2BOCA

Potassium channel kcsa-fab complex in thallium with tetraethylarsonium (teas)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
publication title Structural Basis of Tea Blockade in a Model Potassium Channel
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Immune system/transport protein
total genus 41
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bocA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bocA02
5JUEL 1I9JL 5D1ZA 5FGCB 4MZ3A 5ISZD 4CVXB 3LY6A 4JDZA 5EB9A 2CLRB 1B0RA 5CWSA 4JG1H 4PJ7F 3BRDA 2JJSA 1G6VK 5DEGB 4B50A 4ZS6D 2HA1A 5AG8A 3V4PH 5F7YC 1CXFA 1FYHB 4X7TB 1IGTB 2VL5A 4KY1H 1I7TB 4KY1L 4R96B 3OKKB 4MCZA 2EXYC 1KGCE 5E8OA 2IANE 4D0CB 4U0QB 1XF2A 3V5DA 3C09C 4CAGA 3WIIH 4JB9H 3WIIL 4YHIA 5SWZE 3VXME 3X13A 1M7IA 4I4WA 5KSBF 5KAQG 3QUKA 5B22A 4OF8A 4JGMA 3MRIA 2EZ0C 2ATPB 4P2OD 3M45A 2CR3A 1M05A 4IMLB 4MNGE 5F1NA 4IJ3C 2WBWB 3QH3A 4Q58C 1EEUA 5I73B 1YNKH 1T0NA 1LE9B 5BS0D 2A38A 4Y2OA 1OAYH 1F13A 2KQNA 1OAYL 1KJVB 4XX1E 4NUGL 1MIEH 3VFWA 1JIBA 4HXAH 3O2DL 3FKUS 3IYLW 3UYOD 1DR9A 5I9QB 2EDLA 5JZ7D 1UXWA 3QIWA 1CLYH 4CADB 3N9GH 2HFGL 1VERA 1WZLA 4TQEL 1KG0B 1MVUB 1QHPA 1BWWA 5GRVK 5DC0A 2WP3T 2Z9TA 2VZVA 5FYJL 3PUCA 5DQJB 4OCRH 4D9LL 4OCRL 4NQED 1U3JA 2A6KA 2W9DH 2APWA 4L29A 3SDCA 3OSKA 2CK2A 5GS1A 1A4KB 1EZVX 4NN7C 4BELD 5FGCE 1BFTA 4L8DA 4LVNB 4ENED 3U48A 5KVDL 3IRPX 4IRSD 3GSXB 4HKZB 1PKOA 3HE6B 3VXRD 5AAWA 2AABL 1W0WB 4PJ9A 3EJJX 1ORSB 4GW4A 5J6GA 3BEWB 3RA7L 1ZHKA 5ITBH 3L3OB 5ITBL 5IMKA 4ZOEA 4MD0B 1K2DB 1FVEA 2V2TB 2DLFH 4PS4H 1YEKH 2ZZUT 5CP7A 1S8DB 4WWID 3WUWB 4F7EA 4YHMH 3WIFA 4YHML 5EIQA 3TIEB 3VH8A 1CDCA 4AK1A 2F74B 4X9IA 4U1SB 5DA4A 4Z77A 4GMTH 1F4HA 4GMTL 1OTTC 1QSFA 5T3ZL 3U0WH 1RK0A 5IW1A 1ADQL 1ZT1B 1GZQA 3O3AB 4RAHA 1HHIB 5HPMB 1XF3B 5ID0B 3X17A 5JHDA 2WWKT 5HI4C 1W72B 4JPKL 3IU3B 2ATKB 5C0EA 1WWAX 3U7YL 1G7HA 5FA4A 5C3LD 5F8QC 2YA2A 4WWKA 3VFUB 1YECH 1YECL 1TZHA 3L95B 4IOIA 2F19H 5GRUL 1S7SA 2F19L 2W65B 5A3ID 2YSSA 4R90H 4R90L 5I19H 2YXFA 5I19L 3RWGA 5I73C 3OKLA 5D1XB 2NNAA 5BV7C 4WTXA 1U91A 1IEBB 1J12A 1CVSC 1QVOB 1SQ2N 3C5ZD 3QA3B 4HV8B 5I9QC 2VLKD 3SGEI 2R2BA 3WBDA 3IDIA 4TUJB 3CAFA 1MUJB 4NO5B 1CVRA 4OKDA 3VFMB 2Z31D 2LE9A 4GW5B 2GSIB 2QQQA 2XPGB 2B1AL 4YEEA 4AG4L 5EU5A 4J3XA 1E28A 3IJSA 3DO3A 5FDWB 5C8JA 1N3NB 4X6CE 4PJEF 4OZ4B 5E5MB 5FB8B 4G42B 5IK3B 3MV9D 3UAJC 3MFFB 2K7QA 2YXMA 1AIFA 2W1NA 3EOBA 5L8KB 2BX5A 5DUBB 2B8OT 1ZA3B 4P9ML 3K81A 4Y5VA 4JFPA 3EFFA 4OCMC 2VDKH 3NPZB 2VDKL 4JN1H 4MDIA 4RFNB 4RRPA 3S96A 5EUKB 3RWHA 4JQVA 3IDJB 3TA3D 4CRPA 2DMKA 4MQSB 4XVTH 4XVTL 4MHHI 5JDSA 5TGBB 4OSUH 1FIEA 1SJVA 4AIZA 4OSUL 5C6TH 1BPVA 5C6TL 3NZHH 3NZHL 4FTVE 4QHUB 2LVEA 3WE6A 2GTWB 1S9VA 5IMLB 5I30H 2ENSA 5I30L 2D7OA 2EDYA 3TCLB 3GSNA 2H2SC 4C83A 1T04B 4X99B 1WZMA 4KAQH 5DMGD 2VOTA 4KAQL 1CE6A 2H32A 1WIPA 2VE6B 3KPQA 2C3VA 4N1EA 2DTMH 4LCCB 3JVGA 1T3FB 2PR4H 2Z93A 3O6KH 1KCRH 4ISVA 5JHLL 4XAKD 1KCRL 4C4KO 2I9TB 4UT9H 4XZUA 5J13C 4LSQL 1CBVH 3OXSA 1T1ZA 4XVUC 5IQ7L 3ET9F 3C2SA 5D70L 4LSRL 4DZBB 1DEEA 4I0PD 4CN1A 3QULB 1JZ5A 3VXUA 2B39A 1YNLH 4N8CL 5DHVB 2CRZA 5HHMB 1UJ3A 5F88A 3H9SA 3PJSA 1IGFH 3SO3B 2EO1A 3QFJB 3PWJA 4XCCH 3VG0L 4XCCL 4ORGB 4QLRA 4NKMA 5BZWA 1XGRA 4U1MA 2HFFA 5DSCA 4U3XA 5A2KH 3L1OL 3LS4H 3LS4L 5DRWB 5CD3A 3ARTA 5EPMA 3CFCH 3SDXA 2FATL 3UTTB 4FNLH 5JNYA 3X12B 3P11L 5C07B 5HVHB 5I76A 4G6MH 1MSPA 5A2JH 2B4CL 5B39A 2R29L 3T3PF 4HDIB 4PRDA 1OL0A 2EDQA 4OLYH 4OLYL 1TJIL 4OZFG 1F11B 4RNRA 3KYKH 3D69A 1GH7A 4I18B 3UJJH 3UJJL 1UQSB 1JK8A 3C8DA 1WBYB 3RTQA 4RMRA 4YE4H 2VNCA 2BVQA 1JNJA 1X6LA 4GQPH 3LN5A 4RWYL 3RL2A 1X4ZA 4IRJD 3O2WL 5CJ5A 3G5XB 4Y2DD 2OR7A 4I1NB 3TJEH 3TJEL 1N0LA 1G9NC 4P2CG 4NBXB 5EO1B 5D5ME 1OSZA 1I1FA 1BZ7B 3WXWH 3O8XD 1UADC 2JK5A 1GGBL 4K94H 4K94L 5DRZA 2C3HA 5BW7A 1OWRM 5I1HL 3LN4B 4DN3H 5C6WH 3TBSB 5IESL 1IFHH 5TH2B 3KPOB 2CKBA 3QFJE 5IB1A 3ARBC 1BEYH 1E4XI 3QNXB 4D0BB 1BEYL 4NIKB 1H3GA 3QEGL 4J4PD 4TUKH 3W0WD 1WLHA 2X42A 1U3HD 5JW4N 4BQ9A 4OLWL 3SO3C 5HJ3A 3SKUD 1X5KA 5HD8D 4ZD3H 4QOKB 2N7AA 4ZD3L 3PV7A 4UDUA 4Z18A 4DZ8A 4NWUH 4KRPB 3TYFA 4MA7H 3V0WH 1Z9MA 4TSAL 3UTTE 4YDJA 5DZOA 5C07E 1PY4A 4FG6C 5HYIA 4TN9A 1XZ0A 2FZ3B 1J0YA 1XGTA 1F4WH 3QUZB 1F4WL 2LTQC 4WO4B 4MMXC 2GTZA 4QRUA 3JWDC 3DSNA 3U79A 4U1JB 12E8H 2V2WA 12E8L 2E6PA 3PDOB 5HVHC 4XPTL 3TVMA 4WW1B 3OF6D 4DKEH 1CFSA 4DKEL 5F70A 1CGSH 5T3XD 5BJTB 3OXRB 1HXMB 1AXSA 3MRBB 5I66A 4OCXH 3IVKA 4OCXL 3MACH 1P7KB 1CDIA 1OQXA 1RUQH 2FBJL 3D87B 4LRNL 2DM3A 3FB5A 5GGVL 3RIFK 3U36B 3B5TA 4HJGB 4PP1D 4JFXB 3ZKNC 5KJRL 2F53D 4M8QB 2DQEH 1TFHA 1U8MA 4M4RA 1AR1C 1D3CA 2R23B 4TYUA 2FR4B 3L3IB 4EJ1C 4HW6A 2WAHA 3U30B 5CSGA 3IF1A 1FCGA 5BXFB 3S36X 2NTFB 3KYOB 5FYLE 3GMNA 4OD2A 2P8LA 3EFDH 3EFDL 5L2KD 2P5WA 5DJXA 2C7UA 5LGHH 3D18B 4OZFB 2EE6A 4JZJB 3DRTA 3FQRA 3SJVA 2IH1A 3FFCD 2AKRB 3O45A 1QSED 4QOKE 4PLOB 4UOW1 1MLBB 3RGVA 5I0ZA 3MBEB 4Z7WE 1FHGA 3IFNH 2YD8A 4URTB 3CC5A 1AFVH 1A7NH 3D48R 1AFVL 1A7NL 5EU3B 1CICA 5IEKA 4XXDB 4LSTH 3ZE2E 3QG7L 4LSTL 2X9YA 3WCYA 4W68A 4RDQF 5JW3L 5JO5B 3SY0B 1A7RL 