3B9KA

Crystal structure of cd8alpha-beta in complex with yts 156.7 fab
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
118
structure length
118
Chain Sequence
b'APELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Light Chain
molecule tags Immune system
source organism Mus musculus
publication title The Crystal Structure of CD8 in Complex with YTS156.7.7 Fab and Interaction with Other CD8 Antibodies Define the Binding Mode of CD8 alphabeta to MHC Class I
pubmed doi rcsb
total genus 19
structure length 118
sequence length 118
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3b9kA00
1KN2H 5HDBF 2IALB 3H7LA 1U8LA 5EU7E 2BSTA 1TLKA 4GAGH 2HWZH 3UJTL 5H37H 2R9HD 2HJKA 4FQHA 3ARFA 2OCFD 4H26B 5KAQF 5FM5M 2Z8SA 3C8KA 4PJGF 2X89A 2ED8A 4PJIB 4R97C 2HLFC 1VPOL 4RISL 5DHVA 2DLFH 2X4UA 4P48A 4GG6F 3JV0A 3MV9D 4OFKA 4AG4L 4IHOA 3H3PH 1XZ0B 5D7LE 2PYEB 1K8DB 4PJ9B 1I85A 1LGVA 2ZUUA 1NQBA 3KYAA 4YXKL 2NXYB 2IAMB 4M7ZC 4WHTA 5CP7A 3O9WD 2BX5A 1JPGA 2HG5A 3QXDB 1OP3K 1RULL 5C7XH 3OAZK 2G9HA 2EH7H 1XR8B 1IAIL 5I8CB 2CIIB 3PQYE 4I8DA 3MBEA 5I16B 3QIWA 1KT2B 1EEUA 4FFVD 4WFGE 3IXTA 4KHTH 5GSVA 3QNYA 4NQCD 4KKBD 4EQ2A 1J10A 2W0LA 3EGSA 1KXVC 4PTTB 4PLJC 4HJ0C 3T0BA 1HYSD 1N3NB 3V6FB 5JDSA 1LQSR 4PRHD 5DEFA 4HCRL 3EO1A 3ILQD 3EO1B 3T3PF 5CBEA 4NRXB 5M94B 5J13B 1TCRA 2WWKO 5JDSB 1A2YB 2QKIA 1ZLSH 4WWKB 4P23D 3HRPA 4KK6D 3QNYB 1PG7W 3QUZA 3VXUB 4F9PC 4MAYD 2CKNA 3OX8A 3IRZA 4W4NA 3RTQA 4ONFL 4C54A 1BFOB 1TVBA 2MQ0A 4NDMB 5EU3A 1JWMB 2J6EH 3ETBF 4WW1A 1M7IB 4WFGD 1WC7B 3EYFA 2XG4A 4M3JA 4PJCA 4WHTB 2EDHA 1ZT7A 1B4RA 4NPYB 5ID1B 1DN0A 4M1GL 4PJDB 1OP5H 5H2BB 4TOYL 1IGIL 3RGVB 3DSFH 5J6HA 4JB9L 3OXRA 2FJFA 1Z9OA 3BPOC 3T65B 1DQML 4LCCA 2FJHA 2I5YH 4X99B 3CDCA 2BHYA 4XP6L 4ZOCA 1MCIA 4P46D 3MR9B 5C0EB 1WZ1H 1TITA 2JB5H 4ZXBC 2QSCL 5CHNA 4NQTA 4Y5YC 2YWZA 5GS1A 4LCCC 1QLEL 5IVXE 2GT9A 3QEHA 5C0RL 1S7XB 2BMKB 5D72L 4MQ7B 5CGYD 3L3GB 1IC7L 4OCXL 2DKUA 2MNUA 1EGJL 4YBLC 3UAJD 3QUMA 4TVPL 4JRXA 2IALA 4A6YA 5DEZA 4TVPD 4LARL 1FNSL 4QRQA 3I3EA 2VDPH 2BNRA 4IIQC 4WENB 3GSNB 1LWRA 4ZDHA 1WIOA 4MCYB 2BVOA 3RHWF 4WUUD 3QNZB 3RVXD 2NX5E 1ZA6A 3BSZL 1KACB 3DV6B 4GMSH 5IESL 2ED9A 1VFAB 3TN0C 1DVFC 3EAKA 4X7TA 1UH2A 1JWSA 4EOWH 4YC2C 5IBLD 1OP9A 1MJJA 3QEGL 4PJ8A 1DQJB 2VZOA 5INCB 3ZE0F 3HRZB 3TBWB 1MOEA 5F9WB 4KUZL 2QSTA 4FQCL 3DX6A 5DUPH 1UENA 1S9WB 1T20B 4LSSL 4Z7WF 1NCWL 32C2B 5IV2B 4N68A 2EIDA 4HHAA 3MGTA 5ALBH 3FMGL 5I30H 1OB1B 4H1LB 2BY3A 3S36H 2CK2A 5L7XH 4JFDB 4LQFH 3REWA 4WEBL 3GK8L 3O3BA 5J3HD 4K3DH 1NGPL 1WEJL 3HNTH 1P84K 3RPIA 3RWHA 1S9KC 1FL3B 2H2SC 2GJ6D 2B0SL 4P46B 3TCXA 3SDAD 3O6FB 3MFFB 3GZKA 1SJVA 4PY8I 1RZGA 4LCUB 3VCLB 1AGFB 2DQHL 1RHHA 4FQJL 2VXUH 1QACA 2Z92A 3K8KA 2B4CC 3SY0B 5DK2B 2IQ9H 4DOHB 1WLHA 4KGJA 4FQ2L 2ZNWA 1U8NB 3KS0H 3DV4B 3L5JA 4N8VA 5DLMH 3HMXA 3S34L 1KXTB 3MV8A 4EQ3A 4LF3A 3B9EA 2XTLA 5TE6H 5I1HL 1P2CB 1PYWA 5L88H 1FHGA 4KJYB 3RKPA 5E8EB 3PWPE 5C0JB 3V6OA 1HH6A 3IS1X 2GJJA 2KL6A 3K8MA 4HAFA 1UKTA 5D6CA 3V5DA 3MRCB 2EDRA 2FJGA 2COQA 4JM2C 3MLYH 2HTLD 1BIHA 1IAII 4CVUA 1NGZB 3A67L 3EUUA 4Q9BA 1JMZA 5I17B 5I6XC 3Q48A 3VFUA 1KNOA 2XPGB 3REVA 2MKLC 1UWEH 1NAMA 3UPRA 4HIIB 1V3LA 2Y25A 5HHOD 5IVOA 1FIGL 1PZ5A 1RUML 5F96L 3I75A 3NFSL 3PABA 2YSSB 3ARDB 4KY1L 5DI8B 1LO4H 4IOFD 5K93A 1PJ9A 1CU4H 3DETD 5SWSD 1U8KA 2YWYA 2IAMD 4O2CB 5CWSA 4EDXB 4RGND 1Y6NR 4KKCC 3HC3L 4KHXL 3JUZA 3O3AB 1AXTH 1W72L 3SGEI 1PKQE 3IAGC 2XV6B 4PJ7F 3QCTH 4XPBL 1MPAL 3DGCR 3RGHA 