2BOCA

Potassium channel kcsa-fab complex in thallium with tetraethylarsonium (teas)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/transport protein
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
publication title Structural Basis of Tea Blockade in a Model Potassium Channel
pubmed doi rcsb
source organism Streptomyces lividans
total genus 41
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bocA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bocA02
3VWKB 5EUKB 5IIEA 2DMKA 4TNWF 4OLWL 4D8PB 3MQIA 4JPKL 4KY1L 4XC3H 5I18H 4RFNC 4JFFE 3GGWB 5IP4A 3EOTH 1Y6KR 4YHIB 5DFTA 4U2YA 3LKPA 1A9BB 1REIA 5SWSE 12E8L 2F15A 1KT2A 3VWKD 3WJLC 1CD1A 3QUYB 4KTEL 3BHBB 5EORL 1AI1L 3G5YA 3U36B 1OP5K 5CHNA 1N7MH 1NCBH 5LCVH 1JNHB 5JUEH 4N8VG 2ZUQB 5E94A 1ZT4A 1MVFA 4X6EA 2EDYA 5HGGS 4K7PH 5AAMA 3VH8B 4HAGA 3QI9B 1R3JB 4QHUA 2P8MB 4GQ9H 3EO1A 3V52H 1HH6A 8FABB 3S97C 3UPAA 3E6HB 3BKJH 2O5YH 3SGDH 3QQNA 3EOAA 4JFEB 2H1PL 4ORGA 4YDJA 1WUNT 3JWOH 3NOIA 4ZSOA 1DLFL 1DL7H 1I7TA 2VDQH 3QI9D 5HVHC 1ZGLA 1AD0B 4NZTH 3RKDC 5DQ9A 4YPGA 3MRLB 2D4DA 1HI6A 4X5XB 5I8KL 4HIHB 4QRRD 4LCYA 4HUVA 5F9WC 5ID1A 2V2WB 4JFED 2ATKA 43C9B 3U4AA 3WNOA 1KJ2L 2VXUH 2P5WB 4JJ5A 3OAZK 1G6RL 4U31A 1H5BC 1IM3B 3BSZH 2Z8SA 3UPCA 1IC4H 3FAXA 1KC5L 4HX1B 5F6HI 1KN4H 5DMGD 3BGMB 3QUMB 3I75B 1UKSA 1QNZH 1NBYA 1IAMA 1TJHH 4NN6B 1HXYA 4OIIL 1G7MA 5FUZL 4MJ5B 5EIIA 2WIIA 1RZFH 2P5WD 4XWGH 1VKXA 1ROWA 4KFZC 5FKPA 4JQXC 4C56A 3ZT5A 3G5ZB 1UXSA 3QB7C 2YRZA 3FO2A 2BSSA 3QZWG 4KQ4L 2NY3D 3PL6D 4PS4L 4RGOL 3RY4A 5MENB 4PJFA 4OZHA 4R96A 4LQFL 4Y1AE 1JFQL 5C6PB 4N8VA 2W0KA 5ESAB 1A21A 1PX4A 4JFHD 4KUZH 3RVTC 2H2SD 2VWEE 2VMFA 5I75B 2V6HA 5T1MA 4PYGA 5FYJU 5C2BH 1F3RB 4LSTL 4NJAL 5IGXH 3E2HB 4QOKA 3JWDH 3RVWD 4YQXL 5MEND 3NGBC 1U8PA 2XKNA 3PQYA 1AKJA 3B8SA 5D6CB 1Q72L 4U6TA 4N1EA 1AGEB 2YN5A 2BNRB 5IW1A 2CKBL 2LV4A 4GG6A 4F8QA 5I8EB 3ZKNC 5HVWA 3OPZL 4BZYA 4GLRI 1FH5L 1ZTXH 5E8NB 3MOBH 3BRDA 3MRMA 5DK2A 5LAXA 1S3KH 4QRQA 1MCQA 3BW9A 3OGCA 1I1CA 3RWIA 1X5GA 4D0CA 4L3CB 1SYVA 4HGWB 4XBGA 2DIBA 1IL1B 3H0TA 1HHHB 4JREB 5F1IB 4HJJH 5FCUL 2BNRD 1UWGH 2HLFC 3RL1A 2OR9H 5DJ2A 2CMRL 1AHWB 1U8KB 3L9RB 2V5TA 4JPVH 4EI6B 3LSOB 2FZ3B 4RIRB 5JPNA 3J8F7 3QQ3A 1ITCA 4Q97A 2OJEA 4Q9QL 2AV7A 4AQ1B 4BELD 2HA1A 5ISZE 1IAIH 3GMNB 5F1KC 1OD9A 3JUZA 4YAQA 3RWJB 4K9EH 3C09C 5KW9L 4UV4L 2BRQA 4I0CC 4DUWA 1OTTD 4Y5VC 1H3PL 1ZGLM 1OSPH 1TVHB 2X89D 4A6YA 1KEGL 3B83A 4X6DE 4XCFL 2OK0L 5JW5B 2P49B 1QSFB 1IEHA 3PIQB 5EDXA 4L9LB 3SKMB 1P4BL 5T3XE 1D5BB 1D9KC 2N56A 4I5BA 3KPLA 3TCLB 5MERB 4X4YA 2CR6A 5IB5A 2GTZA 3EYQC 4QF1A 3EOBA 3KPQA 3BPOB 2WSKA 1QSFD 1N8ZA 4BH7B 2DLFL 2DYPA 5HGBB 2H3NB 5B39B 4NHCH 5FO9A 1LK3H 5CD3A 1IGFH 2X1WL 1OB1B 4Y4HA 2P24A 1MCHA 4PRDB 5EO1A 5IG7A 2JB6B 2NXZB 5J6HB 1GZQA 2A83B 3MCKB 4Z7VA 4J7RA 1A6UL 1LO2L 1ND0B 1VENA 2Q3AA 5TF1L 3QWRA 5I1HL 1HEZB 1YEIH 4NFBA 4LNRB 5EFIB 2HYMA 1EGJL 2XIDA 3KJ6H 2IBZY 2OL3H 3VXUA 1EEUA 3EGSB 3VI4E 2NXZD 3MLYH 3PF2A 4UDTB 2R0ZH 5CILL 4K7FB 3KJ4C 4KTDL 3FL7A 4MQSB 4X4ME 4P5TB 1IZKA 3TBTA 1FZJA 4HWNA 3KWWA 5DJ8A 2GCYB 2WUCL 5EU7E 2I5YL 2P48B 3L3HB 3CK0H 1IBGH 1KB5A 3RWFA 3ZSTA 2F53B 2HFEB 4KK9D 2OSLA 3GMRA 1D5MA 3H42L 1OW0A 4M1CD 2ED9A 5I15L 4S1QH 3B8YA 1CBVL 1BLNB 2A77L 5CIPB 4WUUE 5I1JL 4P5TD 5KVFH 2J3SA 2DAVA 5ICXB 4YDLC 2BY1A 4NSKA 3VXOA 3OAUL 3X11A 4Q9RL 4EQ3A 1U8MB 3O0RL 3RPKA 5K9JL 5F9OL 1U93A 2CDEB 1HILB 3P30L 1UZ8A 2CLZA 3WFBH 1LGVA 4NOFA 5IBLD 1U8NA 2P7TA 4LEXH 4XWOC 3L7FA 2VZTA 1FNFA 1L6XA 2DQTH 3ZSSA 4XCNB 1VFMA 2E7HA 1EEQA 1NEUA 1M7DA 2PCPA 4GW5A 4PJXA 1UM5H 1QBLL 1MWAL 5DO2C 5IIEB 4YUEH 1XGRB 4N9OB 2APBA 2DQIL 4WEUD 1MNUH 2R39A 4W4OA 2K1MA 1N6QH 3RZWA 1EERB 1BQUA 4YO0A 5HVFB 4TUKH 2IJ0C 1J0HA 1MFDL 3DX9A 6FABL 4PJ9C 1X3DA 1DBMH 3QIUA 3K1KC 4MHHI 3ZKSD 5BO1H 5MEQA 2A9ML 3G5YB 2VXTL 4NO3A 1WWCA 3T1FA 4NRZA 5CHNB 5I17A 4XVSL 3BP7A 1YN7A 2EZ0D 1U0QA 4JRYB 5IEHA 5E94B 5E2TH 5GGUA 4NQVB 5BW7A 4FRWA 1UG9A 5F89A 1CFNA 3SO3C 2DM4A 5KSAA 1GYAA 3DVFA 4ZYKA 3BO8A 4HKZB 3MRRB 1DEEA 4I9WD 5J3HD 4JRYD 4NRYA 3C6LC 5HD8D 4U1HA 1IGTA 3F58H 4APQC 1X5KA 3U4BH 3DUUA 5INDB 3EOAB 4ORGB 5FO8A 5HGHB 4YDJB 4WGVB 2F58L 1KJ2A 4KMTH 2ID5A 1KCUH 1I7TB 4ZSOB 1HIML 1KCSL 1ZGLB 4HPOH 4X6CE 5DQ9B 1JUFB 1NCUA 3QXDA 1OF2B 3QXAA 1HI6B 5E95B 3WXWL 1FG9C 1RZ7L 3ALPA 4LCYB 5I1DA 4HUVB 1KULA 2E6JA 5ID1B 3WJLA 2D0HA 3BGFB 4EDWH 1JHLH 5BMFH 4FZEL 2HT3D 3QNXB 3P77B 4OZFA 5F72S 3FN9A 1H0DB 4WDIA 4X5WA 1J05B 1A3LL 4MJIE 1IGJA 3RL2A 1MIEL 3CH1A 5LGHH 5I76A 3DXAE 1JWSA 5GPRA 1QFHA 3W2DH 5C7XH 3LOWA 1HXYB 1G7MB 3BDXA 1ZANL 2B2XH 5EIIB 1P6AB 2WIIB 4RBPH 1CXHA 3GIZL 1VKXB 2EE6A 3IS1X 5FKPB 3BKML 4K2UH 1YY9C 2E27L 4ELMA 5I8OH 1DP0A 4FQHB 4C56B 4DOHE 1VERA 3S37X 1AO7A 4F37F 5ALCH 2EDHA 3UTPE 5E2VL 4OZHB 5EU6A 4R96B 4G6AC 2HTLC 4Y4FC 1F5WA 1ZLUH 2CKBA 1FC2D 3BAEH 5EUOE 3RNKA 4J3XA 4KTYA 5T1MB 1ZV5A 1UCTA 3JV6B 5AUMA 1LVEA 2CQVA 5I30H 3N1MC 3VD9A 3IDUA 4C56D 4YHKL 4QOKB 2RCSH 5KSBB 3FN0H 1CICC 1QRKA 4M8VA 2DL9A 3PQYB 1CFSA 1U8PB 2XKNB 1AKJB 1KIRA 1S78D 4ZQKB 1T89C 4W68A 3FQWA 3FQUA 1H5BA 