3IRCA

Crystal structure analysis of dengue-1 envelope protein domain iii
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
104
structure length
104
Chain Sequence
GMSYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSTQDEKGATQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKGSSIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENVELOPE PROTEIN
publication title Crystal Structure Analysis of the Dengue-1 Envelope Protein Domain III
rcsb
source organism Dengue virus 1
molecule tags Viral protein
total genus 13
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2009-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ircA00
2R69A 4FFZA 3UYPB 2R29A 5IZ7A 4FFYA 4UT9A 2I69A 1Z66A 4BZ1A 5JHLA 5KVFE 3C6EA 3N42F 5AAWC 5KVGE 1OANA 5KVEE 1TG8A 2JSFA 3UAJA 3UZVA 4X42A 3P54A 5LCVA 4UTBA 2JQMA 4AL8C 5GZNA 5LBSA 5IREA 5B1CA 4UTAA 3N44F 4UTCA 3VTTA 1SVBA 5KVDE 4ALAC 2GG1A 3IRCA 1PJWA 5GZOA 4L5FE 3N40F 1ZTXE 4BZ2A 5LBVA 3J27A 1OKEA 4GSXA 2P5PA 4GT0A 3N41F 3WE1A 2ALAA 4UT6A 5H37A 1URZA 4AM0Q 1Z3RA 2HG0A 3G7TA 2JV6A 1S6NA 3C5XA 2H0PA 2V33A 4FG0A 5AAMC 5JHMA 3UZQB 3MUUA 3J2PA 3N43F 3UZEC 1OK8A 1RERA 1UZGA
chains in the Genus database with same CATH superfamily
3IN0A 1I7TA 4QOKD 2CSPA 4QRBA 3ME0A 3MNVB 4NQCE 3SDAD 3DARA 1TCMA 3LN5B 4RAVB 3O3EA 1AKPA 1TZGH 4LL4A 2HAZA 3VA6A 3X2QB 3K8MA 3V79C 1HCFX 3L95A 4U1GB 1HHJB 4PWKA 4C8XA 2OL3H 1YAZA 5I0WA 3Q8AA 5K5YA 4IBUA 1HZHH 4OM1L 2IAMB 1CXKA 1MCWM 3T0EA 1I1RA 1KTLA 4G7QB 5KBPA 4FKEA 2D03H 3PPSA 1WSST 3GBNH 4FG6D 3VXOB 5FFOA 3BSZL 3W56A 2PCYA 5A43C 1I7UA 1JPTL 4JQIA 1PQZB 2PKDA 2XWRA 3GS7A 2QADB 3HUJF 1GGTA 4FTVE 3CFIC 5IEHA 1KB5L 1PNDA 3C5ZA 4L8BA 4RQQA 5D5MA 2FATL 3F04A 3CC5A 2E9WA 4I4WB 4N8VB 3TH3T 2QVIA 4FHJA 1IGML 1JZDC 3AROA 4PWGA 3MRMA 4P9HL 3AB0B 3ZOAA 3F7YA 1VA9A 2A77L 1MVUA 3EAKA 5KUKA 4PY8J 2VLJD 3ASWA 5BVPL 5FGCB 1RPUA 2ENSA 5EPMB 5I0DA 1ZE3H 3NCJL 4G1MA 4KK9D 4F8NA 1WUNT 4LSTL 3TT3L 1JP5A 3RWDA 3SDXB 3T2PA 1D3CA 3RPIA 4QD2E 1FZJA 4J3VA 4L5FE 3BIKB 3V6BR 3SGEI 2QEJA 4IDJL 4FHKA 2WLHA 2CBQA 4GSXA 2MHAA 2IV8A 4LEOA 4AYFB 4MQXC 5LGYA 2Y3NA 4QJ5B 3L5WB 5E8PB 3QEUA 4Z0XA 3SE3C 3B43A 5HHQB 2XIIA 3CV5A 3HFML 1B9KA 1N6QL 3FU7B 1WZKA 3VGDA 2J3SA 5E2UH 2ZPKL 2AQ1A 1S7QB 1K5NA 1QLRA 3QHZL 4KK6C 1AYOA 1YPZE 3UJJH 4A63A 1F4HA 4GQRA 1IZKA 2W88A 3DNKA 3EGSA 3EHBB 1U8LB 2FGWL 3SE4C 5B38B 1M9WA 2XU9A 2AMUA 3O4OB 2EYSA 4I9WD 3U0WH 4U1SA 5DEGA 1OE1A 3F5WB 3V5HA 1TVDA 3LJ3A 5C9JA 3OXSB 4NLAA 3DX6B 4EBQL 1E9PA 4YXHL 1KYAA 4M61A 4FS0A 1AKJA 2HPTA 5I6MA 1OP5H 4MAZA 2CO6B 1SYVA 3ROLA 4MWFB 4JFVA 4G7VH 4AE1A 1AQHA 2HMID 5EF3A 5I9QC 5BMFL 4PJ7F 4GAYB 5E4OA 3G5VA 3QG6A 1FN4A 2P5EB 4DEPB 2I69A 3HKZA 4YHPA 4YGVA 1TZIA 2QL1A 3U0TA 1I1YB 3QUXC 4GRWH 3TJEL 5EEXA 5DQDH 1YYMH 4TPRH 3UAJC 4RRPM 2J2ZA 2BSTA 1RPQA 4BK4A 4LESA 4JFTA 1BF5A 3IDNA 1CLCA 2YXFA 1USQA 4WWKD 1U8NB 1UKQA 2DAVA 4EUPA 3AU1B 3T1FA 1BAWA 1A02N 5LBSL 2MEJB 1BCIA 2KS0A 2NY0B 2J5LB 3CFEB 3L8QA 3SGKC 4CAGA 3W3BA 3SKNA 1J5DA 4M7KL 1JZ6A 1DUYA 1SN0A 4ZXBA 2R2EA 2RD0A 1E28A 4IBSA 3LN4A 4WFEE 1FAKT 3V6FB 4B9PA 1B6DA 4NPYA 5FYJE 4P07A 4PJDE 5KYWB 4IKJA 5EOCH 1KN4H 2LT9A 3ULVC 1H0DB 1CGTA 3RDTB 3WELA 5GPRA 3ZE0F 5FHBH 5HI3D 5BUAA 2PP8A 5ACZB 4Z77A 3LS4L 3WKML 4FRWA 1OSPL 5DZLA 1KYOK 5EZLB 5HHMD 5CLZA 2F19L 4JLRA 5KSAD 5E1HB 3LOWA 4F33B 5DJZB 4F1ZA 4NO0A 3FF7A 2ZNWA 1BD2D 1I7TB 1V5JA 2CM6A 3EFFA 1I1AD 1MWAL 3HN3A 3ME0B 3UO8B 4Z8FL 1MAMH 2CAKA 1DBKH 1R33A 3QJOA 5EF1A 3ES6A 3QUZD 3O3EB 4MJ2A 1OCRB 3FQNA 5PAZA 3OHXA 3L95B 3B6SA 5D9SA 1LDPH 1DBJH 2FL5A 3H9ZA 5TQ0L 3GMNA 4EIZC 5DURB 2UXGA 1CLYH 3DJTA 3EHBC 5F7KC 4B96A 5L4FA 3O4OC 2V5YA 2YA1A 4AMKH 1ZIBA 1RK0A 4JBSA 3T0EB 3BZEA 1KTLB 1DVZA 3V6OC 3D33A 3MZGB 3NCYS 2DWTA 5FUOH 1NLBH 4O9HL 4WEEA 2HZHA 3ECWA 1I7UB 5A3IC 2YD9A 1SUHA 3UZEC 3BGAA 3QPQD 1D9KC 1Z5LA 5C0JB 4ZAKA 3C5ZB 4RQQB 5D5MB 3TNMB 5CCGE 5HGHA 3WIHH 5AENA 1AO7D 5DS8A 1W9XA 2BFGA 4LASH 3VA2C 1SLXA 4GY4A 2GAZA 4PTTA 1D7DA 1EDHA 4CC1A 2ZICA 4K8RC 2FWOA 2OXGA 3QWRD 1H9VA 1BZ7A 4WSKA 2CCWA 4G1MB 5C7XH 5KVGH 4YN3A 2XVKA 3E8UL 3UADA 3RWDB 2GC4C 5MENE 4OGAD 5FGBC 3RPIB 1NC2D 3LIZA 4A6YL 1IIKA 1KFGA 1MFNA 5LCVL 3PWNA 4BCXA 1J87A 2XT1B 5CD5C 3UERA 2W9DH 3WL9A 4YHYB 4Z0BL 4LEOB 4PJEF 4Z7QB 1EXGA 4W68A 4Z0XB 3QEUB 1P7KA 3T08A 3H0TB 3KPNA 4LAQL 4OLXH 3GRBA 2F68X 3PAUA 4WHDA 1U3NA 1T0MA 4K7FB 2VUOA 3N91A 1MIML 1K5NB 1QLRB 5CJXA 3UJIL 1EO8H 5C70A 2C7UA 4N25A 4NZFA 5C0GA 5T3XL 4BUHA 4JKMA 4K3HA 3UBXA 3EGSB 2OJZH 3G6JF 3O0RL 3WY3A 4P4KA 5HI4C 1ILSA 2EYSB 2IC2A 3L4YA 5TTRA 4U1SB 4RGNC 2BSSA 5DEGB 1CGSL 4JKPH 5E8DL 3V5HB 5GZOA 2OAAA 5C9JB 3STLA 3F00A 5EHFA 2OW7A 1E9PB 4N28A 1BREA 5TK4A 3J27A 2W81C 2OSYA 2YK1L 4M61B 1AKJB 3C60D 1FL3A 3NAAH 3RIAK 4I3RH 3QXTA 3HAEA 1SYVB 3ROLB 3EXJA 2DM7A 5J11C 1TJHL 5D70L 4F27A 3EO9L 2FIRT 2VC2L 3NTCH 3QEGL 3DX3A 4M62L 3EH3B 3N6YA 4GW1A 1U41A 1UG9A 3G5VB 1NCGA 4OCWH 1R3IH 5CCHE 1D7BA 2NSXA 3QG6B 5AYTA 1NCCH 4Z3FA 1FN4B 1MW3A 2RHEA 3IU3A 1MRFH 3SPIA 4UCFA 4KKAC 4YHPB 4YGVB 1TZIB 3U0TB 4R4FH 4KI5E 2J8HA 3QAZB 3NH7L 3FRUA 5G4OA 5K1VA 1KYDA 4G70B 5KYYA 1COBA 5JW4M 