3IRCA

Crystal structure analysis of dengue-1 envelope protein domain iii
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
104
structure length
104
Chain Sequence
GMSYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSTQDEKGATQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKGSSIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords ENVELOPE PROTEIN
publication title Crystal Structure Analysis of the Dengue-1 Envelope Protein Domain III
rcsb
source organism Dengue virus 1
total genus 13
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2009-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ircA00
2R29A 5KVDE 2JSFA 4BZ1A 4BZ2A 5LCVA 3UZVA 4FFYA 1PJWA 3N41F 1ZTXE 4UTAA 3N42F 1UZGA 3N43F 1Z66A 2R69A 1Z3RA 4UT6A 2HG0A 2ALAA 3UYPB 5KVFE 3P54A 3VTTA 3J27A 5H37A 5B1CA 3C6EA 5IZ7A 4FFZA 2GG1A 1RERA 4AM0Q 2I69A 1TG8A 4AL8C 3UAJA 5KVEE 2V33A 2JV6A 2H0PA 4L5FE 3G7TA 5AAMC 5JHLA 5AAWC 2JQMA 2P5PA 5IREA 3IRCA 1S6NA 4UTCA 3WE1A 3N44F 5LBSA 1OKEA 1URZA 1OANA 4GT0A 3J2PA 5LBVA 4X42A 4FG0A 1OK8A 3C5XA 5GZNA 5KVGE 5JHMA 3N40F 4UTBA 1SVBA 4ALAC 5GZOA 4UT9A 3UZQB 4GSXA 3UZEC 3MUUA
chains in the Genus database with same CATH superfamily
1JPFA 1RUPH 4MMXA 1Q38A 1BXUA 4MFHA 1LMIA 2PTTA 4FTVB 3WGUB 4BUHA 3AB0B 5GISH 2X4QB 4M7LT 3EYQC 3OB8A 3KJ4B 3DX9A 3ZDYB 1EZVY 1KBPA 1L7IL 4DP8X 4F7KA 2P8MA 2W59A 1EIBA 3T04D 2YSSB 3IKKA 2Z8WC 3B8SA 4O02A 3DURA 5KBDA 1Q8MA 2VAAB 5INDB 1PLBA 2MOGA 1J9QA 3EXLA 3B56A 4KKNA 5KBLA 1BMZA 3SDXB 3Q44A 2HRHA 4J28A 1TJXA 2CJTA 3O6MH 2DI9A 4YHOH 5HJ3B 3VGGA 4DGVH 5ISZE 1ZGLB 3SDCB 1A21A 2A9ML 5IESL 2FBRA 2EDLA 7CGTA 4XCFL 3PWPB 4HAKA 1OT4A 5CLZA 5INDA 2WLNA 5D2NE 1EO5A 1CD1B 1LNUB 3CXDH 4X4KA 4JFHE 5DVNA 1OP3K 3FT4B 1RZPA 4JO2H 4RAVA 3HR5B 2NY5H 5DJDB 1ZGLA 2YSTA 1CGSH 2J43A 1K3ZA 3PWPA 2IDSA 5CIPH 1SLUA 3CVIL 3KM2A 5MENB 4RRPA 5DRZB 4I9WD 4BXSV 4DO6A 4POYA 5DMKB 4HHWA 4K71B 4KHTH 5KVGL 2RMNA 4PJBB 3FT4A 3QZWG 3QPXH 3UP1A 3OLDA 3HR5A 2VQ1B 1GZQB 1BVOA 1UWEL 4Y4HA 4FADA 1SLXA 1ZA3B 1EZSA 1H5BB 2P4AB 4OV6F 2LV4A 5MENA 2GITB 4EKJA 4P2QE 3LRHA 2MTAA 2ZWNA 4JPWL 3WIFB 2V37A 1KWGA 2DAVA 1I1CA 2HLAB 5DMKA 3NPSC 1U3JA 3P4OB 2NYYC 3FO1B 4Y2DB 3NFSL 4PJBA 4WENB 3BSZL 3B6SB 1P6AB 3NCJH 2J8HA 3UBGA 3SGKC 2Y2YA 5AB0A 1BD2B 4G8GD 2VQ1A 1GZQA 3S0PA 3UTTA 4NNYA 1MW0A 1KCUL 1TO4A 1ZA3A 2Z34A 1H5BA 4OCRL 2Y6SD 5E2VL 1NBZB 1HNYA 3S5LB 4DNLA 4FABL 1JK9A 3FQYA 1ZD6A 4PJEF 1E2VA 4Y2DA 3NCMA 4JCMA 1LGVA 2HLFD 4IK6A 4AVHA 5LCVH 4B7IA 6CGTA 3UTSB 1J8KA 2HFTA 3B6SA 4K73A 4ZDHB 4WGKA 1BD2A 1EFXD 5JPNC 1M7DB 3FSWA 3ARDB 5CD3A 2E9BA 3ATDA 3KZ8A 2IV9A 1R24B 3GI8L 5CJ5A 3MQIA 2OJZL 1JPTL 1L9OA 3EH4B 4LSSL 3S5LA 5F1OB 4Q97A 3CSFA 5F7FA 2YLHA 5LG6A 2W65B 4N3UA 4GJTB 4GS7C 4M5ZH 1SUJA 5HI3C 3NH7L 2NQCA 4XVSH 3UTSA 4ABVA 5EZIL 4NOBA 1GC1C 1M7DA 1Q0XL 1EVTC 3ARDA 3DMMD 5I1IH 1WAAE 3U9WA 2KZKA 4LF3B 2AGJH 5A16B 7FABL 1KXVC 4J3OD 4O5LH 4R4NC 3RIFK 3TXAA 1PZUB 2XWBB 1WAAF 1YC8A 5IT2H 4KZCA 1WUZA 2XFXB 3L2MA 2EQDA 4ZMPA 2XRAL 2WXPA 3Q5TA 1BBJB 2HT3D 3DVIA 2E5EA 4IRZH 2JB6B 4RGOL 1IGFL 3NQIA 4H0HB 4DN3H 3IETB 3NSDA 2OJEB 1FVDB 1BWWA 4HHGA 2PABA 1B88A 2XWBA 2VISA 2W95A 2XFXA 4HJEA 1AYOA 3K4AA 5T3XH 2CNZA 4A7SA 4LSPH 1BBJA 1YEDA 3QBTB 4J3OG 5E6ZA 1E5ZA 2VLMD 2ZUYA 3IU4H 1U0QA 1DBJH 3FF8A 4WI8A 1WGVA 2JB6A 4KU1A 3MOAL 3S96A 2PP9A 5IHHA 2NCMA 3IETA 3QUXB 4APXB 3SSGA 1ZLDA 5ITBL 3ABZA 2F5BL 2APTA 3S8GB 5AOLA 5F1IB 3BSHA 4TVPD 1RPKA 2XG4A 3MMEB 4JVWA 4R5XA 3HKFA 1PYWB 4LEXH 1R0AL 3WFEL 1KCRH 1ZS8B 2H8PA 2ZNWA 1ZLWH 3BYTA 5GS0C 3VFOB 4OZGA 4WK0B 1J9RA 3IF1B 2HN7B 25C8L 2FNWA 3QUXA 2I5YL 2HT4C 4APXA 5MP6L 5DYFA 1ERNA 1TQBC 4ENED 1CXHA 3P73B 3MMEA 4DOHB 3DJSA 3OSKA 1PYWA 3BZEB 3HMXH 3FC8A 1A7BA 2AZUA 4WHYH 2AAAA 1QWNA 1ZS8A 4WFED 2UVFA 4Z23A 3I2CL 4MBRA 4NUQA 5GS3A 3ZKXB 2OTWB 4I87A 3KS0H 3ILEA 3KPLA 3QXUA 3TTSA 2HN7A 5AFAA 3H9SB 2GCYB 1T1ZB 3ATFA 1BQSA 3CBJB 4UT9H 4M5SA 5DD3L 5AVTB 3WO3B 2FDBP 1PX3A 1JZ4A 4S10A 3K6IA 1JDAA 5DHYA 4B60A 1YHPA 3P73A 3D3VB 1JG9A 3BZEA 5F7UA 5CKAA 1OE3A 4MAZA 2CM6A 2Y06L 2VR5A 3BZFA 4PJGE 1S5HB 3QH3A 2Q8AL 5AYUH 4XCYB 2YR3A 4G70B 2OTWA 3B9DA 2VLRA 4PJGF 4JKPH 3IMBA 3H9SA 4OZHB 1JMZA 2LFGA 1KJ2L 3EG9A 3FO9B 4FNQA 5ES4B 3U1SH 5DFTA 5DI8A 1IAII 3ZYJA 4DK5A 3VFTB 3M1OA 3BGFC 1RJYB 1MNUH 2CM5A 4G59C 4Y9FA 1RVFH 4L29B 5AVVB 4BUGA 1LL1A 1RUQH 4HIXL 4OQTH 3C6LB 3PG2A 1PNDA 2BSSA 4X5XB 5C6TL 3FRUB 3FO9A 1V7NL 4QXVA 1ADQL 2VXSH 4R8WL 4CMMA 5E2TH 5T5FH 3O4LB 4PG9B 3EXJA 2JKJA 1HEZB 5TDNB 3HG3A 1F2XK 3OR6B 3WNNA 1IT9L 5LNGA 3C6LA 2GABA 1CR9L 1KELH 1V8HA 3LNHA 4X5XA 3FRUA 3ZUNC 2DPKA 1XHHA 3BT2H 4RMUA 2XQBH 2WQRA 3RWEB 4LLUB 3VE0B 1MDAA 1UD4A 4PRID 1E5CA 1KUMA 5H37A 5TGBA 4AENA 1JZ3A 4F7PB 3BUYB 5D6DA 2CIKA 4GRMA 3TO4D 4L1LA 4EDWH 5IR1A 2NOYA 3O4LA 4PG9A 3QULB 2WOBA 2YEVB 5TDNA 2WBJC 3ALWA 3OR6A 1J86A 5B3JF 1BM3H 1UXWA 4FCAA 4HISA 4MD0A 4PJCB 3VE0A 5F9WC 1T0OA 1RMFL 4F7PA 3BUYA 2H6UA 2PWDA 4F8TA 1C7SA 4EQ2A 1IKNA 5K59E 2VW6A 2QLYA 2JFCA 4M5YL 1NCTA 1JYXA 2CU9A 3JT0A 4HXAL 1DBAH 3N40P 2A1WH 1AR1C 2EIKB 3ILPB 2JQMA 1YYMH 4WO4A 3ZKMC 2MNUA 4G8AC 4NT6B 3SB3A 1SOQA 4GAAA 