5HXMA 3VDCA 1FE8H 4LSQH 4NM8H 1ZEAL 5IQ7L 5C3TA 3BRFA 4CN6A 2BJML 3I6LE 3QUXB 5ITBL 2XY2A 1QR1B 1MH5A 3MLZL 3OKNB 4L9LC 3BPNC 4NN6B 5EC2B 2JJWA 3AS2A 3FT4B 1AR1D 1ONQA 3AB0B 2AJZA 3QQ9D 3RDTD 5ERWA 1R3KA 3W0WD 4XP1L 4HCRA 1HHJB 3MJ7A 2EDDA 2P7TB 4WFHE 4J8RA 4Y5YB 3B5GA 4X6EB 1OSZA 4XCNA 1NGXA 2ADGA 1ITCA 2QQLL 4ZO7A 3VXUE 3GSUB 3G6JE 4QGTA 5DZNA 1V8HA 2V7HB 3CLFH 4LLYB 3BH8A 2GTWB 3VXUD 3TH4T 2A6JA 1X6NA 3ARED 4Y16B 1T1ZA 5FECA 3AU1A 3M1BB 3V6BR 5SWZA 3WLWD 3D48R 2Q86A 3WXVL 4F33A 4WV1B 1F8TL 2HP4A 3TO2A 3GRWH 3EHBD 3P77A 4CRPA 1I3UA 4OAWB 3OKEA 4NJ9H 4K8RC 4PJHE 4LNVA 4OKVA 2B1HH 2J5LC 5D2NE 1RJZA 3QCUH 4CW1A 3NTCL 3SO5A 4HULB 4PBVC 4RMRA 1IILE 1FV1A 3DARA 2WLYA 3OKDB 4J1UB 4ZNCD 1NGWB 4M62L 2W60A 5FCUL 5H35B 2CLVA 5T3XL 2Y72A 3DX7B 3MRNB 2APTA 5IM7A 1HWHB 4RFNC 2CO7B 3QULB 2X1WL 1LO3L 3G04B 3WEXA 1H3GA 5I2IA 4XVTL 1YEGL 1IQWH 1GC1C 3PWLA 1OARH 4X4ME 1KCVH 2QSVA 4PJAF 1OTSC 3X13B 2X05A 5CJQH 2A74A 2AQ1A 5C0JA 3X11A 3MGAA 2R0ZL 4RIRB 2CK0L 4G8GD 4Q2ZB 4WI5A 3CFDA 4GG6B 1D9KD 1K5NA 2J8OA 5CEZL 5JPNA 1KBGL 4HS3B 1DL7L 1OF2B 3PWJA 1MUJA 4R4NC 3QULA 2L7UA 5JHLH 1P7KA 4FQ2H 3CZJA 1JGLH 1FRGL 3OKLB 4OZGF 1CFBA 3D3VE 4ZSOB 3U9PL 2IH1A 5KTEH 1HHGB 1U2CA 1P84J 1PSKH 2NY3C 1EXUB 2XA8H 4OKVB 4HGMA 4QHNA 4JFDE 3QXVA 4G8GE 4YO0B 4X5WA 4MJ4A 3OF6D 4PR5B 1BD2B 1ZGLA 1KG0B 5TQ2L 3NZHH 1FL3A 2D7PA 4CGTA 3V8CA 1ZHNB 4LPUA 3MRGA 4K7FB 4Z7UB 2P7TA 1HHJA 3MJ7B 4D8PB 1J9CT 4JM2B 5DJ0B 1MAMH 4ODSL 3IB4A 2HLAB 4JFOA 4JFQB 5AWNL 4ZYKA 5ACMA 1MREH 1XF5B 5T1MA 5SWSB 1KF9B 5B4MC 4ACPA 5F1IB 3KPMA 1N8ZA 1N64L 2ZG2A 2VSDA 5C0DB 2DLTA 3CUPA 5HYJB 4KFZC 2VZUA 2P42B 2Q7NA 5IVZB 3EOTH 4PGDB 1XGPA 1D6EA 5HD8D 3P9LA 3FT4A 4PPTA 4TN9A 1D9KB 4RMSA 1VESA 2X4TA 4C56A 4LVEA 5EN2A 4MJID 3MBXL 1IC4H 5GGVH 3QNZA 1JIBA 2XZQH 1UZ6E 3GK8H 2P24B 5I74B 1FFRA 5DD0H 3FO2A 2B4CL 1E4XI 4GKOA 1HKLH 3OTTA 2DB8A 4S1SL 5C0BE 3O41B 2DL9A 3C9NB 5HTSA 2P47B 2HFEA 1JPSH 1IGJA 5GS0C 4OD3H 3U9PH 1YPZF 1JHKH 3IF1B 5DJCA 2F58H 1MCCA 1Q72H 2UZYB 1WWCA 4PS4L 1CS6A 1CGSL 4MNGA 5C09B 5C2UB 4JB9H 5HPMB 4JCLA 1CE6A 4F2MA 4NQSA 5CD5D 4G8IA 4OQ1A 3ZE2E 3QQ4A 1UB5A 4Q6IC 5A40E 5ADOL 1QPPA 5BV7C 4BFGA 4PRIA 4P57B 4WU7B 2XOTA 5C0GB 3TIEA 2YUZA 5D72H 5ESVB 2AQ2A 2K7PA 3UJIL 2WK2A 4NFDA 3PJSB 4JQVA 2CUHA 1IKFL 4LIQE 4U33A 4AIZB 2JK5B 3E1F1 1PG7H 4XVSH 3QO0B 1QBLH 3ILPB 3BH9B 12E8H 3MV9B 2KBGA 2ITDB 3MV8B 3MRIB 1NMAL 1WWWX 2KKQA 1LEIA 3VW3H 1LO0H 5F1NB 3MLTA 5HHMB 4WI6A 2HTKC 3RBSA 4HXBL 4X4ZA 4HK3J 2E6PA 4OD2B 5FGBA 3CDGA 1BZ9B 1JMXA 3QH3A 2VN7A 5HPOA 1JYNA 5AZEL 5DA4A 5DTFA 4YAQA 4D9LH 5E08H 4KZEH 2P5ED 3BMWA 3VWKB 2H9GB 4PGCA 2EH7L 1J8HD 1QRKA 4XMKH 5C09D 5D1ZB 5IV2A 3TVMD 3LD8B 1WFOA 2VSCA 1ZHKA 4NFCA 4S2SA 3WFZA 1QVOB 4LP4A 4H5SA 1AHWC 1U8OB 1A7NH 1KTDA 3MV7E 4OZIF 1FZOB 3UTOA 2ERJB 5GS1C 3LKSB 3VFTB 4F7PA 2IC2A 4O4YH 4Z7WE 1EAPB 2RJMA 4M6AA 3W9EB 3FHAA 4M00A 2HT4C 3MACH 1VFAA 3IFLH 4Z78B 5ALBL 1TNNA 4ODVL 3SE3A 1TTUA 3H9SA 5D8JL 3WIFA 4YDKH 2G75A 3EZJB 3TGXA 3TBWA 3QB7C 4MCYA 4WFFD 4LGRB 2HTKD 2HJLB 4QRQB 5DJDA 1MCWM 1U0QA 4E42B 3NCBB 1FDLH 2H32B 4X6BB 2DQFA 4LCYB 3RZWA 4GW5A 2HJLA 2DQIL 3BUYB 4R4FH 4GMTH 3TFKD 4J7RA 3DRTA 1YEHH 3UEZA 4HAGA 3ZYIA 5I1GH 5CHNB 1XF2A 4GG6E 4XVUD 5KZCD 2D7TH 5ITFA 1ZXQA 1ZLVH 1R5VB 4PJGE 3PG2A 4OZ4A 1AD0A 2AVGA 3QYCA 4LLQA 3F5WB 4XPGH 1EAPA 5E56A 1BMGA 2BMKA 4ZAKC 5EIIA 1A3RL 2VZVA 1RZ7H 4S1RL 4XPTL 3ZTNH 4PIRF 5AUMB 4UIMB 3AM8C 5E2JA 3BGFB 1E6JH 1IRAY 2V5YA 1B6UA 4F8QA 3E2HB 4GMSL 5IESH 1KN2L 1G9EA 