5F97E 1B0WA 1Q9WB 3P0GB 4JQIL 2NX5D 4DFHA 2GUOA 4Q9CA 5GRJH 1KIPA 5GRJL 2FX9L 3QUZC 1NLBH 1NLBL 4MAYB 4WO4C 3RWJA 4NO2A 2EDDA 1F5WA 4GBXC 5KTEL 4M4PA 1YYLH 1YYLL 3VI4F 1YMHB 2ESVA 4Y5YB 3B2VL 1J0JA 2BMKB 3JXAA 4NM8H 5M94B 4NM8L 4PRNA 3VXSA 1DDHB 2ZCHL 5B8CB 4RGMC 3GZKA 2OTUA 1EFXD 1TTUA 1F45A 4DKDC 1ETZB 3KXFA 4XCNA 4EDWH 1GHFH 4NFCA 3BVNB 1CL7H 1CL7L 5DVMA 3SGKA 5DFWH 3L7FB 1TLKA 1IQWL 1HI6B 3PQYB 4OUUB 5B38A 1S7QB 3G04A 1XCTA 4I77H 4JPWH 1GZPA 1MCIA 4I77L 4JPWL 4ODSH 4D9RE 1OW0A 4Z78A 3GJFA 3HMWL 3GHEH 4KK8C 3GHEL 3QWOB 1H3WM 3VU2A 1T7VA 3NPSC 3U30C 1RURH 1RURL 3HI5L 5IFAH 4GXUM 5IFAL 1T7XA 3MGAA 1Y18B 4LFHD 4DVRL 3RPKA 1CT8A 3BPLC 5ICZA 1YEDB 2GJ6A 1J7VR 2ITCB 3DROB 1P5VA 3JTSA 4HEME 2PO6A 1JGVH 1RD6A 1S7UA 4JZJC 4S1DD 4TNWK 5MENB 4V1DD 3MLYL 3QIBA 3OZ9L 5I1KH 5I1KL 2WQRA 1B88A 3OR6A 2IFFH 1QLRB 2IFFL 3GMOB 5F1OB 4AEHL 1I85C 4FQQB 1LD9B 2I26N 2NW3A 4GLRI 3VWJC 4P4KD 3AVEA 2EC8A 3O3DA 5GJSL 5HHNB 5F93C 4MJ6B 5BRZA 4X6FB 3GDBA 2Y07H 2Y07L 3OR7B 3ROOB 4HK3J 5DD6B 1NAML 1ORQA 1R5IA 4XBGA 1IC4L 4DCQA 1YQVH 4K7FA 1YQVL 5IKCA 4BK4A 1U58B 2VXUL 2VC2L 5FYKH 1JNLH 1KXQE 3QEUB 4NHUB 1RZIA 2M1KA 4N0FA 4LQFH 1NMCB 1NDMB 1K8IB 4ZOBA 5HPOA 3DX6A 5I1LB 3DI2B 1HH9A 1XR9B 3QDJB 1G0YR 3QIUA 2DQHH 4HKJB 3PQYE 3C9NA 1FFQA 5A2IH 5BVJA 3ILPB 3T0WA 4QRSB 1A14H 3O4LD 4G80A 5EO0B 3WXVH 3WXVL 4MJID 1J05A 3ZZ1A 2BP3A 2HG5A 1KPRA 2X70B 1DLFL 1W0VA 3QXDB 4WDIA 2FO1A 3NCJH 2OL3H 4ZUTB 4MWFB 2OL3L 43C9A 4NSKA 4F7TB 4H20H 5C0CD 2IQAA 2G75A 4NQDD 2YHGA 5MENE 4PGCB 1DQQB 3MJ8B 5EOQL 5EC1B 1A6TA 2NY5C 4M1GH 1FAIH 1IM3B 1FAIL 2QBWA 3KR3H 5ACZA 5SWQB 1RVFL 3WFZA 2Z4QA 5IFJB 1NL0H 3PABB 1GGYA 1AHWB 1BX2B 2OQJB 1X4YA 4JJ5A 1NBZA 5I1AB 3D2UA 1QLEH 2HVKB 4MCYB 4ZNCD 2FNBA 2VDOL 5H35B 2VMFA 3MRJA 1XAUA 2WBJB 3AC0A 5JIHA 4NZTH 4G8GB 3DXAB 4NZTL 4LLVA 3QISA 4K8RL 2JKXA 3CUPB 4JFOB 2CXGA 4LRIC 1C08B 5AAMA 5M7QA 3PE9A 4K7PX 1ROWA 1U42A 3QDGA 1DVFD 4M7JH 5DJCA 3RUGA 3D5OF 4M7JL 1IAIL 3GSRA 2JE8A 4IIQA 1ZS8B 4PRHB 3DGGA 3QXWA 3TO4D 4WNQA 2IBZY 4PY7A 4JANA 3QDJE 1LMKA 4HUMB 4S1QH 3UXFA 3HR5B 4S1QL 3I6GB 5HXMA 4X5LA 4HIIA 1UZ8B 4JGJA 4G6JH 2HLFC 2BNRB 2CLVB 3PNWB 4HK0B 5CINL 3PGCA 1U8OB 5DGQA 1A3RH 3HR6A 2NY2B 1A3RL 4WCYH 1R3LA 4LEOA 1J8HA 3RWEB 3G5ZB 5AG9A 2F9BT 4HS3B 3RKDD 3MRGB 1S7RB 5D7KE 4JZOB 4D3CH 4GAGH 4G7YH 2VYRE 4KUZH 4NQSB 3H8NA 5CJQL 2DBLH 4X83A 3H3PL 5ESQB 2IMMA 4XPBH 4XPBL 3VFVB 2FEDD 3PIQB 1KCUH 1KCUL 2AEPH 3QUMH 2AEPL 3QUML 3TBTB 4DTGH 4DTGL 3V79C 5FO9A 4JR9H 3K2UH 4JR9L 2PCPA 1M71A 3D85A 1IEAB 2CRIA 3I3EA 3L5WB 1UVQB 1MQKL 4TNVK 4M6NH 1SYVA 2K9UA 4M6NL 4NC0B 4Y4HD 4YX2H 1A6UH 2VDPL 4G7VH 4YX2L 1A6UL 4G7VL 4JZNA 3RVWC 1D6VH 2WIIB 1LNUB 1AHWC 1D6VL 3W9EB 4G8GE 3DXAE 3LB6C 3RZCD 2ZSVB 2CDGB 3I75B 3KWWA 3QO0B 3BRFA 4DK6A 2WBJC 3QNYA 1FVDA 2BSTA 4PRHE 3ZE1F 4CN4A 4LLMB 4WWKC 4LMQI 4JFHE 1IL1A 4KKAC 2EDBA 4PGJA 1K8DA 4PJBB 1QD0A 5E5RB 1BAFH 4Y4FB 2YZ8A 3QI9A 3AFLA 4G9FD 2BNRE 4LVHC 1RY7B 3O6FA 4Z7VB 4IM8A 3IETB 5ERWA 5KSAD 2YBRB 1AP2A 3FT3A 4GRWB 2X4QB 1OGTA 3AMLA 2C5DC 3AU1A 5CMAB 2NY2C 3T4YA 1HH6B 4EN3B 1S7VB 4PRPB 3AROA 4HGKC 1QSFD 3BZDA 2AK4A 3NIDE 4NQVA 2GY7B 4APQA 5DF0A 4U0RB 5KSVB 4P49A 2WLZA 3MNZA 4BYHA 3X3GL 2EO9A 5K9OA 4WUUA 3IJYA 5C0BD 2VAJA 3O9WA 3QHZH 3QHZL 1AGBA 4CJ0A 3VFRB 1G7QA 1ITBB 2VLJA 3BHBA 4OBRA 5IB4B 3EYSH 5F3HA 2X89D 2IJ0C 3BZEB 3TGXA 3SHSA 3ARFB 2Y06L 3PWPD 3QWQB 4Y5VC 1F8TH 3DRQB 1E0OB 4LPTA 2YA1A 3WNNA 2FHBA 3R06A 3RVVC 3NFNA 4D2NA 5JTWA 3QHFL 3CZFA 3AXLA 4HH8A 1ZTXH 5AUMB 1RIHL 5ID1B 5CSZB 1CYGA 3P9LB 2DIBA 4O4YL 4LLDA 5D7JA 3ZE0E 4HKXA 7FABH 4XPFH 4XPFL 3CMOL 4UAOB 4PJBE 4OLVH 5FM5M 2A9NH 1BJ1J 3VFOB 1ED3A 1IAMA 4LL9A 2OM5A 1CFNA 1KXTB 3TBYA 1XT5A 4KDTA 3TWCL 4CJ1A 3BQUB 2BXZA 3U4EA 3NOIA 2PXYD 4JFFD 5CJBA 3F7YB 1RZJL 5CJXA 4NQCB 1OGAB 1AGEA 3RUGF 1F3DH 2Q86A 4Y4FC 3Q5OA 1ZSDA 3MROB 3BPOC 4DUWA 3S34L 3K46A 1WK0A 3RWDB 3SQBA 3HLAA 3UO1L 2DQIL 3TN0B 3BXNB 3T4AB 1ZT7A 3ARRA 4PGDB 3GM0A 1MF2H 3BH9A 1JPTH 3WDHA 1MF2L 4PRPE 5ANMA 3PWNA 3KYMB 5E99H 5E99L 2HFEB 3IDNA 2W07A 2BVOA 4OFPA 1FZJB 2X4RB 4GG6A 2LVCA 1XGQA 3N1PC 3VXNB 3X14A 3IDXL 3D3VA 4LF3B 4EN3C 1KTLB 3GMMB 4OZGE 1UWEL 3FB7A 3ARUA 3DVNB 3QQ4B 2R8SH 2HT4C 4XWOC 2ADFL 4PLJC 2OR9L 5IP4A 2ZUSA 3FCTA 3RHWF 1OPGH 1KB9J 3VD9A 3SGJA 1C16A 5F7EH 4ZAKA 3OMZA 4NWTH 4NWTL 4P2OB 5HYEA 2AJYH 5I6XB 3MRMA 5HYJD 3UBXI 5H2BA 2GSGA 3CH8A 1HHKA 2HTKD 2EYTA 1EZVY 3ULUE 3BDBA 5DD1L 1UG9A 2W0LA 2HT2C 3B9AA 4CW1B 3T1FB 4LLYB 3RTQC 4K3GA 3VXUD 1CXHA 4PJHA 4ZFOB 2BJML 1TMCB 2RBLA 3U4AA 4DVBB 4AT6A 3QG6A 4P2QD 4ZDHB 3ULUC 5C7XL 4GAJH 4GAJL 4HAFA 3OJDB 4R97B 4NQCE 1OGAE 3GMRB 1JN6A 4UAOC 2XXMB 3QCUL 5HDOA 2AJSH 4TRPH 3PL6A 4TRPL 5IBUG 3LKPB 4NQEB 4PREB 4NJAH 4UIKH 4NJAL 2GITB 2N1KA 4UIKL 3BYTA 1KJMB 3BQUC 4U1NA 2PW1B 5ISZE 4LIQH 4LIQL 1R3HB 4HS8H 1TVHA 1CFTB 3LZFH 4NKOA 4OIAA 5HI5D 3LZFL 4IRSB 3BDYL 3WFCL 1YN6A 1QBLH 1FQ9C 1QBLL 1RMFH 5GGUA 5E08H 5E08L 4I5BA 3OAYH 5E9DA 1JNNL 4MAUL 3U7AA 3HUJB 4UT6L 1KTKE 2DLHA 1I9IH 4HFWB 1I9IL 4DKFL 4X9FA 1D5XA 4N1CA 4RSVA 1JPGB 5J9PA 2H2PC 2DWEA 5F9AC 4NRZA 