3UBXB 1UJTA 4P3WA 2QZ5A 4H26B 1P4IL 3B9EA 1MPAH 4QHKJ 4FFYL 4Z8FH 3SGJC 1HHJA 3IDMB 4PV9B 1SF3A 1KY6A 3GXPA 4PWIA 3U48A 3NCFB 4PCYA 3L4YA 3RTQB 1OY3B 2H6PB 3UBXA 3HLKA 5I76A 3A3YB 2ZOLA 1EO7A 4DETA 4U31A 1JGLL 2B1AL 4L3AA 4JZOB 4XPBH 4Y2NA 2EDFA 2LT9A 4U1MB 4GIAA 4H26A 3RX8A 2GHWB 1KJMB 4H0GA 4WGWB 2PF6A 1L6PA 1OAUL 3TEUA 3RX9A 4JHBA 5C0RL 1ASOA 1TTBA 1DVZA 4BKTC 2D9QB 5E4IA 5FOBB 2L7UA 3P30L 2O5XH 5J6GB 3QGVA 1KB9J 3L3HB 5IG7A 2QPDB 4WFGD 5DVLA 4I3RH 3KWVA 2DL9A 2LGNA 2GSGA 2YQ3A 4Z77B 2DQJL 1F58H 2QMKA 4ODXB 4U1MA 2KMWA 2PYEB 4V1DB 3APNA 3FCSB 4XNYH 2C26A 5L8JB 1O7DE 3WG7B 1MCSA 1BZEA 4DPAX 4QOKE 5FOBA 4UNVA 1AI1H 2WLMA 2IPKA 5KW9H 3L3HA 3CQPA 1P9MA 4A55A 3KPSE 4FG2A 4Z95H 2G60H 2J8UE 2RACA 5K1NA 4V1DA 4NDMB 3FCSA 4F7TB 5DEZA 2G4GA 4HSCX 4PGDB 2G30A 4QHLA 4AMXA 1MFAL 2J8UF 2YK1H 5KVFE 5C2BL 3W11D 1JPSL 1PF3A 1HINL 3H54A 1MRCL 3GIVB 4OLXH 4UTBL 1EMTH 3RQ3A 2PR9A 1I31A 2NXZC 4W70A 1CDBA 1P4LB 1HZHL 3CIQA 3QXAB 3L16A 4Y88A 1PGRB 1BQKA 2GG1A 4FLRA 4NDMA 5DLML 4F7TA 1MH5B 1FWXA 2WNKA 3LQAH 3MYZA 4JFEA 5DR5L 1IAIL 4CC1A 4FI8A 3FU5A 1TJGH 3WD5H 3ECUA 1R17A 2HRPL 4TSBH 3WHE0 4BGLA 3VGFA 1QHPA 5TF1H 3UAAA 1YVLA 1QKZL 1TZIA 5G55A 4L1SA 4OJFL 3BD5A 4PP1D 4E9VA 2WQSA 3BD3A 5IB1B 1KB5B 1X5JA 2X09A 1IGML 2CGRH 4L5FE 4L3ED 5F8QC 4CVUA 4XP1L 5FW8A 3RGBA 4Z7WB 3GI9L 3BQUC 1FNSH 4XE0A 4RETB 3FZUC 4R97C 1RUAL 4OGAD 1NMAL 2V3FA 4GRLB 2WSPA 1H3XA 3LS4L 5FDYA 2VDKL 3CU7A 3WE1A 3WKNA 2R2CA 4E5XA 1EAQA 1UT2A 3FO2A 5IB1A 1GGIL 4DO5A 1LO2L 2AI0L 1O0VA 3QDHA 4Z7WA 4HMEA 5GSVB 5C08D 3LYRA 4PJ5E 2Z6FA 1TQUA 2R8SL 3V0WH 4GT0A 4LLDA 4MVBC 4K94L 3TLRA 5LBVA 3MTRA 4FQXD 3E8UH 3L9BA 1DL7H 3TN0C 5AW2B 1EXHA 3BUQA 4DJMA 1HJBC 3H6AA 3FBKA 2QKIB 4JRYB 3OKNB 3R7RA 4ERSL 4JHAL 4PLNC 5HYEA 1U8QA 1CQKA 1MRFH 1TU2B 2H1PL 4WAFA 2GC7C 4G1MB 2LTQC 3L54A 3UJIL 3KPRD 4IRJD 2NNCA 4HKZA 5BRZA 3HNVH 2VXQH 4QD2E 5EN2B 1N4XL 1A3RL 2WANA 2VL5B 2QKIA 2DQDL 3OKNA 2AXJA 3MRHB 3ARFD 3QXTA 3D34A 1M57B 2YUXA 3QZPA 3IVKA 1B2WL 4XT1C 2V3DA 4RFNC 1TU2A 2F7OA 3LKSB 4ZTPL 1Q9KB 5AW3B 1CQYA 4G1MA 3KH3A 3MROB 2IDCA 4BUQA 3UO8B 5CIPB 5IWLA 1B0GB 5EN2A 4EI5A 1A7PH 1YA5A 5HYQB 4LLQA 3RGVB 1GHFH 2L3BA 4OFYA 2A9NL 3D39D 2VL5A 2D03L 4K7PH 1T83A 5I73C 1AKJB 5TTRA 5JHDB 3I75B 5FDWA 2ZWKA 3FH5A 3MRHA 2ZG1A 2HMIC 2YGVA 1KPRA 3A0OA 4PS7A 2H32H 1GPOL 5GHWL 1Q9KA 1AP2B 4OLWL 4RMQA 1M1XA 3NDZE 3OZ9H 5HYQA 3RGVA 2XZQH 1HKFA 4EXKA 1AGEB 4Y4KD 1AKJA 3Q1EA 4ZSOB 3BAJA 4LK4A 3OB0K 2JE8A 4FNLH 3ZMRA 2OL3L 3FU9A 4Q9CA 3TEYA 4KUZL 4YHNA 3FH7A 4ELMA 3H42H 4TNFA 4LLYB 4FXGB 2B9BA 4P3DA 4XCCH 4D3CL 4FZ8H 1WO2A 4P46D 5C0BB 3SPGA 1V7MH 1M53A 1DQKA 4KXBA 4ZSOA 3V5KB 5I0ZA 1C16B 1PSKH 4NRZB 5IREA 5FCUH 2Y7LA 2EDEA 4L1DA 4PH8A 3GRWA 4FFVD 3F7VA 4MZRA 1SNRA 3G5ZA 2EDWA 2H5UA 2GI7A 4LLYA 1QPPA 1NKRA 4C54A 3BKJH 1JNJA 2X2YA 2N01B 4P48A 1BEXA 2Z4QB 3MLVH 1WISA 1UWFA 4UQIM 3MX0B 1C16A 4YUEL 1GW6A 5IHZB 4E41E 3F7LA 1QP1A 3K72B 1M56B 1F45A 4YC2B 3D0AA 5D93C 4WWNA 3VTMA 1G1YA 1RZKC 1FLRL 5J1AB 1F4YL 4M48H 4F2ME 1CVRA 5CBEB 1EDHA 2Q3XA 1OTTD 1A6PA 1EHAA 2VYRE 2IH3A 3ECVA 4FE9A 4UAOC 1RZIA 3LEYL 3LNDA 1HHHA 3K72A 2PUQT 5J4MA 2WXLA 1IUZA 4JFDB 4LCWB 1J8RA 4HCFA 3O9WD 2BFVH 4HUCA 4P5TA 5CBEA 4GXUN 1N64H 5DJ6A 2NDGA 1YEKL 2EKSB 4KQ4L 2DEYX 1WFJA 2MPAH 2YEZB 1Z9MA 3DK2A 2CKBL 5DJYB 2W80C 4IRZA 1O6TA 1ZTXE 1PDKB 2K6ZA 3FT1A 4TKWA 1GSMA 1NAKL 2WXMA 2IFFH 2XXGA 3S3BB 5I26A 3SGDI 4ZT1A 1PLGL 3HI1B 4MZ2A 4G7VH 2A7BA 2WCSA 5DQJA 3RU8L 1E40A 2DS4A 1RIUH 5CEYA 12E8L 2EKSA 2BVOA 2AQPA 2EIZB 4AYFB 2YEZA 3O2DH 3KGSA 2AABH 3OKLA 2JVUA 1PDKA 1JRHH 3L4UA 1Z9LA 3P3SA 1JDCA 2X4RA 1NEZB 4G7YL 1U3HA 2ICEB 4Y8DC 4FLOA 5BS0D 3P2TA 3HI1A 4ANWA 4XBEH 1REIA 3NIGB 1JGVL 2LW3A 3O2VL 3OKYA 1IC1A 4MX7B 4LKCA 2E7LC 3KWUA 1VF5C 5LGJB 3U82B 5AW7B 3MCLL 2ICEA 1A8JH 3TFKC 3GMMB 4AYSA 3VI4B 1RZFH 4IDJL 4YHLH 4A2GA 1L0QA 3A6CH 3G6AB 2VDRB 3CXFA 1YUHB 5IVZB 3S3DB 3CZFA 3AU0A 4MX7A 3TOPA 2HUHA 2V2WB 3GTTA 2GC4C 3UJTH 3P4MA 1O9WA 3LIUA 4NQEA 2R15A 4FNSA 2AJUL 4B41A 5LGJA 5HJBA 2ED7A 1MKFA 3JWNE 4NQSB 3QEQA 1MI5B 3ZT5A 3GMMA 2J1XA 5ISZD 3FFDB 2BW4A 3G6AA 3GS0A 1YUHA 4XO5A 1YEGH 5E8DH 4XX1E 4I13B 3Q2NA 4ZFOB 4CVXB 4JFHD 4P9HH 4R4BB 5HGBB 3GS4A 1A6WL 1I8LC 2V2XB 2XN0A 1MI5A 4O2EB 1J1PL 3SYQA 4B95C 3RY5A 2VH5H 4GKZA 4YXHH 4ACTA 4ANVA 3LRSA 3CHOA 1DLHA 3VD9A 2EUXA 2Y6SC 3CVHL 2CA3A 5CCJA 2O26U 2ZCLH 5CJOL 2DIBA 1NGPL 4JZJC 3VDAA 3OKDA 1ORQA 5EC1A 3OJMB 1IC4H 2X2HA 2SODB 2O72A 2IPUG 2ZT9C 4R4BA 5HGBA 4RBPK 4QCIA 2V2XA 4O2EA 4YHKH 5H4YA 3EJRA 5SWZB 5IIEB 1T6VN 2X0UA 2COVD 1A6UL 1BVLB 3BN9D 2NQDA 4XAKE 4DP9X 3VFGL 1W6WA 1YYLH 3VXRD 3QWRD 3UZVA 3M46A 4H4NA 2BNRE 2FJHB 5IFHH 1AZZC 4P2QD 3K6OA 4X80L 1XWVA 4KXZH 4RFOL 4C4KT 4S0TD 2VWEC 2ZOKB 3K3QA 3LVTA 4I85A 2X4SB 3A67H 4JANA 3TBWB 5SWZA 5L8KB 5E56A 1NBCA 2OFQA 5EUOA 3L5HA 1BVLA 4IRSA 3B34A 1T2QH 1DSYA 1KLFB 1ZCRA 4Y1SA 1BQLH 2GEEA 1B4LA 5JIDA 2FJHA 4J3OC 3V52L 5E00A 3WLBB 1S9XB 2I60L 1BF8A 4TV3A 4Z7VE 1S7TA 3BIBX 2CHWA 2ZOKA 4DP2X 4AH2B 1FPTL 2QQKL 3A4AA 3GQFA 4OZ4B 1GS7A 4Z7VF 4U7SA 3C2AH 2WXIA 5E0QA 2Z0BA 1WS7A 3ARZA 4IU3B 1NCOA 4DFIA 5ENWB 1GH7A 4KWUA 