3TF7C 4ZUUB 3DBXB 4GG6B 3O2WL 2Z93B 1CQKA 3U30C 2FL5A 2WLZA 1T1XA 3IFPA 2VN4A 3O3AA 4Q2ZB 4YHZL 4QOKD 3V4PH 5DK2B 1KELH 1S9XA 3IU3B 1MOEA 3PQYD 2FBJH 3OHXB 3EOYG 3RWIB 1AKJD 3QCUH 1SYVB 5DJXB 2J6EL 3CDYA 1P7QB 2X1QA 4JQXA 4HSQA 2FB4L 4U1LA 1ZSDA 5B38A 5M7QA 3GB7A 1GZPA 1BBDH 1YYLH 4HXBH 5DD1H 5DLML 3QQ3B 4GXVH 2W92A 5T5NG 5C0RH 3RI5K 2XWBA 1Z2KA 5KOVC 1MRCL 4F7MA 5FEBA 2FGZA 3GSWA 4IBLT 4JO4L 4YAQB 2Y25A 3DVNA 5CCKL 3HI5H 1BWMA 3X12A 2IPKA 3NCEB 3RHWF 5GZNC 3N9GH 4XHQA 3W9DA 3UYOD 1OQOA 3V79C 1KPVB 1VEMA 5GGRB 3F7PC 3F5WA 2J88H 3K8MA 2PNDA 4P57A 4OJFH 4X9BA 2YS4A 3SDXE 1GIGH 3U0WL 2VSDA 3OL2A 2NY0C 5ACMA 2HP4A 3WO3B 4JFQB 3MCLL 3UAJD 4QF1B 2AQ2A 2EC8A 3KPQB 2PETA 3CSGA 1AY1H 2WWKT 2DYPB 5DD6A 2YD6A 3LDBC 4QNPF 1EGJA 3SDAC 3ARDC 5CD3B 2VDMH 3F7YA 3R8BB 4LDLB 4Y4HB 2P24B 1K3ZA 3DGCR 3MJ8A 5EO1B 1YUHA 3RA7H 5IG7B 5C3TA 4KKNA 4BFEA 3BIKA 5E6ZA 5B8CC 4ALAL 1RZGB 5MEOB 1F02I 2AJUL 1MI5B 5JHLH 5GRZA 2DYPD 3GBMH 3HZYA 1JE6A 5KS9E 5D2NC 3VXUB 4Y5VA 4Y4HD 2V7NA 5FUCC 2EDQA 2OZ4L 5D2LE 1MCSA 1D5XA 2Z92A 1DQLL 1A7NL 4LU5L 1FZJB 3TBTB 2NXYD 3ARSA 2DM2A 3KWWB 4GUPA 1MI5D 3QWRD 4HXAL 1C5DB 1CL7L 1X5ZA 1YEKL 3RWFB 2CUHA 1D9KA 2OSLB 4I77H 4ISVA 1NBZA 2XQYK 4ODWA 3VXUD 4JFDB 4PJBB 1OGTA 4OI9A 4XPHL 5GS3A 1A1OA 1A7QH 5FYKE 1MUJB 3HC3H 3H8NA 1QRNB 3MGOB 3K8LA 3VXOB 4OZHF 1E0OB 3X11B 4XI5D 5GRJL 1MWAA 2DDQL 1DQML 4NQCA 2P8PB 1MEXL 1U93B 5DWUH 2CLZB 2A9NL 4D2NA 4JFDD 1KB9K 4I8DA 1U8NB 1HHKA 4QRSA 1G7QA 3L7FB 5KSBF 3L5IA 4CVUA 3ZTNL 1VPOH 3WFDH 3SBWC 4UUJB 2PCPB 4PJXB 3STLA 1S9KC 3U0PA 1RUKL 4OD3L 5A2JH 1NGYB 4MLSA 1QR1A 2IH1A 1H3TA 4GG6F 3T0EE 2X41A 1P5UA 1VGEL 3BPLC 3T09A 3HB3D 3GO1L 3QCVL 3QHFH 4YK4B 3D3VA 1PAMA 4ODBD 4YO0B 1L0QA 1H8OA 2AABL 4MB5A 4OCRH 3QNYB 2DS4A 4OUOA 2GEEA 3DX9B 2OQJA 3T8XB 4HWBH 1BZ7A 4OGXH 6CGTA 5FFLA 1DANU 1NAML 3WS6C 4NO3B 1U92A 5EC1A 2F19H 2VC2H 3BP7B 2R29H 4YHOL 1A47A 4U1IA 4NM4H 3LKQA 2WBJC 1YA5A 3LPFA 4QWWD 1C7SA 5GGUB 3JZ7A 4OM0L 2HG5B 1IQWH 5FDYA 5EPMB 1ZE3C 1DUZA 1PFCA 3QIUD 1CFNB 5KSAB 3HC4H 5CUSL 4PY8J 2QQQA 5GGSY 5TFSH 3BO8B 4ODVH 5CSBA 2P8LB 4P2RE 3KR3H 4YIQA 5AAWA 1DEEB 4ZOCA 3BD4A 1EA9C 2ADGA 4NRYB 1G9MC 3OJVC 1IGTB 4Z0BH 1A3RH 5J11B 4FXLA 4XPAH 3DUUB 5IVOA 5IW6A 4YH6A 5FO8B 2ZG1A 1KJ2B 4DW2H 4YHNA 1SM3H 2VITA 3VXTA 1G6RB 3O6MH 3A6BL 5KSAD 1ZLWH 4OUUA 4M4RA 2UVFA 3QXDB 1GPOL 5GJSL 5T3ZH 4ZD3H 5EULV 4P3CH 1T1WB 4KC3B 4Z78A 7FABL 3GSNB 3LQZA 5I1DB 5C0BE 2ZCHH 4PJ9A 4AENB 3WUZA 4BSWA 3FQTA 4V1DA 3LKNA 1WK0A 2OP4H 4GT7A 1LDPL 4XP1H 4OZFB 5JIPA 5ALBH 2VR9A 4KK5C 1CXEA 1XGYL 3F6IA 5JW4N 2FD6L 2E5EA 3RL2B 4K07A 4R2GC 3VGFA 4AYFA 5KSUA 1C5BL 5I76B 1CDUA 1JWSB 2FX9H 2B20A 1IGML 1O0VA 1NLBH 3CH8A 1OHQA 5LWYH 3K80A 4ELMB 1GGIL 4GRWB 3C6LA 5JHDA 1N26A 4DUXA 4APQA 5JNYA 3EDEA 3QDJB 2MHAA 5E7FA 4PJ8C 2AJXH 3FB5A 3IDMB 4P2QE 3DX6A 3OKOA 3O4LE 3MOAL 4MAUL 5GGTH 5HVHB 4X98B 5T1DH 4F7TB 3HG1A 4LSSL 3P9LB 2CKBB 3RNKB 3L3GA 4D9RE 5AUMB 3FQXA 3GSVA 4JZOB 1G9ML 3RX5A 2AGJL 2WMPA 1B2WH 4PJBF 5F9WB 3QDJD 4KKBC 1AO7D 5DJCA 1MCIA 4PBVC 5DGRA 1UM4L 5EU6D 1CFSB 4Z7OE 1RUPH 1P7KB 3KVQA 3TT1L 2J6EA 3FQWB 1B9ZA 3NFSH 3FQUB 3SE9H 1H5BB 5GISL 4HZLB 4JN1H 3RKDD 1AP2B 4ZFFA 1FNEA 4QTHA 3VMOA 2IQ9L 4HJ0C 4L8CA 1KCRL 1T1XB 3IFPB 3O3AB 1I1FA 1PVHA 3LN4B 1S9XB 5L2JA 1FORH 2FHCA 2DQUH 1JPFA 5FHAL 2EE3A 4A2MA 2AS5M 3TJEL 4HGMA 4PJXF 3S4SG 3SPVA 3VD3A 2EC9T 4U1LB 5T1LA 1ZSDB 5B38B 3GB7B 1JPSH 4DZBA 4WJ5A 5EWIH 4UMGA 1XGTB 3PGCA 1OT2A 5A3IC 4RNRB 1NPUA 5TDOA 2Q76A 1T03L 4Y4FA 5GS0H 4J23A 4NN7B 3TA3C 4J6RL 3QNZA 4OZIA 3ARQA 5LXGH 1KGCE 5F3HA 3UMTA 2XWBB 4OAWA 4WHYH 1MAKA 1NUDA 5K59F 5GRUH 3DVNB 4I3SL 4YX2L 1VA9A 3QBTB 3NCJL 4PLJC 1A6WL 3NN8A 1EEYA 5DA0B 4OF3A 4X4ZA 2AJYL 4XAWL 2IPKB 3I6LD 1CICA 4JO2H 1EX0A 3VFTA 5HGAA 1Q9KB 5D7KE 5FGBC 1T89A 3W9DB 5HI3C 2EYRA 5I1CL 3VFPA 2W9EH 4OTXH 5L6YL 3RVTD 2DLHA 5KANI 4P57B 4AG4H 3ILQC 1IFHH 4F58H 3ARWA 4WWKC 3RPIB 5H8DA 4CVZA 3WE6A 4TNWK 1PSKH 1JRHI 5L2KA 1NFIA 1XR9B 1B4RA 1RIVH 1NANH 1S7UA 1NBVH 1CXIA 1JTPA 4Y89A 3CFDA 5FA3A 3VJ6A 25C8H 5DD6B 5D5ME 1QHPA 3ZKND 2AEPH 5I74C 2PXYC 3L3KA 1FAKT 3F7YB 3F12A 2FJGA 3MJ8B 1YUHB 1ZLVH 2OZ4A 4ODXA 4ZUWA 3QEQE 4LLQB 4PJAE 1T21B 2J4WH 4IHOA 3V8CA 2Y07L 1PYWA 3VFNA 3BZ4B 1QFUL 1U91B 4UBDC 3BEWB 2GYSA 2HLFD 3HZYB 1M6OA 4Y7MA 4HFUH 3C09B 4JRXB 5CEYA 1MHCA 1Z9OA 3BVNA 3MRPB 2AK4E 2A1WH 4Y5VB 4U7KA 2V7NB 3QFJB 2FCBA 2MJWA 1EJ6A 1GGYA 4OQTL 1A6VH 1U42A 3LPGA 4XP6L 3GRWH 3RY5A 2XPGA 2Z92B 4KRMB 3DI2B 2BERA 1YECH 3WIFB 2CR3A 1BFOA 2MTPA 2D03H 4XCEB 1D9KB 1G6VK 3BMWA 4LKCB 2R0LH 1H3XA 4N0UA 5DXWA 1E4WL 4Z5RA 1OGTB 3QFJD 4ELMF 2Y4SA 4GRWF 3C08L 3NH7H 4I0PC 4KU1A 1XGQA 2ICWB 1A1OB 4PJ7E 3B2UC 1OPGL 2MPAL 3SDAA 4JHWL 3ARDA 3VRLE 5IJVA 4NKOB 2BSTA 3D9AH 3GMOA 1HINH 2LVEA 1D9KD 4NQCB 3WL9A 4QO1A 4TUOA 2IADB 5DJ6A 4F9LC 1JGLL 1I4FB 4V2BA 3LMJH 3ABZA 2LTQB 4GAJL 4HLJA 1HHKB 3EYQD 4H0GA 4QRSB 2B39A 1G7QB 3UJTH 3LKRB 4XNYL 3G04B 5A2LH 3RKPA 1KJ3H 3W9EB 3BRGC 3KPRB 4JKMA 2D7QA 2Y06H 3T4AA 5JR1L 3STLB 2YA0A 3WIHL 2ZOLB 5D2NA 1NAMA 3SEPA 4NQCD 1NCCH 4JY5H 3D3VB 4JR9H 3WO4C 4J2XA 5AYQA 