4Q9RH 4OGYL 2J2ZB 5JHMA 2BSTB 2NMSA 3QJQB 2H4EA 1Q9LA 5DWUL 3IDNB 4HWEH 4KJWC 4XNZB 1CGUA 4OJFH 4EUPB 2WQAA 2Y23A 2NXYB 2XVLA 5EZIH 1J8SA 2NW2A 3T1FB 4AIOA 1IM9D 1AD0A 1U8IA 3MJ8A 4NKQB 4JY5H 1JYVA 3CZJA 4WTZG 4HIJA 4IGBC 5FO7A 1DFXA 1QWHA 2TAAA 5GGVH 1UM6L 4X7FC 4NXSA 5CJOL 3SKNB 3OXRB 4E2OA 3UO1L 1CLOL 4R7XA 5E6IA 5C08E 1TT6A 3JUZA 1DUYB 4LSPL 4N85A 5IV2A 4ZXBB 2E9GA 2R2EB 1E28B 1DJZA 2J7LA 4Y9BA 3WNPA 1GGYA 5GS1A 5A6MA 1A25A 2G2NA 2YMXH 3QIBA 4U4IA 5L4IA 4A37A 4A7GF 3EYFA 1E4XH 1U8CB 3TCLA 3ZKXC 3UAEA 1GW6A 3F6JA 3BQUC 4Z77B 2VR7A 1C1EH 2ESVE 3L2LA 3X17A 2YAPA 5B39G 1J48A 2FSDA 1CPUA 2UXTA 3QUGA 2DYPD 4UB0L 4PJ7A 4PV9B 5A2IH 4NO0B 2ZWSA 1AP2B 3EFFB 4XCEA 3CVHL 1VGEH 3SE8H 1KC5L 5KVEL 2GJJA 3ES6B 2C4FU 4MXQC 4KZDL 3FQNB 5T3ZD 5KVDE 3OHXB 2A6KB 3ZZLA 1BZ9A 2AW2A 2I26N 2FL5B 3TBVA 4Q4IA 3GMNB 2AV7A 4ZDHA 1MFCH 4HC1H 3FQUA 4TVSa 4MD0A 1EDYA 4ZD3H 1VZHA 1NIDA 1A4BA 1HXKA 2BNRD 2BIHA 2FZ3A 1RK0B 1WGOA 3BZEB 1ZWIB 5FLVA 1F6AA 2XZCH 5DMJB 5HJDA 4WFHD 4R26L 3MVSA 4AGOA 3GXMA 5DHVH 2BVQA 3I6GA 1B2YA 1HDMA 1OAZL 4N0CC 3HHMA 3K2UH 3N1FC 4ZAKB 3RY6C 3LXAA 5F1NA 4IBLT 2IFGA 4XE0A 3NJMA 3SDAC 2ATPA 5HGHB 2NSQA 1C8PA 4MQTB 5DS8B 5INDA 4Z3HA 4YSOA 3WTSA 5E6ZA 2NY3C 3QPKA 4LVOB 2GAZB 4PTTB 4X8XA 3RIFF 2Y07L 3W0WE 4HXAL 3FK3A 3BWSA 3B4NA 2FWOB 2OXGB 5IBTL 3BFQG 4AQ8C 4H8VA 3LZOA 3QAZC 1PPIA 2HRLA 1YEJL 1CXHA 1QW9A 2P49B 5B1JC 5I6NA 1GTNA 3GBLA 5FM5M 4HD9A 1QP1A 1YMMD 3QAQA 5DLML 2VJXA 3N5AA 4FG6C 1PLCA 3G5XA 1KY6A 1LO2L 3PWNB 3CN0A 5I76A 3WL9B 2A9NH 4I8DA 5C0EA 1J88A 1PYWA 1YHPA 3IMRA 1EZVX 1A65A 1P7KB 3NFNA 3NFSL 4HS3A 3J8F7 4PU2A 3PE9A 4Y4FD 3NEOA 3KPNB 5MHSD 4XHQA 5GGTH 1GVIA 1A7OL 1MPAL 3HTLX 3WJLA 4BZ2H 1TQCC 3H55A 1AG6A 1T0MB 3FN3A 2BSDA 1XR8A 4OQTL 1EEYA 1N5YL 3OPZH 5HDLA 4TOYL 1UWYA 3ARZA 1OTSD 4OW6A 3TN0C 3MN8A 2C7UB 5HHXL 5HYJD 2X3CA 1MQKL 5C0GB 3D3VE 4KK9C 2IIJA 2W07A 2DQEH 3UMTA 2CD0A 2RA1A 4FJYA 1TQBB 2QQKH 4L1BA 1CBVL 2BSSB 2N0KA 3STLB 4QAMB 1MCBA 4Z3IA 5DMGC 4Y7MA 1DSYA 1H3TA 5DF0A 3L3JA 4KO9A 3GMRA 3PWPD 1H8NA 4JO2H 1FL3B 5D71L 5E5UB 3HAEB 5JOPD 4GKNA 3FT3A 4O2FA 1MCFA 3W2DL 3WFEH 3EYSH 5CMAA 4GW1B 2IWGA 2N1TE 4B50A 1XSKA 3WFDH 1EFQA 1JRHL 5AYQA 3FCSA 2NQCA 4GIOA 3IU3B 4TUKH 3BKYL 2ZCZA 3L5XL 5FYLL 3QCUL 5A7EA 3FRUB 1G7QB 4FLQA 4YIQB 5KYYB 1NWPA 5KSBE 3HFFA 5LGHL 1T6WA 2K45A 2MWCA 1Q9LB 4WIQA 3ROOA 5CZKA 1QFOA 3VGEA 5IT2L 1L9PA 2E7HA 3WD5H 2A9CA 1UH4A 4LQFL 5TQ2H 2WKOA 2JKIS 2NW2B 4HCIA 3GZOA 4BFOA 4D3CL 1U8IB 3MJ8B 3BW9A 1RZ7L 4HIJB 4NN5B 5FO7B 4W9IC 4JK0D 1JV5B 2DM3A 3GMMA 2ITCB 4HMDA 4KTDH 1UC6A 4MXWL 3RWCA 1CXLA 5DFVC 5E94B 5IV2B 2G3NA 2P8PB 4FKKA 5IB1A 3G6JA 1RZJC 3CG8A 4N2FA 4GUQA 5E9DD 5A6LA 2CM5A 3N9GH 1TTBA 5GS1B 1TYJA 3FO9A 4XE5B 3LXUX 4O02L 2VDPB 1LLAA 3WTYA 4F9LC 3QIBB 3QO1A 1YEHH 3CJJA 3EYFB 3TCLB 5JIIA 4WWKC 3SB3A 1XMEB 1P5UA 4QHMB 2R0KH 4MAUH 1DQJA 5DUML 1S46A 2ATKA 2ZAHA 1HCYA 2K78A 3D8MA 4PB9H 3NJGA 1S4IA 1D2OA 3L4VA 4ELME 2CRZA 3VFGL 5HHOD 3HS8A 3CNKA 4XCEB 4YC2B 5E2JA 2BDNL 4Y8DC 1XR9A 3SYQA 2Q1EA 3NRPA 4GO6B 4HFUL 2QGCA 2VDMB 5TE7H 3S36L 1KEGL 4C47A 5CF3A 1BZ9B 2K0RA 3T6WA 3ZSSA 3QC5X 4EI0A 5KVFH 1S78C 2AV7B 4PCYA 4NIKB 4E42A 3FQUB 4MD0B 5DT1L 4TSBH 3VFTA 1BVZA 1CMOA 3QDJD 3VXUE 4M6OH 4S1DD 3TWCH 2FZ3B 5HI3C 3PV6A 4NUGL 3LPWA 5T33L 5FO2A 1BG9A 1XGZA 1F6AB 1ECYA 2JJWA 3ASNB 1CE1H 2EDJA 2UZIH 5C2BH 4BFKA 1SLUA 3MUHL 3TBSB 1JF1A 3FQYA 1TPXB 2YJLA 3I6GB 1HDMB 3MRKA 1FVEA 2VLRA 5E6RB 2J1YA 1I1AC 2F7QA 2P46B 3IDYC 5F1NB 3KPPA 1SHMA 2ATPB 5HPOA 1KZYA 3Q3GA 4GBXB 4JNXA 1QNZL 1ZHNA 5INDB 4IRSC 1N64L 5FUCC 2ZWNA 5A2LH 1ZDSA 3Q6GL 3S37X 2ZXGA 4Q74A 1DE4A 4XOBA 4A7VA 4B97A 3QXAA 1JZ2A 1FSKC 1UXLA 1IO4C 1OP4A 4A7GA 4E68A 4N5UA 2YN3A 3TGXA 3ARTA 2IPTH 1A7QL 1FG2B 3V0WH 5CD3A 4P5TA 2I9TA 1DHKA 2BNUA 2P44B 5GGVY 5T1DL 1B0RA 3OAYH 1P1ZA 1Y6MR 1N6UA 3G5XB 2VQ4A 3QPQC 5I76B 4WFFD 4M8UA 1NOFA 3BQVA 1JUFA 5HGBA 5C0EB 2WLLA 1PYWB 5CZRA 5MEPA 3N1QC 3VWKC 5CEZH 3NFNB 4FEMA 3EJTA 4HS3B 1P7QD 2IANE 2MNWA 3Q5TA 2E86A 3A24A 2L0DA 3KNBA 5SWZA 1JGLH 3OF6A 1EEYB 4P3DA 3FT0A 5DC2A 5JXAL 4LBEA 1B88A 3VFWA 1JGVH 2WTPA 4EMZA 4ZFOA 1ES0A 2W07B 3RL1A 2YXVA 3ARUA 4XVJL 5AVQB 2FD6L 5GJSH 1K5WA 2YO3A 3VFSA 1IVTA 1L9RA 4AL8H 3VQ1C 4TNGA 2HRPL 4FQJH 2EVHA 4ABVA 2LAAA 1ZPLA 3QUYD 4BFEA 5LVEA 1G9MC 2OCFD 4QHKJ 1X4YA 2WJ7A 3N1GC 3N43F 3L3JB 1TEYA 3GMRB 2VM9A 3KPRA 4PJ5A 1E42A 3TIEA 1KYFA 2XYBA 4GKNB 3FT3B 4O2FB 1WTLA 2O72A 2VXQA 3M6DA 4X6FA 2E75C 5CMAB 1FYTA 2XQYG 5GGSY 2XA3A 3EDEA 5JR1L 4XZ4A 1DZBA 4DEUA 3ULVE 3ZVVA 2WLJA 3FCSB 5JA9A 4DT2A 5L8LB 1NAMH 3DMMC 3MRHA 5F1SA 2BRRH 2M83A 3LEXA 4PLOB 3JWDC 1Z3GL 3NJHA 5E2WL 4OAWA 4J2XA 4A39A 1PG7W 4Y16D 3ROOB 3VRLE 3GKZA 4KC3B 3GBDA 5HVFB 2WXLA 2WXPA 5HHVL 1BFTA 4HSQA 3TCXA 5KZCB 1XX9C 4WUUE 4K3JH 3ZO0A 2XKSA 3BW9B 4B7LA 4QXUL 2HJLA 3GMMB 5EOTA 1J1OL 2EYRB 3I6SA 4GBXC 4P5MA 3RWCB 2ICEA 5GGUA 1W91A 1MY7A 3KM1A 4OI7A 4RGOL 2I60H 5IB1B 3CN1A 2Z0BA 4I13B 5E0QA 4MKMA 1HK6A 3PU7A 3V6OE 3QC6X 4HPYH 4BRVA 5I75B 3NBNA 1S7WA 3DXAA 3T0VA 1KOAA 2B4CL 4ES9A 1JWSA 1KBBA 3QO1B 4KUCF 4MX7A 3UTSD 5DJ2A 2MQGA 4NO3A 1AH1A 1WAAF 3RYMA 5D7LE 5CUSL 1P5UB 4A2EA 