5E8NB 3S3SA 4OBRA 4DEPB 5LBSL 3O8XD 1KEGH 3L08A 3FB8B 4HGWA 3CK0H 2MWCA 3LH2H 1CFTB 4WWKB 5KOVC 1TJHH 2BZCA 2C4FU 1E8WA 4J2QA 2E7DA 3IJYA 4FHKA 5D9SB 3JT2A 1IE4A 5C0AD 1DEEA 4DVRL 4IU3A 4M56A 3M45A 5ENWA 5E8NA 2BVPB 1UKQA 1QLRA 3DO3A 4LRIC 3CZKA 2SEBB 3FB8A 1KXQE 1X5GA 2XTJB 2OI9B 1CFTA 1HXKA 4WWKA 4FA6A 4MXWH 5CWSA 2OXGA 3N43B 4OSUH 4P2OC 4IOIA 1IEHA 3ET9F 3FKUS 5D9SA 3W5MA 2CXGA 4XMWA 2R56H 4UNTA 3QRFM 1XVSA 3G5VA 4BELD 2E27H 1N8ZA 3UO1L 1Z0MA 5CCHE 4PJ8B 4BSJA 4G7SB 2OMYB 1XR8B 5KSAD 5GRYA 2J6EH 3QK0A 4H2CA 4R83A 3IMTA 5IOPB 4G3YH 5T8IA 1AD9A 3RILA 3IMRA 5K9QG 1NCGA 3FQ4A 2A9DA 3KBHE 3U83A 4RFEB 4AL8L 1WHPA 2QPEB 5DGRA 2ROXA 2JK5B 5AKSA 2AEQL 3N42F 3MPCA 1T21A 3BXNB 4WI3A 4OU3A 3WNMA 2MSPA 1MCBA 1MF2L 1XR8A 2D7PA 2G5RA 4LHQB 3X11B 4WRLA 1LJMA 5IOPA 1WHOA 2XN9D 3NCYP 3D18B 4XXDB 2HB0A 1JYWA 2KUTA 5E5RB 4Q6IB 5SV4A 4AV0A 1N7ML 3AC0A 2Z7YA 2JK5A 3EYOA 4YXKL 3T71A 4JRXE 5FYJL 3DLQR 4K15A 4FA8A 3ZIYA 5KBPA 4OLUL 3DXAB 3AM8A 3BCFA 3JTTB 3VWKB 1I9RH 2J20A 4AQAB 5CP3H 2HKFH 4N0YH 3WS6A 4XXDA 1S5IH 1NDMB 1BV8A 5GGRB 1UB6A 3UCQA 4FQ2L 3PL6D 4HMDA 5I1LB 4F7MA 4LVOB 5FWRA 1Q1JL 2DWSA 3V7AE 5J6SA 5KWYC 1EGJH 4LL1A 2XKSA 1H8OA 2CBPA 2X2JA 2WD0A 3DXAA 3OKOB 4NWTH 3H7BB 3VWKA 4AZ8B 4DHLA 5MERA 4YWGH 3FB7A 1K3IA 2M26A 3NEXA 2X1WL 4D2NA 4PW9A 5IMKA 1J5HA 4KKAC 3X1FA 2R0LL 2YIHA 5GGRA 2EO7A 5I1LA 5SWSD 3TO4C 3ZXAC 1G9NC 5AZEH 1RIVL 4NKMB 4WU7B 4N87A 4K7FA 3MGTB 5DS8B 3H7BA 3KBFA 4AZ8A 3CJJA 3MCG1 2VZOA 2QGEA 2CRMA 4LCVA 2KYIA 2X3CA 3HAEA 1UOWA 3LPGA 4NKMA 4WU7A 2BHZA 4I0PB 3GTVA 5CN2A 4XN4A 2JCCF 2UXTA 4FGMA 3UAJD 4DKEH 2MIZA 4XRCA 2DQIL 4WI2A 4R96A 3RIAK 1OM3H 3ZKSD 1RZ7L 1UFUA 4M4RB 3C09B 1DBBH 3DETD 1INDH 4W9IC 3MLWL 1IBDA 4LSDA 4I0PA 4MNHB 2R29H 3NVQA 4Y5YC 3K6FA 3GZQA 4JDTL 1A6VH 3GZKA 3JZ7A 4HQQH 3T4YA 1AC6A 3BEVB 1YEFL 2FYYB 4M4RA 2EYRB 2XA8H 4QJ5B 2H26B 4OR1A 3N91A 3ATEA 5BO1H 3PCYA 1UOKA 1MVUB 2B20A 3MJ7A 2VITA 3ZE1E 4GSDL 4ONGH 4X6FB 3RB5A 1LEKB 3VFRB 1U8IB 3LD8C 2H32B 2V7HB 3D0LB 3DHPA 5DMGD 5AOZA 3ZE1F 4ZMOA 3KCWA 3E3QC 3QAZB 2CHZA 2ZJSH 4HWEL 2WBXA 2HKAA 1F8TL 4KDWA 5LBGA 4AGQA 3RVWC 4BKLA 1OOWA 4HK3J 3O6FB 1NFKA 3L3OB 2Y9RT 3FQ2A 3OJVC 1MVUA 4MMZB 4JO5A 1ZMYA 4QT5A 4X6FA 1LEKA 1UA6L 3VFRA 1U8IA 3T3PF 3KE0A 4JY5H 5DEGB 3K2UL 3N44B 2UZIH 4XVJL 2J5WA 3KHQA 2KDGA 5HYFA 1J0IA 1UACL 5J11B 3EYFB 3CQQA 4XNZB 3P11H 4ZOEA 1YEJL 4IHBA 2L7EA 5EU7E 3MRLA 3ZL1A 4EVNB 3O6FA 3L3OA 2CNYA 1XGPA 2ZUQB 2Q8BH 3V7MA 4MA8H 5IVXB 4PW4A 2BK8A 4ZUTA 4PV1C 1GOHA 4RWHA 2Y1YA 2WZAA 4L0PB 2UUDK 4KZEH 5FS5A 3R0MA 5DEGA 5INCB 1LO4L 1E9OB 2IOOA 3SYPA 4E36A 5I24A 4PBWD 4YDMA 3GBDA 3VSUA 1MREL 5F1NA 4K94C 1OAYH 3EYFA 5JIIA 4EVNA 1TFHA 1JD9A 3O2WL 3FJTA 4Z18A 3FQTB 2P42B 1AXSB 3LJ3A 4MXVE 2ZCHL 5INCA 5EO9A 1E9OA 4UBDD 4JRWA 3THML 4S0HA 5EOCH 2VLJE 2OPCA 3DROA 1P4UA 3J8F7 4JBSA 4OQ1A 1ES0B 4PP1C 3KPSD 1AY1L 4S1DC 5BMFH 1RULH 1AXSA 4XHJD 3OC8A 3VG0L 4CW1B 1QFWM 5HHNB 4NJ9L 4MA1C 4OF8A 1FSKB 3AJ7A 4NYLB 4QRAA 4L0YA 3SIKA 4JR9H 3CZJA 4OGAC 4I8DA 1N5YH 3J07A 3NSXA 3MRCA 5C09D 1KIUB 2GW5A 1UEMA 2XG5B 3KBEA 4D7PA 5C7XH 1PZ5B 4HAGA 4XZ4A 2Q3AA 1FRGL 1HILA 5FYKL 4XAWH 3X2QB 2V5MA 3BW9A 4CW1A 4KNUA 4HG4K 3ECQA 4LBAA 5GZNA 4FAAB 2X2IA 3GJEB 3RNQA 5EU4A 4D0BB 1BDYA 2H9GB 4DUVA 2EVIA 4L4VE 4WI4A 4QRRA 4KX8A 1A7NL 5FM8A 4FRWA 1INEL 4GMTH 5DJZA 3BRDA 4W9LC 3WFHB 4WNQB 1WICA 1PZ5A 2Z35B 1N0XL 5D4JA 2BW5A 2ZCKH 4MMXC 4GXVH 5I23A 3Q8FA 3VXOB 5T1DL 2WNXA 5FLUA 3MV7A 5I16A 3JTSB 4ZS7H 1JZ6A 5MHSE 1ZE3C 2H9GA 1BFTA 4X5WB 3GSNL 4LIQE 4IRJC 4XE5B 3VQ2C 1QR4A 5T1LB 1KWKA 1UB5A 2MKLC 3WFHA 1CLYH 5AOMA 2Z35A 1XAUA 1OARH 2ZYRA 3T0WA 3U36B 4Z78B 4X9BA 4RMBA 4UOW0 3ARFC 2WKOA 4FTVE 3VXOA 5DJ8B 4XO3A 3FL7A 2FVNA 2VN7A 2Y4SA 1WCQA 2G2RA 2XV2A 3ZDYE 5DD0H 1MFEL 2QSVA 4LXFA 3OKMA 3GSXA 3JWOH 3T0EB 1UXSB 2OXHB 3I3EA 2P48B 4Y9BA 3ZDYF 2C3XA 3BZ4B 4XH2B 5B1CA 3T2OA 4X99B 1RSFA 4PBVC 4QAMB 1WFUA 5KVEH 1R3KA 3BKCL 2E9IA 5DJ8A 5K39A 3CHSA 2C9SA 1CLZL 2HKHH 4QGTA 4R3SA 4TLSA 1ZPUA 4R5TA 1RQ5A 3FB6A 1DJXA 1J9SA 4XC1H 3T0EA 2AXWA 1UXSA 3PWPE 3A23A 2VO5A 1ZEAH 4X99A 3BLBA 4NI3A 3U9PH 2MQGA 3JWDH 1SVCP 1R1CA 4PMFA 3MA7A 5D7LB 3B9AA 5BV7H 5F7AA 2VKWA 3FS9A 5DUML 1CICD 1DUZA 1G7LB 1NLDH 3IMVA 1JE6A 1E7UA 3FQNB 1C8PA 3D85D 4GQ9H 3HS8A 3L6FB 4U1HA 5BRQA 5MENE 2AFNA 4P46C 4R0LB 4NLAA 3W57A 2X0WA 4BFFA 3V0FA 1SDYA 5KUKA 1SDDB 3EJSA 5SX5H 4PJBE 5D70H 5D7LA 3BP4A 1DSFH 2JMRA 2X28A 4FFVC 1UJ3C 4RIRB 5TK2A 5KYYB 1G7LA 3NJIA 5DK0B 4FL4C 1LO5A 2QGBA 3L6FA 4ZMZA 3BKYH 2DWTA 3GSOB 2OMTB 2QDWA 5DJ0B 2LU5A 4JFTA 3VQ1C 3JXAA 2IIJA 4QHKI 5IJKA 1OEZW 1W72H 1KGCE 1SDDA 2V17H 1JHTB 1I8UA 5J57B 4N90E 1NOAA 3BI9X 3LH8A 2Y5TB 5GIRA 1BD2E 5HSFA 2Y1AA 3X3GL 5KYYA 5DK0A 4Y5VA 5D1XB 1S8DB 4YHIA 3WDIA 2AXHA 4YPGB 3BOVA 3ARED 3GSOA 3PV6A 5DJ0A 3VYNA 4FXKB 1XF2B 1OTTC 2BY1A 4JG0H 5DZJA 2GBUA 3U46B 2ALWA 3MUY1 3RIAF 3UTSE 4J1UB 2Y5TA 4F80A 5GRWA 2AXFA 3HUJA 3OAYK 5D1XA 1CL7I 1S8DA 3O9WC 4M6ML 4N6QA 3MOBL 5EA0H 5ECGA 4U1KB 1FDLH 2P28B 2G9HB 4YPGA 1B0WA 5FCSH 5GGVY 3BE1H 4PB0H 4QDGA 1RK1B 3ULUE 4FXKA 3QCVH 2VSDA 3IPBA 2J55A 4GP4B 1GGCH 5KSUB 1HXMA 3BPLC 2DIEA 5E1GA 