4NZRH 4Y5VC 1T83C 3AXLB 4PB0H 5DJXB 4O2EA 4FNLH 5IB2A 3U7WL 3MREA 2DYPA 1GHFL 4K3EL 4FTVE 1ACYL 5IR1B 2OR8A 4PJ9D 2NNAB 3EYSL 5KOVC 5GPRA 1A3QA 1D5XB 4WWKA 3VFWA 3FB6B 3HNVL 2NY6C 1P9MC 1CXKA 3MLTB 5I73C 2CO6B 4BK4A 4M03A 5CEZE 2J6EL 3UTPE 1DFBL 3O6FD 2BRRL 4WGWB 3ZDZF 3OX8B 4H25B 4YK4B 5EOCL 3WD5L 1BREA 3U82B 2B2XH 3G6JA 1EBPA 1DEEB 1RZJL 3ZL4L 4JN1L 3V5KA 2APVA 1MCSA 3EGSB 4AMKL 4YR6A 4FQLL 2YD5A 5IVXB 3MUGA 3G6JB 3ZT6A 3MXVH 3MRPA 5C2BH 1QKZL 1G7MB 5CEZD 4Y8DC 4MNGE 2YKLH 1P1ZB 3O8XC 2OZ4L 2NCMA 2VIRB 4P4KC 4PRNA 5DQJB 4YDVB 1BQSA 3JVGA 4J3OC 3MV8D 2NNAA 2NW2A 1G7HA 4WFED 3EIFA 2H26A 4GSDH 4POUB 1MRFL 5GSRB 4PD4K 1ETZA 4DFIA 5JOFA 3ELAT 5HGHA 3QI9B 4LQFL 2JELL 5L7XL 2LE9A 1QA9A 1P53A 1IGFH 4R26L 12E8L 3BD3A 4PJXA 3K74B 4U4BA 1RHFA 4NWUL 4JVUA 2G5BA 2CDEB 3OAZH 2BERA 4OIAA 4A6YL 3GBNL 1GGIL 3QDJE 3X14B 2NY0C 1P4IH 4NO2B 4K07A 4Y4HA 3BKJL 3LKOA 5GGSB 4Y2DA 4K3JH 1TJIL 3UYPA 3BZEB 1HWGB 5JOPE 3NH7H 3S5LG 3VWKD 1IGTB 1ZANH 3UTZB 4XVJL 5E5UB 5IHBA 2DQFB 5I9QC 3P9LB 3FQWB 3DJ9A 2DL2A 4FQXA 3BOVA 4IJ3C 2SEBB 1KJ3H 3HAEA 3QHZH 3CGTA 4DGIH 4PJIF 1MFNA 3VXSA 4AH2A 3AFLA 3D3VB 2EYRB 2X4QA 5IB1B 1BQHG 1H3XA 3HA0A 2Z31A 2YD1A 3WJJA 4FQQA 4BQ9A 3KG5A 4NCC1 1KCRL 2A77H 2D31A 1Q9LB 4HMEA 4CNIA 4P2QA 4AK1A 3SDXE 4IRJB 5I76A 2H9GA 4PGCB 4QHUA 4FQXB 4KQ3L 3KLDA 4L4VE 35C8H 3S5LB 4MA8L 1IM9B 4Y4HC 1I9EA 1G0DA 5HHNA 2AJXL 3V79C 1EK3A 4MJ5A 2MTPA 1BX2B 2FWOB 5LXGH 5EBWA 2V2WA 4MB4A 3WN5C 1T1WB 4CKVX 4Z7NE 5JIKA 3N9GL 5TDNA 1IAKA 4QOKE 5BXFB 3MOBH 1OGAD 1IL1B 4JY5L 3SDAB 1FFNA 4QTIL 4OZFA 3QDMD 1OM3L 4KV5F 5EU7C 2EXWD 1BIIB 1GSMA 1GAFH 1INDH 3AUVA 2VAAB 3P9WB 4TULL 2JK5A 3N1MC 2JE8A 2UWEF 3RZCB 1QTYT 1S7SB 2DD8H 4XHJD 1ZSDA 5TQ2H 5DO2D 1FL6A 5D2NA 2HVKB 3KDMA 4NQDD 3CVHA 2H2SD 3IKKA 3ZKMC 1KXQE 4MB5A 1QFWM 4R96A 1QSVA 3IJHB 3B9AA 2BSRA 1X5ZA 2IFFL 3MLXH 1JUFB 2FIKA 2K3TA 3O8XA 3V6ZA 2NY6B 4O2FA 3VFMA 4YFLI 4CVXA 1E0OB 4LCWD 1I1RA 1N6QL 1I1CA 3KPNB 2G5BB 2FO4A 3TT1H 1RZIA 4OZIB 4OI8A 4WUUA 4Y19A 4DVBB 1QUNA 4MXQC 3IAPA 1OTTC 1KUMA 1KCKA 2W0KA 3RPKA 3HLAA 1A14L 1MI5B 4FHBD 1MCHA 3VFRA 1ULVA 2EDYA 3IT8D 5IMOB 4KV5E 1OARL 1KENL 4ETQA 1SYVA 3LB6D 1G7HB 3AGVA 1ERNA 1SHMA 1XH3A 3IVKB 3BKYL 2QHLA 3CMOL 5IB4B 3U1SH 3WUWB 5F21B 3P30H 1KB5H 4HKZA 4QWWD 1JPSL 3K2MC 4U1MB 3TJHC 3UMTA 5D2NB 3IJYA 3LHPL 3ES6B 1CLYL 4HDIB 5C6PB 2X4SA 3OKNA 3C6SA 3ZHLA 1QR1A 1GPOL 4PGDA 5DEGA 4O2EB 2HN7A 3D39E 4X6FB 5C0DA 5FYJH 5IBUB 4P5TD 4ODHH 5AAWA 1VENA 3U4AA 4NKMA 1T6VN 1J0HA 2BVPB 3ARGB 1UM6H 1A6TB 2H45A 4F7EA 3G6JF 5AG9A 1F6AB 5DJ8A 1UG9A 2AI0L 5DR5H 1LD9A 4LHUD 2V2WB 5EBWB 5I19L 2VERN 3MV7D 3F58L 4RGNC 3F5WA 3OJ2C 4R8WL 1F6LL 3WN5A 5CWSB 1LK3H 3MJ6A 5CINH 2APXA 5KSBB 1K2DB 4FFVC 1D3CA 1CLYH 4BSVB 1FFOA 3G5XA 1II4E 2BY0A 4KKBC 1KJ2L 3MFGB 5E9DE 5AZEH 3D5OF 1JFQH 4UZGA 3FN9A 1N59B 1NDMA 2NXYC 4M7ZB 3WUWG 5IWLA 3VXQB 1UA6H 5HJ3B 4FFYL 3NABL 3BIBX 4APQD 4M7JL 5IJKA 3X3FL 4BQ8A 1BM3H 1LE9A 1RZFL 4L3EB 1A4JB 1MQKL 3BO8B 2ZOKA 3T1WA 5L2KA 43C9A 5EIIB 5EOQL 3GSVA 1OD7A 2NTSP 3OAUH 1ORQA 2XN9B 2YR3A 3M07A 1OSPL 2IPKA 2Z31C 4C4KT 2AS5M 4H20H 3LKPB 4JO2H 2EEAA 5IVXF 2WZPD 4F37F 1H5BC 3AREC 2AGJL 2ARJA 3LD8C 1P2CA 1PYWB 5KS9A 1YEDB 3O11A 1T7ZA 5HGDA 5ICXA 2QADC 2PR4L 3ROOB 2HH0L 2QL1A 3GMNB 2I25N 5I2IB 3V4PH 5D5ME 1JTOA 4IRZL 2LVCA 3QNXB 2EDTA 2J2ZA 3RY6A 1UEMA 1HIMH 4G9FE 5A2FA 1RFDL 3U48A 1CLOH 1CF8H 3C2AH 4Z0XB 1RZKC 5HYJE 5IKCB 5L9DL 4OKDA 2P5WA 5C70A 1V5JA 1KELL 4JDZB 1YMMB 1CGSH 4D9QE 2JLLA 5E0QA 1U3HD 1AGBA 