5DUML 4NQEE 2MQ3A 3DIFA 1AGDB 2OQJB 1UEYA 4LARL 3SE8H 1BZ7B 3RRQA 4PB0L 3OB8A 1KENL 5F8RC 1OAXL 1U92B 5EC1B 1EDQA 4FOMA 1AQKL 1RK1B 1RJZA 4R8WL 4W4NA 4U1IB 3LKQB 1MIML 3D3VD 4YDLB 1BVKB 2HH0L 4PJEA 5DA4A 4W81A 2DLGA 4YE4H 4HQQL 2EDBA 2BNQA 2PTUA 5I1KH 1DUZB 2APFA 1YEGH 4U7SA 1VB9A 3C2SA 4S2SA 3EYSH 3DHMA 5HI5C 4YC2C 3A67L 4JDVA 4L5FH 1BOYA 5FF6A 4YIQB 1MAMH 1RIHL 3K3QA 4OBRA 2DWEA 2ZUWA 4PYHA 4HLZG 5IW6B 1BAFH 3SBWA 4FQJL 1FGNL 1FNSL 2V17L 4YHNB 4NJ9L 4KH2A 2DQHL 3VXTB 5CP7A 5LBSH 2HWZH 3NZ8B 4OUUB 5EBMA 5T3XH 5EOCH 3VFMA 1C12A 5FAAA 3MO1B 1X4ZA 4XWOD 1K3IA 4Q0XH 2NQCA 5I18L 2Z4QB 3LQZB 3RVUD 3VXQA 4I4WA 3AS1A 1KNOB 4PJ9B 4LLWA 3FQTB 3NPSB 1B6DA 4V1DB 5JA8B 1HQ4B 1OOAA 1R5IA 2HJKA 5DO2D 1LK2B 3WS6A 2W0FA 4ZS7H 2FX8H 5LGJB 4QHKI 1A5FH 5TE7H 1QVOA 4HEME 4Q9CA 3MROA 2WBJA 1IRAY 1ADQH 4TNVF 4P5KA 1Q0XH 2BSRA 3CDFA 1NCBL 5IOPA 2GQHA 2IH3A 3OQ3B 5LCVL 4PJ9D 5JUEL 4ZO6A 3FKUS 1NGQH 4V1DD 4GKZA 2FH8A 1TTFA 1ZT7B 4GW4B 5A1AA 2ERJC 1N64H 2YUWA 1OLZA 4HD9A 4GQ9L 15C8H 3T65A 5JHDB 5ACZA 5JNYB 3VDBA 1WBZA 1GGBH 1PG7H 4U0RC 3V52L 2EICA 4X83A 1NAKH 3FB5B 3IDXL 3LRSA 5DSCB 3FT4A 3OKOB 3BKJL 4JGMA 2NX5B 2O5YL 1I1RA 3JWDC 3CAFA 1MCEA 5FM8A 3UBXA 3L3GB 1BWWA 1DL7L 2IF7A 3CMGA 3LRHA 5E6YA 2VDQL 3C6LD 4LP4A 5JHDD 2ADJA 4APQD 4NZTL 4HJGA 3SE3C 3Q5TA 5DJ0A 2EH7H 1A0QH 3ARGC 5D6DA 1P1ZA 4HS3B 3S98A 3M45A 3ZDYE 4KGLA 3UZVB 3K46A 1FNEB 4QTHB 2VXUL 4L8CB 3VFVA 2X05A 5TE4L 1I1FB 1JGEA 4I3GA 5L2JB 1YNTA 1KN4L 4CUCA 4H26A 1QNZL 4R4FH 4CL7A 1JPFB 3OB0H 5FB8A 1TJHL 3MUHL 4TUJA 4DZ8B 2EYSA 3EW3B 3SPVB 5JLZA 4GKOA 4PR5B 2WQRA 2K7PA 1RZFL 5JO5A 4XWGL 4WJ5B 4PJ8A 1EVTC 1U8OB 3PGCB 5JXAH 4K9EC 5F71A 5FYLE 4PTUB 1I7ZA 5DRNA 2NNAB 5TDOB 2Q76B 4Y4FB 2FO4B 2AXFB 2GK0A 4G8GA 2BSED 5F3HB 4OAWB 3O9WA 5FUOH 3FO1A 5BV7B 2QQKH 4LHQB 1YY9D 2HKFH 5T1LD 4KUZL 3NN8B 1CFQA 5GQBA 5C2BL 2WK2A 5IGXL 3WEXB 4M6NH 5HGAB 4JPWH 4FFYH 4UDUA 2DJUA 3JWDL 2E7LC 4G6AD 2GUOB 2J2ZA 2HTLD 4Y4FD 1K5NA 2A74B 3U0TA 1EO8H 1L0YA 2YA1A 1IT9H 4P9HH 1VSCA 3U30B 2AVGA 3MA7A 3S96B 3WE6B 3U2SA 1YEEH 1N6VA 4MNGA 1CICD 5L2KB 4QRRE 4L8BA 1ZTXL 3D1MC 3MOBL 3ARBC 3T2QA 1S3KL 4JZNB 4WEMB 4Y4KC 1OCWH 1IAKA 3RFZC 2H32A 3MLPA 4MD0A 1HCVA 1FIGH 3L3KB 5D70H 1WQVT 3H3PL 4HJJL 1UWGL 3KYNA 2VE6B 4MXQC 2YWZA 4ODXB 4ZUWB 4E41A 4AMKH 4OQTA 4S1SH 5FK9B 5L2KD 3DX8A 4JPVL 3TA3A 4G7YH 2Q6WA 4LAJH 2EDNA 4U4BA 4JFYB 4NZRH 1M6OB 3GEWB 4ZFOL 4KWUA 3H9SA 5LGKA 4RQQA 1OAKH 5CIPH 5CEYB 3BVNB 2DKMA 1W72B 3ZKMC 1YEJH 4GFTB 4RMUA 4K9EL 4U3XA 4DEPB 5FGBA 3DYPA 1G7PB 1OSPL 1YDPA 1G7HA 5I1AA 2OMNA 1J87A 4JFHE 4JDZA 1XF4A 2EDLA 4WWKA 5K9KB 4JY4A 2NY0B 4Z5RB 2F9BT 2P4AB 2QSQA 3KXFA 5EOCJ 4FQ2H 4GMTH 3HUJA 2FHBA 4NGHH 1XGQB 5GZND 4G6ML 2EDOA 1ES0A 4XXDB 3U7YL 1RUQH 3NIGE 4JQVC 3LDBB 2BVYA 4OF0A 3SDAB 3ARDB 2VXQL 2PXYA 4QRUB 3WIHA 1U9KA 4MWFA 1E4KC 2BSTB 1FE8H 3GMOB 3CVHH 3WL9B 5DJ6B 2NY0D 4NHCL 3MUGA 3V5KA 1IGFL 5ECJE 1P6FA 4HS8H 5B8CB 1IGIH 1T66C 1Z9SA 3MNWB 3I84A 3GMLA 4LAQL 5F9DC 3SDAD 3T4AB 2DOCA 3ARDD 3C60B 2BNRE 5FV1L 1YEIL 2IANA 2DB8A 1KXTB 1NEZB 2P43B 3O6LH 3L3DA 1FLTX 4K55A 3KJ6L 3NCFB 2OL3L 3IRPX 4F8TA 4Y19B 2PO6C 3TFKC 3N06B 5D7JB 3MLYL 2R0ZL 4IIQC 4RWYH 2AQ1A 5D1XC 3MRGA 4KHXH 3P0GB 1J0JA 3GBNH 2KBGA 5E8EA 2X4PB 3CK0L 1IBGL 1RULH 4FXKA 2NY7H 4PBWD 5DVOA 2J1KA 4I0PA 5KJRH 3ZYJA 3NACL 4AEHH 3H7LA 3ZE2F 4HHAB 1RJZB 1JPGB 5MP6H 2BVOA 4M93C 4JLRA 3DRQA 4S1QL 4OFIA 4PV8B 5K9QG 1AR1C 5KVFL 5DTFA 4OLXH 3SOBH 1M4KA 2W60A 4LCWA 2YEZA 4S2SB 4E42A 1RU9H 4FN0A 4FQIH 4JDVB 5FF6B 3HNVH 3KPTA 4QXTA 4ZPTA 4KROB 1D5ZB 5JIIA 3L3IA 2B0SH 2DWEB 4PJ5A 2HN7A 4ZFGH 3DJ9A 3WFBL 4XNQB 2KQMA 4H0IA 4LEXL 4WTZG 4XP5H 1INDH 3GKWH 5E70A 3W0WA 4PJIA 3HZMB 5CGYC 2DQTL 3MRQA 5CP7B 3U9UA 1FPTH 3SY0B 5EBMB 3BPLB 3VFMB 4K7PX 2IPTH 4HCRL 4FTVE 4YUEL 4M43L 1I1YA 1R5WA 2ITDA 1F90H 3GMQA 2E9JA 1OAUH 4I4WB 5C08E 2PR4H 5IJKC 4WI9A 1MNUL 1NC4A 4LLWB 1N6QL 1LMKA 4TUKL 3IJHA 4LVNC 1R5IB 2HJKB 4P48A 1W2KT 4HK3N 4BQ8A 4Z95H 5FYJD 1L7TH 1DBML 1W0WA 5AWNH 3O3EB 5BO1L 3HE7B 3VFRA 4KK8C 1QVOB 1FQ9C 1OGAA 5IFJA 2XZQH 4L4VB 2GJ6A 4P5KB 2BSRB 4HH9A 3PNWA 3I50H 5HJ3B 2B8OT 2IH3B 3WMSA 1IKNC 5I1EL 1ZS8A 2Z35A 3C5JB 1EEZB 1UCBH 4OCNC 4OCYH 5E2TL 3RHWK 1WC7A 1T7XA 1GVIA 2VLKA 5C0IB 3S3JA 2BOCA 3IF1B 3BPCA 1M7IB 5DUPH 3HCVA 2WBJD 4L4VD 3QQ9C 2Y5EA 3KHQA 5KAQF 4R97C 3F58L 4XNXH 3U4BL 5JDSA 3CU1A 2ZSWA 5F7LB 3MV11 2UY7A 3F7QA 3UBXB 3OKDA 4KMTL 1KCUL 3EDKA 4LCUA 3U79A 2ADJB 4YHLH 3PJSA 4HPOL 5ANMB 2V9QA 4NP4L 2ZPKH 4HH8A 1G7IA 4PD4K 4KQ3H 3OKNB 5FYKH 4FQQA 4GSDH 1YMHB 3MGTB 4NHUA 4P2OA 2V2XA 1GAFH 1RSFA 4WTZA 5DQJA 2ESVA 4KJPC 1UGNA 5CGTA 4EDWL 2RAMA 1JHLL 4PJCA 3C6SA 2NW2A 3Q1SH 1HHGA 1VFAA 3FQRA 1CI5A 3E6FB 1JGEB 5HHOA 1YPZB 1YNTB 2BVQA 2QKIA 3L6FA 4H26B 3OXSB 3UTTB 1LD9A 3W2DL 5FB8B 5C7XL 2C3VA 2PN5A 4KK5D 5LG1A 2EYSB 1HK6A 2B2XL 4GS7B 3V0WH 3BPNC 4KKAC 5JO5B 1II4E 4R2GD 2NTFA 5DRXA 4K2UL 5I8OL 4N8CH 1I7ZB 3TH2T 4IDLA 4K71C 2GK0B 5ALCL 2HAZA 2FNBA 3WFHA 4G8GB 3ZHKA 1MFBH 3FO1B 4BFGA 1JF1A 2BHZA 4J4PC 2DICA 1JNJA 4LOUC 1MY5A 1UH4A 2ICEB 3BAEL 3SE3A 1C08B 2WWKO 1S9YA 4PJ8D 3WDJA 