3IRCA

Crystal structure analysis of dengue-1 envelope protein domain iii
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
104
structure length
104
Chain Sequence
b'GMSYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSTQDEKGATQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKGSSIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENVELOPE PROTEIN
molecule tags Viral protein
source organism Dengue virus 1
publication title Crystal Structure Analysis of the Dengue-1 Envelope Protein Domain III
rcsb
total genus 13
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2009-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ircA00
2H0PA 3UZQB 3WE1A 1ZTXE 3N43F 5KVEE 2R29A 3N42F 2GG1A 3P54A 1PJWA 4UTAA 4FFYA 4UTCA 5LBSA 1RERA 4BZ1A 4BZ2A 1Z3RA 3N40F 3VTTA 4AM0Q 5JHLA 4GT0A 4ALAC 1OK8A 2ALAA 1OKEA 2JSFA 3MUUA 4UT9A 4X42A 5KVFE 3UYPB 5IZ7A 5IREA 3C6EA 3UAJA 5H37A 3N44F 5AAWC 3UZVA 3C5XA 4GSXA 5LCVA 3J2PA 1OANA 5GZNA 4UTBA 3IRCA 3J27A 2JQMA 5KVDE 3UZEC 2HG0A 2JV6A 4UT6A 1SVBA 2P5PA 4L5FE 5LBVA 1Z66A 5JHMA 1UZGA 5GZOA 2I69A 2V33A 5B1CA 4FFZA 1S6NA 3N41F 1URZA 4FG0A 5KVGE 4AL8C 3G7TA 5AAMC 2R69A 1TG8A
chains in the Genus database with same CATH superfamily
1IC5H 4PMFA 1SY6A 3EH1A 3NT0A 4RFOH 4RQQA 4L4VE 5ALBH 3K1KC 2CKBA 5EC2B 5J5EA 3FULA 1X5KA 5DJXB 3D0LB 1NFDB 3PGDA 2WIIB 2NTSP 2CPUA 4JR9H 4N2NA 4JE4B 5HHMD 9PCYA 1BECA 1KY7A 3U7WL 4O2EA 1WZ1L 2MQ3A 4X7FC 4C83B 3LPFA 4JS7A 4LPWA 2HG0A 3S98A 5DJZB 3RGVA 4LEEA 2HMIC 3OAYK 1X7SA 3QCUH 4PJBB 1Y1UA 4HHAA 1MIEL 1QI5A 5DJCB 2N3JA 1MXDA 5IVOA 3FO9B 3BI9X 4IU3B 2HZHA 2WNWA 2FO4A 1HH6A 4DZBB 3DDGA 2OZ4L 1KIUA 5JUEH 3QJHB 5CGTA 3UX9B 2UY7A 3U1PA 3VXOA 4BQ6A 2Y0SA 3QIUC 5HYJA 5IHHA 5DJ0B 2OV0A 2XWBA 2OJEB 5C0GA 3UZVA 3SKJL 2OW7A 4PJDA 4BBWA 1YUHA 3HE7C 5I76B 1S3KH 5KVEL 5C0FA 4HJUA 3MSPA 3OG6B 1N0LB 2OMTA 2OL3A 4IK7A 1FNGB 2EYSB 1MIMH 2XU9A 4WU5B 4WU7B 1WWCA 2BC4A 2A7BA 2YMXL 3AQXA 4H8UA 4TUOB 3FRPB 1W8OA 4JM4H 4IS6A 4X5XB 3QI9D 1OGAA 2F8XC 4IIQB 4KO5A 5CHNA 4LQFL 4I4WB 2K7PA 3SGDI 4EOWH 5C0CD 3QJHA 4M7KH 4NO5A 3QQ3A 1ZTMA 5CAYB 4YO0A 1JXGA 3WE6B 3S7GA 3N50A 3L7FA 3TVMD 1UADC 1MAML 2K78A 5LDSA 3P3YA 2YQ3A 3VI3B 3VAEA 5TK2A 1GZPB 2IH8A 4ZUSB 1BVNP 1K6QL 2QV4A 2X7LB 4LOEA 1EMTH 1XMWA 3EYQC 4M4RA 4P5TC 3ATFA 4PJEE 1S9VB 1SEBB 1CFQB 5DHVA 4DT2A 1D5BA 3CFEB 4DAGH 3D0VA 4XVSL 3UDWA 2A5UA 2BXYA 3DETC 3HE7B 1FHGA 4H5SB 5B1JC 3TCLB 5IW1B 5IQ7H 4N0UE 4LSSH 1ADWA 1F86A 5B8CA 4ZW6A 3WGVB 5F1NA 4DGUA 4LHUD 1N2RA 4KO6A 4NPJA 2EYTA 4PRBA 3BPLB 4ABQA 1RZ8B 5I66A 1B88A 3GMOA 4PLJD 2MPAH 1G4RA 4P2OD 2C1OA 5AUMA 5CP3A 3IF1B 1MHCB 4L9DA 5CZRA 3EJPA 3QBTB 4E9RA 2YPLB 3BMVA 1BVLB 1D5RA 2DS4A 5D2NA 1VENA 1DVFC 1BFVL 1ZIBA 3TN0D 1U93B 4YBLB 1H5BA 3S4SA 1LK2A 4GB9A 4NUJB 1Z9SA 1TO5A 2VQ1B 3RZCD 4NM4L 4GG6F 1S6NA 1QHOA 2LGNA 4ZUTB 4PD4J 3TU6A 4AZ8A 3P3SA 3BXNA 4WFGD 5GRZA 3T1WA 1N5YL 4WGKA 3H9YA 4HCFA 1AFVL 5MHSE 4G5ZH 5D9SB 4PG2C 1DJZA 1PY9A 3NIDF 4OZGF 1E4JA 2IWEA 1OP3K 4AM0Q 1B9ZA 1NCCL 2AXFA 1P5VA 2XQYG 2MQCA 4JRYB 2BINA 2WLZA 3S96A 4BSVB 1VSCA 1GKOA 1KY6A 2X6MA 2Z31A 4YDLC 1NGYB 4RMSA 2FUQA 2P5PA 5D1QA 3BEVB 4CMMA 1USZA 3MJ8B 4JM2C 4NNXA 3UP6A 4L3ED 3SDCA 1TF4A 3GSUA 4Q7DA 5JPNB 3ES6A 4CN4A 3BIKB 2DQHL 2E8YA 4CNIA 3VD3A 4BSWB 5EO1A 2WXIA 4CA4A 4D3CH 1SJVA 3FH8A 5F70A 2C9QA 4Z77B 3NDZE 3D2UD 1ZGLP 2FX9H 1MHHB 1OSPL 2MNJB 2ZCLH 1PKQA 3TTSA 3OMNB 2XN9B 4D0DB 3QCUL 3ULVL 4PJ8B 1QABA 1MELA 4ZMOA 4MCZA 5D6DC 3A47A 4X8JB 3S37H 3G9AB 5J6GA 3WUWB 2HFGH 1WHOA 1J05A 3DMMD 4XBGB 3H0TA 3UMNA 5H8DA 1WICA 4Q9QH 1J8HE 4UU9B 5JHBA 2QQNL 2D31B 2QPUA 3GHEH 3MV9D 2KPNA 1E5CA 3NJHA 1M1SA 3FQ2A 4ZAKA 5B1AB 1DN2A 1M05A 4FKKA 5CLXA 3EHBB 3Q3GB 3O6LH 1KCRL 2DZEA 4GRLD 5IVXA 4ZPTB 5I1HL 4J3OD 4TSBL 5IVXE 2K70A 5E95B 4U6YB 3TJPA 3SBPA 5T3ZL 2BSSB 4O5LL 5JR1H 1S4IA 1S7UB 4M3HA 1RUAH 4ZOAA 2B5IC 5LJYH 2Y5TA 3EZ8A 5SX4H 4L29A 3RGVD 2WXKA 1FYTD 5IFHH 4PJ5E 1YPZE 2J4WL 4OCXH 4QWWD 2FHCA 4JHWL 2CK0H 1TITA 3TBTB 4BFJA 2YKLH 5EC1A 5B8CB 5CIPH 5D7KE 1CB4A 2X2YA 2FWOB 2AERT 3ABGA 3O8XB 4HEPA 1NCBH 2ITEA 3A6CH 4ETQB 4F7MA 3D3VE 1MEXL 4K5MA 4PGDB 5FOBA 1XBDA 4JFWA 3FUEA 4AV4A 1TNMA 3MZTA 4M7JH 3QCVH 3VFNA 2VZ1A 3P3RA 4C47A 3LKNB 4OCLC 1P1ZA 5EU6A 3RWFA 2CUMA 5BVPH 1M7IA 4S1QH 5LG6A 4JKPH 5FPIA 3IDXL 4JFPA 1HJCA 3LSOA 2H0EA 4HD5A 4NKMA 5IBUB 4PAZA 1MVYA 4KQ4H 5DJ2A 3ULUD 2GIMA 3GXUB 5K1NA 1IAIL 1ZK5A 3CBJB 4JFED 4WK2B 2RFXB 2WXOA 3EFDL 4J2QA 3F58L 2F5BH 4CRPA 3EDKA 3QRBA 4WHYG 3PRZA 4CDHA 1YEHH 3FTUA 1TVBA 3FQTA 4RGND 4LVOB 3J07A 3FO0H 2OJ1A 4A7QA 5F7UA 4ZFOL 4JDZB 2DV6A 4KNQA 1JDCA 1NGQH 2LU3A 2OMXA 3OVUB 3WE6A 3IDUA 1DQTA 3CHOA 3ZRCC 3BN3B 3L5JA 5IBLC 3FHEA 3HJEA 3OAZH 4UT9H 4Z3EA 5AVVB 5C0CE 1UM5L 3AXLA 2OMWB 3AZUA 5A7EA 1C12B 5EBLA 1HE7A 5LCVL 3NEOA 4OZIE 2Z4QB 1N68A 3K2UH 3ZDYE 2BC4B 4Z7OE 2H0FA 5F2FA 3MACL 4RZCA 4AVKA 4TULL 4BWWA 3RURA 1YPZF 3GYRA 1OARL 5G5DA 3WNMA 1PLCA 1R3JA 1NBCA 2R56H 4WFFD 3HNVH 4Z77A 2IDCA 2X89D 3L4WA 2CCVA 2F54D 2IAMA 3OZKA 3FTWA 3QC6X 3FQUB 2NCEA 4C8XA 5B3JF 1K9TA 3RJDA 1KCUL 2YPLE 2NQDA 3CDGB 3PHAA 5I71B 4UILL 4EIBA 1LO4H 4Q9RL 2FO4B 5EN3A 