 2DMBA 1MCLA 3B6SA 2P5WA 1ZTXH 3FOLB 3H3BC 4HFUH 3RWGB 1EEUA 1UWXK 3TH4T 3S36L 1EFXA 1J5OH 2NY4B 4M1DH 1YN7B 1MFBH 1NMAL 2BY1A 3DGGB 3TO2B 4FZ8L 3IDMA 3ARDD 3TBYB 3B9KA 1IC7H 3HNVL 2WWMC 1KG0A 5JLZA 5F8RC 1TDQA 2YUXA 1OTUD 3IDNA 3UTZB 1MVFA 5MEQB 4Z77B 5IVXB 3MV7D 2UVFA 1DE4B 2F8VA 4AY0A 4PR5A 1WCBB 2H2PD 3G5XA 4QF1B 4LCIL 4KKCD 4K3HA 4HS6B 1EMTH 2OI9B 1AGCA 5ID0A 4OZGE 3MNWA 4WFEE 3GI9H 1PKOA 2CLZA 3OJDB 1JZ6A 4GAYB 1MCJA 3ARED 1IEBA 3LKNB 4L1HA 1F97A 4XVJH 2J8HA 3EO9L 4YFDB 4AG4L 3VFGH 1G9NL 1HHIB 1BZ9B 4FNLH 2YA0A 5DRXB 3LH2H 3N1FC 1BAFL 4Y5YB 1MQKH 1B3JA 4OF3A 5CZKA 4IIQC 4YFLI 3VD7A 4KVNH 3QRFM 5E94B 1GGYA 1JF6A 5JW4Q 3IGAB 4F58H 1R3LA 3IXAA 4S10A 4DGVL 5HGBB 3L3IB 1BJMA 1NFDB 5B39B 5FHAH 4ZFGH 1QBLL 1KCVH 3JUYA 4FQIL 5GGSB 3QPQD 4QRUB 3BSZL 4PREA 5I16A 1NCWL 1T0MB 5KW9H 5D96B 3FB8B 4GS7C 2FYYA 1F3JA 3GSRA 4GRWB 5FYLL 5SWZB 2DWEA 2Y5EA 1HQRB 3BUYB 2RCSL 5ESQB 5I2IB 5SWSB 2NY5H 4JR9H 2OZ4L 2X4TB 1YEFL 1IL1A 4KI5F 3KLHC 4NZJA 1JRHH 5C0DA 4DWHA 2IFFL 3V95A 3I6KA 5DT1L 2VLRB 2EDTA 1UKSA 1EO8H 4JO3L 4LSVL 1Z9MA 3C6LC 4NKOA 5FKPB 3SQOL 2DRUA 2VXTL 4LHUD 5C8JB 1ED3B 1NUFA 2DTML 3O6FA 2OQJA 1JWUA 1AR1C 1NBYA 3CFJB 3PGFL 1HYRC 3OL2A 3ULUF 2FSEB 5ACLA 4Z0BL 3GJFA 3KPQB 1G0DA 1M05B 1MCCA 4D0BB 3ZT6A 1WIUA 5C92A 4TUOB 2J8UB 2VXUL 5F72S 1J0KA 1OP5K 2XZQL 1PG7X 1N0LA 4Q7DA 4KPHH 3BJ91 4GKNB 1JGLL 1YY9D 1OAZH 4N5ED 3G5VB 3T3ME 4ZFOB 4WFED 4LVNB 3JWDL 2B39A 4MNQB 4DUWA 4Q9QL 4A6YH 1I8MA 1F4WL 1T0NA 3VXTB 3P73A 5J7CC 1ZGLP 3G6DH 2I07B 3QHFL 1HKFA 3V6FB 1RMFL 1XF3A 4PGCB 3BRDA 5HHQA 4YZFF 4ENEC 2DI8A 3P0YH 3STZA 4PTTA 1XF4B 3BPCB 2QQNH 4JHWH 1ZHBA 2EH8L 1NDGA 2BK8A 4MJ2A 1LK2B 4Y16C 3MR9A 4ODTH 4WU7B 1RI8A 5IB3A 1EHNA 3MLWL 4YR6A 1IGTB 3QA3B 3UYPA 4JPWL 4XCYA 1ZLWH 3C8HA 3DUSA 1N2RB 5IW6A 1Q94A 2R69H 1KJ2L 2IBGA 3C2AH 2NXYC 3NCYS 4NZUH 3VXMA 2HJLB 1TVHB 5JR1H 1QVOB 1FFRA 2GITA 1QYGH 1IZJA 5DD3L 5C0CB 1S5IH 3HUJB 4HKXB 4MA8H 1MRFH 3VXOA 3D69B 4HBQA 5FIEA 3V4PH 3RGVA 4FXLA 4JFEB 3AS0A 1WBYA 2PO6B 3L3OB 2HKHL 5HYQB 1INDH 4UUJA 3SPVB 4Y8AA 3FTGB 4GAJL 1E4WH 3OXRB 4IRJB 4MX7A 5CZVH 1HSAB 4H5SB 2Z35B 5DRWA 1TFHA 2P48B 3F58H 4Z6AT 1P1ZA 2YZ8A 2VLMD 1PKQB 1OAXL 2HVJB 5LGHL 4NUGH 1T6WA 4HK0A 2ZUXA 4ACPA 4FQXC 5DJXB 4NFCA 4JZJB 4NJ9H 2ZSVB 1XGYH 1PBYA 5ENWB 1RUQH 4G42B 4MXQD 3VW3L 3KPMA 2N7AA 5ICZA 4L8CA 2IQ9L 4F7MB 1JBJA 4WO4B 3ZDYF 4G6JL 1J8HA 4PTUA 4OGYH 4NRXA 4MQXC 3HG1A 4R4BA 1U8OA 3KXFB 5F88A 1M6OA 2OR9H 1JPST 2MCG1 4P5KA 4YHNA 2OBGA 3V7AE 3FRUA 5ISZE 2F74A 2PYFB 1SBBA 2ID5A 2AJVL 4FABH 2MFNA 4YO0B 3P77B 4JPIB 1I3UA 3GSOB 1JZ2A 2B4CH 5EFIB 3ROOA 3ROLA 2AGJH 2R2EA 1QRNB 2R2BB 4F57L 2Q1EA 1HWHB 2NY0C 2NZ9D 1QO3A 4EI5A 5D5MA 3QEGH 3ARFC 5FYJE 3VA2C 4ZXBC 5IR1A 3G9VA 3WSQL 1NMBL 4LLDA 5I1KL 5I1HH 5T3ZE 3ZO0A 5BQ7B 1JWMB 5HI3C 1P6FA 4X4ZA 3MXWL 1MPAH 3TBVB 2HKFL 1ZMYA 3MLVH 2A9NH 5FKAB 2BDNH 4N8VA 4HH9A 3DARA 3DV4A 3MREB 3MGTA 4ZUSB 3THMH 1MVUA 5KTEH 2BMKA 3CH1B 2Q3AA 5DVMA 1OSZB 1JPSL 1CLYH 3D85A 3BIBX 1HSBB 3CSBA 2PETA 4HZLA 3EYFA 1EAJA 2ZUSA 4X7CC 1VFAB 1JNHA 5GZND 1WWCA 5C08E 4OKVA 3K3QA 5DFVD 2A1WL 5ABDE 5KG9B 3IDJA 5KSUA 3R0NA 5B3JE 4Z7WB 4HUVA 3MMEA 3GSWA 3GMOB 4U1HB 3Q6FA 5A2JH 4NT6A 4XH2A 4YBLB 2NTFA 5MENE 2VABA 2ENSA 3D39E 4NQEE 5F96L 4JPVH 2NXZC 4L1DA 5FA3A 4LIQE 3NIFE 1IFHH 2OX5A 5ISZD 2DD8H 3MGAA 4AEIH 2EDEA 1FAIH 32C2B 1MLCB 3SDDB 1NBVL 1X4YA 3U4EB 5C07A 5L7XL 1YY8A 3RIFF 4PP1C 2NLJB 1A6ZB 3QBTB 3VG0L 1NLBL 4D9QE 1JNJA 3DROA 4JM4H 2E7CA 3MOAL 1RIVH 2EXYC 2UV3A 1CT8B 2GFBB 4TULL 4UIMA 2FH6A 2VDOL 4ZOBA 5FYJD 5TPWH 4P2CG 2VQ1A 1R3JA 4MZ3A 4WRLA 4ELKA 3GMNB 4R7NA 5T3ZD 1ZGLB 2FHCA 1F8TL 2ERJB 4LMQE 4W6WB 4P59H 1OAUL 5HHXL 1RJLA 4JG0H 2FEEI 