3IRCA

Crystal structure analysis of dengue-1 envelope protein domain iii
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
104
structure length
104
Chain Sequence
GMSYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSTQDEKGATQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKGSSIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure Analysis of the Dengue-1 Envelope Protein Domain III
rcsb
source organism Dengue virus 1
molecule tags Viral protein
molecule keywords ENVELOPE PROTEIN
total genus 13
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2009-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ircA00
2R69A 1TG8A 3C5XA 4GSXA 4L5FE 4UTAA 5KVFE 3MUUA 4AL8C 5GZOA 1OK8A 3N40F 4UT6A 2JQMA 3VTTA 2HG0A 3C6EA 5JHMA 1OKEA 5GZNA 3UZVA 1RERA 1ZTXE 1PJWA 2ALAA 1OANA 3G7TA 3N41F 4FFZA 3UAJA 4GT0A 3J27A 4UTBA 5JHLA 3N43F 5LBSA 2JSFA 3P54A 1URZA 5AAWC 2H0PA 2I69A 5H37A 4FG0A 4FFYA 1Z66A 5IREA 2GG1A 5LCVA 2JV6A 5KVEE 2V33A 3N42F 5B1CA 5IZ7A 4UT9A 3N44F 5KVGE 5AAMC 4X42A 3UYPB 3J2PA 4AM0Q 4ALAC 3IRCA 4BZ1A 4BZ2A 1Z3RA 1S6NA 2R29A 3UZQB 3WE1A 5LBVA 3UZEC 4UTCA 5KVDE 1UZGA 1SVBA 2P5PA
chains in the Genus database with same CATH superfamily
4HDIB 1MI5A 1GRWA 1IGJA 3OMZA 1YECH 5DD1L 3RA7H 3P11H 3FK3A 4XPTH 1EHLH 5TDPB 1G94A 2FJGB 4G6JL 5BOZG 3K2MC 3MLSL 1GZPB 1LNUB 2KLTA 5HDBF 1JYWA 4LDCA 4L1BA 3D3VE 1F8TH 4F7KA 3BN9D 4JDVA 4LLQB 4HFUL 5FK9A 1EMTH 2XVLA 1TZHA 1KCRL 1N7MH 2HLAB 3T0AA 2NR6D 3OMAB 2J73A 4OJCA 3U83A 5I74B 1MJ7H 5IVOA 3STLA 3WNKA 2CGZA 2R0WH 3HZYA 3NPSB 1BM3H 1UGKA 5E9DD 1AD9A 1SEQL 2H3XC 4Z0XB 4TVPD 1UM4H 3L3IA 1G6RH 4PJBB 4IS6B 1AR2A 4MA8L 5HHME 1OK0A 2FEDD 5D7IB 5A7BA 1R19A 3PAZA 1PNDA 2OR9H 4GSDH 1HHHA 3ROLA 1E4XL 5J6GB 15C8H 1OARL 4WJG3 4KZEL 2RIKA 4FKHA 2WNGA 1NAKH 1NFDE 1GIGH 3HB3D 5IV2B 4NZRH 3L1OL 3GSVB 3U25A 5E8NA 4WFFD 3G5XA 4XHQA 4KKNA 4HFWA 2J2ZB 1LD9A 5KYUA 1DANT 5IT2H 2WMPB 2WCPA 3LKOB 1W8OA 3GSUA 4OV5B 3WFDH 5I2IB 3RVTC 3E2HB 3U9UB 4HOXA 4KZDH 1QI3A 3WEXB 2PCFA 3NCFB 2A38A 2IPTL 4LCIH 1ILUA 4P4RA 5IJVA 5I0WA 2YD9A 3FT4A 3IN0A 4E5XB 3UC0H 1MW2A 3P4OA 3MREA 3QAZC 4UIKL 2DDQH 2YAHA 5T1LD 1VJSA 2AVGA 3NIFE 3DX3A 3FU8A 3LDBC 2BHFA 4O4YL 3SE4A 3C2SA 3F58H 4OIFA 1RIVH 2XWBB 1XH2A 3I6SA 4WJ5B 3RTQD 2OX5A 1E6JL 2PTTB 1NMBH 2QZQA 1HZHL 3HBPA 1DQLL 2G2RA 3HPJB 3QE5A 4M93B 1LO4L 2EIZB 3QFJE 3V4VA 1TZGH 4JFZL 3U7WH 1K5NB 3KEHA 1Q9WA 1CGSL 4C83A 5IIEB 2V6HA 3B9KB 2HG5A 1CGSH 4XWGH 1MLCB 1MHPL 4PP1D 5D5MB 5F7EL 5AW5B 3PJLA 1AR1D 1J9SA 2EDFA 4LVOC 4QXUL 1M2VB 4MSWB 3SE6A 4MKTA 3QYCA 2WKLA 3DRQB 3QNFA 3WJLA 5LNDA 1PG7X 1WO2A 4JN2A 2D3LA 3SEPA 4MJ4A 4XVJL 3D4GA 3L3GB 4KO6A 2BOCB 2V7NB 3KHOA 5GGUB 3B3IA 3AXIA 3BH9A 3O2VL 5DVOA 1KCLA 1YPZA 1KTLB 4H8UA 2DI7A 1GYVA 1G7PA 5MENE 3QO0B 3OHXA 3SE3A 4LHUG 1NEUA 2R0ZH 4FXGC 1AIZA 4WEBL 2CLZB 1G84A 3ARBD 1KIRB 4KJWD 5I1IL 4IKLA 1WICA 3EYVB 4PJXF 3DJTA 4D8OA 3ASOB 5J12B 5EO1B 5L7XH 1XGTA 1WISA 5HXMA 2XC8A 3S35L 5LO7A 1OCWH 5E1HB 1TZIB 3KPNA 4PCYA 2CK0L 5E00B 1KCVL 3N06B 3WAJA 3MODL 2Y7NA 2K6YA 2YZ1A 3RVWD 3CFNA 3E38A 5HVHC 4HAGA 4QMEA 3I6KA 4D2NA 4HF5H 3U36B 2WYZA 2YAFA 3QZBA 4HPOL 2R27A 5F6HI 1L3NA 3UPCA 4AEIL 1KXHA 5IEKA 5CLXA 3HHSB 4GRWB 2QHRH 1LWJA 3QWOA 1U8CB 5DLMH 4LCVA 3ZTCC 5IMLA 1PZ2A 2D7QA 1NBVH 1P2CA 4AOFA 3GSNH 3VAEA 1D9KC 3QEQE 3QQ9D 3RUGB 2Q2LA 4HJGB 2VH5H 2D7MA 4YE4H 1I7ZA 3JV5A 5HHMD 1HWHB 3ZDXB 3KD4A 3T4YB 2I60H 3FQXB 3ZTNH 1YHPA 5C09D 5M7QA 1ODAA 5CUSL 1T0NB 3TO4A 1KSRA 3FAXA 1ZV9A 1KMGA 3EFFB 2R59A 5FWRA 1CXEA 3ATFA 3DV6A 2R23B 4OIAA 2AEQH 2B9BA 3OKEA 4NP9A 5EBWB 4N0CD 4M1CC 1QATA 4DP2X 2PTVA 2WXFA 4GXVL 4JPIA 4HKJB 3AM8A 5T1LA 2NY4B 4OFIA 1T7VA 3A6OA 2ZKHH 3N42B 5A16A 3UADA 4YSTA 1XF4A 1WRFA 2EDEA 3BP4B 4DEUA 4CJ0A 3K1KC 4ZPVB 3FCSB 3VXQB 3QIBB 4K07A 1NIFA 1IBYA 1PLGL 4FLSA 4MBOA 1AMYA 4L2YA 1PY4A 2IH3A 3I6GB 1LILA 3RX7A 4MMZA 4MZ3A 2R1XA 1TO5A 1T04B 2XXGA 4U6HA 4YSUA 1U21A 1TTUA 1LHZA 4P9ML 4WTZA 4RESB 2DQEH 4WUKH 4OAWA 4DP1X 4N4YB 1A65A 3DJRA 1MCWM 2I25N 2LFEA 3PE9A 3L3JB 3KPLA 3MYZA 4KTGA 3FSZA 4PJXA 2FDBP 2W07A 3OXRB 2YQGA 2A4EA 3V0DA 2OLDA 1ZTXL 2WLZA 1K72A 1DQJB 3QHZL 4JAMA 3UTZA 5ABZA 9CGTA 1A9VA 3VFGH 3OGOE 2GSIB 1C8PA 2OTUA 2G0LA 3GXFA 3IM1A 1ND0B 4W9KC 3VFOA 4BEIA 3QEGH 4FNPA 4P5TC 5FKPA 1EEZB 1XL4A 2RGSA 3V5HB 5EIIG 1A4BA 1IGML 4E9YA 3GS7A 1YAZA 2CLRB 5CMAB 4NQVB 3WKML 3HZVA 3BGMB 2ZCZA 4BCZA 4PV9B 2MQ0A 2GFBA 3E9UA 4AIXA 1MIMH 3D2UB 4XGZA 3PAYA 4MLIA 4U1NA 3EOBA 3D8MA 3PQYE 1D7CA 4XP1H 5I75C 3MRNA 4IOSA 5E95B 4R3SA 4HK0A 1XGUA 5FC9A 1AXTL 4ODVH 3EO9H 2WTPA 1F11B 3FKUS 1U8LA 2EXSA 2ZOTA 4J4PA 4U0RB 4XP5H 3K3QA 2YGPA 3IPEA 3EYUL 4TN9A 4N5UA 4XN7A 1VERA 1EA9C 2OCCB 3MYJB 4OCRH 1BQKA 1QSVA 3JSSA 4M1DH 4PRIE 5HGHA 1JP5A 3FO0H 3SKJL 1TJIH 1T22B 2C3GA 4RRPA 4F7PA 5C92A 4XOEA 1P6FA 2VDQB 4PJGE 2YC1A 3KH3A 4IBYA 4ANWA 3OR6A 3H9YA 1EVUA 5BRZD 1YEEL 2NXZD 3H8NA 4LOFA 3LZPA 4XX1E 5CHNB 2ZP8A 4EKXA 3LKQA 5EWIH 3RGVD 4CAGA 4NO5A 1IB5A 2YBRA 1T0PB 2O6FA 4Z76B 4I7ZC 2MPVA 5FDYA 3SOTA 2NLJA 1KJMB 3O3BB 1YMHA 1K9TA 4DN3H 2DQIL 4EI6B 4V1DA 2X70B 2Z8RA 4JFHD 4N24A 2WZPD 4I18A 3WSQL 3FB5B 