4WJG3 1BVKA 1QW8A 2IJ0C 1DQJB 3RVUD 2ATKB 3DOSA 2VXUL 5GZND 4DHLA 2FR4A 2BXZA 3B5TA 4R90L 5D93C 1P53A 4I9XA 3G6AA 3ECBA 3UDWC 5H2BA 2ODHA 4Q6YA 2X1XR 3FTWA 1A0QH 1AFVL 1XR9B 3ZDXF 3AW5A 1SXBA 2NY6D 4KDTA 4P05A 4ZNEE 1EJOH 2BHFA 4YQXH 3VI4A 4ZMXA 1Z5YD 2QELA 1XCXA 4E42B 5I1KL 5F1OB 4KOBA 3VFTB 4ZS6D 2H0EA 5T5NG 2JB6A 4ZS7H 1A6UL 5IB5B 3PV6B 1MXDA 1JD7A 1JHLH 3I6LD 2QFRA 5DZ9A 5DD6B 4L3EA 4XWOC 4RDQG 4JM2D 3I85A 1EDQA 5BOPA 2A6DA 5ERWB 4UAOC 2WVTA 4HEME 5JTWA 1JF1B 3MRKB 5D7JD 5IW3A 5DJXA 1NUDA 4Q8BA 1JV2A 1FVEB 5EFIA 1I85C 5HY9A 3VDCA 3WS6C 4WV1C 2CALA 3Q3GB 1FLRL 2JKJA 1ZHNB 5FYKH 3R18A 4QIRA 3ZHLA 1UEYA 4LP4A 1DE4B 3LVTA 1L9QA 1UVQA 1ADWA 1D5ZA 4OD1H 4RGNE 5D7KE 4ANVA 2NY2B 3MLXH 3ML9A 3QXAB 1G43A 4HIPA 2D0HA 3C6SA 3QO0B 2G2PA 4RH4A 4NUJA 1JAEA 2NY4D 1DLHA 2HLEB 4JFSA 4P5TB 5CD3B 2I9TB 1EO5A 4M9PA 2BNUB 3BZ4B 4M9OA 1B0RB 2YAEA 1P1ZB 1ZGLA 4PRID 3WUWB 4CRPA 2D3JA 2LLLA 2DLTA 1QA9A 4TTDD 5D2LF 5ALBH 1FH5L 1JUFB 5C0CD 5HGBB 2HP4A 1CL7H 2WLLB 5ACMA 2WK2A 3O2WL 2Z8WC 5MERA 4OV5A 5CEYA 2ODIA 2R23A 3KNBB 1AC6A 5SWZB 4HV8A 1CJYA 2X89D 3BLKA 4PPTA 4LBEB 3RAJH 3VFWB 4NP4L 1UM4L 1BFOA 4ZFOB 4NI6A 1ZLUK 1FVDB 3SKJH 5ANMA 3QQXA 1ES0B 1O7VA 5DHXB 3IRCA 5E00A 5DO2D 3VFSB 1LNUA 4B5EA 1OOAA 2Y06L 2OULB 5D4QA 1TZGL 1QOKA 1YG9A 1QUNA 1GPOH 2BSED 2GEQA 4NKOA 4PJCF 2X0UA 3E1ZA 5LBVA 3GBEA 2OL3L 2VR3A 3T3PF 2AZAA 1CFTA 3IDXH 3KPRB 4UT6L 3RHWK 5M7QA 4PJ5B 1RD6A 3TIEB 2YLKA 3KBFA 2H5UA 3BKMH 4Y4FC 1B90A 4JPIA 4Z18A 2WXOA 1NIEA 4X6FB 4KV5E 2ZX7A 3G5ZA 5IEKA 5CINL 2D03L 2LR4A 1FYTB 2MPVA 4U4BA 3VFRA 2WLKA 15C8H 1RZQA 3GBNL 4Z7UE 5BOZG 3GUTA 3ALPA 2YMTA 3LPOA 2ZSWA 4YK4B 3SO5A 3PDGA 3BVUA 1S6NA 5F7NC 2AI0H 3K4AA 1ETA1 3MRHB 4PJ9A 2JJSA 3LEXB 4PGDA 1PX4A 4HZ1A 4ADGA 4OAWB 3Q5YA 2VERA 1J9CT 2M2DA 2YGPA 4JFYA 2ZUSA 1RURH 4NT6A 4R96A 2YSSA 2VL5A 1NCNA 2DQMA 5EU5A 2F9BT 1I7ZA 1O6TA 1ASOA 1I82A 2XTLA 3CN2A 2ZUQB 3VI3A 3ESPA 4U1MA 4GLRI 5DC0A 1OT4A 5INCA 3RNKA 2BM3A 1G0XA 2HJLB 5EOTB 5FHAH 3QP3A 5K69A 4TVPE 1QNIA 4AEEA 4P5MB 2D3VA 2ICEB 1F11A 1M57B 2WC7A 5GGUB 1S7VA 3PGFH 5JPMC 1KPVB 1SXZA 4FQIH 4UIKL 5F3BB 3HG0A 4FXGC 4LCWE 4N20A 5H37G 1DQMH 3VYOA 2CR6A 3IBEA 1S7WB 3DXAB 3EJZD 1ZLWK 3RRQA 5A1AA 1BXUA 5JQHC 5AZ2H 4NQQA 1QD0A 3PP3H 5D6DC 4DQOH 1JWSB 5AZUA 4MX7B 5E2UL 5DJ2B 4PBDA 4NO3B 2HH0H 1DBBH 4IOFD 5ISZD 4F57H 3RB7A 3GXDA 4HEPA 3HN5A 1BVKB 3MO1A 3UJJL 3DOSB 5I8EA 2FR4B 4W4OC 2WLIA 3IU4H 3U0WL 5D96B 3ARSA 4PCKA 3T8VA 3G6AB 2VDRH 3PL6A 3ECBB 3CSBA 1E5AA 1O6VA 5H2BB 5HGDA 1HZKA 3V10A 2H1PH 1FNHA 1S9YA 3ARBD 4PHXA 2WP3T 1MREH 4JHWH 2KQNA 5FIEA 3VI4B 1SDYA 2R0ZL 1FNFA 4PJAF 1WJ3A 1IZJA 4HJIA 2XFGB 4G7VL 3KPMA 4OLUL 4PGZA 4ZW8A 5DEZA 4B95C 1ZS2A 4XPAH 4KJPD 4AC2A 4BUQA 5HI5D 3LY6A 1SJMA 3T6VA 2KLTA 3PJSA 1JJUA 1VJSA 2YOCA 2RACA 5HYSA 1MNNA 4JHBA 2YJQA 3IB4A 2YUXA 4L3EB 3WNOA 1SRDA 1VERA 1KWKA 1RIHH 4XMLH 2A6DB 4XMVA 5BJTA 3EIFA 1Q1JH 1FV1A 3T3MF 5C0IA 3N41F 2FAUA 1E5UI 3MJ7A 1XD0A 1YYML 2YPLB 5DQDL 5EFIB 3ARED 5HY9B 5IIEA 2VLJE 2EIKB 5DHEA 3KHQA 2BY1A 5JHDA 4H8WC 1D7FA 4ZUWA 4IIQA 4YBLC 1ZV9A 2VXSH 4M1DH 5ES4B 2R0LH 3D08A 4OZIF 1UVQB 1D5ZB 4HWNA 3EJYD 2HVJB 3N50A 5EIIG 4EN3D 1JZFA 1WAAA 1PTZA 3ISWA 4NUJB 1M3IA 3FQ2A 1DLHB 3RWHA 4GW4A 1N5AA 3UTTE 1E4HA 2X7LA 1RV6X 2PABA 1ZGLB 2WKGA 3TA3A 3ZDWA 3ZQXA 5EO0A 2ZUUA 4JDZA 1QA9B 3RILA 4U1HA 2ZYHA 5EOCL 1KN4L 1S7XA 2WYZA 3NIGE 1INQA 5MERB 5FHBL 2WBJB 3BPOB 3GSVA 4YVNA 4DP1X 4EAEA 4OV5B 2OPCA 4X8GA 5CEYB 1L9OA 4B60A 1SN2A 2R23B 1A66A 4HV8B 4I9WE 2LQRA 3TO2A 2ZKYA 5HDBE 5I1DA 2ZCHL 5DC9B 2CBMA 3AQDA 4M6AA 1BFOB 4JRXA 3GSNH 2D4DA 2FGZA 4Y4KA 1ZSDA 3QHFL 3DOIA 4OZHF 5H37H 2WUBH 1MAML 1NLDH 4H5SA 1LNUB 1DBKL 2UWEF 2DICA 4JKKA 4WGKA 5E00B 5TF0A 4LPTA 5DRZA 4B9IA 1AY1H 1WS7A 3OKEA 1QUNB 4B0MB 4YLCA 1GL4B 1HAUA 4NKOB 4U1NA 4HKXA 3NCXA 1LDPL 1DBJL 3MNZA 3P54A 1Q0YH 3CGTA 4KJYA 4R4BA 1CLYL 3F65A 1CFTB 2H26A 3D4GA 1PF3A 3BVVA 1UJ3C 3QQDA 5D96C 4AMKL 4JPIB 2IEPA 4BINA 3G5ZB 2IGLA 5FUOL 3WDJA 1A1NB 3VFRB 3GUTB 3RDTD 2P7TA 4XP9H 2ZSWB 3QCTH 4CBZA 1QWUA 4TKWA 4W9FC 2WUCH 3MRIA 1IJNA 4PJ9B 4PGDB 3QDGD 2MCAA 1BQHA 3BWUC 2HX8A 1PG7H 1U3YA 3V4VA 4LASL 3QUYC 4KJQC 5F7WC 4D9LH 4JFYB 1G9HA 2ZE0A 5E1IA 3RVXD 2PTTA 4NT6B 1P6WA 1E2WA 3KPSA 3GO1H 5D2LA 1SPDA 4R96B 3ZE2F 5IOPA 1WG3A 2YSSB 2X6UA 4X2UA 4DZBA 4ZFFA 5F7DA 1I7ZB 3WEMA 4GT0A 4MQSB 2GCYB 5C7XL 5KVGL 2QPUA 3VI3B 3QBTB 4U1MB 5INCB 1UXWA 3QHTC 3RNKB 3RTLA 4V11A 2NSMA 3N85H 4AM0Q 2X6AA 2Z91B 1SXAA 1F11B 2BLFA 3OQ3B 1S7VB 5CP3A 4ZW7A 1XGPA 4U31A 1HOEA 2W9DL 4HSCX 1NBQA 2XN1A 3HVNA 3JWOC 1IEBA 4Y7OC 4ZW5A 1MNUH 1OM9A 4PMFA 5CNHA 1EJFA 2X70B 2XTJB 4OLXL 3IE4A 4KO6A 5DZJA 5HHME 5F70A 2DIBA 4Y16C 2ENPA 3CFKA 4BE5A 1WWWX 1Q0EA 1EO8L 1MFAH 3FRPG 2RQ8A 3QQNA 4PLJD 1BD2E 2FHCA 4Z7OB 1T5WA 1LK3H 1WO2A 2OJZL 2OMXA 2OCCB 1M56B 1E90A 2B39A 2YD4A 3KJ4C 3BXNB 3GMPA 4XMTA 3PL6B 2WBJC 4JKPL 1MDTA 2YFOA 3SY6A 4LP5A 5HGDB 5DS1A 4DP5X 2RIKA 3LNHA 1S9YB 3WKNA 5KJ7E 4XPTL 4N3TA 1NL0H 3QUMA 2QGEA 5TFSH 3VO0A 3NAAL 4I3RL 3CZGA 2ZZUT 3JXAA 3ZIMA 4UUJB 4NO5A 3T0AA 3NTCL 1YEGL 3LNIA 3ZHNA 1D5BA 3GLAA 3ESOA 2W1NA 4N6QA 4OCWL 5D7IA 3PJSB 3TZVC 