5DDHA 4D9RD 4NNXB 1JOIA 5B1JA 1T66D 1KIQA 2IGFH 3N3EA 3ZUNC 5MEND 4M00A 4OFIA 3RVWC 5HGHB 3DVFA 2BY3A 4Z23A 4G9FD 4XHQA 4DAGL 4LNRA 2V5TA 1EH9A 4E36A 3ARFC 4WJKB 4NO5B 2AQQA 3MODL 4RISL 1OLZA 1DDTA 1T0MB 25C8L 4LEOA 1TZHB 3MC0A 3AY4A 3WJLC 4DW2L 2XQ0A 1V7MH 4JFOB 4X5XA 3RU8H 3SQBA 2MQGA 2NXZB 1AI1L 4IMLB 4NRYA 2D7OA 5D7IF 1MCBA 4E5XG 5IJVA 4NUJA 2OL3L 5DK3A 3MV8A 1D5MA 1IGYB 2BH0A 4LEBA 2X4QA 3O6KL 5D2NB 3WNIA 2WKLA 2YO3A 5C0FB 5IHZA 3OPZL 1R9FA 1ZLWK 3O2VL 4WFGE 3QC5X 1LO5A 2Z92A 1NIDA 2Y1YA 1T2QL 2BOBA 3PY9A 5KS9B 2Z31D 3NQIA 3L54A 4PBXA 5DMKA 5EZOH 1Q38A 6FABH 1QLRA 3ETTA 5EUOE 1DFXA 2BJML 1QBMH 1HSAA 1OL0A 2YGVA 4A6YB 5I18L 4A68A 3VFWB 4GUCA 1PD1A 2O5YL 1CGSL 4O2FB 3P77A 3X14A 4FG6C 3QEQD 2XWTA 4MD4A 1IAMA 2CKNA 4HA1A 3G5YB 4EPSA 4HXBH 4UI2A 1G0DA 1UC6A 4QRTA 2X3AA 2FD6L 2NT0A 4QRPA 3NPSB 2VM3A 2D2OA 2EDBA 3PGDB 4XP4L 3RGBA 3TA4D 5HYSG 4QXTA 1SUHA 2WVVA 3IXAA 4NKIH 4UAHA 3MV7D 2D7QA 5CN2A 2NY7H 4XMKH 5IBTL 1MJ8H 5EBWB 1SHXA 1O5DT 1XB8A 1OB0A 1HSAB 1J9RA 3KR3L 2HT4D 4OJDH 1HK6A 5AVUB 3L7FB 5D7IE 5DJ8B 4DFHA 4S1SH 5IK3A 3I6GB 4JPVH 4XPBH 3HNSL 3LTVA 4AXWA 1O7VA 2IFGA 2JTDA 3VI4A 1O9ZA 2UUDH 3Q6FA 4XBEL 5JQIB 3NK3A 4TVPL 3ECBA 5AZ2H 4UV7H 3GTTA 3WUWG 4GRLA 3O45B 4P23A 3A4EA 3D48R 2ADFH 3E80A 1KELH 3EFFA 2TRHA 3FONA 1F4HA 3PFQA 3CN4A 1R3KB 4Q14A 4YLQT 4FTVD 2ZWKA 2ZXAA 4I1NB 4KRPD 1UWXH 1RJZB 4GXUN 1HAUA 2XI9A 2IXQA 3EJSA 3U0PB 4GG6B 4WDIB 1HNGA 1AS7A 3ARBD 3V0DA 4E9LA 4X6BB 3NBNA 2W60B 3GSVB 2RGSA 2QVKA 1D5ZA 2WB7A 3V0IA 4PJIA 3UTTA 1OXYA 2XCMC 4KGLA 5KW9H 2E47A 2P5WD 2AK4B 2W65B 1TSHA 4M02A 1CBVL 1PX3A 3ZL1A 2HT3C 3FB6B 1GGBL 1RIVL 1ZDSA 5KSAB 2A6IA 3DROA 5GIRB 4K9EH 3TP4A 1F00I 2PXYD 1G9ML 2C9AA 1U3ZA 3LRHA 3G6AB 5EU6D 4IKJA 3ME0A 2HMID 3C6SB 4OZFB 4JZNB 4PP2B 2XT1B 5EEXA 5JIPA 3BMWA 3GDCA 2DQGH 2KI6A 4GEJA 2QLYA 3UJTL 4IBWA 2Y2WA 3ISYA 4XMLH 4YAQB 3APNA 1L6XA 2BOCB 4XVJL 1ZT4B 3DTDA 4AQAB 3V0VA 1CL7I 5DD3H 5F0LB 3Q1SL 1V27A 5DEJA 2R2HA 3OC8A 5I0YA 3I3DA 3EOYG 3N42F 1KDIA 3LPPA 3O3AA 1JUFB 2ADIA 4U0QB 5DO8A 5T5FL 2DJ4A 2JFCA 4DK5A 5JPMC 5L0QB 2J8UB 2APBA 3D1MC 1QLEH 1I8IA 1JPFB 2DBJA 1T7YA 3RPBA 3QRLA 4DO5A 3CZLA 1BEYH 1PZ2A 2YRPA 4UT6H 1WRFA 2VDOL 4HWNA 4LDCA 1Y0LA 3DVNA 3EFDH 3IS1X 1NEUA 4RX4A 1FBIL 1U58A 4RZKA 4RBPH 1J0YA 5HGGS 1KGCD 4DH2A 2P5ED 4N9OB 2YLKA 4XN5A 1EANA 1I8MA 3KPQB 1CMOA 3ABMB 3OKKA 1A65A 3QZMA 5ESAB 2PTTB 3CUPB 1BM3L 1O6SB 4UB0L 1YMHA 4UAOC 5AAMA 2KKQA 6FABL 4JDTL 4Z5RB 3OB8A 5LHDA 3MLTA 1IC1A 3KPRE 3BVVA 2D7NA 1CYWA 1MI5B 4NB7A 5K69A 2X6CA 2NNAB 4LLYA 2M26A 5FGSA 3W0WA 3KPNB 2RD0A 4DKAA 1QPKA 2HLEB 1INEL 1SGKA 2YN3A 4N0UA 4GIAA 1AZRA 3DPBB 2FECI 4FTVE 5ACZA 5HHOB 2ALWA 4ELMF 2Z35A 2COVD 3GB7A 1HZHH 1YY8A 4ETYA 2GY7B 4NI3A 1JGUL 1XTLA 1Z7JA 4XCYB 3GIZH 1OAZL 1HOCB 2VM9A 1KYUA 4XXWA 4JDVA 5HYQB 4K9EL 2EEDA 3JTTA 1QUNB 1XIWD 2EDMA 4YZWA 3FTGA 2H1PL 4F57H 3II3A 3TFKC 4AVHA 1L6PA 3FTZA 4XP5H 1G6RL 2EQDA 2FATL 1WZKA 1U8JA 3NSFA 3S88H 2YIHA 3H9HB 4QEGA 1VFUA 1FPTL 1WWWX 4GRWH 4DSYA 4ZPTA 4J3OG 2V8MA 1DDHA 2X10A 4L1SA 4R3SB 2EE0A 1FQ9C 1V55B 3X13B 4V1DB 2I5YH 1NCGA 2HVKB 3AAZA 5FWQA 3CHPA 3B2DC 1JZ4A 1BVOA 2ILLA 1FIEA 2PW1B 3V6OA 3VE0B 4HUCA 3WXVL 4L4TA 3WDIA 4U4IA 3IXTA 4DUWA 2VLLB 3P3UA 3WMQA 1E7VA 3EXLA 2NZ1A 1VADA 2VN7A 1KLFB 2N59A 4HIJB 1DVUA 2O5ZL 1CIUA 1BZQK 2A77H 5ICZA 1OP5H 5I8OL 3OR6B 2AHIA 1XAUA 3KBEA 4HZLB 4B3EA 4QRPD 1C8QA 3T0DA 1WVZA 2YJLA 4WI5A 4YFLF 4I18C 1KBKA 2H0JA 3DIVA 3B3BA 2A3TA 5D72H 3QUYB 5EBMB 1SMDA 5EZOL 1ECZA 1PG7H 2VXTH 5LLIC 1FFOB 1K4CA 2B1HL 5FO7B 3BIBX 5AW2B 3CVHH 5E2VH 1DCEA 2AQ2A 3RZCA 3AREC 3N1MC 4J3OH 4UT6A 1FFQA 4ZO6A 1NCCH 1AD9B 2XTJE 4XNBA 2P4AB 2C3XA 2CKBH 1HHJA 1LNUB 3IJYA 3IJEA 3NCCB 4KK9D 4WLCA 4Y0GA 3V6FA 3RFZC 4IJTA 1FGNH 4P9MH 3KPRB 2R0ZH 2YSSA 5ALCL 1RKRA 3BISA 2BFVH 3F7VB 2Q8BL 3MV7E 1PL3A 5IHUL 5AOJA 4DIXA 2VZSA 2P8MA 3QJOA 4C57C 4KUZL 1FL6A 4TN9A 3TT3L 4MA3A 2APSA 1XGRB 2ZP8A 3FU0A 3KPRD 3L3KA 1NMCB 3QAZB 3L13A 1JPSL 5HHPB 3MODH 3K8KA 1GYAA 2OBGA 3CLEH 1Z5YD 1GA2A 4LOUC 4PV8A 4H1LG 1DP0A 2NT1A 5ANMA 2OXHA 2VDMB 3MRJB 3EH4B 5KZCD 3SYCA 5D2LA 4E2OA 2NDGA 1OSYA 3RVVD 2E76C 4FI8A 2VLJB 1UA6L 4JM2F 3TOPA 5E00A 3VRLE 3QWOB 1DJIA 5I8KH 1MHCA 2J12B 2NMSA 1I9IL 4GSRA 4UIKH 2CBMA 1MCOL 4R2GC 3WTTA 3MJ6A 5C9JB 2YA0A 4U1IB 1BVNT 2IADB 4P5RA 4XAWH 1RUMH 2DBLH 4I0CC 5HVWA 1ETB1 1T1ZB 2J3SA 1K5NA 2XVKA 5IJDC 2ZONA 2HFFB 3JWOL 2BSTA 2F08A 2XWZA 2UYLA 5IB2B 3T0EA 3BWAA 3A24A 4AENB 5CEZH 4EI6A 1CD1A 3SY6A 3DI2B 3RTQD 2A38A 3RY6A 1G7PA 1EVTC 2H26A 5CKGA 5TDPA 3S48A 5HDRA 1EERB 5BJTB 3T09A 2GIYA 1FL3B 4BZ2L 4HX1A 1L7IH 1AQKL 3PAVA 2XPYA 5CSGA 2VL4A 4UCFA 3A6BH 5D96B 4KH2A 4F7CA 3D4YA 2P7TB 1XIWB 4JMXA 4K3GA 4HUXB 5EF3A 1KV3A 1MWAA 5BS0A 2LAAA 4BE5A 1P7HL 1A6TA 1FNLA 4CC1A 3TEUA 4U6XA 3P0VL 3ULUE 1I8LA 2WBJA 4HIHB 3K2KA 3M86A 1XBRA 2UVEA 1LQSR 2GAZB 5I0WA 3UO8B 3QZLA 2NXYD 1M1XA 1CTNA 3F65A 1SDDA 2P5EA 3C5SA 4LKXB 4OH2A 3KWWA 4I4WA 5DWUH 1BA9A 1OTSD 3HBPA 2VDPB 5IOPB 4WW2F 5C8JB 2DQHH 1OAJA 3FOMB 4LCWE 1A4JA 2RA1A 4R5TA 4MZ2A 4DQAA 4UTBA 4RAVA 4XNXH 5KSBF 3EF7A 1DTUA 1HWHB 2BVPB 3W9DB 4K55A 2ENYA 4PRPB 1XFPA 1LO0H 