1RVFH 1TPXB 3K2UH 5DK3A 5C0IB 3WIHL 4AYFB 3APCA 3JVGA 5JXED 4N2OA 2OQJB 1U8MA 1BQLL 3HMXA 5CSBA 4ZMOA 5FO8A 3BUPA 2XQYA 2H3KA 2J44A 1PGRB 2OMXA 5LB1A 1N3NA 1SN5A 1BJMA 1TCRB 3AT0A 3NCYP 3KPOB 5D71H 4LP8A 4UUJA 5DD5L 5DU7A 5EMYA 4OCYL 3EJYC 4PFEA 1JZ5A 3X1GA 3KXFD 1RJLB 4E9WA 4F1ZA 3MRJB 1CK0H 3OJ2C 4JK0D 2CDEA 4XXWC 1E9OA 2PUQT 3CDFA 3DSNA 4YIQA 1I7TB 5DO2C 1F3JA 1J8KA 4OB5H 3KWWA 4N86A 5HDLA 1MDAA 4XI5C 5HHOB 3W37A 3Q8BA 4GI8A 1GGUA 1A8JH 2FRGP 3WNOA 3T3PB 1NKGA 3VTTA 1F41A 1KTCA 1FYTD 2NW2A 3DJ9A 3GK8H 4LSVL 4YHKL 4RGNE 5C97A 4H4NA 3APNA 3GK8L 3KYMB 3CN2A 4GRLA 3BWUC 4YDMA 1RU9H 4HWBA 5C0AE 3U7YL 5F7KC 4HXAL 1F02I 4JKKA 4WWID 1YSOA 4TNVF 5AW1B 1G5GA 4DGYH 4L3EE 4OZ4A 4WK0B 5TPWH 4CILA 1N6QL 5FYJD 2H6PB 4KUCD 1EJ6A 4JO1L 4LZKA 3PHOB 2D7TL 2P5WE 4M4RB 3QPQC 4KHTL 3PWJB 25C8L 4MJ6B 4V33A 4AEHL 4IRZA 2P7TB 1JPTL 1ORQB 4HK3J 1TTFA 4JFFB 4PJIA 5JPNB 2WYTA 1KN4H 2Y23A 1BAGA 3IGUA 4NN7C 1A3RH 2XY1A 4UB0L 2MQCA 3RTQC 2O5XH 1S9KC 4J6RL 5I66B 1VHPA 1EGJL 4FQCL 1F4YL 3RX8A 3FT1A 3C09B 2OCFD 4XN5A 5GGSB 2ALWA 4J1UB 1KZYA 1E5CA 4QRSB 4AJVA 4HFUH 2FEDC 1AYOA 1N2RB 3NYKA 5I1AA 3FQNB 3VMNA 1R3HB 5I18H 3F5WB 3ATAA 3W39A 3DTXA 4FG6C 3IGAA 3NIFB 1MFAH 1DDHA 2PP8A 2DQTH 2ZG2A 1VSCA 1G9NC 1UKSA 1ASOA 4NWTH 3KPRA 4AQ1C 2XXFA 3GWJA 3KNBB 1IO4C 3B7YA 1BECA 1ZA6A 3CH1A 4FQQA 1N9PA 4XO9A 1DQMH 4PJDF 4V1DE 3FCGA 1A4AA 4NT6A 4Q2ZA 4PS8A 3QUYA 4FG0A 1DQML 4C57C 5BZDB 2R2CA 1V3KA 3BKML 3FHEA 1I8KA 4XCYA 2P49B 3SBPA 4FTVD 4M3HA 1QSFB 2IALB 4CVUA 5B1CA 3L4UA 3HB3C 4A2LA 1JSYA 5DO8A 4ZQKB 4IMKA 3UBFA 3CIAA 4L29B 4F58H 3O4OB 2OZNA 4KJYA 4WO0A 3NIGE 4Y8DC 1K2DA 3M17A 3MZTA 4Y1SA 5EZLA 1NAMH 5INDB 4FD0A 4UMSA 4XHJD 3RDJA 1OALA 3R7RA 4CSZA 2D0HA 2Y5TB 4TSBL 4BWUA 5GGTH 3HTLX 3FU7B 1WTLA 3CVHA 1NANH 5C9JB 1S7RA 4OIIL 2DLTA 4DERA 1KTKE 3BEWA 2AXWA 2M2DA 5I73B 3R19A 3QRGL 1IM3B 4NZTH 4OGAC 1N5AA 1GYAA 3JVGC 5GISH 4QR7A 2D2CC 1NGZA 2JJUA 2NY3B 3TBVB 2JELL 2F5BH 3NTCH 5HP5A 1U8HA 5J9PB 4JPKH 1NWPA 4QHPA 3BZ5A 3EXLA 4TOYL 1PNCA 3VFPA 2BY3A 4LAQH 4EO5A 5HVGB 3Q2VA 1OVZA 3WN5A 1BX2B 5FHBL 2CHNA 2NW3B 1ZXKA 1MRCH 1I1FB 4PB0H 4Q97A 2L7JA 4NUJA 4HEME 4OZGA 1CFNB 2BVEA 2NCMA 3TH4T 3UTOA 1FLRH 4C4KO 4PS4L 1BVZA 3N40P 2C26A 3MRBB 2QSQA 3MGOB 3LQAH 1HTYA 3LB6D 3PIQA 2X9XA 4A7TA 5L4JA 2RFXA 2DYPD 2GSGB 4CGUB 1X7QA 1YEGL 5LBVA 4AQOA 1QP1A 3L7EB 2L8AA 5KANG 3BQVA 2NX5D 1GC1L 1S9VB 5D7SL 1QRKA 1OLZA 5K9KA 2H2SC 3O0RH 3K6SA 1MJ7L 3JWOH 3KDMB 2VE6A 3WS6C 4F2MA 2J6EH 3NEEA 1LEIA 5HHPB 1AMXA 1ZTXE 4LSSL 5D1ZB 5F3BA 2SEBB 2VR6A 3H6JA 3V4LA 3D39B 3TPKA 4KKCD 3UTPE 2LFGA 4WWKB 2DJMA 3FSWA 4LO9A 1QFOA 3ARXA 3ZDZF 4O58L 4JDZB 5I1KH 3LZNA 2ZPKH 2NDFA 1R24B 3C75A 2NTSP 4M1GL 3GHEL 4JO3H 5AKVA 3VQ2C 4JJ5B 3X1FA 5TE4H 4OKDA 2YQBA 3FONA 2EDWA 2DV6A 5CFAA 4EDWH 5DR5H 3RZCA 3T6WA 1P7KA 4IRJA 4RISL 2AEPL 4DQOL 5BUGA 3FT2B 1XGQA 3H54A 5D6CA 3BZ4A 3L5JA 4N25A 5KJ4A 4OZIA 3LN5A 1FG2A 4JZNA 5DHMC 3LS5H 5AVQB 1ROCA 3C5ZB 4J3XA 1CD9B 3HNSH 3V4UL 3VVVA 3UC0L 5BW7A 2BZCA 2WLIB 4L0PB 4MJ5B 2E0PA 1C7SA 1NGXB 4PD4K 4RMTA 1C08B 4X0KB 2DICA 1EXGA 4PCTA 4JZJA 4D0DB 1J1PH 4UDTB 4XVOA 4YHYC 3OKLB 3I9AA 1H0DB 3IN2A 3L9RA 4JO4H 4WFHD 4Z95H 5MEOA 3VXUE 4OLYH 3GGWB 4NM4H 4R7LA 4CGTA 2A1WL 2ITFA 4PJCB 3DX4A 3JTSA 1K3IA 3RKPA 3LQZA 3K8LA 4XCFH 4W93A 3ZOAA 4IGBA 1BZEA 1GGYA 3SQOH 5FYJU 3UEZA 5FYLD 1T5KA 4KZEH 4JS7A 3Q9PA 4FQPA 3VRJB 1ZLSL 2J88H 4BK5A 1KGCD 2CQVA 3M8OH 3QORB 2B8OT 1QRNB 3QI9A 4KK5D 1G0XA 4N6RB 4OZGF 1NC2A 2HFEB 1CT8B 3HC2A 1U8OB 2OBGA 3GXUB 2YA0A 3QR0A 2UXFA 3DI3B 2COQA 5JYMA 2AV7A 3B83A 4GI6A 1O6VA 1SMAA 1YMMA 2DF3A 1SJXA 2CRYA 3UTTB 3VW3H 3WENA 4PJ9C 3ARGA 3RWEA 4LRNL 2PW1B 4FFYA 3GI9L 2WP3T 4OZFB 3SGKA 1UZ8A 2LTQB 2OMZA 2QVMA 3EUDA 2N59A 2FYYB 3CVHH 2V8LA 5F7NC 2EVJA 2IVFC 2IFFH 4XBMA 3TA3A 4XHJC 3UYOD 3O2DL 1E50A 2QPFA 2Z35B 3CVHL 3IDGB 2R29A 1NKOA 4EN3D 4HJIA 1Q90A 1CICA 2IQ9H 3VO0A 1I9IH 1MNNA 1DVFD 1CB4A 2WB1A 4M4PA 4PJEB 1T83C 3NJIA 4Q9BA 1NMBL 1NSNL 2K45A 3A4DA 4KK9C 4FNQA 4DP9X 1NWOA 3BW9B 3ZKQD 4HIXH 3HE6A 1WFTA 2K7PA 5I18L 1MCSA 3RPIA 5ICZB 2QKIC 4TLTA 5AG8A 2KBGA 4GRLD 5DZOA 3DMMD 4QTFA 1FFOA 2XPZA 1A0QH 1FIGH 1UZ6F 5HD8D 1YN7B 4X9IA 3I3DA 3G6JE 3ZE2B 1AAJA 2D4DA 1NLBL 3PABA 4HUUB 4CU7A 1A6ZB 3BVWA 3T2PA 4RNRB 1DQDL 1GCFA 3V8OA 3P9MB 2BXZA 5I1LB 4XN4A 1AZVA 2Y5EA 3O6FC 3E3QC 3RB7A 4XBEH 1D5BB 4J12A 3HE6D 1HSAA 3PG2A 1FHGA 5SWZA 3DO7B 4IBTA 4XVSL 3NJHA 5IB3B 4YAQA 4Y5YC 1D5MB 2F1BA 4HHAB 5E24E 1NC4B 2A9CA 3BGFC 2XJLA 5FA3B 4MQTB 2X6CA 3A47A 4YHIB 4IEFB 1VKXB 2AEOA 4OLVL 1EEYB 1MFDH 1WK0A 4NQEA 1DVSA 2PYEE 1XMWA 3WJLC 4UZSA 3B8YA 5I6PA 3CFIC 1Z9SB 3GJEA 1ETZA 1OW0C 4Q58C 4GBXD 3RWHA 5E6RB 4YFLF 4D3CL 4PJDB 3D85A 1KENH 3DHUA 1HNGA 5ABAA 4NP4L 4QRRE 4A39A 1NMCC 1KFGA 2YQ2A 3P73B 3NIFF 4JGMA 4L9LA 4U7KA 3UOAB 1XR9B 1XF5A 1WIUA 3ARDB 3FRPB 4HWBH 5LAXB 4PJHF 3KLLA 1HOCA 2ICES 2X1OA 3ELQA 5E2TH 2QQQA 1LEKB 4X5XB 4MNHA 5JDSB 3QJSB 4M7KL 2D73A 5GSVA 4FYSA 2EILB 2Y2YA 1OZUA 5IMOA 3LIZL 3CFDB 3ULUD 4K3EL 4ANUA 1OF0A 1WGVA 3OJDA 3EHBB 3RGVC 3ZDYB 5DD3H 5FKAA 3ZIYA 2BMKA 1GGBL 4G9FE 3MNZA 3RDTA 1JPSL 3SD2A 3FYIB 2VZOA 2H0PA 3C60A 4NN6C 