2WP3T

Crystal structure of the titin m10-obscurin like 1 ig complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
RGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIRSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight Into M-Band Assembly and Mechanics from the Titin-Obscurin-Like-1 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/structural protein
molecule keywords OBSCURIN-LIKE PROTEIN 1
total genus 21
structure length 99
sequence length 99
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2wp3T00
1ACYH 3GIZL 5HYFA 3DYPA 3VXRD 1IEAB 1DQTA 1YNTB 2R0WL 3L5JA 5IMOA 4G9FE 5D1ZB 1CLCA 4G8FB 2GTWA 4X4YA 3MGOB 5T3XL 1OTSD 5LWYL 1BMGA 4YZFE 5JR1L 5FYLE 1UEYA 1T7WA 3UCRA 2UVFA 4Z7VA 3UTSD 1C12B 4HJGB 4ZPVA 2A1WH 4NRXA 3NGBB 5E03A 5I1DB 1T1YA 4MA7H 3DV4B 4Q9CA 1E28B 4TN9A 3QIWA 2XG5A 3DHJA 2H1PH 5DRXB 4NO0B 1S78C 3EO1B 3MCG1 3SDXB 1MI5B 3WFBH 3HC3L 5DMKA 3MRPA 2PO6B 1PZ5A 4Y4FD 5EBWA 3MQIA 1FPTH 4BK4A 1HQRA 4LLMA 3E2HC 2XWBA 4XCCL 4LLQA 1QSEB 4NQED 4XWGL 4O9HL 1WIUA 1W0VB 1NC2D 1BGXH 1MJ7L 1YEHL 1G1CA 1AGCA 5EBGA 2Y06L 4LEXL 2ADIA 2H32A 4U05A 1DBAL 4G43A 1IFHL 1RUAH 3ILQD 4ZO6A 2R4RH 4XB8A 2W1NA 4NKMB 1CE1H 4LCWA 4CJ0A 4KGJA 4OZGB 4WO4D 1J9CT 2JJVA 3ULUF 2HRPH 2YMXL 3V7AE 1F90L 4B50A 2XN9B 1DUZB 5DFTA 4P23B 2FIRT 3NCFB 4C56E 4YC2B 1N0LA 4XMKL 4P2RA 5C92A 5IHUL 2IPKA 3QXVA 5DJ2A 5H35A 4WCYL 1RY7B 2NR6D 4TNVK 2X4OB 5DJYB 3NPZB 4G8FA 4DUWA 5JQHC 4PREA 3NCJL 4OB5H 3MLSL 3QDME 1I3VA 4ZDHA 2AERT 2UZIH 1JNNL 3QZWA 4Y4KB 2VSCA 4S1DD 2HA1A 5A2JH 2EH7H 1UJ3A 1EK3A 4H0IA 4LHUA 4PIRF 4S1RL 5IM7B 3ULUC 1AXIB 3I02A 5IFJA 4Y1AA 3S7GA 4X4ME 1QSFA 3TYGL 2YD5A 5C8JB 4U7KA 3T8XB 4U1NA 3S88L 2ICWI 1MLCA 4MDIB 2IADA 5IB4B 2FD6H 5J8OA 1LDSA 1PX4A 4DN4L 1TDQA 1TLKA 4XPAH 1TJHH 3H7LA 3ROOB 4XX1G 3ULUE 2Y6SC 3RWJB 3HC4L 4ODTH 2I5YL 1UB5B 3SDCD 2DLEA 1YEJH 4Z7WB 2E6JA 1SBSH 1U6AH 4L1DA 2NY4B 1YMMD 4GXUN 3GSQA 3HMXH 1ROWA 5FYJE 1N0XH 5CD5C 2AK4E 4JFXA 5F96L 3MLRH 4PLJD 4FTVB 5EU4A 4BYHA 5CLTA 1X5XA 1GIGL 1U8MA 1UXSA 5C6TH 3OR6A 5HY9B 3P9LA 1QFOA 2CRMA 3DHMA 4XB7A 3GSVA 3W82A 4WGVB 2A2QT 4GRWB 2IBGA 4MJ4A 1F3DJ 2VZ3A 5E1AA 4ODSH 2AXJA 2YPLD 5GGTH 3RAJH 3LMJL 3VU2A 2NY4C 3DGGB 1YYMH 3BD4A 1FAKT 1A7OL 1L7TH 3CC5B 4AH2B 3FOLA 4K3EL 3UPCA 3DROA 5K9KB 4DKFL 4U1SA 4FQXA 1R3JA 4LRNL 5BMFH 4LVEA 3L3OB 1D5MB 3RVTD 1OD9A 4ZNCD 1RZ7H 4OI9A 43CAA 4HLZH 3GHEL 3MACH 4OZFB 3U0TB 4PB0L 3NABL 4G9FA 4RGMB 4PS4H 1EBAA 3TBYA 4B53A 1J0YA 2ZUSA 1NDGA 3BVNA 3PP4H 3QISA 4M4RA 1JCKA 3P4LA 4DZBA 5EOTA 1ERNA 4FTVE 1MCCA 4L8BA 4U31A 4GQ9L 1NBVH 4G6FB 2CMRL 3R06B 1EVTC 1A6UL 2FNBA 3LS4H 4KJPD 3BWAA 1DQJB 3MUJA 5J6HA 1S8DB 3GBNL 1HHGA 2DQUH 5JW4R 1MIEL 5FYLL 3QNYA 4ZUVB 1EXUA 4CVZB 4N5UA 4XMLL 2HFEA 1DBKL 1S5IL 4GH7B 4S2SA 4ODUB 4JRYE 1KN4L 2P47B 3OPZH 4JQXC 5CIPH 4NC1E 2FJHB 2ADJA 1EXUB 1AQKL 3O9WA 3GSUA 1BJ1J 1HK6A 2VLRD 1VADA 4NQSB 4M6NH 4QOKA 4X9BA 1NGZA 4BFGA 2EDLA 1UWEL 3CFKA 4X7FC 4NQVA 4YGVA 2KL6A 3QJFB 4ODBD 3BP4B 2I60H 1OF2A 3HI5H 5EZIH 5HGBA 1LO0H 4E0RB 1MOEA 4ZAKB 4Z7WF 1KEMH 4J2XA 3TBVB 1NCAH 2A73A 3SDCA 4PJFB 2HLFC 1EAJA 3S3JA 5KSVB 1SJEA 3OAZK 4GRLA 4OD2B 2DF3A 1QSED 2XOTA 3L7EB 4HFWB 3EDEA 2HVKA 3VXSD 5BZDA 1CBVL 3SBWC 1N2RA 4LCCC 4HG4J 5JOFB 1A7NL 1JRHI 2VC2L 5EC2A 4QXUH 5BO1H 5DJAB 3KR3H 5SX4I 1D7FA 2MKWA 5IW1A 5D7LE 1Q9KB 1F4YL 1H5BC 5FF6A 2FECI 4C83B 3WNPA 1HQ4B 1AGDB 4XHQA 3ZTNL 5I1LB 2W92A 3LDBC 3RWIB 3FRUB 1OSPL 2AKRA 3VXNA 4P5KA 4Z6AT 1L0YA 4NZRL 2NY5L 4X6FA 3NA9L 5DUBA 4G5ZL 5D6DA 5M7QA 2CLZA 4IIQB 3EYVB 3RVWD 2YA2A 4PJBA 2XZAH 1FNGA 2HLAA 5D7IA 3QI9B 3TA3B 2APWA 1U8LB 3K4AA 2XICA 5AWNL 4M5ZH 4Y16B 4KQ3L 4P5MB 4QHKI 3ROLA 1HKLL 1A7RH 1XEDA 1RUPH 4YXKH 2I25N 1OTUC 3QHTC 4W6XB 4PGBB 3X3FH 3B6SA 3O3AA 3GMPA 4GAJL 2NW3A 3IGAB 3QEUA 5ACLA 5I6XC 3O3UN 2VXTL 4R2GC 5ISZE 4KTEH 1YY9D 3D3VA 3TO2B 3QIBB 1QHPA 2ARJB 1IGML 1CK0L 1E4WH 5CD3A 3MRNA 3P30L 1F42A 1BLNB 3HG1A 4K7FA 1Z9LA 4OF5A 5ANMB 4UINH 5F1NB 1MLCB 4MDIA 1N7ML 4JPKH 4YPGA 4R4FH 2XZQH 1QR4A 4YIQB 1JWMA 5GS0L 5I1KL 2NYYD 4DEPC 2YZ8A 1NKOA 2ARJA 3D2UD 3G6JF 4E41B 2IPTH 5IMKA 1MF2L 3QIWD 4AG4L 2ICES 5I74B 4PJXB 1IMHC 4G8GA 5BV7L 4ZYKA 1I1YB 2AK1H 1PKQA 4M1DH 2UZYB 5HHME 2VWEC 1PSKL 2YRPA 2AJSL 5KSAD 3EYVA 3OB0K 5CJQH 3REVA 1WCBB 4JFEE 3W9EA 3UXFA 1HILA 3B2VL 1BIIA 3C2AL 3PDDA 4PJFE 5SWQA 1ETZA 3B9VA 5F7KC 5KW9H 2V6HA 2JB5L 1KLFA 2NXZC 1JJUA 2F15A 4AEHH 3L9RB 1U8HB 1JIBA 3MV8E 3NCCB 1DLFH 5IMLB 3TESA 2CKBB 5FUCC 2BNRA 3AB0B 2DTMH 2YR3A 1UWXK 4M93C 3SJVE 4UDTB 1N3NA 1ZVSA 4KUZL 3VGHA 5DK2A 3LQMA 1DQLL 2X2YA 5CS7A 3T04D 2X4SB 1K8DA 4M1CD 2BX5A 3AMKA 1ZT1A 4Q9QH 2LU4A 3MCLL 4OBSA 1NUFA 4I2XE 1T22A 2RJMA 5HGHA 2K7PA 3G5ZA 4J8RB 5AZEH 2EEAA 2EZ0D 4KMTL 1RIVH 2MFNA 1I9EA 1ZLSL 2CD0A 5GSRA 5HYSG 1FIGL 4YPGB 3OJVC 1ZHBB 4XPTL 3LPWA 2RIKA 2H6PB 2HTLD 2BDNH 1K3ZA 2R1YA 4I5BA 4MD4A 2WUBL 2D9QB 1MCSA 4OM0L 3QQ9D 3P4OB 4NCC2 3REVB 1ND0B 3ZL4H 5HVHC 1CLZL 3EO9L 4LQFH 3QAZC 4JO3H 5JXED 4ZMAT 5FM5O 1PVHA 5TPWL 4BM7A 2F8OA 1Z9MA 4PJAB 4LNRB 4APQD 2D0FA 3RTQC 4X5WA 1WLHA 1VPOH 2X40A 2FX8H 4UTAH 3O9WB 1U92B 