1TCRB 3GTNA 1X5AA 3JTBA 4WI0A 3Q2WA 4F8LA 2VAAA 3NRFA 3HZVA 5HYSB 5ITFA 2CIIA 2FUTA 3PP4L 1MRFL 4LHUA 4ZG1A 1AO7E 3NJVA 5GZNC 3BFOA 3OGCA 4R4FL 3MTXA 5BJTB 4PH8A 1FV1B 3D51A 5C0IB 1JTTA 1YJDL 4LL1A 5E5LA 3ARXA 3MJ7B 2Q6WA 5DZPA 2PYEA 5IIEB 4Q9RL 2BRQA 5A2CA 3LEVH 4PIRF 8FABA 1F1DA 3QK0A 4ZUWB 4IIQB 2ZJSH 3ABLB 2NT1A 3KBPA 4OJFL 4LLQA 5EZIL 3GLDA 1S9XA 4OJYA 2WXMA 1BWWA 2SODB 1NC4B 4JY5L 1HXMB 4M03A 1NEZG 2YRBA 4ZS6C 5GGVL 1DVUA 3MRJA 3F7VA 5FS5A 1FORH 4PJXF 1DQDH 1IBGH 5JMOC 1UD6A 4Z3TA 5CILH 3OV6A 1MY5A 4JM2C 4GW4B 1IFGA 1N5AB 4N90D 4NKMA 4XO5A 5H8DA 1JXJA 3DX4A 5BRPA 1KG0A 3EBGA 1ND0A 5EO0B 4PQXA 2GSIA 3DSFL 5D7JC 5CCJA 3SKUD 3B2UC 4U1HB 2ALAA 1S7XB 2YMXL 3JUYA 1INQB 3OHMB 1I31A 4RSYA 3ISRA 4G9FA 1E4XL 3GSVB 5FR3A 3L81A 4MAYD 3ARDD 5F9OH 4BSJA 1XMWA 1C1EL 3OJVC 4L1DA 2J1KA 1BVOA 3S5ZA 3TO2B 5B3JE 5I1DB 4R5XA 5KEZA 3B7UX 2AAAA 2NY5C 4PWHA 4JRXB 2DKSA 4LSRH 2DD8H 2YLHA 4Y4KB 2PO6A 1S7RB 2G2RA 2HTLC 5TD4A 5LQBH 1VGEL 3SE8L 2NY4C 4H5SB 1CGVA 5ANHA 3P40A 1BAFH 4KY1L 3DTUB 3FF8A 3OKEB 4X6DE 4Z7WA 2WYTA 1YNKL 2VKWA 4U1NB 4HKXB 3MNZB 4TTDC 3B56A 2JCWA 2QV2A 3MR9A 4KJYB 4R4BB 1MFCL 3HLAA 4HC1L 4ZD3L 2DMCA 2H26B 3BEWA 2QVMA 4X4ME 4ZXBD 2ZWKA 3QQDB 2J5WA 2AANA 2Y3AA 1RLWA 2XZCL 3QQ4A 4DKAA 4MCMA 2IDCA 3TV3H 2P7TB 1QZNA 2E7DA 4R2GD 2E9BA 2G5UA 5J6SA 5F9JA 2DQUH 5D72H 2WZAA 1BFVH 3K2UL 3MRIB 4JFOA 1SUJA 3FUMA 3PGCA 3GRWL 1BPVA 1XIWA 1UZ6E 1BQHB 1A4JB 5DO2C 2UZXB 3FSZA 4OLYL 3V4VB 2VOTA 4YSUA 4PSPA 3VACA 4PS4L 2PTTB 3KPSB 4GAFB 5D2LB 4ZMNA 4A38A 4DZBB 4WGWB 3RURA 4ZFFB 5F7DB 2B2XH 1R3KA 1NMAL 3HJ0A 4N1CA 1G7PB 4KFMA 1UXWB 5CU9A 5I1CH 4LSVH 4UQCA 2ZX8A 2XOTA 4XP1H 1E27A 3CMOH 4CVXA 1XGPB 3IVKB 3X11B 1ZLDA 2A9NL 1H3PL 4FL4C 4GYBA 4TV3A 4OZHA 4UILH 4G5AA 5D1XD 3RWJA 1IEBB 4GMTH 5TGBA 5TE6H 5CWSB 5H4YA 4TSCH 1L6ZA 4RFNC 4W9DC 5BZDB 4BZ2L 4P2QD 2C9QA 1BLIA 3LRHA 2CE6A 1UGNA 4FX5A 1M71A 3CFKB 2IDSA 1KCRH 5LG1A 2XFXA 3NSYA 2WAQA 4TF4A 1T5WB 2OMXB 2DQEL 1I9JH 3RG1C 4S1RH 1IE4A 3SGDI 1EMTL 3GMPB 2VISA 2QQKL 5IQOA 2Q0ZX 3QXWA 2HFGH 4IRZH 1NGXA 4YL9A 3DJ9A 1Z9OA 2YBRB 3LXCA 5FLUA 5AKRA 3DETD 3QUMB 4JO2L 1VHPA 4NNPH 5T3XD 1IAII 4E41A 5LHDA 4HUMB 4NO5B 5DK3A 4WFHE 1UOVA 2PXYD 3WFEL 4RAHA 3EYSL 4XXCA 4KX7A 1X4ZA 4NZTH 5D7IB 4FMKA 2V3EA 1A6PA 3WFDL 1EERB 3DSNA 4WI0B 5ITFB 4Y4HD 4PCSA 2VAAB 5F0PB 3HZVB 4DJMA 2CIIB 4LHUB 4UQIM 3TFKD 3OGCB 2M1KA 3OKDA 4PGJA 2XN9B 4MJ5A 1OP3K 2Q6WB 2PYEB 1T7YA 4FFZA 2Y5QA 2DTMH 4FQQA 4P4KD 4WQOA 5EN2A 8FABB 3ARBC 5FXCH 3WD5L 5KOMC 1U2YA 4PLKC 3K6NA 3SCMD 1MWOA 5CU5A 5TQ2L 1YMME 5B4MC 4LLQB 1U2HA 4U1LB 1S9XB 1K72A 2WQXA 2DLFH 4KJPC 5D1QD 1DFBH 4N1HB 5I17A 5HI5C 3MRJB 1NCHA 3F7VB 3SSGA 4QLRA 4MNQA 4KTDL 3RBSA 3WNNA 5I8OH 4NKMB 1T2QH 1ID5I 2J12B 2YD3A 1TEGA 1KG0B 4ZO8A 4HVBA 1I53A 4F37K 1ND0B 2FUQA 3N9GL 2GSIB 2OZ4A 3AQYA 2XNAA 3SDCA 5AW2B 1OW0A 2EE0A 3WENA 2C3WA 3UMNA 4LRIC 4G9FB 1YEHL 5HYJE 1R5IB 1X7QA 1FNGA 5AB2A 3T2OA 2R0KL 1ZLUH 4MAUL 5D55A 4E9QA 1F5WA 3QI9D 4MZRA 4W9EC 1CD9B 4PRNA 4MS6A 3TVMA 3BPCB 2HT2D 1E7VA 4G6FB 2UVFA 2GT9A 2VZ3A 4EN3C 2PO6B 4YFLI 4ESKA 2Y7SA 4J6RH 4UTBH 1HE8A 3PWPE 4X98A 4OR1A 3STZB 3ARYA 1DSFH 1KCWA 3RIAF 3PYCA 5TE7L 1KFAL 2W8CA 2YRLA 3CPLA 2DWYA 4OD3H 1BJ1J 2FO4A 1PLAA 4Z7WB 2EE3A 4M93B 3WGUB 5BQ7A 2XPGA 2ZWZA 4OCRH 4J4PD 5E6ID 5KVFL 3MR9B 5CIPH 5IQMA 3DVGA 3T0XA 3HLAB 3BEWB 2CMRH 4TSBL 3WE1A 3PWLA 2DL9A 3GSRA 1QBLH 1RP8A 4M6OL 5FYJU 2FJUB 3TWCL 4A2GA 5C7ZA 2BJML 2VN6A 4AH2A 3MRDA 2G3XA 5FKPA 4JL1A 2UZIL 5FDWA 4N1EA 5C2BL 3IAGC 2A3TA 4U3HA 2HLAA 3L16A 1DTUA 5F9JB 2GYSA 2XI9A 8CGTA 4PJXA 2RGSA 4PJ8D 4HUXA 3PGCB 1MFBH 4HS6A 1XIWB 4W70A 1QQDA 3BPNB 2CUHA 4JREB 4O58H 4UTAH 3N55A 5T5NF 1JXDA 1HHHA 1XL4A 1EAJA 1J0KA 3WEAA 3WEBA 3DHPA 2X4SA 4YSDA 2N3JA 2JH2A 5SV4A 3QEQA 4DQAA 2ENYA 3BD4A 4ODWA 2BVEA 1JZ5A 1PLBA 1R3KB 1QACA 2V5SA 3RB5A 5D7EA 4Q58C 4XZUA 5E9DE 2WGXA 1IBYA 2V7HA 3X1NA 3X3GH 5C1MB 5I18L 4FNTA 3ABMB 4IHOA 1E27B 5JXED 5EULV 3TJHD 2JXMA 3GIVA 3M07A 4IS6A 4RZCA 4CVXB 3D2TA 2P80A 5DC4B 4JZJC 2EDHA 4GKOA 3RWJB 4KNQA 5CEZL 5TGBB 3AMLA 4PRDB 3ZIYA 3P3YA 3V7AG 3FTSA 1YEFH 3GSXA 1HE7A 1NFAA 1UB6B 4H1LG 3RJQB 3SOTA 5EH1A 3RVXC 1JGLL 3HC3H 2F54D 1M71B 2GKIA 4HUWA 2A74A 5HHOE 2XFXB 1JGVL 3WHXA 1BYOA 4KRNA 4IOSD 3VGAC 1FFRA 5I1JH 2MRYA 3U4KA 2IDTA 3OJMB 1IAOA 5LBGA 2CHDA 4R97C 4M3HA 5I2IA 2VISB 1M7DA 4AL8L 5T3ZH 4DUVA 2Y2YA 4P9HC 4FQJL 1T83A 1NGXB 2HKAA 3QXUA 5A2BA 5JYLA 4ISVA 1H8OA 5I15H 1A3RH 1A7RH 2WCSA 5F1KC 3ZKMD 3GI8H 1XL6A 4XT1C 5JIDA 1OCZB 3QG7H 5EU6A 5B1BB 2KI6A 2RBLA 2V2WA 4E41B 5JIKA 5I23A 2YKLH 5J1SC 1ML0A 1QFWI 5L2KE 25C8L 3DPDA 3BJ91 4L9DA 4B9KC 3ERXA 4NC2B 1G4RA 4IBWA 2JELH 5DTFA 5F3HA 3DSNB 3I2CL 5J9PA 2FECI 3HG3A 1ZT7A 2Z7ZA 2APWA 1NAML 5E0FA 4ANXA 4F15C 5AB1A 3RX8A 1WZMA 3C5JB 4MJ5B 4DFIA 4W9JC 4HKJA 1ID2A 3RTQC 4X7TA 2YAHA 5IP4A 3U9WA 4FQQB 3SPCA 5EN2B 1NFKA 3D2UD 3T77A 2OMZA 5K9JH 3LMJH 1K3IA 4ZODA 3F3HA 2CHNA 3RA7L 3FOMA 3R4DA 4GG6A 4K3JL 3EJCA 1UACH 4I0CC 4N6RA 4XH2A 5FYLD 1A7BA 1LP9E 3OBAA 5E2VH 1LL1A 2CPUA 1GZQA 2OP4H 1V55B 3JTTA 2NX5D 4PVBA 5I17B 1SBSL 4WFFE 3BPNC 4WO4D 4JREC 4MNQB 2B15A 4JQVC 3ZXAC 1Q72H 1W72A 