3ARGA 5I30L 4G8EA 2ZCLH 4UDUB 1JPTH 3HZVA 4M03A 4PGCA 2ED8A 2RCSL 4Z6AT 2GY5A 1K5NB 3FN0L 3U0TB 4DGYH 5J06A 4G8GD 2YD3A 1CLCA 1HNFA 4R3SB 4ZXBC 3HZKA 1MF2H 3MA7B 5CJXC 3U2SB 4KKBD 2VISA 1JGUL 4N0CC 3B4NA 3V4PL 3UO1H 5C2UB 1KELL 2G2RA 4OKVA 4QNPE 3ULUC 4RZCB 4ZSOE 3CC5A 1CDYA 1IAKB 2FBJL 4ZFOA 1N5YH 2H32B 2JK5A 4UINH 3O4OB 4HJ0D 5BS0A 3KYNB 4NO0A 4E41B 1LEIA 4K3GA 4NPYB 5DC9B 1BBDL 4YHPA 5DZLA 3DX8B 4XNMA 3BIAX 4F3FA 5DYOA 5DD1L 5BOZG 5I0DA 1PZUB 4PD4J 5ILTH 1JNNH 4GXVL 3H9SB 4RQQB 5C0RL 5IMMA 1G9EA 2VXVH 2MOVA 2APVA 1T7WA 4M48H 5A3ID 4E41D 3SJVA 2ADIB 3HI5L 3WSQH 2E7LA 1MHEA 4HKJA 2PW2A 3TA3D 2XFXA 1T83C 1T1YA 4PJDA 1G7HB 2CJUL 2VQ1A 3MUZ1 3N9GL 4JZJC 5J12C 5I1AB 5JORA 4RGMB 1XF4B 3FFCA 3H9SD 4PLJD 4WWKB 2GTWA 2J88L 4JY4B 1BX2B 2PKDA 4OJFL 2SEBA 3KXFB 3P4LA 4C56E 1GIGL 3HUJB 4J1UB 5DURD 1TCRB 3ORJA 1N0XH 3ARBA 4PJFE 5HI3D 3D39B 4Y4KA 2NYYC 2YRPA 3TLRA 3EO9H 5I74B 3V4UH 2PXYB 4MWFB 1AY1L 1WF5A 3ILQD 1KCLA 1EBAA 4HUMB 1X7QA 2WZPD 3RBSA 4TSCL 4WWKD 2DBJA 4MZ3A 3WS3B 2YPVH 1RY7B 4R0LC 3KXFD 2VDML 3V5KB 5IVNA 4QOKE 2OL3A 4HT1H 3RA7L 3CLEH 4WUKH 4XGZA 4D9QE 1GC1C 3VXRE 1YNKH 2RR3A 3ULUL 4B7LA 1U95A 2FJHA 3TJHC 3MMEA 1NSNH 3GMLB 3OKKA 2PXYD 5JHLL 1KPRA 3G08B 3FONB 4OM1H 4IJ3C 3PWUB 1VFOA 3DNKA 3TBYB 3QDGB 3MBEB 2VLJB 2GAZA 1OTUC 2OR7A 4UBDD 4PTTA 4WEBH 1YPZF 4HUNB 4LBEB 2IBZX 5E8EB 1A1NB 1I85C 3QPQC 3BP6A 3V7MA 5CJQL 3E3QC 3BWUC 4PRIE 1T5WA 1T20A 4I77L 4MHHG 2LAGB 2UZXB 3SDDB 3O3DA 1HZHH 4GXUN 4JQVA 3G6JB 3NCMA 5IK3B 1A7QL 1E4KA 1NDGA 2W60B 1QACA 4LCWB 4LLVA 3ZDXE 2YEZB 5EBWA 2DWDA 4LHUB 1UB6A 1BP3B 4QXTB 4ZPTB 4I0PD 1CFVH 4HCRA 3L3IB 5H35A 4PJ5B 2HN7B 1W0YT 3PABA 3MRJA 1U8IA 3I3EA 5K93A 3B2UD 4JEGB 1QEWA 4GAFB 4O00A 3W0WB 4PJIB 2DQEH 5HHXH 1VPOL 3WFDL 3WLBA 4YEFA 1ZVYA 3MRQB 4LCWD 3U9UB 4RGNE 4ESKA 4PRHB 3S6CA 2PO6A 1I1YB 5D96C 5IMKA 3WO4B 2QLVB 4PJ5D 2ITDB 3EYFB 1GC1L 3GMQB 1PX3A 4IIQA 5D1XA 3GK8H 2BDNH 3QHFL 3N50A 1NC4B 3M1BB 2VOTA 3IJHB 4OKDA 3W0WD 2NY1C 5I9QC 1PZ5A 3ARRA 3TBWA 4HWBL 4OGXL 2VLMD 2VTFA 4IOSD 3O11B 2NY6B 4LPUA 3EAKA 5L7XH 4Z7VE 2GJ6B 2F19L 2EDTA 2VC2L 4HH9B 2R29L 3P73A 1IKFH 3A6CH 3KPPB 1NBQA 4NM4L 5CEXB 5HYSG 1ZS8B 1NC4D 4KI1A 4OI8A 4CKVX 4IRSC 1EUUA 3OKLA 1WC7B 1ERNA 1IQWL 1QPXA 4NWTH 1XF2A 4DVRH 3QG7H 4G43A 3MUY1 1AH1A 4NQUA 3WFEH 4YR6A 2VKXA 2X42A 3HC4L 3L3JB 3HCVB 1U3ZA 3HC0A 1OGAD 4ODVL 3DRTA 5KVDL 3D25B 2GJ6D 3KR3L 3X14A 1WZMA 1EHNA 1T5XB 4LFHG 5FV2A 5HPMB 4HUXA 3QXTA 4QCIB 4ELKA 4Z0BL 1A3RL 4XPAL 1V3KA 1ZOXA 2XRAH 1QSEA 4AIZA 5ICZA 1U8HA 2E9IA 1RURH 2HT4C 5HI5D 4KZEH 1IMHC 4B5EA 4DW2L 1SM3L 2VLKD 3JTSA 2XQYG 4LCUB 1YQVH 3PWNA 2FX7L 3O6ML 2YUZA 1EXUA 3PJSB 1XGPA 5IJKA 3HUJF 1I7UA 4TVSa 4XXCC 1VACA 5T3ZL 4ZD3L 1G7IB 4F33A 1U8LA 4P3CL 4KI5E 3DGGA 3F65A 3MPCA 2P44B 3UZEA 2ZCHL 4NHUB 5HXMA 1N4XH 2V2XB 3MGAA 4OLYH 2OP4L 3HR5A 4U6VH 2D7PA 3C6SB 4XP1L 2NW2B 1V3LA 4M7ZB 1HHGB 3CJJA 5H94A 1IE5A 1VFAB 3FQRB 1JTOA 4WW2B 1NGZA 1IKNA 2Z91B 2C26A 2BVQB 4WV1C 2QKIB 3L6FB 2ATPA 2R2EA 3FOLA 1D7FA 5F7FA 1UQSA 2QADC 2FX9L 1LD9B 2ERJB 2ESVD 3H3KA 1U2CA 5GS0C 1CE6A 3IFNH 1NLBL 5BJTA 4HG4J 2NTFB 1PY9A 5HY9A 4CADA 4MQTB 5HHOD 1NGXA 1FFPA 3MJGX 1FFQA 5L8KB 3INUL 2AJXL 1W0VB 2CDFB 2XKSA 5K59E 5F7HA 2GT9A 2VUOA 1CVSC 5HYSA 1JF1B 2YPLA 4XNUH 5GGTL 4OGAC 5C6TH 5T1DL 1BOGA 4B53A 2X7LA 1QR4A 5CINH 1R3HA 5KZCB 3AU1A 5IVZA 3BXNA 2EEDA 5HHPA 1B2WL 4P23B 1RFDH 4ETYA 3AFLA 3KPMA 3G6JF 3MFFA 1AGCA 3ARXA 2DMBA 1RUPL 4F7EA 3MV8A 5M95B 3NFSL 2BOBA 4O2CB 5E9DE 2PTTA 3SE9L 4IMLB 5KZCD 3AAZA 4JN1L 3MOQA 3ARGD 1CK0H 2X4TA 4O5LH 5IB4A 3MV9A 5FGRA 4ZNEA 3CFJB 1T0MB 1BBJA 5DD3H 1FORL 2DQUL 3CC5B 1CDHA 4ZFOB 1C16B 2C4XA 3ISWA 2JK5B 3SE4C 4NO0B 1BPVA 2AKRA 1T80A 3T4YB 2YXMA 1LEIB 1JPSL 3OAYK 4CVWA 4YHPB 3NCCB 5EWIL 1CDBA 3E0GA 2I24N 5DYOB 1FZOB 2Y5TA 4OZGA 3L5XH 4DUVA 1QQDA 5GS0L 3CNKA 4J4PA 5HSFA 4QHMB 3WV0A 5LXGL 5IMMB 2CO6B 4HW6A 1PKQA 1DN2A 5BS0D 1A6ZA 2D4FA 3L5WB 5GRUL 1LEGA 4NO0D 2L7UA 3SJVB 3UTSA 1WFNA 3WD5H 4JVPA 1MHEB 5F1OB 4H1LG 3QT2A 2XFXB 4HUKB 3I6KA 3IETA 4JO2L 5LKNA 2VQ1B 1IC1A 5T5FH 4ZXBA 5JORB 2MQ0A 4BZ1H 1GOHA 2W9EL 1QKZH 3FFCB 4OTXL 1S7VB 4IRJC 4CU7A 1RVFL 4GRWE 4Z7UA 4LASH 4NO5A 1J1XH 1MCRA 1IFHL 4DK6A 4F58L 3DX7A 2E8YA 4G6FB 3SJVD 1AO7E 4WI3A 3ARBB 3H9ZA 4OT1H 3RQ3A 3BZFA 5EU6E 4YNYB 1PSKL 4Y4KB 4NCC2 3QFDB 3QUYC 4BQCA 1RHHB 3WKMH 1RIVL 2VDLH 3MZGB 2FJFA 4PLKC 1NBVL 4JFPB 2D7OA 3FFCD 2Z8WC 25C8L 2NCMA 4FP8H 5JOFA 5JW4Q 2AEPL 2PYEB 4S0SD 3CFCH 2ZUQC 1OM3H 4G6FD 3OKEA 4PREB 2IALA 4XGZB 1QYGH 1OQXA 2HJLB 3ARBD 2XNAA 4IRZH 2J4WL 5GZOC 4Y4KD 4TNVK 4JM4H 4ZNCD 3BQUB 3O45B 4KGJA 3P9MA 4E0RB 1KPRB 5D72H 3EBAA 4MXQD 1MFAH 1KJMA 3V0VB 2IG2H 1T83A 2EIZA 4WW2F 3MNZA 3L1OH 4M02A 1A6VL 2IFGA 4ENEC 4JZJA 3GRWL 2ZSVA 2ARJQ 4M7KH 1YECL 3EFDH 3ZKMD 4QRTA 3BP6B 4NQSB 1NFDE 4ZUVA 2QQNH 1CG9B 2D03L 1JYXA 1T5WB 1T20B 4ZPVA 3I6LE 2BCKA 2R0LL 5F1SA 3G6DH 1AQDA 1AD9B 5EO9B 1QTYT 3NH7L 3KPSA 1MJ7H 4GAGH 3B9KB 5FYLH 4NC2B 1UYWH 3VXMA 4PJGB 3QDMA 4H1LA 4U1JA 5CSGA 5A16A 4PJHE 4S10A 1FN4A 4R0LA 4N5EC 2DWDB 3ZKXC 1UB6B 4S1RH 1HINL 43CAA 1GOGA 1AFVH 3DUHA 