3MRIA 1IKNA 2VAJA 3U46B 2VZ1A 1G7MB 3RL1B 2GSGA 4UT7H 1MH5A 4ZS6D 1Z3GL 2LV4A 1KNOB 4WHCA 2WSKA 3GM0A 2J2ZA 5CAYB 2B2XL 3VXPB 2W9EL 5IEHB 3MRMB 1LEKB 1KTDA 1U3ZA 2QSTA 3JV5A 3EDDA 2YMXH 3H42H 3LEYL 5EOQH 3MLUH 3BEVA 3JZ7A 5C08D 1KJVB 3DX8B 4F3FA 3NTCL 4IRSA 3EYSL 5J1AB 3O9WB 2YD9A 2UWEA 5IG7A 4OZHE 2ZNXA 4R97B 1DQJB 3P4NB 5EIQA 1IGCH 3PGCA 4OI9A 1YEEL 1T2JA 4L9LB 4G6FD 4HJJH 2AXHA 4IRZL 3GMRB 4E41A 2C4XA 1A7OH 4RIRB 1CDJA 5A16B 5CWSA 4XNXH 2V17H 2YPLB 1FH5H 5EO0B 1S9YA 5MEND 4OTXL 1FIGH 3DI3B 1IGIH 1OPGL 3D39D 3D3VE 4NQED 1G7QB 5T33L 2VDML 2IH3B 1CDBA 5ALBH 2L0DA 1NFIA 2J7LA 5D2LB 2QLVB 3ARGC 2XZAH 2YR3A 3NCFB 2X40A 1QR1B 3KYNA 3OKYA 5BZWA 5KSBF 4S1DC 3HE7A 4WEBL 3C5ZD 1X5YA 4D9QD 1FBIH 4OLZH 1OW0A 3VWKB 1FNSL 5INDA 1F3DJ 3QFDB 5ERWB 5E8NA 4PRPA 2RIKA 1PY9A 1FPTL 1JF1A 1YPZB 4R26L 2AAVA 4JRWA 5J11C 1YEDA 3HR6A 5LXGH 4PJ5E 4YNYA 3SKOA 4DQOL 3RFZC 1OB1B 5HSFA 3VXQB 4GRLC 1U3HD 1IM9B 5C0BE 2HJKB 2E27H 5T3ZL 4K3EL 1E28A 3ZDZF 1IZKA 4YHOH 1MJ8H 4DFIA 4RAUB 2YC1A 4S1RH 5CILL 2GJ6E 3V6OE 2WINA 3BPNC 5ICYB 3N1GC 3DO7A 4HWBA 3N85H 3MRRA 1S7RB 5FK9A 1T2QL 4S1QL 3VU2A 4X0KB 4Z7UF 2R1XB 3O8XC 4FHBD 1U8JA 3SJVA 3ARBD 1F4AA 5SWQB 5TGBB 4YK4C 2P24B 5EBLA 3BVNB 4JHBA 2E6PA 3OF6D 1H8NA 2IANA 5F9JB 1RIUH 2BVEA 3WS6C 4KTEH 1Q9WB 5CSZB 3OKDA 3GSQA 2GY5A 4ZNEA 3D0LB 5EO1B 3M17A 4DUXA 4YX2H 1KENH 3AM8C 5CUSH 3ZE2E 3D3VD 1SHMA 3RP1A 2AEPL 3U79A 5DDHA 1WTLA 4R4FH 4NZTL 2DOCA 3RZCA 1RJZB 3O3UN 4BZYA 2GHWB 4JFFA 2Q86A 1C16A 1YEKL 3ARDB 4GOSA 2D7OA 4M48L 1KXQE 3GHEL 2V5SA 1VSCA 2W60B 1KT2B 5I1IH 12E8H 2IGFL 4U1KB 4O02L 4OLUH 1P7QA 4WTXA 5GJSL 5K33A 5IQ9B 1CBVH 3DSFH 4DJMA 4X6CA 3MV7B 3WXVL 8FABA 3D9AH 4PV9B 3HC4H 1MRCH 4QCIA 5I30H 3CNKA 1NC2A 1T66D 2NYYD 4QXUL 2QSQA 3R4DA 2HTKC 4PJ5D 4JHZA 1SYSA 3LKSA 5JW3H 2CKBA 1U8IB 3QDJA 1UGNA 3AREB 5C0BD 4B41A 1DBKH 4HXAH 3IYLW 5E6IC 2V7HB 3GB7B 3BT2H 2OTUA 2GJ6D 3FQRB 3UROR 2CLVB 1D5XA 3GMLB 4WV1C 3GNML 2GJZA 3SCMD 1KELH 2JF1A 2DQUH 2ADFL 4LSQH 4PY8J 3MOBL 2VDQH 5AZ2H 1H3PL 4UDTB 4ZAKD 4LEOB 3B2UC 4G8GB 4U7SA 4C4KT 5F7EH 2HN7B 1AHWC 1AXIB 4PJ8A 4OLVH 4X6DF 4BZ2H 3MRPA 1JNLH 4UU9A 4M5YL 1WT5A 4JFXA 1K4CA 5DVNA 1FN4B 2ADGB 2QR0A 3STBA 4UTBL 5FAAA 4LPVA 4PJDE 1REIA 1U92A 4P57A 5B4MC 5IEKA 3VXUA 5C0GB 1SMAA 1WV7T 4HS8L 4U6XB 3A0OA 1KULA 3J7HA 4XC3L 1SJVA 2NY1D 4PJBF 2KBGA 4MS8C 3D25B 3DECA 4Y5XC 3QIUD 4HKJB 4LU5H 2KUTA 2ORBL 4WGVB 3RY6C 5DHYB 4G7YL 1FZKA 4PJCE 3O4LA 1BQLL 4OLXH 2EKJA 5IKCB 4NJAH 5CZXD 5T5NG 1TNMA 4FMKA 2AJYH 5L88H 5C2BH 4P3DB 3EOTL 3T0EB 3VFTA 4KQ4H 4OZIA 3CC5B 4ZFZA 2FIKA 1GCFA 1UKQA 4TTDC 2FGWH 3ULSB 1UXWA 1UH2A 2ARWA 2YEZA 4O9HH 3WIHH 4OV6F 3LY6A 1K8IA 3B83A 1NFKA 2H26A 4D3CH 4QHUB 1KF9B 3D2UA 1ZLWK 1MJJA 1W0YT 1MFDH 4EN3A 5BXFB 4HUXB 1ADQL 4ZQKB 1DR9A 3UTQA 1XR9A 4F8QA 5I8KL 4L3CB 2Z92B 4LRNL 2VE6B 3LAFA 1YNLH 2HFFA 4HKBB 3N0PB 4OI7A 1W72L 4JGJA 4H1LG 4XVSL 1SVZA 2C9AA 2V5TA 3HI5H 3KPPB 1A6VL 5GGRB 4M4RA 1UB6A 4ZYKB 4PJEA 2ADJA 4L8DB 2Z93B 1YECH 2F15A 4P9HC 1XFPA 3P9MA 1NGWB 2BNUA 3C5JB 5SV4A 5D1ZC 3RPIA 4YHLL 4GKZB 1JFQL 5J0BA 2X42A 4GSDH 1S78D 2ZOKA 3O0RH 1NH6A 2VR4A 3P2TA 4J8RB 3RWDB 1FP5A 3OR6A 2IG2H 3GMMB 3PDOA 3MRQA 3P9WB 3IDYC 3AS1A 3MRGA 4XWGL 2ARJB 1NAML 5D2NA 4NFBA 5EDXA 3S36H 3MYJA 2E9JA 4GH7B 1CFNB 1G84A 3MRHB 4MVBC 4U1IB 5BO1H 1A1OA 2EYSB 1KBGL 1IEHA 1NMAH 4JEGB 4XP5H 2WBJB 4FZ8H 4XXDB 4LCUB 3QNZB 3X13B 3DOSA 3CLEL 3HNVH 3HNTL 3TFKD 3OPZH 3IFNL 3HS0A 3RAJL 1Q38A 5JO5A 5C3LD 1TTGA 3RWEB 5ID1A 3T09A 4G5ZL 2BOBA 4RZCB 1A9EB 2Z8WC 4LDEB 1OGTB 3ZTNL 2F5AL 4LCIH 1E4KC 4P3WA 4R96A 2A73B 4P2OD 5F93C 5CGYD 5DQDL 4PJAA 4U05A 3PHSA 2BC4A 4JN2A 3B9AA 4O00A 3EO9H 4AG4H 2X7LA 1QLFA 1KIRB 2XFXA 1JE6A 