2PYFB 3T5WA 2WOYA 1HHGA 1NJ9B 2HA1A 5E6UB 4Z9KB 4ZPTA 1XZWA 2EE6A 3ZE2B 5KYUA 1T80A 2ZTBA 4P4RA 3HVNA 4PJ7A 5I18L 3RGHA 5DZLA 2G9HA 4UQAA 4K9EH 5I8KH 3UTQB 5FUCE 3ZT7A 2B5IB 1J9CT 5IEKB 5IZ7A 1LO0L 4KK9D 5KSUA 4NN7C 3HHSB 2DICA 2FJFB 3ARBB 2EYTB 1NJ9A 4YLBA 1OW0A 3TGXA 4HCRL 4X9FA 4PG2C 4YAQB 2FX9L 1FGNH 4HGKC 4EQ3A 5KANI 4XODA 1MCCA 4L9DA 3N1FC 2VR7A 3ZKND 4YHML 3T4AC 1RZQA 3UTQA 5IEKA 3QR1A 3TNNA 3HHSA 3ARBA 5DRNA 4K3EL 2EYTA 2F61A 1OSZA 1D5IH 1HCVA 1OF0A 1OZUA 1UH2A 2NT1A 1G4MA 1I53A 3EFDH 3ABMB 4LNRA 1KCBA 3DGDA 4KJPD 5E2WH 2YPKB 1X3DA 1GCYA 4KTEL 5J89A 2IANA 4OZGF 1SQMA 4IBUA 2H3NA 3GO1L 4U6HB 3D4YA 4ODTL 1NQBA 2VB5A 3GLDA 4R7LA 3GD1C 2H47C 2X4NB 4AV5A 3NJMA 3DOSB 3HBGA 5FM4A 1DVSA 1P7KB 1EZVX 2HFFB 3HRZB 3HZKB 3SQOH 1TMCB 4DN4L 4U6HA 2ZP9A 1KFAH 2GEQA 1KDIA 4DOHE 3RLSA 3WCYA 4DKAA 1HS6A 1HEJC 2X7LB 3DOSA 2JKWA 3V0GA 5EF3A 2VLRE 2HFFA 3FQUA 3H9SE 3K8LA 2ZXQA 3APFA 3X14A 3HRZA 4PWJA 2GBVA 5DUBA 1JNHB 3TBTA 4YPJA 2V8LA 3K2MC 4DZBB 3D3VE 4CKQA 4P9MH 2NZIA 4FHJA 2YD8A 3O4OC 1Q4NX 2MHAB 2VN6A 4GG8B 2E8YA 2ZXAA 2X7LA 3KGTA 1DQLH 3D9AL 1HSBB 3JQOB 4OZHE 3BUDA 2L0DA 1AXTL 1NCAL 2WLIB 4WUUB 1JNHA 1ET8A 1CPUA 5GJTL 5KSBA 4TL4A 2IBZX 2P80D 3UYPB 3P9WB 1NPJA 3EH5B 3KWTA 2ZE0A 5TQ2H 2ADGA 4XO9A 3JV5A 2I7OA 1GL4B 2R0ZL 3WNJA 2WLIA 5JXED 4WUUA 5HXMA 2YD2A 1NUGA 4FDWA 4IKJA 3CDZB 2VC2L 1JZDC 3O4LE 3DJZA 1AD0B 2FATL 3GMPB 4XX1G 4RMRA 4GT7A 3SDYH 4G82A 1CD9B 3K6NA 3NESA 2XHNA 1F6AA 2IGLA 2AEWA 1TZGL 2X1OA 4WW2B 3BO8B 3HE7D 3IXAA 5EIVA 4J3WA 1FAKT 3PGFL 1TG8A 4AL8C 1UM4L 2GFBB 1WZKA 1UA3A 2V33A 3G5XB 4RESB 1WBYB 3WFDH 4YSSA 1HQRB 1T3FB 2NLJB 1QFWI 2GJPA 2IQ9H 2BSTB 3O8XC 3S34H 3Q8EA 1CL7L 2JH2A 4P5MB 2EVHA 3GMPA 2VZSA 5JHLA 4JMXA 5AAWA 5DO2D 3KEDA 2ZP0T 3VXQB 1JZ7A 1HK6A 4WW2A 4DKFL 5DD1H 1VFAA 4KI5C 4W6XB 4PB9H 1O5PA 5I30H 1RPQA 4Q52A 2GFBA 3OL2A 3DX8A 3PJLA 5FF6A 4APQD 2VRQA 3G6DH 1HQRA 1T3FA 2NLJA 4HS8L 4KI5F 3EOTH 2BSTA 4M8QA 5FX3A 2PWFA 3A22A 3VYPA 4A6YL 2VDQH 2ZXEB 3CVDA 3PPEA 1LD9A 5FYJE 3SODB 2WINA 4BCZA 3VXQA 4UTAL 4GG6F 2NNRA 2W5PA 2VXTH 1L3NA 3L45A 4X42A 2M83A 1FBIL 4NO5B 4H8WH 3C6SB 4X7SL 5DSCA 2AQTA 4W9ZA 1AH1A 2GJZB 3N9GL 5DWPA 1UD6A 2ZXWB 4Q2ZB 3ECBB 3ZW3A 2YXWA 2JTDA 5E03A 4KUCD 1KCSH 4KOBA 4MCZB 3UMNA 2JB5L 1QFUH 2A77H 5HGDA 4JKMA 2OZ4A 4C56A 3KS0J 4NO5A 2O30A 5HHQB 4WLCA 1WRFA 2FNBA 1NC2D 4Q2ZA 4QHMA 5AYQA 3A6BH 3ECBA 1OP5H 1NGYB 2VO8A 4AQ8A 3RPKA 4LSTL 2DM7A 2NY6C 4I3SH 3REVB 4Y19A 4I4WB 1NC4D 1L9RA 1RV6X 2OTUB 5HHQA 5D1QB 4Z7NB 3KNBA 5CD5D 3RWJA 2YMOA 1NCDH 1TQCC 1X5AA 4V1DE 2WAHA 2QSTA 3W9EA 5D96B 4D8OA 3QHFH 3R1GH 5M95B 1A2YA 5I6LA 1NBQA 2G5BB 5MEOB 1TQVA 2J4WH 1MHCA 3MODL 3PHSA 4DVBB 1YMMA 1HI6A 3BUIA 5JMOC 5EEZA 3QIWB 2HJKA 3C6EA 3VXMB 3PL6C 1IU1A 2OTUA 4HD5A 1H3GA 5DFAA 3S48A 2YKKA 3V0DA 2VRAA 1U3NA 2J5LB 4XN9A 5B1JA 3A5VA 3MLUL 3LKOB 3MAWA 3OMAB 3AAZA 1I1YB 5F3HB 3QI9D 3H6JA 4WFHE 2A6KA 5MEOA 2NXYC 1ZVSB 4DVBA 4JPQA 4JO8A 3QIWA 2BIIA 4PI0A 4NZUL 5FFOA 4P2AA 4R2GB 4DPBX 1WS8A 3R8QA 4CL7A 4AV4A 4DKDC 2X1XR 2EC9U 3KH4A 3V0IA 1I1YA 1S7WB 3HS0C 4N68A 2B14A 5IOKA 1XEUA 2Y7SA 4YVUA 2JI1A 2ED6A 4FQHB 2VQUA 4WEBL 3H0TA 4K8RH 1S7QB 2KLTA 3BAIA 3QB7C 2WKLA 2CIIA 2J21A 4JQXC 3MLXL 3RJOA 5CFHA 3BKML 1EERB 3HZVB 4Y16D 4BV1A 1IBHA 1SBBA 1ORSB 3FU7A 3DVGA 4XP5H 1CTNA 1S7WA 2CLRB 4Z7WE 1U91A 3UAJC 4Z7WF 1VACA 1S7QA 2AMGA 4JPKL 5LO7A 1KYDA 4TNVF 3DETC 1I9IL 4HUMB 4M9OA 1BAFL 5AZ2H 4YXLH 3HZVA 1V05A 2ITFA 1QI4A 1ORSA 2DEXX 4WI9A 4XWOD 1U3YA 1NGQL 1YNTB 4GRWH 4O9HL 4XMLL 1E4KA 3S35H 4TQPA 3V7AG 1QFWL 1BVZA 4JQVA 4P4KA 5TE6H 5BRZE 4IMLA 3RZCA 3EJQA 5BXFB 1BW8A 3LIZA 1DVFB 1R4XA 3N55A 4OFDA 1Q9OB 1OAKH 4XB7A 4RA0C 2A6DB 2YGNA 4XPTH 5G4NA 1WEJL 4JL1A 3TBBA 3SE6A 3OG4B 2Q7NA 3ISYA 5DZPA 5L4MA 1YNTA 2A83B 1DJZA 3IRPX 3G5WA 3A6OA 3SDAD 5GS2D 3DARA 4X8CA 2BERA 3CFEB 1ZY9A 3FN0L 4H88L 5FYLH 2F58L 2BWQA 2AEPL 2UV3A 3WEXA 3A4FA 4XVTH 4ZX5A 4J2XA 2ATKB 5E6YA 1KIQB 4HT1L 2A6DA 3CFJA 2ENJA 3GMLB 3RVTC 3GGWA 4ORZC 1IC7L 3ZE0E 4MA7L 2YO3A 2A83A 2ZWYA 3R18A 1NL0L 4KK5D 2BIHA 3RURA 3ZTNL 3FHEA 3L5XL 3ZE0F 2DIAA 2YD0A 5ANMB 3RWDA 1MCHA 1ZHNB 3B4NA 3ML9A 3QC6X 5E1AB 1J1XH 5IVOA 3NRQA 4H7VA 1T5KA 1J11A 2ATKA 3WJJA 1KIQA 3QNYB 4S1SL 4RVBA 4TM9A 3GMLA 3D2UD 1AE6H 4IBSA 5FYKE 4OGYL 3Q06A 1T0PB 4HJJH 5HJDA 3VNYA 1JNNL 4ELME 2ZUSA 4JK0D 3W0WB 1BZ9A 3ZQXA 1MWOA 4ELMF 4NKIH 5IFAH 2QQLL 2VSKB 5JHAA 1DN2A 4ZSOE 1W72B 3F05A 5C9KA 5L6YL 3HNTL 2WYTA 4ATWA 1WWWX 4C4KO 4XNBA 3LX9A 3ZMNA 3F12A 4UBDC 3GZPA 2BVUA 1MAMH 1OQOA 2RHEA 3CHRA 3DSFL 3G04A 4MJIB 4H0LC 4BFNA 1MLCA 2FJGB 4AIEA 2VDNL 3JTBA 4AXWA 3PQYA 5DHVH 1MQKL 1QRNA 1SBSH 4M7LL 2CCLA 1BA9A 3UTPD 1HVXA 1W72A 2K7PA 4CC0A 1J8HD 3WGVB 5I6XC 4KX7A 3ROOB 1I1FA 4MAYB 4UQEA 2E56A 3V6OC 4HF5H 1S9YB 1ZOXA 1BJ1H 4AEHH 3LDBC 1D5ZA 3VXNA 1CLVA 4FQLH 1G43A 1KB9K 4A2HA 3IFLH 3HS9A 3S36H 1DQDH 3D5OF 1FG9C 2W07B 5EBMB 2P8PB 1DP0A 3MV8B 2BJML 4I77L 1OZTG 3CC1A 4OZFH 1W80A 3EFFB 5FM5O 2UWEB 3EO0B 4F20A 3OAWA 3ROOA 2X4OA 3BAEH 3MV9D 4U6TA 4TTGA 3MR9A 2Y25A 4PGZA 2VLJD 2JELH 1S9YA 5DJAA 1SJHA 2IQAA 1I1AC 4XNQB 1Q0YL 2VMEA 1ZHLB 2FWLB 2WY3B 1MELA 1DUYB 3QJRB 