3NJFA 2PF6A 1I4FA 3HBZA 4ZTOH 5T1DH 5JLZA 5CCKL 3FB5A 1W0WB 2CWRA 1SN5A 4OB5H 4RAVB 3JWDL 1H6EA 4PWEA 2BSCA 4UOJA 2PNDA 1L9NA 4N28A 3WO4C 4Y8AA 1HU8A 4RSVA 5E5MB 5F7WC 1DO6A 3KHQA 5CU5A 5G4MA 1S7XB 1NCTA 3VXOB 1E43A 1A02N 3E8UL 3NVQA 5KYXA 1SDDB 2P5EB 1I3GL 2ICES 3GLZA 2E4TA 3CPUA 4KK8D 1J87A 4WV1C 2IAMC 1NIAA 3VSUA 3TTYA 1H15A 3BAEL 4KI5D 3RKPA 1E67A 5ELIA 1A3RL 3HC0A 2P3YA 4PGBA 4KAQH 2IPUK 5DC4B 3G5XB 4NZTH 4HS6A 4WI7A 5IQ9A 4ZFFA 4QRQA 2Z7YA 2IH3A 2ZCLL 3GMRB 4ECNA 4F2FA 1DQVA 3N43F 1KB5A 4OV5A 2ROYA 3HNVL 4JHWH 3ZGIA 3UTSA 3ZRFC 4TNGA 2V2WA 1SOXA 1NFDA 4PRHB 5EZLA 1IRAY 3DK0A 1I8KA 4WENB 2C7UA 1U42A 4JQXA 5A6IA 5JLZB 2F54A 3VXMD 1CGVA 4K2UH 3S5LB 2XV3A 4UBDC 5CZXD 1HS6A 3V8OA 3WFDH 1I3VA 4GXVH 4L4TD 1F90H 1RXLA 1N6UA 1W72B 2PYFA 1EBPA 5AW0B 4TLKA 4ZUVB 5IUCA 2BNRD 4JG9A 5KBLA 5GRXG 3KPSB 1RZKL 3REWB 1KCRH 2HJLA 1N6QH 4PJ5D 1Z6JT 2IADA 1P7KA 5MENA 1IQWH 3AWEA 4E9YA 5IMLA 1PNDA 2NY5L 4MLIA 4M29A 1RLWA 4HJ0C 4LOUD 4PCKA 5J4MA 2ICEB 5EOTB 3DGDA 1JNHB 2P44B 5D71H 12E8H 5T3XE 2W95A 4NQTA 1NJ9A 1DJYA 1PZ3A 3MJGX 4IRSC 5JHMA 4AC4A 2UWEF 1TYRA 2JJTA 3HZKB 1IFRA 3HR5A 3LEVH 4JO5A 1P84K 4LAQH 4WTXA 4ZTPL 4POZD 5C0RL 3L9RA 1BQKA 1IC7L 4RVBA 4EDWL 1CICD 3INOA 2LVEA 3B8YA 1NDGB 3GKZA 4PJFF 5EDXA 4EDXA 4Q9CA 3D85B 4JRWA 5C0AB 5I1JH 3WOVA 4QO1A 4GQ9H 4FOMA 2EKSB 1OSZA 1MQ8A 2L4OA 3U6XS 4DP2X 4EUPA 1DJSA 2YMXH 1TENA 4EI6B 3BP4B 1LK3L 1WFNA 2AV7A 3D34A 3F12B 2OK0L 4ZFQA 5CJXC 1JZIA 5F44A 1I8UA 4WV1A 2GITB 1QSEA 4WEEA 5JW4Q 5LKNA 3N1FC 2HFFA 5FR3A 1KTBA 4U31A 3GEFA 1LNUA 5E03A 1YEEH 2V6HA 2VXUH 4U3SB 4ZAKC 5BPPA 1IC0A 4Y5XA 4NSKB 1QFUH 4E41A 3MO1B 1I3RA 2ERJC 4P2QE 5F8RC 1U8PA 1W9XA 2ZCHL 4KFZC 4KITB 4N0CD 1JD7A 5IW6B 5EZPA 2BP5M 1MCWM 2NY6D 1KB9K 4MX7B 3LN9A 4KI5E 5AKTA 2ZOWA 3I84A 3NJLA 5CCJA 2CIIB 5I1CH 5D2LB 3JZ7A 4OFYD 1FZKB 1SXBA 4ODXB 2BWDA 1JAEA 4F8LA 1T7XA 4PJAA 5DRWA 1X5YA 4OIIL 1F6LL 4PV8B 4UQDA 4HZ1A 5GGRY 2YK1L 3ET9F 4Y5YC 3T4YB 2F1EA 4GBXA 4FXKB 4APXA 3OQ3B 2XQYA 4JPIB 1A7NL 4NN7C 4PW9A 5D7LA 2ZXBA 5BOZG 2YAPA 4YXKL 1OCRB 1VPOH 3FH7A 3AACA 3SDDC 4A7UA 1KJVA 1D5XA 1I9JL 5DD0H 5G55A 1KELL 2FHBA 3RTQA 3N1GC 4JVWA 1EAPB 2BZDA 4OUUA 4AQEB 5HTSA 2Y24A 2UVFA 1E3XA 2A6DB 4HS8H 4RNRA 5ETUB 3UC2A 3D4ZA 1MI5E 5KTEL 4KKCC 1HWWA 5D1ZC 5TF1L 3E6FA 5IW6A 3I3BA 4FTVA 3V4PH 3AQZA 2AJZA 5CMAB 3SGKA 3SKJH 4BK5C 1TVDA 1MY7A 1T66C 4CNIB 2O5YH 3IKCA 4ODWB 4X4YA 5JXAH 1UH3A 3B7TA 4DP8X 1HDMB 5BNXD 4P4KA 3ENEA 1OTUD 1H3XA 2YD1A 4JFXB 3GMQA 5ITBL 1BOYA 4KJWC 1G6VK 4XP4H 1N3NA 2J44A 4M1DH 4E9TA 2R4RH 3UYPA 5D6CB 4RMUA 4BA0A 4WHDA 1ODUA 1M53A 4Y4FB 5ACMA 3P4MB 3K2MC 1JYNA 2D3NA 5IB4A 1AVAA 1I85C 1U8QA 4IU2A 1OO2A 4UOW1 3P4LA 3THMH 5KYUA 2GG1A 5DLMH 3KR3H 3ZE2F 3K4AA 5LB1A 4FFWD 4XWOC 3L1EA 1O6SA 3NIFB 4P2QA 4W4OC 5FYJD 5CN1A 4QMEA 3EDJA 3RDTD 3GBNL 1QEXA 3VWJB 4ZD3H 3O0RL 2R4SH 3VFTB 5H4YA 4P2RB 25C8H 5L4JA 1FZOA 2BDNL 5FO2A 1CFVH 4Z7WF 5CJBA 1A3ZA 4OTXH 4XX1G 2WUBL 1GZQB 5KEZA 4WI0B 4X4ZA 1AGDA 3NCYP 4MLSA 4FZ8L 1EFQA 1L0PA 1IILE 3MBEA 3S4SG 4QHMB 1IIIA 3L1GA 4FHKA 4K3HA 4OM1L 5DD1L 4EBQH 5AVQB 1P4LB 1AS6A 1AAJA 3RIFF 1JNNL 1QKZH 1IBBA 1E8WA 1KUMA 3B2XA 3H7LA 4HKJA 1S9XA 4S10A 3S97C 3TVMA 2YLHA 3UTSD 3ZDYB 4Z7OB 3P9WB 3PAZA 5DA0B 4OBRA 3O6FC 1DQJB 2X12A 4A63A 5CEXB 1N0XL 3UTPE 1UD6A 1YSOA 3PWJB 4FYQA 4AEHH 3IFOA 3CSBA 4W9GC 3WN6A 2WYZA 1JZ3A 3QUZD 5D1XB 1NEZG 3OKYA 1FL5A 4J4PC 3L4YA 4NO0D 3KCPB 2Z91B 4DUVA 1SXAA 3OKKB 1DJGA 4M1GH 3GK8L 3FN0H 2A6KA 5K9OB 3MRLB 4QCIB 4YK4B 4YHNB 2Z8VC 2AV1B 2PWEA 3BWUC 3NJMA 4J3VA 1LDPL 4UNVA 3B3IA 1J8KA 1FLRH 3ARDC 2DLEA 2CMRH 2YD3A 3SBRA 1A2YB 3MQIA 5LAXB 4KKCD 1SJHA 3O8XD 3FCSB 1NOAA 1ZT7A 3VFGL 1MFAL 4EQ2A 3FUKA 2V33A 3RNQA 5H94A 4XNYH 2Z7ZA 3D06A 5HI5D 1AJ7L 4NYLA 4HIEA 3RWIA 3C8KA 3W9EB 4UOW0 1FNSL 3KG5A 5AVSB 1IL1B 1TZIB 2IXQB 2IH1A 2ITDA 2G2NA 2VDOH 1S8DA 1YAIA 3ABKB 4J27A 3QORC 4XBEH 2WTRB 3QXWA 3GBML 1X7QA 4Y4HA 5KVFL 2DJUA 4U1MA 1QSFB 1NDMA 2WQWA 2NY0C 2VGLM 2LOEA 4ALAL 1FIGL 4GRLB 3WTYA 1MFEL 2NYZA 3ECBB 2CG9X 3DO3A 12E8L 3VMPA 2DMCA 2WB1A 3NSYA 4L8BA 3QNYB 3IPBA 3KYNB 1KN4H 1SFHA 5FOJA 4IU3A 4MXWH 1S5HB 5CJOL 2WD0A 2CQVA 3WNLA 5JHDA 5JTWA 2OTUA 3Q1EA 2PR4H 3LZLA 5GS1B 5I6OA 3NACH 3L5XL 2AXWA 4LMQE 3SYPA 1AZCA 1NGZB 4M8QB 4TUJB 3LN5B 3VM7A 2Y4SA 1N7MH 1TTFA 1H6UA 1QHPA 4ZS7L 5CD5D 3NMEA 4Y5VB 5DMJB 3GD1C 3UC0L 4XCEA 1GZHC 3QP3A 4X0NA 1TQBB 2XN9D 3MFGB 1IEAB 4F2MA 1JCKA 2GT9A 5TFSH 1LXMA 5ITBH 1OZTG 4D9QE 4CUCA 4YE4H 1QBLL 3UADA 3D2UB 4M6NH 2Y3AA 2F8VA 2EICA 4JCLA 2VMJA 3KYOA 3QJRB 4W6YB 5A2BA 2HT3D 3FYIB 2OFQA 4ZW5A 2R8SH 3DHMA 4LP8A 4JJOA 4FQXC 1F2XK 1UXSA 1AG6A 2CXGA 3AUWB 4NC0B 3TXAA 5KYNA 1MCRA 5DLML 2XPZA 3V5DA 2FEJA 1ZHKA 2AGJL 3APDA 4QI3A 5FKAA 3ARBC 4R7NA 2H3XC 2R1YA 5TGBA 3WTVA 4JO3H 4YQXL 2H9GB 2WCPA 5GISL 2WAQA 1CZ8H 3D18A 4LPUA 3AG4B 2ZNWA 3RUGE 4KFMA 3CLWA 4ZT1A 1BYOA 3WDHA 2O6EA 4AGMA 1PJWA 1FNEB 4P2OC 5IJVB 1TJGL 1NL0H 1OK8A 3GFUA 4X7TB 5C07A 2EDNA 5C92A 2NCMA 3GMNA 3PCYA 3FQ4A 3F84A 5I5RA 3NSJA 1RK7A 4IEFB 4C56E 1INEH 2WVVB 3IXAB 4FLRA 3RA7L 3BX7C 2ISDA 5LCVH 3CDFA 1A64A 3SE4A 4DGIH 1FNHA 3CZUB 4QY8A 3ZZ1A 2Q2LA 5AVXB 