1DBBL 4HW6A 1BAFH 4LHJB 4R4NC 3UYRL 4KV5E 5CINL 3IETA 3OGOE 1TJHL 1KB5L 3DMMA 3OJVC 2LVEA 3G6JF 1X5AA 1T1XA 2XQYK 1SEBB 1URLA 4DGVH 1MCEA 3NMEA 4PGEB 3U4BL 1I7RB 3V5KB 4FQIH 5IVOA 3BSZH 1XIWD 3U9UB 1UJ3B 5TF1L 5FYLH 3UAJC 4UB0L 1Y6MR 5JNYB 4RAHA 2RCSH 3RNKB 4K7PX 4JDTL 2PTTB 3K81A 1BWMA 1FNGB 1T0PB 3G08B 4Q2ZB 3VWJA 4UV7L 2OZ4H 5ITFA 1YEFH 4Y0GA 5TH2A 3NFPA 2IFFH 1I7UB 1QFUL 3ALPA 3BRFA 2VAAB 3QQ4B 1AD9B 1HEZB 4LSVH 4IOIB 2EXWC 3SQOH 5KS9B 3WXWL 3FMGL 1VACB 3MRDA 2DTMH 1QTYT 3S5LB 1TZGL 3PGFH 1C08B 1WBZB 3QNYB 4M7JH 2WQRA 5IVZA 3SDCC 2ITDA 2D31A 2EKSB 3NOIA 1LWRA 3E6FB 2FBOJ 3U30B 5HI5D 4LKXA 3TIEA 3MLZH 5FF6A 2XZQH 5IFAL 2LAAA 4OM0L 4MCZA 3TN0C 1ZSDA 1JGLH 2GKIA 3T8XA 2X4PA 2C1OB 1TQBC 2O26U 4HUUB 5A40E 3QUXC 1JHKH 4KY1H 3HRZB 2HVKA 3FQNA 1RUKL 2E7HA 1A6PA 2QTEA 1PW3A 4KJPD 4S0TD 5ICXA 1N26A 3FB6A 4OZFA 1O0VA 4N0UE 1F4WH 3OTTA 3S37X 4HBCH 2AW2A 3C6LD 1F2XK 2M26A 3QHFH 1CTOA 4PLNC 1P84J 2R9HC 3O3AB 5I1LA 3TZVC 1T1YB 4F7PB 4ZDHB 5I1AA 5E8PB 2QHRL 3T1FB 2WUCL 1QKZL 1A5FH 1FC2D 3ALWA 5DMKB 2EH8H 1JV5B 1A3QA 5KVEL 5DQJB 1B2WL 1VESA 4WI4A 5I1EL 3OB0K 4HT1L 3MLWH 3RVWD 5IMMA 5CEXA 1FNHA 2W0FA 4GJTB 4JPWH 3AAZB 5A2LH 5FUOL 4OBRA 3MGOA 5BV7L 5C9JB 4ZUVA 5ISZB 3PGDB 3QZWB 4JFDE 1E0OB 3UPAA 1L6ZA 1N59B 4FG6C 1CE1L 3PQYD 4NO2A 1B88A 1MY5A 2ED8A 4JFYB 3BAEL 5DD3H 3DRQB 4LNRB 3PUCA 3CJJA 4YHIB 4WTWA 4ENED 4U1MA 5C2UB 4M6ML 1J1PL 2HKHH 2CIIB 4DOHE 3VCLA 1KB9K 1KIPB 3JV0A 4RFEA 4GAJH 3QIBA 4MNGA 4Z0XB 2F8XC 4W6XB 1KEMH 5DLML 1AGBB 3HG1E 3F5WA 4X9FA 1MLBA 3WN5B 1OAXH 5LGHH 4LLQB 2FD6L 1QA9A 3P4OA 1WAAA 3RWCB 2I9TA 1JUFA 1QFWH 4FS0A 4XP1H 4R0LB 1HOCA 2NXYD 3VW3H 5EZLA 4O2EB 2IQ9H 4YXLL 3CVIH 3MBEA 4G6JH 3VGEA 1UZ6E 2HJFB 4CN1A 3GKWL 3MRKA 3K4ZA 1D9KD 1DUZA 4KZDL 1UC6A 5KN5B 5C08B 3EO1B 3VFSA 1UXSB 1CWVA 4QT5A 1P6AB 2A83A 1I1AB 4EKXA 1MAML 4I0CC 3SO3B 2RR3A 3LKQB 4GXUN 1IEAA 2AJVH 3LKRA 5DVKA 4BQCA 4DZ8B 1DVFD 4OCYL 4U6YA 2VUOA 1G7JA 5MENB 5FM4A 3UBXG 4F57H 2GY7B 2ICEB 3ZE1E 3D39B 1CICC 4FOMA 3OKKB 5EOCL 1K3IA 4ESKA 2MNUA 1ES0A 1S9XA 3O3DA 2EIZA 1X5JA 2HT2C 5B38G 5I1KH 2JIXD 2BVYA 2C3HA 4JFDD 1VADB 1T83C 4MHHI 4MQXD 4XGZA 5EOTB 4AH2A 3MXWH 5IB4B 1PVHA 4NKMA 2HKFH 3BN9C 5INCA 3C5ZB 2WIMA 4GXVL 4OF8A 5EBGA 4LLMA 2HG5B 3FO0L 3U83A 4PB0L 1YUHA 3GIVB 4HIEB 4CDGC 3QR2A 1CF8H 4LPTA 2C3VA 4CMHC 4LDOB 5GGQL 2KQMA 2JB6A 4I5BB 4L3AA 4QYOB 3MO1B 1YEGH 2HT3C 4Q6IC 1JPSH 3HG1D 3EYQC 2NY0D 1S7UA 2AQ3A 5MI0C 4PRBB 1U3HB 1YN6A 3FN0L 4ZXBD 1UB5B 3P30L 5SX5H 4ZO6A 1QD0A 1CZ8L 3QB7C 2A1WH 2VL5B 5IB5A 2AEWA 3GSVA 1E6OL 2FLBT 1JGVL 2A74B 4JRYE 1TCRA 1JGUL 1QRKA 4XHJC 3VFVB 1B6UA 3FQXA 3R1GL 5GSVA 3E6HA 3QULB 5EPMA 1WF5A 3T4YB 2CH8A 1NEZG 1DDHA 5I1JL 4APQC 1EFQA 5F1NB 4N0RA 3QYCA 4PP2B 2Q8AH 4NNXA 2BNQA 2QQKL 1HKLL 3DHJA 3QXAB 5F96H 5IUSA 2BVOB 3HFML 4RBPH 1UM5H 5EIVA 4OGAC 4CN4A 4OZHB 3D1MC 1V3JA 1XMWA 1PSKL 4P2RE 3ZDXE 4JO4L 4MD4B 2R0LL 2UZXB 5HDOA 3BD4A 2D7PA 1SJEB 1FLTX 4Z7OF 4WTZG 1OQOA 3D3VB 3U2SB 4TULH 2VDOH 3NN8B 4HHAA 2V5YA 1XGPA 1R6VA 2I9LA 2PW2A 4PGDB 4KDTC 1F8TH 4UDUB 1S5HA 3KG5A 5EWIL 1OAUH 4AEEA 1O5DT 1YMMA 1OT2A 2VUYA 1RZKL 3HKFA 5DJ0A 2NXZD 3R8BB 3SE4C 3CAFA 2NY5C 2VIRB 4ORGA 4IOFD 2FX8H 2OM5A 2QKIA 1DBML 4YDLB 1RK0A 4PRIA 1RY7B 1EEYB 1Z3GH 1ZT7A 4XNMA 3QDGD 4XNQA 3MLYH 2L7UA 3HZMB 4OQTL 4WWKC 2B2XH 1A21A 3F7VB 4E41E 1K9TA 3REWA 1W72B 4D8PB 2X9YA 2CUIA 3LEYH 4MXVE 2EXYD 4PJ5B 4OCMC 5B21A 3U0PB 5ADPL 1T4KA 1J11A 2W9DL 4GUPB 3NZ8B 4OUUA 3BISA 5HHNA 5C0BB 3NTCH 3EYSH 3PDGA 1G7LA 2V2XB 3QWRA 1P4LB 3IT8D 3RBSA 3UTTA 3IJYA 4JRYD 2CGRL 2GJ6B 4NM8L 5HYFA 1J1OH 3IKCB 1Z6JT 4NN7C 4IRZH 4QTHA 4LL9A 1IAII 5C9KA 2FR4B 4O2FA 3CPLB 2H1PL 4OTXH 4PRAB 5IW1A 1OPGH 5I1CL 