1T6WA 2PF6A 3MSPA 3DV6A 4H0GA 3DYOA 4XC3H 4XCEA 5IBLD 2FECI 1NBVH 3QAZC 2BOBA 3H9ZA 1NBVL 1BOGB 5JPMB 5AZ2H 3PWUA 5AZ2L 4ODXA 4WU7B 3RIAK 3NFSL 2CQVA 5BS0E 2PYEB 4P2OC 3F7PC 5I6XC 3FN9A 4X6BA 2FWOA 4UQ3B 1U92A 2YPKA 2ZUVA 3NIFE 2YN5A 4KQ4H 4KQ4L 2Z35A 2ITDB 3BESR 3LPWA 5K9JH 1FBIL 2H26B 4O2FA 3TZVD 1DLHA 2XKNA 3VXOB 4KPHH 1TQBB 2Y7QA 4NHCH 4NHCL 4HKBA 2A77H 1I8MA 2A77L 3C5ZB 4EOWH 2FBOJ 2VLRD 4JDVA 1WZKA 2E6QA 4NKDB 3PWLB 1NDGB 4NQEE 4ZTOH 4ZTOL 2VLKB 3WLBB 1YEFH 1R5WB 4XPAL 1SVCP 2E7LA 2IG2L 5KANI 2HWZH 2QQNL 1KACB 3P30H 4R97C 3P30L 1OP3H 1UH3A 3ZKSD 3DYMA 3MV7A 5T1MB 1ZANH 3OWEA 4U6TA 5GRXG 1WEJH 3QZWG 3SPVB 5I8CA 2Z31B 4KQ3L 4HZLA 4WI9A 4DN4H 3VXRE 4OGYL 2FGZA 4WEBL 2LU4A 3K80A 4KXZI 2FX7H 2FX7L 2IPKB 4NYLB 4PJDB 1JJUA 3AAZB 3S8WA 4K3JH 4TUOA 4D9QD 1UH2A 4F8QA 1G1CA 4GAFB 4ENEC 1LO3H 4GRMA 4KMTL 2IPTH 4PPTA 3HUJE 2IPTL 5C09A 5F9OL 3MV9B 9CGTA 3RGVC 1CXIA 3SKMA 2X4TA 5DMIH 4CU7A 5FYLH 2CKNA 1A5FL 2GK0A 2DQUL 4G9DB 4GG8B 1TTFA 3BE1L 1CICC 5T5FL 5CIPB 4GG6F 1SJHB 1B2WH 2B20A 1B2WL 2VUYA 3WV0A 1MJJA 3TA3B 4JEGB 5D2LA 5FYJD 2LAGB 5JORA 3CSGA 5IBUB 2I9LB 4NN5B 3SCMA 4CDGC 2ED9A 4UUJB 1QKZH 1OP5K 3KLDA 5F3BB 1QKZL 4WHCA 1YY8B 4HT1H 5LKNA 4OZIA 2VQ1A 4HT1L 1YPZF 5C0ND 5F21B 3QQ3B 1YN7A 4JQXC 2X4NA 1A4JA 2FYYB 3QUXA 2WP3O 1KPVB 4Z76B 1UB5B 4PJ5B 4YHOL 4H88H 1G7IB 3MRFB 4HMEA 3BP6A 4P23A 3SJVD 4XVSL 5D93B 4GRLD 2VLKE 4OLEA 3P0VH 4DAGH 3P0VL 2VIRA 1UM6H 4L8SB 5EZJB 4PJHF 3U83A 5IJVA 1WCQA 1TQBC 1U8LB 4I0PB 1T5XB 3U46A 3FO2B 4QYOB 3C5ZC 3EYUH 2YD6A 3EYUL 1JWUA 3SGKC 5T3ZD 2DD8L 2IADB 4YPGB 3KPSA 1T0MA 2PYFB 3W9DA 1S9YB 3MQIA 4PJDE 2FJHB 4Z7UB 2CUMA 1EGJA 5IQ9A 3KAAA 4Q6IA 5JW4R 4A6YH 3MV9E 3EIFA 4A6YL 1T83A 3ZT6A 5DRXB 3RWIA 1D6EB 3SDAA 2CO7B 3ESUF 2PO6C 2GK2A 3VWKA 3B5GA 2WLYA 3WFBH 3WFBL 1FNAA 4OFIA 1FRGL 2NY0D 3MO1A 4OZFH 2AXGB 3B3IB 2WWKO 5CEYA 4OBSA 4W70A 3UBXG 2XTLA 3QDHA 4TPRH 2GT9B 5E00A 4JPIB 3PV6B 3TP4A 1ES0B 1SYSB 3BPNC 3LKSB 2E8ZA 2QR0A 2ZWLT 1MCJA 4F7MA 3TO2B 4G8IA 1FVCA 1KLFA 4C59B 4ZXBA 3TA3C 5DXWA 4YEFA 2OJEA 3QZWB 4HWUA 4IRJB 5IHUH 4Y2DB 1N6QL 1MCQA 3LV3A 3BGMA 4X5WB 5TFSL 1DQMH 5T1LD 4XAKE 3FQUA 3QDMA 2HT3D 2VWEE 1A1MA 3O8XB 4UIMA 2R2HB 1A7QH 5DMGC 4ZPVA 4PJFA 1HIMH 1HIML 4Y1AD 4Y4KA 4PTUA 1FFPA 1MH5B 1TZIB 2Q8BL 3ZT7A 3O81A 3T3ME 3CFJB 5HY9A 1H8SA 1GPOH 5D93C 5E8DL 4MXWH 1GPOL 4MXWL 4RBPH 2XOTA 3LS5H 4L8SC 3LS5L 4YO0B 4R4FH 4Z7UE 4R4FL 4I0PC 4LU5H 3MRPA 3T2QA 5JOFB 4LU5L 1G6RA 3W0WB 1KNOB 2HRPL 4JY6B 4L8BA 3LRHA 2A0LD 1DQTA 2A83B 4RZCB 4HC1H 5IMOB 5ILTH 4LMQE 5ABDE 3TNNB 5EU4A 5ELIA 4XMPH 4OQ1A 4PUBL 4E0RB 2AEIT 5I1GH 3C8KB 5I1GL 3HMXL 3T2PA 3RWCA 1BBDL 1T21B 2ZP0T 2YRPA 3L5XL 1OARL 4KI5F 2X1PA 3UP1A 1CDBA 1JHLH 2SEBA 4H5SA 1O7VA 4PY8J 1BBJA 3FFDA 4QHLA 2DI9A 1PKQB 1NUDA 3BH8B 3BJ91 4LFHG 5JDJA 1GSMA 4QRQA 3SOBH 3SOBL 3CFBB 1AY1H 3ZMRA 1AY1L 5IIEB 4HD9A 3LKRB 4JPVH 5D2LF 5A16A 4JPVL 1DBMH 4PY8I 3SGDH 2Y25A 3C60A 1P6FA 3EOTH 3EOTL 2P5ED 1NAKL 1IRAY 1MI5A 4P5TD 1FYTA 1WF5A 1CK0H 4MA1B 3FONB 4H1LG 4IRJC 1H5BB 4Y2DC 1KB5A 3L5JA 2F53B 4YXKH 4YXKL 4OZIF 2VLMD 4OCSH 5KANG 1KSRA 4UOW0 3DO7A 2EIEA 3B9KA 3Q3GB 4GKZA 2MPAH 2MPAL 4MXVF 1MWAB 4AMKH 5JA8B 4AMKL 1JZ7A 1P9MA 5DVNA 5F96L 2FJFB 3UBXB 3MLWH 3MLWL 4YBLB 3W0WE 2XI9A 1JVKA 4WW2A 2HJKA 5A2LH 1CTNA 4P3DB 3FFCB 4QXTB 4JFDA 1ONQB 1QSEB 5IVXA 1ZHLA 2XWJA 4XGZB 3ZDXF 1A6WH 5F7NC 1A6WL 5C0IB 4J4PC 3KNBA 2R0LL 3V8OA 1U3HC 4PRBA 4L4TA 4XB7A 3QXTA 1LO2H 1N26A 5HD8C 3VXPB 5EU6A 1GGUA 2FEEI 3KLAA 3QEHA 1JTTA 5DJ2A 1YYMH 2R2EA 4Y16B 4EDXB 1FDLH 4ELMA 5C0JB 1FDLL 3DVGA 1PKQE 3TH4T 5E4IA 1D5MB 3TYGL 1HHHB 1H3UA 5T3XE 1JF1B 1YZZA 3HZVB 3LKNA 3UTPD 3UYRH 3MRDB 3ESVF 3DHMA 2X7LB 43CAA 2DI8A 4PJ7B 3WEXA 1OLZA 4J1UB 3EKCA 2F53E 3MGTA 1EFXB 3D0VA 3I84A 1N0XL 5C0GA 3MUGB 4XNZC 3G6AB 4GH7B 1R24A 32C2B 3MRNA 3LMJH 3GM8A 4MA1C 3FJTA 3LMJL 4PJCB 3CSBA 2F8XC 1D5ZA 3TBVA 1VACB 5TPWH 5TPWL 5IV2B 5L2KE 4H8WH 1QO3B 3CFEB 3F7QA 1LEIA 5KSUA 4GXUN 3SKOB 4WTZG 3G08A 3S7GA 2OZ4H 1A9BA 1L7TH 2OZ4L 4MNHB 4ZUWB 1L7TL 4PJFF 5E6YA 3FFCE 3HI6H 3A6CH 1QSEE 3A6CL 3AREA 4UV7H 3PHOB 1G0XA 5C0AD 1CD9B 2BNUB 4BZ1L 2YPLA 4LAQL 5I18H 5I18L 1OD7A 4YBLC 2VRAA 4NN6C 3P4OB 1U8QB 2CR6A 1FC2D 4LEXL 4R7DA 5CZVH 4RMSA 5CZVL 1P1ZA 3UTSA 5D72H 4APQC 5D72L 5JXED 3GJFK 4MNQD 4V1DB 3OBAA 1INQA 1KN4H 3LRGA 1KN4L 3MR9B 4BQBA 2EH7H 2GJZA 2EH7L 4JHWH 4H1LB 4M48L 3OQ3B 1XF4B 1HDMB 1PG7W 4L3EA 4N0RA 1BZ9A 3U0PA 4FQXD 4HCRH 3JWOH 5HYQB 5HDQH 2ZOKA 3DUUB 4P4KB 4LPYA 5DHYB 2D9QB 5GRVL 3EDKA 1OAQH 3SE4C 3T65A 1OAQL 4TSCH 1MCDA 4TSCL 3T8XA 2F8VA 2Q20A 3B6SA 4JLRA 3RNKA 5GRYA 5F7KC 5DMKA 3MV01 1CLOH 5EA0H 4G8FB 5EA0L 1EEZA 3MUY1 5IOPA 3RRQA 3QEQD 2P49B 4B41A 1EEYB 2MWCA 1EO8H 5D7JC 5GS0H 5GS0L 3DMMA 5CBAB 1KEGH 3THMH 1KEGL 2FCBA 5BMFL 3H3BC 4PJCE 3P4LA 1KCSL 2BVUA 3VE0B 2FSEA 3VRJB 5I8KH 5I8KL 4X8JB 3UDWC 3H0TA 2DKSA 3O4LB 3ARDD 2PTTA 1KPUB 4S0TD 5D7LA 3T0ED 3EYQD 4YDLC 4MJIB 5CJXC 3I02B 5DQDH 4N5ED 2H41A 4O51A 1T1XB 3U0TB 1A2YB 4U1LA 1CXKA 5GZOD 3BN9D 4HULB 3V7AG 1NCAH 2P46B 1NCAL 5EC2B 3SO5A 1S3KH 5C0CB 1S3KL 2A6JA 4GAYB 5GSRB 