2ICES 1GGCH 3MRJB 3AVEA 3G5VA 3MLRH 5C0DA 3UJTL 4KV5E 4M6MH 1KJ3L 4FFWC 3HE6B 3R1GH 4UT7H 1LO0H 4FG6C 4HWBA 2OTUA 2Y06L 5EOTB 4Z7NF 1G84A 1BD2E 4IDJH 5JQHC 5IMKB 1T66D 2EDEA 5F7UA 5F8QC 1NCCL 2UZIH 4JY5L 2B1AH 1NMAH 3TIDA 4JR9L 3TGXA 3HN3A 2P42B 3R06B 1I85A 1PEWA 4XX1G 3TBWB 3SE8L 3I85A 3DROA 4WRLA 4G9FE 3UYRL 5C0EB 3VD5A 4X4XA 4NT6A 2PO6D 4M93B 3TFKD 5I1LB 1EMTH 5IW3A 3ZE0F 3ZE1E 1R24B 3P73B 5D1XD 1QUNA 4GRLC 4OFVA 1BECA 3Q6GL 3ZL4H 1CLYH 3LIZH 1I7RA 3CSYA 4YE4L 5GHWH 1KFAL 1S9VA 4NYLB 1XF2B 2GJZA 1ZEAH 1YEGL 1EAJA 4YR6B 3EYSL 4I13B 3HC0B 4L5FL 3DRTB 3X14B 1MAML 3MXVH 5ITBH 4X9HA 4HUXB 2IEPA 2X4QA 1AR1D 4FMFA 4DFHA 1BAFL 4JREC 1QSEB 5CWSB 5ICZB 4LIQH 1FJ1A 2KQNA 3TH4T 4HUWB 3JTSB 1RJYA 1S7QB 4NNXA 4LLAA 3PWNB 5LBSL 2HWZL 5KN5A 5ITFA 1PG7W 5T3XL 1TITA 5EOCL 4MVBC 1I7UB 1A7PH 5GGSA 4OGZA 3FO9A 1U8LB 4Q0XL 2WBWB 4LVNB 3DGGB 5CGYD 1QSED 5C0CA 5HDQL 4NQCE 1KTRL 3V4VH 2ICWJ 3HR5B 4PRNA 4MSWB 5CJ8A 4HKBA 4ZS7L 2FX8L 1RK0A 5H94B 1A5FL 1Y18A 5TE7L 2JCCA 1LP9B 1NGZB 4WU5B 1QLFB 4UQ2A 5BV7H 3QO1A 1ADQL 2J8HA 1Q0XL 4IRSA 2ATPB 2R2EB 3FOLB 1OP3K 1CL7I 3V95A 1NGQL 4AT6A 5I1GH 1CE6B 5GGTA 4KK8D 3DVGA 5BJTB 2R0WH 3BDBA 1N64L 3IJSA 5DS8A 3KPOA 1KTLA 3D3VE 3W39A 4R97B 5HY9B 1GGBL 1PG7L 4RMRA 4YXHH 1MCOH 1NAKL 2WP3O 3GIVA 3I02A 5HYSB 1U41A 3TBSA 2YPLB 1NUNB 1S9WA 1BOGB 5JQ6H 5HHNB 2X7LB 1GGUA 4F57H 1SMAA 4XXCA 3AU1B 3QQ9D 5IVZB 3BXNB 2UYLA 5HHPB 3HI6H 4OFYA 4Z7WA 3VI3E 1F4WH 2EH7L 2M2DA 1A0QL 3KPMB 3MFFB 1AGCB 5EU5A 3HI1B 4F7EB 4PJGF 4XVUC 2YPLD 1WFOA 2BZDA 2BOBB 2WNGA 4WENB 5LQBH 4XPGH 4BQBA 5KANG 4WV1A 2X4TB 4M9OA 1FZMA 4KKLC 1BBJB 4WW1B 1UM6H 2QBWA 4KJPD 4DFIA 5I66B 5KVMC 5DZNA 3MV8D 5FOJA 4HF5H 3BPNB 3X13B 1DBBH 3EIFA 3P2TA 3VDCA 4QYOA 2AKRB 3KPNA 4PGDB 5IBLC 3NFNA 3BEVA 3K8KA 1N6UA 2WUBH 4K71B 1EV2E 2FH6A 3TPUA 5DI8A 3VMPA 5JXAL 3IU4L 3GKZA 2Y5TB 3S36H 3T3PF 5TE6H 3GUTA 5CP3H 1QQDB 4ONFH 1PKQB 3NFPA 4KKAD 3VCLB 1HDMA 3TN0A 3U7WH 5FUOL 2E9WA 2COQA 1A6ZB 2QQKL 1OAYH 1V7NH 3RZCC 5KOMC 3DYMA 2QHRH 2HKFL 3UTSB 2P5EA 4HC1L 5C6WH 3ULVE 2F54A 3NIDF 4WVRA 2HRLA 1JK8A 3I6KB 3IETB 4M6NL 1DSFH 3BUYA 1I9JH 4JPWL 4FFYL 4PP2A 4DJMA 4ZXBB 1JN6A 1X5FA 4J4PD 2BY3A 1RZIB 1FVDA 1EO8L 2UUDH 4LOUD 5DMKA 3Q5OA 3BRFA 2W91A 3LEYL 4G6KH 3BGAA 1IT9L 5BRZA 4P9HL 4Z7UB 3N85H 4NO5B 3OX8B 2FIKA 3VH8G 5C09B 3ELAT 3VGEA 3DHJA 1JZ7A 3DX7B 3UTSD 4U1GC 1YEEL 4UTBL 3KS0J 1L7IH 3BZFB 1SY6L 3DURA 5DHYA 2VDRH 5IBTH 1HHJA 4ZXBD 3DSNA 3SE4A 4MMXC 3HG1E 3PDDA 4EIZC 3QEHA 3QWOA 1OCWL 1GGTA 3IB4A 1FIGL 3QUKA 3L5HA 4IM8A 5D70L 1INEH 4N0CD 3MRFA 4N0FA 1FFRA 2CGRH 2IALB 1M05A 5J6GA 4ONHA 3MV7B 4AMKL 2XNAB 3ULUD 3GRWA 2BRRL 3QEGH 4G7YL 1FC1A 5HHQA 3QSKB 3C8HA 2BVTA 1YJDH 2A2QT 2MKLC 1BFSA 4JQIH 4NZRL 4PFEA 1AC0A 1KJMB 1OAKL 5GS1C 1YEJL 5CBAA 3BI9X 2EIZB 2IMMA 3T3MF 1LP9F 3MNZB 4BKLA 1G7JA 3MV7D 5HPOA 5EUKA 4JZJB 5J12B 4XRCA 2AJZB 1QZ1A 4LSPH 3LS4H 3NIFF 2XTJC 3MREB 4IRJA 4U0QB 3PHQB 2EDXA 2JIXB 3I2CH 4ZUVB 5IESH 3GGWA 2CK2A 2ZNWA 3QUXC 1K8DA 4ZPVB 1S7WB 2AK1H 1A9BA 4NQDB 4FQ2L 3N1QC 4GMTL 1EHXA 2YSSA 4IOIB 3QUYA 2RBLA 4ZO7A 4KXZH 4OV5B 4QHNA 4OZIE 1ZHKB 1RUQL 3QDMB 4U1JB 4YXKH 3DUSB 4Q6IC 1FN4B 4H5SA 2VAJA 4ETQA 3UBXI 1V3JA 1WVZA 1FE8L 1JNHA 2OXHA 4WFEE 5DHXB 1MREH 2Q7NA 2QQLH 4OCXH 1HWHB 2NYYD 3TWCH 3VH8A 4HS8L 1CIUA 3BZEB 3VXMD 4JPIB 1MHPH 1TZGH 3QDMD 4NJ9H 4JGUA 5E2JA 2ZUVA 8FABA 2OTUB 5I6XC 3P40A 4IJ3B 4E5XA 1A8JH 3TNNA 3TNMA 4HV8A 3O6LL 5TQ2H 1DE4A 5L2KE 4QXWA 2V9TA 4BM7A 3TJHD 4RDQF 1MELA 1XCTB 3IAGC 5ID0A 2HKHH 4JHAH 4RWYL 5GRXG 3GSQB 4KHXL 3HPLA 1BJ1H 2W9DH 1FO0H 1KTKE 3MRLA 2BFVH 5ADOL 2AV1B 3DROB 4NT6B 3AS3A 1RULL 2NY7L 4LPYA 1OTUD 5EZOH 4MDJB 3OGOE 43C9A 1FGVH 2J7LA 5C1MB 5MP6L 1SJHB 1LNUA 2XXCB 4LCCC 1FRGH 3QIWC 2DTMH 4WO4B 5F7KC 5C8JB 3QPQD 3DMMB 5ESQB 1IM3A 1S9VB 1J10A 1BHGA 4RAHA 4OLXL 3SOBL 1T22B 4ODTH 3R8QA 1WZ1L 5L88H 2I07A 4TVPE 1I8MA 1RU9L 4FQIL 3FO0H 3HNVL 3V8OA 3UJIH 2DBLH 2B0SL 3PHSA 5IM7A 3ZDZF 4ZFGL 2X4QB 1BF2A 5GRWA 4XP5L 2K3TA 3LEVL 4N9GA 1EH9A 4QXUH 3GKWL 3VA6A 2H9GB 3LHPH 3X3GH 4N0UE 5D96B 4NNXB 2VUYA 1FPTL 1FYTE 4LLDA 3MRIA 2FIRT 4TPRH 2GK2A 2IPTL 2EDWA 1QG3A 5GGSB 4LPXA 5T3ZD 5ESAA 1SVCP 4FFZL 1F90L 1OAUL 3ARPA 1MHHA 2EDDA 2IQAB 1B0WA 2NY5H 2PR4L 5I9QB 4JCLA 5C0AE 3O8XC 3Q0HA 1PG7X 3ZTJH 1RZKH 1E27B 4YFLF 1IC7H 4Z95L 3OJ2C 1XCQA 3TT3H 1L7TL 1Y18B 5AWNL 5C86A 5J13C 1ZLSL 1OTSC 2C3GA 2YC1B 4GRLA 4XPTH 1VGKB 4MJ4A 3QO1B 2XZQL 1H8NA 5J1TC 3RWHB 4LDEB 2QR0A 5GSVA 4IRSB 3I50L 4M7LH 2NY1D 2OTWB 1NC2A 5ENWA 5I8EA 5D2NE 5C0CD 4ZMAT 4OCYL 4D0BA 1DBAH 3DVGB 5SV3A 2VSCA 2CIKA 5E8NA 3IJSB 1KTLB 1OAZH 5DUPL 2J5LC 4L3CA 3MRNA 3VGAC 4K3DH 1IL1A 3BP5A 1HHHA 1N5AB 4N1HB 2R8SH 1J8HA 4IRSD 2MKWA 3NZHL 3GIVB 3I02B 4AEIH 1VDGA 2V5MA 3AC0A 3TBSB 1S9WB 3L9RA 4EI6A 1X4YA 2X89A 4RIRA 5IMLA 4M5YL 4XVJH 4JG1L 1J0KA 4Q6YA 1T6WA 4YHLL 2BJMH 4PJEE 4Z7WB 3EHBC 5C0NC 2ZPKL 4P3DA 2BNQE 2HT4D 2EDFA 4FHBD 4KQ3L 5EU5B 3RWJA 3BDYH 3W5MA 2YD1A 3LH2H 5FYKL 2RFXA 4GSDL 1C8PA 1IEBA 1Q0YH 1GAFL 3V7AG 3BJLA 3QH3A 1TVHA 1JGDA 3ILPB 2XXMB 1TJGH 4WV1B 1EFQA 1NCDH 3Q1SL 4TOYH 4RWHA 2QADB 3DV4A 