3WHXB 1GC1H 3BAKA 3ZYJA 5L88H 5K9QG 2A99A 1QWUA 1H3UA 3HC3L 5EF3A 3AWEA 2ZX6A 5IBLC 4X7FC 2BC4B 1TQUA 1NBYB 5CJXA 4AI7A 2CMRH 3HMXH 5FB8A 2YGOA 1IM9A 1UOWA 3L4CA 4FXKA 5ERWA 2OSYA 5E5UB 5AALA 1D5ZB 3EDEA 4PV1C 4NHUA 3UBXA 4JN1H 2XYCA 3MOAL 2PXYC 2PWEA 4QWWC 4XMKL 1SJEB 3H9HA 3WTVA 3OF6D 2X1WL 3T65B 4A7SA 4FL4C 3BZEA 1F4XH 3DTDA 2DQCL 3EYOB 3QDGE 1UYWL 5JXAH 2GIMA 1JDDA 3S8WA 3ESMA 3VG9C 3NAAL 4LLWB 1NANI 5E1IA 4L4TB 1UWGL 3TBTB 4K3GA 3EYUH 4DGYL 3QC5X 1MY5A 1C5BL 1KBVA 5B39B 4JG9A 4IRSC 3ZE1B 4F9PC 4BGLA 3U4BH 3WKNA 4QYOA 1T0OA 4Y16A 3QUHA 5G5DB 3ORJA 1LYQA 1P7BA 1FZKB 4D7BA 4DKFL 2CO6A 3QUZC 4EBQL 1H3VA 5DURB 3KW7A 1EHAA 5LG1A 3VRIB 2Y06L 3VXTA 4HVBA 3WEBA 3QR2A 5DJDB 4HA1A 1FZJA 4LLDB 4LPTA 1XXDC 3BIKB 1EIBA 1EGJH 3QEGL 4EIUA 1PVHA 1G6VK 4FLOA 3EJZC 3ES6A 2ZONA 5FHAL 2EIKB 1IGIH 3EO0A 2V4LA 1SDYA 4NERA 1HNYA 1NH6A 5HI3D 3C6LC 5DD6B 4HUKB 2LT9A 3L4WA 2XWRA 1PY9A 4Z7UB 3MRKA 3MOQA 3HAEB 2E4FA 3WKQA 4QLWA 1MKFA 3WTTA 1FGNL 1OCOB 4GPVA 1WTGT 2E75C 3O3AB 3VA2C 3TV3L 1JF5A 1TIUA 2X42A 5CEXA 3L3OC 3MNVA 1IBGL 2WWNA 3KS0J 4HKXB 3QCTH 4LNVA 2W5PA 2XA8H 3NCCB 4ZMQA 4P5TB 1TQSA 2C4FU 2IV8A 2EUXA 3VFVA 3FOLB 4YSRA 4NI6A 1IC5H 4P23D 3CTTA 3V6ZB 4JRYB 4Y4FA 1DQIA 5CF3A 5KG9A 2A0LC 2Z31C 3LXAA 3OC8A 4UNUA 4W9GC 5GRJH 4E41A 1N6VA 4DCQB 5IKCA 2X89D 2X89A 2ZOOA 1KYDA 3OHMB 5MP6H 4YSAA 4PY7B 5GHWL 1DCLA 1TENA 2DWXA 1FAIH 3WL9A 4OZGE 3L5WA 1CF8H 5CEZD 1KPVA 2DD8L 1SXZA 4ZW6A 2BP5M 1CJYA 4AGOA 2UZXB 2Q3AA 4YVUA 3N44B 5AOIA 1B4TA 2VXTH 5E2WL 1SYSA 1OPOA 1F3DH 1KIQB 3OKOB 3LNGA 2AQQA 1ZT7B 4P59H 4ZTOL 4YXHL 2J4WL 1JUFA 1BZDA 1B4RA 4LQFL 3QG7H 5KAQG 4F2ME 5FCSH 4MA1B 4WW1A 4ZFOB 1EPFA 4AENA 3KGUA 4ETYA 3RKDC 2BW4A 3ARYA 1AD0A 1Y6KR 4B9FA 1QUPA 3P9LB 1F4YH 2Z1KA 1IGFH 4PS4H 3UG3A 4RIRB 1L0XA 5DHVA 4OTXH 4Z77B 4MMXB 3NFNB 2HJFA 3S5LG 2BX5A 4KRPB 3P0VH 1E4WH 1NGYB 2Z7WA 3PHAA 4LK4A 4ABUA 1TQVA 4EI5A 4IMLB 2AJ3A 1KC5H 5CINH 4GEIA 5KVDH 4ABQA 1EDQA 3JWDC 3WBDA 1YY8B 4LVOB 3BP6B 4PRDA 5B1AB 5I19H 3T8MA 5BS0E 3NEXA 1TQBB 2UY6A 3F00A 3VXUB 4DOHE 4HWNA 3N42F 5KVEL 4LHUD 4LHUA 5I0DA 3I3EA 4GBXB 3IETA 1HILB 3KWUA 3WCYA 3UZQB 3T0EB 5EOCL 2R69H 4P5RA 1OGSA 3ARBB 3ZDYE 2UYLA 3OAUH 1A9BB 2VISB 1L6XA 3TM6A 4TUKH 4DP7X 3I6LD 1RURL 2DB8A 3ARBC 4MYPA 4X5PA 3C5SB 2OL3L 2CNZA 4P46B 4P4KA 1H6TA 4W9FC 4HC1H 1DP0A 4NOBA 5D1XC 2FX7H 4NSKA 5KVEE 3TH2T 4NCC2 4N2AA 2BNRD 4GO8A 4XNZC 4RSYA 4M7LH 3W1ZA 5HI4C 1L4IA 3UEQA 3DRTA 1WFUA 1CBVH 1NL0L 1TNNA 2K6ZA 4XMLH 2ICEC 1IAOA 4TM9A 2VL5B 3CCHA 4YDVB 3X12A 1WE5A 2YO3A 4GAGL 1C5CH 1SLXA 4GW4B 4PGDB 3D4CA 4HXBL 4E9LA 5E94B 3U0WH 3UPRB 5I0YA 5J1AB 1G7IB 2BWDA 1E3XA 3CXFA 4C56D 1J5CA 1YJDL 4DVRL 1GPOL 1JAEA 4HG4J 2OJZH 1OSYA 4XPHH 3W5MA 1ADQA 4G42A 4NZ8A 4HUXB 4M8QB 5KBNC 4PJEE 3IWVA 3LAFA 4X4XB 1JGUL 3RWJB 1ZWIB 3KPMB 1M1XB 1BEXA 3NZUA 3FO1A 3VQ1C 5KS9A 1O7VA 2R4SH 3CN4A 4R83A 5TQ0L 1XTLA 5I71B 1WC7B 3OAZH 2R1YA 5IJBC 5DMJB 3TBCA 3OWRA 1U93B 3IT8D 1E7UA 2VLRA 4HCIA 4ZW8A 4N28A 4PREB 4U6VH 4MDJA 3IU3A 1T1WB 1I8AA 2YEQA 3FH7A 5D5ME 1AXSA 3SCMD 4AJWA 3JTBA 4EI5C 4YUEH 1IBFA 3IDJB 5CBAB 3Q8EA 5JTWA 4LKCB 3MFFA 4WNQB 4U3SA 5IT2L 2R8SH 1DVYA 3O41A 1NDMA 1ZV2A 1AO7B 3G6JB 3QNZB 4ONHA 2IF7A 4YFDB 1W72A 1P5VA 3H9SA 1H3XA 3EH4B 4OCXL 2FT7A 1JIBA 2NY4C 4P57B 4JREC 4GYBA 4CC4C 2FUTA 4AQ1B 3WNIA 2LU4A 5C6WH 3HR5B 2NUPB 3ARTA 3ISRA 5BMFH 5DRXB 3D2UD 2ROXA 5E99H 1UVQA 2E46A 2ZOLB 2VDQL 1BOYA 2ENSA 4KITB 1U33A 1WAPA 2XVKA 3MRCA 4RRPG 5E2UL 2Z65C 2VR3A 5C0ND 4XNYL 4X6BB 4Y9FA 1IEBA 5C0AA 2G9HA 1BLIA 5KSBE 1PKQB 5F7FA 1A1NA 1MFBL 1OTUD 3AROA 2ZD0A 4JHVA 3QIUC 1P4LA 2JQAA 2OMYA 5GS2D 4P99A 3ZL4L 1A3ZA 1MCOH 2JXMB 4IRZL 4MXQD 3DOSA 3KPSE 4QHNA 3ECUA 4WTQA 4AUYA 4ADIA 1JNHA 1HHHB 5IB4A 5D7JA 3RURA 5FYKE 1JZFA 4UZGA 4F80A 2EC9T 2YD1A 4P5KB 4PJ8B 3CAFA 3OKYA 4YGVA 2EE3A 1E27B 3BN9C 4N0UA 2PCYA 4HIJB 1MQKH 2CO7A 1J1OH 2DMCA 1P1ZB 3X1BA 1DQDH 4LLYB 5D2LB 5EUOA 1Z9MA 2EDNA 2HVBA 4BH7A 1JVOA 1W0WA 3MGAA 5SWQA 2F61A 2Q6WB 1GGCL 3RUGE 5KJRL 4YZFF 2YOAA 4JNXA 4ZK8A 1HEJC 1F18A 3GMPB 4J3WA 1COBA 1NCTA 1Z3GH 1UH2A 3MA7B 4ODSH 5AVXB 4CW1A 4ZNEE 2YD4A 3AQXA 4NI3A 1NBZB 4YL9A 3MREB 4JVPA 4NJAH 4WW2C 1IQDA 3EDKA 5DLLA 1HSBB 3J27A 3M07A 4YDNA 3TL5A 3EHBC 3NCMA 3WFDL 2EVIA 3EJSA 4UU9A 1BWWA 4PVBA 2HB0A 3I74A 4N1EA 1Z66A 2AJYL 2JNZA 5L2KA 3CFCH 1IBDA 3COOA 3VACA 3D34A 1JPFB 5B38A 2V5MA 2FVNA 3IJHA 1ES0A 1GXEA 4HH9B 3QJFA 4BKLA 4F33A 4NPYB 3SDAD 5HVHB 1JHTA 1IC7L 2X5PA 4IJ3B 5DUBA 3Q7JA 4HISA 2BY0A 4Y0GA 4K8RH 1IKFL 4EXKA 3FFCD 4AUUA 4YSEA 2DPKA 1KLGB 1I3GL 4JPVL 4M7JL 1YUKB 3KLDA 4OIBA 5D93B 3V0JA 3RWIA 3REWB 3T3PE 5SWSE 4MCZA 3WMQA 1GTFA 3IVKB 1ZHNB 4HT1H 1RIHL 4RVBA 2DWDA 3L3GA 3N1GC 2J8OA 5BUPA 4ZSOB 2K6WA 4NKOB 3MKKA 3OPUA 4FNLL 3E6FA 3TT3H 3GLEA 4PSPA 1Z5LB 3AREA 1WF5A 3EFOB 4YXKH 3T8VA 4L3EB 4XPAL 4EJ1C 4X4ZA 5IG7B 5KSAC 2AK1H 3D4YA 3L9EA 3OKKA 4XXDB 3L4VA 4KHXL 4KX9A 3N0PB 4JJHA 5JNYA 4ENEC 3GINA 4JFFE 4MNGE 2ADGB 2XZAH 3BVVA 3OKNB 4M9OA 3O2WL 2JV6A 5D9SB 2J57A 3FFOA 2IH8A 2Y4SA 5D70H 4YDIL 2W60A 4FQ1L 4M61B 5SV3A 4PJ8D 5IUCA 3NCWA 1HEHC 3UTSB 2XBTA 1JE6A 3QJRB 1R75A 2B16A 3ZSTA 3PWPB 3RIAK 