2H8PB 1B3JA 1KXVC 1T20B 3OB0K 3STLA 4WI8A 4K7PY 4IDJH 1MCEA 1MY5A 1OD9A 4GRWH 4JAMA 4V1DE 4K55A 2OP4L 3D25A 2IALA 1B9ZA 4WW2F 2CK0H 3BGFC 3CDGA 2JIXA 3VJ6A 4OF3A 3WKNA 2J4WH 2J4WL 3LPFA 3ISWA 2HKHH 5IVXF 2X4SB 2HKHL 4S1DC 2R2CA 1R3KB 4F58H 1JP5A 2X4OA 4KUCD 4L9LB 3KJ4B 3QPQC 4MS8D 4TVPH 3FB6A 4TVPL 2ADGB 1C1EH 1C1EL 4HSQA 4JM2D 5DUPH 4DGVH 3WIHH 3F58H 5DUPL 4PRIA 3WIHL 4KDWA 3D39A 1CGVA 3ES6A 1V3JA 1FGVH 5DT1H 4E41A 2NW2B 5B3NA 3MLPA 1QLFB 4ELMF 4BH8B 5E94B 4PD4K 5EBLA 2H6PB 3TT1L 5HGBA 1KCKA 5IMMA 1G9MH 4NBZB 1G9ML 5C2UB 1DVFB 4PLNC 2ZCKH 1FNFA 1R3JA 2ZCKL 4JRYA 5FDYA 3GIVA 4JKMA 2Z92B 5CD5D 3TFKD 4DOHB 5I2IA 4NO0D 5EUOA 5EBGA 4ZSOB 3TESA 4FFVD 1OCWH 2MMXA 1VGKA 2AGJL 1YDPB 3K2MC 2BXYA 3O4LE 5ITFB 1FNSH 1FNSL 1NANH 5DYOA 4WV1B 3GSOA 4MJIE 4ZNEE 3GGWA 4EUPA 4LPCA 3BUYA 2VL5B 3GMQA 3PL6C 1KT2A 3QFDA 2C1PA 1XF2B 3IKKA 1OOAA 2QSCL 4M7LH 1YY9D 1GOGA 4M7LL 4HX1B 4IRZH 4IRZL 5C0CE 2QSVA 1M7IB 4K3DH 4NQDE 5D1QA 3MBXH 5DK3A 1FFRA 4YR6A 1F97A 1IBGH 1IBGL 3DNKA 3ABZA 5IB5A 5C2BH 2NQCA 2GAZA 5FF6A 2VR9A 5EG6C 1T0NB 5DJAA 3P73A 5F6HI 4X5XA 2EDHA 3WS3A 5DVLA 1WCBB 3ULVH 2ARWA 3ULVL 1MOEA 2WM0A 1FC1A 4ZUSA 4Y4HB 4NRXA 5ENWA 1HINH 3JTTB 2O5ZL 3P0YL 3QQNA 3UCRA 3TIDA 2XNAA 5HHOD 5BZDB 1ZE3C 4L9LC 3KJ4C 2NR6D 3VG9B 1C5DA 1A8JH 3RZCB 3AUVA 3HA0A 3VFSA 1BJMA 1CU4L 3GSWA 1JI1A 1AD0A 4U6YB 3OGCA 4FQ1H 1MRCH 5I1CH 1MRCL 2A6KB 2AJ3A 1MQ8A 3SDCB 2RJMA 3ETBF 4F3FB 1H3VA 4KDVA 5IEHB 4DOHE 3GRWA 1SMAA 4PV9A 2RR3A 5I71C 1LEGB 3FN3A 3CDYA 4L1HA 4OD3H 4QY8B 4OD3L 4UBDC 4HUVA 4ZSOE 1AXTH 1N6VA 2YKLH 1DVFC 1JNHA 4N0YH 2YKLL 4N0YL 1U8HB 4LHUD 2EYRA 2O5XH 2O5XL 1Q1JL 4G9FB 4PV8B 1T22A 1EO7A 3DBXA 2DRUA 3TO4C 4GW4B 3RDTA 3BAEH 4YDKH 3MOAH 4OQTH 2A6DA 5T1KA 3MOAL 4P9HH 5IMKB 4RMTA 1UCTA 4P9HL 4MX7B 5LQBH 1NGWA 5LQBL 5I1DB 3BW9A 1KUMA 4QRRD 1MREL 5INCA 1WICA 3S6CA 5JLZA 4S0SD 3RAJL 2MCPL 2BC4A 2QHRL 5DZLA 4K8RD 3C2AL 1BQLH 1QSFB 2HN7A 1WWBX 3WL9B 1RK0B 4F7CA 3EO0A 5CJOH 1BFVH 1MCOH 5CJOL 3RKDC 1BFVL 1MCOL 3OJ2C 1NSNH 1MHHA 5E2WH 1AO7A 1A47A 1BGXH 5C0BB 1EXUB 4XRCA 2OS7A 4H0HB 3KPPB 1G7HB 5FA4B 1AGFA 2XWBA 4PJGA 2FEDC 1CGYA 3D0LA 2B2XH 2B2XL 2C1OA 2XN9D 4QNPF 3RWGB 3ARGD 3PWPB 3MLTA 2NNAB 4CNIA 3HC3H 1D9KA 2P8MB 5DS8B 4ZFGH 5MI0B 4ZFGL 4Y4HC 1KLGB 2MKLC 4E9LA 1IGMH 2V17H 1WAAA 2JCCA 3DX9B 2R2BB 4F33A 4QCIA 1NEZA 3IDIB 4FS0A 1VSCA 5IROA 3VG9C 1UEYA 3RZCC 3C5SB 5MEPB 1FGNL 2IAMD 1CS6A 4R26H 4G9FE 1BQHA 4R26L 1FJ1A 2XG5A 4KTDH 1T4KA 4BH7B 3IJSB 25C8H 1EX0A 1O5DT 2ID5A 4JFFB 3NMEA 1QR1B 4Q9QH 1NGXB 3DTXA 3VFPB 2DKMA 2HMID 3Q1SH 3Q1SL 3NA9L 1T03H 5EUOF 1T03L 1VFUA 4AL8H 5KSAC 1HOCA 5E2JA 1MEXL 5CZXD 3L7EB 4AEIH 1QSFE 4LP5A 5FA3B 4NPYA 5EBWA 1WBXB 4Z7NE 4ESKA 1FV1B 1I7RB 5EOTA 3MTRA 3GBNH 5JPNA 3GBNL 2QSQA 5EN2A 5C0BE 2F54A 1DBKH 3BWAB 4Q6IC 3DV4A 1JCKA 1T83C 5CEZH 5CEZL 4F9LA 1CFVH 1JZ6A 1FO0L 2V9TA 1KJ2H 3FN0L 1KJ2L 1XR8A 3GSNB 5DJ0A 3MMEA 1DQDL 3PWPE 3TPUA 4KV5F 4OF5A 1ZGLA 1PG7X 2C3VB 3MCKB 1B4RA 2B1HH 4H0IA 4Y19A 2B1HL 5DJ6B 2J5LB 4L3CA 5HYJB 2Z93B 3MUZ1 4XWGH 1GVIA 3HTLX 5L2JA 2P47B 3RX7A 5AD0A 5LGJA 2OTWA 1J0ZA 5CIPH 5J6HA 4RGND 2J8UA 3T2OA 4BFIA 3CSYA 1I7ZB 3VXUB 4NT6A 5IVZA 4WI7A 1VFMA 3MLUH 3PJSB 5ESVA 4WJ5B 3MLUL 1L9NA 1I1YB 4JFFE 4CMMA 4LAJH 1XGRB 5MP6L 2ZNWA 1J5OL 2DQJH 1TENA 1CDGA 2DQJL 3BGAA 3UYPA 1JI2A 4J3VA 1Z5LA 3L3JA 3LRSA 3AB0C 4JKPL 2NZ9C 1MCPH 4AH2A 1Z3GH 1MCPL 3SDXB 1Z3GL 2XRAL 2PXYC 1D5BB 1RSFA 4J6RH 3OG4B 4J6RL 5I76B 2MHAA 4OLUH 3WD5H 3WD5L 1RHHB 5EWIH 4KK9D 4E42A 4L4VA 1HXYA 4HWZA 1HHGA 5E7FA 4X4YA 1S5IL 3OKEB 3VMPA 1YEHH 5GGQH 1JK8B 3BEVA 3G9AB 2X41A 4MA8H 1F3JB 2G9HA 4O9HH 4PG2A 3GBMH 1J18A 4JFQA 4YGVA 3ARXA 1ZK9A 3WNKA 4CL7A 3H9HA 3V95A 2VDNL 4R4BB 5HYJE 3O11A 3O41A 4I48A 1K4CB 1BHGA 3BI9X 2XYCA 4NGHH 4B7LA 1FFNA 4NGHL 3FQXB 3HPLA 2FJGB 5DRZB 3W2DL 4PJGF 5D1XD 4LOUC 4EKXA 4GOSA 1KIUA 2XG4A 3VXUE 3C6LD 3JZ7A 1INDH 1INDL 3ULSB 4CU6A 4DQOH 5DDHA 3NTCH 2HTKC 5IJKC 3BT2H 4EZMA 2CKBB 1NPUA 3H42H 3H42L 4XNXL 1JV5A 1N59A 2BVTA 3TZVB 2GCYA 4LSUH 3WFHA 1ODAA 5JW4Q 1WAAF 2JCCF 3CXHJ 3VXQB 5IHZA 4KKLD 4WU5A 2VLRB 3W81A 3OG6B 1B0GB 1ZHBA 4E5XB 1FL3B 2YWYA 1HHJB 4DZ8B 3TYFB 1RV6X 3NIGF 3B9KC 1ZVHA 1LO5B 3L5IA 2BY1A 5F44A 4FXKA 1EJ6A 2R1XB 2J6EA 2IC2A 5H94B 1MCCA 1QRND 5I15H 4CUCA 5I15L 1XCQA 2GTZB 4QRUB 3V6FB 5E6ID 1JPST 4Z0BH 1FLRH 3RVTD 5CGMA 2V2WB 3TNMB 3DX7A 2A74A 2P4AB 2AV1B 5FOBA 3KS0H 5KN5A 1DFBL 4PJIF 3IAGC 5J06A 3CK0L 5E1HB 2V7NA 4GS7C 1CFSB 1T7ZA 3CX5J 3BKYH 3S35X 3K8LA 4P57B 5CSBA 3MXWL 1UACL 1IM9A 1C5CH 1C5CL 4MA3A 4U1KA 3WSQH 2BY2A 3NZ8B 3T2NH 1WSST 4XVJH 4XP4H 4Q7DA 3O2VH 5LBSH 1M6OA 5LBSL 4WHTB 4IBLT 1G9EA 1BIHA 2PTVA 3GMLB 4JRXA 4JFYB 3OPZH 4PJAB 4F9PC 1U8MB 3OPZL 4HIHB 4MB5A 1KTRL 2DL2A 3S36H 3S36L 1P7QA 2I60L 3RPIA 2JB5H 4PFEA 3L3KA 4YQXH 3GMNB 3LPGA 4YQXL 3J7HA 1E4WH 4EQ2A 1GGIH 1XIWA 1GGIL 1U95A 3LHPH 4B0MM 2VLRE 4N0CD 3DRTB 4EI6A 3SJVB 3U2SB 2IH1B 1FORH 2Q7YB 2G60H 1WC7A 1TJGH 5HHMD 5DQ9B 4GRLB 2J8UF 1AE6H 1IEHA 1WT5C 1AE6L 1QG3A 4YK4B 1MLCA 3FT4A 1CD8A 1DUZB 5HI3C 1CL7I 4QXWA 1DN0B 4NNYA 3E1F1 4YBQC 3U9PH 3U9PL 1RIVH 1INEH 