4KMTL 1AMXA 3H6JA 5E7FA 1F3DH 3HUJF 5DHEA 4ODTH 3LV3A 1FYTA 2VLRB 2VR8A 4PJCB 5I74C 5CD3A 2ADGB 3K8MA 3BHBA 5CFHA 4OF3A 1PZSA 1XDTT 2EIZA 1U8CB 2KLTA 3FKUS 3GSOB 4K5PA 3IJEB 3V6FB 3WS3A 3MRMB 3OX8B 4JKMA 4OGYH 5IROC 1SVCP 3C5JA 1H8NA 1KXHA 1N19A 2Q6WB 1YN6B 2AQ3A 3VWKB 4EZJA 3CXFA 3B2VL 4C59B 1B3JA 3GO1L 3NCBB 3TWYA 2F74B 2R0WH 2CO3A 1X7QB 3D85D 2R69A 5C0AD 3NG5A 3HG1E 1E30A 4UQIM 4X2UA 3H8NA 1CICB 2HVJA 3BUDA 5I1CL 4MZIA 3CXHK 4XVTH 5CZVL 4OZHA 2P5EE 2W9EH 3P73A 3VRLF 2FL5A 4FQLH 1BJ8A 3WO3B 2CO4A 3VA6A 1PZ5A 1D7FA 3RNQB 3IJHB 2FRGP 1RV6X 5F9AC 3VFGH 3C12A 4ZUUB 2YHGA 1IBYA 3WLBA 3ZMRA 2WUCH 4YSAA 1UENA 2Z93A 5IUSA 1DQQB 1AO7D 4G8FA 1RHFA 3ROOB 2VLKE 2DQTL 4XOAA 2HJFB 3G7TA 2DM2A 1U6AH 3F7YA 3I6KB 4R3SA 5DRZA 4PJ5B 1E9OA 1XF3A 4U1KA 1ZV9A 3OLEA 1VEOA 3R06A 4MGXA 3QI9B 4QGYA 3VXRB 5DDHB 1ONQB 3U30B 1RLBA 4AIZB 1ZHLB 1VCAA 1G1YA 1FFTB 2VJ0A 3B4NA 4MJIE 4OI7A 3HHSA 2BIOA 4TLSA 2ARWA 3LSOB 2OMZA 2P5WE 1T0OA 4U0RB 3VNZA 3TBWA 1BGXL 2I60H 1ETA1 4AX3A 1N6VA 1KC5L 4Q9RH 4R96B 1JK8A 2HTLC 4I3GA 2NX5A 3QEHA 5FM4A 4IMKC 2QSCH 2XETA 3IDMA 1AACA 3BZDA 4Y1AA 3O8XA 1T04B 4B9CA 4OT1L 3OGCB 2X4TB 1NUNB 2AQTA 4G1MA 5K33A 2WLIA 4N0RA 5B7FA 3Q43A 4Z78B 1CI3M 5IB3A 4PJBF 3ARGB 5T5FA 1G7MA 5I8EA 3SKOB 2FLMA 5BW7C 1CLOL 4GRLC 5ENWB 1NCUA 2VQUA 1FFNA 1L9MA 1FG9C 4G9FA 2K3HA 4YDJA 5EPMB 3RPKA 3EBHA 5I8CA 2MCAA 4JPVL 4Y4HD 2L7JA 3FTVA 1TJXA 1BIIB 3O3EB 1KGWA 5DF0A 1GGUA 1T0PB 5F3BB 2X4NB 3SPJA 3B2VH 4AYMC 3N6YA 4M5ZL 1H6FA 4MAUL 2D3VA 1J5DA 4U1SB 1TTBA 3SDXF 3TO2B 5JHDD 2OXGA 3UCRA 3W5NA 3EG9A 1V7NH 2E27L 3L4ZA 1IBFA 4HUWA 5IT2L 1IBGL 3SB3A 2XN0A 3F00A 3EJQA 2OYPA 4N0CC 3WUWA 1MW0A 3N44B 3O4LB 4XCFH 4WKXA 1B9KA 1Q1JH 3F04A 4KUCD 4YUEH 4HU8A 1V3KA 5J0BA 4RRPG 3DHPA 1L0YA 2XN9A 2JJUA 4NQDB 3A4FA 4QTHB 4ZXBA 4QYOA 4BK5A 3H2PA 1JYXA 1KCKA 3DK2A 1IT9L 1B3IA 2QQQA 2V9TA 4HUKB 2JCCF 3R4DA 3T6ZA 1G0XA 4RGOH 2OPCA 3MRCA 4DGIL 2RHEA 5EU4A 4JFDE 5HHQA 4BSWA 1EAJA 1RVFH 3C6LB 1JPST 1X7TA 2VERN 2ZUVA 3O6FB 5L2KE 4YDMA 3FU5A 1KDJA 5IR1B 5CCHE 1S7SA 1OK0A 4N4YB 1KPVB 1SF5A 1VKXB 2PCPB 4QGTA 1WAAA 3C6SA 1U8CA 3ARED 3W56A 4CVZB 5AUMB 5CBAB 5I16A 1J1XL 3ALWA 1HL4A 2G9HA 2W9LA 1YNTB 4JANB 3OXRA 5DSCB 1F2QA 2ZYIA 3HB3B 4FHBD 4XXDA 4HXAH 4ELMB 2YD0A 4XODA 4JCWA 3FB6A 5T8IA 4XNQB 1MFBH 2R83A 3IRPX 3TGXA 2QSCL 3H0TB 1RHHB 3QUXB 5DGQA 4JKLA 1HESA 2VISB 4W9ZA 2LR4A 3N0PB 4L2YA 5IEHB 4GXFA 1JWMB 1CU4H 4PJAB 4QRSB 4KJPC 5DRWB 2B5IB 2J1KA 3PABB 4TTDC 3VFSB 2VITB 2E74C 3N0AA 3VWKC 2MPAL 4FQQA 4GG6A 1T20B 3TF4A 1IKFL 3FRUB 3TYGL 1HH9A 3ZL4H 1JK9B 2K6WA 2NW3B 4P99A 4HKXB 5CEZE 5GISH 2HFGL 3NCMA 4ANWA 1XTMA 3O6MH 2UXVA 1F58L 2VXQH 3MGAA 4WI6A 3FU6A 3O45A 4P23B 3DX8B 3DX0A 4Z7WA 5KG9B 4OKDA 3D50A 3MLYL 3LMJH 1INQA 3UTTD 2PETA 1H0DB 3VXUE 5IK3B 5LNGA 3S6CA 3TCXA 1NGYA 4M7ZC 2NYYC 5TDNA 3TO4A 3RWDA 3ZMEA 1C8PA 3IMRA 7FABH 4AEEA 5FECB 3EYOB 5CILH 2F15A 1AHKA 1C7TA 2QKIB 3ELAT 3QH3B 2FWUA 2VSCA 3P40A 3SGEH 4WY7L 1D5BB 2IFFL 3UC0H 3OB0H 3WL9A 4LSRL 4BELD 2YKKA 2XV0A 1ET5A 1ZV5A 4YBQC 3RHWF 4NPYA 5DD3L 1XF2A 2HUEA 3UGXA 1WZMA 3VFRB 1S9WA 3HS0C 5IVZB 3OGOE 1QP1A 1TEFA 4FFYH 4XWGL 3MAWA 3D8MA 4N8CL 2AEOA 5MI0B 4PJFB 4P59H 2MPVA 2D7TL 1QLRB 1XB6A 1Z2KA 4Y9CA 2ZX9A 3MRHB 4FFTA 3VD1A 1QR1A 4KHXH 4LASH 3DC0A 1C5CH 2DQDH 1MIML 1GC1H 3DVIA 4MKTA 5GS2H 3FFCB 1UWXK 1E5BA 5B38B 2B0SH 4O58H 1LM8V 2A2QT 1JI2A 4OZGA 1ZANL 3K5RA 3LXAA 2LU7A 4X50A 3MHZA 4M6ML 3KYMA 4DN3H 3KJ6L 2HPOA 3LRMA 4M1GL 3LH2H 5AVRB 2E7DA 3QHFL 2CAKA 4G6AD 5F9OL 4W4NA 1DZ0A 1J8HD 2QVMA 4M48H 4JQIA 2C7FA 3QJFA 3SQBB 3WFCL 2WP3O 4JZOB 1OPGH 3CZFB 3QORB 3ZE1F 1IEAA 4NQDD 4HIXL 5D7HA 4F2MB 3I85A 5ISZB 3CHSA 3P0YL 3QFDA 4MNHB 4XNDA 1T7WA 2K3TA 1P84J 4BFRA 5IV2B 1FPTH 1JGVH 3II2A 1D7DA 3JYBA 4RMRA 2GCYB 2Z34A 1QNIA 4TUJA 5EO9A 3V6ZA 3W11D 3W2DL 1EHLH 1E6OH 1VEPA 5EEWA 2A74B 3ORJA 4JZJA 1DUYB 2PWDA 2B4CC 4U6VH 3S36L 1KIQB 1CS6A 1MEXH 5E99L 1XGYH 1HC1A 4UDUA 3EGDA 4F7PA 1UWGH 3KCPA 3NN8A 4K0OA 4O2EB 1TCMA 2M1KA 4IIQA 3K46A 5C0DB 3D69A 4U33A 3LN4B 3Q7JA 1UOKA 4Y4HB 5TE6L 3GO1H 3NEXA 4I8DA 1R3HA 4Q56A 3T3PB 5G5DB 1B2WH 2X0UA 3FQXB 4NWUH 1AOZA 5IBUG 2BVPA 3QUZA 1JNLH 2D3JA 4LIQH 4E9XA 3RWGB 2NQCA 5I17A 1WWAX 1A4JB 5HI5C 5JPMB 3VXSB 2R39A 5H94B 1IKNC 5DMGC 3C5ZC 4JO4H 4ADJA 1KFAL 1X5IA 2OMUA 1KIUB 1GH7A 3IN0A 1RULL 4KMLB 5BUPA 1UOVA 1R46A 4LSUL 3QR0A 1JF5A 3MRGA 4QHUA 4WWKB 4P2RA 3QYNA 3QIUD 3N91A 3VFTA 4NQEB 4WUKL 5D1QC 4O2CA 2WJ7A 2JXMA 1GVIA 2WO3B 2E6QA 1KWKA 1WITA 3C87A 1RZFL 1Z9MA 3F2LA 4TKWA 4L5FH 4RAUB 1YCSA 2DQCL 3GI9H 4OLVL 3P9MA 1XGUA 5C0BB 4EIGB 1MFEH 4GKLA 1UZ8B 3CX5J 4LESA 1ZTXL 5I15H 1JPEA 3ATAA 4PY8I 3RL2A 3D39A 5D6DA 3LY6A 3CNKA 3PHQB 4FJ6A 2JI1A 2MRYA 4KROD 1ID2A 2J72A 4XNYL 2MCG1 1OV8A 1P2CA 4XNUL 1AO7B 1B0WA 4YHKL 2ZWNA 3KLDA 2B15A 2VL5A 2UXTA 2J6EA 1BVKA 2ZXGA 1U3HA 5E2UL 1GY1A 1FLTX 4WUUD 5D4QA 4QHKI 5E56A 5F72S 2OJZH 3BC9A 3SE3A 3WN5C 2VT0A 5AW9B 3BAKA 5K59F 4EXKA 2QHRL 4XTRC 4X99B 1UTDA 5I1DA 2QQKL 1KTLA 4I7ZC 3ARSA 1WO2A 3SDXA 1OW0A 2WXNA 1G7HB 2AK4D 2VDKL 3GS7A 5C07E 2P5WB 5GRYA 1HH9B 2ROXA 3DA0A 1EMTL 3E1F1 1EK3A 3QZWA 4PG9B 1AE6L 1R34A 3RY5A 5I6KA 