5DZ9A 1NUFA 5IEKB 2QFRA 4X8JB 3LXBA 1TR7A 4UOQA 5ANME 2ZKYA 4DTGL 5KS9E 3Q8FA 4Y5XA 3TN0B 2M8XA 2O5XL 3RGVA 3BGAA 2C9RA 4J6RH 3DBXA 3QNXA 4LSUH 4P3CH 3TIDB 4G8IB 4G82A 4TL5A 4AMWA 4ALAL 2WD0A 3ARPA 2QTEA 4M6NH 5IVXA 1NDGA 2CBPA 2JLPA 3ESNA 5HY9B 2HTLC 3PLYA 1H8OA 2VN5A 3MU3A 2EZ0D 4LBAA 2YUXA 4BQ8A 5JPMB 3NPSC 2VL4A 1FGVL 1PX8A 3FQXA 4LL9A 4DP8X 3PDDA 3KGTA 2EKJA 2FZ3A 2F5AH 1HH6A 4XMWA 1MRFH 3CK0L 1A7BA 5LXGH 5EBWA 4KDTA 4U2ZA 7FABL 1X7SA 2HAZA 5F1NA 3WYRA 4BH8A 4Z7QB 5IJCC 3EGSB 3TA4D 2BH0A 5MERA 4URKA 2QGBA 2HVKA 3UJIL 4DK3A 4FFWD 2X40A 3OGCB 1RP8A 1JTTA 1JRHL 1JI1A 3QDMA 4P3DB 4R4FL 1NAML 3BZFA 1RCYA 2P80A 5KTEL 4POUB 1ZHBB 4HETA 5DJCB 1X5YA 5SWSA 1A1OA 1U4EA 1JK9A 3GHBH 3NJMA 8CGTA 5IBTH 3CD4A 2DEXX 2O72A 2A6KB 3FB8B 4CKQA 1CURA 3ATBA 1OD7A 1MFDL 2A6DB 4AYBA 4U6HB 1BMWA 2BRRH 3PGCA 1WBZB 3P0YL 5CIPH 2TSAA 4Z3EA 2B4CL 5F3HA 4L48A 5J12C 3P2BA 3WMSA 4S1SL 1XV8A 1UB6A 4U1JA 4I1RA 3CV5A 4UTAA 2ICWA 4U1KA 1PZBA 4DGIH 1X9RA 2LR4A 4AQ8A 2E3VA 3N1QC 3ULUE 3QZNA 2F74A 1ZD6A 2AI0L 4KI5C 4CVXB 2BNRB 3SO5A 1XH1A 1FL3A 3RPKA 3SYPA 1LVEA 4XPBH 3VSVA 3FTGA 1IAIM 4WI7A 4Y5YB 4DZBA 1HCYA 3G08B 3T0EE 3WI9A 4JM4L 5CILL 2ZX7A 1JWUB 1T03L 4WWOA 3IE4A 1DEEA 3UP6A 4YH6A 1UD4A 3D2TA 3RFZC 1TEGA 3U4EA 1CD0A 3MFGB 4QDGA 1ASPA 4R0LB 2ED9A 3ALWA 3GXMA 2H4EA 1RPQA 1NOFA 4FG4A 3ZDZE 2WIIA 4PJ9A 4APQA 2GYSA 5DJXB 1PIFA 3SKNB 3CXHJ 1WS8A 3Q2WA 4GY4A 1A6TB 5FFLA 1K8DA 3MYJA 3II2A 1A6UH 3U1SL 4JY5L 3A4EA 2PYFB 1T20A 1CTMA 2E4TA 3CSPA 4LCWD 2Z7YA 1MCLA 2K7QA 3QI9C 5DEJA 2YC1B 4YHZL 5HYSB 2LAAA 1W16A 2A9BA 4YR6A 5AD0A 3MBED 4NS0A 4YXLL 4FMFA 5IK3A 5JOFA 3VD9A 3GI8L 5HGBA 3LKQB 1ANUA 2VKXA 1URIA 2FX9L 3VFSA 1IVTA 4G8FB 4AEFA 1UWXH 4PJHA 3IJ8A 1MVUA 4MJIB 2I27N 1TITA 5IROD 4JMXA 4U3HA 1QUNB 3H55A 2VZUA 2DDQL 3J8F7 3N41B 3BKJH 4P49A 1N59A 4RGMC 4ZS6C 2M1KA 2G5UA 2DYPA 4DKDC 2AABH 5EIVA 1FFTB 3OR7B 4BQBA 3WTUA 3MLWH 5ID1B 3QIWC 3IFPB 5JW4Q 4KVCL 2YAPA 2PXYD 4NUQA 4XMPH 3MMEB 1AGDA 1RUPL 2XG4B 2XI9A 2V17H 3EG9A 1JZ8A 2BIOA 1D5RA 2DMKA 3LNIA 5E2VL 3D0LB 2F1EA 5CEYA 5E08L 2R9HC 1CFVH 1WD8A 4I4WA 1RJLA 2W9EH 1CWVA 4Y2DA 3MRMB 1QLEB 2IJ0C 5L9DH 1ZLVK 1G9ML 3BAXA 3KJ4B 3GSQA 4TRPL 1KBGL 2ODIA 1E65A 4HULB 4XWOC 2OJZL 3CFJB 4GXFA 4JJOA 4K3JL 4XPHL 3VWKB 4O5LL 3PWPE 1S3KH 1JGIA 1I9EA 5A43C 4YFEA 1BIIA 5L4FA 1ZGLM 3VWKC 2LW3A 5ESQB 3UO1L 4A2GA 5ADOL 5I24A 5CGYD 3EJUA 4M5ZL 1IAII 3M7FB 1G6RB 3BVNA 2AJZA 4MDIB 4W9JC 2HT3C 2J25A 3QIBC 4D9LL 4ZMNA 1XF2A 3US0A 2D3VA 32C2B 1S7XA 4G9FA 5FYLE 1D6EA 1H5BA 3BE1L 3O2DH 1A6WL 3O6FD 4NNXB 5GJTL 2LVCA 1DFBL 2Z92B 4AYGA 3LZFH 3ZTJG 4NQXB 4NZUL 5TF1L 4BFGA 2YZ8A 5LNGA 2WB7A 4P8QA 1FAIL 5MEPA 3MV9D 4KRLB 2GTWB 3VXUD 2WVVB 4XNUL 4KDTC 4JDTL 2W65A 3O2DA 3W57A 2G4EA 4HPHA 2JTYA 3ESUF 3L4TA 3DECA 4WU5A 2YKLL 5E8OB 4QRSA 5TDNB 2X3BA 4ADJA 5EF2A 4N87A 5T1DH 2EXWC 1GMIA 4WHTB 4UQ3A 4AEHH 2JB6A 2EC8A 4D9QD 4HJ0C 2FECI 5E23A 2YA2A 4P9HH 1YEJH 3VFRB 4EOWH 5EEXA 2GJ6A 1WDAA 1V54B 3ZK0A 4LSRH 4NRXA 2AAAA 3LKPB 2ADFH 5F9AC 2CU9A 3T4AB 4CMMB 5JORA 1XB8A 2AJSL 1ZJAA 2DQJL 1EAOA 2VLLB 1MRCL 2WVTA 1MFNA 2E9IA 4Z7VF 3HAEG 2XVGA 3O3DB 1GAFH 3FTZA 4K71C 2PO6B 1DL7H 5ESAB 5C0DB 3NT0A 1I8KB 3P0VL 4MB1A 5JHAA 1QLRB 2NTFB 4AEEA 4L1SA 3VD1A 3BSZH 4DN4H 5IW6B 1UH3A 1WCQA 3FPYA 5JW4R 1PEWA 1K2DB 5HYJA 1TVDA 2FD6H 5INDA 1ACCA 1O7DC 4Y1TA 4QRRB 1ITCA 3N9GH 3R0NA 5J56B 5KVDE 5GS0L 4HS3A 2MCPL 3WLBA 4APXB 2YAMA 4A63A 3FZUD 5GSRA 5JQHC 4JPWL 1GGCH 2XWTB 4A6YH 2DKMA 4N8VA 4MQXC 4WWKC 3NACH 3ABKB 1L9PA 3BUQA 1R3IL 5IQ7H 1MCIA 4HKBB 3SQBA 4XP9L 5C0GB 4X7DC 4PJBE 1YO4A 4X9YA 1FYTB 1AY1H 3JV6B 1LO3H 2VSKB 3DWTA 3BQUA 1U0QA 3P4LA 1VFBB 4IIZA 2KQMA 5EFIB 1QBLH 3FQWB 1ACZA 1SMDA 1W2KT 2CBMA 1WAAE 1ZVSB 2R56H 2WLKA 1OSPH 2UZYB 4PGCA 4ZUTA 1QPPA 4LSQH 2G3NA 2IWFA 5DQDH 1GJIA 3K72A 1FN4B 1CFNA 1S7WB 1WS7A 2GC4C 2ROYA 3LMJL 5EU3B 2Y07L 4JDEB 3K8KA 2NY0D 3GEFA 2JKTM 3RAJH 1K4DA 3FT3A 4DFHA 2BFGA 2EYTB 3KEDA 1KG0A 4W1TA 1HL4A 4M7JH 2H3NA 4XP4L 4BINA 4AIOA 1F58H 2RB8A 3VXOA 5K9KB 1YDPB 5AOKA 4OCMC 1IGCL 1RIHH 3LKSB 3SDXA 1U8NB 3L6FB 1FL5A 3D69A 1EEQA 3OG6B 1MY7A 4L8CA 2DLIA 2Q3XA 5EU4B 3BUDA 5IMMB 5E0QA 4MJIE 4WWKA 2IPKB 3TP4A 3DMMB 1H6EA 2IAND 2AFNA 4WW2A 4FXTA 1GS7A 4WI9A 2ZF9A 4ZMLA 1R5IB 2GJ6E 3OB0K 4U6TA 3C6SB 4KHXH 4U6VL 1RUKL 3MBWB 3VFWB 3VGAB 4ZFFB 5KS9F 3Q05A 4Z5RA 1WVZA 5K93A 3D12B 2NZ1A 3THMH 4MJID 4X4MA 1RSYA 4JHAL 1P7KB 1NM9A 1FFPA 4J3OF 3WIIL 2EEBA 1KGXA 1U30A 4Z7QE 4IOFD 3UG5A 3VI4F 2R0ZL 3MLRL 4PCSA 3VXSE 1AC6A 1YEEH 1CGWA 2CDFB 3B9KD 1PS3A 5GRUL 2H9GB 5T33H 1IGTB 3HG4A 1SDDB 1M1SA 2P8MB 4ODUB 2K9FB 1G0YR 2LGNA 2Q7NA 3NSCA 5FDWB 4LARL 1E2VA 2O5ZH 5SX4H 2BSRB 1NCHA 1Q1JH 4YDJB 3H3PL 4LGRB 5ICYB 2VDOL 1TZHB 2HLAA 4MRCA 1B0GA 4G43A 2NQ3A 4WLCA 4GP5B 4I0PB 3C09C 1T2QH 4BWWA 5F7DB 4BBWA 3GTTA 4Z0XA 4MNGA 3S96B 1RZ7L 2IH1A 4LOUD 2HX7A 2F7RA 1QNZH 4NO2A 1EO8L 5DI8A 1M7DB 3LVTA 2BK8A 1S3KL 3BUBA 3H9SD 1PZAA 4LSTL 4P2OD 1HVXA 1G7LB 2BVTA 2KLRA 3EHBD 4M5SA 1O75A 3D05A 3L1GA 4JQVA 4AGNA 2Q10A 3WFBH 4B0MM 2K70A 3G9VA 5IF0B 4R5TA 4MAYB 4LCYA 2LQRA 3SGDI 2PABA 3TBSB 5JA8B 2OL3B 1WUZA 4G8GB 4RGND 5AQ0A 2XQBL 