3OAZK 3WI9A 1PZSA 1UYWL 2G0KA 2NSQA 2P8PA 5EBLB 5EBMA 4EMZA 3EH3B 2GI0A 5JPMC 3N41F 4O4YL 3QDGA 3K71B 3ALXA 1P5UB 5DD6B 2UWEA 3EO0A 4PJ6A 3SKMB 1FGVH 1BGXH 3O45A 3TJPA 4CBZA 2HH0L 3P0VH 4YDJB 2V0AA 3IAGC 1CU4H 1ZSDB 4JFDE 1GJIA 2P5EB 4KHXL 2FX7L 1HYSD 1AGFB 2Q2LA 3DUSB 1EO8L 4XNQA 1Z3RA 1ZHLA 2ITEA 3EO9H 1U4FA 1QFHA 2BY2A 1CDJA 4GP8B 4AQEA 1O75A 5GGTH 5DWUH 5T1KB 2CLVB 4G7RB 3GLZA 1ZSDA 2BINA 1MG3C 3V4PA 5I1KL 4AK1A 1A7OH 3DUSA 4B9PA 1QR1A 3PWLB 1X9RA 1IBGH 1KPUA 1PAMA 2OMWB 4M3HA 2R83A 3BVDB 5F7DB 5MI0B 5DS1A 2H2SD 2D3LA 1XDTT 1EZLA 4KAQH 4A67A 4YHZH 3C5JB 4KKLD 5MHSD 2CLVA 2QBWA 4XMZA 5D8JL 4C4UA 1SN0A 3TCTA 3VM5A 4J8RB 5IJVB 4P59L 1ZA6A 2FH6A 2WJ7A 4XWGL 5ILTH 3NIGE 2ZAHA 3VRLE 1MCWM 3FTVA 3IGLA 1MHPH 1QTSA 3HIZA 4PUBL 3D07A 3RX7A 3BVXA 4XN1A 3SE8L 4Y5XB 5CSGA 2OMWA 3NIGF 1L4IA 5F7DA 3VRLF 4FTVD 3B2UD 2XQYA 1PZDA 1WZ1L 3SYOA 2OR7A 2I32A 1GYCA 2O5YL 3QEQE 4NO2B 1MW1A 3OLEA 5DMIH 3ZYIA 1OGTB 2YJQA 3UC2A 4TNEA 5IJVA 2VZUA 1CBVH 4CDGC 1F3RB 4DP0X 3U0PA 1AS8A 2RFXB 4Y5XA 4HULB 2ARJB 2DKUA 1WC7A 2R1WB 1BFVH 3LRKA 4GEIA 1JSYA 4XVUD 5FFGA 5DUPH 5IMMB 1MI5E 2DJ4A 3TEWA 2J2ZB 3TWCL 3SDCD 5E94A 4DP7X 3VDBA 2OCFD 2ZQKA 3JV6B 2GTWB 3CBRA 4M7JL 2B1HH 3ZMEA 2NX5B 1GC1H 1U41A 1Z6JT 2ARJA 3GPEA 5E9DB 4MGXA 3WEMA 3LZFL 3E2HC 4HIEA 2FK9A 2R1WA 3DYMA 1BREA 4HS3B 1XSOA 4JFZH 3HG1B 1ZANH 3SBRA 1MFDH 1WFIA 3QR0A 1YJDH 3NN8A 3DV6B 3CN1A 4M62H 1A7RH 1OTUD 4LL9A 3FPXA 4M8RA 3ZVVA 4ZQTA 4P5KA 3BAKA 2BXYA 2F74B 4IU2A 4WDIB 2BSEA 5C07B 2NX5A 3AREC 3LMJL 1KXTB 1KN4L 1G5GA 2D7MA 4MDIA 3T6WA 3FAXA 5J1TC 4QY8B 1ZVNA 3QDJB 1G0YR 3NYKA 4RRPG 5SWZE 3TYGL 2FUQA 5EUOE 3DV6A 2J88H 4IRSC 1UWXH 4Q56A 5HVHB 3JV4B 1L9SA 2G3NA 1TO5A 4LGPB 5EUOF 1UUSA 2CH8A 4FKHA 4WDIA 5C07A 4H20H 5D1ZB 1AZCA 4UI2A 3MBEB 4Y2DD 1RHHA 3WKPA 4NS0A 1UD2A 2FD6H 1MXDA 1HE8A 3QEHB 4QY8A 4RH4A 1G9EA 2WO2B 3AWFA 4UM9A 1FVCB 1MCNA 5DK2B 2APSA 2GAZB 2H0JA 1AFVL 4GQPH 1J5OH 5C1MB 3L3JB 5D2LB 2QELA 3JV4A 5ALCH 1DANT 3IJEB 4R4FH 5ERWB 4GH7B 3VFSA 3ABGA 2O61A 1KN2H 4J3VA 2W9DL 4PBXA 5D1ZA 1XL6A 2IALB 4K5PA 4KK9C 1I7RB 1YECL 2D7NA 2D0HA 2VDQB 2OTPA 2CBOA 1ZLSL 2BY3A 5DK2A 2GAZA 3PAVA 3IPEA 5D2LA 3TPUB 5BZDB 3IJEA 4JPIB 4NZFA 5ERWA 3L13A 4AVJA 2FLRT 5HHOB 2A0LD 4LASH 2QMJA 3HVDA 4F93B 4ODWA 2IALA 1P2CB 5DYOA 1PZ2A 1D5MB 3BDYL 1I7RA 5IW6A 3AU1B 5AVRB 1ID2A 3S5LG 3SKOB 2IPTL 3N0AA 4ZD3H 2Y36L 2EDTA 4LEBA 1UVQB 1MFCH 2VMFA 5IMLB 2X44D 2L04A 5BZDA 4AG4L 3WIHH 5B7EA 5AW9B 3BAWA 3HFML 5HHOA 2WTRB 2YAMA 4AZUA 3QEUB 4OKVB 1JZGA 3TJHD 1XZ0B 1D5MA 5TJWK 5FW7A 3Q5OA 2ITCB 4LHJB 2JJSA 4MS6A 5D5MB 3AU1A 4PCKA 2BNQB 3SKOA 5FM5M 2XTJE 4YSUA 3WY1A 3WEOA 5FV1L 1ZV9A 2WIMA 3AXLB 1UVQA 5IMLA 3W81A 1M6OB 4WTZG 4HJSA 1EPFA 4NZTH 3UJJH 2WTRA 4UILL 5J56B 2WVTA 4GXFA 4PS8A 5E6IA 5B8CC 3HC0B 5CINL 4UQ9A 4ETQB 2BNQA 2XICA 4BSWB 3C2SA 5JHLL 1ZWIA 3PWUA 3O6LL 5A7BA 2IAAC 3AXLA 4Z7OB 3X1NA 4ZNCD 2XY2A 1OP9A 3AY4C 5LXGH 3QIUB 5EBGA 3DPBA 1X9QA 1K4CA 2OV0A 3WELA 1BP3B 3IJHB 2BXZA 3HC0A 2AC0A 5F7NC 4BSWA 3V4LA 2XTLA 2O5ZH 3IDGB 3IFNL 1EK3A 3X3FH 5HVGB 2AQ2A 5A3ID 1XTLA 3ELAT 1J88A 3SO3C 15C8H 1MCRA 2CSPA 3PNWB 2XYCA 1TF4A 4FMKA 5L2KB 4BINA 5IGXL 4U1JB 1AZRA 2CJ3A 5G5DA 3DXAE 1DDTA 2EXYD 3MRJB 4LPXA 5L0QC 2R0WL 5JW4Q 3UZQA 4Y4FB 5I5IA 1YPZB 4X8XA 3MRRA 5JXEC 1XB6A 2W92A 1Q0EA 1QYGH 1K2DB 3H8NA 4PGCB 3D3VD 5L2KA 4HZAA 1SYSB 1VADB 4U1JA 3GKZA 2F1EA 1OP3H 3JSSA 5F0PB 5CGTA 3RWHB 3MRJA 2ROYA 3AG4B 4M6OH 3HE7C 1WA2X 4GQQA 1YPZA 4HC1L 2P47B 2VR8A 1MWAH 3OVUB 3GB7B 2NY0B 1PFCA 1K2DA 4PGCA 3QNZA 4PS4H 5HHMB 4HHAA 3S8FB 5F96H 1U8NB 3DIDA 5GGSY 5K9OA 1ETB1 2EDNA 3RWHA 4CU7A 1BQRA 1HWGB 4JM2A 5DO2C 5C0ND 3ROLA 2VMDA 3SKJL 1SXAA 1IM3D 3S88L 3WTXA 2YXVA 2P1YA 1U6AH 1FVEB 1YQVL 4AJVA 1MIMH 5DT1L 1ZLUK 4JFFB 4OBSA 4DTGL 1UOVA 3GB7A 1N3NB 4GINA 2JF1A 5BJTA 4H44C 4JL2A 1AYRA 4APQC 2K4AA 3D51A 4HFWA 2JJUA 1U8NA 4P23A 5DQ9B 4GOSA 4CRPA 2DQHL 1ITBB 4NB7A 3EJJX 5FGCE 3RIKA 3U6XA 3MBWB 2BVYA 2X4TB 3QIBA 1MJUH 2DQTL 1ZTMA 4IBQA 1N3NA 4XP4L 4DESA 4FZEH 1JWMB 1FL6B 2N59A 2BSRB 3CD4A 5H37G 4X7TA 4PIRF 2ERJC 3F85A 4PU2A 1OOAA 5PAZA 3E6FB 5D7SL 5ACLA 1I7UB 1Q9LA 3MBWA 3MRPA 1PQZB 1TZAA 3S3JA 5KVFH 2QADB 3U1PA 5EUKB 3RDTB 1JWMA 1A65A 1B4JH 1FL6A 5LUMA 4YQXH 4UT7L 3TZVB 3E9TA 2WTOA 1B0RB 1EJFA 2D7TH 1I8IB 4BHUA 3TM6A 1G87A 1I7UA 4P57B 1FAIL 3EGSA 2I27N 3WXWL 1G0DA 1CTOA 4WY7H 4JHWL 4N2OA 1TTGA 3SCMA 3RDTA 5I75C 1A47A 3VTTA 5CD5C 3FCGA 3QG6A 1HL8A 4ZFQA 3BJ91 5BUPA 2B4CL 1I8IA 1F4XL 4OM1L 2GKIA 4G6FD 4P57A 4L5FH 4PJXB 4W9EC 4PJAB 4H13C 2NTFA 4M93B 3RTQD 4Z7QB 4BFEA 3LIZL 5J6HB 4OD1L 4QXUH 5I8CB 4RGMB 1R5IA 5DHVB 4B9CA 2RTTA 1V3MA 3V4UH 2PO6D 4X7CC 5GS1A 5IVXE 1DJWA 3UBXG 3QJHA 2RJMA 3HN3A 4JO1H 4NXKA 3K6SA 3GK8L 3X12B 1JNLL 3QISA 3QI9C 1EEZB 1M71B 3FTYA 3FDWA 5J12B 4MS8D 3WLWD 5KSVB 2C1OB 5J6HA 5EU6D 5I8CA 2V5TA 4Z3FA 4TSCL 1P6FA 3NTCH 1U8PA 5DHVA 2ZAIA 2J8OA 8FABB 4Y8AA 4HBCL 2PYED 4V1DD 1I8MB 4QR7A 2JJWA 1QASA 4OZFB 3SN6N 5AVUB 5HVWA 1FNEB 3MKGA 3FUKA 4NI6A 1G6RA 3H53A 4XNMA 5IUCA 1EEZA 1S7VB 2IG2L 2BIMA 4AQ1C 4PIBA 3I9IA 2BLFA 3IMWA 2W0PA 1SFHA 1AQ8A 3MLSH 3S9DB 3QCTH 8FABA 1XH1A 4LCCC 