3FTGB 3AS1A 3C5JB 4OKVA 1JGLH 3MA9H 4J8RB 3BP4A 1QFWH 4D9QE 3P9MA 1XH3B 2DB8A 4OCLC 3HNVH 2IFGA 3IRZA 3HNVL 1WBZA 4WFHD 3W11C 2IANA 3MNWB 5DTFA 2NYYD 5FM8A 3ZKQD 5SWZA 3VXMA 4HBCH 5DEFA 5BQ7A 2NY0B 1U6AL 1P2CA 5I1EL 3LVEA 4QEGA 1VGEH 4YHNA 5FYJE 1VGEL 4KRLB 4MNGA 4ETQB 4R0LA 1LK3L 1ZVSA 1JTPA 5F9WB 3QJFA 4PJAE 3LEVH 1EVUA 1ZLWK 3KXFB 1NGQH 2FB4L 4EVNA 1NGQL 3MRRB 2H3NA 3RQ3A 3KPLB 1NGYA 5MERA 3FO1A 4ZUVB 5CHNA 1G1YA 4LNRB 3G04B 2PTUA 2YUZA 3IXAA 2WK2A 4F2MA 1B4JH 3CH1B 1EH9A 1B4JL 4EIZC 1Q38A 3SJVE 1EAJA 4HPOH 1U2HA 3V6OE 2DKUA 1EHLH 1MCSA 3AY4C 1IVLA 3CLEH 3CLEL 4UT7H 3DMMC 2BSRB 2HVJB 3FB8A 4LCUA 1L0XA 5DLML 4MJ4A 3MJ6A 2XXCB 3O0RL 2XA8H 1EFQA 4WGVB 2XA8L 2AI0L 2AEQH 5T3ZE 1DSFL 5DD0H 4CVXA 4JO4L 5DD0L 4H25B 5JIKA 4GRLC 3UTSD 1FE8H 2CLRA 1FE8L 2CJUH 4D0DB 1I9RH 2QTEA 2VO5A 4QXUL 2XQYK 4KFZC 5JW4M 4P2RD 2DMCA 3OR6B 3ZLQC 4X7TA 1IGTA 4ETYA 1IKFH 3T77B 1I7TA 1IKFL 4R96A 3OKKA 2RAMA 2Y36H 2Y36L 1MHCB 1OSPH 5DUML 2UY7A 2NW3B 4D0CA 1X5GA 5B3JE 3O3DB 4GSDH 2OYPA 4XCFH 5ADPH 5HVFB 4XCFL 1RZKH 3ZDZE 1RZKL 1PX4A 4HH9B 3HN3A 4FMKA 4DCQB 3SE8L 3BX7C 3B4NA 7CGTA 2ATPA 1EJOH 4IMLA 3FHQA 4LASL 1Q9KA 1LO0H 4HMCA 1NMAH 5GZND 2UYLA 1RZIB 1D5IH 4Z5RB 1D5IL 2NY6D 2NY0C 1GRWA 1LE9A 1FZOB 2XTJC 3OKNB 5L7XL 3DX6B 1KJVA 3LQMA 5GIRB 3QIUB 3C9NB 5F9WC 3V5KB 2ZKHH 1FNEA 1TNNA 4NP4H 4NP4L 4MZ2A 1JFQL 3T0XA 1KG0A 1MVUA 4OTXH 3BDXA 4OTXL 1F4AA 4HUNB 4QXGL 2P5EB 4FP8L 2LABA 1B90A 4KK5D 1OM3L 1UJTA 1X7QB 1IAII 1I1AD 4WDIB 5DQJA 3F6LA 5GISH 2RFXA 5GISL 4Y1AE 3STBA 1F2QA 2IQAB 3FO0H 3FO0L 3A6OA 3EGSB 1TVBB 4P48A 3OGOE 2YD4A 5TE7H 4O2CB 1F4YH 4M43L 2C3WA 3HE6A 1W0WA 3VRLF 3DUSB 3WDIA 1ORSA 4WRLA 4WHYG 1A1NB 3BEWA 1K3IA 1OF2A 2APVA 3L3OA 4X6CA 1ZGLM 4JVUA 5HYSG 4MD0A 1K2DA 5FGRA 2V2TA 3R1GH 1N7MH 4LVEA 1QBMH 3D2UB 1EK3A 1S8DA 3HAEG 3WUWA 5ALCL 5IHBA 2R4SH 5CP3A 2R4SL 2F74A 2A0LC 1ND0B 4U1SA 2AVGA 4LLVB 5CCKH 4DGIL 4K7PH 4K7PL 1RUKH 3O3AA 2R0WH 1HHIA 1AGDB 2R0WL 5HPMA 3PP3K 2KUTA 1XF3A 1JTOA 5ID0A 5CLTA 3QDGB 3RUGB 4EIGB 1W72A 5EOCL 4WHDA 2ATKA 3LEXB 1Y0LB 3MYJA 4FTVA 1AGCB 1I7UB 4C58B 4PY7B 4JANB 4F37K 3VFUA 1IQDB 1WZ1H 1W8NA 2FO4B 1QP1A 5A1AA 3L95A 4ODBD 2W65A 2WUBL 2R1YB 2W38A 1MJUH 2NLJA 4U6VH 1S7XA 4I2XB 4LSSH 2XZZA 4K07A 4LSSL 2P5EE 3PGCB 5I1IH 2CIKB 5BOPA 1IEBA 4POZD 2IMNA 3QA3A 1C5BH 1C5BL 3ZYZA 4HV8A 2DTSA 1P6AB 2VLME 1G7JB 3DOSA 1A6VH 2R15A 1H3PH 2A6IB 1H3PL 2A2QT 3NABL 2YZ1A 2WANA 1MUJA 2FHCA 4NO5A 4P5TC 5E70A 3VFMA 4NM4L 2BHZA 3B9EA 5F6IC 2VZ1A 5DR5H 2MCG1 4GW5A 2GSIA 2BSSB 4JKWA 4KJYB 4S10A 3MODH 2FLBT 3RDTC 3E3QE 5EFIB 1JBJA 3TBWA 1N3NA 1W2KT 4OZ4A 2B4CC 5E5MA 3S3JA 4FQJL 3CX2A 5FB8A 5IK3A 3EYOB 3MFFA 3H7LA 1EVTC 5C0AB 3VI3E 3WKMH 3T0AA 3E3QC 3QUYD 2QADC 1S7TA 2D0GA 1BWMA 1ZA3A 4JVPA 1FNGA 2E7CA 4RQQB 4RFEB 2ZCLH 1I4FB 1MRFH 4MNQB 3IDJA 1MFCL 5EUKA 4QHMA 5E03A 5TGBA 3WN5B 2HRLA 3MXVH 2NTSP 2XACC 1N2RA 2GTWA 2R1WB 4FQXB 5GGVY 5IMLA 2W92A 1BF2A 5T33H 4OGAD 3TCLA 3GSVB 1PSKH 1NC4D 4K94C 4QF1B 3O3BA 1TQCB 1PW3A 3UTPE 3QI9B 1T04A 3A67H 4I2XE 2DQGH 3I85A 2VDRH 1A7OH 1EAPB 1DZBA 1A7OL 1D9KC 2FIRT 2VE6A 2XFXB 3EOAB 3SKJH 5E4EB 1WIOA 3QNZA 4LCCA 5D5MA 2FDBP 1JHTB 2XQBL 2I9TA 3OKYA 5TDNB 3QEQB 5HYSB 3I6KA 1F3DJ 3HHRB 3GSUB 4GMSH 2AQ1A 3ARBA 2D03H 5I75B 4ZFZB 4DZBA 3HAEB 4QRPD 3NH7H 1MJ8L 3QULA 4LNVA 2P8PB 5DHVA 2DYPD 3IFPB 2ZPKH 2CH8A 4UNVA 2D3VA 2R0ZH 3L9RB 3QFJA 2R0ZL 4PJIE 3ARDB 3T0EB 1ZT4B 2ZUUA 5C70A 4XP5L 1G7QB 2E6JA 5TE6H 5HGDA 5TE6L 3F12A 5J12C 2BDNH 2R4RH 5DRWA 2BDNL 2R4RL 4R3SB 5F1KC 5C0AE 1G7PB 2B7DT 4A2LA 4YDIH 4YDIL 1EV2E 5E2UH 4M03A 5E2UL 1CTOA 1T5WB 1JPSH 3UTTA 5HHPB 3X12A 1BIIB 5C07A 4LHUG 2FX8H 4TULL 3S97C 4MNQE 3PHQA 1CLZH 3M8OH 3FT2B 3M8OL 4HDIA 4LSPH 4TTGA 4X6CF 2YRLA 1G0DA 1ZWIB 4OF6A 3IDUA 4ZO8A 1F11A 5CEXB 3VGBA 3JV6A 2L0DA 4JHZA 3TCXA 1NKOA 2DQFB 4F9LC 4I18A 2ARJB 4M9OA 4R8WL 1UQSA 1PLGH 1K9TA 1ULVA 4FA8A 4JM2B 4Y8DC 5F7MC 4RIRB 3A6BH 3WN5C 3A6BL 3S88L 1F6LL 3MNVB 2R56H 3G5XA 2VISB 2R56L 2CLZA 5MHSD 3BMWA 4FQXC 1KBGH 1G7MB 2VERN 4S1RH 1BZ7A 2DAVA 1TQCC 3QEQE 2AV7B 1F02I 1HEZA 3KPRD 4RMWA 1FP5A 5E4EC 3CLFH 4U1IB 4XAWH 4XAWL 3MRLB 3LN4A 3HNSH 3HNSL 1T1WA 4NO0B 3TBSA 3ZHKA 5TH2A 1ZEAH 1ZEAL 1BVKB 3KPOA 1G84A 1E27A 3T0EE 3X14B 3QNXA 4D0BA 1ZHNA 1AKJD 1NQBA 2ZOLB 3PG2A 4U1HB 4IOFD 3TV3L 4AENB 3BZFB 1MFAH 3QXUA 2D7TH 5IFHH 5IFHL 4QOKA 3ARDC 3HNTH 3T0EC 4FQCH 3AMKA 4FQCL 4Z7WA 5KAQF 1NAMB 1PDKA 2MQ3A 5K59E 4N5EC 4LLQB 4FABH 3QWRD 2FZ3A 3FMGL 4RMUA 5GZOC 1CXEA 1DN2A 3BN9C 3QUZA 1OP5H 4WO4A 4JY5H 1HILB 5E1AB 4JY5L 3G6DL 2NXYD 5GS0D 4U1JA 5ETUB 4P0DA 1GGTA 3FOLB 3N1FC 3B5HA 3GI9L 4WW1A 3KPMA 2BY3A 5BJTA 1Q9LB 3OXRA 3MRBA 3BIKA 4ALAH 1U8NB 4FZ8H 5DJDA 2K1MA 1P7KA 2JJUA 5HHOB 4BSJA 1BP3B 2NY3D 5SX4H 4I0CC 4JM2C 1VFAA 1CF8L 4KHTH 3U36A 1KC5L 4FZEH 3GSNH 4JFXA 3MA7A 4FZEL 3GSNL 2OL3B 5HGAA 5IT2L 5IT2H 2WBKA 3S5LG 1EPFA 4UV4H 4M8QA 1I1CA 3S37X 3TC9A 2H32H 2R23A 3GHBH 3GHBL 2FR4A 3L3IA 1J0KA 2BCKB 1TVHB 3BZ4B 1BM3H 1BM3L 2NTFA 3KYOA 4LHUB 4DGYH 5D5MF 1U8KB 3LSOB 5GRWA 4BSWB 5FHBH 3BSZH 5FHBL 3TFKC 3BSZL 3FL7A 4WTWA 3AS2A 4OZFA 1URLA 