5LWYL 5T33H 1F3RB 2VDMH 5GZOC 1G6RA 4JG1H 1MHEB 4NPYB 4GAGL 4Y16A 3BIKB 4K7PL 2CDEA 1VERA 1A6AA 3S97C 5KVDL 4KRMB 4P2RD 4WEBH 4ZODA 4O58L 1F11A 2R0KL 1BVLA 1FORH 4ELMB 4RDQF 2B5IB 2QJDA 5TE6L 3E3QC 3UDWC 1X5FA 2PTVA 3HZYA 1FNSH 3BIAX 3LN5A 4PJXE 1PYWB 2NY1B 2EYRB 1MHHA 4NBYB 3D0VB 3QIUB 1FPTH 4FFZL 3O45B 4R26H 3KPSE 4GG6E 5F9OL 1BLNB 1LD9A 4DQOH 1FNEB 3P4MA 3MUZ1 3S8WA 1GOFA 3BW9A 4KKNA 5FYJH 1CFTA 1GGIL 5LAXB 3RPKA 5TJWK 4LPWA 3SJVE 3H7BA 5T3ZH 3ARGD 4LKCB 4K3EH 1KB5B 1JZ8A 5F8QC 4OD1H 1BGXL 5CILH 4Z7VF 1NDMA 2APWA 3BRGC 4FQXA 3T2QA 1M1SA 4E41D 5EO9A 4IDLA 1FG2B 4XTRC 2IPKA 1U42A 3S37L 5H35A 1T2QH 4E0RA 4S1QH 3O41B 1MCFA 5DJYA 5K59F 1OTSC 5HYIA 3IAQA 5LBSL 3TNMA 2O61B 1FVEA 1AXTL 3B3IB 2CQVA 3QAZC 1EA9C 4LVOB 5I8CB 3EFFB 4W6YB 4MYWB 4P4KD 3KS0H 5GS1A 4FMFA 1ERNA 4WIQA 1R5WA 4I2XA 1N6QL 4R9HA 4MA7L 3L7FA 3HE6B 1KTRL 3F6IA 4KUZH 4X6EB 2CLRB 3BQUB 5TE7L 2AEPH 3AY4C 4U3XA 3L3JA 3MUGB 4CMMB 3VMNA 4KFZC 5MP6L 1DFBL 4QRPE 3QJHA 1OLZA 3C60C 4KMLB 4B0MM 3QQ3A 4U7MA 3QO0B 1XF5B 3L3KA 1BPVA 1I3GL 4DKFH 3LPFA 2Q76A 1LO4H 4P46D 1C12B 3ARFA 3MA9H 3O8XD 3QDJE 1YEKH 4YPGB 5ANMA 1KYOJ 1B90A 2AKRA 4M48H 4PJDB 2GAZA 3GHEH 4ONGL 3BKYL 2RFXA 4X6FA 5AG9A 4XNZB 3HC0A 4JQXC 4PJFE 1LO0L 2IGFH 4O02H 1BBDL 5GJSH 4G80A 2DQDL 2BVUA 5DJ6B 3S3PA 1EPFA 1JVKA 1P5VA 4HCRH 3WXVH 3L95B 5HYEA 1X5IA 5CP7B 3RWIB 5BMFL 4QXUH 5F7HA 1QSZA 3KPSD 4HAFA 1HYSD 4BSVB 1QFOA 4P2OB 1S7TB 3K8KA 1WICA 5CLTA 4NP4L 1OCWL 2VZSA 3LV3B 4GMSL 4L3EE 3WE6B 2G75B 1BMGA 4TSAL 2Q7NA 1ZAGA 3WCYA 4PJIF 1EZVY 2XY2A 2KDGA 4EXPX 4X80L 3NCMA 4NRYA 2P8MB 4OD2B 4KJQD 2W65B 2NY4C 7FABL 3UPRB 2BX5A 3QXWA 2DWDB 3MRLB 4MJ5B 5DHXB 4GW1B 1P7KA 4X99A 4NO5B 2VSDA 1HCVA 5J6HA 3GNMH 4WCYL 1CLOL 4YBQC 1NGPL 3UX9B 2JELL 4QY8A 2ADFH 5D71H 4OLWL 5CJXC 4ZOCA 2EIDA 3LB6C 3MOBH 3RKDC 5M95B 1H3PH 1T80A 5DD5L 5GRVK 3H3KA 1XIWB 4P23C 4ZPTA 3R06B 3AROA 2VZOA 3UXFA 3D18B 2OI9C 4QRSA 1EEQA 1ND0A 1X3DA 4M5YH 2R8SL 3MC0A 2FB4L 5HD8D 2A77L 1A3RL 1IGYB 2XQYG 3RUGA 5C09A 5E6ID 1WIPA 3H6JA 5JLZB 1KG0B 1QACA 4XCCL 5FYKU 4C56A 3BFOA 1AKJA 3I3BA 4XC3H 3FT3A 3WNLA 3C8DA 3G5XB 1YNKL 3GO1L 4QRPD 4XZUA 2ORBH 3MNVA 5ID0B 5GSRA 1BQLH 1T89A 2VITA 1NGXA 2OL3A 1F4XL 1IEBB 3ULVC 4JLRA 1ULVA 3QNXA 3WFHA 3CU7A 5D96C 4F7EA 5L2KA 4NNYA 1G0XA 4AIZB 1WC7A 4F15B 2FECI 1ZE3C 2C1PA 3CFBA 4AQOA 1J88A 3CXHJ 4EDXA 4KUCF 4NQSB 4R3SB 3IJHA 5HVFB 5T1MB 2DS4A 4LFHG 1R3LB 3IXAB 1WZ1L 2VR9A 1FV1A 3IF1A 4L3ED 4LRNH 1KJMA 4UQ3A 1UEYA 1EO5A 4XPBH 5HHOE 5D1XA 4MS8D 2C5DC 1QSFE 4HWBL 5DTFB 2CSPA 1W72H 4CDHA 1ONQA 4XVSH 1EGJA 2FYYB 3GSRB 1MUJA 2YRLA 1A6VH 2CUHA 4CBPA 3ESUF 4QRQA 4Y2DA 2YD8A 1I85C 2GCYB 1NFDF 4LVHB 2JCCE 1EVTC 4LARH 4YHLH 1IC5H 5B39G 4TTDD 5FCUL 4P4RB 3UBXI 3I6KB 1M71A 1DQMH 4GBXD 5JZ7C 4I9WD 3HPJA 3TPUA 3SN6N 4IMLA 4ETYA 4JB9H 3KS0J 1IAOB 1LO3L 1T04A 4XWGH 4LCCA 4H8WH 1CI5A 2VLKE 5KVMC 2DKMA 2OQJB 1JWUB 3O2WL 1NBYB 4LVNC 4PJAE 1KBGH 3GJFB 4UBDD 4QTIL 3IXTA 3FCTB 5FO7A 3VD9A 2VR5A 3CLEH 3ZYJA 2YRZA 3L7EA 1N8ZA 1RHHA 3IFNH 2Q8BL 4JDZA 4G8FB 2BSRB 5GGTA 3RAJH 4Z8FL 1DQDL 2FIRT 3H0TB 4G5ZH 3ZTNH 2F5AH 1EEZB 2X4UB 3AMLA 1CE6A 2AQ1A 4Z7UA 3G04B 4J1UA 1MCBA 1JPTL 4QHNB 4BYHA 5J89A 1W0WA 2Y5TA 1RU9L 2ZWLT 1A6WL 3SGEH 1BZQK 2X09A 4R90H 5CJQL 1MI5E 4KVCL 1DBBH 3ECBA 1XF3B 2CKBL 4MVBD 4M6NL 2C3XA 5D7LA 2WW8A 4HIJB 5JHDE 3CDYA 1LO5A 4PTTB 3LZFH 1TJHH 1KB5H 3IRZA 3BEWA 3HPLA 5BVPL 5I18L 4ZMAT 4ZOEA 2BVQA 2A6IA 3H9HA 3MR9B 5DZLA 3U4BH 4BELD 1D9KB 5HHOD 2DIBA 1QSFD 4Y19A 1U8HA 4P5TD 1HIML 4HLJA 4OFPA 3IDGA 3VGFA 2PO6C 5TF1H 2EH7H 1V05A 2F53E 2BSSA 4L5FH 4EBQL 5IW6B 1Q94B 4UB0H 2GSIA 4G6ML 5I73B 4JDTH 1Q9OB 3ZT5A 1SM3L 3A6BH 3MRCB 5GRWA 3GMPA 2QSCL 2J88H 2F54A 