3MNZA 4IMKC 5EORL 1R3LB 3LY6A 3CFEA 4GRLB 2VDQL 4H5SB 3VJ6B 1RUPL 3HUJE 4P2YA 2VLLA 4F33B 3FTGA 3L95A 3QO0A 4XX1E 4KVCH 4WUKH 4DKAA 4JPVL 4N5UA 2EZ0C 1OB1A 3PGFL 1HIML 2IJ0C 4KMLB 3VGHA 4G6MH 4EI6B 1CT8A 1KYOK 4PG9A 5D1QD 1T04A 4TSAH 5ICZA 1ZVSB 4HC1H 4U05A 5LG1A 3RWFB 4AY0A 3VI4F 3MRHA 5F1NA 3EJJX 2P8MA 3L3DA 4YHMH 1CGXA 1EX0A 1JGUL 1DQQB 3B3IA 1MIEH 5CEXB 5SWZD 3K8LA 1BVLB 5DJZA 4XWOD 4G6KL 5D93B 1HKFA 1C1EL 2PYED 1MSPA 3MRRB 3FO9B 4Z95H 1NBQA 2X4NB 1T2XA 3V6OC 2VISB 1U3HC 1R3IL 4PG2C 3UTQB 1CD0A 3EBAA 4LDOB 1NGPH 3HNTL 4K3HA 3K4DA 3KAAA 5EOQH 3A6OA 1I1FB 1MF2H 2AJYH 4B5EA 2H8PB 4S1DD 4HLZG 1ORSB 4X0KA 4NC1C 4NQEB 3FB6A 3BKMH 4X4MA 1CDHA 5I1DB 3CNKA 4YIQB 2AJ3B 1YYMH 5ETUB 4IOIA 4OJFL 3IJSA 4HFUL 4UDUB 5DQDL 4OBSA 3GBLA 1CE6B 4KRPB 3X3GH 2WLZA 1GCFA 3TT3H 3OHXB 4HIHB 2QR0B 4NNXA 5E08L 4KZEL 5JW4N 5SX5K 3O0RH 1VDGA 1BFSA 1HK6A 1HQ4B 1DBKH 5EN2B 1IEHA 4PB9L 5EU6A 5JXAH 3I50H 1YPZA 4ISVB 5E00A 1QSED 2AV7A 2X9XA 4NC0B 2YPLD 3F7QA 1ZT1A 5GGUA 1MI5E 5BV7H 1JHTB 1FAIH 2BRQA 2IANB 5L9DH 4ONGL 4P5TA 3C60A 1N6VA 4POZC 3S96B 5DD6A 4GKZB 4JM4L 2BC4B 3S37X 1T7XA 5DO2C 2CRZA 2RFXB 4JREC 5ETUA 4AJ0A 5J13C 5KSBF 1HH6B 3VFOB 4GQ9H 1TTGA 4CN1A 3ARRA 1CN4A 4JO3H 3QO1B 4L4JA 2VLRB 2DM3A 4QHKJ 1P7QB 1QSEE 1BQHA 4WFEE 4N8VB 5JXEA 1CICD 5IBTH 1AGBB 1RUAL 2UY7A 3ILQC 3QFDB 1EXUA 4LMQE 3H9HB 1MHHA 2YOCA 5HHQB 5LXGL 3UTSB 4E0RB 3R06A 3E6FA 5D2LE 4KJWD 5LVEA 5IEKB 4CU6A 1BJMA 3L5XL 1NANI 1EUUA 1CVRA 4NOBA 4P5KA 3L3DB 4MX7A 4LSUL 2P8MB 3UZQA 3BT2H 1OCWL 4LLDB 5C6WH 4AYFA 1EMTH 2UZXB 3PIQB 1JRHI 4JN1H 2HAZA 1X5XA 1NUFA 1F4YL 4ZS6C 5BRZD 1MRDH 3MNWA 1C8PA 4WEUD 4PV8A 3T4AB 4ZXBB 1N2RA 2VXSH 4JY5H 3W5MA 4MX7B 4B53A 4PJGB 3F65A 4JKPH 1A8JH 1XR9A 3FTGB 3RA7H 5BMFL 1HHGA 2XTJE 4DN4H 1OWRM 4OLWH 1U8PA 3QWOB 5DRWA 2PYEE 3EDDA 5D6DC 1KB9J 2N7BA 2YZ8A 4LVOB 1MFAL 2A9NH 4P2OA 1DUYA 1J12A 5CS7A 4L4VD 5BZDB 1TJHL 3PP4H 2OLDA 1UM5L 5DGQA 1DQJA 1I9RH 1KPVB 1N7ML 5E8PB 3GMPA 4J3XA 3FB8B 1WAAA 1J5OH 1EDQA 5I30L 3UPCA 3CDFA 4B7IA 3FMGH 3MCG1 2PW2A 3VFNB 1PX4A 2BVOB 3MO1A 3BZ4A 2XQBL 5KW9L 4P2RA 5DDHB 1IC7H 5B3JE 5GRJL 5AG8A 1LP9A 4P9HH 2EDQA 3JTTA 4B7LA 2WBWB 3QPQC 3DX8B 3HPLB 5JR1H 2ZCKH 3QQ4B 1NUDA 1CK0H 4J1UA 1LE5A 4PGZA 4RWHA 4XXCA 5C07E 4JO4L 1YQVH 3VGAB 4JZNA 4Y2DD 2JIXD 4CN4A 4JFEA 2FX7H 1FNSH 4MNGB 4WFFE 5EBGA 2A77L 5FUZL 3P4OB 3SDCA 4BSVA 2JELH 4KROC 1YQVL 1UZ8B 4JZOB 3DVNA 2Z31D 4P3CL 2CLZA 4FS0A 5HJ3A 1IZKA 1I3RB 3AU1B 3M1BA 4ALAH 1J1OH 5CSZA 4DEPB 2Q3ZA 5DVKA 1BEYL 3E8UL 1IT9H 1YN7B 3TVMA 5CJXC 1B0RB 3SDAC 2NR6D 4JVWA 5D7IA 1UH4A 4K8RH 3SKMA 1OSZB 2XICA 2R1XA 4TOYH 3EYQD 3QWQB 2PTTA 5DD1H 3MUJA 1T5XB 1A7PH 1VGKA 1ZVYA 1S7TA 1MRDL 2GFBA 3WNNA 1IQWL 3GI9H 4V1DA 4UT6H 2RHEA 3SCMD 4PRID 3GSNH 3SO3C 1J0IA 4WUUB 3P4OA 4FQ1L 4EUPG 2XYCA 4XTRD 2CJUH 1X5IA 2NLJA 3MRFB 3QDMA 4ZFOL 5DJ2B 2X4SB 2J4WH 2I9TB 3FQTA 1I9IH 2YD9A 4LGPB 3AMLA 2J8HA 5DUBB 3QCUL 2C3VB 2X7LB 4R26H 3QG6B 3WUWA 2FZ3B 3DMMB 2GKIA 1RZJH 3ZL4H 2EZ0D 4TQEL 3D6GA 2KH2B 1FVCA 4L3EE 4X5WB 3SGDH 2X1PA 3KVQA 2BXZA 3UTPD 4EUPH 4MXQD 1JZ2A 3VFRB 1JCKA 4Q7DA 3CH1A 5DUPL 5F44A 4BZ2H 5B39A 3QEQD 1AQKL 2AJXH 1J0JA 4OFPA 2BSRB 2ZCLH 5F7EL 4NN5C 1T6WA 4FXKB 1DUYB 4P4KD 4OCMC 4PGBA 3WFEH 1T0MB 4R0LC 1QSFD 1CFTB 3EDEA 3QZWA 2DLHA 4R2GC 1NKOA 1KJ3L 2DLIA 2OL3A 5D5MB 1F4HA 4M5ZH 1F3RB 4QHMB 5E70A 4X7DC 1U92B 2CUMA 2YHGA 3DXAA 3HMXL 3TJHD 1VPOH 4KC3B 4RISH 4JR9H 5E8NB 1KIPA 4XBGA 4ZUWB 3TZVD 4F3FA 5E1HB 3O6FA 5C6TH 3HE6A 5GGRB 1YYML 3KNBB 4HIEB 3Q5TA 