4JZJA 5KVGL 4FFVC 4TVPD 3IAPA 1BLNB 5DJYB 2AKRA 4QRRB 4TSBL 1MLBA 5HVGB 1R3IH 3MBEA 2KPNA 1QFUH 1CG9B 1QFUL 4NRZB 3VFGH 4YHPA 2E8YA 4NDMB 5EU3A 5LWYH 5LWYL 1RZFH 2FLRT 1TCRB 1RZFL 2EE9A 2VXSH 1I85A 2VXSL 2BOBB 4HG4K 2A1WL 3SY0A 3VWJA 1Q9WA 4P2YA 3ARFD 1F90L 2E7MA 3MV8D 4YFLI 4N0UB 2AK1H 1JPFB 1R5VA 4HGMA 5LAXB 4KZEH 4GUPA 1U92B 2WMPA 1NCCH 1RFDL 2GQHA 1NCCL 2XN9B 4GJTB 2J88H 3C08H 3C08L 4NUJB 3ARGB 4Y7MA 5HHOE 1YMHA 1SJEB 5JMOC 2H9GB 2Y7QB 2N56A 2VL4A 4M93C 1DDHA 2OCFD 1FN4B 5B8CA 1PQZB 5DWUH 5DWUL 4YIQB 3DURA 4ODVL 3P4MA 1J9CT 1YEEH 1YEEL 2KL6A 2NR6C 1ETZA 5D2NB 3MV7B 2BHYA 1J1XH 3MYZA 1CD1B 4HC1A 3RKPA 4HZLB 4HS6B 2AJUH 3L7FA 2A9MH 2AJUL 2IAMB 4R4ND 2A9ML 4XXCA 1HI6A 3PQYA 4OUUA 5DK0B 1S7QA 2DM2A 2XQYG 1XIWC 3QUMB 4PB0L 3TN0D 4OV5B 2UUDK 3X11B 3QWOA 5CZKA 4OJFL 5JUEH 1I9JH 3N85H 1CIDA 2AXFB 3N85L 1CFBA 1A22B 1SEBB 3C6SB 3ULVD 2M2DA 4QRRE 2X4TB 1I3RA 1Y18A 2CKBH 4N9GB 2CKBL 5FFLA 5J1AB 3DPBA 1YEDA 4P4RB 2ITCA 3DROA 4YFLF 2FD6H 2FD6L 4QHNB 3KLHD 5HHQB 3FOMB 4OM1L 2RCSH 2RCSL 1QA9B 4JN2B 3IDYB 1IZJA 5CBEB 4YUEH 4YUEL 3GKZA 4XH2B 1QLRA 3GMOA 4N0UE 3S5LB 3D6GA 5MEOB 4Z7WF 5D6CA 4G5ZL 1VEOA 2X4UB 4FQQA 1LD9A 2NXZD 2VQ1B 3OAUH 1RUPL 3OAUL 5HHNA 2XN9E 4LRIA 3HG1D 1YN7B 3QXAB 2X4NB 3Q5TA 4MJ6A 5IB3B 4ZO9A 2VXQL 3OR7A 3ROOA 3ZE2F 4I9WD 3L3GA 3JSSA 3Q6GL 2B0SL 2ICEA 4LSDA 1S5HB 4OIIH 4OIIL 5E0QA 4NUGH 4M7KL 4R0LC 4Z6AT 3V7MA 2CDFB 3O2DH 3ARGC 1M7DB 2VIRB 2F5BH 1P53A 2YA0A 2F5BL 1NDMA 2HFGH 5IJVB 1K8IA 4OV6F 4TQEH 3VD4A 3V4VL 4LCWD 4RGNB 5D2NE 1QOKA 3U46B 5I1LA 1XR9A 4FXGB 3QDJA 3MUJA 5FYJH 3D1MC 1VCAA 4HKJA 4KROB 4D9LH 1T0MB 1P4LB 2DJUA 4QRSA 5D2NC 5HDBE 5FUCE 3V0AC 5C71A 1PY9A 4RAUB 4B53A 2X70A 4JRWA 1IC1A 1XMWA 5KVDH 3EYVA 2IAMC 4JFED 1WQVT 2CDEA 3QXDA 4JHAH 3IT8D 3O4OB 4JHAL 2AABH 2BVPB 2E7HA 2EKSA 4MWFA 3S98A 1TETH 5EZOH 1TETL 1VADB 5EZOL 1FL5A 4F7TA 1QHOA 5FUCC 3RA7H 5IWLC 1ZAGA 1FNHA 2HMIC 4KZDL 3GUTB 4PGCA 3UPRB 1DQQA 1F6AB 3MJ8A 4JCLA 2GIYA 5E00B 5EC1A 3VCLB 2WW8A 2Y6SD 4UMGA 1IM3A 4GT7A 1AJ7L 2H45A 2KKQA 3O6MH 4KVCH 1CQYA 1NLDL 3O6ML 4KVCL 5CZXC 1EHNA 3PABA 1AHWA 1DANU 2H1PL 2JJWA 2ENYA 1KN2L 1K5NB 4ZXBB 5T3ZH 3NA4A 4PLKD 3K8KA 1ADQH 5I1AA 3CFDA 3IDYC 2OJEB 2HVKA 3OKOA 2YPVL 4CN6A 3W5NA 1DL7L 5H35A 4JPKH 4TOYL 2WBJA 1YC7A 2FIKB 4X6DB 3U7YH 2PYED 3ALPA 4G8GA 3DXAA 3P77A 1EIBA 1JGUH 4JFOA 1JGUL 1C08A 4PTTA 5GRUH 3RI5F 3AM8C 3TJHD 1DUYB 4ZPVB 1XGUB 1NC2D 4PTUB 1FFPB 1ZS8A 4RGNE 1I3UA 4PRHA 4NZDA 3C6LB 3HR5A 3I6GA 3SGDI 1UZ8A 4RGNC 1KCLA 2BNRA 4P99A 2CLVA 3PNWA 1G6RB 4KTEH 1KFAH 5H37H 4KTEL 1U8OA 1KFAL 4Z7OE 1SVZA 3DYPA 5CEZD 3NFPB 1Q72L 2PKDA 4LKCB 1OTTD 3H7BA 4HIEA 3G5ZA 4AG4H 2B1AH 2WUCL 3GSQA 2KZWA 5E2VL 5J4MA 4HS3A 4OLZL 1S7RA 8FABB 4LVNC 1T6VN 1X6NA 4J23A 4NQSA 3RWCB 1SY6A 4HCRA 5ESQA 2VDLH 2VDLL 3HE6C 3O4OC 2EDFA 1QRNB 1XGPB 3EJZD 3VFVA 4HUXB 5E6IB 4MJ2A 1P69B 1SBSH 3V5HB 1SBSL 3BD3A 4PBXA 3TBTA 4P9MH 5D6DC 2Y9RT 2Y4SA 5E2TL 4I8DA 3FQWB 1RPQA 3REWB 5JQHC 1CD0A 4QRQB 4KK9C 4YBHA 3L5WA 5KS9B 4QT5B 5IM7B 3MZTA 3WS6C 2WIIA 1EERB 4X6DE 3W9EA 4ZFFB 3C60B 4NJ9L 2CDGA 3I75A 4M62L 3QO0A 2YD7A 4L4JA 1X5ZA 3OKDB 4JM4H 4L3AA 4JM4L 1RZJC 3KJ6L 4XBEL 4PJ5D 4LLMA 1JGDB 5D7SH 1AI1H 2EDOA 5D7SL 1AI1L 5JHLH 4PJBA 1V7NL 4LSQH 4Y4FA 4OAWB 4EEEA 5D1XC 1QUNA 4X4ME 5IQ7H 1IE5A 5D70H 4LSRH 3M17B 3C6LC 3IETA 3U6RA 1OAXH 1OAXL 4F57L 2YBRA 2Q76B 4N8CH 3ZT5A 3MRHA 4LCYB 2X4QA 4FFYH 3OB0H 4FFYL 3VG0H 1PBYA 2FHFA 1CQKA 4G8EB 4Z9KB 5F9JB 1U3YA 5CMAA 1HH6A 4KKLC 5JOEA 4EN3A 1S7VA 1TPXB 4PRPA 3L1OH 5TQ0L 4LGRB 1QRNE 4J3WA 5FGSA 3E6HB 1A7PL 5DJ2B 3G5YB 1VESA 2Y1VA 4G6AD 3QRFM 2FATH 3Q2CA 3P11H 5CKGA 5FUZL 4JY4A 3VFRA 4YAQA 3WDJA 4OZGA 2B4CH 5IB4A 2R29H 2OJZH 2OJZL 5E6IC 3O3EB 5KS9E 2XZQL 2VN4A 1TJIH 4UI2A 3RVTC 3NAAH 4V2BA 3NAAL 3DRQA 1CLCA 5B4MD 2EDXA 4OZHB 4RFNC 2VQUA 2DWDB 4EI5D 4WI4A 4XBPB 2VZUA 3RJQB 5AUMA 1YMMD 4RWYH 2BOCA 5ID1A 3O2WH 5CSZA 4WFED 3P9LA 4LIQE 4M5ZL 3IXTB 1VDGA 4XT1C 1I8LC 4ELKB 4RGOH 4RGOL 1Q9OB 1S9XA 1GGBH 1RZ8B 3MREB 3RVUD 2XKUA 1BJ8A 1I8IA 2QQKL 5EIIB 3BQUA 1TZGH 3M1BB 3B8SA 1RZGB 1TZGL 5I1HH 4LCCC 3F7YA 2WZPD 4NQCA 1OGAA 5IESH 2X4PB 4P59L 4LCIL 5HHME 3VW3H 3VW3L 4K2UH 4K2UL 4OFYA 4CVZB 3QEGH 3RWDA 2D4DA 3T4AA 3MJGX 4M3JA 4MQ7B 4PGDA 5DO2C 5K9KA 4N0CC 1P1ZB 5F7DB 5ISZA 4DEPB 2DQDL 3E6FB 5GSVA 3UTSB 1KELH 4OLWH 3UJTH 1KELL 3UJTL 2HFEA 1SMOA 2D7NA 1FZJA 2X4RA 4EUPG 4P2RB 2X5PA 3VXNA 5D8JH 3R4DA 1UFUA 4TSAH 5D8JL 4XTRD 4LF3A 1KTLA 4PJ8D 3GMMA 4WFHE 4YDVB 1BZ9B 4C57C 3DVNA 3QQ4A 1BF8A 1P5UA 3PGDB 1MAKA 2F58L 3NIDF 1I8KA 3OKMB 4FQIH 2ZG3A 4FQIL 2P48B 5GRZA 1X5YA 4OZHE 1QSZA 4P2OA 4XPTH 1LE5A 2V9QA 1HQRB 3GKWH 3RZWA 3GKWL 1UB6B 2NYYC 4NC2B 1EEZB 4KJPD 4ZS7L 2P43B 4C56A 2EC9T 2NY6B 3ARBD 2V9RA 4I18C 5BS0A 2FBJH 4LRNH 4OQTA 3TF7C 4MXQD 5GGVH 5AYUL 4CW1A 3T1FA 4LLYA 3U9UB 5HHVL 4O2EB 1Z9OA 4ZFOA 3K0WA 4JO1H 4JO1L 4DVBA 1D7FA 35C8L 1AQKL 5GGSA 2BNQD 5KJRH 5DRNB 4ZDHA 3MLXL 5D7LB 2W0FB 4IHOB 3V0VB 3OJDA 3BD5A 4O51B 4A6YB 3ZKMD 4HJ0C 3RNQA 1I1AB 1MHPH 3SDYL 1MHPL 4IMKC 5J7CC 4NQEA 3ZE0F 1WFOA 4PREA 2VTFA 2GITA 1FZMA 1KJMA 4PJBF 