4N2BA 4TNVF 5D7SL 5F7KC 1AQMA 3VWKD 4OGAC 3L3OC 4HPOL 4XWGH 4Z3HA 1DO5A 4AYDC 1ND0A 4KNTA 4Y16C 4L9LA 4G8GB 4N2AA 3ZUCA 4BKLA 1I9RL 5L7XL 4KRPB 3HNSH 1QX1A 5C71A 1E9PB 2BY1A 1ECYA 1DHKA 2YD5A 4IU2B 5HD8C 2DQDL 4FHJA 4UQEA 2WYTA 1Z3RA 2ZAGA 3C9NB 4B9YA 4KVNL 5EG6C 3UYPB 5DVMA 3T4YA 3U9PL 4LLMA 3JQOB 1UT1A 2DL2A 3HAEG 1U8MA 4A37A 4EMZA 5C0JA 1M57B 1NC2B 4Z0XB 4D0DA 2X4SA 1NAMH 5F9OH 2PCPA 4GINA 4HSAC 3QUHA 4Y88A 4ZUWB 2W0FA 3T08A 1YEGL 3CDCA 4KX7A 4N24A 1SLXA 4EKXA 4JFFD 2IPKB 1HHIA 4HXBL 4FZ8H 4PJHF 5D7LE 4L8DB 5DO2D 1K4CB 2WNKA 4MSWA 4RGOL 4WEBH 5B3SB 3RI5K 1ZDQA 1QA9B 4PW4A 1CDJA 3RGHA 5INCB 2VYRE 2GTZA 4H0HB 3MRRB 1PKOA 4B5EA 3OAUH 2YEVB 4OM0H 4JGJA 4M4PA 2RBLA 3BAXA 1G7LB 2CBTA 3OLIA 1M7UA 4NNPH 3I75B 1DEEB 2R0KL 4NGHL 1U3JA 5A1AA 4N8CH 2HRPL 3OKLA 3MJ7B 4MASA 3MXVL 5L8KB 1MPAH 4KQ4L 4FA7B 1OSZB 3CAFA 1IARB 3MX0A 4QDGA 3L9BA 5E0FA 1D2PA 3US9A 3K6SB 1CGUA 3ECWA 1ASPA 3D2TA 1U8LA 2IVFC 5FHBL 5D9SA 3U82B 4TQEH 1A3RH 4HIQA 1E4XL 2BSRB 3CSPA 5EWIH 1CQKA 4M5SA 4PS4H 2EC9U 3WUZA 1J0IA 4U1NB 5JNYA 5L2KA 4CN6A 4G3YL 3GRWL 1JMZA 4JY6A 2VABB 1PSKL 1SJMA 3DXAD 5F7DA 3VG9C 3BH9B 5TD4A 1EZSA 4L5FE 3SDXB 3P30L 5J7CC 5CGYC 5IQNA 1JI1A 1BOGA 1Z9OA 2FNBA 4ES8A 4HLEA 2QQLL 4FYSA 3QO0B 3D30A 3QQ9D 2BK8A 3I9GH 1JN6B 2OI9B 5I19H 2EYTB 4HF5L 4PRBB 4DN4L 5CEYA 2D9CA 4CDGC 4MVBC 5C0CA 3HAEH 3MOAH 3IDYC 2CGYA 3NZSA 1A7PH 3DIDA 3TYFB 1DE4A 4GRMA 1KPUB 1J7VR 1DYZA 3CN3A 4N0UB 2XQYK 4OGZA 4PTUB 1AR1D 4TRPH 4XC3L 5J56B 4KH9A 4XN2A 1S7TB 2VDQH 3HE7A 4N3UA 5GZNC 1KT2B 3VH8A 4NRXA 3H55A 3KDPB 3UYOD 3DV6B 1DQKA 1KN4L 3CFEA 2DD8H 5F1IA 1IM3A 5L4MA 4KTDL 5EUOB 4Q4EA 5E6IA 3AW5A 3RWCA 1ET8A 1DFBL 1H8LA 4X7EC 4Z7NF 2PLTA 4G8IA 3M46A 2MCPH 3SCMC 3BYTA 4OIIH 1LQBC 4IRJB 5E4EB 1SYSA 4RETB 2W07B 3AS0A 4JFVA 2XDHA 1Z3GH 3HEIB 4YIQB 4DW2H 4OSUL 4KK6C 5TQ2L 1IGML 3T3PF 4H88L 2WQUA 4X6DF 4KY1H 3ETSA 4EJ1C 1EZUA 3ZZSA 4GP8B 4DHLA 2YN5A 3G6JA 3BN9D 1PZ5B 5JPMA 3GSNB 3L17A 3VYPA 3QDGA 3ZKND 4N8PA 3T5WA 3WNJA 5C7ZA 3P73B 1RD6A 4NO0B 5EU5A 1Z5LA 3WFHA 2VXSL 1G87A 4J12A 3QUZB 2GK2A 3EO1A 4V2CB 5D1XD 3ML8A 4ZSOB 3TBYB 3U46A 1I4FB 4EUPG 1IGFL 4JKPL 4HCRL 4MA8H 4R4FL 4UQAA 2NW2A 5FAAA 3SDAA 3BAIA 2QADB 1JRHH 2D8KA 3IETA 3PV6B 1F0LA 5T1KA 3U0WL 4ADIA 1FO0L 1HEJC 4BYHA 1N4XL 4WGVB 5AVZB 5GRVK 1F11B 2VKWA 4S0TD 1ZOXA 1ZEAH 5FS5A 1Q1PA 3TV3H 2XN9E 2RIKA 4Y2OA 3HS9A 5A16B 1U3HD 1B4TA 3NIGB 1YPZA 2LTQB 4ENEC 3ARXA 4NM4H 3G6AA 4L0ZA 5I1LB 4IGBB 2LABA 3VGEA 3HC0B 1JZGA 4IBLT 5A40E 1FVDB 3HCVB 4PRID 3F64A 3LEXA 2EE2A 2WTOA 3EBGA 5F3HA 1A6ZA 1AKJD 3HRPA 3R18A 3TA3D 43C9A 2CBPA 3I6LE 3PQYE 3QR2A 1D9KD 3BKMH 1QSED 1UCTA 2P49B 4P9HL 3CZKA 3IE9A 4V1DE 3RB7A 4Y16A 4HKBB 4ZOCA 1S7XA 3O6ML 3IJ9A 4MJ2A 4NQXB 2AZUA 5GGTA 3EGSB 3FO2B 5DHYA 2LU5A 4XCCL 4FFZH 3FNKA 2BNQA 4XPGH 2EXTA 2KT6A 1BDYA 3PUUA 3FB5B 4OKVA 1KGCE 4X0KB 1CLCA 2VRQA 1FFPA 4NQSA 3T8VA 3G08B 1IMHC 3G5ZA 2HB0A 4OLEA 3WNPA 4JY4B 3HUJB 3Q8BA 3KLAA 5K59E 3I2CH 4HBCH 1J0ZA 3R7RA 1UWEL 2COQA 4H8PA 3HPLA 2RCSL 1GOHA 2ADFL 3DX6A 3ISRA 1Y6NR 3BH8B 4ELKB 1RCYA 4KHTH 5LBVA 3B43A 5FHBH 2NUTB 4GAFB 2ODHA 1IU1A 3LOWA 2R2EA 4FXKC 5KN5A 1JGEB 1QRNB 4XN4A 2XBZA 2GJJA 4LVHC 3GF8A 3TZVB 1YRKA 1JZEA 4QTFA 3UTQB 4GO9A 4N6RB 1VACB 4PWKA 1E9QB 4EIZC 4N26A 4KBPA 3KPOB 2J55A 4X0KA 3GRBA 3H4FA 1TKWB 1XF2B 1CVSC 4RMWA 3EDFA 3UTPD 1CFTB 4LLUA 4GG8A 2DQTH 3T8XA 4Q9BA 3RKDD 5CBEA 4JRXA 1JFHA 1ROCA 4DOHE 3LXUX 3RTQC 5H35A 4TSBH 3LN5A 4OFKA 1V5JA 3WLWC 4YHMH 3X14B 1JMXA 4IBSA 1FVEA 3KGSA 1UXMA 4LRIA 1I85A 1NM9A 3X17A 3UBXA 4F92B 1P7BA 2H1PH 2QKIC 1UOLA 1G9EA 4XXCC 4NIKB 2R4RL 3WG7B 2R2EB 4XCNA 5KN5B 7CGTA 3KYNA 5FUCE 1ITCA 3VVVA 4U1IA 5JHLH 5HYIA 3TO4D 2YQ2A 2Z7UA 2VXVL 1ZA6A 4JHVA 4PJIF 4KROB 4OM0L 2EDWA 4FXGA 4NERA 3EJZC 5JYMA 1NBVH 4YZFF 2JQAA 3S3BB 2NW2B 1J0JA 3DUUB 3GNMH 2WTRA 4DCQB 3H9SE 5FLUA 3FBKA 5DZ9A 1IBGH 2E7CA 3U4BL 3F7QA 4LL1A 1KJMA 3U1SH 4TOYL 4WZ9A 2N4IA 5FYKE 5I28A 1I1CA 3MLWL 4LCCC 2IBZX 4X7SL 3PWPA 5DHYB 5D7EA 5I6NA 2VR3A 1QEWB 4S0HA 5E99H 4NQED 1KZQA 5I6PA 2VN4A 1DR9A 4UM9D 3LKOA 1T1YA 2AJYL 3IXTB 2BVQB 4MQTB 4YK4C 3ZIMA 4PJXA 4F5CE 5IM7A 4KXAA 3G5WA 2LT9A 4U0RC 3S3DB 5J1SC 4E5XA 1FA4A 1ETJA 3VE0A 5F3HB 4B9KC 2ZG3A 4DN4H 1OGTA 1PSKH 2DLIA 2LFGA 4P2OB 1FVDA 2ZUSA 1N10A 4X6CF 2QFRA 5GGRA 5I16B 1B4LA 1UD2A 4LHUB 4UZSA 2IOOA 1HQ4B 4TPRH 3KPPA 4Y5YA 3HC4L 4Z7UA 5IMMA 3UTZB 2WLMA 4FNPA 2E59A 2X70B 4CVXB 5IB5A 3PJSA 4MXWL 4X4XA 4M48L 3PP4L 3B34A 3GBEA 3C5XA 3FQUA 3O2DA 4YE4L 2O93L 4YGVA 3BZ5A 3QUYA 3P4NA 3FU3A 4IBVA 3STLB 3MVSA 2ZD0A 3B5GA 1V3LA 4IJ3C 4ZOBA 3VFMA 1IAII 2B0SL 4FFVC 4NOFA 4PTUA 1WSST 3RUGA 2ZWYA 5MEPB 3GMMA 4PD4K 4LSRH 3MRFB 5C3TA 3WMPA 1ZV2A 2A1WL 2XKNB 1YEIH 3PGFL 4DGYL 2YMOA 1M6OB 1YC7A 2IBBA 5IMKB 3IJSB 3MFFA 4K7FA 4UOZA 2BNRB 2G5UA 3NCFB 4GSXA 2P8PB 3HC3L 2ITCB 1MI5A 5E7BA 2AQNA 3PL6A 4JPWL 3VD7A 3LDBB 1T4WA 5TE4L 2CRIA 1MFVA 2HG5B 3B2UD 4HS3A 5EU7C 3QORD 4PYHA 5D4IA 1NCWL 3QUKA 4U1GB 4ODBD 6PCYA 1E8XA 3DOSB 3T9WA 1NGXA 1PYWB 2XRAH 3GSNL 2D73A 3S0PA 3S5LG 3E8VA 3U7AA 4XMPL 1NINA 3GUTA 3RQ3A 1U58B 4TVPE 4BCYA 4L4TE 3IDYB 3TO4C 3HRZC 1TFPA 1BQ5A 2YAEA 1JPTH 3BP6B 