5E70A 3T6XA 2QTVA 4XMPH 3S98A 4UINL 3UC0H 3K74B 4XPFL 3LKNB 4D0CB 5I9QC 2RIKA 1RJLA 5H94B 1KBBA 3VUAA 2VJXA 3RA7L 5D2NB 1YY8B 4DGUA 1BFOB 2VZ1A 4QRRE 4DEUA 3RDJA 4KVCH 4YS4A 3NFPA 1QSVA 4LEOA 4DERA 1VGEH 2JSFA 1N2RB 3KR3L 3LKNA 4BZ2A 4XWOC 3L4XA 3MV7E 4Y2LA 3QJTB 1YY8A 4JO3L 4Q4IA 3HE6B 1LHZA 1JIBA 1IGIH 3OF6A 5CO1A 4WFFE 2DBJA 2NUTA 1BIIB 2EINB 1U8OB 4YSRA 3INUH 1T5WB 2CE6A 4G42B 1K9TA 1MN4A 1G6VK 4UDTA 3B2VH 3HPLA 1D3CA 2A6JB 2IADB 2JIXA 2HZHA 3CLWA 4HWBH 4R7VA 2IOIA 4U1IA 4YK4C 3TA3B 2BS8A 1JV2B 3MJ9A 1FNAA 3TBVB 1RURH 4PY7A 4XMVA 4POZD 3PXJA 1H6UA 3VFUB 2WKOF 3NPSB 5F7MC 4GRLD 3S37X 3IGAB 3GWJA 4TXVB 4LPTA 3BGMA 4KX9A 2X4PB 3ARQA 1GR7A 4PGEB 4G42A 3P3TA 1G4RA 4WKZA 1U95B 4PRPA 4OM0L 4PJEB 5D71L 3KDMB 2F08A 1CFNB 2FB4L 3TBVA 2EEFA 3LAFA 1MEXH 2VJ0A 2BP5M 4CN4A 3MO1B 3OGCA 1FLTX 1Y0LA 3F7YA 3IGAA 4OB5L 2KERA 4PVLA 4LOEA 4P8QA 3T0EE 2X4PA 4UQDA 3SGKA 4PGEA 3MSPA 2Z0UA 2OX5A 5JPNB 1H6FA 1F5WA 2P5WD 4GO9A 1KPVB 1ADWA 4JRYD 4PJEA 3S4SB 1DQQB 3FUJA 2FIRT 3KWWB 1L9NA 1NA8A 4G6KL 5IW1A 1KBVA 2XIIA 5GGSB 3NZSA 4HPOL 3MUHL 3FUEA 4RSVA 1LK3L 2EUWA 2HX7A 1EXUB 3D50A 4NGHL 5JPNA 3KPQA 1XGTA 5CZXC 1QOKA 4G9FA 2NY4C 1KPVA 3LNIA 1TT6A 4ODSH 2A9MH 3GSVB 4OGXH 1XF3B 3UG3A 4DCQB 2LU4A 5D7LE 2E6QA 5C0IB 5IBLD 4JFOA 4L2YA 2BIPA 2AJ3B 1RUKH 4J3UA 3V4PL 3CSTA 5EBWB 3L3KB 5JIPA 5LNEA 4PR5A 1EUUA 1HOCB 1FV1B 1F13A 4HBQA 5EOCJ 3SJVB 2CR6A 4G5ZL 4CSZA 1UM6L 4PRBB 5JHDD 3EBIA 4NQCB 2MNJB 5DJ2A 1KXVA 3D8MA 1M9WA 2MCAA 4DCQA 1IBFA 1MQ8A 3E6HB 4GBXB 4GPVA 3VFNB 3B1TA 4RAUA 3I3DA 3NJKA 5EBWA 3L3KA 4Y5VC 2PR4H 3UERA 1HOCA 4MDJB 4YSDA 4K3DH 2EDYA 3SGEH 2OMBA 4HKXB 1FV1A 2KZWA 3CFNA 5KUMA 3FUHA 3SJVA 9PCYA 2DQFB 3B5TA 3OHXC 4PRBA 1K6QL 3LNGA 4N0FB 4NQCA 1O5DT 2WZPD 3WDJA 3VXUB 4YHOL 1IM9B 2XPZA 4UT6H 3VFNA 4M43L 3OKEA 5DJXB 4JPWH 4NQVB 1ZSHA 1OWRM 3HUJE 5D1XE 2OSWA 1RLWA 5DA0B 1WWAX 2WVVB 3NFSH 4HKXA 1AMYA 5C0BD 3BSZH 3HUJF 1TEYA 2DQFA 3FAWA 4N0FA 4AQOA 2GY7B 3VXUA 1IM9A 1KCUH 4OCRH 5E2VH 3WKML 5JW5B 5LQBL 4FABH 1TITA 5DJXA 1LQBC 1HYSC 2B15A 2ZOUA 2Z7WA 4IJ3C 2WVVA 4PJ7E 5EV7A 4RWYL 5ICZB 3IPFA 1X5XA 3ATAA 2I9LB 4PJ7F 4S11A 3QPXL 3JVFC 3QDMB 4HX1A 1CMOA 1FFOB 1DVXA 4AQZA 2YPVA 2OJZH 1JPTH 4ZXBB 5CN1A 2Q0ZX 5JZ7D 1JXKA 1QSEA 4OFIA 3STLA 5E5MB 1UCTA 3JWNH 1T7ZA 1TETL 2XJLA 5ICZA 3NH7H 4BEIA 2LABA 5EZIH 1QA9B 3LRLA 1E3FA 3A47A 1Q0XH 1TOXA 3QDMA 2H2SC 1FNHA 1FCGA 3WXVH 3G7TA 1KIPA 3E9UA 3AQZA 4PP2B 3EYVB 2L4OA 5TDPA 4JFDD 2YAPA 3FUDA 4LCWD 4RDBA 2DB8A 2XIDA 3T0BA 4NWUH 3I6GA 4POUB 5E5MA 2XRAH 4NQQA 3L9YA 2IANE 4NKOA 2WQWA 1QA9A 4KDTC 4QRPB 1THCA 5T3XD 4RGOH 3U79A 3DI3B 1EEUA 3DPDA 2Y3AA 3VJ6B 4WI0A 3WHE1 3EYVA 2XZAH 1Y1DA 4GKNB 4Y1TA 2ORBL 3CUPB 2QVKA 1O9ZA 2IDUA 1D7DA 4FERA 1BIHA 4OD2A 4ZOAA 3Q8BA 4TUKL 4NZRH 4QEGA 3F62A 1I3RB 5JOEA 1OLLA 2Y24A 4QRPA 3MRNB 5BVJA 4HIIB 1M4KA 3MOAH 3U7WL 4UQBA 4XVSL 1U58B 3V2AR 2DMCA 1X7SA 3B3IA 3WTYA 4UCFA 1PZ3A 1QHQA 1UT9A 5IMOA 5F9JB 2F5BH 4UF7C 2AGJL 3SDCC 2YPLA 2QDVA 2WBJB 3DX4A 4EIZC 3S5ZA 3GIZL 1I3RA 3EOAB 1R0AH 3WFEH 1S7RB 1D7CA 1ED3B 3MRNA 4HIIA 4FC3E 4JHUA 3GYRA 1LLAA 5F9WB 3HZ3A 4F8NA 25C8H 3UFIA 1T0NA 1FZKA 5MP6H 4IMKC 1TYEB 3ZHNA 5GZOD 3B83A 2WBJA 1KIRA 1OTUC 1CFSB 1NANI 3MNVB 4ZRGA 4BHUI 5EZLB 1AR1B 5E8EA 1JN6B 1OPOA 2XY1A 1S7RA 5JW4M 3IDXL 3FO0L 3I2CH 4OCWL 3IU4L 3QORB 5DD3H 1CLCA 2HG0A 1JK8B 5K1VA 3V4VL 4BDVB 2VKXA 3HB3B 5KSBF 2BNUB 1QQDA 3Q48A 4E68A 3MNVA 5FK9B 2Y06H 5EZLA 5A2BA 1INQB 1JN6A 4WUUE 1QSFA 2Q8AH 4RISL 3HJEA 2IH9A 4LEXL 3V5DA 3DO7A 1F3JB 2CO3A 1DDHA 3DWTA 4WW1B 4GSRA 1JK8A 1M7IA 2ZYIA 4BDVA 3MLZL 5ITFB 4OCSL 4JVUA 5DHEA 2V6HA 3SGJA 2D9CA 1WBZB 5FK9A 4HSQA 2YQBA 1K5NB 4HIXH 4U1SA 3SE3C 3OB0H 2QVIA 1F3JA 2PETA 2HFEB 4U3HA 4JN2A 1HSAB 4BXVA 1ADQH 5AAWC 3KPOB 3PNRB 5IQ7L 3VXPB 1CGWA 4U3SA 1FYHB 4EDXB 1WBZA 3RVVD 5CCKL 4FFTA 4TQ8A 2JQZA 4TRPH 4CGUB 4QOKB 1K5NA 3G9VA 4WW2F 1U8LB 3RG1C 3S8WA 2C3VB 2HFEA 1SJVA 4JGMA 1NIEA 1QNZH 2GJ6A 4ODHH 5I1EH 1HSAA 2LE9A 4JKPL 2X9XA 2J8UB 4R7DA 2C9UA 1M3IA 5HYJB 3LKQB 5HI4D 3HTLX 4R5VA 1USZA 2G5UA 4FG0A 4IBTA 5FUCC 4RZCB 4CN1A 1NBVH 3GDCA 1Q9WB 1U8LA 2D2CC 3B3BA 4K07A 3WUWA 3ZL4H 1GCFA 4GFXA 4XBMA 2NXZB 3KVQA 1RMFH 3MA9H 2FR4B 1PMYA 1V27A 4FMFA 5AVSB 1QPKA 4HUUB 3CFTA 5HYJA 4M5YH 5T5FL 3D0VB 3QQ9D 4C56E 4HXAH 3C9NB 3CZEA 4RZCA 43CAA 2KBGA 2UZYA 4PRHB 2UX6A 5BOPA 2VOTA 3I84A 3FOMB 1J0JA 2AK1L 1GZPA 4LBEB 3LQZB 4UOZA 2IXQB 1KELL 2K70A 2R0KL 2XQBL 3V9FA 5I0VA 2CBQA 3NQKA 2EXSA 3QO1B 2X10A 4HUUA 5DHDA 3JVGC 4C4BA 4N6RB 5ID0A 4NRXB 1P4IH 1CBJA 2A6IA 3D0VA 4EDWL 3BQUB 3PP4L 4F58L 1IRAY 1Z66A 3VFPA 1TEGA 4R97B 4PRHA 2ICWB 3FOMA 3M1CA 4LBEA 4JQIA 1EHXA 2V9TA 1YAIA 1WWBX 4GSUA 4OAWA 2IXQA 4PTUA 2XTJD 3NA9L 4NHUA 1YUKB 1RY7B 4MZIA 1FO0H 3UDWC 4OLVH 1JGLH 3QO1A 3RKPA 4N6RA 4X6BB 2XQYK 3ZHLA 2OMUB 1XD0A 1C1EL 1YMME 3BQUA 3EHBC 4WK4B 1OAUH 4HGMA 4PJ5B 2VDPL 4O00A 4A7VA 5C0RH 3SOTA 2ZUWA 2XI9A 2R4RL 4PJ8D 5ICXA 5I82A 2A1WL 2VSCA 4MJ2A 3TN0B 3WFCH 4PJIB 1YYML 4XOEA 1IKFL 4LMQE 4AI7A 2EXYC 2EDQA 4I5BB 3ZKXC 5ABZA 2OMVB 2OP4L 3HJ0A 1X4YA 5J13B 1UZ6E 2DMKA 1V54B 2XTSA 2AJZB 4PJ9B 2GT9B 2F53A 1G7QB 1T1YA 3N04A 3W1ZA 