5KYUB 4GT7A 1UEMA 2WMPA 4NQUA 4J3OD 4UAOB 4B96A 3RY6C 4GIOA 4H0HB 3GSUB 4OV5A 4JKPL 1YNLL 3CMOH 5F7LB 5KVGH 4XVUD 3WEXA 3AU0A 3NZ8B 2PCFB 3O9WD 4J3OC 43C9A 2VR4A 1KB9J 5CN2A 5D7IF 2YPLB 5DJ2B 4ZDHA 2IDSA 3SDXF 4DNLA 2HRHA 2VERA 3KLHD 2EDXA 1N8ZB 3V9CA 3L1FA 2D9CA 4ISVB 3ZDXE 3P4OB 4J5VA 2H32H 3C8KA 5F1IB 3APFA 4I9WE 4PVNA 4URTB 3V6OA 2FR4B 1JPEA 2J7LA 3QISA 2ADJB 2RCSH 4LP4A 4PJ5A 2F0CA 5KJ7E 2NX5A 3RVXD 4D3CH 2DQUL 2OTWB 1IZKA 3Q6GL 2IFFL 4MXQC 1IEAA 3HE6B 5SX5H 2V2WA 2NXYB 3VWJA 1SJMA 4H25A 5FO7A 2XTLA 2RD0A 5CN1A 1V3JA 2VM9A 4YWGH 3SO3B 1RJYB 1Q9WB 2VJXA 1BOGB 2EIDA 3WEAA 4AW7A 4DGIL 4TULL 4XC3H 3X3GL 3F65A 4AE0A 3SE8L 2O5YH 3S36X 5DMIH 2BLFA 1QSEB 3AXLB 3VVWA 5H37H 5AAPA 2C7UA 4KUCF 1EH9A 4XMTA 1MXGA 3U0TB 3FO2A 1YN7A 3L17A 5DD0H 4WO4C 1E4JA 2O26U 2V37A 4LVEA 5SWZE 5AYTA 1F90H 2XKUA 1UKTA 1YAIA 2CG9X 3MV9E 5BRZE 1KXQE 2VXQL 2HG0A 4F24A 5EUOF 3DETC 3V5KB 3VCLB 2IIJA 2OR7A 1A7NL 1G7PB 3WLWD 2Z8VC 5E70A 2D7NA 1MFMA 3JTTB 2N7BA 5B1JC 4FFZL 1R5WA 4IKNA 5GRYA 1EEUA 3FUIA 1OAZH 4A6YL 5I6XB 4A37A 3HS0B 5K39B 4DH2A 5IBUG 3O2VH 2GSMB 2HFFA 5DQ9A 3C08L 3PJNA 3SPJA 3WNJA 2X9YA 1FHNA 4PJDA 2DY2A 1XH3A 1ODUA 5GZNA 1X5LA 3OQRA 4XI5D 4F5CA 2DLFH 4M3KB 4H0GA 1E8XA 1W0VB 1T1YB 4GAYA 4NC1C 4QRQA 3ROOA 3U82B 1ZXQA 2R56L 2BS9A 3QXDB 2JJTC 1ITBB 2VABA 3VD3A 3VYOA 4H2AA 1GZHC 4B95C 3BN3B 1WUNT 4U3CA 3L81A 5C6TL 1OAJA 2JKLA 3ARRA 3FFDB 1JYVA 3DUSA 4QF1A 1S78D 1DE4A 1EX0A 5C07D 2WZ0A 4M3JA 1JGDB 2CO3A 1A22B 4N2EA 4AVKA 2A5UA 3RUGA 1T21B 4HX1B 3BWAA 4P2QB 3Q3GB 3B7SA 1X9UA 4FGMA 3UAJA 3KVPA 1AR1B 5J7CC 3FTXA 4G6FD 1MNUH 1I8MB 1Q9KB 2VXVL 5E6SB 1FUNA 4NKDA 2EXYD 5E2JA 3UYRH 5EA0H 2ATKA 2WSPA 4YHOL 1PKOA 7FABH 3MXVL 3PDOA 2CJUH 3SPVB 4YQXL 2A73B 3IDMB 2WQRA 5E6IC 4JEGB 3W0WE 1KJ2H 4WQOA 5I8CB 3F6LA 5F89B 2EDDA 2I9LA 2D7OA 4JFYB 4NC1E 3SDCD 3MUHL 3QORC 1KCSL 4J8RA 1BBDL 3B2MA 4HALA 3Q2NA 1DJSA 1XF4B 3BP4A 3WEOA 4FTVB 2X41A 5HI5D 4I48A 2A9AA 2QL1A 2L0DA 5CO1A 3TBTA 2R9HD 5CAYB 3ME0A 1PSKL 3MCKB 2YMXH 5B39A 2YEZB 2NY5L 3IDXH 4W9CC 4DUXA 4HD5A 2RACA 4PTUA 3RGHA 1FSKC 1UXMA 1PKQE 3MJ7A 1QTYT 4OAWB 3DIFA 4JHZA 4LDLB 2CLVA 2XKSA 4U2YA 3Q01A 4ZMYA 3SE9L 1DJWA 4XZUB 1DR9A 3GRBA 3ZMEA 5IMKA 1V7MH 2R2BA 4NYLA 3HRZA 4GQQA 5TF1H 4IJTA 3OXRA 1KTBA 1W72L 4HCGA 4RMBA 2OPCA 4GKNB 3QWRD 5LDSA 2H6OA 1M6UA 4JAMB 4IDLA 4QRAA 5F7BA 4ZFQA 3T0ED 3ZGIA 1I1CA 2OTUB 1XAUA 4ILDA 3N5AA 4JQIH 4NKQB 4XPTL 4DOHB 1MOEA 1XGRB 1KPRA 1L7IL 1ULVA 3VI3B 1OP9A 5IP4A 1YYML 1FL6A 3I75A 1IL1A 3SDAA 4FKKA 5ES4B 5IR1B 1J8HE 1QPKA 2EYRB 4FERA 1N0LB 4QXUH 5L2JA 2WXIA 4X6CA 1A1MB 4ELKA 2O93L 2DM4A 5E1AA 3TVMA 1PX3A 2R83A 4CU8A 5ACLA 2E8ZA 4K0OA 4QEGA 5GS1A 2EDHA 2BOLA 5IHZA 4OUOA 1GOHA 1CFTA 3IS0X 3RUGF 3QXTA 5HI3C 4JGNA 4F9PA 3ULVC 1GOGA 3HG1B 3LQMA 3RILA 5D6DC 4RBPH 4GRWH 1QQDB 4EDXA 3RJDA 3IS1X 2Q86A 2MCG1 1G9MH 2ZXAA 1AS7A 5DQJA 5HGDA 3ULVD 2N01B 4Y16D 4Z7NE 2VDMH 3UYPA 2CRZA 5B1BB 4JL1A 1I8LA 4JRYA 1KLUB 2X4NB 2BNUB 5KG9B 3PGDA 5DVKA 2ITCB 3P2DA 1ADQL 2K3TA 3OSKA 5JQ6H 1IE5A 2P5WA 4OCSH 2X2JA 3TYGH 4JX0A 4RMVA 3MODH 2APBA 3ARFA 4HC1A 4LSDA 1KFAH 1I31A 4XWOD 4YSOA 4OCRL 3NACL 4U7MA 1HEZA 3S2AA 3U0PB 4F37K 1UXLA 3MJWA 3MNDA 2VLMD 4QRTB 1BBJA 1HKLL 1PAZA 4DT2A 1S46A 2CK2A 2A83B 1PDKA 5BRZB 4EI6A 2ZUTA 3NH7L 4GRMA 2R69A 4ZBJA 3VDAA 1JZ7A 2JKSA 4EIZC 4KK8D 4OZHF 3RE0A 5BXFB 5GS0D 4CDHA 1D5IH 5AVSB 2KZ1B 1WWWX 2GEEA 4BZ2H 3MXWH 3SHSA 1MRDL 4FXGB 3QQ9C 2J1XA 1ESOA 3CFEB 4L8DB 2VWEE 4OLXH 5ID0A 3CX5J 1D6VH 1ZOXA 3WHE0 5IFAL 4FXKC 3GMLB 4PW9A 5DHDA 4TQEL 3WXWH 4LMQI 3GUTB 4L9LC 4YIQB 4R8WH 2J4WH 2X4OB 4HXBH 3A22A 4DO6A 2H2PC 4KI5F 4OI8A 2O61A 4WFED 3Q8CA 2OSLB 5KN5B 1S9YA 3DI2B 4G7YL 2UZIH 4G1MA 1NCIA 2RH0A 1NCWH 1AQHA 3ULUH 3P77B 4I77L 3WNNA 1RHHB 2WXOA 5GS1C 3ZUNC 2H8PB 1U92B 5ANMB 3N1FC 4GBXA 4JHWH 4J3VA 5EEUA 3SDDB 2VSMB 3AUVA 4HUWA 3UZQA 4ZI8A 2WLLA 4QNPF 2EXYC 3ULSA 4F15C 1XCTB 2G75B 1DHKA 2VN6A 4JFOB 5D7SH 1O6TA 1AGEB 4PLNC 4HLZH 4OGXH 5I1GH 4MNQA 3DXAD 1CLOL 5KVFL 3NIDF 1MUJB 1HE8A 3WE6A 1JZEA 2J1KA 1D7BA 3IU4L 3PHOA 1KDJA 2HLFC 5DRNA 4MRBA 5H35B 5JO5B 3HC4H 4MJ6A 3EZJB 3VSTA 4P2RD 1PPIA 1UWFA 3FCTB 1F5WA 4JUSA 4OD2B 3SDCC 3WJMA 2Z91B 2MWCA 3BSHA 3QUZB 4J23A 2XPGB 4X5WA 1OW0A 1MFUA 4E9XA 1F6AB 3MJ9L 5E1QA 5E6IA 1I82A 5IZ7A 1QFWI 1AR1C 3DRTB 3DPBA 4HPOH 5IB5A 2D7PA 2Z7ZA 2VRKA 3IJSA 3WELA 2NYYC 3V6BR 4NO3A 5I15H 2B39A 1JXKA 3UPRA 1XCXA 3MJ6A 4KGJA 2V7HA 1K3ZA 1BDYA 5C0BE 2H1PL 5DZNA 5IESL 1KIPA 1U95A 1HAWA 3BI9X 2CUIA 3OZ9H 5I76A 4CVWA 4YHNA 4YE4L 3CBKB 3WKMH 4XPFH 3LNHA 3IJYB 4K94H 1HWWA 4O9HL 3CPLB 4PV8B 2F7PA 1CG9A 5D7KE 2IPUG 1KPUA 2GJPA 3S5YA 1WHPA 4OCNC 4PMEA 5FO9A 1YJDH 5K33A 2HJKA 3BISA 2GAZA 1WG3A 1S7UA 1MHEA 2WINA 3KPQA 4MDJB 1T1WA 2FD6L 3CZKA 3BAIA 2OMNA 4W9ZA 4Y4KC 1EZUA 3QDJD 3PWLB 3HE6C 4AM0B 4KTYA 2V9TA 3BKMH 2NNRA 4XBPA 1DQKA 2C5DC 5ECGA 5JQIB 2Y72A 1EAPB 2ZKMX 4ZPTA 3BCFA 3GTNA 4KRNA 1S7RB 3S36H 2PO6C 2X4RB 2F53D 5A2AA 3BAEH 5DHYA 5HHNB 3O6MH 5KBLA 1M6OA 2N7SA 4F3FB 3K4AA 5K69A 4PJCF 5EWIL 4K7FB 3H7LA 2YJQA 2V5SA 3O3UN 3A23A 1BYOA 4GUQA 1WPCA 4IGBC 4BFIA 1KCUH 1JFQL 3ZE0F 1OM3H 3I2CL 1IEBB 4KKRA 3U6XS 3CC1A 