1RJLA 2LAGB 2D4DA 2PYFA 4QOKB 4EBQH 1VKXB 2HVJA 2JF1A 1YEIL 2OZ4A 4CADA 4C55A 2FX9L 4YHYB 3MLRL 3OXSA 1QEWA 2E7LA 3P4MB 1GZQA 1ZMYA 4NRYA 2DM2A 2VXTH 1MAKA 4I3RH 4MS8C 1KPUA 3I50L 4UNTA 3LMJH 5JW3H 4UT9H 5EZJA 4Q6YA 3WCYA 1MY5A 3DX6B 4NO0D 3VFPA 4YPGB 5BXFA 3F62A 1RK1A 2KZ1B 2X4PA 1Q0YL 3B4NA 5INDA 4K23L 4Y19E 4XP5L 3OKEB 5IW3A 1UWGH 1P69B 1T2JA 4P46A 5TFSL 4JKMA 4HWBL 4CNIB 1AO7E 5BS0A 1PFCA 2D31B 2YPLA 1Y6KR 4EUPA 3OSKA 5SWZB 3QO1A 4CJ0A 2AK4D 1Q38A 4H1LA 2BOBA 4IRJA 2XTJB 5FHBL 5K59E 4OGZA 5ECJE 2W9DH 2BC4A 5EPMB 3BI9X 5K9JL 3MROA 3PGFH 1NGXB 2ADGB 4HFWB 3SKOB 2C7UB 1GZQB 2EDNA 2WW8A 5CJ8A 2YD4A 2FEDD 1R3KB 1BQUA 2B39A 2EDWA 4N5ED 3CFKB 3UTSD 4ISVA 3VXRB 2VDQH 4HH9B 3I6GA 4GBXB 1OPGH 5E8OB 5JXED 3SEPA 1EEQA 5AYUH 2C3XA 4LPVA 1BZQK 1BF2A 2BNQB 3MRLB 1EGJA 2WUBH 3O2DL 4L3CB 2EE6A 1CLZH 1ETZB 1LDSA 3KPLA 5FGBC 1BOGB 5KVEL 2FD6L 2PUQT 1CR9L 5KVFH 1JN6B 2R2EB 1DL7H 4A6YB 3N85H 5IUSA 4L9LA 5TDPB 1MVUA 5HVHC 3RZCD 3MRJA 3RNQA 3RQ3A 5C7XL 1YY9C 5IMOA 5IOPB 1A6WL 2HKFH 4N0CC 1TZGL 2AEQL 1VEPA 3FRPG 4X98A 4DK6A 1PZ5B 1PGRB 3TO4C 1MWAH 5LGHH 1A21A 4LAJH 4OD3L 5T1DH 5JOFB 3UJIH 1H8OA 4YDLB 1F3JB 3ZDYF 1SJEB 3RVVC 4GBXC 5MEOB 1WT5C 4R97B 4GW1A 3GFUA 1CF8L 3C2AL 4YDVA 2FIKB 1QA9B 4LBEA 3O3UN 1J8HB 2O26U 3MQIA 3HI1B 3MUY1 2VLKB 1ZGLP 3WXWL 1DLHA 1L7IH 2DMBA 5D6CB 3V5DB 4PYGA 5C0IA 1S7WB 2NW2B 1FH5L 4OLXH 3QISA 1KJ2H 3TA3A 2XA3A 1YYLL 4B50A 5H94A 4AG4H 3EOBB 4RBPH 3IETA 4S1SH 1RZ7L 2VLLB 5B4MD 2OXHA 2FX9H 3QPQD 3ARYA 4GW1B 4U1NA 2EE2A 3UTSE 4JFPA 3TH3T 4AT6A 2ZOLA 1NFDE 4WW2F 5EU5A 5HVWA 1BBDL 3HPJA 3GIZH 1MCEA 5F8RC 4O51B 1FYHB 2DWEB 4FQPA 4LLQB 5A3ID 4N0RA 1NCDL 3INUL 3NAAH 3U2SB 3L5WB 4MA7H 4JFZL 2R8SL 5JHDD 1S8DA 1XIWD 1L9NA 2FRGP 3OB8A 2GK0B 1WJ3A 2D03H 5KSVA 3ISWA 5K9OA 1CXIA 1EHAA 4W68A 3Q6GL 4X83A 3T04D 1Q9LA 3QCTL 4JE4B 4XPBH 3ZKXC 3KYMA 1UZ8A 4JZOA 4XC3L 2PYEA 4MLSA 3B9KD 2B4CH 5T1KA 5HYFA 2FATH 3RIAF 1UACL 3KXFB 5GGVL 4FMKA 1LE5B 2QHRH 4J3TA 3T77B 4LK4A 2DS4A 1ES0B 2I07B 2UVFA 3RVWC 4XTRC 4XMKL 1ES0A 3QUZD 1AD0B 3ZLQC 5ESAB 5HHPA 2V9QA 1RUPH 4U6HA 1R5VA 5I8EA 3QCVL 4M1CD 3SGJC 5DHYA 5JO5B 2P1YA 5D5MF 4DVRL 3D85B 3HFMH 1AFVH 1J0YA 3SE8H 4I9WE 4XI5D 1FAKT 5A2JH 1NC2A 3CMGA 4W4OC 3WS3B 1A7RL 1MAML 5JO5A 3KYMB 4DFHA 4ZO8A 3V7AG 1PY4A 2F8OA 4NGHH 3ULVC 4DZ8A 1G0YR 1U9KA 4OIIH 4OD2A 4JFFA 4LLVB 1IARB 1IAIH 2P4AB 1RFDH 5BVJB 4DKFH 2IADB 3FN0H 3IDMB 5GRUH 4FFWD 2F15A 3LCYA 3AROA 5KSVB 4RDQG 3TO4D 4KDWA 5I1JH 2XZCL 1MEXH 2YA1A 2M8XA 4UOJA 1WAAF 4LDLB 3V4UL 2B5IC 3C6LC 2HT3D 4JGJA 4JRYE 4Y4KC 1FSKC 4GRWE 5T1KB 5CCKL 5BOPA 5GSRA 2AABL 2B1AH 3ARUA 1W0WA 1ZT7B 2HVJB 2ZOLB 3HHRB 1DR9A 4G5ZL 3EYFB 4S2SB 4HKZB 4R2GD 3KNBA 2FSEB 4M8QB 3GBML 4HZLB 4NDMA 3FFDB 1K3IA 3IETB 4Z9KB 4JHWH 3GJFB 1A22B 4HEME 1XF1A 3VMNA 1ZWIA 1EERB 1S7WA 5C08E 3WUZA 3L5WA 2B1HL 3G5YB 2AP2A 1MHHB 2E9IA 3J8F7 1I1AB 2IF7A 3HI1A 5IHZB 2FLRT 2FB4L 2DQCL 1J7VR 3HMWL 3MOAH 4I2XA 3RTQC 1E4WH 4OM0L 3FT3A 5FM5O 4X98B 2L0DA 3D2UA 3BYYA 4L1DA 4W70A 4WTWA 2AV1A 1U8MA 3A6CL 1HILA 1UKSA 3C6LD 4Y4KD 4QY8B 4OF6A 5C0AE 1EEYB 1G7PA 1S9XA 2NZIA 4KRLB 1DBML 1JN6A 2VLKD 2PF6A 1MIEL 4UTBL 2VLJD 1FP5A 1Z6JT 4KKAD 4P2OD 3MV8E 5F7HA 4LQ1A 4LPCA 4MJ6A 4EN3D 5E8OA 5HVFB 5F3BA 5EOCJ 4BK5A 1UB5B 4JY6A 3QEUB 5FHAH 1CG9B 1FE8L 2YC1A 3KYOB 3QIUA 4JG0L 4LSQL 4M9PA 4R9HA 3P3YA 4TVPE 3DUSA 3ARBC 4L3CA 1RUAH 2ZUSA 3CUPB 2R4SL 5HYJA 2AJSL 1QFUH 4NGHL 1ZTXH 4OZ4B 4JHAL 1N5AA 1S78C 4TTDD 4RZCB 3IF1A 3M8OL 5FAAA 3PV7A 5A16A 1F4AA 1OOAA 1IGJB 