2R15A 3JUZA 2GAZB 2Y6SD 1IAOA 2FJHA 5SWSE 5F7EH 4JO2H 1NAMA 4GMSL 1NMAH 1AGFB 4PJHE 4XP6H 3B5TA 1INDH 3Q3GA 4PJDF 1OAUL 4V1DE 3V6FB 5F3BA 4KUZH 4FFVD 4NKOB 1J87A 4KKAC 1AY1L 3LN9A 1JFQH 2UYLA 3QEGH 1AR1C 4LSSL 3CVHB 5D70H 3TBWB 3MPCA 2BRRH 4GMSH 4H5SA 3O9WC 1FFNA 1TJHL 2CO6B 1UYWH 1NUNB 5KOMC 1ITCA 4JAMA 4PD4K 3FCTB 3T1FB 4NO5A 3WHXA 3BN9D 3PWPE 1A6WH 1TQCC 2ZNWA 4YHIA 1OHQA 3TYGH 4ZTOH 3BD5A 2W0FA 5EC2B 1KJ3L 3NPSC 3BPOB 5DD0H 4TSBH 3SDDB 4X7TB 1J8KA 2H2PD 4QRPB 4YHPA 2HLAB 1XCQB 3GK8L 1RPQA 5CEZH 2Y07H 4UT6H 1P4IH 5I1GL 4MS8C 5E2VL 1U41A 4Y16D 3SKOA 4OJFH 5E08L 4XP1L 4IIQC 1EAPB 4B0MM 1IGTB 1YDPB 4I3RL 3VDBA 2HWZH 1EEZA 1H15A 1AKJA 1MRDH 2BJML 3I6GB 3OKEB 5I8CB 4X6CE 4P5KB 1J8HD 4MNQE 4OLUL 3KYMB 5IFJB 5E6ID 4BQ9A 1AD0A 1FGVL 2ZOLA 1JYVA 3NFPA 3VGEA 4F7TA 4KKBC 4JFDE 4HPYH 1KCUH 1HH6A 2AXGA 5I1AB 2KUTA 3B9KA 3QCTL 3D69B 1FZKB 3QIUD 2Q7YA 2O5YH 1ZGLB 3CDCA 3WN5A 1LEGA 3RWJA 4EOWL 4OTXH 5E99L 3JTTA 3BP5B 3IJYB 4D0DB 4ZDHB 2WBJD 3U4EA 5JXAH 3K0WA 2PKDA 1NLBL 3INUL 3QWRA 3LQZA 1HOCB 3C09C 1FNGB 3V4VH 1ZGLP 4HIIA 2VLKE 2VTFA 4HV8B 2QTEA 1X9QA 1MFCH 4P5TC 4HZLA 4Z7OE 3MFFB 3VXMD 3TYFA 1Q9LB 3TWCL 4CNIB 1OGAA 1RZKL 4WHYH 3L3JB 4LPTA 4V2CB 2OTUA 1BM3L 3EDDA 4LLYB 3DX6A 3VRLF 2VDOL 3HE6C 3SJVA 4QTHB 3QHZH 3O4LD 4ELMA 2EZ0C 3FQNB 3TWCH 1FFOA 4XBEH 4JFDD 2DYPA 1I9JL 3VXPB 4K3DL 1T1WA 1R3LA 2A83A 3U4AA 4L9LA 1G7PA 3MRBA 2YHGA 2C26A 5D2LE 2FX7H 3B43A 3HR5A 5DI8B 4XPGL 3KYOB 1YPZB 2C1PA 1BFVH 3D6GA 3HE6B 4HLJA 3VXQB 5IMMA 4UB0L 1CF8H 3D39B 1DZBA 1UA6L 4G3YH 5T3ZE 4R4NC 2P1YA 4X9FA 3BMVA 4ORGA 1JNHB 5FHBH 4OAWA 4ZNEE 3MJ9L 4X80H 2PYEB 5LAXB 1UFUA 1II4E 2VLKA 1ZLVK 5HI5C 1F6LL 4HIHA 1KN2H 1QBLL 1RZ8B 5F3HA 1ZGLM 2PTUA 4JZJB 3PWPD 5FO9B 4WFHD 1P7QB 4XT1C 5MEOA 4P99A 5E8EB 3GKWH 5CKGA 5DD1L 4HWBL 4JDTL 4NQEA 3S34H 4PJ8C 2EXWD 1QFWI 1F6FB 1VESA 2NY2C 1YYML 2YSSB 1RZ8A 5GRUL 4Z0BL 3SDAD 3F58H 1LO0L 4FQXB 5DS8B 4XMPH 1P7HL 4V1DD 4EZMA 3L7FB 3T0ED 4DOHE 4KDTA 4OLWL 3VXUD 4TTGA 1CXKA 4XRCB 5EC1B 3KPPA 1RZGB 3NCEB 2CMRH 4PV9A 3PGDA 4EVNA 1ZA6A 3D25B 5C0BB 3PGFL 1ZTXL 4ONFH 2YC1B 4DVRH 3K8LA 2NX5A 5JA9A 1CGTA 4L3EA 3TNNA 3AFLA 5DC4B 5I8KH 1E28A 5E2TH 3DVNA 4ODTL 3AS0A 3IKKA 1NDMA 4HK0A 12E8H 4DJMA 4UOW1 3PWLB 1XGRB 4I18B 1HXYB 5KSBA 4OQ1A 2EXYD 1E6OH 5IMOB 4DGIL 1CS6A 3O4LA 5I2IA 1LE9B 2FEEI 2VZ1A 1Q9OB 3Q6GL 2FGWH 4OLYL 4GW5A 5DHVH 5E8OA 1A1OB 1RFDL 4FQ2L 4O5LL 4JFQB 1G7MB 1C5BH 1IAIH 5SV4A 1K5NA 3A6BH 4YFDB 2I60L 1EBPA 3HI5L 3EYSH 1ONQA 2FYYB 4JKKA 4XH2B 1S9VB 25C8L 3BZEB 1CDHA 5T33H 3BKCL 3GDBA 3SO5A 3BT2L 4F9LA 4QRPA 4YHPB 5JPMA 3KAAA 4K55A 1FJ1A 1ZHLB 1ZSDB 4X6DA 4NNPL 3H42L 5L6YH 2BP3A 2WM0A 5CHNA 3U48A 4F57H 5F9WC 2VDKH 3EHBD 2V7HA 3AGVA 2PYFB 1QBAA 2CLZB 4IIQA 1TQBC 3ZE1E 5D72H 1CCZA 4ZAKC 4Y8DC 3TIEB 1KN4H 3OPZL 2VDQH 1AD0B 2ZOLB 2F53E 4PV9B 1V7ML 4MJ6B 3RZCC 1QEWA 4MNHA 2QV2A 4KZDL 3IDMA 1IEBA 3VWKC 1EEYB 1DUZA 3EHBC 4GLRI 4MJIA 2KZWA 5ESAB 5SWSB 2Z31C 4EUPG 2BNRE 3EDKA 4NKMA 5GS0D 2IG2H 4E0RA 4JO3L 1I9IL 1QLRB 3JV0A 3MLYL 5AZ2L 3WFEL 1R5VA 2XV6B 4PLKC 1NBYB 3IDGA 3QDAA 3QJFA 4ZUUB 4FMFA 3PHSA 4PYGA 1G7HA 4FXGA 1MFEH 3AREB 3S37L 3SGDH 3L3JA 2RHEA 4PGDB 1A6TB 3FN9A 5I8OH 2D9CA 1CFNA 5DMIL 2JF1A 1UKTA 3JWDC 3MV8A 5E8NB 2IEPA 2LU7A 1EV2E 3UZQA 2HVJB 5IFAL 3BQUA 5GIRB 5J56B 4I9WD 3VD5A 5DZLA 4AL8L 1CQKA 2WLYA 5C9JB 5DURD 4ETQB 1M7IA 1NFIB 5FGCB 4A6YB 1KB9K 1RZKC 1S7WA 2B1AL 2XXMB 2PUQT 1CG9B 1DVFD 3C6LB 1JVKA 5HTSA 3ULUD 2Y36H 3BGFC 5ISZD 3FTGA 2B8OT 1XGYL 4IRSA 3UTQB 2NY6B 3HAEB 2YPKA 4XAKE 3QPXH 3VI3E 2HVJA 3LQAC 4HZLB 3CLFL 4PJCB 1JPFA 5JDSA 3TT3L 1VEOA 2OXHA 3W2DH 3KJ4C 2NR6C 1S7SA 3Q1SH 1QP1A 1K2DA 4NWTH 5J12C 4XNQB 3X13B 2EE9A 3GSWA 4O58H 5CILL 1GHFH 4CGTA 3WUWG 2VXTH 4PLOB 3WNNA 2X89D 4CAGA 3SJVB 4MAUH 7FABL 1D6VH 4R2GD 2UZXB 4Y16C 4NKDB 4X9IA 1CN4A 5ESQB 1E4WL 4DGIH 1S7XA 2XKSA 1FFOB 2FSEB 1I3GH 1PG7L 3O6MH 4NSKA 5T3XH 3MOQA 1QLRA 1TCMA 4RFEB 4OIAA 2QQLL 1BHGA 1KJVB 5IWLC 1IGYB 5TQ2L 5E8EA 4JGJA 4ENED 4NN7C 3MO1B 2PYED 4PRAB 2EO9A 5F1SA 3B5HA 3UTZB 2I07A 2VQ1B 1RHHA 4OCNC 3KPLA 1NDGB 4X6DE 1EJOH 3OSKA 2EH8H 2IQ9H 2MNUA 3QUMB 2DD8L 5DK3A 3C5ZA 1JYXA 1QSVA 3G5ZB 1A6AB 5I30H 3VRIB 1NCWH 2VRAA 1T89A 1IGFH 3A6OA 4POZD 4KK6C 4PJEB 3D39A 2EKJA 2Z4QB 5CGTA 3HC0B 3FQXA 4CN4A 1EHLL 3DETC 3MYJB 3L3OA 4OF3A 1D5IH 1A6TA 4ZFZB 3D9AL 4NUGH 4PJXE 4XP9H 5EUOA 3VXSE 4UINL 5HYSB 5ICYB 1KPVB 4NZUL 1QSEE 5HHVH 5DRNB 5KBNC 3GUTA 1S5HA 1KTKE 4UDTA 4KHXH 3BAEL 2IANE 1O0VA 2EDRA 3P9WB 5DD6A 1C1EH 1KCRH 3BEWB 3GEWB 3UDWC 4UI2A 1BZ9B 2NXZB 3BP6A 4JFFD 4TOYL 2Z35A 3WDIA 1G7QB 4BH7A 5CEXA 1MCOH 4MMXC 2H32H 4NO3B 3MV9D 3TJHD 4IMLA 4LVOB 4A6YL 3BKYL 3W9EB 4QRSA 4DAGL 1NCAL 4AMKH 2J8UF 3EIFA 3MV9A 3IS0X 3TBSB 3CAFA 1DBAH 2CLRA 4L4JA 3UJIH 5HHQA 4UQ3B 5EBLB 4NQDE 4JFQA 1BJ8A 4IJ3C 2VERN 3IAQA 3M1BB 4F37F 3IDJA 2X1XR 1I1CA 3O3DB 1DTUA 1D5ZB 4OD2A 3MV7B 1A2YA 4G6ML 1WBYB 4JAMB 3D0VB 3EZ8A 3N85H 5TDOB 5HHXL 3PWLA 2FLRT 4Q7DA 1UCBH 4POZC 5J1AB 2NTFB 1F3RB 4P0DA 4GFTB 3U7WL 3Q3GB 4BELD 4YDLB 5EUOB 4G6FD 5DQDL 4M4PA 5FCUL 4NBXB 4JGMA 4XPTH 1H3GA 4JFYA 3VD9A 2EEBA 5CJOL 