5FGCE 4WU5B 1CXEA 4NQVA 3C8KA 3UEZA 1DVFB 4JZJC 4Z7QE 3TA3A 1QFUH 5HXMA 1K8DB 3B5HA 1FZJA 1I1YA 5DRNA 2EDOA 4WDIB 3AXLA 4MAYA 3VXNB 2MJWA 4DVBB 4WUUE 2VLKD 1J8KA 1F6AA 3WXWH 4UUJB 4V1DA 3FMGH 4MD5A 4WO4C 2JIXB 4JFDB 1TZGH 5IHUL 3VD5A 4MX7B 4I4WB 1CTNA 5DRWB 1BIHA 1MCOL 2X70A 1P1ZB 1W2KT 2DLFL 3GJEB 3L5IA 4LQ1A 4NUJB 1QUNA 3DBXB 2R1YA 4XXCC 5IFAH 2BY0A 4OM0H 4F37K 2OR8A 2V9TA 4XMLL 1F00I 3KPMB 4RQQA 5ICZB 4AYFA 5CP3H 4M3KB 3DMMD 5D7KE 4OI8A 3DHMA 4RBPK 3I02A 5IROA 3T0XA 3TVMD 3VGAB 1D6EA 4J3WA 4NRXB 1JWSA 2H32A 3HG1B 1CVSC 3MNZB 4R4BB 5IHZB 2W91A 5EUKA 5F88B 1M6OB 4P5KB 5F7DA 1MI5D 1BBJA 2EXWD 4YHNB 2DQEH 4LHQB 3CH8A 4Z95L 4O5LH 5IIEA 3EYVA 3VGHA 2F74B 2MMXA 4MQSB 3RVUD 3T65A 1DN0A 2IBZY 5JHDD 2QHRH 3RKPA 2WUCH 4NQCA 1QKZH 1A14H 1KYOK 4AENA 4M00A 1EXUA 4PJBA 5KVEH 4KMTL 1B2WH 2R39A 5I1EH 4HT1H 3TN0D 4H26A 2Q6WA 4EI5B 1ZHNA 2ICES 1T7VA 3L9RA 1JRHI 1RZ8A 1WBXB 2F53D 3L3HB 4ZSOE 4MDJA 4G8EA 2UVEA 2VZ3A 3T0BA 1CDUA 1X44A 3WFEL 4HS3A 1CE1H 1I8LA 4J4PD 2IFGA 1MIEH 1UWGL 4OGZA 3BAEH 5DD1H 4XBPA 3U36A 2DJUA 4HH9B 3KPRD 3T04D 1DLHB 4M6MH 1J1PH 1MVUB 4WUUD 1ZKAA 4K9EL 2GK0A 3SDXF 3UZEA 4H1LA 4HLZH 3S3JA 4YBLC 1UA6L 1C7TA 2XA8L 4HZLB 3WDHA 3NCCB 5EC1A 4OZ4B 5L6YL 3K7UA 1QBBA 1UQSA 3IDJB 2FD6H 5KSUB 3KJ6L 3WMSA 2YD6A 5FO8A 3DUUA 4MB5A 3BH8A 4POYA 3MMEB 1EO7A 3GSWB 3SDDC 3F7YB 4FG6D 4ZUWA 5C0IB 4YXLH 5D7KD 4QXGL 3Q6FB 1OF2A 4NT6B 1FJ1A 4KKLC 3VXSA 3K4AA 4NN5B 3HI6L 1J0JA 3GKWH 5IJKA 3CK0L 1MCWM 4QHLA 2Z8VC 4KZDH 4J3VA 1YYML 3QUMB 3VE0B 5KSVB 4GFTB 3A6CL 1I3RA 1QSVA 1MAMH 2ERJC 5AYQA 3VI3F 3U7WL 2WP3T 4U1SA 1LMKA 2FJFA 2CIKB 4JRYB 4M9PA 2YD3A 1D5ZA 4OFYA 4RISL 1HXMA 5EU3A 2A6JB 1YY8B 5F9WB 5E6ZA 3K2UL 5FUCE 3ARUA 4RWYL 4J2XA 4JO1H 4MAUL 3EZ8A 4ZPVB 4DVRH 4DCQA 1ZEAL 3DROB 5MEOB 5EU7C 2BCKB 2R23B 5JXEC 2D9QB 5D1ZA 4EIZC 3QISA 4HIHB 5EOCH 3CXHK 1A6TA 2VQ1B 1R3JB 4ELKB 2JLLA 4R7NB 2APVA 4YAQB 3VFOA 1TPXB 1Z5LA 1GGCL 4NRZA 4UINL 2AJUL 2VB5A 4ZUTA 4ZD3L 1KN2L 1MWAA 4P2RB 2GT9A 1OTTC 1JYVA 3O9WC 4JQIL 4GXVH 4WW2F 2X1QA 4JZOA 1WUNT 4K23H 2GSGB 3IDIA 4M5ZL 1MH5B 3GJFH 4R97C 1HHKA 3D5OF 4JHAL 3K80A 1SVCP 4KI5E 4L9LC 1L7IL 1WGOA 2ENYA 2FDBP 2FO4B 4ODXB 3RWJA 3BD5A 1AO7A 1YNTA 3FQTA 4MJ4A 5DJ2A 3BEVB 1C5CH 2VLJE 4M8QB 5E2JA 1CICD 3V8OA 1U91A 2HLAB 3CIQA 4FQLL 3FN0H 4IRSB 3P30H 4IOSD 1HHGA 4UOW1 3ULUE 1CZ8H 2HT2D 1OGAD 3ARGB 1A0QL 5JOFA 1E6OH 3BHBA 1RHFA 3HCVB 1JGVH 3S3SA 4YE4L 1JGUH 3NA9H 5CEYA 4ZOAA 3X11A 5ILTL 3R1GH 4E41B 5CWSB 1X5ZA 2HAZA 1S9YB 5DYOA 5B3NA 5EUOF 5I1JH 2B1AL 15C8L 4TOYL 3VWKC 3ARYA 3CGTA 1CGYA 1HKLH 5CIPA 1IMHC 5IHLB 2C26A 2BOCA 3PG2A 3OHXB 3L6FA 3I6GA 5A2FA 4RNRA 1RZIB 3DURA 3KYNB 1G9NC 3EYQD 4KWUA 5BZWB 1T5WA 3ZKXB 5EU5B 4XP9L 4P4KB 5BS0E 5FECA 4JO4H 5CKAA 2GTZA 2R0LH 1XAUA 4KK5C 4X4XA 3RWFA 5HVHB 4G9FA 3BDXA 2R15A 1FZOA 4XHJD 3BPNB 1CR9H 1R24A 1CGVA 4UQ2A 4O4YL 5AYUL 1D5IL 4AM0A 4F9PC 1JF1B 2D03L 5EWIH 3OX8A 5EIIA 3GSUB 4YNYB 2PXYD 3QEUB 1PX4A 1MREL 2H2SC 4P46B 1KCUH 3BE1L 3O8XB 1OWWA 1RZKH 4MWFA 3CSYA 3MACL 1E28B 4ZS7L 4YIQB 2VSCA 1DBMH 1NSNL 3SDCA 2YC1B 1RURL 5ITBL 1UM6L 4G6AC 4PJXB 4RMVA 3HAEG 3CSGA 4OQTH 3LOWA 1SYVA 2BNRA 5I8EA 5IBTL 1JNNL 5F1OB 2VLJD 4KKBC 2W92A 1AE6L 2FGZA 4QRRE 2GYSA 3E3QE 3VXRE 2W9DH 1NL0L 2AJXH 3SJVB 3K2MC 5F7FA 2VXSH 4W4NA 3PABA 3QUXA 5EN2A 5CGMA 5EBLB 2Y4SA 1UZ8B 1V8HA 2CGRH 4NM8H 3UJTL 1KPUA 3BWAA 1IM3B 3OKDB 5H2BB 1JHTA 3TZVA 3V2AR 3ARDC 4GQPH 4NNPL 3JWOL 2APTA 2H1PH 3FO9A 2DLEA 4OCRL 3BPLB 2WZPD 4NOBA 1OTUC 4NM4L 3JWDC 2X05A 5I1CH 1OT1A 1OQXA 3LQMA 3ZDYE 1S7QA 2AK4E 5HDBF 3GSXA 4GAGH 1TNNA 1LEGA 4LPYA 3RZCB 4K7PH 4KKCC 5HPMB 2XV6B 3NH7H 4ZO7A 4KH2A 5KVDH 3VRIA 1HH9B 2LU4A 1DQLL 1NLDL 3UTSE 3WHE1 2MPAL 