1BGXL 3SDCD 3FZUD 4U1IB 1FCGA 3BUYA 3BAEH 2C7UA 3PWNA 3ALPA 3SKMB 1IGFL 3CSPA 2I24N 3MROB 4R4BB 5EWIH 3UBXA 3S5LA 1BOYA 4S1QH 4YBLB 2YS4A 2J5LB 2WMPA 3KPLB 5CJQL 5C71A 1QBMH 3ZKXB 2GSGB 1I7RA 2NW3A 2NTFA 2ZWLT 4ZODA 5L8JB 4DGVH 4D3CL 4QXTA 3X12A 4LSVH 4DZBB 1A1NB 1QRND 4QTHB 3RHWK 3K2UL 5FO8B 3MLWL 4EUPB 2IH1B 4XNUL 1MLCB 2OZ4H 3UTTB 3O2WH 1XCQB 4OGYL 4F15B 1A6AB 3L9RA 3MLXL 4AL8L 3W11C 1AD9B 1MEXL 2YD2A 5LQBH 3FB7A 3VRIA 4NO3A 3G6DH 4L9DA 1BD2A 4LPYA 5D1ZA 3GHEL 4JFOB 4K7PX 3P4MA 5E99H 4ZQKA 4C58B 4LAQL 4C59B 1ZLWK 3ARDC 3FN3A 1ZHNA 3QFJD 4P23A 1QBAA 3I6KB 3DUUA 3LRGA 3QH3B 1RZ8B 4OLZH 1G7IB 1RJLB 3OPZL 1KG0A 2ZKHL 1IGCL 4FXKA 4M62H 2CMRH 1T03L 1T3FB 4F3FB 2NY5C 5E8NA 5J56B 4GXUN 5DJ6B 4YHNB 3FHQA 4H1LH 3UC0H 1A6ZA 4KTDL 5FUCE 3B9KB 4OCNC 4FABH 3OR7A 2ITDA 1X7QB 1X7QA 2VDKH 4NRYB 4NNPH 1U3ZA 2OR9H 4GRWH 4M6MH 4WO4D 4QOKA 4UAOB 5DK3A 4ZUSB 3LKQA 1U41A 3EDFA 4A2MA 1DZBA 2J8UF 3D69B 4JO1L 2IPUK 1XIWC 4OD1L 1X6LA 3PHOA 3L3KA 2M26A 5FECB 2BXYA 4PJ7E 3GUTA 5C0NC 3T4AA 1K3ZA 2OTUA 1EHXA 1B90A 5HHVL 5T1LB 2NY1D 2VWEE 1EJOH 4YNYB 5D4QA 4PJ5B 4I3RL 1W0YT 4ELKA 2CSPA 1QLFB 5EU4B 1FH5H 5KS9F 2ZOKB 4BH8A 1A4JA 2XI9A 3BO8A 3TWCL 3ULVF 4YQXL 1HOCB 4DW2L 1NGWA 2UZIL 5IVXA 4F80A 2V2TA 2AW2A 1I8KB 1QG3A 1K4DB 2A6JB 3FQUB 4OQTA 3U9UB 3QDJA 3OGOE 3TNNA 1U3YA 5D96B 2WP3O 4UAOC 3KPSB 1K2DA 1G7QB 2FHBA 2WBJB 4U0RB 5TE7L 3VXME 1PEZA 1C5CL 3ZE1F 2VXQH 1N5YL 2GFBB 1FLRL 1S5IL 3PWPA 4Q9CA 4G8GA 4GKSA 1YECH 2VL5A 3T0EA 2UUDK 2R1XB 2OP4L 4H20L 1W0VB 4HJ0D 2C1PB 1HYSC 1IFHH 4F7EB 3MREB 4XP4H 3O2VL 3OG6B 3OKYA 3QDJB 3FQUA 2HKFL 5FOJA 3U9UA 4UILL 3CK0H 3RUGA 2JJVA 4U3CA 5I74C 1FC1A 3BEVA 1ZT1B 4Y1AA 4KROD 4JY6B 5E6IC 4U7SA 1CLZL 2FYYA 3K4ZA 5F7DA 2IEPA 4HLZH 4P2RB 1FO0A 3LPGA 1E4JA 2BVTA 3UJJL 2AEQH 2VOTA 3D25A 1CFSA 5IB3A 3C5ZD 5SX4I 3OB0K 3L1OL 1DUZB 4WHCA 3U6RB 4HUWA 4ZSOA 4NOFA 4WDIB 4MA8H 3LKQB 4XNUH 3TF7C 1IBGH 4XWOC 4M7JH 3QJFA 1TDQA 2VQ1A 1H0DA 4OZIA 2R0WH 1OLLA 5DHVH 2PW2B 3VFNA 1MUJB 4I3GA 4F15C 4GLRI 2I9LB 3B9DA 5IHLB 1FNEA 1B9ZA 1E4KC 3QWOA 4NHCL 3TPKA 1CD1B 1ADQL 4Y8AA 2H3NB 1AO7B 1Q0YH 5B8CB 5IG7A 3PHOB 1Q9OA 1T3FA 4YEEA 2VABA 2O61A 4PV8B 4U1SA 4P2OB 2RR3A 4F9LC 3KR3H 1FCCA 3IS0X 3PIQA 1KENH 3MRDB 1CGVA 5L8LB 5CKAA 4QWWC 4KUCF 4ZFOB 1B4JH 3ZDXF 4QHLA 3O81A 5DF0A 4KMQA 1IAIM 4RMTA 2MMXA 1FFNB 2R0LL 3D3VD 4JJ5B 1I1AC 2C3GA 4PJEB 4ELMB 1K9TA 3VE0A 2VITB 3OZ9H 3MFFA 3MJ9L 3PHSA 3H3KA 3OKOB 1EJ6A 4X4XB 1UEYA 3CMOH 1JWSB 4LLVA 1CXEA 3RPIB 1F58L 3RWHB 4U6YA 3V9FA 2E7HA 5HHNB 3MV9A 2VDPL 4UV4L 4HUXA 5F88A 2ERJC 1AC0A 3G9AB 4QHLB 4KWUA 4Q6IB 4F58H 1DANU 1ZT4B 1RZGB 4M4RA 3FFCE 2YPKA 2CR6A 1WIPA 4KDTC 2GSGA 3GNML 3A6CH 5GS3A 3RNKB 1I4FA 4HGKC 1IGYB 3WLBB 4GAGL 1NGYB 2CLRA 3S37H 2G2RA 4D9RE 5ICXB 1GIGH 1AJ7H 5HGDB 1AD9A 1CBVH 3NA4A 1T1YA 4ODTH 3TT1L 3UTTA 3LQAL 3HUJA 5D1ZC 1MLCA 4PRPD 1YPZB 3Q5OA 4GOSA 4I2XE 3WV0A 2EYRA 1A1OA 2X4QB 5HHQA 4NQSB 2IPKB 5K33A 1SBSH 3WIHL 5DD6B 5DJAA 4KPHL 3C09C 3WFDH 3S35X 2NTFB 3T65A 5EBLB 1ORQB 2FJFB 2VLJB 4HXAH 4O9HH 5JW4M 1RQ5A 5LCVL 3Q6FA 4FQIH 4LVHB 5FXCH 4ONFH 3IJSB 4G5ZH 1QSZA 2EKSB 1TENA 1SYSA 2HT2D 2WUBL 2DBLH 4U1IA 1D9KC 1CDJA 5EU3B 2GT9B 3BZEA 4K7PL 4Z18A 4PRDB 1M7XA 1FO0B 4M5YL 5F9OL 5I1JL 2AERT 4O02H 4HIIA 1VADB 4P5MB 3W0WE 1X4XA 4J3SA 1XFPA 2BVPA 1DQQA 3D2UD 1M7IA 4Z76B 1KLFA 3HZYB 2VR9A 3BPLC 3VWJC 2EEBA 5FUOL 5IHZA 1M1SA 3RWFA 1G6RH 4K9EH 4DQOH 43CAB 3ZYOA 5ABDE 3ZZ1A 1GVIA 4UB0H 5HI3C 4DKDC 4MQXC 3R0MA 4X9FA 1EEYA 3DUHA 4U1MA 2ID5A 2VLKA 