2ICEA 2NR6C 5C3TA 2OMYB 3AC0A 2VRAA 2QZ5A 1LGVA 1QABA 4GO6B 3FJTA 4WO4A 5E99L 2UY7B 4LBEA 1ZTXH 4TXVB 4X7EC 1HL9A 3TIEB 3KVDD 4LOVA 2FLMA 1CL7L 1YEDA 2OMTB 2RHEA 3I84A 2F54D 3KYOB 3MI6A 1ZEAL 4N20A 5SX5K 3JQOB 3OKMA 2ESVB 1CDYA 2LOEA 2VM4A 4RZKA 4NXKA 3K5SA 3D25B 5BV7L 5CP7A 2VAAA 3MQIA 3VWJC 2E59A 1YN6A 3NOIA 4WEMB 4WHCA 4WDIB 2D3JA 4C59B 5KYXA 4P48A 4K73A 2YGNA 4YPGB 3U9PH 1W0WB 3FCBA 4P23A 3RFRA 5SWQB 1BLNB 1H6UA 2FJHA 4LEOA 5I6KA 4MS8D 3MRRA 1SEBA 1D3CA 5ILTL 1I8IB 5IOPA 3KM2A 5F9OL 2DQGL 4G9DB 3FT9A 1MCPH 1UWEH 4ABWA 1EDYA 1IC1A 4WW2F 5DZLA 2NSXA 2NY5C 4ETQA 5BW7C 1OANA 3KJ6H 4WWPA 1PAMA 4LCUA 3GXTA 4Q6KA 3D18B 4XBEL 1MI5E 1WZ1H 1JZHA 2F7QA 4IRJB 3MV8E 4DGWC 5BNXD 5IREA 1L9NA 1TF4A 3LN5B 4IRJC 2HUHA 3GSWB 4EN3B 1FNFA 1UENA 2VZTA 4ICWA 1L5GB 1ONQA 1TNMA 1HQRB 5A2LH 4GG6A 3BO8B 5DRZA 4Z3GA 4EQ2A 4HUCA 3SDDD 1U91B 5F0MB 1OAUL 2F1AA 1SVBA 2IXQB 4PGEA 5HHVH 3FS9A 5C09A 5IY5B 2H26B 3JV4B 3N6YA 4X83A 3V10A 5C0JA 1KCKA 2ZG3A 5MENB 4DN3L 4B53A 3GKWL 1FNEA 1QYGL 1TEFA 3AW5A 5DJ8B 5A2IH 2KS0A 3G5ZA 1UH4A 4PJCA 1DBAH 3QPKA 5DC4B 3ZBMA 2G0KA 2ARWA 1VEPA 4N8PA 3HLKA 4YDKL 3HB3B 2DMHA 3EYQC 1FORH 1YZZA 1NICA 4HLJA 2WZ5A 3VRJA 2YPKA 5I30H 3S5LA 5MI0B 4FN0A 1NCBH 1I7UA 2GBTA 2WCSA 1BZ9B 3BUYA 1NGPL 3HIZA 3L3HA 4UYPA 5JW4M 2B1AL 4R7DB 4GRWE 5LGJB 1Y1DA 2F2HA 3T1WA 3RY5A 2CXGA 2VDRB 2PYEA 5MEQB 3TBYA 4YUEL 1JHKH 3FL7A 1BXVA 1ZHKA 4OCWL 3PHQA 3QEQB 4GIPD 3RWEB 3TJHD 4LSVH 4YHKH 4PBDA 4BFKA 2EC9U 1ZDSA 3D0AA 4UOZA 3L3OA 4FFZH 1BFOB 3GO1L 5I8EB 4X50A 5EIIB 2D0GA 2VRQA 4PLKC 1OAYH 4FQXA 3TN0A 1J10A 1BQHG 1BSIA 2J5WA 1UCBH 3OKDA 1U3HA 4JMNA 2AK4E 4Q9CA 4B0MB 3DBXB 1EDHA 1PX4A 3QNXB 5TQ2H 1UOKA 3SYOA 3TO2B 2AEWA 3M45A 4G8IA 4PJFA 4U1HA 4BE5A 3MLVH 3T77A 1HHKB 4OJFH 2GJZA 1RK0A 3SN6N 3T0WA 3LCYA 4GLRI 1HKFA 3VTMA 4QJ4B 2OMVB 5HDRA 5IHUL 2ENJA 3DIDA 1UWGH 2FEEI 1QI4A 4LAQL 4MZIA 4PVLA 1Z1WA 2PPEA 5FX3A 2ADFL 2E56A 5EBLB 2BJML 3F7VA 3KVQA 2VTFA 4FP8H 1E28A 4EXPX 1DLFL 1CBVL 4XOCA 3MV8A 4K23L 4MQXD 4WWKD 1KNOA 2DQEL 4WUKL 4PJBF 1AKJD 3IDIB 5F93C 1G7QB 2NY0C 2IANA 3AWGA 2YGQA 3QDME 5F1NB 4CL7A 3DVNA 1SPDA 2G5BB 4PY8I 4ALAH 1IT9L 4PSRA 4JM2F 5MERB 2W88A 4OCLC 1QFWH 3PXHA 1YEHL 4JM0A 1M05B 3DX6A 2XZCH 4WI6A 4U6XB 3LPGA 2TRYA 3SBRA 1NCDL 1CTNA 5HGGS 1QWNA 2RBLA 3WD5L 1ZT4B 4OU3A 3CVDA 3QCVL 3WXVH 4NQED 3T71A 5IB3A 4KK6C 1WJ3A 5F7WC 1OHQA 3W2DL 4GQZA 4GMTL 4NOFA 5FA3A 3TYFB 1DVFB 4IEFA 1KN2L 3R8QA 2QPUA 4F7TB 1VKXA 4QRPA 2Q3ZA 4PRHD 4U6YB 1FGNH 2RQEA 1Z9SA 4NRYB 3PV7A 1XIWB 2MHAA 2WBJD 4LKXA 3HKZA 2BSCA 3PREA 5DT1H 3QH3B 4XP1L 3IMTA 1N64H 1KB3A 1LTXA 3RL1B 3G5VA 1JV5B 2Z0BA 4HMEA 5HYEA 3GHBL 3KW8A 3KBEA 4LRNH 3C9NB 2DM2A 4X7TA 1R3JA 2MMXA 3BQUC 2ZCLL 1LDPH 1Z9LA 3MGTB 2ZWZA 5AZEL 3HNTL 2IADA 5FXCH 3PQYB 5B7FA 5J5EA 2CKBA 1C1EH 2L4OA 1HI6B 3CFDA 3F58L 4Z0BH 2P3YA 5JIKA 2D0FA 3CSTA 4H1LA 2J56A 2X6AA 3EBAA 5GQBA 3T2OA 1B2YA 4I3GA 2VR8A 3TN0C 3FAWA 2XWJB 2GTZB 3KBFA 3Q5YA 4M43H 5E4EB 4NQCB 5I5JA 4CNIA 3LS4L 3NFPB 2QV4A 2J6EA 1LDSA 4EUPA 4PJGB 4XCFL 3CFUA 2X4SA 3LEYL 2FBRA 3LKRA 4YK4B 5E9DA 3MRHB 4PJ5E 3LKNA 3QPXL 5HBBA 2QSVA 3TA3D 5L0QC 1KEML 4X99A 5CILH 1NIDA 1NFIB 1FIGL 3OX8B 3S3CB 2N1KA 5C07A 2X1QA 1CUOA 5ACZB 5C8JB 4Y89A 3DK0A 2CO2A 5DC9B 5KSUA 2JE8A 3C5ZD 3ZT5A 4QHLB 1N70A 3GLZA 4HLZG 1MPAH 1I3UA 5ISZD 5K59E 4I18C 3PWNB 1Z3GL 4ODSL 3LPFA 2MQ3A 4XVTH 1G7MB 2Q8BL 4P2YA 2GUOB 4Y9EA 1R3KA 4NZFA 5A6MA 1A6UL 1YUHA 4QYOB 4Y16B 3A5VA 2XQ0A 3GSXA 4OFKA 3OF6A 4LPYA 1RUMH 1YNKL 2EH7L 2BSED 3X14B 1N0XH 4KO5A 2OYLA 5KBDA 1S8DA 1ZLVH 3EGXA 1CDHA 3HC4L 4UNVA 1Q1JL 2CO6B 2G30A 2WXQA 3R1GL 3QP3A 2BWIA 3CGTA 2HTKC 2WBKA 3K6OA 4QJ3B 3VXTB 1KGWA 2EDKA 4CC4A 2EVGA 5KYYB 4NBXB 2W9LA 2H2PD 7TAAA 2VUYA 5HYFA 3GMRB 1FZJB 3I6LE 4LLDA 4Z7OB 4YC2B 1A9EA 3S7GA 4HWUA 4CMHB 4NNYB 4BHUA 1RZQA 3ECQA 2FQFA 2D03H 3QHFL 4JFDA 4YBHA 5E7FA 5J1TC 1Z0NA 1NIBA 2F53E 5I16A 1UXWB 3LIUA 3BEVB 4F9LC 1A0QL 2ZAGA 5CGTA 3NEOA 4NIKB 3T1FB 3CZSA 4ODWB 3SY0A 3VWKA 12E8H 2P4AB 5LQBH 1RUPH 1FZMB 3EYSH 3UIZA 1YEIH 4J3OG 2UV3A 3FF7A 3IPFA 4IKKA 5D1QB 2WLYA 3QJXA 2ZUQB 5D96B 1UT1A 5I1EH 1BG1A 4EKJA 2QKIB 4P5TA 3CHOA 3QZLA 5AVYB 1NCCL 4KXCA 5AG9A 1D6EB 3HZKB 1KXTB 3NZHH 1IKNC 1XSJA 4XO8A 2C1OB 6PCYA 1U8QB 1RH8A 3BVUA 4GKZA 4Z3JA 1YYLH 4W6XB 5C7ZA 3GNMH 2G2PA 3MUZ1 4MASA 4BK5C 1BMZA 1RUQL 1ZGLB 4JKNA 1AANA 5C0BD 5C0BA 3I02A 4F8OA 5GS0C 2HFTA 1CDGA 3MACL 1UTDA 4L9DA 1JDCA 5D1XA 3OC5A 1FNGB 3T8XB 5I5MA 2FYVA 3NA4A 5BVJA 1UA7A 5PAZA 2IQ9L 4FP8L 1I9IL 1VRSA 5IM7A 4JQXC 4M7KH 2J20A 4NQDA 1QBLL 3AQZA 1HT6A 4G6JH 4LMQE 4R6UA 4WWNA 2YUWA 4GAFB 5GHWH 3WO3B 1TJMA 3IDYB 4P2RE 4P5SA 3V0WH 5BRQA 4K7PH 5ITFB 4G6FB 3QFDA 3MRPB 2X4QB 4IM8A 1G43A 3O3DA 3DX0A 2PO6A 1CR9L 4OLUH 1UGNA 1HHJB 3DXAE 2MEJB 1QFHA 2AXJA 3VXSB 1GSKA 1AGFA 4WCYL 4BSVA 1J1XL 1FH5L 2YXWA 3NJVA 4ZX4A 1C12B 3JVFC 3MV7B 4WU7B 4Z78B 3U6RB 3SYCA 4N2MA 5DTFA 1EFQA 4OLEA 4L0ZA 5IW1B 1MG3C 2E27H 2DQFA 1AD9B 3BJ91 5C0FB 4RAUB 4GQ9L 5F70A 5F72S 3BMWA 1AZBA 3VXUA 2Z93B 3BSZL 4DN4L 1DUYA 1XGPA 1BVNP 2J1WA 4UINL 4KMTH 3DMMC 1DTUA 2X4UA 5KSBB 1OM9A 1PZ5B 2HLEB 5FA4B 1EXHA 2G4GA 1M7XA 2P24A 1I9RL 