1UZ6F 3PFUA 3VXME 1OGAB 2A74C 5ANHA 2YD4A 6TAAA 3TN0A 4X0KA 3GTNA 4PM1A 4PJIA 3G08B 4X5LA 4I5BA 2OMVA 4RGND 4QYAA 1XCQA 3ETBJ 2H4EA 2MJWA 1M2OA 2AAVA 1G7QA 2GSIB 1PD1A 3ABLB 1G5AA 2PP7A 4LOFA 1OGAA 1MFAH 3RVUD 4HU8A 3CN0A 5C2BH 1GOFA 1SMAA 1X5YA 4Y7OC 4N5UA 4UTBH 5ALBL 4EPSA 5KEZA 3VXTA 3G08A 3ZUCA 5I73B 1UT1A 2MCG1 4U1GC 8CGTA 1HZHH 1CIDA 5C0NC 2O5XL 3QHZH 3RWIA 5EF0A 4KITB 1NKOA 2KQNA 2HRLA 3KYNB 4I3RL 5L2JA 2P49B 4FG6C 5DLMH 1F58L 3IFOB 2OR9L 3C08L 2AF2A 5DR5H 1IAIH 3ASOB 3BPNC 2VM9A 4XNYL 3LY6A 3T08A 1DO5A 2HRPH 3ISWA 4EBQL 3DGGB 1HH6A 2B4CC 5KW9L 1QKZH 1N26A 2DKSA 4OJFH 1NCHA 1NUNB 1CTMA 4JE0A 4NO0D 3HW7A 3QUZC 1A3QA 1ZHBB 1GAFH 3IS0X 1Z9PA 1IGMH 2WPGA 3KYNA 4K3HA 5E1IA 4OI7A 3KCPB 5EEWA 4CC4C 4IYKA 3QE5A 3TASA 3GI9H 1BHGA 4HWBA 4I0CC 4UOJA 1NZRA 4ZQKB 1NCWL 4LCYA 2XBTA 2YK1L 3DGGA 1SFDA 1D6VL 1G6RL 3LS4H 4K3JL 2VDKH 1NGWA 3BQVA 3MRMB 3US1A 4PLKD 4X50A 2V8MA 4KNSA 1MCQA 1FC2D 5DRXB 5KANG 4KRPD 1ZHBA 4BFIB 3ES6A 2OSLB 1YNTF 1LO2H 3KCPA 2AJXL 4U2ZA 2AXGA 3ZHKA 4JUSA 5GRVL 2Q6WB 1WTLA 2W81C 3VRIA 3OQRA 3LQAL 5IHUL 2R8SH 4K94H 3I9AA 4I18C 4AVIA 3HAEG 1TJGL 3VXSB 1X6LA 2X6AA 5A2IH 5A2CA 4HLEA 1MAJA 2N7BA 1EEYB 5DRXA 4PBDA 1O6SB 4JHAH 1X5HA 4LESA 2QZQA 1NGZA 5D93B 4YHYB 4KVPA 4BBWA 2E7MA 1D5BB 2H1PH 4F2MB 2HT2D 3B9KB 1CIUA 1CK0H 1YEEL 3UJIH 4BZ2L 4KZDH 3U2SB 2BOCB 4HALA 2QHLA 3VXSA 4NPYB 5AOIA 1JXFA 1N4XH 1I7ZA 2WIIB 5GXBB 4QWWC 1HHKB 3FTXA 1VFBB 5ANME 4HIJB 5GJSH 1IBYA 3L5WA 5DQDL 4AGLA 3L1OL 3KPTA 2DTML 5JUEL 1D5BA 2PO6C 4ZTPH 3T6QC 5AAMC 2UY7B 5H4ZA 4HPHA 3MJ9L 4DAGH 2X88A 2ICES 2BOCA 4JFUA 1E27B 3C60D 4NPYA 4YBQD 4M1DH 1IZKA 4QI3A 2B08A 4WF7A 1GTFA 2A9NH 3FU6A 4MS8C 1FIGL 1HHKA 2D03H 5KVDL 3WLWC 2Y07L 3VD7A 2V9RA 4HIJA 3M7OA 3W0WE 1OP5K 2CO1A 2M1KA 5BVPL 3PQYE 4EN3C 1S78D 3DDGA 3APCA 4JFPA 1QRNE 5GHWH 5AZUA 2UY7A 4OLWH 4A04A 2PN5A 1Q94B 5GSRA 2R39A 1PIGA 3O3DB 4HKBA 3MTXA 1M42A 3ZO0A 3CN4A 5L9DL 2VXQL 4XOAA 3VYOA 3LS5L 4NZDA 1FN4B 4ONHB 4ZO6A 3VCLB 4MASA 5TE4L 5JW3H 2OL3H 4P2YA 2HX9A 3UGUA 5EZPA 3T65B 5CKGA 4A38A 1XSKA 4LIQH 5JLZB 4XXCC 1PD0A 1PX4A 4QRUB 4KUZH 1ZRUA 1N6QL 3HI5L 1H9VA 3BCDA 4O02H 4D3CH 4BH8B 1XBRA 1HKLL 4A6YA 5CP7B 2ATAA 4XP9L 2DM4A 1J1OL 4A2FA 1FN4A 1LE5B 1GHFL 3KYKL 4W4OC 3CSYB 3VCLA 4CU8A 1FZOA 5I6PA 4OLZH 2PTUA 1V3JA 3WYRA 3UGXA 2C9PA 2HFGL 4PV8B 5JLZA 4OGQC 4MNGA 2A2QT 3ARUA 3UPCA 5T3ZE 2A4ZA 2HCZX 3I6KB 3QDGE 4NCC1 4URKA 1T1WB 2FSEB 4BH8A 4FEIA 1NOFA 2UWEE 2H1LM 1WLHA 1IGCL 2DQ6A 4R90L 4IGBB 3CVCA 3ILQD 2E7LA 1D9KD 5IY5B 2DH3A 2UWEF 4JY4B 2R69A 2VAJA 4Q89A 4YUEH 1U8HA 2AV1B 3FU0A 4P04A 5EB9A 1EDYA 5LGHL 2KKQA 3BH8B 5FO7B 1M6UA 4X8GA 4HJGB 3SY0B 4PV8A 4QGYA 4FNLL 4F33B 1QD0A 4PMEA 1F4YH 1Z9SA 4HUXA 1P0SE 1T1WA 2FSEA 4POZC 4OF5A 3T0DA 3H42L 2BCKB 3ENEA 1QHOA 2HPTA 3FTZA 4GRLC 4KTDH 1A6AB 1VZHA 3LN4B 5EDSA 3BH8A 2CDGA 3U1QA 5I8OL 4HJGA 1E5UI 3LEYH 4P2RD 3SY0A 1KULA 4KNQA 1KJ3L 4LPUA 5DC0A 4F33A 2LVCA 4JE4B 1C12B 3V6FA 1QSZA 1L6ZA 5L7XH 1OCWL 4MCMA 4YZWA 4JZJB 3QZOA 5JOFB 3O41B 1YEKH 4U1LA 2AQ3A 1ASPA 4NC1C 4CNIB 2ADIA 4UOQA 5IB3B 1I8LA 4OCYL 1VFOA 5FA4B 3MLVL 3EUDA 4XOCA 2QFPA 4G8GA 4QRSB 3VD4A 4KGLA 1NAKH 4CN6A 1C12A 1BQUA 1PLGH 1Y6MR 4IEFB 5F93C 3RU8H 1E9QB 5AL0A 4L8DB 4BWUA 4N2DA 1LVEA 4CNIA 1HDMB 4DP5X 2NW2B 5T1LD 4B50A 5GS0L 5IB3A 5FA4A 4OUUB 1RP9A 3UAFA 3EGDB 3IE9A 1EFXA 4OCXL 3DGCR 5EWIL 4DFHA 3ULVE 4G7YH 4NRYB 1R3HB 2R2EB 4MWFB 1TTRA 4IEFA 3WAKA 5CEZD 3ULVF 1VESA 3IJ9A 2YPVL 1JGVH 5I28A 3O2VH 4L8DA 2NY5C 1P1ZB 2Z9TA 3NRPA 5IBLC 2X89D 5IROC 1N64L 1HDMA 2I26N 5IB5B 4U33A 2XWTA 4C8XA 1S7SB 2FJSA 3EGDA 3CZLA 3M17A 3MCLH 3TP4A 5B1BB 3ULSA 1F4WH 1R3HA 2KLRA 2R2EA 4MWFA 3GXNA 5B7FA 2CGYA 4IDJH 2ITDB 2IFFL 4GUOA 1VSCA 2LHAA 5C6WH 4G7VL 5TPWL 2AJVH 1AIFA 4JAMB 3TVMC 3MFFB 5IB5A 3FFCB 2AJUH 1S7SA 3O2DL 4N20A 2DJMA 1KDJA 4UANA 3NEEA 4AYGA 3IJ7A 1J10A 2NX5E 5DA4A 1IL1B 1KJ2B 3QS3A 4HH8A 3ZGIA 2ZSWB 4JAMA 3TU6A 3CPLA 4FXGC 4KVNH 3V10A 2Z7ZA 3BUBA 3DHUA 1A6WH 5DHXB 1A1MB 4P2OB 3KDPB 5C07E 3RJDA 1J1PH 3AZUA 1GW0A 4QF1A 5CEZL 3EDEA 4YH6A 4AT6A 3E1ZA 5JA8B 1KJ2A 4HIPA 2CO4A 1NAML 2YC1B 3CVHH 4G6AD 3NDYE 3PABB 3NZ8A 1NGPH 4LRIA 4WI6A 1RLBA 2W9EH 3NZHH 3CC5A 1VEOA 4S1RH 1PZCA 5FB8B 2AV7A 3QJQB 4P2OA 4GB9A 5CMAA 4ISVB 4L8BB 1FHNA 3FF7A 1BOYA 1A6UH 4HDIA 1NBYA 4AVKA 3VFGH 4LP5A 3N42B 3U4EA 5F7KC 1UENA 1ADQA 3MU3A 1AHWC 2YLKA 4XC3H 1F90H 2EECA 3CDGB 2ZXBA 5JZ7C 1TTFA 4MJHA 5I5MA 3CZGA 4RFOH 5D2LE 1YEGL 1PG7H 2XVKA 5E8DL 3OWRA 2G3ZA 1E65A 5IV2B 3S37L 5FB8A 1HCZA 2ED8A 4ISVA 4YSEA 4J3TA 3T8MA 3JYCA 4Q9BA 4PREA 1L0YA 4JDVB 4X6CA 1S3RA 1PVHA 2NR6D 2ZUVA 4KJQC 4UZUA 4Z6AT 4NCDA 4YXHL 2FLMA 3CDGA 4N5EC 3RKDD 5CJ8A 2EDMA 4JRXB 4QLWA 2I60H 3VH8B 2ZCLL 4Z7IA 3K4ZA 3Q13A 2QQKH 4JO4L 1UH4A 5HHOE 1LWJA 1GZHC 4NNXB 4L4TD 3B37A 5JQIB 3UACA 4MCYB 4PWGA 2DI7A 4JDVA 3ULAB 1FQ9C 5CBAA 3DRTA 2ZXCA 3DJRA 3FUNA 3QUYD 3RPIB 1KTDA 3QA3B 3VH8A 1N67A 3F01A 5D7IA 3PJSA 4LQ1A 1YN6B 4NNXA 1AZUA 5E6IC 5EORH 4MHHG 3ARBD 2XQ0A 5E51A 2BNQE 1F3DJ 1ZDQA 4DVRH 1UGNA 3BMWA 3RPIA 1BQLL 5BUAA 2B0SL 2F8VA 5IK3B 3O81A 3SGDH 5B39B 4FFYA 1N5AB 3S2AA 2FWOB 1F0LA 1OPGL 2MFNA 1OSEA 4ZW7A 5JR1L 