4Q6IB 2I60L 2UV3A 4R7LA 3S4SG 3BIBX 4HJUA 2B8OT 4Y5YA 3UEQA 1FFOA 3ZLQC 2BFVH 4HPYL 1PZUB 2WSKA 1FGVH 4PJHE 2XNAB 3SDCB 2L7EA 3MLSH 4X6CF 2K70A 5CXPA 2AITA 2R29A 1X7QB 2L04A 1FNGB 3JQOB 2RB8A 2J20A 5KW9H 2R83A 2P3YA 2DIJA 1ZV2A 3I74A 4BZ1A 2ZWLT 1KEMH 3TVMB 3M7OA 4DKFH 1SFDA 1LEKB 5DZVA 5KZCD 3U1PA 3NJNA 3SYCA 4GH7B 3GDCA 1C5DA 1ECZA 1A0QL 4X98B 2PPCA 1JCVA 2A9AA 5GSVA 5JUEH 1KJ2L 3CPLB 2BS9A 2ZOTA 1EJOL 2FO4B 4YQXL 1TZHA 3HNVL 4H1LH 5BQ7B 2XPGB 4AM0A 3DVGB 2W60A 1IGIH 3H54A 5E95B 3BZFA 3PWLB 2OMWA 4ZS7L 2D3LA 4X4KA 4MAYC 2NYZA 3TM6A 1AGCA 3ARDC 1KDIA 1JHLL 1AXIB 5FKPB 3NJLA 2OYLA 1WZ1H 5FDWB 4ZMWA 1BA9A 4L9LC 3QZBA 4KKPA 3W37A 2HLAB 4PV8A 1U3ZA 3IFLH 1EAPA 2FVNA 2OJ1A 2J71A 1NANH 2FK9A 4PJXB 3WJJC 3W9DA 4HS6B 2ZCKH 1QQDB 4F2ME 1U3JA 5FYKL 1A2YB 4R8WH 2AGJH 3ZUNC 3SD2A 4TULH 5FV2A 2X4SB 2VN5A 1R3LA 1LO0H 2X1OA 3BD5A 3HRZA 4HCRL 4YHMH 1OT2A 4X5LA 4KKBC 3MLXL 3VTMA 3C9NA 3CZFA 4ODWB 2H0FA 2AF2A 1CYWA 2WQUA 3TLRA 3BSGA 1VENA 4XZUB 4OIBA 1NFDE 3CFUA 3VSTA 3ELQA 2V7HB 2DIAA 3ARGA 2BY0A 1KLGB 1XB3A 4GI6A 5T1KD 3N1PC 3SN6N 4IHOB 4F24A 4R2GC 1X5YA 3FCTA 2JXMB 3GIVB 3MSPA 4IS6B 4RZCB 3UTSE 5ALBL 1WBYA 5DHDA 1CL7L 2PNDA 1M05A 3ASOB 3VMOA 1FDLH 4FFVD 3ZT7A 2ZXEB 3I9GH 4M1GH 3GSXB 2VLRD 1E6JH 1SF5A 2B1OA 4WWNA 3VW3L 4NHUA 2X1QA 4HUWB 2A74B 2DF3A 1FP5A 5IKCA 3WHXB 1DVTA 4BA0A 2EEAA 1V05A 3SKJL 1B0GB 1J5IA 2X4UA 1IAOB 2ARWA 3EYQC 4QRRE 1OWWA 2NY2D 5I2IB 1M7DB 2NXZB 2NY1B 4F2FA 5I74B 4L23A 2E59A 1GPOL 3VWJD 4YX2H 5BUGA 5ICUA 2DLHA 3UYPA 1IGJA 5EU6B 5D1XC 3IDXL 3I6LE 5E6UB 4DGVH 2VR6A 3IJEA 4BQCA 4YE4H 1MW2A 4G5ZH 4GAJH 15C8L 1OANA 1JGIA 4FI7A 3I3EA 4EOWH 5E4AA 3H3KA 5DTFB 2X38A 3MTRA 5F3HB 3US9A 1HYSD 5J9PB 4AI7A 3DIVA 4AVJA 1J8HA 4PV1C 1ZT7B 2AI0L 3N1MC 3CZKA 4C56B 5SWZD 4L1SA 2SEBA 2XACC 5K59F 5L8JB 5D4IA 5GIRA 4S1SH 4GMSH 3QDMA 4X7TB 4MJ4A 4PJGE 1RURL 2WXFA 3T77B 3QFJB 1CIUA 4ZMYA 1JN6A 1GZHC 2BVPA 2APXA 3Q5OA 5CFAA 3FOMB 5D1ZD 7CGTA 4GG6B 5JPNC 1SVCP 2LLNA 4XH2B 3QIWC 2ZXQA 2DH3A 2PXYC 1GZQB 1B0IA 4PRIE 3JTTB 4TL4A 5FHAL 5CBAA 2G5RA 2VQ1A 1REIA 1YRKA 1UA6H 1W72B 4UT9H 4Y4HC 5IQNA 2V7NB 3PGFL 3FH7A 4FQIL 3TFKC 2FHBA 3VFMB 5BV7H 1ZLEA 4HF5L 5DD5H 4N2EA 1UT9A 4X83A 4Y5YB 3E9UA 1FFOB 3SPGA 5CJ5A 3LRMA 1DN0A 5JOFA 4IRJD 3TS8A 1S9VA 4M5ZH 4DQOL 4QAWA 5I24A 2BIMA 4U1KA 1J0IA 1ORQA 3P2TA 2HH0L 1DBBL 3SCMC 1MJUH 3P0VH 3WMPA 1QSZA 4Y2DC 3QORC 4QEGA 3ZL2A 4B41A 4F57L 2WLMA 4AEIH 3OKOA 3HE6B 5DVMA 1N7MH 4KQ4H 3PPEA 2ZP8A 4YHIA 3IU4L 2FNWA 4BH8B 5D1QC 3EOAA 3FFCE 4HBCH 2VDRL 2ZF9A 4B53A 1UENA 3HZ3A 1NCAH 1C5DB 4JRYA 2J4WH 1ZXKA 2H1PL 2ZIDA 4IQHA 2GJ6D 5GSVB 1TQSA 4GXUN 5IWLC 2XZQH 3DI3B 2DQHL 4KNTA 3RUGE 4G2AA 1MREL 4HJ0D 4JHWL 1TZHB 1OAXH 2V8MA 3ARFA 3BZFB 2VDKB 2OMWB 4O5LH 1AGBA 2CKBH 1AGCB 3DUSA 3DXAD 3H3BC 3EFDH 3WTXA 2FIKA 2J1ZA 4N2DA 2QKIC 3QI9C 3JWOH 4ABQA 3T09A 4GRLA 4XMLL 3NCFB 2E6QA 2C9RA 4PV8B 5IFJB 1Q1JL 3PQYA 1XWVA 2EIEA 4CC0A 1R0AH 1AZCA 1EAPB 2HT2C 4JFFA 1HIMH 3D39D 5K9KA 3W9DB 3FUJA 3EO1A 2CGZA 4K94H 1E9OA 3WFCH 3ZL4H 4LGRB 3H3PH 2VXSL 1W8OA 2WIIA 4G8GD 2YGNA 4M1DL 2EADA 1R3LB 2R0LL 1CE6B 4J4PC 3FT2A 2P8MA 3C9NB 1QABA 3CZFB 3NUKA 3T04D 3ZY7A 1C12A 1PX8A 3SBWC 4X6CA 5IW1A 2V6HA 3LPFA 3S5LG 5AW3B 1ESOA 1XXDC 4Y1AE 2EC9U 5CGBA 2BERA 4JN2A 3ARGB 1P2CA 4UM8B 5C0RH 3SKOA 1K8DA 1Q9KA 2P4AB 2H6PA 5FA3A 3QH3A 3FCTB 3SQOH 3U6XS 4AYEC 3O8XA 5I30H 1GJUA 2CQVA 2VR9A 1WBYB 4P57B 4PJ8C 4JW3A 5ISZE 1M05B 1PNCA 3A6OA 4HK0A 4J12A 4PJIE 4XOCA 1TQTA 1QSFA 2DM2A 5AD0A 2JKNA 5IB2A 4LLYA 2WB7A 4UQ9A 4QXVA 3AWGA 4OCLC 3HZKB 4PJFE 3NQIA 4MDIA 4NHUB 3FO0H 3Q8EA 3L3KA 4IMKA 5IKCB 1OKEA 4D2NA 3RP1A 3FU5A 4KGJA 3ZT6A 1IM3D 3GSNL 3BT0A 2X4UB 4RMTA 3J7HA 3FQXA 1IV8A 2DQDH 5F6HI 2WUBL 3HE7A 3IAPA 3RVWD 2IH3A 3BKCH 2DKMA 1AY1L 3B3BA 4Z7VF 1FG9C 5JXEC 3TJHC 4PG2A 1Q0YL 1IGJB 1MXGA 4DPAX 4OQ1A 3HE6C 3TEWA 2BNQD 5L0QB 1DANT 3QJRB 2DIEA 5I71C 2LTQC 3IJEB 2R4SH 2ZYRA 3I3DA 5E5MA 3UPRA 3L2MA 3FUFA 2E7BA 2DLGA 4XNBA 2NR6D 4XP9L 4RETB 3IMBA 3KDMA 1NCIA 4NOBA 3E38A 3WEOA 5D7SH 1LWRA 3QCTL 2NRDA 3UC0H 4W6WB 1NPNA 2ED6A 3FSOA 4YNYA 5EO9A 1J8HB 4X0NA 2KQMA 2IF7A 4MYWB 2WUCL 1OE3A 5JW3H 5KS9E 2VZVA 5I5RA 1AZRA 2WLNA 4ODBD 5GIRB 2X2YA 1RK7A 4I0PB 1PG7L 3QDMB 4W93A 1LJMA 1FIEA 1J05A 1SEQH 3PHOA 4D9LL 3DYPA 3QNXA 5BS0D 3ZKMC 1P9MC 3D05A 4FZ8L 4N8VG 4WW2F 1MG3C 2BVPB 4DF9A 5IMLA 3D34A 4HK3N 4M48H 4Y19D 4LDLB 1IU1A 3AS1A 4JCLA 3ZDZB 3ZR6A 2ADYA 4QRSA 4X6BA 2ZTBA 4U6TA 3KYMA 3AT0A 3V95A 3ZE1F 4JFEA 2IO5A 4LSSH 2VQ1B 5LAPA 5CBAB 3N85L 1D6EA 5J57B 4XCYA 4X4XA 3UG5A 4FEIA 1HI6A 1EGJA 5CN3A 3HS0B 2DQIL 5AAWA 4LGPB 5C3TA 1MKFA 1KIUB 4NUPA 3LHPH 1MNUL 2XPYA 5JOFB 5FO8A 1G7IB 1JZIA 2COQA 2FSEA 2MOQA 4IBTA 4DAGH 3LXBA 5I1IH 3DI2B 4PJ9D 4U1KB 3HCVB 4Q7DA 1MFAL 3Q2LA 5IFHH 3VSQA 1KGWA 3D07A 1LK3L 3MRCA 2WJ5A 3OKOB 1P4UA 2JCCB 1TTCA 4YHIB 4L18A 5G4MA 3SDDC 5ENWB 3EOAB 4WO4C 4U6VH 3O4LB 3ZUCA 1SOXA 4GAAA 4JRYB 1BGXH 1B9ZA 3RHWF 1WBZB 4MJIA 1FVCB 4NDMA 4NXKA 5F0LB 4ETYA 1K4DA 1NL0L 4CU8A 4PWIA 5TFSL 1XZ0A 4FERA 3O45A 5I82A 3DIDA 3GF8A 2YD8A 5D4JA 5J12C 4XB8A 3W39A 3EF4A 3ARFB 2CBTA 2GJZA 1AGBB 1I1FA 3RI5K 1QATA 3PWUA 3DUSB 5AW6B 