2VZVA 4ESKA 2VR7A 4Q7DA 4YE0A 4AQEB 3LRLA 1L9SA 3O81A 2FWLB 3GSVA 2AGJL 5I19L 3UCQA 2YRLA 4JY4A 3GRWH 2FO8A 3BQUB 5EOQH 1OXYA 1Y1UA 2XKNA 3KJ6L 3ULAB 4NQCE 1G7JA 2E7DA 1HH9B 5AW8B 1JWSA 4OZHA 3CZFA 5FEBA 3B7TA 4X7CC 4O58H 3LDBB 1A7PH 4ACTA 4WI5A 4HIHA 3U2IA 5FOJA 4JR9L 2EE9A 3L3KA 3UP1A 1EFXA 3CHPA 3QZWB 1KIUA 3KBPA 2AI0H 3V6FA 3WN5C 5DS2A 1V7NL 3ENEA 1D9KB 3QB7C 4HCRH 1G0DA 5DA0B 3GBEA 1DVZA 1EQWA 3HW7A 3LRSB 3QDJA 5LXVA 3CN1A 4LEBA 4HUMB 4XWGL 2EZ0C 5DEFA 4FKEA 4GKLA 4G6KH 2WOYA 1DBJH 4OM1H 1TJHH 4KKAC 3GMNA 1T2QL 2ARJB 1ET8A 4OQ1A 4AV4A 1K5NA 1UHVA 4XMLL 4V2CB 4MMYB 2E6PA 3BPNC 2HG5B 3PNWB 1FORL 1T5WA 2OSXA 3RBGA 4FLRA 5AAWA 4OI7A 3KYNA 3J7HA 5CEZL 1Y18B 4KPHL 1QO3A 4G8GD 3U9WA 5J57B 4YEFA 1FFNA 3HMXL 1S3RA 3E6HA 1H8LA 1P9MA 1HAUA 5C2BH 1J88A 2FO4B 4JGJA 1YC8A 3DO3A 3HNVH 4PJFE 1KTDB 4WGVB 4OGZA 3WE1A 4EMZA 1WD9A 2ZXGA 3TASA 4DUVA 3ABLB 1M3JA 4X98A 3C6LB 2NY2D 2H6UA 1WGOA 4WHYH 3MX0A 2JQMA 2DN7A 4PJCE 4ZUSA 3F7KA 1OIOA 2CLZA 3FN3A 3UABA 4AQ1A 1SZNA 5EU5B 3Q6FA 3HR5A 3Q2LA 1NCAL 5KSAD 1E3FA 5I1JH 3GXPA 1NCAH 3F12A 1JF1B 2EO9A 3AREC 1FBIH 4ZW7A 5TPWL 4FLQA 1IC4H 3DKHA 3RI5F 4TL4A 1CD1B 2Q20A 1F1AA 1TEYA 1KGJA 1S5IH 4Q6IA 3ZRSA 3C5XA 3S96A 4KTEH 4YWGL 3PL6B 3DOSB 5DEZA 3WFHA 4WO4D 2K0RA 1UKQA 1INQA 1T89C 4KXDA 3T3MB 4FJ6A 5F9WC 4DHLA 2OYMA 4YGVB 3WY2A 4R4BA 5BO0D 3STZA 4PRPA 2F8OA 1EXUB 1RZ7H 3S9DB 4BFOA 5CZKA 1LE9B 5KSVB 3DVIA 2BZ7A 2JK5A 3G6AB 4AKQA 1BQHA 1U58A 4NFCA 2CJTA 3BIAX 3N40F 1R17A 4PIRF 1JGEB 4TSCH 4NWTL 2YPLA 3FB7B 4L8SB 4M5ZH 2HKHH 4LGSB 3ZL2A 4G8EA 4R96B 1IQWL 2IGFH 2QADC 3OKEB 3IFLH 3B4NA 3EAKA 2F54A 5AL0A 4ELDA 3DO4A 3QW9A 4HKJA 2J8UE 4JKPH 4H8QA 43CAB 5FGBA 2ZUYA 4QT5B 4TF4A 4HWEH 5JR1L 2ETWA 3E7JA 2OTWA 1VADB 3FRUA 4C56A 2B5IC 4ZPVA 3VWJB 4CRPA 3HCVB 2WO3B 1BOGA 3FF8A 1D5IL 3OV6A 3BCDA 4DP6X 4TVPH 2ZCLH 5AZEH 3AXLA 4QNPE 5DHVH 2XA3A 4E36A 4NJ9H 4NRZB 5LCVH 4G1EA 5JOEA 1HINL 3M6DA 4FQXC 4X6FA 3FTVA 3NTCL 4Z7NF 3BH8B 4GSQA 4RAHA 3RWCA 1QKZL 3BPCA 2IV9A 1HCFX 4MA3A 3IVKA 5FF6B 5KUKA 4N0FA 1FV1B 4PJ6A 3MO1B 4ZSOA 1FPTH 1QA9A 1HZHH 2XN9A 1NCOA 2AQRA 4WFGE 2EH8H 1IBBA 1B0RA 1TYJA 1CL7I 2ERJB 3SPCA 2XFGB 1VZHA 5FYJE 5EC1B 2W80C 4O2CA 4XN9A 4ZYKB 3ZZQA 4AQAB 2C34A 5EA0L 1YVLA 5TE7H 1G9EA 1UUNA 1M56B 4M6AA 3M46A 4A1RA 1GGIH 5HJ3B 4Z7OE 3N1MC 2Q87A 1JXFA 3PUUA 4DIXA 5D7JC 4YBLC 2MOQA 3FQRB 5T8IA 6TAAA 4KO9A 4R5VA 1QD0A 2FHFA 3NGBB 4ERSH 3B9DA 1UG9A 4J27A 1JS4A 4FNTA 1J8HB 3ZHNA 1QVOB 4HK3N 3OAZK 4EI5D 5D1ZI 1ZLEA 2ICCA 1BREA 1OKEA 5KVEH 2VC2H 1E5ZA 5KANI 1S7QA 3W2DH 3D3VA 2GCYA 4IHOA 4AL8L 4XVTL 2VDNL 4PBWD 1JERA 4OCXH 3WU1A 4Y1AA 3FFDA 3M1BA 5T33L 1G1CA 2P8PA 2MPAL 5I1DB 3TESA 1GHFH 2DLFL 5EORL 2F53A 1JCKA 1T21A 5K1NA 2QVFB 1A7OH 5J11B 4ELMA 3EO9L 2DL9A 4ODHH 4F7CB 1JPGA 3RNKA 4PJFF 1IRAY 2F68X 5C0CB 2XLLA 2X1XR 4X5QA 2AEPH 1O6SB 4ZO7A 4AXWB 5IESH 2BVOA 2YBRB 3V0IA 4JDVB 3HHRB 5CKGA 3R06A 4B7IA 3ARGC 4PEEA 3LS5L 2Y3AA 3KG5A 3GT6A 3LN4A 4Z7WE 3RAJL 5B22A 3VE0A 4JRXB 3ECWA 3TCLB 2ZE0A 2APWA 2D03L 3QHFH 3PP4H 5EO9A 4QRBA 3SO3C 1R46A 3I9PA 4U05A 3KCPA 5DS8B 4PJBA 1AP2B 3IJ9A 5CBEA 1I4FB 2VDNB 4H26A 4XNMA 4JO4L 2HVJA 4Z95L 5C6PB 5I5RA 1UOLA 4J8RB 2R51A 3EYSL 2Y7MA 3WNLA 4GQPH 4EZKA 5I8OL 5DSCA 3BFQG 4YHOH 4L1HA 5INCA 1LO5A 3GIVB 3MJ8A 3QA3A 1OHZA 1GMEA 1IIKA 3G5XB 3MRJA 3N43B 4OGYL 4YXKL 5EOTB 3O6FB 3V9EA 3P4MA 3CQPA 4BV1A 3FNKA 3DVFA 1J5OH 2OK0L 1KJ2L 3O4OC 3KPRD 4I3SH 1KBGH 5LG6A 1NA8A 2VDRH 4WGKA 3PRZA 5HHOA 4KQ3L 3GRWA 2C3VA 3DOHA 1WBZA 1F2QA 2V5TA 2ZCHH 5SV4A 3PQYD 5AOLA 2JI2A 3RNQA 3MV7E 3QULB 4DF9A 1IAIH 5IMKB 4JHAH 1K6QL 1IBGH 4MA7H 3FQ2A 2YMXL 2VN7A 3CFMA 4A7GA 3AS1A 3MBXL 4JG1L 4Y2OA 4KX8A 2ED8A 5EZOL 3VX1A 3S88H 3DYPA 3QG6A 4N8CH 5CJOL 1KN4L 1SDAB 4PJ7B 4MXVF 3B6SA 1AGBB 4MB3A 1VCAA 4PGBA 3ARDC 5I6LA 3N91A 3VI4A 1F6FB 2BZDA 4K9EL 2BVPB 2KERA 5BQ7B 2N0MA 3QUYD 1R0AH 2I5YH 4ZX6A 4F20A 3IKCB 5AYQA 5L8JB 3PV6B 1EV2E 5F7MC 2ZUXA 3U4EB 4WI4A 4J3TA 1ZHLA 2XTSA 2B08A 3HEIB 3QPQD 3MBEB 1CGVA 2YKLH 3GBNL 3WUZA 2HMID 5JZ7C 3T2NH 5EN2A 4HJEA 5DFVD 1AGCB 1FNAA 4CSTA 4UYQA 1J1XH 1A6TA 1ZIAA 4YPJA 5F9JA 3RY6A 2QPEB 4JKWA 5FUCC 4HWZA 3DOIA 2I32A 3DTUB 3Q5TA 1T20B 2AJSH 2DQJH 3QARA 3TZVC 5T3ZD 2W0FB 2XX1A 3AT8A 1VA9A 2FGWL 1PD6A 3BOVA 3IFLL 4WHYG 1ZLUK 2Z31A 1JYXA 3HHMA 2EDBA 1ZA6B 4B9ZA 4JQVC 2WBXA 3HG1D 2O30A 4RMUA 1E8YA 3CLFL 3P02A 3ZTNL 4AZ8A 1ID2A 5F97E 4GS7B 1J05B 1J8SA 1ECZA 2K4AA 2VOTA 3U4AA 1FO0L 5JYLA 2ZJSH 1AXTH 1E9PA 1ZANH 2J71A 2V2TB 2HT3D 2DI9A 2A83A 2OULB 1ZA3B 1LO2H 3R4RA 2JMRA 2KYIA 1PMYA 3AU1B 4HKZA 4ZUVB 5H37G 1NGWB 1YYCA 3DX8A 4PRAB 5IB1B 3Q13A 2OP4H 4Z18A 1KJ3H 5HYQB 4PJAF 2HUEA 3GLDA 1NEZA 3J07A 5D7LD 1DUZB 1U8IB 2W92A 3FQ1A 4TSAH 3VB9A 5C9JA 2XTJD 1F2XK 4HF5L 4FYTA 2AXFB 3VXMA 1CDJA 2CWRA 3NH7H 5DVLA 4DVBA 1E6OL 3MR9A 3QJHB 5B21A 4MYWB 4YSQA 3VH8B 2I85A 4QY8B 3IGFA 3P30L 1OGPA 2R2EA 4Y2DB 2O5NA 4P9MH 4L1TA 5TH2A 4OF8A 1R3LA 1TKWA 1OGAD 2JIXA 2X4OA 2DQHL 4KVCH 1HL5A 4IMKC 4TYUA 1XCWA 1ZT1B 3AG1B 1FYTE 1U8JB 1UURA 3B7UX 3LRKA 3MXWL 4OM1L 5GISL 1D7DA 4QRPD 1GKEA 3BPLC 3HMWL 4M8RA 3EFFA 1FZOB 1CYWA 2XV0A 4DPCX 4KNTA 1XF3B 2EEFA 3D51A 