4U1MA 4Z7UE 1NLBH 3INUH 3DTXA 4DOHB 1F3JA 1VKXB 4UBDC 4PRHA 2CIIB 3LEYH 4XBGA 1RZJH 1A6UH 1JHTB 4HMEA 5C71A 2ESVE 1LO4H 2P5WA 3L5XL 5DSCB 4LVHC 4LEOA 3P77A 4UTBL 2BY1A 1RUKL 4U2ZA 5TQ2H 4HPOL 3HI1B 3V5DB 2A74B 2R2EB 1C5CL 1V7NL 4P2OB 3ARED 3GNML 3N1QC 1K6QL 2X4TB 4WUKH 4XAWL 4UDUB 4FFVC 3S8WA 1XGPB 3SN6N 4QRRD 1FZMA 4MA3A 3LN4B 4JO4H 4NHCH 5BQ7B 4CBPA 1RUQH 3SQBA 4OV5A 5T1LD 5IB5A 3RWIA 3RWGB 1KCLA 1WIPA 3JV6A 3W39A 2QJDA 4HFUH 1T0PB 4S0TD 2BHUA 3RVUD 1C08B 2BVYA 3O3EA 1XR8A 4FQCL 3PIQA 1JHKL 1A9BA 1DL7L 5EU3A 1P7KA 4JM2F 1E0OB 3VH8B 4I18C 3MOBH 3KYNA 1E4KC 1K9TA 2FRGP 4PJCE 5IBLD 3LKQA 4PG9B 5ERWB 2ZPKL 4WTZA 1P4IL 1RHFA 3KJ6H 2BC4B 1CGYA 2YPKB 4JRYB 3B9KB 5DQ9B 1H5BB 3NFSH 1JUFA 4OT1H 2DMCA 5CKAA 3PIQB 3GSNB 3DX6B 5IHUH 2DQIL 2FEEL 3VXSB 1DDHA 3SDDC 2OR9H 1XGUA 3CXDL 1TZHB 1NBYA 3QIBA 1J10A 4XC3H 2AJYH 4PJ8B 1IAIL 3FQWA 4F3FB 1HCFX 3P0VH 1MCDA 4YDKL 3IGAA 1NCBL 4WENB 4X6EA 4UMGA 1N5YH 5IVXF 2IAMB 3KDMB 1S9YA 3U9UA 4LHQB 1IRAY 5IEHB 1HILB 3A0OA 3O6LH 3AS1A 1J05A 1VGKB 2DQGL 1M05B 4GW1B 3QQ9C 5DQJB 5EIIB 3T0BA 1UWXH 3CFEB 3TGXA 1JPSH 5I71B 2BNRB 1BPVA 2GTZB 3MJ9A 5L2KD 3ZE0F 2FD6L 1QLFB 3V7MA 4FQLH 2NY3B 2XA8L 1GGCL 3RA7L 1M6OA 2IPUK 1ZVSB 3MA7A 2HH0H 3O0RL 2DM2A 2X4NB 4O02H 5BS0E 3HC4H 3LN4A 4OV5B 4DFHA 1WUNT 4KK5C 4OZ4A 2C3VB 2IH1B 4YHOH 5IROA 3WE6A 5GSVB 2AGJL 4H8WC 3ZSTA 2AV1B 3BN9C 2F54E 3LV3A 1UKSA 2VH5L 3C5JA 4KZEH 1UKQA 1QSFB 3UBXI 5JLZB 3GNMH 2AAVA 3BEWA 3ECBB 3RVVC 1C8PA 1P53A 1UB5A 4N0CC 1KCVL 3SCMD 2Z9TA 3DBXB 2VR9A 1AR1D 2MTPA 3T65B 2V9TA 5L9DL 3BZ4B 3RGVC 3U0WL 3ZDXF 5HHPB 3MYJA 5GRVK 5T3XE 5I0DA 3V7AG 3ZE0E 3BPCA 4FQ2H 5DLMH 2P46B 1ADQA 3RKPA 2JIXA 4NQTA 5E8PA 1VGKA 1CDYA 1N7MH 3HMWL 4IOSD 1RUKH 3TA3D 1V5JA 2UY7A 5GJSL 2ESVD 3VCLB 2CIKB 4MZ3A 1QSFE 5ITFB 3KDMA 1WTLA 4PJHF 4OKVA 5DRNA 2R1WA 2E7LC 5IVXE 5I2IB 4KZDH 2D3VA 1AGFA 1HHIB 2I27N 1WBXB 3H3PH 1N59B 4ZXBD 2V2WA 3PGDB 5K93A 3T1WA 4ONFL 1J0HA 4JHBA 2FHBA 1CGSL 1TTGA 4NZDA 1DQML 1N4XH 4OSUL 4APQB 2VXSH 1XF3B 3VD4A 4TVPE 1T66D 3QUZD 3DRQB 5JQ6H 4HKJB 5FYJU 4WV1B 3O8XA 1N6UA 4YHML 1BGXL 4PJAA 5ALBL 2P8PA 1S9XB 4NQCE 1PYWB 2WQ8A 5AAMA 1AXTH 5C0CB 1CD1A 4TUOA 1ADQL 3V2AR 1JGEB 1GH7A 2A9NH 5J0BA 1ZMYA 4IRJA 3QSKB 3WE6B 4HUVB 4UT7L 1SQ2N 5KG9B 2UUDK 3BXNB 4JDVB 2RGSA 1OWWA 1SMOA 4NCC1 3ZTJG 1TZGH 3IDNB 4R8WH 3TBVA 3EO0B 1P84J 4QT5B 1B2WH 4UNUA 2FO1A 3PHQA 1CXFA 5F9JB 3NCMA 4PR5B 4R4ND 5DT1H 2R0ZL 3HRPA 3HI1A 4P46A 1FN4B 5HHOA 5BRZB 3SDXA 3GBMH 1KN2L 5C0GB 1RJCA 3QDGB 2BSSB 3BGFB 1F97A 4RISL 2YOCA 2X9YA 1S3KL 1Q9KA 1IM3B 5IBTL 1OSZA 5KTEH 4EXKA 3MV9E 4P2OC 4P46B 4R4FL 5IB5B 1JN6A 3QNYB 5JOPE 3JWNC 1NC4A 4XMPL 4Z77A 3WXVL 4XBPB 2VLJD 3P77B 2ZCLL 3QDMB 1QEWB 4MNHB 2O5ZH 5GRZA 1U3HC 1YECL 1CD0A 4LSPH 4AT6A 1XCTB 3HCVA 4QLRA 4UQ2B 4H0GA 2VB5A 2OZ4H 4CJ1A 3LKOB 4FXKA 4J7RA 5INCA 5HGAB 5CEZE 3QWRD 5DDHA 3BZDA 1HNFA 3QCVL 4NBYB 4W4OA 5F9OH 5HI3D 5ICZA 3D2UB 3FHAA 1T1XB 3BH9A 3QQ4B 3L6FA 2KZ1B 4XVJH 3G08B 1FH5L 1PX3A 4B7LA 4GXVL 3OKLA 3O3BA 3IRZA 4G6JH 4NGHL 5ADOL 4KI5D 1S9VA 4IS6A 2Z8RA 4GKSB 2ZCHL 2D7TL 1YQVL 4LF3A 4HUXB 4K71C 3ZKSD 5HDQL 2Y5TB 3PGCA 1CFTA 2LVEA 2GI7A 4FZ8H 4HAFA 2GCYA 4G8EB 4RX4A 5GRYA 3BN3B 1IAKA 4WVRA 2VL5A 5CMAB 2VLJA 2VL4A 1UWEH 3SPVB 5HHOE 5DRZB 4A6YH 4Y2DA 3QRGL 5FDWB 1A7QL 3D39E 5L2KB 1KGCE 3ILPA 1S9WB 4H26B 4ODVL 1T80A 1W8NA 5MEPB 4EKXA 1W8OA 2B4CL 4X6CB 4OGXH 4ALAH 1R5VB 3LRGA 3OB8A 2YPVH 4H88H 3BPOC 4N8CL 5D2NA 2Y36L 4I13B 1ADQH 3BDBA 5D7IF 3MFGB 2BOBB 5D7JB 4XX1E 4I9WE 5LGHL 4OM0H 1KUMA 3O4OB 4G9DA 2IPKB 3KJ4B 1TVBB 5C08D 1IGYA 3HB3C 1Q72H 4JFEA 4X0KA 1CD8A 4MXQC 1D3CA 5D2NB 1MCLA 3L7FA 3FT4A 3G9AB 3ZE1F 1JGVH 5IROC 3CC5A 4KMQA 5D70L 1RHHB 5GGSA 4YHIB 1JZ8A 1QTYT 1M6OB 3H8NA 3LKRB 2GK2A 5JZ7D 3RPIA 1G7LB 3F7YA 3O6ML 3GRWH 3FMGH 3U79A 3WBDA 5AEAA 1A7BA 1MAKA 3DYMA 3HNVL 3WJLC 1FYTB 4OFYD 4OQTL 3T4AB 3TVMD 3SDAB 2QQNH 2W9DH 1AD9A 1RUAL 1FG9C 4MCZA 5DJ2B 2Q8AH 2DKMA 4D8PA 3T4YA 4E42A 3QI9C 4ZS6D 1ZHKA 3CU7A 5FO7B 3CX5K 1CFTB 4S10A 4YHNB 5DJYA 2WW8A 2D4DA 5E2VH 4TRPL 3SGDI 5GISH 1IL1A 3RWDB 1VFBA 2QR0B 2XKNA 4JLRB 1FFRA 5F93C 2AI0L 2Q3AA 3EFFB 4S1SL 5FUOH 1NL0L 1DQJA 3O6LL 3ZTJH 2VAAA 3A6BL 2VQUA 5CAYB 2X7LB 3T0VA 1WC7A 4GG8A 5SWZD 3QRFM 1BOGB 2YA1A 2H6PA 2YPVL 5IVXA 5I15H 2QHRH 3ULVD 2GK0A 5DHVB 1QRNA 1KYOJ 5LGKA 2JJTA 1A1NA 4LSDA 4ERSH 1IJ9A 2DD8H 4HJ0D 3G6AB 4XNUL 2FJFB 5GZOC 3DETD 1FDLH 2A6DB 4OF8A 2PXYD 4YHOL 5C3LD 4KH2A 2PNDA 3DROB 5EZJB 3ZE2F 5F7NC 2VXVL 4ODSL 5CSZB 4FQQA 4NUJB 2HRPL 5GPRA 2X4RA 4C4KT 2OR9L 4V2BA 1I1FA 1SEQL 3D48R 2LTQB 3WL9B 2NY1B 1D9KA 5GZOD 4M7ZB 1YN6A 4JM4L 5D5MB 2R0LH 5C0FA 4G8GE 3GIVB 2AJZA 1X6LA 2ZUVA 3OKKB 2VNCA 3RPKA 4HXBH 4O4YL 1JZ3A 1PZ5B 3RY5A 2XZZA 4UV4L 1FRGL 2X4PB 2DQFB 2V5YA 1G9EA 5C0CD 4Y4FC 2DQDL 4M5YH 4HCRL 3GMQA 3EJYC 3IFLL 1JZ6A 3JTSA 3C5SA 5KANG 5D2LA 1MWAA 5J13B 2DQCL 1J0JA 2GEEA 1MH5A 5HHMB 4KI5F 3ALXA 5ICXB 5GJTH 2XY1A 4TUJB 2NXYB 4KRMB 1IFHH 3C6LA 4G5ZH 3MRGB 3VXTA 5DSCA 2EDQA 1QNZL 1MFBL 4WFHE 2JJWA 2VSDA 3HI6H 4RAUB 5K9QI 3LH2L 3AU1A 1UCBL 5EO0A 4LCCB 4M02A 4MAYD 4YDJB 3U6RA 1DQQB 5JZ7C 3IYLW 