2FIKB 1T5XA 1CICD 4DO5A 1F4WH 1OK0A 3QDGE 1NJ9A 4I2XA 3LPGA 5SWQA 2PYFA 4GRLB 5D7HA 1FNAA 3PQYB 4UQBA 4HMEA 4KKLD 3PRZA 3C6LA 3FU0A 1T66D 5TF1L 5J06A 1OCWH 5K9KB 2VLLA 4MGXA 3QQ3A 2IBZY 3EO1B 3LEVL 1E9OB 3GSQB 2ZJSL 2WIIB 3B1TA 4S2SA 5CKAA 1WFMA 1HZLA 3O9WC 3FT2B 4H4NA 4BV1A 3KYOA 2P8MB 4AG4H 1C12B 3KZ8A 3OAUH 2CCLA 4OT1H 2ZAIA 2VLKA 5LO7A 1FORL 1RFDL 2W92A 1DQDL 1IBGL 5I6OA 3UX9B 5CILL 1VFUA 4K55A 4GKLA 2DH2A 3UL4A 4Y5XC 4JN2B 3TO4A 1P2CB 1SLVA 3V2AR 3SKOB 3LZPA 1Q9KB 4F5CE 2H6PB 2KBGA 3NMEA 3QYCA 4QGYA 2DBLH 3QH3B 4NUQA 5FA3B 1AGEA 3O8XB 1MI5E 4JFZH 1X5XA 4HJTA 4HK0B 1ETZA 4NP9A 1PKQA 1QSFB 5AD0B 3APFA 4LLYB 3U4AA 5F9OL 2Q3ZA 2OTUA 5DU7A 3QXVA 3WI9A 5T5FH 4J1UB 5HBBA 5JHDD 1A4AA 2JSFA 4MDIB 1YO4A 3HS0C 3L3KB 5G2NA 1XH1A 4YVUA 4UQEA 4LSRL 1NGPH 2UZYA 2DD8L 5MP6H 1V3JA 4LHJB 5BZWA 1E4WH 1QSED 1QHOA 2X2IA 3CIAA 3FQXB 3CHQA 5LQBL 3Q06A 3HE7B 2E4FA 2DMHA 1GMIA 1JTOA 4KUCD 2IH3B 1PD0A 4X9IA 5J3HC 4R3SB 3GB7B 3CFJA 2XN2A 3RGVA 3RU8H 1ETB1 5GS2D 1J5OH 2WXIA 5LGKA 4APQA 4KQ0A 4W6XB 4FFVC 2XYCA 3TBYA 2OX5A 2VDOB 1XH0A 3LS5H 3ZDYF 1ILUA 3TA3D 3GPSA 5E5MB 3RPKA 4ZZKA 3EOYG 3F83A 4M8QA 3MFGB 3KR3H 1YECH 1ZV5A 4CMHB 3UPRB 4KHTH 4N26A 4P8QA 3NSCA 3TV3L 1MHCA 2L4OA 4NQSB 3FT1A 3KDMB 2YARA 2P8LA 4NAJA 4YNYB 5EO9B 2DQUL 3KLDA 2VZSA 1BFVL 1T7VA 5I1GH 1A14H 3N0AA 4JRXD 4RMSA 1J05B 3PHOB 4NN6C 4NQEA 2APSA 4KNSA 3QNXB 4ORGA 3VWJC 2OFQA 4P46A 4Q0XH 2IGTA 2BO0A 1WD8A 1IVLA 4R5VA 1CQKA 1H3XA 4U3XA 2B2XL 5IMLB 3IDJA 4RMVA 2V9RA 5I5IA 1QPPA 4L1LA 4DVBA 3LRSA 4QLWA 5I1CL 4QRSB 2ED7A 4X6BB 4GS7C 3KYMB 4LSVL 3LTVA 3WUZA 5AWNL 1PSKH 3KEHA 4ONFH 4XP1L 2YGQA 1HI6B 1HYSC 3CMOL 1Q9WB 5AAMA 3ZYZA 5HD8D 4NBYB 3NIFE 5BRZD 3V0IA 1GIGH 1IGYA 5I28A 1OAKH 1RZGA 4GMTL 5TE6L 2MOVA 3AUWB 5FO8B 4GT7A 4TSCL 2FSEB 2MIZA 5CR1A 2XQBH 1CO1A 4IKNA 1ZANH 1HL4A 3MLZH 2JKTM 3FFDA 5D1ZC 4ETQA 5KANI 3MRCB 3DVIA 4AEHH 1I9JL 1TNNA 1H5BA 4S1RL 5F7HA 1G87A 4YAQA 4POZD 1X9LA 2QVKA 1ONQA 4MYPA 2HFGL 5AOKA 2KL6A 3D0VA 4IRZL 2B5IB 2BIQA 4KZEH 5IVXF 2VUKA 2V17L 4J3SA 4WWOA 1ZGLP 4MJIB 3MV9A 4KXAA 4NDMB 1ACCA 4AK1A 3LD8B 5JW4Q 2J6EA 1XZ0B 4NNPL 3ZL1A 1DO6A 2MCG1 3K6SA 1UWGH 1ZD6A 3O45B 3P4OB 4IRJC 3IDUA 3W39B 4HULB 4CA4A 4LOUD 2WO2B 3VD2A 2GJZB 1I1FB 5C0ND 3PWUB 4W1TA 4WW2A 2ZX6A 1V8HA 4AJYV 2X4NA 4BSWA 1MVFA 4HWBA 1NJ9B 4I2XB 5EUOF 2PYFB 3BPLB 4P4RA 4KXZI 1IAMA 3I6KA 4EZKA 4UQ3A 2B4CC 3EW3B 1IKOP 2Y9RT 3C6LB 4P49A 5IB4A 2VLLB 3L3OB 4NQCA 2DTML 3QQ3B 4YPJA 3VDBA 1SHXA 1M2OA 2DJMA 2NZIA 4N8UA 4S2SB 2OL3B 5EBGA 5JHBA 3QA3A 3DROA 1U6AH 1RZ8A 2DLFL 3KYOB 1AHMA 3DX1A 4P9HH 4L0YA 1DFBL 2QHRL 4X7SH 1AQMA 4KGLA 1WAEA 2VLKB 4EUPG 4HXBH 3FB5A 2RH0A 2EUVA 5D1XE 4WKZA 2NUTA 3CVCA 1T2QL 1L0QA 1JWMA 3HMXA 4FQXA 4JPVH 3TO4B 4WO0A 3TV8A 5AVWB 2C9VA 4JQIH 4LSTH 3TT3H 4P2QE 3H56A 1AGEB 4FTVA 1DJIA 4DZ8A 2WKLA 1ETZB 3KW7A 3LRKA 1S7UA 2C4FT 2Y1YA 2CGRH 5F96H 3QZWA 1D7CA 4MCNA 2C9PA 2JQAA 2VSMB 2OTUB 2JJVA 1PZBA 2KKQA 3FBQA 3BMWA 1MZZA 3BGFB 3NIDE 4N3UA 1E0OB 1UKTA 2WNXA 3MA9L 4RMBA 3DLQR 1OAQH 3P3SA 3ZMEA 2YFNA 2UZYB 1KCKA 4YFDB 5BZWB 4ANWA 1WD9A 1WF5A 3QHZH 4J6RL 3UEZA 4DH2A 4HU8A 5T3XE 4Z7AA 1DSFL 3T65A 4J23A 2D8KA 4AGMA 3KE0A 1VFAA 1Z0NA 3FUNA 2LVEA 4AQOA 1YZZA 4S1QL 2MQCA 4XO8A 4APQB 3VD0A 4JO8A 2VSKB 2CMRL 2A73A 2OX5B 3MBWA 1QBLL 3GHPA 4BYHA 2ZP9A 2VXVH 4KKZA 4M8QB 4Z9KB 6FABH 1JXKA 5B8CA 3S3DB 3IJ7A 1ZLVH 3SO3C 1WA2X 4JG1H 2AVGA 1ETJA 1MHCB 4B3VA 2P8LB 1YPZA 3OX8A 1V3KA 3LPPA 2HJFA 1F58H 3WDHA 3BKJH 1MFBL 1JWUA 1MHHA 3CFCH 3H85A 4QKTA 3U6RA 2VUYA 4O58L 3RVWC 9PCYA 4UTAL 1RJLA 1CR9H 4NQEB 3HUJE 2X5PA 2DBJA 3KGRA 2PO6D 2R0WH 4ORGB 5D1QE 3HG1D 4TQIA 4ODSH 2ZX9A 5EC1B 1AS6A 2BK8A 4NQVA 2OW6A 3IDJB 4TS6A 5KJ4A 3GMQA 4QTHA 2JKWA 2NTSP 4BZYA 5CJBA 4DVBB 5LNEA 3SPVA 3L3OC 4KROB 2OA9A 3LDBC 4PGCA 3X3GL 1EK3A 2NR6C 1WBXA 5E24E 2YC1A 1BPLB 4HAGA 4OF5A 4Z7NB 3WN5A 3TF4A 2ZUTA 4E9VA 5GS0L 1IGYB 1GAFH 1RZGB 2OMUA 3KS0H 4RVBA 4P2AA 3LQMA 3BP7A 4R4ND 3HI6H 5JZ7D 1YEFL 3H9SB 4PJBE 5AYUL 5T1LD 2VIRA 1QR1A 4ZMZA 3HC3L 2JI1A 1XIWD 4P2RD 4WFGD 3WAJA 4XNYH 4XAKD 3FW6A 2DQ6A 4EUPH 4UF7C 3RFRA 2EDFA 3DX0A 3FFDB 2W94A 3H4HA 5I1JL 3W57A 4NYLA 5FWQA 1H5BB 3PAZA 1BV8A 4NM4H 4XCFH 3APMA 3RPBA 4YAQB 3TEZA 1NUFA 5CFHA 4MLSA 1M42A 2Y4SA 5T3ZL 4N2IA 1ONQB 1WS8A 3RWFA 3D0VB 1MUJB 4C56E 4WF7A 3UBXG 1A3RL 1A7RL 5I15L 3ATEA 3GI8L 5HGGS 3MV9B 4Z76A 3T2QA 4DGYH 3B83A 1YNTF 3K6SB 4PJDA 4P0DA 2YKLL 4DCQA 3WAKA 1RJYB 4YZFF 2PCFA 2IH1A 1WV7T 1IKNA 3MOAH 2JELL 3HAEG 5BXFB 4HOWA 4BSWB 3MV8D 5DSCB 3N04A 1OXYA 2ZAGA 1KF9B 3WFHA 4P4RB 1XSJA 2NYKA 4PJ7E 5CLTA 3KBHE 4XX5A 3I6KB 4UQ3B 4RWYH 4NQCB 1EHLH 2AXWA 3KW8A 3RNQA 5HSFA 5K9JL 5HPMA 3LMJL 4V2BA 5CGTA 4LLVA 5FCUH 3QA3B 3X14A 1PGRB 5SWSE 5K1NA 1UACL 4MJ6A 1RZ8B 1E6OH 1RVFH 2O26U 3BI9X 5E2VL 2OP4L 2OYMA 2C4XA 4GI9A 4NZUH 1NEPA 2Y1VA 1L9TA 5C9KA 3FB5B 4NAMA 1MJ7H 3N40P 1Q72L 2X4RA 2NUTB 2GFBA 1A9EA 1CICC 1S5HA 5C92A 3MV7D 2VDQL 3HW7A 2CO3A 4H88H 1JWMB 4FQXB 1GYUA 1K3ZA 1A9BA 3ECQA 1C16A 1DVFB 1XGUA 4LLDA 2CU9A 2WTRA 2BFVL 4FE9A 1UCTA 4FTVB 4KKLC 1FGVL 4DZ8B 2F54E 1T66C 1AQKH 3DK2A 3S2CA 2ZD0A 3MLSL 5TH2A 3VCLA 1XZWA 3TURA 2XTSA 