1TQCC 1TTFA 5BS0D 2Q86B 1C16B 2MTPA 3AREC 5EOCJ 2R0KH 5E8OB 5IFJB 4LLVB 3EHBC 4PRDB 1P7QB 1CLZL 5I6XB 1BVZA 5TE6H 5K9JL 8FABB 4WV1B 2NX5A 1U6AL 1GXEA 4QCIB 4HUNB 4QRPB 4OB5L 1MCQA 5D7JD 4FFZH 5GXBB 1UJTA 4L4TA 1SYSB 4RMSA 3PWPE 4DW2L 2CKBB 4Y1AA 3LN4A 3QDJB 5GZOD 1GGIH 4OV5B 3TCLA 5DRZA 5DK2B 4PJFB 4BH7B 2OTUB 1BGXH 3I84A 5D5MF 2AV1A 3QEQE 5DJDA 3CXDL 2DI7A 3OWEA 3OR7B 3UBXA 1D5XB 5JIKA 3V4VL 1D5BA 4PY8I 3IFPA 1R3KB 3HC3L 4S1SL 1JYXA 5T1LA 4QHMA 1SY6A 2JJUA 2M2DA 1ZT4B 5B38A 3NCYP 3RU8L 4QRRD 4WW1A 3S37H 5HYSB 1MQ8A 6CGTA 3VXRD 3QI9A 1LE5A 4UMGA 5LBSH 1S8DA 4CNIA 1T7YA 4M7LT 1AXTH 3W0WE 4WFFE 3PP4L 3MRPB 1KEGH 4M1GL 2C7UA 4UU9B 3AGVA 2XWJA 5J57B 4X98A 3QUMH 4BH8A 3ULUL 3T0EC 4BFEA 3FFDB 4K3DL 2PW1A 3X3GL 1R5VB 5IEKB 5GRUL 2YD7A 1N0XL 5TE7H 4C58B 1MEXL 3NPSB 5KSAD 1CG9A 3SKNA 4GBXB 2H9GA 4YHML 1WITA 2AK4D 3WL9A 1GAFH 1YY9C 3P11L 5MP6H 1DFBH 4DKAA 4XTRD 1FZKB 5KAQF 3UTSD 5KAQG 3OXSA 3TP4A 5H94B 4Z18A 2FJGA 25C8L 5L2JB 1SBSH 3VJ6A 4L8BB 4ONGH 1D3CA 2O5YL 3NACL 5CBEA 1FVDB 4ZFZB 3JV4A 1T83A 2FIKB 2FJHA 1LO0H 1UXWB 3DUHA 1BBDH 2UUDH 2HFGL 5F3BA 1NEZA 2ZG1A 2DQDH 4JFZL 1K8IB 3AMKA 5BMFH 4X9GA 1MJJB 3RIAF 4BA8A 3EOBA 2ZUYA 1MRDL 3PWPD 1ZHKA 1XR9B 1X5XA 4NP4H 3RVVC 1OCWH 4GMSH 3PXJA 3QUYD 1V3KA 4I77L 1MCIA 4TSAH 5LGJA 1CK0L 4Q6IA 4X80H 2EIEA 1JGEA 3VD4A 3QEQD 4HKZB 1UB6B 2X6MA 2GTWB 4PJEB 1CD1A 2A0LC 2ADJB 4OZGF 4LP5A 1BFTA 4CUCA 5I1GL 4WTZA 5F89B 3P9MB 2WBJC 3ULVE 3EJZC 4WCYH 3RPIB 1CLOH 4DUVA 3JVGA 4EVNA 5CEZE 2JELH 2CJUL 5D6CA 2Q20A 4OLWH 2DYPD 5KZCD 2ZOKB 1G7IA 4GRWE 1BQSA 3L3GB 4ETQB 1U3YA 4WFHD 5DD5H 1RUAL 2AJZA 3OR6B 5SWSE 3S96A 1QSFB 3PDOB 2NW3A 3MRQB 4P5TB 1ZA3A 3W0WD 4WFFD 4BK5A 5D2NB 2AI0L 4APQA 1W8NA 3BKML 5DA4A 2R8SH 4PBXA 2A77H 5LGKA 1A3RH 1A1NB 4XP4L 5EB9A 2JCCB 2HT4C 3C9NB 2EZ0C 3QUZA 3DX9B 4XCCH 1FAKT 5ESAB 2IH1A 2NY4D 4XI5C 3NAAL 43CAA 2DQFB 3HS0B 5E2TL 2QEJA 3RX7A 4MXQC 2UWEF 4PPTA 4TSBL 1EBAA 3GO1H 1WISA 4YBQD 3QHTC 5DURD 1Y0LB 1PEZA 2VLKB 4R96B 1FYTA 3RKDD 2RBLA 4PJAB 3AU1B 1JPGA 2J5LC 2DL2A 1CDIA 1F4XH 4P23D 2X7LB 3DVFA 2FEDC 1AJ7L 5DUBA 2XA3A 3LDBB 1UJ3C 4RA0C 1KC5L 5KSBE 3I9GL 3IVKA 3QDAA 5IB1A 3SE4A 1CGTA 4JAMB 5JXAL 3IETB 1BHGA 2APFA 3DMMB 3BDYL 4TVPL 1T1XB 5F6HI 4F9LA 3L3DB 4OGXL 2NY7L 3TVMB 3ZKND 4HX1A 4L4VA 1T3FA 2D7TH 5EZOH 4WWKA 2X2YA 2ZCKL 3I3DA 3GMQB 4FQCL 2VDKH 2NZ9C 4F37F 1MI5B 1UWEL 1BQUA 5JOPD 3T3MF 5FOJA 1ZGLM 5BCAA 2COQA 5GS0L 1JGDB 3GK8L 3ULVD 2J8OA 2X9WA 5CEZD 5JPMB 2EEDA 3U30C 3CDCA 2R0WL 5FCUH 1BJ1H 2K7QA 5SWZD 5TH2B 1KLFA 2E9WA 3PV7A 5SWSD 1G1CA 1OLLA 2V2WA 4JO2L 1LO3H 4XWOD 1S7VA 2AABL 1J1XL 1IGFL 3MRDB 2V5MA 1BP3B 3O2WH 5C0CE 2XKSA 4U7KA 4HWUA 3HUJE 4A6YA 1FFQA 1UYWL 2XN9A 4QTIH 2ITDB 1MCNA 4PJHA 3WEXA 4X6BA 2EC9T 5GZNC 1RVFL 3LEVL 5E8DL 5ESVA 1AGEB 5FGCB 5D8JL 3TIEB 3MUHL 2Q8BH 3UJIH 4Z8FH 4Z5RA 1DQDH 3WKNA 2ZP0T 2DL9A 1XCTA 3DTXA 3T8XB 4Y4HD 1I8IB 1DN2A 1JCKA 3MRFA 3S5LG 3FN9A 2X4RA 3T2NL 2YS4A 1PKQE 3CVHH 3LEXB 3TESA 4GMTL 3LPGA 4K7FA 5BZDA 5F70A 3FQNB 5E8EB 2LTQB 4JGUA 5DSCA 5ICXB 3FB6B 1CCZA 2EECA 4OZFB 1JPTH 5J56B 1ZLUK 1B0RA 3FFCE 5D1XD 1NJ9B 4Y19E 1A6WH 2DIAA 1MCSA 5CJQH 1T7XA 3KYKL 2IAMA 4HPOL 5BW7C 1A6UL 2CKBH 2LU7A 2R4SL 2L4OA 2PN5A 1MF2L 1CDCA 3BYYA 4M6NH 4Y2DD 4AL8L 5CD5D 3BZEA 1QQDA 3TBTA 3MJ8A 3KXFE 5JPNA 1JJUA 3RHWK 1VDGA 3F7PC 5BVPH 3Q1SL 2F54E 5C1MB 2PNDA 1S9VA 4LPXA 1LGVA 2H6PB 3QCUL 3WUWB 3VH8G 4YFLF 2GEEA 5IMMB 3NIGE 3NZHL 1UCBL 5FB8A 2W0FB 1HIMH 3LIZL 1QFHA 2Y25A 3MGOB 4EBQH 1U58A 4X6CF 2YZ1A 1P2CA 1AGFB 3QDMA 2IPTL 5E56A 3DJ9A 5DI8A 1SM3H 1KLUB 1RK1B 3MCKA 2YWYA 3WN5C 3FQUA 3JTSA 3B9VA 3DSNA 5C0FB 4FQHB 4NQDA 2BSED 1IAIH 4U0RB 5C6PB 4AIOA 3V6BR 3FO1A 4YHZH 2DQCH 3X12A 