3CX2A 5KVDH 4HPOH 3UTTE 4G6KL 3WSQL 5F89B 4W4OC 1IKNA 2Y7QA 4WI9A 1DFBH 1T21B 2Z31A 1U8NB 1FFNB 2AEPH 3SPVA 5T3ZD 5E9DD 2B1HL 4TVSa 1HKLH 4W68A 3B2VH 3NOIA 4OGAC 1MIMH 5E0QA 5GGSY 5ISZB 3E3QE 2QSQA 4BFEA 3GMNB 1EEUA 3CUPA 1P6AB 1A6PA 1P4BH 4U7SA 4HIXH 1I7TA 5D9SA 5CUSL 4JN1L 3TPUA 3I75B 1IM9D 5DVLA 4OZGA 3MO1A 2C3GA 2QSCL 3WIHH 5B8CA 4WW2A 2V9RA 3RZCD 1FE8L 1W2KT 4NFDA 1A4JA 4M61A 2BY0A 4JDZA 3FL7A 3V5HB 3X14A 2ITCB 1NCWL 4RBPH 3GSNH 5GHWL 5KVFH 2HJKB 5A3ID 3SDYL 5DJ6B 4ISVB 3BE1L 4LCUB 4RMSA 5CP3A 5I1LA 3W5MA 4ODWB 1FORH 3D69A 1J1XL 2EDWA 5D7KD 2GCYB 4G8EA 3ARUA 2V5MA 1AQDA 1S9WA 2P24A 4JANA 3TT1H 1Y0LA 4TUJA 3RIFK 2JLLA 3WXVH 1GCFA 1M4KA 1GGIL 1OAYH 2EE2A 1MHHB 3IDXH 4HUWB 4JFPB 3V0WL 1C7TA 2IFFL 5D2NC 1Q0YL 3MRDB 5MEQA 4WO4B 2VLKD 2H9GA 1BEYH 4MXVE 4JPWL 3MRKB 1OGTB 2XN9D 3S37X 3IJSB 4ZG1A 1INEL 2ATPA 2BNQA 4KI5C 2IBZY 3QUYB 4AQ1B 4F3FA 3H7BB 4ENEC 5I6XB 4ELME 4DN3L 4UUJA 2R0KH 4CMMA 4Y5XB 1X5LA 2DWDA 4U1KA 1N6QH 1DANT 1J8HE 4MWFA 3B9EA 4U7MA 3VXPA 5CINH 4R4BA 3QBTB 2FATH 2NW2A 2NZIA 4ZSOB 5KS9A 3HZMA 2CDGB 4G8IA 3T77A 3GSNL 4W6YB 5GHWH 3VXQA 5IMMB 1U93A 5JNYA 1A8JH 1JGDB 1NPUA 1Y6NR 3VMOA 5D7SH 1GPOL 2NX5B 2B0SL 2V7NB 1NGPH 1JPTH 2X1OA 4LSTL 5IFHL 1Z6JT 5I1HL 3QXWA 4MDJA 4HJJH 2P44B 4Y19D 1YECH 1WZ1H 4LPWA 4JY6A 3WO4C 1JGDA 1EERB 2HJFB 1JF1B 1Q0YH 3UZEA 4CRPA 4WI2A 2UY6A 3T3PF 3BVNB 4O2CA 4M03A 4E41A 3RKDD 1LILA 3LAFA 1DFBL 4P9MH 1GSMA 1MCKA 3STLA 1YEJL 3H7BA 1YNLH 4HC1L 4A2MA 5FYKD 3LSOA 1KLGB 5KJRH 2CGRL 4XGZB 2BNQB 5D6CB 2APXA 2BVEA 4YUEH 5EWIH 4YGAB 2HFGH 4KQ4L 1PYWA 3DURB 5DMJB 1OAKL 4JZOA 4Z5RB 4R0LC 3MXWH 5E8OB 3ARFB 3W5NA 5EIVA 2BHZA 1I9RH 5I9QB 5CFHA 5IB3A 1F8TL 3D18B 1KCRL 4PGCA 1CXEA 1HWGB 1OP5K 5DMGD 3MJ7A 3IVKB 4O5LH 5C0JA 4X6DF 5J7CC 3IFNL 3LEVH 3FN0L 3DMMC 2E9IA 2F58L 3DVNB 1I1AB 1QACA 2DLFH 1W0WA 2Q3ZA 5CSGA 5CBEA 2KBGA 5BCAA 1JMXA 2GY7B 2PYFA 3L1OH 1DEEA 5SX4H 4WFED 4YWGH 4KK9C 4GKZB 1I4FA 3P4MB 1ZEAL 3MLTB 2GSIA 1KBGL 1SBSL 32C2A 4KY1L 3LZFH 2C4FU 2R2BB 1Y6KR 4CU6A 1WGOA 4MZ2A 5TQ0H 3SOBH 2JJSC 2ICWA 3MNWB 1HWHB 1ZEAH 3MRHA 2P7TB 4Y19B 5FOBA 1KT2A 3LEXA 2WANA 1I7TB 3BIKA 5MP6H 2OTPA 3RU8L 1U92A 3MV8D 4JHAH 5CWSB 1BAFL 4D3CH 4FXKB 1MAMH 3C8KA 3FO1A 3MREA 1ND0A 1GJIA 3L5HA 1N2RB 3MRCA 5CP7B 3CZFB 3DIFB 4AT6B 3ETBF 4GRMB 5FA4A 4JPVL 4JQIL 3X11B 1T1XA 2OLDA 1AH1A 3M8OH 4YZFF 2PF6A 4YX2H 2AKRB 1CDBA 3ARXA 3DUHA 4FNLH 4HWUA 4WU7B 1JZ4A 3VW3H 1A7PH 5HD8C 3V6OE 3FQRB 4WDIA 1F8TH 2ORBH 5CJXC 5L2JB 1CLZH 2GAZA 5I1CH 5M94B 5HHMD 1J11A 4FZEL 1DDHB 1QFPA 3TEUA 2JKXA 3O3BB 1V3JA 2G75A 4KXZI 3VWKD 1NFDE 4XBPA 4HKBA 4S1SH 1E6JL 4TQEH 5FUOL 1GOGA 1HQ4A 4WW2C 2HFGL 4N9GA 2E9WA 2NY0B 3OXRB 4JVUA 1VFAA 1NANH 4P5MA 1XGQB 4KJPC 1FIGH 5FDWA 4WFGE 1JRHL 4HS8L 3P0YH 3HE7D 3ARBA 1IBGH 1OTTD 1KTRL 3B9KC 1EO7A 1X4YA 3CVHA 3TBWA 1C5CH 1J05B 1V7NH 5DDHB 4WNQA 2VKWA 4AMKL 3UJJH 4LDEB 1LD9A 5F9WB 1JF5A 4XHJD 5IIEA 5DMKB 5KVEL 1TQBB 2CRIA 1ORQA 2MHAB 3F6IA 2ADIB 2H32B 4MB3A 1FH5H 5IESH 2ZKHL 2EICA 2H8PB 5CEYB 2ARJQ 5CCKL 2HMIC 1OP3K 4TSAL 4MAYC 3MRQB 5IR1A 4YHNA 5E94B 4BZ2H 5DQDH 4M7KH 1M7IB 1BOYA 1I9RL 4RA3A 3OJMB 4LSUL 1K2DB 1FBIH 3CSYA 4PG2A 43C9B 1HHKA 1UVQB 1T1ZA 3QEQD 4JG1H 4G6MH 1MFAL 3E1F1 1LEKB 2WBWB 1CLYL 4NP4H 3CVHL 1N5AB 1ZLWH 1ZT1B 5ETUB 3VFSA 3N85L 5T1LB 2JCCA 5JXEC 4HUUB 4E5XA 2PO6D 2A1WL 4F7TB 3HNTH 4EUPA 5F6HI 2VIRA 1MCRA 3D3VE 4U1KB 1T7ZA 4DUXA 3QUMH 1PFCA 5JO5A 3DSFH 2CDEB 4Y2DD 5DFWH 2B4CC 1HHGB 1T4KA 1TJGH 3VDAA 4ELMB 5HHOD 2XNAB 1RU9L 4JHZA 4RMTA 4YBLC 1U91B 5E7BA 1YEDB 4P3DA 2HT3C 2VIRB 5SWQB 1VFAB 4KVNH 2YRLA 4F37K 3VE0A 3DSFL 3HE7C 5CBAB 3QUKA 3HR6A 1B0RA 1NEZG 5IV2B 1G0XA 1R5IB 1FG2A 2XTJE 3IJHA 1HNGA 1RJYB 4OUUA 2HWZL 3IFPB 3OKDA 4KK6D 4B5EA 3LH2H 2CLRB 2H1PL 3F7YB 1OAYL 2BNQD 1RULH 1JGUH 3WSQH 5IVXB 4P23D 4ZOCA 3WS3B 1HEZB 4J3OC 4PTTB 5CJ8A 3SGJA 4I0PC 1BFVL 1NGYA 5J9PB 3BHBB 3TBTB 3CFCL 3MZTA 4LLWB 3ARYA 2XFXA 3WD5L 3RWDA 3GKZA 1QA9B 3WUWA 5KVEH 3GIZH 3I3EA 4KGLA 2GSGB 4TULL 3ULVC 3VFWB 2OL3L 1AO7D 5C07E 2MCG1 4ZQKB 1LK2B 1U8KA 4XP4H 1T03L 5M95B 1RVFL 4HJ0C 4Z95L 3ZT5A 3MLTA 5SV3A 3WUWB 3O6KL 5CEXB 1ES0B 3H0TA 4OZFH 5DC0A 4JKPL 4FQ1L 5K9KA 1OARL 2DS4A 4L29A 2NY1C 1SBBA 3HE6D 3AU1B 4KVNL 2ZSWA 5J3HC 2XQBL 1EZVX 4P46D 1LE5B 1CL7H 3L3DB 4KMLB 5DGQA 3NH7L 5I8EA 1U8NA 3IDIA 5DD5H 4HUXA 1KPUB 3IAGC 2DL2A 4XNZB 4GKSA 4UILL 4WTZG 4KRLB 4NWTL 5D71H 2EKSB 2YD3A 3MTRA 3X11A 1UADC 3PP3H 4PTTA 4RGMC 2APBA 1AXTL 3N1GC 1EUUA 2FWOB 3QQ3B 4F9LC 1OLLA 5D7LB 3NTCH 3F65A 1PBYA 4PUBH 5FOBB 5KOVC 2AGJH 3VXMB 4M7JH 1U8QA 4IRZL 3LKQB 4NJAH 1I1AD 2FDBP 4PRID 1JP5A 4QHKJ 2VAJA 3MCKB 4XCEA 3B8YA 2OI9B 5KAQF 4K3JH 1LMKA 1HHHA 5FECB 1U9KA 3VG0H 4ODXB 2X4UA 3QXAA 2R0ZH 5E6IA 1T5WB 4YAQB 4XI5D 5DWUH 3P4NA 1LDPL 1A14L 1DE4A 2BMKA 4LF3B 1KF9B 3MCKA 3ARBC 4P3CH 5HPMA 4XVTL 1EA9C 3V5DA 1YMME 2YBRA 4WWKB 4TUOB 3FRUA 3VXNB 3TT3H 3CFKB 3BX7C 1X5IA 2AV7A 1FFQA 1OAUH 4KKLD 3WJJA 1AHWB 2F58H 4ZS7H 4N0FB 1NQBA 4OQTH 4LSSH 3Q5YA 4YDLC 2BC4A 3PF2A 1KEML 1T1WB 2A83B 3KYKH 2A73B 3HZYA 2CPCA 1F4HA 5F6HJ 3RL2B 5I66B 1FZMB 2VR4A 3SE9H 3VFUB 3VMNA 4CMHB 