4B6ZA 2IV9A 3QZWB 3DO4A 4KZCA 1NPJA 4GOSA 4S0HA 3O6FA 4PGEA 4C4KT 5KW9L 1NINA 3KYKH 1OSYA 5F1IB 2CPCA 3NJKA 1Q38A 2W5PA 5I1AA 3ZHKA 3ZE0E 2EEBA 1D5IH 1KEML 2P5PA 4DKFL 1CWVA 4YSRA 4A68A 5DVNA 5C2UB 5MENA 5LB1A 1NICA 4HIEA 3LIZH 5JDJA 4YDLB 5JUEL 5T3XH 3DGDA 3T65B 5KSBF 4LT7A 4GI8A 3X3FH 1VFAB 5HHNA 4HCGA 4BGDA 3JTSA 4FNLH 4M7ZB 2X44D 1PZ5A 1CGSH 3NGBB 1IGIL 3MBWB 4HHGA 5GGTA 3W82A 4EF3A 2ICCA 5B8CB 4F8QA 1BF2A 2I9LA 2QKSA 1JZ3A 4MA1B 3SD5A 1YPZB 3OX8B 1FH2A 1X5MA 2HJFB 1H8SA 1ZVYA 2ZCKL 2VZTA 3II2A 1JWUB 3K5RA 1CDHA 1MHHB 3U6RB 3WNJA 3INOA 5FWRA 1RJLB 4YFLF 5B7FA 1BEYH 1JL8A 3DTXA 5FYLE 2C7FA 4R8WL 2AGJL 3MLWL 2CHXA 2WQSA 4TULL 1LO0L 3RJDA 2NX5E 3IS1X 4NERA 2WM0A 4OGYH 3HAEH 1PLGH 4RAUA 2E5EA 1SXSA 4NQVB 4QWWC 1BG1A 3GMQB 3B9KA 1TTFA 3MPCA 4Y5VA 4QY8B 3SPVB 4OF0A 4OZGF 3PS6A 3KBEA 4PGCB 1U8PA 1WBXB 2OSLA 3LAFA 4PRHD 3VXRE 3WLBA 2YC1B 4E9LA 3WN5B 1U3HA 4JM4H 4NFDA 2OK0H 4X50A 4TUOA 1NIFA 1FDLL 1OCOB 1OZTG 1P69B 2OMUB 3TBCA 5BW7C 1EVUA 3I9GL 2A1WH 1KGYE 3L5HA 4HLZG 1SF3A 3BP7B 1G1YA 4M1GL 3LNDA 3LKPA 1E6JL 1M53A 1GH7A 1JVKA 2VIRB 3QT2A 3S8FB 1QR1B 4PJEE 3NG5A 4HMCA 1DQTA 1P5VA 1DVFC 1QSVA 2EIDA 1E9QA 1X9UA 3CBRA 4NYLB 3GEFA 1VFBA 4NRXA 3QEQD 4Y2LA 3IPEA 4IYKA 4I89A 4QJ3B 3VM5A 1TQUA 5E99H 3RWFB 1LMIA 2X87A 5C08A 1WH0A 3GKWL 3G6JE 4YX2L 3UXFA 4LARL 5HD8C 1MCSA 2WWMD 3DWTA 2VNCA 3M1CA 3P3RA 3OB0H 4Z76B 3RFZC 4KTEH 4CNIA 2WLZA 4PJDB 3ABZA 1KC5H 4DCQB 2VDPH 1TMCB 1BMWA 3BESR 3GS4A 4YE4L 1SN5A 2PCFB 2IH1B 4G5ZL 2FWSA 4GAJL 1T80A 2GHZA 5C0DA 4EOWL 4BKSC 4HAKA 5D4HA 3QDAA 2ESVA 2ZQKA 4XNUH 3FMGL 1TIUA 2D7QA 4J3OD 3IJSA 1KCVH 4BH7A 3NA9L 4DP2X 4POZC 3BYTA 4S1SL 1SDAB 4GMSL 1GC1H 2W95A 4I48A 1MHPH 2F7OA 3RNQB 4NEHB 4XMZA 4DKEH 2CRYA 5HPMB 2NXZD 1OAZH 4X4ZA 3VXPA 4BEIA 3ULUH 3L1FA 4IK7A 4JE4B 4LLVB 4PVMA 4U7MA 3X14B 2Q9OA 1QHQA 3QQ9D 4MJ6B 4DW2H 2LU5A 2NZ1A 3EF7A 3DUHA 3LQZA 4QJ4B 1WGVA 1G1CA 2DWXA 1P7HL 1CG9A 3U4BH 5C0NC 4LCIH 5IMMA 2VSCA 1UA6L 2XKUA 2XXGA 2X4RB 3F7LA 2GFBB 3FUDA 1XD1A 1A9EB 3PFUA 1S5HB 4JRLA 5J56B 2RFXA 3RX9A 5BV7L 1QMUA 1A9BB 3GEWB 5DD5L 4BK8A 4LLDB 3IBOA 4P2OA 4RGMC 1QO3A 2VLRE 3OPUA 3V4PA 2AQRA 2A9DA 1JK9A 4M5ZL 1AANA 1HL5A 2UYLA 3MMEB 5DUJA 5AW5B 5GISL 5DRWA 3FTZA 3VCLB 5HVHC 2WMPA 3SE9H 1PU0A 1MJUL 3P0VL 2MFNA 3O6FB 5I19H 1GYWA 5TDOB 1FJ1A 2VMCA 3W0WA 1YY9C 3DDGA 1T89C 5EWIH 4AEIL 3O11A 4KQ4L 5I1AB 1NBCA 3KYNA 4OIIH 2LU4A 1YJDC 3SDXF 1MPAH 4HBCL 4XNMA 2HKHL 3EDJA 2EILB 3T8XA 1QEXA 1NCAL 5MENB 3HI5L 4HIEB 2J4WL 3T0BA 5KYUA 3Q8BA 1YN6A 1J9SA 1SY6A 2C5DC 2XZQL 4BA8A 1F3DJ 4HLZH 3CFTA 2EDRA 2CG9X 2W9EL 1RJCA 5HHNB 3S98A 1EAOA 3EH2A 3L9EA 5FM8A 4DKTA 1SVBA 4YJZL 1OAXL 4ZOEA 2IOOA 2X10A 3EYOA 3JTSB 4P5KA 4ZK8A 2O5NA 4I3SH 3VH8A 4H8UA 3MBEA 3JV4A 3AM8C 3A4DA 4RCAA 4ADIA 2CKBL 4D0BA 3EFDL 5E8OA 4PS7A 2KLSA 2I9LB 2EUZA 4OBSA 3L9YA 3NOIA 2ILLA 3GJFA 1R0AL 3GLZA 5GRXG 3D3VA 2XVBA 1KXVC 4FADA 1OHQA 3GXTA 3L1GA 1CZ8H 5ESVA 1KTJA 4K94L 3WFCL 3ZL4L 1KTBA 1AR1B 3CXDH 4PWFA 3H3PL 5ICXA 3BKYH 1SOKA 1P4IH 3X12A 3L5XH 2PR4L 4HIQA 3Q44A 5GJTH 1WAPA 2WV3A 4YE0A 2CR3A 4LLAA 3ESNA 3IYLW 3K5SA 1DBAH 1GGIH 4RAUB 1ZMYA 3BUYA 5IT2H 2H0PA 3NZHH 3B9KB 4D7BA 3U0PA 3Q13A 4Y5VB 3OAZK 4LQFH 5IHLB 3VXME 4HDIB 1R5WA 1U8PB 3JV6A 3PABA 5C0RL 4DP0X 3WLBB 3MUUA 3SQOL 5I30L 4UDUA 1U3HB 3AY4C 2QLYA 3CDFA 3S6CA 3MV11 4I18B 4TUOB 4FC3E 5EBWA 2FJSA 1JF5A 2E7LC 2LAGB 5KSBA 1ZEAH 3UROR 3O3BA 2R69A 4CDGC 4E5XA 3LKPB 2Z34A 2X12A 1XGQA 2R1XA 4WI8A 4HOZA 2ADJB 1QRKA 4FFYA 5F89A 3FO0L 3LN9A 1QLEB 5CGMA 1P5VB 5IW6B 2GJ6E 3OSKA 5F97E 3U6XA 4OF7A 3K8LA 1VFBB 2DQDL 4NRXB 5E4EC 4AV4A 3MC0A 3OJDB 3BKCL 1TYRA 2EH7H 3BAXA 4LDCA 5C08B 5LAXB 4FQPA 5CS7A 3O2DL 2NCEA 2C9XA 3ARGD 4CNIB 5F6HJ 4EPSA 4YR6A 3N0PB 2R4SL 5I66A 4R4NC 2AXGA 5IHUH 3SHSA 3VD1A 2I7OA 2WCPA 4LVHC 4PRPD 1KEGH 2VZUA 4GUCA 2ISDA 5C0DB 2VM4A 4AGNA 3D48R 3D39E 5D7SL 3UC0L 2ESVB 4Q56A 5B1KA 2CO2A 3B9DA 1ZXQA 5DT1H 2HT4D 1QZ1A 4NUGH 5AZEH 5T33H 4BH7B 4G8GE 1NMCC 2FH6A 4NLHA 4ELMA 5E8EA 1GTFA 1ZVSA 2VE6A 1E4JA 3GZQA 1ET7A 3CHXA 1M7IA 1SEQL 3NRQA 5JNYB 3M46A 4I48B 2YUZA 3WTWA 2V0AA 4JPWL 3IXAA 3VXPB 3OTTA 4L48A 5EEWA 5E9AA 4KFZC 3GT6A 4FXKC 4M48L 1QBBA 5E1QA 4JFDE 3LQZB 1HEHC 5AKSA 3FU3A 3WNKA 1CG9B 1H6UA 2TSAA 3AVEA 1WWCA 4LKCA 4LSSL 2MMXA 5IMMB 1KGCD 2EKSA 1LK2A 2IFFH 1M7XA 2ETWA 1AD9A 3SE3A 3C8HA 3U4EA 1L6PA 2RFXB 4JFWA 2H1LM 5C0BA 2PPFA 1PDKA 2J8UE 1BM7A 3FUHA 5D5MF 3L1OH 2XC8A 3LHPL 3RLSA 3V0EA 3V4PB 1MDAA 1QEWA 4DAGL 5I1IL 2BP8A 2UYLB 1RZKL 1B4TA 4I5BA 3UJTH 5DRWB 4X9YA 3KWXA 4QF1A 4MMXC 2WMPB 3C12A 3QWNA 3SE4A 5IFHL 1RUPH 4MVBC 3JYBA 1FJ1B 1AQDA 2GABA 3O81A 3W0WB 2HG5A 3O11B 4AENA 5SX4I 3BUQA 3HKFA 3KYNB 3MLYH 2IMNA 2K3TA 2GIYA 4I18C 4ZTPH 2EDLA 4XNMB 1NDGA 1T3FA 4N2LA 4PJ6A 3QRBA 3T8XB 4U6VL 1GZPA 3FFOA 3VFNA 3LKNA 3KLSA 2KZWA 2GUOA 2Y6SD 2BNQE 2H6UA 3O3UN 4WENB 3SZ6A 3WIFA 4XVJH 2B77A 4JN1H 4XMPH 4X9HA 4Z7QF 2YAFA 3GM0A 3CDCA 1QTSA 3EYOB 3HI1A 3MKKA 4P5KB 3VH8B 3LN5A 2J72A 4XHJD 2M8XA 3MBEB 3JV4B 5F2FA 4YSCA 1IC1A 1RUMH 2VH5H 1PX3A 1OGAD 2BIPA 4L8SC 4D0BB 1H6TA 2YZ1A 3GZKA 3QUXA 5E8OB 4EI5C 5GRWA 1F4AA 4QDGA 4B9JA 5J13B 3T4YA 1Z9PA 1UB5A 