3HE7D 5FV2A 4PJXB 2HJLB 4KJQD 5J1SC 2IH3B 5J11B 1AH1A 1GYAA 3UTSE 2C4FT 4WHYH 1CFTA 4IRSA 3GI8H 1NANI 3GI8L 4JAMB 5H8DA 3UZEA 3VXRA 5LG1A 4P2RE 3CDGB 1YEGH 2JIXB 1YEGL 3NACL 4HUUB 4M8VA 4HHAB 3AS3A 3HAEH 3Q48A 3QG7H 2X4OB 2QL1A 5JW3H 2UV3A 4ODHL 2CIIB 2VITB 4J3TA 4HFWA 1A7RH 4KRPC 4U3HA 4Y16D 5CKAA 4UB0L 3LQZB 4JQIH 1JPGA 5ICXA 3ZKND 5TDOB 2FX9H 5L6YL 4XNYH 5DI8B 4XNYL 3ME0A 5JPMA 4D8PA 4WU7A 1C7SA 5KTEH 4OZGF 4JQXA 4K23L 3B2VH 4FOMA 1GXEA 1BD2D 2ZCHH 4NQUA 4UQ3A 5HDLA 1IGYA 1HWGB 2ITDA 3QP3A 4ODUB 1UM5L 5J0BA 2H26A 3HI1B 3ROLB 5DYOB 3VXOA 2OR8A 3WHXB 5LVEA 4D94A 3KYNB 4X98B 4EUPB 3EYFB 1T80A 2DIAA 1UZ6E 3BIAX 4HF5L 3C5ZA 2F5AH 3QYCA 4F7PB 2F5AL 3MLSH 3ULUF 2C3GA 3MLSL 4G43A 1ZLVK 4NKDA 3PWLA 1NDGA 1IQWH 3QSKB 1LWRA 2VLKA 3HMWH 4PJXE 4JO3H 3CJJA 4JO3L 3CIQA 5T1MA 4KK5C 2Q3AA 3HI5H 1JWMA 4QWWD 2Z31A 2EDTA 3QT2A 3LQAH 2KBGA 3LQAL 1Z2KA 1RQ5A 4L1DA 4DVRH 1EDQA 5IB5B 2IPKA 2GAZB 4PJDA 1K4DB 1HKLH 5FF6B 1HKLL 4GBXD 2G5BB 1LHZA 4YZFE 3AAZA 1EMTL 2BZDA 4UTAH 5C08D 4UTAL 3WNPA 3P73B 4GW1B 2ZNXA 3ZHLA 1P4BL 2BERA 4P3CL 3MV9A 4YHKL 1SM3H 3VGDA 1SM3L 1A6AB 3MBEC 3MLYH 4ZUSB 3OZ9H 1JL8A 3VRIB 3QUYB 4G9DA 4GG8A 5HBBA 1A6ZB 5CIPA 2FL5B 1ZA6B 3TIDB 4AEHH 1SJHA 3E8UL 2VKWA 1T1YA 4ORZC 1AR2A 1NGPL 5DC4B 1K3ZA 3CVIL 3TA3A 5GJSH 3PDDA 1NFDB 1DQJB 2UZYB 1EA9C 5E8NB 3WFDH 4QGTA 5L8JB 3WFDL 1NAMH 5D4QA 2I9LA 5TE4H 1IC4H 5TE4L 3REVB 4UUJA 4Z0XB 3EO1B 5F3BA 4UOJA 1NGZB 2VXUH 1YY8A 4MAYC 1V5JA 2VC2H 1HYSC 5E56A 4RX4D 3FQTB 3INUH 1NC4B 3INUL 1L4IA 3QQ3A 1JWSA 3QQ9D 5CLWA 4L5FL 2FYYA 1CGWA 4WVRA 2EYRB 1KPVA 4Y5YC 4Z76A 1FIGH 1FIGL 1UB5A 3DBXB 1TIUA 3HRZB 1JF6A 3MRFA 2NY4D 4X9GA 3CVHA 4LKXB 5B8CC 5I17B 4UU9B 4XCYA 5EORH 1FFOB 4Y88A 3GB7B 5DFTA 5EORL 3PXJA 4L8SA 5JLZB 1H8NA 3V6ZA 4HQQL 4I0PA 1T5XA 3NIFF 4QRPB 4POZC 1U93A 4QYOA 3CPLB 1DLFH 1JUFA 3F5WB 2HN7B 4M1DL 2DYPB 4XXCC 4YPGA 3EO0B 3KPNB 1MVFA 2PYFA 4W6XB 3GO1H 2FJHA 2IQ9L 1AO7B 3GO1L 4Z7UA 1RJCA 4XRCB 2P42B 2ZUQB 3KDMB 5J57B 2G2RB 3G6JB 4HUWB 1WWWX 5EOQH 3EO9L 4BFEA 2W60B 1D6EA 2C1OB 1RVFH 3U7WH 3U7WL 1H15B 3SDDD 3E2HB 3MLTB 1CCZA 2AXGA 3SE3C 3B3IA 4RAVB 1V3MA 3OV6A 2GT9A 4NZRL 1NFDE 4YWGL 1IZKA 3DX8A 1ES0A 1SYSA 2J1KA 2OX5A 2VDOH 3HUJF 4MD5B 2JCCB 4K3HA 4NFBA 4CGTA 3DWTA 4WFGD 3ZDYE 1HE7A 1YJDH 1SEQH 2N7BA 1YJDL 3TO2A 1SEQL 3GEWB 3JV5A 3MRKB 4K8RH 2X05A 4X4ZA 4OB5L 4PR5B 3MZGB 1MRDL 3UX9B 3G9VA 3QZWA 3LD8B 5SWSD 4IRJA 4P46D 5EH1A 1IAIH 1T4KB 4Y2DA 5FEBA 1A9EB 4V2CB 1CR9L 1VEMA 1C12B 1N64H 1N64L 5D1ZD 3RL1B 4L9DA 3R0MA 1CWVA 4OGAC 4XHQA 5FHAH 2YRZA 5FHAL 3O8XA 2D9CA 5L88L 2R2HA 4KTYA 3KPRB 1NMCC 3CNKA 2J8OA 3JWNC 5EBMA 4QRPE 5CINH 1MH5A 1TZIA 3O3UN 4X4XB 5D7IB 1WWCA 4QTHB 4XPHH 1K6QH 4XPHL 5F89A 1K6QL 2HKFH 2HKFL 3HPJB 4MD4B 4Y5XB 4YO0A 3DVIA 1AO7E 1AKJB 1UYWH 5JOFA 1UYWL 4J4PA 4N8VG 3W0WA 4JY6A 3G6JE 1U3HA 3I2CL 5CJQH 3H3PH 4Q97A 4C54A 4RZCA 3MJ7B 5IMOA 4HWBA 2OXHA 5E24E 1PG7L 2ZUQC 4E0RA 1CGUA 1U0QA 1KJ3H 5HHXL 4PJDF 1KJ3L 1T21A 1EBPA 5C0DB 3OHXB 1MQKH 1ZLSH 1ZLSL 2VDPH 2NXYB 3I3BA 1M1SA 2HP4A 5LGJB 1N5YH 2OTWB 3QIWD 1N5YL 5E7BA 4B7IA 1PKQA 3ECBB 4AM0A 2HLFD 3BH8A 2J8UB 4HIJB 3CMGA 1F4XL 3OF6A 2YS4A 4BFBD 5IIEA 5C9KA 4J3OC 3HZKA 3LKRA 3SDCD 5MHSE 4X6EB 3UTQB 1QYGH 1QYGL 3EZJB 2NY3B 3JV0A 5C0FB 2ICWJ 3DIFB 3FONA 4IEFB 3KPRE 2FH8A 3L3JB 2V5RA 3LRSB 4H8WC 1H5BA 4YFEA 2F53A 3P4NB 4AH2B 4PJ9D 1H9VA 1UXSB 1FPTL 1X3DA 5D7IE 5JMRA 5D9SB 5MEQA 1HWHB 1I75A 1MWAA 2Y23A 2WSKA 3TT3H 2ICWI 3UBXA 3TT3L 5L2KA 1VB9A 3F7VB 5AZEL 3RVWD 2COQA 5FKAB 3WO4B 4P3DA 1VFBB 3FFCA 4QXTA 4WI3A 1QSEA 4Y5XC 4ZYKB 3KS0J 2G9HB 3X3GH 1HSAB 3HCVA 3T3MF 2BFVH 4TVSa 5C0IA 5JHDD 2BFVL 5IUSA 3WJJC 4IOFC 3SN6N 1NFIB 1EGJL 1RUAH 2CPCA 3IKCB 1RUAL 3JWOC 3BPCB 1CN4A 1EUTA 1OT2A 3O11B 4Z7UF 4WWKD 3VXPA 4I48B 5FOJA 1ZLWH 1OY3B 4W4OC 4EDXA 5C0JA 5C9JB 1FFNB 3VXTB 2NX5A 4DK3A 2Y06H 3MV8B 4MSWB 3SE4A 3X3FH 3X3FL 1D5MA 1IGCH 3MGOB 3QHFH 1IGCL 1T89C 5DDHB 2ZG2A 4POUB 1RIHH 1JF1A 2CUIA 2VR5A 2NXYC 3HZVA 4XNQB 1JV5B 5IF0B 5GS0C 1N59B 3MRDA 1BZQK 4O4YH 2X7LA 1UCBH 1UCBL 1QQDB 1AD9B 3EOYG 3CMOH 3BP5A 5IHZB 3IDGB 4N8VB 4Y89A 2JELL 3QCVH 2HFTA 3QCVL 4HIXH 4J1UA 4HIXL 2GFBB 2WQ8A 1YNTB 4AEFA 3UDWA 1EFXA 2ADJB 3SE9L 3TWCH 4Z7VE 2MFNA 5C6PB 1RZJH 4JO2L 3G6AA 2MJWA 4TNWF 1KIRB 1VKXB 4DJMA 4PJCA 4GRWE 1KULA 3DLQR 1TJHH 1TJHL 5IV2A 1XCQB 3LKOA 5GGRA 3S34H 1QO3A 3CFEA 3HC4L 4ZTPL 3UO1H 2DQIH 1J1PL 2FEEL 4QO1A 3SKOA 4LLAA 2A74B 4ZUWA 4MNHA 4TVPE 1OB1B 5GGTA 4I3RH 4I3RL 3S35H 3RVVD 3S35L 2CXKA 3PHOA 2BNUA 5DK2B 2P7TB 4PBVC 3NCYS 4K9EH 3FZUD 4K9EL 3IDXH 1MPAL 2D31B 4HXBH 1U8QA 4HXBL 1G6RH 1G6RL 3WO4C 4UDTA 1UWEH 4I0KA 2XIDA 4GQ9L 1H3XA 4U0RC 3H6JA 1U3ZA 1JMXA 1QFWI 1PYWA 4V1DA 2ADFH 3GMPA 2OR9H 4Q2ZB 3I50L 3MR9A 1W0YT 1QBAA 3MV8E 4H1LA 1YPZA 1FG2A 1HDMA 1DP0A 4MLSA 2NXZB 5HYQA 1G9MC 3DUUA 4P4KA 2DM4A 4QRTB 4NRYB 4OCYH 1E4KC 3HG1B 4OCYL 5DHYA 3ARFC 1A3QA 5FO7B 2E9WA 3CFKB 5DD1H 2NCMA 4XPGL 3QJHB 4A2MA 2BJMH 2L7JA 1WC7B 1RZ7H 4G8FA 5EO9B 1RZ7L 4NCC1 3H9SD 3VFTB 3PWVB 4PRAB 1EEYA 5JR1L 1DE4B 1FZKB 1E6JH 2GHWB 5C7XH 1E6JL 2A73B 5CBAA 4LCWB 5JQ6H 1IGIH 3QO1B 