4A6YH 1HH9B 1TDQA 4JFFB 5TDNA 3ULSA 3SKMA 5BOPA 1D5BA 4LSUH 5FYJE 2O5ZH 1OVZA 3MR9A 4BZ2H 2XG4A 4HC1A 3V0WL 3VGGA 5E08H 1C1EH 3U4EA 4BH7A 1HKFA 1IILE 2H3NA 4N8CL 2J12B 2QADD 2WWMC 2NY4B 3GUTB 2EE9A 5KVEL 4WTWA 3ZYZA 5GS0D 1OB1A 4F15C 4TQEL 3EZ8A 1HDMB 1MFBL 2A83A 2PTVA 3AUVA 2HVKA 5EIVA 4GQPH 4DKDC 1JWMA 1MCWW 3IJYA 4XPBH 5DQDH 1DQQA 3QYCA 1SY6A 3CSPA 5EFIA 3BESR 4PP2B 2ZCLL 4CN1A 1JPTL 3RAJH 4YZFF 4NC0B 1OWRM 4OGAD 1HXMB 4DGYL 5DMKB 3EGSA 4XB7A 4Z18A 4UDTA 3BX7C 4UIMB 2C1OA 2X4OA 1MF2L 4EJ1C 2MQCA 2X2YA 3MZTA 2GCYA 5DFVC 2F54D 1S8DA 1MCPH 1B0RB 1B88A 3DURB 1A7OL 5F7YC 5DHYB 2F53A 2HFEA 4Z0XB 3UO1L 4U1NA 1RZJC 4QY8A 3QEHB 3QWOB 1BMGA 4H25B 3KHOA 1BJ1J 1N5YL 4EZMA 5BRZD 2V9RA 5CIPA 4UINL 3QUKB 2XZAH 1YZZA 1M05B 4YFDB 5J6GB 1R3IH 1K9TA 3W5NA 4OQ1A 1U8MA 1OP9A 1Q94B 1DQTA 5HHQB 4KUCF 1YQ2A 4L29A 1HILA 5ILTL 1JNNL 3RZCA 1WIPA 1CDGA 1NGWA 1HWGB 4TN9A 5C0JB 4OLWH 2LVCA 3EO0A 3O81A 2VXVL 3TV3H 5CBAB 5CEZH 5I16B 4XCNA 4BKLB 1G7JB 1ZKAA 3FFDB 2I26N 3WSQL 4XRCB 2NLJA 4NQXA 1E6JH 4QGTA 4XMKH 4U49A 1P4IH 1XGRA 4M62L 4IRJB 4POYA 4RRPG 5IVXF 4CJ1A 5JA9A 1K8DB 5E2WH 4GW1A 2YSSB 1I75A 1BEYH 3DWTA 1RMFH 2Z8RA 1GXEA 3F8UB 1N0XL 4QHNB 1QFPA 4G8GE 2AXGA 5F7EH 2FRGP 4IRJD 5E4EC 9CGTA 2EEBA 4H5SB 1OARH 3EO9L 4QGYA 4JRYA 4ETQB 5K9QI 1QO3A 3MLSH 2YPVL 4NQVA 4PY7A 4CNIB 4OF8A 5HDLA 4HT1L 3P4NA 3QUYD 3CLEL 4WUKL 2ZUYA 4Z7WF 1RZJL 3A6OA 4PLKD 1YNKL 1F2QA 1A4JA 4HKZA 3MRRA 2VL5A 1NSNL 4JFZH 5GS1A 3VG0H 4E5XB 3VFSB 1I8KB 5INDA 4NNPH 4MNGE 3TNNB 3TNMB 4HV8B 4OM1L 1DE4B 1IQDB 5HGHA 5GZOD 4AY0A 1KACB 1Z3GH 4MXWH 4WEBL 5ID0B 1IM9B 2IGFL 3HPLB 4GO6B 2EEAA 1JUFA 3VDAA 3QUXA 1OF2A 1EJOH 4PRAB 4R7DB 3WNPA 32C2A 1ZA6A 3KYKH 1V5JA 3PWLB 4FS0A 4ENED 1LNUB 5HYJE 1J1OH 2L4OA 3QNXA 1HZHL 3P77A 4Q6IA 1H0DA 3B6SA 1FL5A 2ARJA 1ZA3A 2GHWB 3ZKXB 1J05A 2PF6A 1T0NB 4JN2A 3F6LA 3NAAH 3AMKA 1BIIA 5HDBE 2I07B 4WHTB 4MMZC 1I8MB 4UQ3A 3GSNL 3FB8A 1W8OA 4RRPA 1NCAH 1CFVL 5IM7B 3EYVB 5FA4A 2NW3A 4EXPX 4RAVA 3QJHB 3QG6B 2ZNXA 4N9GB 4N5ED 1MRFH 3D2UA 2DQEL 2WBKA 4FQHA 5HHXL 2GFBB 2VH5H 1O7SA 3REVA 4UT9L 4Z8FH 3KXFE 2CIIB 4LLDB 3JVGC 3MRIB 5T3XD 3VFWA 5D7IE 2LABA 4FFVC 1IZJA 4NN7C 1J8KA 4JFOB 1CGYA 5TQ0H 1MHHB 4YBLC 3GK8L 2BDNL 4FFWD 3PWVA 4MNHB 4XP4H 4AL8H 3JV6A 4FG6D 3SKJH 4RA0C 2JLLA 2YZ1A 1NUFA 4M6OH 4OLUH 4YDKH 5KSBA 1XCQB 5AD0A 1CLZH 3CFKA 3IFLH 4GRLB 4ZQKA 5L7XL 3NA4A 3QIWA 5JIHA 5GSVB 2QR0B 3T0XA 1SBSH 1IKFL 4ZUUA 1F4HA 1NC2B 3DBXA 3LQMA 5ENWB 2EECA 3UJJL 3S37L 2Z93A 1M1SA 2IANE 4D0BB 3CFEB 4Q2ZA 2CIKB 4NWTL 4DVRL 3QG7L 1JWUB 2O26U 1OT1A 3IU3A 3CDGB 3WFEL 3AS2A 1J1PH 3OHXA 4GRLD 4C55A 2GITB 5L0QC 2W07A 3MRNB 1UT9A 1EHLH 5DJXA 3BP5B 5MHSE 4BH8B 1LO5A 1J8HB 1P7QA 4K3JH 3NBNA 1NC2D 2GY7B 1H15A 5IT2H 5F7WC 1HHIA 2VZ1A 2XRAL 4K3HA 2OXGA 1RURL 1MQKH 1CTOA 4KZEL 3C8DA 5IMLB 4V2CB 1B4JH 1NH6A 1YQVL 3SN6N 3NABH 2VDOH 3SO5A 5JW4M 3I6GA 1PD6A 2DQJH 3BYYA 1J8HD 3OR7B 4P3DB 3T0AA 1JHKH 2P45B 5BVPH 4MJ6B 4WY7H 2RFXB 4LCWE 1IEBB 1N4XL 2QL1A 3S34H 3QH3B 3FN3A 3QJFA 2VQTA 1JGDB 4L9DA 4OLYL 4MVBD 4U6VL 1DR9A 1BIHA 1CGWA 1V8HA 1KPVA 4OCLC 5GGRA 4KK6C 1X4XA 3DV4B 3I3DA 5TDNB 3ULSB 3WN5B 3V2AR 4PJIE 2FGWH 1ORQB 5D8JH 5FXCH 3UX9B 5BQ7A 2F74B 3Q2CA 1TQBC 2VLME 3MR9B 3PG2A 1UVQA 4JFQA 3HLAB 4ODUA 3TIEB 5E5MB 5EBLB 4KDTC 5A2KH 4GMSH 4HIEA 3IFNL 3BZDA 3U4EB 3TVMC 2OMBA 3Q3GB 5IFHH 1LO2H 1QFWH 2D31B 4JGJA 2EXYC 4G42B 5HHVH 4X7TA 4MYWB 3CZJA 2E7BA 3TO2A 2HVKB 4F7PA 2LTQC 4XNUL 1JWMB 5IV2B 1OGAE 5HYIA 4KMLB 1RZGA 3IJYB 2GJ6E 5MEOA 5CINL 2CDGB 1MI5A 3GJFB 4DN3H 1DQQB 4KTDH 5AG8A 5IFAH 2CK0H 1RFDL 4H88L 2G5RA 2VLKE 5IKCA 1H8SA 2C1OB 2X4OB 4C54A 2XN9E 3MACH 2BNUA 1S8DB 1C5DA 2BK8A 4X0KA 3GMMB 1CK0L 4O5LL 1UWXH 1JV5B 4XVUD 3C2AL 4JM2B 4U1NB 4QY8B 4JFDA 3IKCA 5DD3L 5EN2B 3O6KL 4PJBA 1FIEA 1XR8A 1G0DA 1UZ6E 1IAOA 1MUJA 1F2XK 3MRDA 3V6ZB 1Z9MA 1QRNA 3BWAB 5IB3A 3MGOA 4KKLD 4ACPA 5EO0B 1CTNA 3K4ZA 5BVJB 4MJIB 4DN4H 3H9HB 2F53D 2P8PA 3DXAB 1U36A 1VCAA 4L29B 3L5XL 2ESVE 1QBLH 3RZCB 1NGWB 4PJCE 4X6FB 3EO0B 3H7BA 4RMSA 4O02H 1A7BA 3MYJB 3RVUC 4OZFG 5HHOE 3AROA 4O2FB 1WWWX 5F70A 4UUJA 3WD5L 2X5PA 1PEZA 4R26H 2NLJB 4NQXB 3VI4F 4U6XA 4EBQH 4OFDA 3FTGB 1NGYA 4P2QA 3RZCD 1A6TA 4UNUA 1BQLH 3CVHB 3MNVB 4KMQA 2R4SH 4U1GB 5EUOB 3QNYA 4LASL 4NDMB 1J1XL 4GW1B 3T8XA 3B2VL 3IAPA 4URTB 3NPSC 4OT1L 1MVUA 4HIJB 1A1MB 1DQDH 4P4RA 2AXGB 4L4TA 1UKTA 3IT8D 4YXLH 3ZKQD 3WKML 1VESA 1H9VA 2VDLL 1QO3B 3RDTC 3UTQA 4K23H 4FP8L 1A14H 4O9HH 4GOSA 1I8LC 4PY7B 3OR6A 3P0YL 2HG5A 5EPMA 3CFCL 3P4NB 1OM3L 3RGHA 1QYGL 1PQZA 4DCQB 4IRZL 4NZUH 1A4JB 4JM4L 2P8LA 2VL5B 1WITA 5GS1B 1DBJL 1SEBA 4X7CC 5D72L 1MFAL 1I9IH 1T2JA 3GHBH 3DO7B 4IMKC 4D0DA 4KRNA 1TZHA 2IG2L 1MCNA 5JW4R 7CGTA 2YRLA 1G6RA 2XTJB 3L1OL 1CVRA 2J8UA 1FVEA 3LY6A 2V5RA 4AH2A 5BS0E 3QUXB 1XF3B 3EFDL 3UTZA 1T1WA 32C2B 1ZA6B 3GSNA 3ZE0E 4G8IB 1UB5A 4EN3B 2QQNL 5FIEA 1ITBB 4AENA 4ZAKC 4M1DH 4XAKD 4G3YH 3QAZC 1A2YB 3G6DL 5B38G 5I19H 1F4AA 1INQB 4OIBA 4Q6IB 2XTJD 1MJ7L 1HYRC 1N3NA 3C9NA 4GAGL 3B6SB 5FYLL 1FL5B 2ARJB 3PXHA 1UYWL 1ZA3B 1MCWM 2EDKA 2FYYA 3KDMB 3S88H 1A22B 5EZLB 4JN2B 3QUXD 4C57C 