1TJIL 4ZS6C 4R0LC 3C6SB 4E5XA 1FLRL 3V7AG 2IADB 3EJYD 5CEZL 1A7PL 3QZWG 2DQGL 4ZSOB 4N8PA 4LGSB 3SGKC 2DLIA 3AY4A 3ILPA 2P8PA 4RFEB 3QIBB 5IHUH 5B8CA 4MCYB 4NC1C 4PJIA 5C0CD 5D1QA 4LSSL 1VKXA 1MCOH 3O3BB 2FHBA 2G60L 4X6DE 2GK2A 3KYMA 3C60A 1OHQA 2MWCA 4XCEB 2PO6D 3WIFA 3S6CA 2DLFH 4MXWH 1I9JH 3SY0A 2YD5A 1XF1A 1I1AC 3CCHB 1N4XH 3P4OB 2WUBH 3GIZL 1JUFB 5FA4B 3SO3C 1HOCB 4UNUA 4XMLH 5EZLB 1AQDB 4N9GB 4Y5VA 4NQCE 2DN7A 4I3RL 1HZHL 2OXGA 4JFOB 4WI2A 3QWQB 4J23A 5TDPB 2MQ0A 3KLAB 1YQVH 3MRKB 2YXFA 3FFCD 5IMOB 1CGSH 4Z7WE 5MERA 3IU3A 3OKNB 1W0VB 1LDSA 2XG4A 4L4JA 2HFTA 4DN4L 1JMXA 1YYLL 4Z95H 1YMHA 2NY3B 1UKTA 3EDKA 2AJSL 1U95B 1IEAB 4JFPB 3KXFD 2CKNA 3RWGA 2F54D 1IGML 3C5ZC 3MJ9L 5E2WL 1P7HL 1G7JB 1XH3B 4OZIF 3BDBA 4M4PA 3TBYA 5KBNC 4HUMB 3QEHA 3QJFA 1ES0B 1S9XB 3O3DB 1FFPA 2EE3A 5MEQA 2PYEE 1A8JH 5IVXA 1BJ1J 1U8LB 1DE4A 3PNWA 3B5TA 2QV2A 1U3HC 4FFVD 3VRJA 3KYAA 3OKEB 3MV8E 1UWGH 3WUZA 1X5LA 5F44A 3NIFF 3OJDA 4GAYA 1YUHB 3HI1B 3LKNA 5DWUL 5J06A 2C3VB 3CFIC 1HHIA 1F90L 5GGVY 3BZFB 1NC4D 1C5BL 4V2BA 4Y5YA 2IF7A 1UA6H 1XR8A 2XA8H 2PXYB 1NANH 1OSPL 4HGMA 1S7UB 5E94A 4E9LA 4RX4D 2CR6A 3OAZH 3IGAA 2WMPA 3EGSB 3BWUC 2KL6A 4BFGA 5L6YH 5IB5B 4CL7A 3GSVB 1NFDA 4RFOL 2A9ML 5J8OA 1OP3K 2ZJSL 5GJTL 1U36A 3LQAL 3STLA 1TCRB 5GGSA 4QRUA 1OY3B 4NHUB 1GC1L 3FQXB 1H3GA 4QXGH 3FB8A 3HI6H 1FIEA 1DDHB 5I2IA 3CK0H 2DM2A 4IHOB 5DO2D 2BNQB 1YYMH 2X4TA 4P2QA 4ZTPH 3TWCL 4KAQL 4XNUL 4HV8A 2ATKB 4U3CA 4G8IB 3BH9B 3U7WH 2VLRA 1IILE 4AEFA 4GW4B 2CMRL 4X5XB 4LOUD 3T4AB 4RISH 5FKPA 3LS4L 4LEXL 2ATPA 4XAWL 1QFWM 5C8JA 1ED3A 4RWYH 4MAUH 3DWTA 4YDLC 1I85A 4GLRI 3KPQA 1M05A 3WO4B 5IESL 3ABZA 3G6JE 3MPCA 1MCHA 4OZHF 4TUOA 2WIIA 2OTWB 2J8UA 2G9HA 1H5BC 4QWWC 4Y4KA 1A7NL 3BGMB 5I17B 4I3SL 2VZVA 3MUJA 4KKLD 2NYYC 5JMOC 1S5HB 2PYED 1GGCH 1UVQA 3IS1X 1EAPB 4GKNA 3TO4D 3UZVB 2AJUH 4R2GD 4QO1A 4U0QB 1H8SA 4KROD 3BKJL 1INQA 3PWLA 4ODVL 4ZD3H 1KN2H 5BS0B 2XPGB 4YDJA 3F7RA 4ZFOA 3GBML 3MJGX 3MV8D 1RZJL 3UO1L 4JQIH 4MNQA 1RK0B 4PRIB 1YPZE 4RGNE 4JHAH 1IJ9A 2ZKHL 3TJHC 4XNQB 5J13B 3V6OC 1L7IH 3N9GL 4XCNB 4Y7MA 5D6DC 3REWB 3QO1A 5D7JB 1YDPA 5F21B 4XT1C 1T4KB 1GOHA 5C0RL 1DP0A 3V6ZA 4N1CA 3KGRA 3BPCA 2AVGA 5HHNB 4FQLH 1OAKL 4WFGE 3KPLB 4OZFH 4WU7A 1PY4A 1KTKE 4CGTA 1IGTA 1CD0A 4MDIA 4YE4H 1A3LL 4H0GA 2VXQL 4LSRL 1ZLSH 5ILTH 1RPQA 5E5MB 1OTTD 1N2RA 1WWBX 2YD2A 3MV11 3O9WD 2XRAH 1BQHB 4HXBL 2FH8A 5AWNH 5F1IB 5HHPB 2B5IC 4QRRB 2B1AH 15C8H 5D4QA 4BQBA 4TOYH 1TVHA 1QVOA 1F02I 2NZIA 5CGTA 5TDOB 2NY1C 2OXHA 5HGDB 3QIUC 2YUVA 4X7SL 2VL4A 5JOEA 2CDEB 4HKXA 4X4YA 2UUDK 4JFEA 4XP9H 3L3OA 3MLTA 4KTDL 3SPVA 5IMKA 1F11B 2X1OA 3SKMA 4M6OL 4IRJA 1HSAA 3N1PC 1G0YR 2Z35A 4H5SA 5DZNA 5KSAB 5C6TL 4G3YL 3HZYB 1HHHB 3JBG7 4N9OB 2HVJA 4I0KA 5T1KD 3ORJA 3TC9A 5AYUH 5EZIL 5JQ6L 4JZJA 2ZSVA 2D03H 5ENWA 1VPOL 2JJTC 4G42A 4UTAH 1FL5B 1LD9B 4I18A 3VWKD 3P4MB 2BJML 1AGDA 3BE1H 4LLUB 1OARL 2MHAB 3ZE2F 4F7MA 3S88L 1HINL 1NAKL 3H9YA 4OLYL 4WO4A 5C70A 4UV4L 4ZS7H 5JW5B 1NSNH 4RGND 4U6HB 4FFYL 3MLSH 2OMNA 4LVOC 2G5RA 1RURH 2Y6SD 1UM6H 5ITBH 4MD0A 1KLGA 1H15B 4JPKL 5D7IE 5EO9B 5F3HB 4KK5D 5IBTH 2PYFA 2IPKB 3HE6C 1BIIB 3PWPB 5FGBC 1AE6H 5HDQL 3BQUC 4E0RB 1S78C 1NL0H 3QUYB 4KRPD 5DJYB 4N5UA 1A4JB 3WYRA 1FVEB 4WFGD 1QRNA 2R2BA 4JM2C 1OAYL 3QEQB 2YPKA 3DX7A 3VFWB 4HWEL 4CJ0A 3UJTH 2H2SD 1TMCB 3T77A 3HR5A 4Y4FD 4G8GE 5C0AA 4YHKH 5E03A 5GS1B 3JWOH 1R5WB 1TCMA 5IB2B 3DLQR 5BQ7A 3L7FB 1GZQA 4XNZC 1JWMA 4OCRH 4ODBD 2DYPB 5KZCB 2ED9A 4NM4H 4CJ1A 4G6AD 4WHTB 1I8KA 3SDXA 1K2DA 2VLLA 3BGFB 4H88L 3WD5L 3QJHB 2F58L 5FUZL 2P7TA 3FAWA 3SGJC 3QQ3B 4OIAA 4TUKL 5CGYC 2Q76B 3RVTD 5E1AB 3MREA 3RRQA 2MPAH 1MHPH 3CH1A 2GAZB 3DXAE 1J86A 2RFXB 