4ZOEA 2W9EL 3PQYD 5L6YL 1O6TA 2QL1A 1KPUA 1A7QH 4R0LB 3TBTA 1NKOA 2VB5A 4ZFGL 4F9LC 1ORSA 1BW8A 3L1OL 3PXHA 3QQNA 4HV8B 4EZKA 3O81A 1OAQL 3HIZA 3P4NB 4TLUA 2PP9A 5A2IH 2I07A 4XE0A 5AYTA 5L8LB 4BDVA 2Z0BA 4PJGA 3HS0A 4MA1B 4YFLI 3RNKA 4Y1TA 5BUGA 3QAQA 3IJ7A 1VERA 4LLDB 2EVJA 3V9EA 2ATAA 5DRXA 4Z1PA 2X70A 4H25A 5HXMA 3X12A 3RPIA 1J0HA 3PG2A 2X44D 2HPTA 4XNUH 2AJUL 3QFJA 1ZLVH 3F7LA 3E9TA 3IMBA 1BQHB 4P2YA 5AL8A 3N04A 1HHHA 5C0ND 2WXQA 3JZYA 3KM1A 2ENPA 4WF7A 4XO5A 2Z93B 2GHZA 3GGWA 2WUCL 1UURA 4P46B 1AOHA 2DYPB 2E9BA 4AQ1A 4HOMA 2XICA 1RUPL 2WLKA 4JPIA 5DA4A 4GKOA 3FCBA 1E27B 4J3OF 4U7KA 4XBGA 3BAWA 3IB4A 1N8OE 3CQPA 2X4UB 4PJIB 3UTTB 2WNGA 3MUZ1 3IYLW 4G8GA 3RUGF 1KBGL 3AU1A 5KSAC 1TQCB 2DI9A 5FLVA 3L3JB 5I15L 5ITFB 3MXWL 1MCEA 3N5AA 4KVPA 5HDBF 4P2CG 1GOGA 1GMIA 5I5IA 2V4LA 4A2EA 1MHHA 3HN5A 4DCQA 4DPCX 3CDYA 1CLYH 5I30L 2R1WB 5J3HD 3UO1H 3MRDB 1FO0A 2QR0A 5DD5H 1SLWA 2Q8AL 4QIRA 2YGPA 4AYFA 5FYKH 2R1XA 3MRQA 1UWYA 1NSNL 1KOAA 4TNEA 2XQBL 3VWKA 2BP8B 4C55A 4FQIH 1WA1X 4LSQH 1T03H 4QF1B 3CFKB 1NH6A 1WCBB 5DS2A 1A9EA 5C0EA 2VSDA 5JXEC 1MZYA 3MLXL 3LS5H 1VFBA 4BINA 5CJ8A 4PSRA 1RPQA 3VI4B 3VQLA 2JCCE 2J5WA 1ILSA 1MCLA 2X42A 1BREA 1BWWA 1Q9WA 2HTKC 3QXVA 3VCLB 4HS8L 5AW8B 3BP4A 3TNNA 3CFDA 5KYWB 1YEKL 2LTQC 4WKZB 1S7WA 4F8TA 3I9PA 1NM4A 3MGOA 5A6LA 1UB5A 5FW7A 1AZVA 3MRNB 4Q0XL 2ZSVB 3AREB 3BSGA 2Y07L 3FCTB 5T3XL 1QSFE 1HQRB 3TJEL 1XR8A 2JCCA 4LF3A 2DQJH 1URIA 5DS1A 2HH0L 3G5YA 1CTMA 1RURH 2ORBL 3BZFA 3N9GL 5LWYH 1G6RA 4J8RA 4X9IA 3X1FA 1A4KB 3GXPA 3L48A 4XZUB 5AOLA 1WAAF 3EYFB 2YUXA 5C09A 2EIBA 4APQB 5IESL 1NFIA 1FORH 3EFFB 1YJDC 4PY7A 3SPVA 3ZDZE 1UWEH 2ZUUA 1KTLB 1I1AA 1H3VA 1Q9KB 3PIQA 3QUXC 2VDKH 1B0RB 4QAMB 1RUQL 1V54B 2X6VA 5FFGA 3FT1A 2K9FB 2UX7A 3O4LD 4FNUA 3S8GB 4RMQA 4HK3J 3QZBA 4CMHB 4ZW3A 3HLAA 3HB3C 5LCVA 3GMLB 5F1NB 1MRCL 4LARL 1BBJB 2BS8A 1W8NA 3KNBB 5AAPA 5JIQA 2WBWB 1KXTA 4PJ8C 5JIHA 2FSEB 4IRJC 4N0YL 5E4EC 2EH8L 2YXFA 1F3DJ 1DUZA 1I7UB 5EEZA 4XC1H 3UJIH 5J6HB 4OKVB 2E7LA 3ARWA 4CILA 4F58H 2FH8A 1IE5A 1OB1B 1MREL 1YMMD 4GFXA 1OP9A 3OAYH 3NABL 2GT9B 3L3GB 3SGEI 2EKJA 4QRPB 3CVIL 4MQ7A 1T0MA 1WV7T 3O3UN 1V8HA 2XACC 4XMVA 3OQRA 4LLWB 2OSWA 1JPTL 1KPRA 1XEUA 4QRAA 4ONGH 2P45B 4EAEA 4K07A 5HGAB 5AW6B 4I0PB 3ZSTA 3CVCA 4O02L 2Y22A 1CXEA 4PGBB 3TEWA 4JQVA 4XN8A 5DLLA 3FFOA 3S9DB 2V9QA 1F8TL 4I5BA 2Z9TA 5EOQL 4KRNA 1HHGB 4A1RA 3IMWA 1NBYA 3NJIA 1IGFH 4MA8L 2DQIH 4BZ1H 2CCWA 2VMCA 5GS1C 1A9BB 1DVXA 4JJ5A 3SHSA 4KTGA 3OKNA 4OQ1A 1P7QA 3VQ1C 3HI5H 4F24A 2JELL 2FGWH 3F7RA 4POZC 4FNQA 2KHAA 5E0QA 4MDJA 1SXSA 2VDML 3ALXA 4CKVX 3NIFE 1IGCL 3W9DA 2Y07H 3KE0A 4IRZH 2PO6C 2XXMB 4UOQA 3HC2A 3VDAA 2WMPA 5B7EA 4OLUL 1YEFL 3GSNA 5FA4A 3VXRD 4R90L 3H7BA 3OHXB 2BNRE 3EOBA 3MRPB 1M1XB 3NK4A 2AEWA 3MNWA 2ZXEB 3RHWK 5HVHB 3CSYB 4N68A 2Q76A 3U30C 2YPVH 4B96A 3PDOA 1HFUA 2AV1A 1T80A 2CHNA 3LEYH 3QQ4A 5DD0L 5C0RH 5JW3H 4XAKE 1U33A 4XX1E 1NBZB 2C4FU 4FQIL 3U4EA 3H42H 3ZHKA 4BKTC 2W91A 3SO5A 5HP5A 5ESVA 3SE4C 3QDGD 3PGCB 2XYBA 2UZIL 1PCXA 3HC4H 1KTJA 4K7PL 3NGBB 1UJ3A 3H9SA 4EI5C 3EAKA 4AK2A 4ZFZA 1BFOB 2IBZY 4JFPB 3V4PL 3SDDB 2DLHA 2XWXA 5DJXA 5CEXA 1SMAA 4P5TB 3KWXA 1Q72L 1QTPA 1CU4L 4K94C 4GUPB 5DEGA 2ED7A 3TZVC 2D2CC 5CKAA 1ZXKA 2FLBT 4UQ2B 5FECA 4OB5L 4M8UA 4AENA 5DCCA 2EYRB 4XPFH 4K7PX 3UAFA 4UM9B 2C8NA 4IHOB 1W8EA 1A7BA 1PS3A 4NN6B 1CI5A 1NPUA 2IMNA 3FFCA 4ZS7H 1DEDA 5E1GA 3LXBA 4AITA 4HGWA 1H3PL 3HZYB 2VLRD 1Q9KA 1BZOA 2X2IA 1IGJB 3BDBA 4F27A 2AJSL 4M43H 1TR7A 4NZRH 3FQTB 3RIFK 4A2LA 3GDBA 3SDXE 2AQSA 2YUZA 2XVLA 3LKRB 3UAJD 2FO8A 4NKIL 1WAEA 1I53A 3V5HA 1NCNA 5F6IB 2CNZA 1UWGL 3UROR 1U36A 4JAMA 1JZ7A 3L3HB 1WS7A 3KS0H 5ANMB 2R29H 3KS0J 1NUFA 5DJ2B 4OGQC 1A6VL 5BMFH 1XR8B 2AVGA 5HHPA 2JLPA 5F97E 1CXFA 4GEIA 1M7IB 1PZDA 4YLCA 4UU9A 3K72A 4XNAA 2PXYB 5GSRB 4TSCL 2WO4A 4XXDB 4PV9B 5MENE 3VCLA 4X9FA 3RWDB 3WYRA 1QTYT 1DLFL 3CVIH 3DBXA 4MJ5A 3FJTA 4KROC 4OD2A 2JK5A 4O4YL 4XGZA 1C1EH 1KNOB 5DUPH 5AG8A 4AT6B 1YYCA 3CH1B 3MKGA 1QFWH 5DRNB 3O2DL 3ZX1A 4YLBA 2FYYA 4B0MM 3T0ED 4HT1L 4F58L 5ILTL 3EJCA 2Y06H 3MBEC 2XG4A 3BLBA 3Q2CA 4JUTA 4Z7VA 4OF5A 3C08L 1PG7L 4PCSA 2OYKA 4URKA 3MUGB 1T0NA 2AEIT 2EIMB 4WWPA 4XPHL 3UAEA 2ESVD 3RYMA 3V0WL 3KBHE 1NZRA 4CU6A 3IGFA 1AGBB 4JRXD 1MFCH 5C0JB 2YRZA 3FUHA 3FO1B 4KJYB 3U0TB 4MXVE 4PV9A 2KZBA 2MHAA 3ZHLA 4U6HA 3M1BB 5D7SH 1FYHB 5DD6B 3ABLB 2LFEA 5FUZH 3B9AA 3TNMB 3QPQC 1B4JH 4U1SA 1E9PA 4WFHE 4QOKE 1TEGA 3GBMH 1BWMA 1CK0L 2ZG1A 5FO9B 5KSVA 1WBZB 5LQBH 2IAND 3LNIA 4X8JA 5J6GB 1IJNA 2Y1AA 4KNUA 4BKLB 1CBVH 3QCTH 3IVKA 1DL7H 4CVZA 1WFJA 3FFDB 5IWLC 1QSFD 4XMUA 2CUAA 2DM7A 5CILL 1U93A 1UM4L 1PDKB 2FR4A 2L0DA 3ECUA 4Y4HC 1PAMA 3O6FA 4PRHE 4QLWA 1JG9A 3VACA 1C16B 1E6JL 3MRCB 1JNJA 4BDVB 1AKJB 2VUOA 2WXLA 4JN1H 3GTVA 4E9SA 1VLXA 3QUMA 4IGBD 4HV8A 4ZXBB 4QHKJ 4YL9A 3MJ8A 1U3HB 4UM9A 3OKDB 2KC0A 5HYEA 5F6HI 3ESVF 2YBGA 3GXDA 3IDMB 1PKQE 3ZO0A 5DQ9B 2AV7B 4DVBA 4BXVA 1T1WA 32C2B 1E65A 2P26A 3G3LA 3UPRB 2CM5A 3JVGA 4JQIH 5F6HJ 1RSYA 1I3GH 3CFBA 1XHHA 3ILQC 4W9JC 1UZ8A 2XWJA 1CE6A 4PJIE 1BD2A 3TBWB 3B2MA 2LW3A 1RJYA 3UTTE 5MEOB 4UT7L 3JYCA 3LNHA 