1BIIB 4HUUA 3PV6A 4PY8I 4UQ3B 3FB8B 5DEFA 1JIBA 3TO4C 3SJVE 4S1RL 1RZ8A 3SDXB 4Z9KB 1AFVL 1OWWA 3ULVH 2EKJA 5FA4B 2E9BA 2NW3B 4PJDE 1ZHBA 5E2VH 4RAVB 1MJUH 1GGCL 3MRBB 5EZJB 2VKWA 4ONOA 3MLRL 5I6XB 3D2UB 5DMIH 5A2FA 4LVHC 3ZYIA 5LJYH 1E28B 1K4DA 2BVPB 4J3VA 3REVB 3R1GL 3QDJA 4UT7L 5D5MA 3L7EB 3GNMH 3BIBX 3IDMA 1CS6A 5DF0A 3VFWB 3CPLB 2H45A 3M07A 4X98A 4F7TA 2X4UA 4MA8H 3EZJB 4PJAA 3P9LA 3PWVB 2UZIL 2B1AL 5BV7C 1NMAL 1F58H 1T7YA 4JZOA 4JM2F 3D2UD 1JPST 4CU8A 1TNMA 2CH8A 4YPJA 4HWZA 3IRZA 1KIQB 5IEKB 1AGFB 5AD0B 5KS9B 1JTTA 3CFKB 2AK4A 4LCCB 1M71B 1P7KA 1U58A 1RPQA 2VLRA 3QIWB 1EMTL 1FFOB 2ZUXA 4HZLA 4CN4A 1R3KB 1AP2A 3AXLA 3W82A 1ONQA 3ZL4L 1CLYL 3LIZL 5GHWL 3LS5H 2R2HA 3PWPA 3LN4A 1ZEAL 1WBYA 1WZKA 5JOPD 5SWZA 3SGEH 1P9MC 4U6YB 4MD4B 2G9HA 3QIWD 1X5IA 1LO5B 3MXVL 3JBG7 3CXDH 3VRIA 5DD0H 1Z5LA 3ZO0A 2CLVA 2HVJB 1H15B 1HHIB 1KIPA 3MXWH 4JO4H 1XGTA 1NCWL 3JVGA 4LIQL 1QFOA 4RNRA 4CVXA 2YA2A 3P0VH 5EUOF 5ERWB 4Q9BA 5I73C 3I6GB 1A7PL 3O8XB 4UIKH 1P7QD 3U7AA 4HAFA 1JNLH 2G60H 5FYKD 4QHLA 4YFLI 3OG4B 3QJFB 5J13B 4PPTA 3FRUA 5GRYA 4OD1H 4DEPC 1Q9KA 2E6PA 1QPPA 4NQTA 4NWUH 2AEQH 4OCSH 3T0EB 4RBPK 3RWGA 3O8XD 5BV7L 5BQ7B 3TPKA 4NQEA 3RPIA 3AB0C 2AJ3B 1UVQB 4ODUB 5I1GL 5DJYB 1OTSD 5J1AA 1SBBA 1XR9A 2J5LB 4HIEB 3E8UL 2R0WL 4HIXH 3VGAB 1ZLUK 4X7TB 2R69H 3OMZA 1E4XL 4YXHL 1MCOL 2WM0A 3CX2A 4OV6F 1J86A 4LLQA 4WFFD 1T21A 3TO2B 4F7PB 4MA7H 4FNLH 3BZ4A 5JQ6L 3F7VB 2KH2B 4LCIH 3VGBA 1U91A 4JHZA 4F57L 3BEWA 4P2RB 1W8NA 5IBUB 1T3FB 4QKXB 3QULA 3CU7A 3HI6L 5CZKA 4JRXA 1Q9WB 2VDPH 3C60C 3MRPA 1F4WL 1UJ3C 2H2PC 1CL7H 3LD8C 5CBEA 3QFJA 3O3UN 1VEPA 3HA0A 5IKCB 4ZDHB 4TVPH 3EUUA 5LQBL 2BNUB 5D7JC 3ECBB 3EHBD 3WIFA 2AJVL 3SDXF 3T2OA 5C0ND 4X0KB 1JGVL 2E7MA 4XCEA 1G0XA 5GGQL 1WISA 3P3YA 4LKCA 1W72L 3MLTA 4NFDA 3PGDA 1UM6L 1KXQE 3IKCB 1N2RB 1AXIB 2DDQH 1DQMH 4KDTA 2ICWA 4HF5L 1XR8B 4NKQB 4MQ7B 2R4RL 1YJDC 1IAOB 1DBBL 3RP1A 1UXWB 3MRDB 3TVMA 5IB3B 4XHJC 2VQUA 2R1YA 1X9QA 4NKOA 2WUBL 3HPJA 1T04A 2R1WA 4F15B 4JFXB 4P99A 2IADA 3S36L 4PUBH 1CFTB 5TE6L 3WIIH 1I4FA 3VXPA 1D6EA 4KROC 1Z0MA 1NCNA 3H7BB 5BXFA 1UWEL 4LGRB 3LKRA 3G04A 1OAYL 1V7NL 1QRND 3PP4H 3WXVH 5KS9F 3W9EA 3KPRA 2WWMD 1GSMA 2AEIT 3RX8A 3KLAA 3QXWA 2ZOLA 3PDOB 2DLEA 4U6XB 4U1SB 4WI6A 3JV4A 4P2QB 1DSFL 1I9JL 2E6QA 4JAMA 5EC2A 1A6TB 1C5CH 4ZTPH 4Y8DC 2PYFB 4G6KL 3KLHC 4YHOH 4CMMB 1SEQH 3J7HA 3N85L 1AGDA 3RIFF 1UKQA 1CZ8L 2HFFB 1MVUB 4PRBA 1L7IL 4P4RB 4I2XE 4L4TB 1X44A 1HSAA 2VDRL 4P2QD 5IBTL 1TETH 5E5RB 2ZUUA 4N68A 4NRXB 4X7SH 3PDGA 1RK1A 3HE7C 2MCG1 4AQOA 3UTQB 1C7TA 5DFVD 1ZHNB 1BVKA 5M94B 1WBXA 3OR6B 2IPUK 4NUGH 1INEL 1JZ2A 1BZ9A 2CGRL 3H6JA 3PUCA 1PQZB 4L4TD 3MV8E 4NFCA 1N59A 3QEGL 2E8ZA 1SEBB 1YJDL 1NFKA 5C0FA 3CXHK 4JQIL 5DMJB 4EUPB 3IDNB 1B3JA 5DR5H 1MCFA 5GJSH 5EOQH 4MNQA 1MRDH 4D0DB 3MV9E 4NUJA 4ZNEE 1TZHB 4CMHB 3NCYS 2P47B 2J8UB 3NZ8A 1FVEB 3JTTA 3N1GC 4LSPL 4AH2B 3MO1A 3LS4L 5FYJH 4UU9A 5E00A 3UTZB 2Z4QA 3I2CL 1UB5B 5IESL 2Q8AL 5F6IC 1KNOA 2FD6H 3KAAA 3MJ9L 4J3OC 1HQ4A 3R0NA 3ALXA 1LK2A 2BC4A 2AK1L 4OZGE 5E4EB 1N3NB 3C9NB 4Y2OA 4DQOH 5LGJA 4JG0H 4W6YB 2FYYB 2Y9RT 4YXKL 1KGCD 2R56H 4HUUB 4LP5A 1I8LA 3PV6B 5DEFB 1RZ8B 5FDWA 3EFFA 1WCBA 2M1KA 1UC6A 1MREL 1FCCA 1ZVSA 4M7JH 2HMIC 2QQLL 1ZHBB 1ZT7A 4GW4A 5B22A 4OCXL 3TWCL 1P84K 2FR4B 3UTOA 1MHPL 1TZGL 4GS7C 2NY5C 1K4DB 4KJQC 5IHZB 2JJTC 2VDKH 4Z7UE 1ZVHA 5D5MB 1E6OH 5DSCA 4IMKA 1RZKC 2RQ8A 3K1DA 2NX5A 3BH9B 4NN5C 3LV3B 3ULUE 3QEQB 5TQ2L 3REWB 1WTGT 2X4UB 4PJAB 1H3GA 4X8JA 4RFEB 5B3JF 3WJJC 1JP5A 5GJTH 2HKHL 2YK1H 2D7NA 4JHAL 4UNVA 4HWZB 4XMLH 4Y5XB 2W9DL 1FO0L 1D6VH 5E1AA 2BFVL 1KCRH 2Q87A 3HS0B 2AK4B 4I0KA 1U58B 2VLRB 4HS3A 4AM0A 5HYQA 5EZOL 1KCKA 1S5HA 1FGVL 5TPWH 3AXLB 3IVKB 1FRGL 1KCVH 4HLZH 1ONQB 2DTML 4JKPH 1F45A 2UWEE 5EB9A 5T1KA 4UTAH 4OFPA 2R2HB 3PWPB 1KEMH 2XQBH 5D93B 1NMBL 1WIUA 1WBYB 1TXKA 4ODTL 1KYOK 3CXHJ 3HMWH 5SWZB 5L88L 2AK4D 1KLUB 4ODHL 3RU8H 3FO0L 2E7CA 2G9HB 2VLRD 3UJIL 1ZLWK 3VRIB 2DBLL 4DZ8A 1Z5LB 1DQJB 2CLVB 5KAQG 4PRPA 4PR5A 1CR9H 4PJ7B 3O4OC 1KIPB 4UILH 2YXFA 1U8OA 4QXUL 3PGFH 3LHPL 3PWPD 4I3SH 3TYFB 5IHBA 4PTUA 4CVXB 3X3GL 2NNAA 1A6WH 4J3WA 1KJVA 1RJLA 5SWZD 2FO4A 2AXFA 2APWA 1ED3B 3BE1H 5SX5H 4YBLB 3KPSE 3KG5A 5DVKA 4TPRL 1L4IA 4O4YH 1HYSC 1QLEH 3VXME 5IQ9B 3QDME 3B5TA 35C8L 4QHLB 2NY5L 3ZT7A 1ULVA 4DK3A 5EU4A 4BUGA 4Z7OF 3TP4A 1F6AB 1KLGB 1ZMYA 3WEXA 1RZKL 3FRUB 1IC7L 4KJYB 2GUOA 4FFVD 2AQ3A 2A74A 1VHPA 4RGNC 1V3MA 4XPTL 4Y16B 3RWGB 4RGMC 2VR4A 5D9SB 4M7LL 4BYHA 4NQEB 1P84J 3ES6A 3M8OH 3S96A 1BFVH 3D87B 4I48B 1CGSL 4CU6A 1WT5C 3VGDA 5J1AB 1DBAL 1JYVA 1P9MA 5L0QB 5FOBA 1FSKB 4JZNA 1QP1A 1NEZG 4L8SC 1OAZL 2YMXL 1MLBA 4KDWA 1JF6A 3CGTA 4JVWA 2A6KA 4LRIC 4K3DL 2R8SL 4BSJA 2C7UB 4X9GA 3O2VH 2J8UF 4NQED 2VE6A 5J89A 4DGVH 4AEIL 3MA9L 2LU7A 5FK9A 1ZXQA 4MDIA 3RUGA 4OQTH 4XVJL 2HRPH 3QULB 4JFYA 3WFCL 2BJML 3ZHDA 3WBDA 1W72A 5FKAB 3AY4C 5CBEB 2XA8H 3LH2L 1DCLA 3MTRA 3C5SA 3S36X 1ZHLB 4LF3B 4DKEH 1E4WH 3HAEB 2P1YA 1G7PA 3MBEC 4H20H 4JKKA 4LGPB 3QXVA 1KYOJ 1TJGL 4FTVA 1F42A 3CMOH 1NCDL 4U1MB 3HHRB 2W1NA 4JRXD 4TOYL 4WI5A 