4PRIA 1H8SA 1V5JA 3CHQA 5H37H 4UMGA 2JCCB 4V33A 3TWYA 3TO4A 2XV3A 4C57C 4Z7OE 5GZOC 3UO1H 3HG2A 1KLUB 4Z3JA 2DOCA 2QL1A 2FEDC 3AUVA 4QXTA 4FS0A 5IQOA 4ZO7A 3WEAA 1JHLL 1G7PA 3US0A 3AT9A 3QJVB 3HC4H 3K7UA 2VCOA 1I3VA 3EF7A 1QMUA 3BP5B 3EFOB 2P52A 5BZZA 3DVNA 2XWEA 4Y5YB 3LRMA 2J3SA 1XGQB 4CILA 1JWSA 4UOW1 4WWPA 1XF5A 2PW1B 3PHOB 3LNEA 4AM0Q 5IBTL 2R59A 5L2KE 4JEGB 2ZSVA 2NT0A 1XIWC 4MXWL 4F7EA 4UAHA 5E4EC 1JJUA 2Y7QA 1QWHA 1LE9A 3BP5A 4RMWA 3EFOA 1KCVL 3REWB 2CUHA 4H8QA 5C0DA 4Y5YA 3BP6B 5AG9A 5E1HB 5FYJH 1TQWA 1MY5A 2WQXA 1F1AA 2E27L 1A1OB 1YPZE 1XGQA 1SUHA 3MUZ1 4OLUH 5I0DA 2PW1A 3G6JB 4R7NB 4JQIL 1RFDL 4ZFFB 1YPZF 2YGQA 3HC3L 3DJTA 3U25A 3D25A 3U4KA 3RL1A 4UZGA 3P9LB 1A14L 2DD8L 3D12B 4NUPA 4YE0A 4ZTOL 3QNXB 2OJ1A 3T3PB 1T22B 2ADJB 1X9UA 1DVQA 3UGEA 2FHBA 1Q1JH 1AIZA 2ADFH 3L3DA 4U3XA 5IB4B 1OHZA 4JM2F 3RVVC 1A1OA 4R7NA 3G6JA 1MOEA 3UX9B 3ARWA 4YLQT 5HHME 1WA0X 1UWXK 4ZFFA 5HPMB 2EP6A 1VCBC 1F86A 2BP8B 1C5CL 2P24B 3P9LA 2VDKB 1TQSA 2BIQA 4I1RA 3QCUL 2R0LH 3EZJB 1T22A 2ADJA 4KKCD 3C8HA 5LHDA 4ODVH 1AQKL 1RIVH 5CJXC 1QI5A 5E8OA 1JTTA 5HI4C 3CSGA 5HHXL 2D3JA 2OMZB 2BMKA 5HPMA 2IH1A 4K0OA 3FT2B 5B4MD 2P24A 1IQWL 4K55A 4KI1A 4WWID 5IJBC 2HKFL 3IJ8A 4G8IB 2LR4A 1GGYA 3ZTJG 2V2TB 3QRLA 4RSYA 4H8HA 2WXOA 3QQ9C 1A1NB 3V6ZA 2HJLA 2DQIH 3FTSA 5F0JB 3FT2A 4X9YA 4JREB 5FW6A 4YWGL 1ZPLA 3WBDA 4ICWA 4D9LL 1CXLA 2G0LA 3FHQA 4G8IA 2ZOWA 3GMNA 2D4FA 2V2TA 1KCLA 4NP9A 4I48A 5I2IB 2FTAA 4ZMLA 3IDUA 4MA1B 4EOWH 3LXCA 5AZEL 5HY9A 1MW3A 3BH9B 1B4TA 2CQVA 4MB1A 1FA4A 4JDTH 3I6LD 3I02B 1YEFH 4NC2B 2LAAA 2OI9C 1OB1A 4FFZA 2B7DT 4L3EA 3S36X 4C59B 2GUOB 4AYDC 1JHKL 4GSDH 5KVMC 4Q8BA 1SXNA 4JPVL 1T20A 2PKDA 3V9CA 3BH9A 3Q8CA 4L4VB 2E59A 3L3GB 4HWEH 1PCXA 3RVXD 4PJ8C 1F8TH 2VR9A 5I1DA 3I02A 4FQ1H 4UM8B 4W9JC 5HHVH 2ZICA 5DGQA 3STBA 5FR3A 1JPFB 4MMXB 5HDBF 4PJXE 1JF1A 4PJAE 4LDOB 2GUOA 5DFVD 1IARB 3TV8A 4LRNH 4Z7QE 1UASA 5C08A 1UA6H 4QHNB 2OL3B 1I82A 1AANA 2R29L 3BIAX 3KPRB 4XVJH 2QV2A 3MACL 3QEGL 4QO1A 4AIZB 1ODAA 2C9XA 3ARTA 1A9BA 1ACYL 3D69B 1YEJH 4RGNC 2WUCL 5BO1L 4Q6IC 4QHNA 3BZ5A 2OL3A 3GKWL 1VZIA 5D1QD 3RVUC 3ZY7A 1LO4H 3KPRA 4IRJA 1P7HL 3RUGB 2X5PA 3AABA 2C1PB 3WY4A 4AIZA 1KTCA 4GIOA 1S7UA 1MJ7H 3LQAC 3D69A 3D39B 1AJ7L 1IKOP 4B5ZA 3O2WH 5C3TA 1MCFA 3V0HA 3ARFA 2W88A 2FO1A 3V79C 2F54B 3B7TA 3UBFA 2Q1EA 4XB3A 4RAVB 4NERA 3VXMD 1RZKL 1SMOA 1S3KL 4L05A 4J3BA 4KMTL 5AG8A 1BWMA 2XACC 3RUGA 2C1PA 2X6BA 4FD0A 2R9HD 3THMH 2VDLL 2XOTA 3D39A 1JZ5A 5GRUL 1AY1H 3QYCA 4F27A 4W9CC 3BHBA 3WJLC 2F54A 3VG0H 2Q8BL 1CUOA 4GAJL 4NJ9H 3CSPA 4R2GD 2DLIA 2YUVA 4Y4HB 4Y1AD 5GGVL 5JQ6L 5D4HA 2CUAA 2JKLA 1X5IA 3VVVA 2IWEA 2R2BB 4Y4KA 4PJFA 4HIHB 1UG9A 3AS3A 4KRPC 4EIBA 3CNKA 5FYKH 1ZKAA 1U30A 3FK3A 1XSJA 3UTTB 4NNYB 5C97A 4PRPE 4YGVA 4D0DA 2D2OA 1WA1X 1MSPA 4FQIH 2WKGA 1A7NH 3Q6FA 1INEH 3JV0A 2DBLL 1JK9B 4IOFD 4P46A 4UV7L 5A2FA 5D55A 2R2BA 4ADGA 4Z5RB 5EOCL 1N0XH 1BVKA 1NMBL 1QX1A 2DQEH 2CKBA 2NY3D 4HIHA 1QO3B 5BMFL 5KS9A 3TX4A 1UJ3A 4TTDD 2G3MA 5AW1B 3GRWH 2HT2C 4JB9H 4PJEE 1OAXL 4W9GC 2X6UA 4ZMAT 3DX6B 4I2XA 1DE4B 3EH2A 4NZ8A 4Z5RA 4RAHA 4HV8A 2WAQA 2WGNB 1QO3A 2R69L 4UIKL 1DVFD 1KC5L 4PS3A 3N6YA 1SHXA 4G9FE 2BP0B 4WIQA 1MFEH 3DX6A 3C60C 4LL4A 3ML8A 4YBQC 3QAZC 1DE4A 2FQGA 3LZLA 2Z4TA 4K5MA 3CV5A 3BPLB 5AAPA 1IFGA 3UH8A 4E9QA 1BLIA 3AQYA 3BKCH 4OLEA 3WFBH 2K9FB 3SDDD 1X4ZA 4X0NA 1CLZH 3DV4B 4MMZC 3ZDXB 5I66B 5JNYA 1S78C 1ND0A 2BP0A 3IJSA 2PCFA 1TIUA 3O9WA 1E8YA 3VD2A 5J06A 1RD6A 1F6FB 4IK7A 2VISB 2BVEA 3RE0A 4L1HA 3U9UA 2ZWLT 1JTOA 1A0QL 3QJUB 4M03A 3L5JA 4NQUA 4NN7B 2DYSB 1YEDB 4LP4A 3HN5A 2XA3A 3KMDA 5FLVA 1VFUA 4XTRD 1QNIA 1OARL 3P4LA 3S96B 3DV4A 5HYSB 5I66A 4EAEA 3SJVE 5DUMH 4YDLC 4TSAH 4NQCE 5F2FA 2ADYA 3ZYOA 4NM8L 3CVHB 4Q9QL 4OH2A 4DW2L 3PRZA 1AO7B 1IVTA 2XG4B 4HJUA 3JWOL 3CAFA 2KHAA 3WDHA 3W0WD 4NLHA 4OT1L 2H8PB 4LSQH 3NA4A 4HS6B 4PG2A 5BS0A 4OZGB 5HYSA 4NC0B 4XI5D 5KVEL 2BZDA 5GGUB 1DJHA 1LXMA 3C8KA 2NZ1A 4MB5A 4U1NB 4EN2A 1KYOJ 1UWYA 3VXUE 3CVHA 3AMKA 3C5ZC 3T4AA 1L9PA 5EFIA 1AO7A 1KGIA 4MRBA 3L2LA 4MJID 4XC1L 3ILQC 2LLGA 1D9KC 1MRDH 1ZEAL 2WW8A 4G5AA 4HS6A 3CE1A 3GEWB 1F42A 4G8FB 3U9PL 3KPLB 1BYPA 3JWDL 5B1AB 4EZKA 1AACA 1B3IA 5GGUA 3FULA 3X3GH 4U1NA 5BV7L 1UKTA 5DHYB 3UADA 1FSKC 2DYPD 5I0YA 4MAYD 1EUTA 1BZ7A 3GHPA 4Z7UB 4J6RH 4MTMA 4FI6A 3BZFB 1DR9A 5C6PB 4YL9A 3ESMA 3QH3B 4EZLA 1S2EA 5FHBL 3IKCA 1KSRA 2W60A 4G8FA 2VLRB 3U0WL 4R7XA 4YDIL 3VFWA 3W56A 4L18A 3KD4A 3MV8D 1RH8A 3EG9B 3NABH 2VDRH 3QDME 3TESA 2GTZA 5DI8B 3IWUA 3LKPB 3MOBH 1ECYA 4GNKB 3QFDA 1U92A 1TYRA 4Z7UA 1RK0A 4XPAH 1HT6A 2OMNA 3BKYL 1EH9A 2CZNA 1KTLA 2XT1B 3O4OB 3FSAA 3MN8A 3OXSB 5GPRA 3DBXB 2BSSB 3VRJA 35C8L 1I3GL 2JCWA 4K23L 4GLRH 3LKPA 4MB4A 4CMMB 4TVPL 3EJUA 1MFNA 5LBSA 2P5ED 1TLKA 1BPLB 1OANA 4N9OB 3OXSA 1FYTD 3DBXA 4TMPA 4UV4H 4HCRH 3QFJD 2G9KA 4QRPE 2FX9H 1PY9A 3MRFA 3VXRA 4XZUA 1XCTB 1IVLA 1CI3M 2QR0A 1TCMA 4P2QA 5TGBB 4AENB 2CIKB 2E9GA 5C0CD 5T1KD 3DDFA 4GRMB 5IR1B 2VLLA 4YHMH 3L81A 4DZ8A 4X5QA 3UPRB 1FDLL 1KZYA 2YPLE 4RDQF 4WSGA 4LVHB 1UXWB 4K3EH 5EZJB 2E9WA 1GGCL 3M1BA 4TN9A 5H35B 4MD0B 1GOGA 1C08A 3RJQB 1XCTA