4LSUH 5AOMA 4OR1A 4CSZA 5BZDB 1QBLH 4HKZA 4AEIL 3IDGA 1FV1B 3LIZL 4U1JB 1NUDA 4AZUA 1BYPA 4LAJH 4TS6A 4KVCH 3ZY7A 4QHUB 4WWKA 3ARGC 3FTSA 1UM6L 4IRSB 4LL4A 5K1VA 4TXVB 4H4NA 4G9FB 1IAKB 2V7HA 4PJ9A 4HPYH 5IMLB 1P4BL 1TZ8A 2EDHA 1UYWL 4LU5L 3LDBC 5I0ZA 1NFKA 2ZOKA 5K1JA 4AI7A 4JDEA 3QULA 3ROLB 5BZZA 4W6XB 3MRIB 1QLEL 1S9YB 2Y23A 2R9HC 3GMMB 3UJJL 4PUBL 1HL9A 2PYFB 1LD9A 3UCQA 3LKQA 3P4OA 4BGDA 3RVTC 1I1AC 1WS8A 1EBAA 5DEFA 4K3DL 4WU5A 1NWPA 5D2NE 3QJXA 1H8SA 2RR3A 4P2RD 3EDEA 4S1QL 1UFUA 4NKQB 3LZPA 1ODAA 3TA3C 4V2BA 3HE6C 3T4AB 3VWJD 4AMXA 3DX7B 1P7QB 3DJ9A 2V2WB 4GFTB 1AR1B 2RB8A 4PJFE 3QDGE 1WZAA 1V7NL 2E27H 4OFVA 1EJFA 2IH3B 1ACYH 4TLTA 3WJLA 1XWVA 1HQ4A 2EC8A 1X9UA 4Z7UB 3QXDA 4PQXA 3MJ9A 1KULA 4PP1D 1MCCA 2HRPH 3VB8A 2C4FT 3L5WB 5ICYB 3PJLA 1JHTB 3KLHD 4OAWA 2V37A 4PJHA 3GPEA 2EXYD 3BD4A 3HHMA 4GIOA 3PQYA 1LEIB 1H15B 4HEPG 1G1CA 1B0GA 1RU9H 4RGNB 4GO8A 4TV3A 3ARYA 2F7IA 3LKOB 4R97B 1D6EA 4R8WH 3REVA 3RVTD 5ISZA 1QLEB 3C60A 1I7ZB 3HG2A 4P3WA 5E5MA 1E4XH 2AZAA 3MA7A 3S35H 2KLRA 3GSVA 5FCSH 4JFEB 2QTVA 2C1PB 1RP9A 5M95B 1OAZH 3BFOA 5L2JB 4W70A 3LKSB 2ZUQC 4NJAL 1N0XH 1N26A 1C5DB 3N41B 2L7QA 3HC3H 2CK2A 4NKOB 4FG4A 5D1ZA 3DRQB 4NQDE 4PJDB 4L5FL 1YNLL 2VZOA 3HA0A 4QNPF 1ICTA 1TT6A 3RFZB 4PS4L 3QCTL 4YC2C 2A1WH 3TPUA 3QFJD 2H9GA 2NXYC 4LKXA 1SBBA 5HDBE 3THML 4L3CB 5FM5O 1ZE3H 3CFIC 3B7SA 1AP2B 3NIGF 4MRBA 3O9WA 5AL0A 5CLWA 3F05A 3IMVA 4HUXA 3DLQR 4I77H 2HKAA 3RGVB 2CKBL 1YQVH 2WJ5A 1NIFA 4X8CA 2N0MA 1WTGT 1C1EL 2K0RA 2VO8A 2WXGA 3CXDH 3Q0HA 4F7EB 1XCQA 4NO2B 1DVYA 1HIML 4PJEF 2J1YA 2E75C 5GQBA 2D9QB 3OXSA 5IHUH 3L4TA 4YEEA 4CW1B 3EHBD 5EIQA 4F7EA 4OJEH 5E9DB 1U95B 3WSQH 2CE6A 2CU9A 5F7FA 3I6SA 2IANB 4M8QA 1KENL 2VDRL 3N85L 3ASWA 4JM2B 4QHLA 3O2DH 2WKOA 3GWJA 2A77L 3EJTA 1I9RH 2PCFA 1HINL 4DZ8A 1WZLA 3E9UA 4KO9A 4M1DL 3H6AA 2NUTA 4X6DB 1KIPA 3SE6A 1ACYL 3FQNA 4DEWA 4KPHH 1NEZA 1OCWL 3JBG7 3FB8B 1N8ZB 4MJ6B 2EUXA 2WLYA 1DBJL 1R5VB 1RK1A 4PJ8D 4MMYA 4KVNH 3UBHA 1HVXA 3APCA 2BVOA 3EF4A 3EJUA 1AQ8A 4G8EB 4LCWB 2IPTH 1UKQA 2A0LD 2AJSH 5C09B 2AF2A 4MBRA 5CWSB 4XZUA 1QATA 4TRPL 3EZJB 2FWLB 1MW1A 1KYAA 1MQKL 1U8OB 4BCXA 2Q7YA 3ESPA 3G08A 1YUKB 3C75A 4IMLA 3M17A 3DNKA 3HRZB 5DMYA 1AS8A 4W68A 4S1RH 3TFKD 5EH1A 4L3EB 3DXAA 4MBOA 3EGXA 4OTXL 3QNXA 4GKZA 4MNQE 2F53B 2EDLA 2ZXWB 4Y16B 5FKPA 3QDJA 5INDA 2BZCA 2VJXA 4NWTH 1UEYA 3RVXC 5FWRA 4LNRB 1O9WA 4DVRL 5T33L 1WTLA 1OE3A 4RDBA 4MXQC 2R4SL 3LEXB 4FG0A 5D7IB 5BZWA 4ESKA 3US1A 3WY4A 5HDWA 4XP9L 2BVUA 3T0EC 5AVWB 4PG2A 1WA0X 3W5MA 43CAA 3R8QA 4P05A 3D25B 2NSMA 1XQ4A 1FNAA 1A9EB 4UNIA 4QF1A 5I30H 1A5FL 1EFXB 2WQVA 2XTJC 3P0VH 3RNKB 2QBWA 4WO4A 4JFYB 3VXMB 3T4AA 1RZGB 2VE6A 4I77L 1T7ZA 1LO2L 3BJLA 1E2VA 3F83A 3IFLL 4ATTA 1O5PA 3K6FA 4BWTA 3KGRA 4PRHD 3AT8A 2OX5B 4ZW8A 3AQYA 2FVNA 3MA9H 5F1SA 4HCIA 5SX5H 3MU3A 3HMXA 4NLAA 1JWUB 1PZBA 3BW9B 3FT2B 4NZFA 3DTXA 3WJMB 4BSJA 5ID1A 1J5IA 4HIEB 2Z65C 3KDMA 3MRIA 1EZLA 4Y89A 5CINL 3PWLB 4B41A 1G7IA 4FMFA 3L7EB 1U91A 4OD1L 4M3KB 3VXSD 3AROA 2GEQA 2Z31C 5I6XC 1LE5A 1Y6KR 5HDQH 2YUVA 3QZOA 3MV8E 4YNYA 1A7OL 1LEGA 4JHBA 1E8YA 3WIHL 2JELH 3V4LA 1TMCB 5A6MA 2A6KB 5K9OA 4QXVA 3WHE1 1FLRL 2EDKA 4W9CC 5JOEA 3IE4A 3QUKB 1BF5A 3LS5L 4X6DE 2XIDA 2QSTA 5C86A 1OT1A 3MLSH 2BS9A 2FT7A 2LVCA 3B5HA 3QUMH 4LLDA 2GSMB 3ULUC 2A9AA 2HG5A 3NJJA 2IBGA 5F3FA 2GUOA 1AJ7H 4JG5A 4M3JA 3LKNA 3RWFB 1U8QB 3DGGA 5EEYA 3WXWL 3FSVA 3CHQA 3MYZA 3UPRA 5D6CA 3LHAA 5DUBB 4LK4A 3GINA 5DFWH 3MROA 5GGTH 4WSJA 1MWAH 5DVLA 4ZQKA 2CJTA 2YKLL 4FYRA 2XTJD 3AWGA 1GS6X 4EI5D 1ZSHA 3FUFA 5ISZD 3U7WH 4FI6A 2XY1A 1OTUC 4W9IC 5JW4M 4KRMB 5F96L 4JREC 4G6FB 4MDIA 1ADQL 2JKSA 1K2DB 1E6OL 4YE0A 1GZQA 1S7QA 3BUTA 3MUY1 4GQQA 2MEJB 3ZT5A 1V7ML 4PLOB 3HHSB 1FZMB 1HOEA 1BMWA 5FHAH 5LXGH 3ZQXA 1NGXB 4M61B 4F5CA 1MJ8L 3T77B 1JZ5A 3RX5A 1DVZA 3UTZA 4OJAA 3GSRA 2PPEA 3OM3B 4M8VA 3RTQB 2CA3A 2MNWA 2DMGA 3I50L 3ESMA 4J2XA 2X09A 4ZMPA 2VMEA 1D5XB 4N0YH 4M6MH 1D6VH 1SZNA 3LZNA 1HEZA 1SPDA 1RURL 1UH4A 4S0SD 5TJWK 4FXKA 3IJHA 4J3WA 4CSSA 2YXMA 4IBYA 4JKWA 3M07A 4L4JA 5IIEB 2HN7A 4P5MA 1A8JH 4IDJL 1LO3H 2Z8SA 3T6QC 4TULH 2MCMA 3DUSB 1KN2H 3IKCB 2H2SC 4ODWA 3MUGA 5GRJL 2CPCA 1X4ZA 1RZGA 2VE6B 3K7UA 2Z3FA 4OCNC 5K9KA 4XVJH 2AEQH 4NZUL 3SODB 4EI0A 4F9PC 5FO8A 5GS2D 4H20H 1BQLL 3CMOH 1NPNA 4W9FC 1RZKH 4Y5XB 3WAJA 1N6QL 4LFHD 3KWUA 4U3SA 3KVPA 2X1OA 4M7KL 2JK5B 4FZEH 3DSNA 4OCRH 5EIIG 2X4SB 2FQFA 4X5LA 2CHDA 2NY5H 4NIYE 4ZMYA 1J48A 1ZPUA 4NN7B 3D3VB 1KTDB 4HMDA 4I88A 2D4DA 3VXNA 5IQOA 3L3OB 5FO9A 1DLFH 3LV3B 4BFGA 5J9PB 4QT5B 4B27A 3WJJA 4DO4A 1O6VA 1XX9C 1T1YB 4CC0A 2NXZC 4G72B 4YSRA 1F90L 5E2WH 4E0RA 4JHUA 2J6EH 3K74B 4AMKL 3RGVC 2JCWA 5GGSA 4Q6IA 1W6WA 3ZK0A 4OI9A 1RUKL 1N5YH 3FQWA 1A7NH 1FRGH 3D33A 3ZE0F 4LRNH 4PB9L 2IGLA 4B7LA 5J06A 3GLAA 3VXQA 3L3IB 3D12B 2YXWA 4N6RA 5C07B 3LQAC 1T3FA 4MCYB 3CPLB 2WVUA 3FOLA 3QUXD 3UEQA 2JVUA 3WFZA 5I1EL 1JNHA 3V9CA 2ZX7A 1TG8A 3GS4A 4UV4H 3VXTA 1T6WA 1QO3B 2QEJA 2HSIA 2EDRA 3SBWA 4IOSD 3OLDA 3S8FB 2EINB 1F41A 3KGUA 2YAMA 1A6AA 4HC1L 5CU9A 3WNKA 2Y2YA 5DJ8A 4YHML 1ET7A 2XNAB 2WLHA 3A21A 3IK2A 5LGJA 4XMPH 5C2UB 4JFDD 3DECA 