5DJZB 1X3DA 3KPSD 2J8OA 4OSUH 4WU5B 4JREC 2N1KA 3QP3A 1QVOB 1F6AB 4LU5L 4RQQA 1LD9B 3BKCH 2H9GB 4HQQH 4R7NA 4NRXB 3VWJD 1LEIB 2JCCB 3SQOH 4J6RH 1S7UB 3RZWA 4OLVH 5GS2D 1AI1H 1RIUH 1VFMA 1UM4H 1HN1A 1HKFA 2XA8H 1QBMH 5IT2L 5JO5B 2P8LA 5I15L 43CAB 5DVNA 4D9RE 1BVKA 3H3BC 2XZCL 3ULVH 4FFZL 4KK9D 1AI1L 4JO4L 1A7PL 3ZDXE 3GJEA 1JWUA 5KN5B 4D8PB 1MIEH 2X41A 5FYLH 3OMZA 1E6OL 4LPCA 3DBXA 3T0AA 2EDJA 4K94C 4YUEL 5B8CB 1U58A 3EGSA 2AJSH 1XAUA 3BT2H 2QQNL 3I3BA 1UQSA 2QL1A 1OTUD 5TDPA 5LXGL 3QB7C 2Z35B 2COQA 1JF6A 2WBKA 3DVFA 3PWNA 3E6HA 2XQYG 1ZHKB 2XTJB 3JWOH 4OZ4B 2VDML 4ODWA 1NEUA 3BPNC 1NC2A 2AXFB 2W91A 3MA7B 3AY4A 3V4PH 1RZ7L 1T20B 1B0GA 2ZCKL 1J1PL 2AEQL 5C2BH 1T3FB 2SEBA 1IKFL 2FR4B 2D4FA 2A38A 1A5FL 4NM8H 2HMID 1MPAH 4XXCA 2AJVL 5EOCJ 4NYLA 4P3CL 1T5XA 1BQHA 4U1SB 4ZYKB 3M1BA 1N5YL 4IHOA 4JG0H 2L4OA 4FQHB 3ECBA 5CBAA 3GM8A 3FB7A 4ZOBA 2XZQL 4RAHA 3WNLA 2BK8A 2X4OA 1Q9OA 5IFHH 5ID0A 1MLBA 4PJ5B 4Y2DB 4ZQKA 5EUKB 3T8XA 3VRLE 4P2QB 3OJDA 4KC3B 4RFEA 3WIFB 5D5MF 3W9DB 4D0CB 1KTDA 1RUML 1WF5A 4L4TE 2BCKB 3DX8A 1EJOL 4AYFA 1KELL 5D1ZC 4EOWH 3HRZB 3FCTA 3T1FA 1CT8B 3MV7D 5BZWA 3DVGB 6FABH 4PRIE 1BZ9A 5IW1B 1NGYB 2DBLH 1FAIH 5DZOA 3ARGD 1CGXA 2CGRH 4RGND 2ATKB 2YEZB 3V8OA 4GKNB 2RAMA 5F71A 3ZHLA 3ARFA 3QUZC 4GAJH 4LCWD 1JZ7A 1NGWA 2YN5A 2CKBH 1CK0H 3JTSB 3FQXB 1TFHA 4M6AA 1B4JH 5C0AA 3CPLB 4BSWB 3BDYH 1ZT4B 5ANME 4OFIA 4AY0A 1IE5A 4FA8A 3JV5A 2Y72A 1M71B 3LSOB 2ZSVA 2NY5C 1OAZL 1HZHH 2R1YB 3PWVA 4I5BB 4JFFA 4BQ6A 4BZ1L 3ISWA 1MRCH 4KHTH 3RHWF 4GRWF 5FYJH 1M7DB 2Y25A 4HDIA 4TVPL 1DEEB 3PGFH 4OZHE 5E5MB 4I1NB 5TE4H 1EO5A 3QUXA 4YDVB 3WLWD 3VA2C 4MSWB 3CX5J 4LIQE 4FRWA 1ED3A 4L4TD 4YDIH 4GW4B 4MAYB 1KFAL 1TITA 1UENA 2B2XH 4JZOB 4Z5RA 5I30L 2Q76B 3KXFB 3CVHH 5GS0H 3QEQB 1AGEB 1CE1L 1LGVA 5F1OB 4IDLA 4H0HB 2EIZA 3PDGA 5JQ6L 1NC4D 3MOAL 4YR6A 5I73C 4X9HA 4K3GA 1EPFA 4F15B 1PEWA 2ED8A 2DQEH 4FN0A 2EIDA 5FKAA 1VA9A 2DBLL 5LKNA 3IF1A 5IB1A 1G7IA 5E6IB 2EIBA 5HI5D 1C12A 1WICA 1Q0XH 4GXVH 1L7IL 2FJFA 2J8HA 4I77L 2ATKA 1B9ZA 1ULVA 2VLLB 1ORQB 2MHAA 3O6KH 2E27H 3BWAB 1QBBA 2BMKB 4NRZB 1OAQH 1AQDB 3QDJD 2ADJB 2IF7A 5EOCL 3P4NB 1W0VA 5EG6C 5KSAB 3LB6C 4XMLH 2HG5A 2V5TA 3SKMB 3A67L 2R9HD 4KKNA 4Z78A 1F3JB 3GMOB 4IRSD 3JV6B 3W39B 4P5TA 1H8OA 4ORGB 1CWVA 1FGNH 3MRRB 3E6FB 3ZKNC 2K3TA 2ATPB 3AAZA 2HKFH 1BF8A 4NFCA 2EIEA 4ZS6C 5HVWA 1WAAA 4RZCB 5D93B 1VACB 4NDMA 5L2JA 3C9NA 4RWYH 3VFGH 5CEZL 4MSWA 4CDGC 2FECL 4D9RD 4G42B 2HFTA 1WWCA 4UV4H 4HBCH 5GGVY 4ZXBA 3NCYP 5ESVB 3WFEH 2OJEB 1CD9B 2VITA 4XCFH 2RCSH 1CICA 1NMAL 1U8PB 3FT3A 1WTGT 4WJ5B 1G9MH 1CDIA 3WCYA 3EFDH 4Y0GA 2J4WH 1IGIL 2DKSA 2OR8A 4HKBB 2C4XA 1EO8H 3CH1B 3PV7A 4LPXA 1DLHA 4YFEA 5JHDA 1A9EB 5CGMA 5F1IB 1WBZA 4P4KC 4KFZC 3MNZA 5INDA 4ETYA 1QYGL 3AS2A 4QRPD 4L9LC 4XAKD 1X5KA 2WK2A 2XKUA 2E5EA 4FQHA 4Q6YA 4JFZH 3QUXD 5D72L 4OV6F 1E4XH 4Y5XC 2NX5E 1FL6A 4PP2A 2DTSA 5F9DC 5IBUB 1NC2B 4DVBB 2R39A 5GS1C 5A16A 3QO0B 3QDHA 3KPSA 4ONHA 1KXQE 4YQXH 3RGVB 1GL4B 2G60L 2WWMC 3GSQB 3HAEH 3K4DA 4WFGD 3LKRA 1T3FA 1V05A 1ZLSH 4OUUB 1HXMB 2BSTB 3LIZL 3H9SB 4ONGH 3TNMA 2EYSA 4UIMB 4GW1A 3PDOB 4OIBA 3VD3A 2XPGA 4JY4A 3UEZA 3RWEA 4Q9RH 3X14B 4OLVL 3B3IA 4ZFZA 4WEUD 2DQUL 5E2WH 3FJTA 1U95B 3VI3F 1QLFA 5IVZA 5K33A 4G6KH 4HWEH 4H8WL 1I7UA 3MRBB 1JPSL 3ARWA 4KRNA 1Y6MR 3VG9C 5F44A 5EU6D 5F7LB 3I3DA 4QYOA 4HK3J 4J4PD 1X44A 2C1PB 2V17H 4ZNEA 4XC3L 2Y9RT 2WP3T 2F53D 3FT3B 3D2UA 5C0GA 1D6EB 3QFDA 5F3HB 1NCBH 4MA7L 4O2FB 3PWVB 3VFNB 3V79C 1NSNH 1R3KB 1PGRB 1DQLH 2ZSVB 3O2VL 3PXJA 2Q87A 3ZSSA 3MNVA 4M9PA 4X4MA 2I24N 4CKVX 4HK0B 3V5KA 1M7DA 3EOTL 8FABA 1MHEB 4Q58C 1YUHB 1I3RB 2AK1L 3SE4A 3WDHA 4JKMA 4AIXA 1I8LC 3RUGF 2FH8A 2I26N 3UPRA 1HYRC 2X9XA 3QO1A 1ZA6B 3P40A 4GRWH 1OW0A 1MJ8L 3SQOL 3FB5B 2WUBH 4ACPA 3KWWA 4NRYA 2Q76A 1I3RA 2MQ3A 3BO8A 1EVUA 5C07D 4OGXL 4FXGB 1SEBB 1FHGA 3IU4L 2A9MH 5BVPL 1BQSA 1CXLA 2VDPH 4GO6B 5EPMB 3RI5K 1RUQL 4UV7H 4N0UE 5IB1B 3BUYB 4JDVA 1HH9A 3MV8B 3LN5B 4XVJL 3THML 1E27A 4FFYH 5IMLA 4YHYC 5KS9F 5CZXD 2GYSA 1L9NA 1XGQA 2I9TA 3FHQA 3PHQB 3CDGB 1RV6X 3KVQA 4R97C 1U8QB 1U95A 5HYEA 2EC9U 3IB4A 2EYTA 2WZPD 1MCBA 2Y06H 4LEXH 5D7LA 2P8MA 2R0KL 3HN3A 4L3ED 4XNUH 3QZWG 3I6KB 2H26A 3R0MA 1Q1JH 1KC5L 5IB2A 5IG7A 4L1HA 4R0LB 4F8QA 3W0WE 4AIZB 2AK4A 1YZZA 2X1PA 2JE8A 1TZIB 3FQRA 3T3ME 5EOQL 2NQCA 5TF1L 1C1EL 3ZHKA 5K9QG 3HLAB 4V1DA 5FYKE 3LEVL 5TE6L 1R0AL 4PJAF 3T0EE 1NGXB 1HINL 3N0PB 4JM2A 3W0WB 3ZYOA 4Y4HB 3F62A 4X6DB 5GGTA 3MA9L 3BPNB 5EOQH 2CO7B 4ALAL 4RDQG 4UU9A 4TSCL 4JKPH 4M8QB 1P84K 3T3PE 4MQXC 4DKEL 1MQ8A 4TNWF 5T1DH 2GUOA 3N9GH 3HUJB 5LWYH 4KQ4H 2ZCKH 3CUPB 3WEXA 1KB5A 4PP1C 3B4NA 3D3VB 3H3KA 1QFWM 3L5XH 1TPXB 3UBXG 1U8IA 4ZXBC 1REIA 2DL9A 2XRAL 2F5AH 1NAMB 4WI5A 5T1DL 4L5FL 4QGYA 4X7EC 4I48A 4K3DH 3WFZA 1A9EA 4Y2DC 4MA1C 1G7LA 5J4MA 5E00A 4Y16A 1KV3A 1MY7A 2H45A 5CILH 4S11A 1KFAH 2B2XL 1VGEL 5E1HB 2AXFA 1S7UA 4FHBD 4TTDC 4IRSC 4LDOB 3VE0B 2AJXH 1F2QA 4GQPH 5DT1L 2V5SA 4RFNB 2AJ3B 3FFDB 4V1DB 3TH2T 35C8H 2MJWA 2D0HA 4HBQA 1T7XA 4RFOH 1JL8A 1T4KB 5F9AC 1ZK9A 1QBML 5IT2H 1KB5L 1BBJA 3ARGC 2GTZA 4ZTOL 