3UAJA 4CKQA 5GRVK 2ZT9C 2N7BA 3GJFB 4CMMA 5BS0E 3D3VB 2Y5EA 3GHEL 5ABDE 1OCWL 2YD2A 3IMWA 4RMQA 1IBHA 5AUMA 1KBVA 3RVTD 3IEAA 2ERJB 5ICXB 4Y19E 4UU9A 3X12B 4R0LC 4I4WA 3LH2H 4JDVA 5D2NC 3V6ZA 4HJGA 5E2WH 1AHWB 3ZBMA 3SGKA 3WIAA 4OT1L 3BUYB 1GGBH 1T0PB 3U0PB 2UUDK 2VXQH 1GMEA 2ZG2A 3ESUF 3NZ8A 1R5WB 4F80A 3JV6B 3PABB 5JMRA 4JFUA 1Y0LA 2VLME 1QBAA 3GTVA 1OTTD 1UM5L 3BD3A 2DBLL 1UWXK 2XXCB 4UDUB 1BXVA 2X4TA 1YCSA 5EBWB 4BE6A 4ENED 4Z3EA 3L3IB 3FONA 3UYOD 1NFIA 5G4NA 4RGOH 5KSBB 1HT6A 1X5HA 4JFFD 4EZLA 4ZMQA 1M6UA 3O3BB 4E5XB 3GSUA 4QHPA 1R34A 1XGQB 5IFAH 4JVPA 5T5FL 5DJ8B 2VMEA 5FECA 5EMYA 4QHUA 5F89B 1TTUA 4AKOA 1JVLA 2VTFA 4WUUA 1IL1A 1UASA 1NGPL 4J8QA 5MP6L 4IBVA 1NCTA 1E4WL 2A4ZA 3A4AA 3CZEA 4K73A 4ZUVA 1JGEA 3M1OA 4K7PX 3JZ7A 1MAKA 4LPYA 4UT9L 5AVZB 3L4TA 4HOXA 1NA8A 3RU8L 4XWGH 2B3IA 2YD0A 4R90H 1J5OL 3VD9A 5FF6A 1UWEH 3V6OA 4YSTA 4L05A 1EA9C 4HP5A 5KSUA 3WO3B 1RLBA 4YR6B 1FI8C 3CWGA 1LWHA 5I66B 3O8XD 2AXGB 3KR3L 1YECL 3UZEA 4LLUA 3GUFA 5IJDC 3SJVE 3TX4A 4KHTL 1D9KA 2F8IA 3L5JA 2CO6A 2X40A 5D7LA 1QSFD 4MTMA 2VXTH 3OMNB 2X2UA 2YEQA 3ET9F 3K2IA 2XN0A 2QPDB 4KXDA 4D7PA 5I1GL 2HUEA 4ELMB 5E8EB 5DRXA 1ZVSB 2VE6B 2P5EA 4PIBA 5HYIA 1M7IB 5GHWH 4XN4A 2ZUVA 3P1VA 1I1YA 4LOFA 2CO4A 4GRWE 4OTXH 1T03H 5AB0A 3EH4B 4ZNEA 3IXAB 1TG8A 1P7BA 2ZX5A 1RKRA 1RU9L 2K4WA 5FGBA 5J89A 3TC9A 3W38A 2GW5A 3MBXH 5C07E 2YXMA 3IDIA 4AL8C 4YEEA 3VXUB 4LKCB 1O6SB 1PSKL 4IKIA 4A2HA 2EKSB 1LK2B 4ONFL 1AD9B 4G8FA 3U4EB 3B2VL 1X6NA 3A23A 1GIGL 2WAHA 1AHWC 1UOLA 1PDKB 4HEMA 4P23D 1OAKL 5DQ9A 1KBGH 3VSVA 5JIMA 5JHDE 4OI8A 1QEWB 2BP8B 1JYWA 4IEFA 1IC5L 3WNIA 2XQBL 4I5BB 3TYGH 2Z6FA 4QF1B 5AVYB 2UX7A 1MEXH 1AZVA 2PWHA 4YH6A 1QSEE 1ZHLA 1AQDB 1F45A 3NDYE 5F44A 3ZGHA 5I6XB 1H0DA 2HG5B 2IQAA 3IKCA 4HS8H 4AENB 3QQ9C 4AEHL 3N44B 1IQWH 1D2PA 3EJRA 2D9CA 5ICYA 1NDGB 1T3FB 3IWVA 5H94A 4B9YA 4MBRA 4RESB 3GWJA 4HEPG 1GZPB 3VFNB 3LKNB 1OQOA 2J1XA 2V8LA 2GUOB 1VACB 4KZEL 2WWOA 4F33A 3U1QA 5DD3H 5F88B 3NPSC 4JO1H 1ZK5A 4JFED 1DYZA 4JG5A 4R7DA 3CXHJ 5I9QB 3WIFB 3IETB 2KZBA 2BVOB 1UWGL 2H2SD 3AS2A 2EYTA 2Y06H 3HI1B 3ZDXE 1T1ZA 3BN3B 4LEXH 2VN3A 5B7MA 2IANB 2LW3A 1JS4A 3QUXB 4BBWA 3N3EA 4UT6H 2VAJA 3T4YB 1UB5B 3BO8B 4MJHA 4CMMB 5ICZA 3KCPA 2E8YA 4NZRH 4WHCA 4M43L 5CINH 1KGJA 5HYSG 3RGBA 4JY4A 2DLIA 4ALAH 4KUZH 4WI7A 5AUMB 1WCQA 3FTGA 1RHFA 2HFTA 4DUWA 3GNMH 4I7ZC 3U79A 5C0JA 4FZEH 4IGBA 4UU9B 5IBUB 3TNMA 4JDVB 3V6ZB 4HJGB 2DEWX 1TUPA 1U6AL 4JCWA 5DJ0A 4MMYA 4MJID 1PZSA 3NJXA 4I77L 4TMPA 4X7SL 1EO7A 2OMVB 4XO9A 4HXBL 1ROCA 2JJTC 4CN1A 5BRZE 3JV0A 1OAYL 2VJ8A 4FP8H 3NZ8B 3CVIH 4Z7UA 5KVGE 2KZ1B 4JPVL 5ECJE 1Y0LB 4JQIL 4TQEH 1KDJA 3O0LA 3L4WA 4ERSH 1OD7A 2X4TB 1CDJA 3ETBJ 2NDGA 3BQUA 2Y2TA 4YLBA 3WN6A 4AKPA 2Y5TA 3FONB 1OLLA 2CGRL 1NFIB 5F96L 3O2VH 2BS8A 1UTDA 1XF3A 4JZOA 3P4LA 1NCWH 3C6LD 3BAEH 1CIDA 4UIKH 3KWUA 1J5CA 2QMKA 3GSUB 1PY9A 1LEKA 1GHFH 1T6BX 5FECB 2IVFC 4QHUB 3H0TA 5IROC 4ZYKA 1OAQL 3AXHA 3CU7A 4WUUB 1IL1B 1E4KC 4R84A 5IF0A 3CUPA 4K7FA 5HJ3A 1ROWA 2P45B 3T6ZA 1ZSHA 4ZUVB 3GSWB 1JGEB 1UD4A 2E47A 1E5CA 3H7LA 4PAZA 1XB6A 4ZSOE 2NNXA 3HBGA 1J86A 1L6XA 5I6XC 2Z4QB 4LCWA 5JO5A 4BFFA 1JZJA 2BWQA 3IJ9A 5FF6B 3RI5F 3TO4D 1GXEA 5KSUB 4XBGA 2P26A 3EDFA 4KHXH 2AQ3A 2VXVL 3U7WH 5M95B 4PJCE 6FABL 1TR7A 1R19A 2UXVA 4A2FA 4LLUB 3T3PE 1PY0A 1GJWA 4JG1L 1D9KB 2R0ZH 5LLIC 2DLEA 2R1YA 3FN0L 5D7LB 5C3LD 4OLUH 3ZKSD 3CZLA 5E9NA 3EUDA 4X8JA 2AQ2A 4L2LA 3SDAA 3VU2A 5DGRA 1F58L 3MRGA 3BKJL 3CFCL 5DRXB 2K9UA 4AT6A 1HYRC 2FT7A 4HW6A 2W9LA 1CR9L 1FUNA 4MB1A 3AQXA 1DVXA 4FYTA 2R0WL 3NCWA 1TFHA 4AQ8A 3ULUF 3BX7C 2Y7LA 5MEOA 2Q10A 1DR9A 2GSGA 5B1JA 1XTMA 4ODSL 4MHHI 1IC7H 3DDFA 4NZ8A 5SX5K 1S7TA 3RGVD 1WFNA 3BRFA 4K2UH 2CCVA 2W91A 3D30A 3IDIB 4PYHA 3QNFA 5FCSH 1T1XA 3AY2A 3IN2A 1GYCA 4P9MH 1L7IH 2ORBH 3JT2A 4G8FB 1YUHB 3UIZA 2HT4C 2MNUA 1Z9LA 1JGUH 2H0JA 1GAFL 1F4XH 4ZUSA 2VJ0A 3OXRA 4FULA 5DQ9B 1H6EA 3PXLA 2IPUK 4ES8A 2VLJA 3BLBA 3HI6L 4FYRA 4J3WA 4IEFB 3D25A 3TN0A 3VTAA 1BQUA 3N2JA 4XC3H 1ODAA 4NGHH 4XNYL 1HWGB 1ZHLB 1JZGA 2BZDA 2IQAB 3IKCB 4RGNB 1U8CA 4P46D 2I25N 3FULA 2X28A 4NM4L 4XCFL 5J4MA 4F91B 1JZ7A 4KNUA 5ICYB 4KRPC 4KMTH 5H94B 4L4TD 5K9QI 1UZ6F 5GS2H 1CS6A 2YQ2A 2ZCHH 3RZCB 3UTTA 3D12B 3IJYA 5J11B 4KROD 4PV9A 4B3EA 4DGYL 2EC8A 4R7DB 4BELD 4QTFA 1AP2A 3VXSE 3QHFH 4KQ3H 4Z3GA 2EYTB 3S96A 3WDIA 4K5LA 1T1ZB 2APTA 1UXMA 2A6KA 3MOAL 3QJFB 2AK1H 4PJAE 5CLXA 1CLZH 1JZHA 1L7TH 2QZQA 4XXWC 4HZLB 5KTEL 3CN4A 5KVMC 1AHKA 5F7UA 1ZCRA 1PCXA 1ZWIA 4P48A 3EH1A 5ICZB 3KCPB 4ZFZB 3K1KC 2A0LD 3HG1E 4RWYL 2QSVA 1AZZC 4JY4B 3IGFA 4LHUG 1EHLL 2D3NA 2Y6SC 3OZLA 3FTGB 1XHHA 4N8CH 1RL1A 3T3ME 1PBYA 2H47C 4IGBB 3KPQA 3PNWA 2MTPA 3FAXA 5FCUL 5KBDA 2YS4A 3AZUA 5C09D 3WCYA 2FNBA 1JI1A 1E6OL 1RVFL 5DJ0B 3VRJA 3Q6FA 4MMYB 4XHJC 3VG9C 3DECA 3MLVL 4XO3A 3OAZH 2KYIA 1U4EA 1KN2H 1YYCA 4NZUL 2V33A 1L9SA 1H3WM 2H3KA 4QRPE 1MJ7L 4N0YH 4OZIE 4PY7A 4ELKA 4Z7UB 3E2HC 1Y18A 4H88L 5EZJA 3IGUA 4ZX3A 1RIUL 2NZ9D 2MKWA 3K46A 3UFIA 4F9LA 5HTSA 4NS0A 2YBGA 2F53D 3ZKQD 1TJIH 4P2RE 1AQKL 4RBPK 4WFGE 3JWNG 4WWKA 2BOCA 4XAKE 5AL8A 3ZKXB 3BQUB 4V33A 2PW1A 2HB0A 2Y5TB 4DGWC