1AZZC 3V4VH 2H41A 4P57B 4HVBA 2DQFA 5E9DA 2DWDB 2YFNA 4WK0B 1LK3H 1NTDA 2WIMA 3V4PB 1X6LA 2X1QA 3ARTA 1H3UA 3T2PA 4GG8B 5H4ZA 2Q2EB 5J89A 5AWNH 5I0XA 1MF2L 5KS9F 3Q8FA 2G60H 2DWDA 3GMRA 3CC1A 4I2XA 1E40A 4HH9B 1NCJA 3U4EB 4GRWB 2QZ5A 3A23A 4PJ7A 1QFOA 1DVQA 4PJ7E 4NZUH 4IGBA 5MERA 1Q90A 1NLDL 2EO1A 4UNUA 4FLQA 3UAAA 5SV4A 2RACA 1LGVA 1SFDA 1ZVYA 4YX2L 2OCCB 1OSPH 5HHOD 3KWTA 4YDVB 1KC5H 2FX7L 2FE0A 2B4CL 3GSXB 1GAFL 1CT8B 1XSKA 3GXTA 4MD5B 2EE6A 1YN7B 4I13B 4QOKB 1IFHL 3A67H 1OANA 3F3HA 3RWJA 1O75A 4OI8A 2VXUL 4XPHH 1TEYA 3LD8B 4PRPA 2IFFH 1SRDA 1SBSH 5EU5B 4TTGA 5IJBC 5CNHA 1TTAA 1A21A 2PW2A 1XMEB 3LNGA 5F7BA 1NWOA 1J1PH 3ARGD 3G6JB 1KIRB 4J1UB 5F7EH 1J9QA 4RMBA 4AEFA 3LXCA 4BH7A 4HKBA 1FN4A 4PBWD 5F88B 2M83A 5DUPL 4GQPH 1SJHB 5FYLD 2NZ9D 3QJTB 3NTCL 3P2BA 3FN9A 3L3OA 2XKSA 1S7VA 4M9OA 4P5SA 4RMVA 1ZJBA 4YBLC 2AVFA 4JB9H 5B1BB 1FORL 2WVSA 3GJFA 4X5QA 1I9IH 4UIKL 5I1LA 4XPAL 3VW3L 4C4BA 3ARDA 1YPZB 2YJQA 3GLEA 5ES4B 1HZLA 5GZND 2VDQL 5F96H 2ZF8A 4LLWA 3ZYIA 3EH5B 3EOTL 4YHZL 4X7DC 5EUOA 4CGTA 1QNZL 5HPOA 2WZ0A 3BP7B 5HGDB 3BQUA 4FFYA 1RPUA 3VG9B 5TDPB 3HR6A 1T89C 4AYID 1U3HC 4JVUA 2GTWB 1QSZA 4XMWA 4BHUI 5KJRL 2XC8A 2IEPA 5LN8A 3IAQA 3V0EA 1QWHA 2VLKB 5T3XD 4AYEC 3TVMC 1KGJA 2Z1KA 5TQ2H 1KJ2H 3ZQWA 4IKIA 1IB5A 2CHZA 2E4FA 3QO0A 2DKSA 3CFTA 4GP5B 4W9EC 3FK3A 1HSBA 3MV11 2EJ1A 1QR1B 3CBRA 4I9WE 1UUNA 3FMGH 2VDNH 2Y36L 1OKEA 1Z32X 2EILB 4RMTA 1RUQH 3CCHB 4IRJA 1CXKA 2GYSA 3C60D 2RQEA 4JY6B 1UOWA 3FDWA 3OD3A 1EUUA 3PHOB 5F7DB 1T6BX 4K8RD 1ZKAA 5KYYA 1UYWH 1U92A 3VXQB 2VXQA 1UGNA 4ATWA 4R4BA 4JGUA 5D72L 1RZ7H 4H40A 5IG7A 1QLFB 4NUGL 3WL9B 1SN2A 1SOSA 4ZMNA 1DVTA 3QQXA 4PHXA 3C5ZA 5A43C 3KYAA 3WE1A 1L7TH 2V3EA 1N64L 5J12B 1PAZA 1UB5B 2KBGA 3QH3A 3VH8B 3QPXL 5ESQB 3QRGH 1WEJH 3PUCA 2Y6SC 4WHCA 4J3TA 4P23C 4BQBA 5BVJA 2XIIA 3CN0A 1UXWA 1ZA3B 4ZS6D 4HF5H 5IT2H 4R2GB 1DE4B 2PTVA 1VFAA 1HCVA 4NPKA 4GAAA 3O3DA 5JOPE 4HOXA 1JP5A 3DSNB 1DN0A 1MHPH 3EKCA 3MLUH 3PNWA 4N2HA 5DU7A 3SPGA 3WHXB 4ZYKA 3SJVA 4P3DB 2X9YA 4WFED 3HVNA 1SQMA 1RZIB 4FS0A 5BXFB 2IWKA 1KG0A 3V2AR 1WIOA 5FF6B 4KDTC 4KUCF 1FFOA 1UM6H 3FT3B 2YRBA 3FT4B 3MV7B 2EDTA 4L1TA 3MRDA 4AYFB 1KYOJ 2KZWA 1IGCH 1WISA 4P9HH 3L6FA 1HXYB 1HT6A 3CVBA 4UILH 3ZGHA 3A4AA 4OUUB 2JIXB 3D51A 4K8RH 1CLYL 2VR5A 4AQEA 5JHAA 1KB3A 1CFNB 3HN8A 3ARQA 3RAJH 3V52L 1JIBA 1IAOA 2MOGA 4HFWA 5HYFA 1VADB 1Q72H 3GHBH 5CP7A 4OJCA 4ZJ9A 2CDFA 2UZYB 2EZ0C 4AQ1B 3TNMA 4MA3B 3KL0A 2ATPA 3B56A 3ECVA 3RIAK 4JFQA 2P47B 1X6NA 3OXRB 5I0VA 4LSSL 5FYJE 4CSTA 3U0WH 5E94B 2OCJA 2N56A 4Q2ZB 3Q44A 1YY9D 1P53A 5F7MC 4PG9A 1BMGA 1L9SA 2X38A 2CIIA 3QG7H 1TJHH 5FDWA 1Y7VA 4X8XA 4UZGA 4H7VA 1F13A 4J6IA 2XWCA 2IC2A 5FO8B 4PJEB 1T4KB 2VZUA 2ICWA 1S78D 4UT6L 2I24N 2QPSA 4ODVL 2ZAIA 5HYQA 4NSKA 4PWHA 2NR6D 3ES6B 2NY4D 4MS8C 1P5UC 3TZVD 3TM6A 2DWXA 2YAOA 4IIQC 1DN0B 5K93A 1QRND 4G83A 4QJ4B 1KEGH 3JV5A 4IRZL 4TVPH 5AZ2L 2XOTA 5FCUH 2G4EA 4TQ8A 4FDWA 2OMVB 2UWEB 1G7JA 3HE6D 2AC0A 3F12A 4DP1X 1NLDH 1F6AA 1BX2A 2HKHH 2WPGA 4PJAE 5ESQA 2VLLA 5HJDA 3SDYL 3KPNA 1YQVL 4RFNC 3I74A 3IGKA 4KX8A 4LGPB 3U48A 4BJLA 4K23H 4L0YA 2IOMA 4Y1AE 4MHHG 2H0PA 2NX5E 1VA9A 3OLGA 2V17H 4DP0X 4AMWA 1QR4A 3DOSA 3BDYL 1Z9SB 3HMWL 3BVDB 5IZ7A 4WWNA 3H9HA 3QDME 2P5WA 4MJJA 3CCHA 4ODTL 3G04B 4MB1A 4QXUL 3C08H 3VGBA 5C6PB 1LEGB 1IGJA 2BPBA 4FQCL 5I1DB 1WGOA 2C1OB 1RK1B 4XVUD 1MCDA 1Q8MA 1Q9OB 2PO6B 3FQYA 1BHGA 2C9UA 4ICXA 1R5IB 5E8NB 1G7MB 2Y7OA 3B9DA 4IKKA 4B9PA 1EXGA 4X6DA 3MJWA 4PRNA 1AD0A 4OIAA 3VXSA 2ENQA 1F3RB 1VEMA 2BP0A 2JKIS 2R29A 4OLYH 2QSVA 2ZX6A 4XO8A 1SEQL 2YR3A 1NKGA 3TCLA 4I3SL 3FSOA 3JT2A 4YXKH 3ZDXE 4ZAKD 3ZTJG 5BQ7B 4N86A 2A9MH 3BQUD 3CU7A 2FJSA 4MAZA 2AITA 5AW1B 1C5BH 2EADA 4MAYC 1ZVSB 1XVSA 4KQ0A 5C0BA 2XG5A 2BIMA 4GAGL 1ZT4A 3BQUB 3ZJAA 5SWZA 1CFQA 4KKAC 1L7TL 4RH4A 3R1GL 3O6LL 2DH2A 3W11C 4M93B 5IFAH 1RMFH 3QDHA 5DVOA 4UDUB 4F7PB 4WWID 4R26L 5L6YH 1G1KA 2B1AH 1NBZA 1KCLA 3FW6A 5GGTL 4AYBA 1BFTA 3KL3A 3QK0A 5JIDA 3DX4A 1CFVL 4HJGA 4LP4A 2YSTA 4Y2LA 1KXQE 1YEJH 1S7VB 2FB4H 3T3PE 1CGTA 4RX4D 3V6ZB 4Y2NA 3FU7B 4ZDHB 1Y0LB 4WW1A 3WSQL 3V79C 2A9BA 4IRJD 4G7SB 4WUUA 1F56A 4L37A 1G7IB 3POHA 4WEBL 4AK1A 5BUAA 3MRKB 4WW2B 1SLUA 5I17B 1ZAGA 4NXKA 3ZN6A 4WHTB 1TMQA 3FQXA 3U7YH 2VO5A 5B8CC 3LKSA 1ZLWH 5KTEH 4NHUA 4KRPC 4ZMLA 3C5ZD 1JHKL 4IMKA 2VMDA 4WJ5A 1TVHB 4F93B 1RK0A 2GBTA 3C8HA 3LN4A 4JFEA 4HUVA 1M3IA 1YUHB 2YAFA 3UPCA 1DANU 4BK8A 2QPFA 3L8QA 4YGAB 1XZWA 4JMNA 4PJ9C 5EN2B 5EWIL 3REVB 1MCHA 3BGFC 4P07A 1VPOL 2EE9A 4AEIH 3FB7A 2AKRA 4UQBA 2H8PB 4Z3JA 2XRAL 3GSNH 3UFIA 3VD4A 1LP9B 3T2NH 3MV9B 2JWYA 1MCIA 1U8NB 3QXTA 1I3UA 1UB6B 3MDJA 3SEPA 3FBQA 2BCKA 4HJSA 5D93B 5HVGB 4C54A 4MNGE 1XIWA 1TXKA 4MNGA 4D9LL 1WBYB 3ULVD 1AHWA 1U95A 2VZTA 4GKZB 4QXTB 5LGHH 1E50A 4Y4FC 2A73B 3DXAB 1S78C 4UZUA 4HPHA 5FCUL 2FGZA 2GW5A 1D6VL 4JFFA 1FNSH 5JXAL 5I1AB 1DVFA 1G7QA 1RUML 2DBLL 3MLVL 3MLYH 1U8OA 3E6HA 3BPNB 3KYMB 4NAJA 1KXTB 1LD9B 5KUKA 3V0GA 3DTUB 4YPGB 3GIVA 5BRZA 4R5XA 4L3CA 5FHAL 4IOIA 4F3FA 1IKFH 5SX4I 1BXVA 3J27A 2HX9A 1TLMA 4ENZA 4WWKC 2R1YB 2WOBA 1BXXA 3C60C 4HWEH 4IHBA 3PIQB 4JRYD 4QKTA 4N90D