4IS6B 5FA3A 1B90A 1OT2A 2JELL 5C0BD 3CLFH 2UWEB 4FABL 4F9PA 2Y5TA 4WU5A 3C8DA 4X6CA 4N8VG 2G9HA 2UVEA 5B39B 2W9EH 4XI5C 3V0VB 4LASL 3EOAA 3MRFA 3V4PL 4PJ7F 4GAFB 3S35X 1KLUA 1P4BL 5D7JA 2F54A 2EE6A 2R8SL 2A6IB 5GS1A 1VEPA 3FZUD 3U1SH 1IQDA 5D2LF 5ENWA 1G9MC 3QUKB 3E0GA 4PTUA 4R7DB 4Y4KC 1IQWH 1BBDL 1CGSH 4HD9A 4KY1H 3TCXA 2FR4A 3HE7A 1UEMA 2F53B 3ARRA 1EZVY 3RA7H 1WCBA 4GAGH 1FYTE 1U58B 1AFVL 2HLFD 1FBIL 2R2HA 2DIJA 4HS3B 2I9LB 5KSBF 2IFFH 5IGXH 3ZKQD 3Q6FA 3HG1E 5SWZA 5CZVH 4LMQE 1Y18B 1GC1L 3ZL4L 4AEEA 1AO7A 4FOMA 3DO7A 4NZUH 4GUPB 3FQUA 3OR7A 3REWB 1MWAL 5DK0A 3HZMB 2ICWJ 3TVMA 2OYPA 2HTKC 5J57B 3KLDA 5MERA 1U8HA 2ENYA 2FHFA 4KI1A 1OLZA 2X4SA 4FQXC 1P7QD 1TJIL 1I8LA 5F96H 3VD7A 1QG3A 3UJJL 2IH3A 1IGJA 1RMFH 3UBXB 4F7CB 4OCWH 2VDNL 4DZBB 5DD3H 1YNKH 1G6VK 3NIGE 4XVSL 1IAMA 3C08L 4EI6B 4HT1H 4J8RA 2VWEE 4IMKC 5I1KH 5KTEL 5D1XB 3X12A 4IJ3B 1MFEL 1I8MB 1CFVH 1CD1B 2FJGB 5ILTL 2P43B 1NGWB 2FH6A 4O58L 5EFIB 5EO9B 1YPZA 4M00A 4XCNA 1Q94B 3IDGB 4ZUUA 3F12A 4OUOA 4ZUWB 3QUZB 1FNLA 1QO3A 4K3EH 1ZT4A 4LIQH 5EU7E 4OZFA 1VHPA 3CFBB 1LO5B 1CFVL 5KS9E 1CTOA 2O93L 2VDQL 5JW5B 4K2UL 3Q0HA 4GG6F 1QRNB 2LTQC 1J7VR 3C2AH 2OI9C 1BZQK 4HBCL 3TM6A 4JQXA 4PJFF 3S97C 2BCKA 3DX8B 1ZWIB 2WWKT 4TUKH 2LE9A 4EBQH 4WO4A 2HFFB 5IGXL 4D0BB 4G8GD 3I50L 3KHQA 1U3JA 3CSBA 3HPLB 3QAZB 3H6JA 3I75A 4WUKL 3RJQB 3SE3A 3IFPA 3OKDB 3U82B 1RIHH 3EJJX 4NZRH 2XXCB 4OF6A 4EI5C 3HG1D 5DVKA 2R0WH 1HDMB 1NJ9B 2GJ6B 4OLXH 1N6QL 3S37H 2VABB 2J5LC 3U30C 2CDFA 3G08A 3O11B 2OS7A 5HI4D 3J7HA 5F8QC 1RZJL 3SDCC 3LPFA 4PYHA 5CZXC 2GUOB 2FX8L 2QSTA 2PW1B 4GKZA 1CL7L 5DJAA 3HTLX 4YFLI 4E41D 4ZUWA 4WI6A 4CADB 5DD5L 3LCYA 4TRPH 1UM6L 1YC8A 3UTSA 1P1ZB 1L7IH 3AC0A 1T2XA 1Q8MA 1JV5A 3LV3B 4RQQB 5IB4A 1S7TA 1EAPA 2OK0H 4PREB 5FHAH 2I5YH 4NN6B 3UYPA 1DQQA 4ZTPH 4YJZL 4RMVA 3RNQA 4J3WA 5HDBE 1LO5A 3K46A 2ARWA 4EUPH 2VISA 3RNKA 1SYVA 1A9BB 2VE6A 3MRJA 1CYGA 2NNAA 3AREC 1XIWC 2NY7L 2LFGA 1VCAA 5C0BE 2HFEB 3EAKA 4KDWA 2H2SC 1BF2A 2DMBA 3AXLA 3DUSA 3DXAA 1S7QA 5C70A 2V2XA 1H3XA 1WITA 3M17A 2EDXA 2FL5A 4HEME 1FVDB 3O2DL 1MY5A 5D1QC 5JHDE 3DRTB 5ACMA 1XR8B 2XN9E 1XF4B 1TZHA 4PLNC 2PR4H 2ICCA 5EOCH 1J5OL 2HT4D 2V9QA 3VXSA 1H3PH 2D7TH 3TH3T 2DM4A 5FV2A 5ID1A 1RZJC 4M7LL 2CDEA 3NA4A 3T0DA 4NC1C 1Z5LA 2VQTA 4QHMA 3NVQA 4W4NA 4U6XB 5FAAA 4HJJL 2RR3A 1H9VA 1U8JB 5GGUB 5K9JH 3SCMB 2G9HB 2OP4L 4LCIL 4YE4L 3Q2CA 1LO4L 4XP5L 4Y5VA 5DEZA 3ILQC 4X6EB 5IBUG 3NH7H 1IC4H 3F7VA 3O2DA 1KGCD 3AY4C 3GM0A 4LP5A 1RZFL 2XQYK 3B9DA 1PKQE 4KTDH 5IEKA 2HRLA 5IR1B 4WY7H 4I4WA 3KYOA 5E4EB 3VDCA 1DSFL 5L0QC 1IT9L 2BY3A 3PDOA 4KKAD 1BIIB 3UPAA 5E9DE 4YEEA 2XNAA 4P4KB 4J1UB 5I1GH 1HZHL 1OAZH 1HXMA 3MNVB 5MERB 1GGBH 5E8NA 1WZKA 2JIXB 4G9FB 3P30H 1CI5A 4R4BB 1FC1A 2IH3B 4N1HB 5EOTB 1AQKH 3THMH 4KK8D 2JCCF 5AD0B 1GGUA 1FLRH 3MUZ1 1G0DA 1MCIA 4CMMB 1IC5L 3VGGA 4JPWH 1QBLH 4WWID 2QBWA 3QI9A 4IOIB 1A02N 1ZHNB 4FP8H 4F2MA 4QOKE 1NFDA 1QLEL 2MOVA 4LSVL 4HG4K 5JLZA 1FAIL 4KV5F 1I7ZB 5DEGA 1Q1JL 2Z0BA 4HKJA 3IU3B 4F58H 5KSUA 2AEQH 5C2BL 4U49A 4LLWA 3RWGA 2WBJC 5CJOH 1A2YB 1UACL 3VWJA 4ONHB 4DN3H 2HTLC 4DKEH 4LL9A 5EB9A 3H2WA 1S8DA 2IPUG 3ARFC 5GGRY 5HVFB 4P46C 3K7UA 3H9YA 3PL6B 3BPCB 1B2WL 2HJLA 4XNZC 4C4KO 4WEBH 5I8EB 4PS4L 1FL3B 5DJ0A 3UMTA 3RWHA 2Z4QA 2X10A 1BFSA 4OQTA 1EHAA 4HH9A 2X09A 4HWEL 3O8XB 3RDTD 1S7VA 2A6KA 2Z91A 5DHXB 4F7MA 5ICYA 1T7VA 1PZUB 3CD4A 3QXUA 1GGIH 2NZ9D 4QF1B 1XGTA 4CL7A 4R26L 4PBWD 2APFA 4D9LL 5DD0L 4IDJL 3GMNA 3VFWA 1ZT7B 2F8VA 2VLJB 2O5YL 3WO3B 4XXDB 1EHNA 5JHLL 1N64L 3QIWC 3ARVA 3IVKA 1XH3B 4H26A 3KPRE 4H1LG 4HKZA 5DEGB 5EU6E 4U0RB 4PRIA 5CIPB 2EO1A 1A0QL 1I1AA 1TTFA 1FGVH 3FRPA 5KSAC 4LCUA 1P2CA 1YNLL 4HC1H 1X5JA 5SWZE 3VGDA 1PY9A 2PXYA 3ZKMC 5TH2B 2FEDC 4AENA 1P7KB 4RMUA 1BECA 1MJ8H 1CFSB 4NNPH 3V6BR 4HWNA 1BVLA 3HMWH 4JRXA 2UWEF 4U3XA 4ORZC 1Q38A 4FQXD 3NIDF 4NN6C 4GQ9H 1PKOA 4OCXH 3KJ6L 4YWGL 4X6FB 4CW1B 2IQAA 1FCCA 1KIPB 1C5DA 4M1GL 4POYA 4Z78B 3MLSH 5ILTH 2YUWA 1CL7I 1XIWA 1QSFD 1MQKL 1TNNA 3BUYA 1I4FB 2CUMA 1SJXA 3S4SA 2NX5D 1FO0L 2HAZA 1YJDC 2E7BA 1P69B 2AJYL 2BRRL 5EBWB 1Q9WB 5MENE 5F7DA 3L3IA 4GS7C 4OCRL 3G04A 1MI5E 2BDNL 4PRDB 3AREA 4KKCD 4LU5H 3HNSH 2EDTA 3I6KA 4JFOA 4QY8A 4HCRA 4LGRB 5I16A 5C0EB 4P23A 3F5WB 3DMMD 2QQLH 1TTUA 4PJIF 4ZUTB 3V52H 3AUVA 4OFYA 5C9JA 4R9HA 1DCLA 2AQ2A 3HAEA 4UOJA 2R2EA 4X4XB 2QADC 3SEPA 2IG2L 3DV4A 5AG9A 1IEHA 2FGWL 4OLYH 3SDXF 5I1CL 2RFXA 2P5WB 3FRPG 4BQBA 2GK0B 3RDTC 3CSPA 4GW4A 4MAYA 3T2QA 4PD4J 4AK1A 3PABB 4UAOC 5KVGL 1HSBA 3BFOA 2IQAB 4FNLL 1GPOH 5GGVH 1RMFL 4PJCA 3EYFB 4ELMF 4PG9A 3X3FL 5IHBA 1A3QA 4QHUA 1E4XL 4NKIH 4CUCA 1FORL 3GSWB 2YPLB 4MNGA 5GRVL 3SGKC 5JNYB 2NLJB 4F57L 3CFJB 2ZCLH 4HXAH 4JFDA 4JY4B 3JTTB 4D0DA 2ZPKH 1R5WA 5CJ5A 1O7SA 1YEIL 3WJLA 3QDJE 3BKJH 1BJMA 3I50H 3IDIB 4LQ1A 4DTGL 1VB9A 3RWCB 4CVXB 3MRLA 4C56D 4K94H 3CVIH 1T04B 1YEGL 4ELKB 3PQYE 1U8MB 5CEZD 4YK4C 3ME0A 3CCHB 4M9OA 1S5HB 2R4SH 1PAMA 2D7MA 1M1SA 4L3CB 1H3VA 1ZV5A 2V2WB 3GO1L 5E8DH 5C0RH 3KXFD 4P2QE 5E1AB 5FM5M 4O2FA 3VFNA 3O4OC 4QTHA 2NY2B 5HBBA 4PJ5E 2FO4B 2FZ3A 3LRSB 4GG8B 5HY9A 