3I2CL 5EUOB 3WKNA 3L95B 3MRGB 4K7FA 2BSSA 4B41A 4LBEB 4GAJL 3TO4A 4U1JB 1ZVSA 5MEPB 1XH3B 4MVBD 2WBKA 3BXNA 5HHXH 1H3VA 3BW9B 4OLYL 2WIMA 3ULVH 2DM7A 5FYJE 5DRXA 3O3DA 4ZPTB 3S8WA 5DXWA 3MRRA 4OCWH 3JV6A 4JHZA 1ZTXL 5DS8B 5ESQB 4NQVB 3QDME 5T33L 2QQNH 4JFYB 4ZAKB 2Y9RT 5I1KH 3BVNB 1QRNB 5DMGD 4P59L 2E27H 2NY4B 4OZHA 3VWJB 1KEML 3OKOA 4IS6A 2BNQD 5E2WL 5ILTH 5BW7A 5HGBB 2FHFA 3PL6A 1JPGB 5JR1L 2HYMA 2Y06L 3B43A 5F89A 5JA9A 1U8LB 4K3JL 3BT2L 4RCAA 5IR1A 2NR6C 2F5AH 4MA3B 4XPFL 3VXPA 5DRZB 4Z0XA 4XPHL 3WS6C 1UM5H 3QIWB 2DDQH 1KLUB 3LSOB 4ODXA 2YN5A 2NXZB 5DJXA 5SX4H 5T5FL 1KCSL 4KI5E 1KJ2B 1M4KA 2FR4B 1JGEA 1G6RB 4JKPL 5I0DA 4H0HB 1T20A 2AK1L 1KB9K 4GBXA 5IFJA 5MEND 1R3LA 4UIMA 4H1LG 3UO1L 2XN9A 2HJKB 1IEAA 4N90E 3HRZA 1K8DA 4PJ9A 4S10A 5IM7B 4QGYA 3A0OA 3C6LA 4Y4KA 1E4WL 4LSPH 4N8VG 5BVPH 2MCPH 2JJSA 2W60B 4AEEA 1RPQA 1RIHH 1FNEB 5EOCH 3WD5H 1JRHL 1NFIB 5EPMA 4OZFB 1HSAB 4LSRL 4G6JL 2AK4A 4LPTA 4PTUB 4YHNA 1BD2D 5DJ6A 5FKPB 3VGGA 3DXAE 4ZO6A 1T1WA 4HW6A 4LVOC 4PJ7B 5LQBL 5DHYB 1MPAH 5L8KB 4PP2B 5DD3L 1I3VA 4A2LA 3EFFB 2VC2H 3BHBA 4P23B 2AXJA 2ZUTA 3TA3D 4EN3B 9CGTA 3MLYL 1AIFB 1LO2H 1ND0B 4FP8L 2WWMD 4NP4L 3OF6A 4RAVA 2OXGA 2BZDA 3BWUC 3IDNA 1AC6A 1SY6H 3EYVA 5D7JD 3KHQA 1A7PL 1NL0H 2HN7B 1KFAL 4YHPB 4F7PB 3LV3B 4XCFH 2VUOA 1FPTH 5EC2A 1OLZA 1UXSA 1YEGH 3BEWA 1QVOA 4S11A 4JKWA 3MLWH 5K9OB 5HI3D 2YK1H 3FQNA 5BV7L 4P3CH 4GMTL 5CLWA 1GGYA 5CZVH 1WBXA 1G7JB 4R0LA 4RWYL 3O3EB 2W07A 2YUXA 3O3AA 4TNWF 2V17H 1FORH 2BSED 5DQDH 1QFHA 5I1EL 3NTCH 1A9EA 3QDGD 3G5VA 3SDXA 3OL2A 1PBYA 2WWMC 1U8KB 4O2CA 2HA1A 1LDPH 1JPFB 2D2OA 2WBJA 1E28B 2DQTH 1UQSB 15C8L 1NCCH 4NO2A 3CZFA 3MMEA 1B0GB 1T89A 4NKMB 1HH9A 1D7FA 4JY4A 4ZTPH 4GAFB 3HZVA 4RBPK 3RWEA 5KBNC 3R1GH 4J4PD 1BQLH 1DBMH 1AP2B 2FL5B 1OY3B 1CFNB 1MCBA 5DEGB 1UVQB 2A9MH 3TA3B 3TBVB 3S3JA 2AJYL 3QIUB 2YC1B 2XPGA 3I84A 3QEUA 5C0CD 2FR4A 1GL4B 2F8VA 2GJZA 4JFXB 5MEQB 1JWUA 1FVCB 3SGDI 5I0ZA 4DVBA 2IBGA 3MBEB 2DQHH 1JTTA 2WINA 1FYTA 1QLFA 4LOUD 4KAQH 5HGHB 2H2PD 4PJ5A 3L3OB 3F58H 4YDIL 3CVHH 3RVUD 1IGCH 1KOAA 4N9GA 2GIYA 4UT9L 2D0FA 1ZSDB 5TPWH 3RL2B 1BOGA 3VU2A 3FRPA 3TBVA 1EO7A 4P9MH 3ABZA 1A6VH 2BOCA 3L3HA 4G6FB 4ORGB 4XAKD 3S35H 1HH9B 4TTGA 4DN4L 5IHUH 2B20A 3IU3B 3MRPB 4Y1AD 1QLRA 3WNKA 1O5DT 2PXYC 4NO5B 3RVTD 5I1EH 2YPVL 4XP9H 2JCCB 3IU4H 1U58B 4L9LB 5TDPA 3U1SL 2EKJA 4OT1L 1B0GA 2NY6D 1RURL 4H25A 1AY1L 1TQBB 4DGYH 3V6OE 2EXYC 4QHUB 1YN7A 3TVMB 4Y5XB 3QA3A 4ZMAT 1FNFA 3SE9H 1MQ8A 2IG2L 4AM0B 3GSXA 1TMCB 1Z3GH 4M4PA 1XGTA 4NHUB 3MC0A 2IH3B 8FABB 3DVNB 2D0HA 3DXAD 4YZFF 5DURB 1JNNL 4Y16D 1BAFL 4FQQB 4I0KA 5I76B 1BIIA 3T4YA 3VD7A 1PG7L 3S97C 3QDJD 2ED7A 4BELD 3O8XD 3NIFE 4HUVA 4GT7A 1MCQA 3IDNB 3NACL 4GBXD 3UCRA 3HG1A 1ZGLM 3ZYZA 4YHPA 5C92A 2IADA 3IDMA 2O5XH 5CINL 3RL1A 4POYA 2DICA 4JFFB 4JM4H 3LEYH 4I0PB 1FG2A 1DQDL 3P11L 3EFFA 4MB3A 2R29L 4NC2B 5IMLB 4MDIB 2Y7QB 2HFFB 4TRPH 7CGTA 1C5BL 1ND0A 4RAUB 1G1CA 2ICES 3UROR 1NFDF 2F54E 2ZUWA 4PS4H 2EDLA 4KKNA 5FYJL 4JRXB 4MWFB 3KWWB 2OTPA 3AREB 1P7KB 1OGTB 2LVEA 1RZJC 3NOIA 3CLEH 4UT7H 1DE4A 4E9LA 5I19H 4PJXB 3QAZC 4NZTH 5B22A 4X99A 1U8PB 3I3BA 3ZO0A 4ODUA 1MCOH 1RSFA 5DD0L 5DMGC 3CXHJ 4J12A 1BJ8A 2CDEA 3DXAB 3AY4C 1U92A 1A47A 1H9VA 4MA3A 2H26B 4RMWA 4QCIA 4LLUB 1QHPA 4UQ2A 1T0MA 3BD4A 3RIFK 1T7VA 1JWMA 1NCBL 4LRIA 4WW1B 3L3OA 3WIIH 4Y19D 3ZSTA 1PSKL 2ZPKH 1RIUL 4M7KH 3BP4A 1I1AD 1NLDH 3FB5A 1AKJB 2ZJSH 5JIPA 5ANME 2FECI 1JGLL 5FA4B 5DR5L 4O51A 5IFHL 1L7IL 3WXWH 2CKBA 1GGBL 1QP1A 