5JQ6L 1IGIL 3QCUH 3VE0A 2Z0BA 3VRJA 4X8JA 2K3TA 3C09B 1KB5L 1II4E 3O4LA 4NKIL 3TEUA 1KPUA 3CCHA 4MJIA 4ZNEA 3I02A 3WYRA 3S9DB 1NFKA 3P2TA 5DJ8B 3KLSA 3ULVE 1T1XA 3L3DB 4R4NC 4JFEB 4PP2B 1QR4A 5A40E 3BDYH 1A2YA 3WFCH 2IANB 1KTDB 3TN0C 3LIZH 5EC2A 3LIZL 5FECA 3PHSA 5C0CA 5BQ7B 2H8PA 3PP4L 1JNNH 3PP3H 4MAUH 4NQDA 1T20A 3HS0B 3ULVC 4UT6H 3PDGA 4OUOA 4YHNB 3RTQD 1V3KA 1MHEB 4DKFH 4ZS6C 3ZTNL 1U36A 1CDYA 1JZ8A 3GNML 3KLHC 2X4SA 5ADOH 1BQUA 5ADOL 2YC1B 2IBBA 5GHWH 5GHWL 2P24B 4L9LA 4ZPTB 1KIQB 3EDDA 5IVNA 3NCFB 2ADGA 2QQLL 3HG1E 2DS4A 4LSVL 5MERB 1DQLH 1DQLL 3NFSH 4OT1H 4FQPA 4OT1L 5TJWK 4I9WE 3IFOB 2NW2A 1QLFA 2PW2A 4LBEA 1JGEB 4BH8A 4NN7B 2NXZC 3UTZB 1HQ4B 5E94A 2VDML 4WTZA 2H6PA 2CGRH 2CGRL 4GO6B 4BZYA 1DVFA 1FBIH 1NC2B 4LCWE 3FB8B 2X6MA 4P9HC 1LDPL 2Z92A 4OD1H 4OD1L 3TO4A 5FK9B 4ZSOA 4YJZL 3HZYB 5JZ7C 4JG1L 1YDPA 5ITFA 4XPAH 5IHLB 2IG2H 4PBWD 1U8PA 2QQNH 4WV1A 1BMGA 2H2PD 3V4PL 5TDPB 3T04D 4JFEE 4KQ3H 1FO0B 3RJDA 5ACMA 4TNVF 4OGYH 1KJ2B 4WEBH 3C87A 3T0VA 2EE2A 4JB9L 4PJCF 4HX1A 5IR1B 3BUTA 4U7KA 4KMTH 4NQXA 1B6UA 4IRSC 5F9OH 4FQHB 3TVMD 5IB2B 1Q9KB 2VABB 1O0VA 5T5NG 4GKNB 1A5FH 4HBQA 1FG9C 1U8JB 2DQUH 2XY1A 2UYLB 1NMBH 2M26A 4C56D 3BE1H 1NMBL 5T5FH 1YNKL 5BV7B 2XT1B 1N8ZB 2JB6B 5EOCJ 3IS1X 5INDB 1V05A 1WCBA 1YUHA 4QKXB 4X0KA 2Y6SC 2VXTH 1IKNC 4J12A 1MIEL 2VXTL 4Y4HA 5L9DL 5L9DH 1FNEB 4HXAL 3JTTA 1CLYL 2PYEE 3N9GL 5BZDA 4L8CB 4PLKC 2D7QA 5KZCD 3RZCA 3Q6FB 1DBAH 1DBAL 4OCNC 4U6YA 5FO8B 2RFXB 3Q5YA 3N1QC 2W9DL 2MKWA 2P5WD 4YHOH 4F3FA 5IEHA 1T7YA 4KKCD 4Q74A 1LEGA 4QY8A 4XVSH 5A3IC 3BISA 4OIBA 3TJHC 3MLVH 3RGVD 3MLVL 1U8HA 5F9DC 4G9FA 2HLAB 3NCBB 4PV8A 3HZMB 1OF2B 5CEZE 1CICD 4X6CB 5KSAA 3K1KC 1UM4H 2DD8H 3UC0H 1UM4L 3UC0L 4MX7A 3HC0B 5I1DA 4M7LT 2DLFL 4PS4L 1YEKL 5IG7B 2Z8SA 2VSDA 4WUKH 2Z31C 2LU3A 4WUKL 3ZL4H 4ZMAT 3ZL4L 3L6FB 4NO3B 3WL9A 3U0WL 2EH8H 2EH8L 2X10A 4KJWD 4PGBB 4K3EH 5C0BA 3BD4A 1EXUA 4K3EL 5ICYB 2ESVD 1FRGH 4AQ1B 5KG9B 3KPPA 3MYJB 4FTVB 1AQDB 3JUYA 3VXSD 2X89A 3OX8B 3EJZC 2Y5TB 3EZ8A 1WJ3A 4BUHA 4PGEB 5J13B 2NLJB 1LVEA 3PWPA 1S7XB 2YK1H 3KXFD 1QFWM 2ICWB 1RJLB 2YK1L 2QKIB 1QACA 2P8MA 3FRUB 5DS8A 5I16A 4EI5B 1A1OB 1VENA 1ZLUK 1KLGA 4JKKA 3QRGH 1KLUB 3QRGL 1YMMB 1CFQB 3MOQA 4NN5C 1N6QH 1S7WA 3DX9A 1RJYB 4PJ5E 4P5KB 5TFSH 3C5SA 2V5SA 1NJ9A 5EULV 5MEPA 1CIUA 2MQCA 4U6HA 2GJ6D 1UA6H 4ZUUB 3OAZK 4BH7A 1UA6L 1MCBA 2PO6D 2Q8BH 5BOZG 4JFFA 2PXYA 3TBWB 1QR1A 1NGXA 1UC6A 1FLTX 1PEZA 5E8DH 3VFPA 2VWEC 1HYRC 4ONGH 4XHJD 4ONGL 2EIBA 2OBGA 3QIBD 1PJ9A 2HJFB 4OF7A 4NNXB 4UQ2B 2MSPA 3L3HB 3WJLC 2X9WA 1S7TB 4EUPH 2V7HB 2HRPH 1FNGB 5AEAA 2D2OA 3L7EA 3MJ9A 3DJ9A 5FA3A 1WBXA 1RHFA 4PG9B 4JN1L 2Z8RA 4PYHA 1FV1A 3VGAB 1JZ2A 3WNLA 1I7RA 4KU1A 4QHMB 4S11A 5BRZD 2JLLA 4OM0H 2E3VA 4OM0L 2X1OA 2NY7H 4PUBH 1XF5B 1B6DA 2NY7L 3BWAA 3T1WA 3HMXH 4PJ8B 2XZAH 1NH6A 2XZAL 3F6IA 1V8HA 1BBDH 1N2RB 4PGZA 3L5XH 4W6WB 4XNMB 1OARH 4G6AC 5KVMC 5IW6B 3O3BB 1F58H 2E9IA 1F58L 3P9WB 4BQCA 4U6XB 5JW5A 2RQ8A 3UMTA 2M8XA 2CO6B 3MCKA 3QNZB 1IAKB 5DJ6A 5HYFA 5D5MB 2DTML 5HYJA 2X09A 4YXLH 2PR4L 4YXLL 3O6KL 1G7LB 3QIUD 4UT9L 1YMME 1CBVL 3I6KB 5IJKA 2OSLA 4WFEE 3RWFA 1OTUD 3ARBB 1EHAA 5B4MC 4HGWB 1LEKB 4EI5C 1I7ZA 3N1GC 1NAKH 1IGJA 1YNLL 4MDJB 3LH2H 3LH2L 2AJZB 4WJ5A 1IGFL 2BNQB 4P2QA 4FRWA 3B9VA 1I1YA 5A43C 1JF5A 5ACLA 1M4KA 4F8TA 3GRWH 3GRWL 3LCYA 5HGDB 3O8XC 3F12B 2UWEB 3RVUC 4RA0C 2LTQB 5F96H 2JJTC 1X5JA 3CFCL 1IMHC 5K33A 1YEJH 3HE7B 1D5BA 1YEJL 4ZG1A 4FNLL 1U8IB 4XI5D 4JHBA 4G6ML 1RHHA 3PHQB 3D2UD 3RIAF 1IAOA 4OI9A 2R0LH 3JV6B 3G5VA 3KYKL 3OKEA 4IS6A 4MQTB 4S2SA 5ESAB 1HN1A 3VGAC 5LXGH 5LXGL 1F3JA 4YE4L 3MUHL 3QDGD 4XTRC 3S3PA 4XP6H 2C9AA 4Z7NF 4PJ8C 4XP6L 3MC0A 2CLZB 5C3TA 4Z7QE 4F9PA 1GL4B 2ZUTA 1LP9B 4R4BA 3TYGH 3RBSA 4GKSB 1K4CA 3WXWL 1HEZB 5L0QB 5J1TC 3FQXA 2FJGA 3SBWA 4HWNA 3B9DA 1V3LA 2X1WL 2YD9A 1BD2B 5EDXA 2ZSWA 1T1WB 4DN3L 3I9GH 3I9GL 3ULSA 1IFHL 2UUDH 4KJPC 1J8HD 3RY6A 2BNQE 2Q6WB 1E27B 3DVFA 3QR2A 2O61B 2R9HD 1WT5A 3S4SG 3TZVA 1N0XH 1ZHNB 5SX4I 5FKPB 1H8OA 4MXQC 4TUKL 3VXQA 1UGNA 3W5MA 4PP1C 2VLLB 2VLRA 4AY0A 1B0GA 2UWEE 4G6KH 4G6KL 1H5BC 4E5XA 1FL3A 5KSBB 1HHJA 4UNUA 4NWUL 4GXVH 5HGGS 4Z7WB 4GXVL 4MA7L 1F2XK 2X40A 3ARWA 3V0WL 3JV4B 3ZKMC 1LO5A 3D85D 2R1XA 3FAWA 5H94A 3GJEB 4BZ1H 4LAQH 3V6FA 2GKIA 3HE7C 2I07B 4P3WA 4KJQC 1C8PA 4GBXB 4ODTH 4LEXH 4ODTL 5C08B 3TNMA 1MNUH 1MCLA 2J2ZA 1MNUL 2AV1A 2V2XB 3KPMB 3W82A 3O2DA 4RGMB 1CGSL 3BIKB 4P57A 3WO3B 1TDQA 4QTIH 1MAJA 4QTIL 5DJDB 5B21A 3MACL 4M48H 3OJMB 1J11A 1LP9E 1RUQL 3NZ8A 1KV3A 3CDFA 4CDHA 1VFAB 5IW3A 4Y16C 5BO1H 5BO1L 4WHTA 1BFOB 3MA7B 4P5MB 5HGAB 5E8PA 3S37H 3QI9D 1WITA 3S37L 1GC1H 1FH5H 3GMLA 1GC1L 1FH5L 2EDKA 4JFYA 4PJAA 2DQEL 4HIHA 3O6FD 4J3SA 1BD2E 4PJ7E 1GOHA 3NPSB 3F65A 5L0QC 3IDMB 2XWTB 1T7WA 3STZB 3WLWD 1N5AB 3AY4A 3BPLB 1TXKA 1RJZB 2VXVH 2VXVL 4M61B 4ZOCA 5BMFH 2NY4B 5LGHL 1KCSH 3U2SA 2Q7YA 2AK4D 5KSBE 5DQ9A 4GRLA 3V6OA 4APQD 3IJHB 1DUZA 3IFNL 4WUUD 4YHPB 2WINB 3O9WD 1DN0A 3EDJA 3K4ZA 1MFEH 3FRPA 1MFEL 1X5HA 3BO8B 5EZLB 2VLJD 1Q94B 3B43A 3FTGA 1ADQA 2AQ3A 4BA8A 5DVKA 4J3UA 3CXDH