4K3JL 1H0DB 3GSRA 3C6LD 1RZIB 4OB5L 3BOVA 1PW3A 1H3PL 4NQDA 4WFFE 2J5LB 3U30B 2R8SH 2E6QA 3DMMB 2BZDA 5IK3B 1G6RB 4HIJB 2MCPH 1UG9A 4LAJH 4BH7B 1XF1A 4XVSH 5D6CA 3SE8L 4F80A 1JNLL 3WHE0 2VDKL 5KVMC 3KPPB 1XGTB 4OFPA 2N4IA 2W38A 4HZAA 4OBRA 4X5WB 2NLJA 3TT1L 1ZS8B 4D0BA 3LKPB 4C56A 1DQDL 2CKBL 3BH9B 2BSRB 1ACZA 3IXAA 4S1QH 4G7VL 5IHLB 2C7UB 4I3GA 5C6PB 3FAWA 1FL3A 3D18A 4LFHG 1GAFL 4NZTL 4KTDL 2HJLB 4PJHB 4MD0A 5I17B 5DUPL 1T04A 4XP1H 3W9DA 5JDJA 4XPHL 3RRQA 4LSUH 3BGAA 4PGCB 5GS2H 1SM3H 3RUGE 3QIWB 1EIBA 2B5IC 2C1OB 4OLUH 1I1AC 5GRJH 3TN0A 3WHE1 2I9TB 5BO1L 3G6AA 5DLML 4CN6A 4L3CA 3PL6D 3C5SB 4DW2H 1CLOH 5HHVL 4JZNB 2D0GA 2F5AL 2XACC 4Y4HD 5J11C 3ULVF 1MCHA 3DOSA 3I2CH 5I8KL 4NO5B 3WHXB 1QSEA 4RGOH 1A22B 2BNUB 4H25A 4X5XA 4KXZH 5JIHA 2CRZA 4JHWL 5T5FL 4JFFB 2NY0C 1BJ1H 3MBEA 5IVNA 1IGFL 2ZCHH 1MRFL 5D1XA 1A6WL 4DUVA 2KPNA 3UP1A 1KELH 4I18A 3TPKA 2GITB 5JUEH 4U6HB 3QA3B 2YS4A 2VXSL 4YGVB 1U3HA 4QGTA 2EIZB 4IBLT 4MVBD 4PPTA 5ACZB 3DPBA 1AXSA 3G6JB 3S9DB 2ZUWA 2B20A 2BVPA 3IETB 4HW6A 4JFOB 4QY8B 1SJVA 1CTNA 1RULL 5T3XD 2HN7B 1YMMB 1IZJA 5C0EA 4MMZC 1EGJA 4MXQD 5ACZA 5I1AA 4MXWH 4NN5B 4WFFD 3VA6A 1LHZA 2V7HB 4HUMB 1TZGL 3T4YB 5CCKH 1MREL 5HYJE 4GRLC 3ARDD 1JI1A 2AEPL 4HH8A 4NRZA 3RIAK 4FFZH 1ZSDA 4WTWA 3AMLA 1U0QA 2F54D 1CQYA 4PR5A 4U1GB 3V5HA 4G7VH 3M07A 3MLRL 1D6VL 4JHAL 4D3CL 1YY8A 1T6VN 2IWGA 4BA8A 3PQYD 3OZ9H 4WGWB 2D31B 2IMMA 3EBAA 5FB8B 3I84A 4OIIL 4Z77B 5ITBL 1FZOB 3WIFA 5I1DA 4KZEL 1MFDH 3ZKXB 2W59A 3SE8H 4LLDB 2Z93A 1WT5C 4POUB 1JN6B 2DM3A 3M17B 4JFPA 1FDLL 1A47A 5E56A 3EOBB 5BOZG 1NMBH 4EEEA 3PWUA 2E7MA 3MC0A 5ESAA 5K9OB 2D7OA 4S1RH 2J7LA 4WUUB 1FRGH 2EC9T 1BM3H 1JNJA 3JSSA 2J6EH 5EZLB 4BQ8A 3EOTH 5C6WH 1DBJL 3VI4F 1C5BL 4HCRH 1HI6B 3VXRB 5AZ2H 1MPAL 3WFCL 3L5WB 1G7PB 2YBRB 5HHNB 1KSRA 3BIAX 3FO9B 1I1RA 5KW9L 1TCRB 4HMCA 2B4CH 3N06B 3PE9A 1EMTL 3RWCA 2EEDA 3QEUB 3RL1A 1AY1H 2VXQL 3K3QA 2HT2D 3CIQA 3TJEH 5DJ6A 2NCMA 1DP0A 5HYIA 5FO7A 2X4NA 4W6WB 3DRTA 4KWUA 2CK0L 2A0LD 1N0XL 5C07B 1NMCB 5FHAL 3G6DH 3FT2A 4D2NA 2FZ3B 3LRSA 5BMFL 2P42B 3JXAA 1QQDA 5F1IA 3T0XA 7CGTA 4LLVA 3B9AA 3EJZC 5IOPB 4X4ZA 2WNGA 4JVWA 5EUOF 1BD2E 4LKCA 1XGRA 1B0RB 5DWUL 4P4KA 1YPZE 5E2WL 5DZNA 1KPVA 3GUTB 1BVKB 1EHXA 3MRLB 5GZNC 4Y2OA 3U7WH 4B41A 4OLZL 5MEND 1DJSA 2YK1H 5GRXG 1D5XB 1WIOA 5GRUH 3MLZL 3U0WH 4ZAKD 3IDYC 5GQBA 3BP6B 5JW5A 4H1LH 2JB6A 3EGSB 3C5ZB 1IGJB 4Q6IC 1NCCL 3MRGA 4LHUD 3L3KB 4OLZH 2RCSL 4QWWC 4X0KB 2DQGH 5HGDA 2AI0H 5EZLA 2VQ1A 4O2EA 4QRRA 3H42H 5L6YL 1INQA 4Z76B 1LE9A 1FZJA 2N56A 3RVXC 3F7PC 4YXHH 2W0KA 5C86A 4HHAB 4WIQA 1GVIA 3BGMA 4KJWD 2X6MA 1F4AA 3F12B 5H37G 4Q6IB 1WVZA 3BW9B 2ERJC 1QA9A 2BSSA 4LVHB 2B5IB 3ZO0A 4OCXL 2W0LA 1FYHB 4NQVB 3RTQA 4KRPC 1OGAD 4MA8L 2F9BT 4M3KB 3FMGL 5E9DA 4YHYB 1KLGA 1MCWM 1JTPA 1KIRA 3KPRD 2F19H 4QXGH 5C0AE 1E27B 4S0SD 2A74A 4F2MB 2ENSA 2FSEA 4JRXD 1ZWIA 1NH6A 1T5WA 4EI5B 2VOTA 4FP8L 2E7HA 1CVRA 3L3HB 1YEEL 1XT5A 4L4TB 5AYUH 5ENWB 1AO7E 4HX1A 5D96C 1NMBL 5B22A 1EGJH 2LVCA 1SY6A 3MROB 3U9PH 3QA3A 3BKMH 4DGVL 4PJEF 3RNQB 3V6ZB 3DGCR 3VXMA 4X4YB 2RQ8A 5H8DA 1QFUL 5F9JA 5I0ZA 5AUMA 1P4LA 3S36X 4LLAA 5BZWB 2FATL 1TJGL 2VE6B 3S4SB 5FO9A 1PEZA 4Y5YB 5ICZB 5KSBE 2UV3A 2EECA 1OSPH 2X4UB 2JB6B 2WINA 4JZNA 2GY5A 4MQXD 5DRWB 5J6HB 5IBTH 3BGMB 2B39A 5IUSA 4KROB 2XTLA 2FBJH 3MBEB 2XQBH 3DSNA 3CFDB 3BI9X 2IAND 1KIPA 3VXUE 5DD1H 3VMPA 2KKQA 1M71A 2AP2A 3TJHC 4JJ5A 3V0AC 3RNKB 5FO8B 1W72H 4U1MB 4PGBA 3V0WH 3MNWA 2ICWB 2BFVH 4H88L 4R96A 1G6RL 2OZ4L 5HYJB 2IAMD 2DWEA 5IW3A 5KVDL 2XRAH 5A40E 5I1JL 3MODL 5F9OL 2BVQA 3FOMA 5AYUL 4AM0B 5BVJB 2X4TA 2OBGA 1ZLWK 1BWWA 1SYSA 1JK8A 1WEJH 3KPRB 1IGTA 1YDPA 5ANMA 5DVOA 2AABH 4J23A 3O2DH 2AJ3A 3JVGC 5INDB 3D0LA 1MJUH 1QRND 2IAMC 3LD8B 4WNQB 1XF4A 3FO9A 4QTIH 5F72S 3SKUD 4XNXL 4AM0A 1WT5A 3B2UD 3QIBC 5E2UH 3GJEB 3WN5C 3BDYL 3QG7L 4FMKA 5HHXH 3JWOL 5BRZD 5KAQG 5K9OA 2Q7YB 4K9EH 5L88L 3ILPB 1QFWL 3QDGD 3EOBA 2OZ4A 3U7YH 1V8HA 1WFNA 4AQOA 4U1NB 4IHOB 2DICA 2YN3A 2G75B 3H3PL 3QUMA 1URLA 1AC6A 1V3MA 4AH2A 1I3GL 3WS6C 5DYOB 5MEPA 3U0PA 2AJVH 2CR6A 2ZKHH 3UTZA 3CFDA 1NCDL 1W0YT 3VXME 3VFSB 4KVCH 5C09E 5A2KH 4PRHD 3BKJL 1TCRA 3Q1SL 5MP6L 2NYYC 3P0VL 3U0PB 4PJEA 4LOUD 3PP4L 1UJ3C 3OV6A 5LVEA 1AC0A 2XTJC 1PDKA 1U3HD 4I3RH 2XT1B 4DGYH 1MVFA 1U2HA 3BRGC 2I9LA 5C6TL 4BH8A 1LP9F 4JCMA 1HYSD 1QQDB 4PJAE 1ZA3A 2OX5A 1DQMH 3ZDZE 4I0KA 1WEJL 5TFSH 1PG7X 2BNRD 1KJ2L 2VXUH 4JPIA 3CFEA 3BP7A 4GG6B 4X6BB 1T20A 1SYSB 3TO4A 1XMWA 2NY3D 5F7FA 3ET9F 4MD4B 5GRWA 3ULVL 3HE7B 4HUNB 1L4IA 5AAWA 3IAPA 4PY7A 4MNQD 4KK5D 1G7QA 4CVWA 3CLEL 4GSDL 5TE7H 2OK0L 3NIDE 2B1AH 1MEXL 2C3XA 5ETUA 5C08A 2J6EL 1Z3GH 3S5LB 3PHOB 4EIGB 3DXAB 4JZJA 3T3MF 4Z18A 1R3JB 3FN0H 3HUJE 1JRHH 5D5MA 5C0FB 3TBYB 2WWKO 1JBJA 3QDGA 3U9UB 4PJXA 4HS3A 3KNBB 5DF0A 1MSPA 1QKZL 3SO3C 4HWZB 1GZPB 3MV11 2X44D 4JQVC 1MAJA 3K1DA 4PJBF 5F7YC 2WAHA 4O2EB 1KG0A 4ERSL 4ZSOA 3PP3K 2YUXA 2R4RL 3QEQA 5K59E 3GMLA 4OLEA 1DBBL 4P57B 1SJEB 3RTQB 4CVZA 4Y4FA 3SHSA 3T77B 3TNMB 3W2DL 3PV6B 5HPMB 1J86A 1KJVA 1KIRB 5DJ8A 5GGTL 5GGQL 3RAJL 4M1GH 4NFBA 3QPQC 4PRHB 