4DTGH 4YGVB 5K9KA 4A6YL 1TQBB 3MLTB 4AJ0A 3PGDB 4LSVH 4C83A 4KI5C 2HLAA 1U8QA 5IB2A 4LSUL 1JGLH 4XXDA 5D5MF 3SDDC 3TVMB 4GAJH 4BZ2L 2J8OA 4KK6D 1OP5H 2R1YB 4QRUA 5E08L 1C1EL 3HPJB 1T04B 2D7TH 2R1WB 2MCPH 3FOMA 5ICYA 4PJAF 5C0CE 4L1DA 3SGKC 5JR1H 3VXPB 1D6EB 3DOSA 5EZIH 5B8CA 4FQCH 5GS2H 1P2CB 5BXFB 3CSBA 5E5UB 2JCCE 3MNWA 3TVMD 5KG9B 3WNNA 3V9FA 2EXYD 3KLAB 5JDJA 4XPBL 3C60A 3FHAA 3VFUA 3STBA 1UJ3A 5DQDL 4HMDA 3JV4B 3IYLW 1NEZA 4JAMB 5FHBH 5EC2B 3RAJL 4Y19A 4XX1E 5D7JA 5B21A 1A3QA 4CW1A 4JO1L 1ZT1A 3KPRD 4LSQH 5HYEA 4XC1H 1L0XA 1MCPL 2X4PA 4PRBB 5E03A 1HSAB 1ZLVK 4BQ9A 1DUYB 4HHAA 4HBCH 1JPGA 4PJ7F 1WIOA 2EO9A 2NY6C 1MY7A 5CMAA 4XMPH 5F9JA 3VRLF 1RIHH 1WBXB 4PV8A 3OAZH 1R0AL 2HFTA 3P11L 2XZAL 1F8TH 3UBXG 4Z7WE 4HWEH 1BZ9B 1TFHA 1R3IL 4EVNB 3JWOC 1N59B 1D5ZA 2DQHH 5IWLC 5C0FB 3PHOB 5HDOA 5DRZB 1OD7A 4XNQA 3UPRA 4LPCA 1BJ8A 1I1AC 3MJ9A 4MNQB 3RBGA 4NUJB 3HZMA 3TV3L 1ZAGA 5CEZL 2VERN 1PY4A 4ZG1A 3G5XB 2DM7A 3TYGH 1IGYA 1TZIB 3SY0A 3X3FH 3JTTB 1E6JL 4XMKL 5HHME 5F3BA 1P4IL 4LKXB 4LEOA 4QRPA 1UH3A 4UU9B 5E00B 4XC3L 3EOTL 4MNQD 5GIRB 2LQRA 5J9PB 5F93C 5E2UH 5DHVH 5E2WL 1FL6A 2BC4B 5GXBB 4YFEA 2I9TA 3ZTJG 1X5YA 4HWUA 1BEYL 5FYLD 1RMFL 3O2DH 1J88A 3O3EA 3HE7A 3QDHA 3RDTB 4YBQC 5F7EL 4MXVF 4L4VA 4BJLA 4M7ZC 1N7ML 5F88B 1BQHB 1OARL 5HJ3A 4WW2C 5CZXC 3MLSL 5SX4H 2P5EE 2F54E 5FDWB 3EFFB 1WCBB 3C5JA 1EEZA 1A9EB 1ZVSB 3IDGA 3IDXH 4K7PL 3WCYA 3ARZA 4KPHH 4YLQT 1XF1A 1CU4H 4Q7DA 4QRRB 5C0IA 3L3OB 4ONGH 3IF1A 3RDTD 1M7IA 2JJWA 5BRZE 5HVGB 1FO0A 3LKOB 3U6RA 4JFZL 3VG0L 2L7JA 1HOCB 3EYOB 4M8QA 5D7LA 4NNPL 3U48A 3ME0A 4Z7QF 1YMMA 1KTDA 1ZK9A 3JWOL 4X8JB 4GXUM 2BHYA 2XA3A 1Z3GL 2ADFH 4MXWL 2DI9A 3CVIH 2APTA 5F97E 5ANMA 3BKCH 4OF6A 4ZTOH 2C4FU 2CLRA 5E1AB 4ZAKB 1EJOL 4JHBA 3QAZB 5TE4H 4ZS6C 3OKNA 4P23C 2NX5D 3ARVA 3CFBA 3KYKL 1YMHA 1AJ7H 4MA3A 3MGTA 4AM0B 5HYQB 5SWQA 1S5HB 2NY3B 2A6DA 3CLFH 3PL6B 1CQYA 2YD5A 1J1OL 4XNZC 5T1KB 5C07A 2D9QB 1SMOA 3VA2C 3BSZL 3TO4B 1IC4L 3E6FA 2ZG3A 3LN5A 1YPZA 4ZAKD 3NAAL 1P53A 4MAYC 4NM8H 3OXSA 3QRGH 3UTTA 4KZDH 1NCAL 3V6FA 1I3RA 4OFKA 4LVHB 5DD5H 4PRPB 3BD3A 2QSCH 4ZODA 2JJTA 5T1KD 4X7DC 2A6IB 3QO0B 1H3UA 3TO4D 3W11C 1MRFL 1ACYH 3GMPA 1LEKA 2VH5L 1KJVB 1RJLB 4KKCC 4Z8FL 1TVBA 2CPCA 2XWJA 2XACC 1CGXA 3WJJA 4WI7A 4MCYA 1EK3A 1VFBA 2F5BH 1FL3B 4PRPD 5TQ0L 3VXRA 2ICEA 2AI0H 4XP4L 4AL8L 1C08A 1BGXH 5EU4B 3EJJX 3U9PH 1CDCA 4LSRH 3SKJL 4M6OL 4AEEA 4OLUL 4YDKL 1FLRH 1QOKA 3ZDYF 4LSDA 1CLZL 4JRWA 1Z9LA 3IFLL 4I1NB 4R3SA 3WDHA 4KJWC 1FZKA 3AM8C 1SBSL 1DN0A 2UV3A 3ES6B 5CZVH 1UEMA 3GJFH 4R4NC 4LPWA 4ERSH 3H3PH 5DC0A 5FOBB 1CLOH 1K4CA 4JFEE 2X70A 3R4DA 4PRIA 4RZCA 4O2EB 5FM5O 3QA3B 4P49A 1J1PL 1MLBB 2ZUSA 1MCCA 2A6KB 2FATH 1EHLL 4K3JL 1HNGA 4HKXA 2YPKB 2OR9L 5IT2L 5J8OA 5EIQA 4CRPA 4NPYA 2EIDA 4K8RH 4P2CG 1MQKL 4MDIB 5I73B 1TNNA 3RUGB 4LQ1A 5B4MC 5DEGB 1B4JL 4NC1C 1J0IA 3MJ7B 4WI8A 1NL0H 3NABL 2P5WE 3BQUC 2VDOL 4XBPA 1S5IH 2DQJL 1IAIL 4IOFC 1JHKL 1QLRA 3QZWA 3HR6A 5BVPL 4GLRH 2ADIA 4WY7L 3QHZH 4PB9H 3C5SB 4EXKA 3S34L 2VL4A 3IS0X 3RIAF 3OB0K 1XT5A 4LHUG 5A43C 4FTVB 4G6MH 3U7YH 4YGAB 3AB0B 1BX2A 5C08B 2E3VA 4C83B 2VXQH 3LKSB 4G80A 2FGWL 4J1UA 5D8JL 3SKOA 1WT5A 2HLAB 1U8QB 5IB2B 1TCRA 3HFMH 5MENE 1FFNB 3D39A 2XICA 4GBXC 4L8SA 3OV6A 3B9KC 5DJZA 4GMSL 4FTVD 4LRIA 3FOMB 2IAMC 3QISA 5ICYB 5IFHL 1QFWL 3WS3A 4LAQH 3EJZC 5C08D 1LK3L 5HHVL 4JCMA 1XFPA 1DDHB 1TPXC 2GI7A 2DQGH 3B3IB 2JJUA 5D1QC 3MFGB 2R1XA 3VW3H 5E8DH 1U8JA 3VFUB 1UJ3B 4UOW1 3G08A 2O61A 1S7SB 3AY4A 4DN3L 3LD8B 3FONA 2EDJA 3HE6C 2VJXA 3MRHA 3GJFK 2CK0L 1CN4A 1YC7A 5IFAL 3PWUA 3TBYA 3D18A 3QDGA 3MBEA 2VLJA 4P46C 3NACH 4LBEA 4CW1B 4KVNH 1ZT1B 3GI8H 3MACL 4F37K 1FG2B 2XZCH 4JKLA 1BJMA 1J8HE 3MRCA 3C60D 3DO3A 3ZLQC 2H2PD 1A1NA 4EDXA 3MLVH 1WAAA 3K4DA 4GG8B 2YR3A 1K6QH 3NIGF 2A38A 3DETC 1AXSB 2X6MA 4Y19D 3SDDA 5CMAB 5F9JB 5D7JD 1NMCC 3D0LB 5T33H 3G6JA 5IK3A 3T1WA 4DWHA 5EA0H 3MBXH 3SGKA 5E99H 1HE7A 4F9LA 4LHUA 1X5LA 2HTKC 3V6OC 5TGBA 2FDBP 3LQAH 1NKRA 4AIXA 3ESVF 4DN4L 1RV6X 4HS6A 5EBGA 3UPRB 1QBAA 1VADA 4HCRH 4XHJD 4M43H 3H9YA 1QSFE 5TF0A 4I3RH 1MFCH 4O02L 4Y0GA 1IGYB 3S35H 1UM5L 2VZVA 4PRHA 4R26L 3LKPB 4KROD 4EBQL 5DVLA 4CDHA 5F3BB 4LEOB 1KT2B 4L8DA 4QRPB 1CD1B 1WSST 3EYFA 5DDHA 2RHEA 3TC9A 1BQLL 2OTPA 3M1BA 4OI7A 3VFGH 2R4SL 2QJDA 3JSSA 1FL6B 2HFGH 2OJZH 4M5ZH 4OCMC 5I1EH 2I9TB 1ZT4B 4X6EB 3ULVC 4YJZL 1DQDL 3O11A 3IGAA 4AZ8A 4QRPD 2D2OA 4YXLL 3KLHD 5F6HJ 4QHUB 3KPPA 5CEXA 3EO1B 5E9DA 4K23L 1A14L 4O9HL 1HH6B 3IDGB 3RUGF 2NR6C 2X40A 2AXHA 4G6JH 4EOWH 5IWLA 3HE7D 3L3JA 4DKFH 4NZUL 3D25A 1FO0B 2X4RA 1T5XA 5HPMA 1I1AA 3U6RB 1OAQH 4QCIA 2WANA 4PG2C 4M8QB 5D7LB 4XCYA 1UADC 4YPGB 4NP4H 1I9IL 5A2IH 1FNLA 3VGHA 1YMMB 4CJ0A 3GHBL 1KTDB 2F53E 3K81A 1L9MA 3FQNA 2ATKB 2X9YA 1F4XH 1HKLH 2CLRB 5F6IB 4JJ5B 2CUIA 3E1F1 5J7CC 3OBAA 4MS8C 1M7XA 3V7AE 3ARUA 3CFBB 5D7LD 5E7BA 4MA3B 2Z31C 1P7HL 2QHLA 4RA3A 5SWQB 4M1DL 1YMMD 4TYUA 4G3YL 4OLVH 1I3UA 2A6DB 2X9XA 4PIRF 1A64A 5BMFL 2YD4A 5I19L 1NBYB 3FT3A 1D5IH 5C07B 1L6ZA 4N5UA 4WW2A 4PBXA 2Z91A 3LCYA 2ICCA 3LN5B 3S88L 1WV7T 5LGHL 1CE1H 2QSVA