4EOWL 3HC0B 1HSBA 1CLZH 1VFAA 4G80B 4D9LH 1MWAL 1OAQL 5K9JH 1S7WB 2VXVL 1U6AH 1A2YB 5E70A 3SDAA 3T0EE 5DURB 2DBLL 4QRTB 5BV7C 4J12A 3CFCL 1DQQB 2D0FA 3GMOA 4H0HB 4U1HA 3HNSL 5E99L 2HWZL 4P23B 3RDTA 1XIWC 4JRXE 4NRYB 4YLQT 1PX3A 3HHRB 3EAKA 5DFWH 3CXDH 3VD3A 4PJCF 1NGQL 1P7KB 1X5GA 4P49A 1NKOA 1HI6A 3HC3H 4S1SH 5JW4N 3QCVL 3BP6B 3BXNA 4IEFB 4FFWC 4QY8B 3EOYG 3EHBD 2NY2C 5ECJE 3RU8H 5BOZG 1MLCA 3SDDA 4X9IA 5LG1A 3L5JA 1A6ZA 3OMZA 3O3EA 2F19H 4XRCB 1GJIA 3S4SB 4F7TB 1LEIB 3GRWL 5TFSL 1AI1L 4QRSB 3NIDF 4M1GH 2L7JA 1ND0B 3EFDL 3V5HB 2GFBA 3GM8A 4G8GD 4WW2A 1PQZB 3SKUD 3ULUH 1JL8A 1Q0XL 1ZGLA 4TTGA 4A2MA 4K3DH 3X3GH 1AY1H 5E2UL 5GRUH 1N0XH 4KJYB 5I76A 5HI5C 3V52L 3LHPH 2XNAB 4OF5A 4YHMH 4F15C 3MUY1 3FT3B 4F2MB 4HIIA 3U46A 1J18A 2YRPA 1G6VK 3P11H 4XZUB 1KXTB 3MNVB 5GSRB 1DBAL 2X89A 5JXEA 1K4DB 2MQCA 3KHQA 4EIGB 4KJPC 4KQ3L 5I0DA 4NO0D 5KANG 3MRMA 25C8H 3DXAD 3WFHB 2O5YH 3IFOB 3NACH 4HLZG 1EUTA 2ZOLB 1FO0L 2GI7A 3T2PA 4F7EB 2W0LA 2HFGH 5IM7B 1PJ9A 3CLFL 4NN6C 4ZTOL 4Y4HB 5EUOA 4LVHC 2IALB 4OAWA 4Z7OE 3T0ED 5IFHL 4E42B 2NMSA 1MRDH 1UG9A 3P4NA 1DUYB 1FV1B 4M7LH 2CXGA 4L9LA 4UQ3B 5IW3A 4TRPL 5FYKL 3RVXC 5D1XB 4I77H 1U8KA 3RVWC 4RIRA 5GISL 4JRXD 1CK0H 2P44B 2YPLA 5EO0A 1Y6KR 5KSBB 5FYJU 4U1JB 3O6FC 1G7QA 4FQJL 8CGTA 4Y2DB 3QCTL 5I1GH 3VFPA 5D2LA 4BQ6A 5CMAB 3O6MH 3AS2A 4XNYL 4HUWB 3C08L 1VFBA 2CJUH 1QR1A 3PWUB 4QHKJ 1RUAH 3HPJB 4JY5L 4Z76A 1JPFA 3TPUB 4KHXL 3RTQD 4UZGA 3ARRA 1ZHLA 4LCCB 5CSBA 2OSLA 3TYGL 2XKNB 2AI0H 1FYTE 1RUPL 3WNNA 3BKMH 1JN6B 3RHWF 3ZL4L 3RVVD 1E6JL 5BVJB 2W9LA 3TCXA 1X5HA 1AH1A 4X9BA 2ESVA 3IXTB 1S7SA 5FO7B 4XP4H 3HAEA 3OB8A 1EVUA 1XGQB 5KS9E 1IAMA 3NAAH 2APBA 3M8OL 4JDZB 4MGXA 1OVZA 5CCKL 2A0LD 5CHNA 5I66A 2XXMB 4S2SA 2YA2A 2WBJD 1IQDB 2P5EA 3EJZD 5GRJL 5I9QB 2IBBA 3ZSTA 5JDSB 1HDMB 4Z7UB 4LBEA 1HHJB 3HZKA 4RAUA 1B0GA 3PP3H 3B8SA 3N06B 1D9KC 2Y23A 4JQVA 5C71A 1AJ7H 3WFBL 1S7RA 2CR3A 3DPBA 5GRZA 3I9GH 3ECBB 3NFSL 1QR4A 4Y2OA 1INEL 4I0PA 2R1XA 2YBRB 5DA0B 5I73C 1XCQA 4BFIA 4HG4J 2BRRH 4LMQI 5SWQA 1LO5B 5JXAH 4HC1H 2OZ4A 2HT4D 2OMBA 3BDYH 1DJSA 2EZ0D 5F9JA 4XI5D 4OGXH 2BVQB 2NY7H 1WZKA 1DVFC 2A6IB 3H9HB 3JTTB 2DQJL 4Z78B 5CSZA 3FFCB 3I2CL 2ZCKH 4UOW0 4Y19B 2LFGA 1V7NH 5EO1A 4NCC1 1RZKC 1BOYA 1V5JA 2BSSB 3L1OL 4PB9L 3P40A 4MMZC 5GS0H 5E0QA 5EC2B 3SOBL 4YUEL 2FEDD 5DEGB 1RJZA 4XVTL 2F54B 2B7DT 1M7IA 4Z7VE 4NQVB 3C8KB 2R0WH 1VENA 1FZJB 1I1YB 3ARDA 4LP4A 4ODHL 2CDFB 3RI5K 4MAYB 1UCTA 1KJ3L 2FRGP 4JO2H 2AABH 1KT2A 2ITCB 3OAZK 1FYTD 1J1XH 2V2TA 4FQ1L 1IGFH 4U1KA 5IQ9A 1TETL 3VGAC 4IM8A 4HAGA 1EH9A 1CFSB 1UYWH 1DBJL 3MV7A 2ZSWB 3JV6A 3I75A 5TQ2L 4AZ8A 1RVFH 5E8DH 3WFCL 3QRGL 5HI4C 3KDMA 2RHEA 3F6LA 2DQIH 5D8JH 3W5MA 4GG8B 2YPVL 3NCJL 3AREA 4UAOB 4HWZA 2DQTL 3HMWL 4U1GB 5HYJE 1KACB 2CK2A 3T2NH 2V7HA 3VFNB 4HMDA 4GMTH 3U7AA 3I02B 1NC4B 1KCRL 4NQTA 3FQRA 1D6EB 3W39B 1RZ7L 1G7HB 4I1NB 3TJEL 1JWSB 2CLVA 1KOAA 3QWOA 3BZDA 4X6DB 2VDNH 4EI5C 1F5WA 3KYKH 4HPOH 3EYVB 5DK3A 1A6UH 4W68A 2SEBA 2HFEB 4NC1E 1DN0B 2R4SH 1U0QA 3WJJC 1MF2H 1NKRA 4NQCB 2VDRL 4AENB 1TTUA 1KXVC 3ZLQC 3Q1SH 1EXUB 1XGTA 2D7NA 4C59B 4PJBB 5EU6E 3T1WA 1MFBL 3RWHA 4H26B 2Q6WB 2Z9TA 3HMXL 2ADGA 3NZHH 3J8F7 4PY7A 2BVTA 1U8NB 5IGXH 3PL6D 4G8EB 5C0GA 1ZXQA 3MJ6A 1H3WM 1DEEA 3DETD 2IPTH 2Y07L 4ONOA 3T0AA 4HKJA 3FOMB 4HS3B 1GH7A 5A2IH 2W0KA 3G5YA 1VEOA 4LHUA 3HLAA 4MNHB 3TIDB 4IOFC 5ETUA 5IWLA 1TJIH 3ULVH 4LPUA 2WP3O 4P3DA 4ZNCD 3CZFA 2R4RL 5CEZH 1A7PH 5HY9B 2GK0B 1J0HA 3OKLA 4GRWH 3WHE0 1QP1A 3LH2L 3NVQA 4NN5C 2PYEB 2VTFA 3KHOA 3TO4B 2RJMA 4R2GB 4KROB 3Q48A 2W59A 4P5MB 4QHUA 2G60H 5E00B 3C5SB 4LLYA 3DGCR 1VEPA 1T1WB 2I25N 4OZGA 1BFVL 3MV8B 2IAMD 4PIRF 1UQSB 5E9DA 2Z31D 2VE6A