1DL7H 4QT5A 4L8DA 3H9HB 3QH3B 1I7UB 3MGTB 5EU3B 4ZUSA 4M62L 2DJSA 4XWOD 1N26A 5EDXA 5GGQH 1TENA 3MZGB 3P9MA 3VW3L 1ZS8A 3GSOA 1OB1A 4ZO8A 1NJ9A 2GJ6A 5C0IA 3C60A 5TE7L 1G0YR 4LPYA 3QNZA 4XNMA 3UPRB 1RIVL 1JPGA 4NPYA 1KULA 3VH8G 1WSST 3E8UL 2W60A 1C08A 2VO5A 3V6OC 1A1OA 4PJ9B 3WXWL 3STZA 3GBLA 4WU7A 5BQ7A 3KYMA 4Z0XB 1YQVH 2X4QB 3VWKA 5KG9A 4Q9QL 4F33A 4KV5E 4DK6A 5BJTB 1FZKA 5EH1A 5HYJA 1KIQA 4MHHI 3ARPA 4ZD3L 1VERA 5LGHH 1ZAGA 4EDXA 4LCCA 3G9VA 4WO4C 3QFJE 5CHNB 3NGBC 5E6IC 1P9MC 2Z93B 5EA0H 1FPTL 4BUGA 2VDOH 4JM2C 5GGRB 3VXTB 2FWOA 3JV4B 4NJAL 4KAQH 4KKLC 3WIIL 5C0DB 3IXTB 3OKMA 3VJ6B 1DVFA 3JVGA 2EKSA 3K1KC 4DZ8B 1WFOA 1BQLL 3IRPX 1XF2B 5DUBB 5BV7H 4YX2L 4NN7B 4N8CH 2GJ6E 4MJ2A 3WJJC 4AG4H 3CH1A 2X05A 2HT4C 3JBG7 1CIUA 3P11H 1OM3H 3O8XD 3RDTB 1HH9B 2W9DL 3KLHC 5I1EL 4M1DL 4HH9B 4NKOA 1NGQH 4I0PD 2DWEB 2IANB 4YDKH 4D94A 1CFQB 2DIBA 4P4KD 2ZG3A 1T03H 1JK8B 1IILE 4PJIB 1W72A 5DRZA 3ROLB 3RX5A 2QSCH 3QNXB 1TZIA 4HPYL 5DQJA 4DKAA 1OARH 4LLDA 4C83A 2XWBB 2YD4A 1JGLH 4RZCA 3VFMA 1YY9C 2A6JA 4M7LH 3ZKND 3MRHB 3DX7B 5AG8A 1JNHA 5K9JL 4K8RH 1U8IB 5C09D 3S96B 1OAQL 3GMRA 5F7WC 5GSVA 4HKXB 5FHBL 4RMWA 1R24A 4LPVA 1K8IB 5DURB 4R7NB 4IEFB 5TE6H 2B0SH 3ZKXC 4FS0A 4I4WB 2M26A 4C54A 3RY6C 1W72L 2NXYD 1RZKH 2P8LB 3ES6B 3UX9B 4QYOB 3V95A 3IDUA 4XNQA 3I02B 5D7JD 1MFDL 3DO7B 4P2OD 3QUYA 1NKRA 4K8RC 4NZJA 3V8CA 1JPFB 2OL3B 1FZOA 3BRFA 4PJDB 2MQCA 3DI2B 4Y5XA 4PRPE 3EYQD 2ZWLT 3B3IB 3OHXA 2LU3A 3OAUH 3HFML 3O45A 4MNQB 1OP5H 1U93B 5ELIA 3V4UH 4JY5L 2YXMA 2FX7L 4PRPA 1BX2A 1IARB 3NAAH 3BQUB 5GIRA 4Y5VB 4HGWB 1T89C 4NSKB 5LGJB 5B4MC 3KPLB 4OZIB 3BJ91 5C0NC 5D1ZA 3GJFK 3QFJD 1S7RA 4KU1A 4PGJA 5JW4N 5DK2B 3UC0H 4M6NL 1AKJD 4H20H 3QNXA 2X7LA 1D5BA 2EDFA 3IFLH 1FNAA 4JY6B 4NKIL 3O41B 3QWOB 1S7SB 4FTVA 3MBXH 4OCYL 1FZJB 1OTTC 3CSYB 1NUGA 5DC9B 1GOHA 4OZHF 3N50A 5KVFL 1HIML 4YQXL 1MJJA 2E9BA 5JUEL 4HUVA 1R24B 2QQKL 4KJYA 1SVCP 1UYWL 4IRJB 3OX8B 5DO2D 2GITA 1A21A 3MUGB 4HULB 4LNVA 3W0WD 2HP4A 4Y7MA 1R3KA 4XNYH 3WFDH 4L3EE 1YNTA 3KYKL 3PQYA 1FSKC 4Z8FH 3NABH 2CLVB 4UT9H 5BV7C 2M1KA 1V3KA 4HWBA 1F4YH 4PJ9D 4YK4B 5EU4B 1YJDH 1IGIH 1BFOA 3DTXB 1MRDL 2BJMH 2XI9A 5D2NE 1P6FA 3T0WA 2ZOKB 5EUKA 1NBVL 1CT8A 2VLRE 3HI6L 1D5MA 3QI9D 5DXWA 4EDWL 3M8OL 3LD8C 5C9KA 3TIDA 4JO2L 4QKXB 6CGTA 4GT7A 4UT7H 2XY2A 1YJDL 3WLBB 1CICD 3IDMB 4UNTA 2BY2A 1VDGA 5C0AB 3MLWH 4OM1H 3QPQD 2YC1A 4EDXB 1EFXA 1J1XH 1RZGA 4DTGH 4Z7VF 4L4VE 3OKMB 4NNYB 3RVTC 2BVTA 1P9MA 3E2HB 3GZKA 4I2XB 3FAXA 3NACH 2A6KB 2Z91B 4I3SH 4LAQL 2O5XL 2GSIB 5CJXA 3SJVD 4XZUB 2HJKA 2R29L 4OCMC 5FUCE 1IGCL 3TCLA 3KHOA 4XTRC 1QFHA 3BIKB 3WUZA 5I8OL 3DYOA 5TPWH 4GBXD 4K2UH 4DEPB 4F33B 3TFKD 3MBXL 4Y4HA 2CLVA 4WWKC 4K8RD 5LQBH 5CMAA 3CXHK 4M48H 1MWAB 4IRSB 1EEZB 2PTTA 4J6RL 3BSZH 1N8ZA 4JFED 5F3BB 1A5FH 3MLYH 3ZMRA 5ICXA 4JPVH 3I85A 4X9GA 5C0RL 4PLJC 4NCDA 3VJ6A 2R4SL 5KANI 3KYAA 2OTWA 5EZJA 3ARGB 4NNXA 5JOEA 3QIUA 1NCTA 4R26H 5FB8A 3NZ8B 1JTOA 3KXFA 5EO0B 1CF8L 5BS0A 3V52L 5DD3L 3MLUH 1NAKH 4QHLB 3LDBB 1SMAA 2MQ0A 4RRPA 2IC2A 1U8JA 4YEFA 4PRHE 4Z8FL 2QSVA 3ZYIA 3OXSA 1PQZA 3PUCA 1CICC 5FYJD 3PABA 4JJHA 5C08E 1OY3B 1AIFA 4F15C 5LBSL 5DJXA 1RK1B 4C57C 5IBLC 4P2RE 1I8KA 3SDXE 2DQIH 1QKZH 4JFDB 1MUJB 4X5LA 3FFCB 1ZANL 4HSQA 1MEXH 1CXIA 3GMOA 4KK8C 4O51B 1K4DA 3IU3A 1HOCA 2ORBL 5DGRA 4HUUA 4FQIL 4BZ1H 1JUFB 1IEBB 3MRKA 4EXPX 5CEYA 5FK9A 3QDGE 5L8KB 4MXVF 1D9KD 4N5EC 3G5VB 4U1LA 5BRZE 3O45B 3HZVB 3D39D 2H3NB 4XAWH 4R90L 5D1QB 3SDAC 1I3UA 3Q6FB 2F5BL 5B38A 5LQBL 5DHVA 3SCMC 4QXUL 3GJFH 4YHKL 3FN3A 5DO2C 4PJ8D 4FQJH 3WN5B 1QRNE 1PG7W 3HNVH 4DGYL 2PW2A 4L5FH 3T2OA 1OAXL 3UJIL 2PYEA 4G6AC 5LAXA 1FNSH 3S5LA 3BRDA 3UYRH 4MNGE 4GBXB 3GFUA 4YO0A 1J0ZA 4QRUB 4GS7B 1KJ2H 2VXUL 2DQEL 1WC7B 3TZVC 1VFBB 4QXTA 3VFGL 4RWYL 2C5DC 4OD1L 3U2SB 2BOCB 4HIJA 4LARH 3CK0H 4Y4KD 4BH8B 2VLKB 1DLHB 3UROR 3ARGA 1F02I 4NNXB 5HDQH 1N64H 4A6YA 5I1EH 3X3GH 1IQDB 3FOLB 3MRDA 5MEQB 3HNTL 4PB9L 2ITDB 2H2SD 1MRFH 5DJDB 5ID0B 2EYRA 2W65A 5T5FH 4XXCC 1GXEA 3CU1A 3MA9H 3OHXB 4MNQA 3D5OF 4KTYA 4PJEE 1MCNA 4PJCF 5FFLA 4NC2B 4RDQF 2ED7A 3BKML 4TSCH 1RVFH 3QO0A 1DBML 5F88A 3O3DA 3PWJA 4F7EA 4NQEE 4K8RL 4KUCF 1B4JL 2LAAA 1SY6H 4N1CA 2NY4D 3RGVA 4N8VA 2C7UA 1A7NH 3CNKA 4NWUL 4JRXB 4J3SA 3LKSA 3HG1B 4K7FB 1ETZB 3D25A 3BE1H 3TH4T 4X6CF 4MB4A 4MQ7A 4KDTC 2C1OA 1GZQA 4FQPA 5E24E 3MLXH 5JPMB 3S5LG 1MJJB 4DK3A 5D71L 1Z9SA 5AD0A 5CJBA 1QNZH 3BISA 4G9DB 4KVCL 5CGYC 2FCBA 5CD5D 4G3YL 1NAML 4NPYB 3LKSB 1BWMA 3PL6C 1A3RH 5FYLD 5IK3A 4XP5H 1NGQL 1ZHNA 5FYKL 1GRWA 4P9HH 3KLAA 3DRQA 4JRYD 4M7ZC 5TGBA 1KCSL 4MJID 3QUZA 5ABDE 3PG2A 3SE4C 4MB5A 4J1UA 4LSQH 5DA4A 2GSGA 4JRXE 2FJGA 4I2XA 3O6FB 4KRPB 4YHKH 3SDCB 2SEBB 4L8DB 3EZJB 5FGBA 4XP4L 1A3LL 2IFGA 5DTFB 1OGAE 3NMEA 1OF2B 1LE5A 4HWZA 2PR4L 5DVMA 2N7AA 4FTVD 5C1MB 2ZSWB 1T83C 2HFFA 3PWJB 4F7EB 2BVQB 4NQCD 3K8MA 4U6VH 4O4YH 3FO0H 1OQOA 1UXWB 2JIXD 4KJQC 5JPNB 3CK0L 5DMIH 3SDYH 1GZPA 2OMBA 5BRZA 1CGWA 5D8JH 2FBJL 4PB9H 3QHZL 4U6YB 5FYJL 2OP4H 4PJGF 3AVEA 4WUUD 4BSVA 2CR3A 1T0NB 5L7XH 5LG1A 1FP5A 4FZ8L 1N4XL 5DHYB 1YEFL 4XP6L 4QHUB