4O2EB 2HRLA 5C70A 2GIXA 4AYMC 1JRHH 4R4FH 1FJ1B 4HZLA 3SKOA 1KELH 2OI9B 3ZO9A 3IF1B 3BP5A 4P06A 2ZSVA 5E8EA 1OB1B 4KV5E 4N0YH 3P2TA 2WN3A 5F8QC 1OAZL 1TQTA 4OZFG 1T80A 2FT8A 4XAWH 2DJ4A 5FOBA 4Q8BA 5MEND 1EJOH 3W81A 1CE6A 1AQDA 2CIKA 5FUOL 6FABH 1FVCB 3ULUL 1FO0A 4IU2B 5BCAA 4B9JA 3W9EA 2EKSA 1Y0LA 3QIWD 5IV2A 4QTHA 3QUZA 4LPCA 2JKNA 4D9QE 4JFHE 3BPOB 2E47A 5TJWK 1AI1L 3HN5A 5F44A 1XSIA 3D48R 4KKLD 3CU1A 5FM4A 3TFKC 3BAWA 1JZ3A 4X80L 2I7OA 2ZOWA 3ILQC 2AKRA 2RJMA 4JQIL 3CDZA 4TUOB 4FABH 2VAJA 5B3SB 4NFDA 2APXA 4NKMA 3WEMA 4UT7L 2BNQA 1BCIA 1KIPB 2VIRB 2OAAA 2VQ1B 4B7LA 2HH0H 4FEMA 3ZJAA 4EUPH 4YSCA 1VEOA 4XP6L 3T0BA 1YEHH 1A6PA 4FLHA 4UB0H 2WIMA 4NPJA 2OX5B 5EZJA 1LNUA 5CJQL 3GSOB 4WCYH 2QADB 4MHHI 2FWSA 1XWVA 5IW6A 4HU2A 3RJOA 3TNMB 2GFBB 4GO9A 5JW4N 4UM8B 4U1NB 3QWQB 3SQOL 1IBZA 3TN0D 3L5IA 2CKBL 4HGWB 3U4KA 2OW6A 3MRNB 4N1HB 3ETSA 4KKPA 4MQ7A 2QVKA 3LEVH 1XGUB 2G60L 3PWPD 2DEWX 4P2QD 4Q9RH 1KCSH 1I1YA 4IS6A 3RDTC 4ZPTB 3W11C 5EU6E 4LCCC 1SHSA 3WFCH 2X4RA 4KUZL 1IAIL 2A3TA 4UV4H 2TSBA 3BGFB 3QYNA 5HHNA 3O11B 1MCDA 4MXVE 5IBTL 1BD2B 2QJDA 4G2AA 4K7FA 2Y3NA 1YPZB 3KPSB 5AW2B 4JRFA 1EJ8A 1Z9NA 5FS5A 4N26A 2VJ8A 3GZPA 4F58L 4K3HA 2VJ0A 5CHNA 4TVPE 4F15B 2J88L 3SCMB 3GSRA 4NO5B 1NMCB 3O4LD 1Q72L 4TLUA 4DAGL 1H3PH 5DUMH 4WI0B 2IO5A 2WKOA 3R8BB 4ES8A 2ZYHA 1DO6A 4HOWA 5I1HH 4FHJA 2F7OA 1PW3A 1XL6A 2DD8H 3I50H 4UWQB 2B4CC 1TZIA 3KPNB 5DHXB 1IE4A 1D6VL 2UWEE 3CU7A 2A6JB 3OKMB 5JZ7D 3DGDA 4JFZH 1NPUA 4YBLB 3D5OF 2MKWA 4WJ5A 3VYPA 4JREB 2GT9A 3ZDWA 5CP7B 4HUVB 3WSQH 3K2UL 4Y4HB 3FSAA 4JFWA 4UV7H 4WDIA 3LEXB 3LNDA 1T1XA 4OQTH 3L6FA 4R7NB 2Y25A 1J9TA 4OZIE 4UUJB 4TRPH 1GTNA 2VXUL 3ZTEA 2AQSA 5HHQA 4KK9D 2DLGA 4O4YH 4RZCB 5KOMC 1RZIB 2AQ1A 3DMMA 1E9OB 4K2UH 3DSNB 4XCNA 3MOBH 2DAVA 1AKJB 4KJQC 5LCVA 1I3GH 4JPVH 5FUCE 2EUWA 4WNJA 5TD4A 1D7FA 3MRDA 5EZIH 4G9DA 1EFXD 5C2BL 3IJEA 3NN8B 1P5UA 4N2GA 5C7XL 5E8DH 3BT0A 3SPIA 1QSEE 5IWLC 4FL4B 1WLHA 2ZSWB 3TO4B 4UQCA 3IU4H 2BP3A 1ZSDA 5EEZA 5JUEL 1OCRB 4PRBB 1VFMA 5F9OH 5SWZB 3AFLA 3DV4A 2NQDA 2WKGA 3F7YB 3HVDA 3KL5A 3TYGL 5B8CA 4IBWA 4JFSA 4ZSOE 1IGTA 3IAGC 1NMAL 4QRUB 4XNUH 5KBPA 4JFQB 3U2SB 5EO1A 5EU6D 1AQ8A 5FDWA 1BQSA 1ZE3H 1MDTA 3O9WB 1WWCA 3ZL1A 4NDMA 3CX2A 3F6IA 5E00A 1Z6JT 5T5NG 1JPST 3GRGA 2JJVA 1NFDB 1FFQA 2PCPA 3LH2H 5E8PA 1BGXL 1IGYA 4KZCA 3EOTL 4N2HA 2DWTA 3GSNL 2XQYK 5A40E 1KGYE 3U36A 1CDBA 4MNGB 2EDTA 4UAOC 4EVNA 2B15A 1U3YA 4JZJC 2VDOH 3OLEA 5E2VH 4MNHB 1PLCA 4JANB 4XCEA 3OLDA 1EHLL 4IOIB 5IMOB 2I9TB 1Q0EA 1DJHA 1TVHA 2J55A 3BAJA 4LT7A 2C1PB 3IMUA 4OFDA 2FECL 2Z64C 1AQKL 4MA1C 3OLIA 1CI5A 2YRPA 4G83A 3QXVA 3DHJA 3NP3A 3PAUA 2CCLA 2F19L 1ND0A 4HGKC 2H2SD 3EO1B 2XZCL 1FG9C 3BKYH 4NO0B 1PQZA 3ET9F 1EEZA 1NBVL 3C8HA 1XSKA 3C8DA 3MXVH 4Y4KB 1A6VL 3VXNB 5BJTB 4U1MB 4E68A 5AW3B 2JB5L 5TQ0H 1AI1H 4R2GB 2FLRT 5L88L 4JCWA 2AQPA 5LKNA 2VT0A 1AHWB 1THCA 2BVQA 4NM8L 1UB5B 2JKIS 1BBDH 5AYUL 4AYSA 3U7AA 1QPXA 1UA3A 2ADJA 3CVHB 3NA9L 4PJ5B 3T65A 2XZQL 3LTVA 4L23A 5H94A 3BEWB 4JB9H 2F58L 2WSKA 4Y5VB 3FCSA 3H3BC 2F58H 3BZDA 3JZYA 4H25B 1RZ8B 2F7IA 4POZD 3BHBA 4B97A 2P5EA 1O0VA 1OQOA 2ZWYA 3OJMB 4UQ2A 4AL8H 2XXCB 5H8DA 1MCCA 5LBSH 5IFJA 2H1XA 3HC0A 1NCNA 5JIQA 1E28B 4MMZB 4NZTL 5FYLH 2V5YA 1X5KA 2Y06H 1E90A 5EDXA 2IANB 2FHBA 3QJOA 3QUXB 4YNYB 5EEWA 2VDQH 1SVZA 3NRQA 5L6YH 2ATPB 4MS6A 2VLRD 1X6NA 3II1A 4RISH 2ORBL 4TUJA 3MUGB 3VRIA 2EH8L 3FT0A 4MCYA 4JZOB 1J8RA 3UBGA 4OLZL 2ZCKH 3OHXC 4G80A 1X7QB 4RGNC 2ESVD 2G60H 1RZFL 3Q1EA 4N6QA 4N2DA 1Z32X 1X5FA 5TK4A 4BSWB 5I0VA 4Q9RL 3JTTA 1CFMA 2QSCL 3N55A 2IC2A 4MD0A 4F92B 4EN2A 3H53A 2OQJA 1HHGB 4O02A 4AYID 1KB5H 2H0EA 3NABL 3V5HA 1LEIB 4CBZA 5E4OA 4LLVB 5D7LE 4XPGH 4Y19A 4NQVA 3G5YA 4IU3B 3BKCH 3LXCA 5KSAB 4JFEB 1NLBH 3D2UA 1O9ZA 3KLHC 4NQTA 4U1SA 2A6IA 1QEXA 4RMWA 1BPVA 1XH3B 4DUWA 2A4ZA 2VDLH 1OTUC 3S37H 4QRQB 4AC4A 1OARH 2NY2B 3MHZA 3QCVH 3JYCA 1MPAL 2AQ3A 3PWVB 2P26A 3FO9B 4M5YL 4PG9B 1UQSA 4UOJA 1V3LA 5BZZA 5TGBB 1ZLSH 4AV5A 1BJ1H 2ZJSL 2MH4A 4LB8A 4EI0A 3WY1A 2FCBA 4MD4A 3B1TA 3FT2A 2OXHB 3M86A 3MUY1 5ICXA 1AE6L 1XQ4A 3KYMA 3SZKC 4OZIB 4LF3A 3EF4A 3KPPB 3KXFB 2X2IA 4LHJB 4ZTPH 1IGJB 3SBQA 4X6CE 3MV9A 5IBUB 4DGVL 4MGXA 5JOPD 2GTZA 5B7EA 4LU5L 1OSPL 4OZ4B 2Y22A 2BHUA 1L7TH 1E5AA 3DNKA 4ELMF 4UDTA 3OKLA 3LSOA 4NENB 5HPOA 1OSZB 3TLRA 3WUWA 2BDNL 2ATKB 4GRWF 1MIEL 3GGWA 3HJEA 3UTQA 5T1KB 1K8IA 4I5BB 4CBPA 4Y4HD 1CL7H 1RMFH 2EINB 1MXDA 5GPRA 3RTQA 3EOAA 3FB5A 1JUFB 1UACH 4KC3B 3BVXA 5I8CA 1RZJC 1S2EA 2W9DH 3POHA 4P05A 2R39A 3K5RA 4GMSH 2LTQC 4S1DD 8FABB 1J0HA 4XRCB 1OB0A 2W9DL 4WW1B 4AENB 4EIBA 4ZFOA 4RQQA 2CSPA 5DZJA 1JVLA 2YXFA 4OLXL 3ROLB 2HCZX 5GRXG 1EAJA 2CKNA 1FRGH 3KYKL 4Q0XL 4W4OA 4ZMZA 2OMXB 3QXAB 2VMFA 1I8UA 4MMXA 4TTDC 4I48B 3HC3H 2A74C 3PWNA 3FYEB 2FE0A 3FU3A 4HG4K 3LXUX 1CTOA 1WFNA 4MAUH 4IMLA 5FYKD 3UROR 2ARJQ 4FI8A 1B88A 1NCCH 2JCWA 2V9UA 3FQTB 3GBLA 3ARGB 2XN9E 3JT2A 3BP6A 1UZ8B 4RMRA 3CHSA 2HJLA 4JY6A 5IJVB 1WZ1L 2YOCA 4N3UA 3FN0L 1N6QH 1JNJA 1RUQH 5IQMA 1MCKA 2FNBA 4AMKH 1YEFH 2BHZA 4KJYB 1NC4D 3E1F1 5BPPA 4G5ZL 1A4CA 3CDGA 1Y6MR 1PG7L 1UUSA 3QNYA 4PP2B 5EU6B 1HCVA 2Y5TA