4NKDA 1J05B 4JFED 3WJLA 3IDGA 1TCRB 3BXNB 1ZLWH 4ETYA 3LKRA 3MMEB 1QRNA 2J1KA 3MLRH 4WO4C 4JPVH 4BZ2L 3FT3B 2D0GA 3MCKB 4NJAL 2KPNA 5EUOE 2P5EB 4M6OL 1XGYL 4I3SH 3H42H 3V5KB 3T2QA 5E7BA 3CVIH 4XI5C 1F4XH 2F19H 5JW4Q 1EFXB 3MJ9A 1DEEA 3Q2CA 3PJSA 1RMFH 1KIRA 1OAZL 2H1PL 3P30L 1INEH 1MVFA 2YBRA 4MLIA 1S5HB 3EJZC 3RAJL 2XFXA 4QKXB 1PEWA 5CSZB 1UWXH 5GGUB 3P0VH 3BEWB 4P9HC 1F42A 4RFEB 5E00B 2A38A 4TNVK 1PZUB 3AS1A 4O9HL 5HVHB 3SCMA 5IB2B 5EO0A 1JNLL 1T5XA 1VGKB 2Y23A 5ACZA 4FN0A 5EZIL 4PREA 4PP1C 5HHMD 3VFSA 5T1DL 5JXEC 2VDOL 3HZYA 1DEDA 2O5ZH 5GJTH 3CSGA 2ICCA 2EYSA 3RI5K 1WV7T 3TYGL 4K7PH 4PRDA 4MAYB 2VDMH 4PUBL 1UACH 1ZA3B 3ZKQD 1F00I 3H9YA 5JMRA 4KKCD 2P8LB 4D9RD 2ADJB 4ODWB 5JQ6L 5ISZD 3BHBB 3B2UD 2R2EA 4IOSD 1H8SA 2PW1B 3EOAB 1B88A 4PJ7A 5KANI 5I75C 5EBLA 4GXUM 4BFEA 3S3PA 4XPFH 4PRHA 3KPRD 2E7CA 5IMMB 4DOHE 4U6HB 4PB0L 3CFKA 4MHHG 5FYKL 4NQCA 1D6EB 3B3IB 5CEXA 3QDGA 3MJ9H 3OZ9L 2X4RB 4LLWA 1L0QA 4NKIL 2OTWA 1J1XH 5BZDA 2XQYK 3TESA 5T33H 1OAXH 3LVEA 1K6QL 3DPBA 3VFVB 2XZAH 1YN6B 3V0AC 1MCJA 3UX9B 4EI6A 1U6AL 4KUZH 4ONGH 25C8H 1KTLA 3N50A 5E94A 3LKSA 3CFJB 4OCSH 3GMPB 4IMKA 1V3MA 4PB9H 3BWAB 2IPTL 1KTRL 4RFOL 2UY6A 3C5SA 3K0WA 3PL6B 4K8RD 4NWUH 1NLDL 1NC2D 5FDYA 1O7VA 5MHSD 1CICB 2Y07L 5KVGH 1W2KT 2WNGA 4JJ5A 3BPOB 4LKCB 4HUXB 5F88B 1TFHA 1CGWA 1S78D 1QSEA 4WNQA 4BKLA 4BKLB 3QPXH 4GKNA 2A73A 2YD8A 3CJJA 4NQVA 4LKCA 2PXYD 2EH8H 3EJYD 3RVTC 1QLEH 3PDGA 3ARZA 4ELMA 1KTDB 1KEGH 1MFCL 4JFFE 1TVHB 2CDGB 3KXFD 5KSUB 1FPTL 4O4YL 1DQLH 1MWAB 3NN8A 3MXWL 4XCFL 2O61B 3C87A 2AJUL 3GKZA 3BISA 2XQBH 4HKBA 1QKZH 3STZB 4WHYG 5C2BL 1PKQB 2GQHA 3TEUA 4R90L 2V5MA 3D0VA 4OV5B 3MGTB 3T1FB 4YDKL 5IJKC 2E8YA 1YN6A 4H8WC 3RRQA 1T7YA 4JDTL 1H8NA 2KZWA 2CPCA 4WIQA 3QUYA 3MACL 3TIEB 1HINL 3RWGA 1MRFH 2IQ9L 1CFVH 2WIIB 3DVGB 3W11D 5DJCB 4L8SC 5AYUL 5CZKA 1BP3B 1QO3A 4LCIL 1U6AH 4HUWB 1UB6B 1I8MA 1PG7X 1VADA 1SM3H 5D70L 1N0LA 5DK0A 1RY7B 2FHCA 1W8OA 4Y7MA 3DRQA 3G6AB 3VFOA 4E5XA 1CFSB 1H0DB 3IDYC 5DZLA 1IVLA 3U7WH 1QBBA 1WEJH 4GKZA 3PXJA 5I8KL 2H32H 5J12C 5C0CB 1S9VA 3OWEA 3RY4A 5K9QI 3ULVD 1KPRB 2NX5B 4HWNA 1MY7A 1NCWH 2W9LA 3F7PC 2OYPA 1QSFB 4HQQH 4OLUL 3C60C 1P4LA 4CVZA 2GCYA 1MFEL 1OTUC 3JXAA 4UOW0 3IDXH 4IOFC 5GGTH 2X4NA 4PREB 5IMKA 3OXRB 1A9BB 1XGUB 4KK6C 4KRPC 5GRVK 2G60H 4IOIB 5ENWB 2B0SH 3OBAA 5J1SC 4LSVL 4PRIE 4KK8C 5DJ0A 4OF5A 1PD6A 3KLAA 4PJHA 3U30B 4QRRB 4X6DF 3SGKC 1XGRB 5H37G 2OL3L 1UJTA 3A6BH 5F1IA 4OV6F 1DBBL 4V1DE 3TYFA 4U2YA 4OJFH 3TNNB 2VISA 1TQCC 1BLNA 2OSLA 1OAYL 3F8UB 1J87A 3V52L 2NPLX 5I1GL 3L7EA 5J6GA 5MI0B 4OCYH 5D7IE 2VL4A 2P49B 4DK3A 5DJZB 4JZJB 5TPWL 1XGPB 5EU4A 2CRIA 3JUYA 5CGYC 2OJZL 1HXMB 4JFEB 2YEZB 3K1KC 1EUTA 3I2CH 3KPMB 4IJ3B 5DURD 2XACC 4O5LL 1TZIA 5C07D 4JFQA 1IZJA 4KTDH 4OF3A 5JOPD 5I16A 3L3KB 1BD2E 3GKWL 1FFPB 1C16A 4G7VH 4XCCL 3MRDA 4L5FH 4RMVA 3X13A 1MCOL 3JWDH 5DDHA 1CFQA 4XXDA 3GMNA 1BQLL 1PDKA 2DQGL 2HVKA 3KDMB 2OR9L 2OTUB 1JPST 5E8DL 4IRSD 15C8H 3QHFH 1M05A 4J4PA 3EJZD 3BQUB 1MRCH 4NZTL 4MD0B 3LN4A 3EOTL 3H9SE 5HDOA 2VDNL 1CIDA 3HZMB 1FORL 3G04A 2J4WL 4D0BB 2EYTA 3STLA 2IAND 3VXOB 4ODSH 2VQ1B 1TZHB 5DK2A 4K2UL 2X1QA 3RU8L 5H35A 2EC9U 3ROOA 1C7SA 3HAEH 5DRWB 3SDCC 4Z6AT 5IFAL 3OKDA 4GG6A 3CFDB 3OJVC 2Q86B 4ZFFB 4MD0A 2YKLL 4DGVL 4PJGA 2YEZA 2O5XL 4D0DA 3SE9L 2Y7QA 3D25B 3LEYL 3PWLB 3UDWC 4N0FA 3F6LA 1XIWA 4CDHA 2VDLL 4Y16C 3KJ4B 3RJDA 5BOZG 4RGNE 1D5BA 4HCRH 4DWHA 3RIFF 1TPXC 4NSKA 4PY7B 1XCQA 4NM4L 5ALCH 4NYLB 4ZQKB 1FZMA 1LK2A 1MIML 3H2WA 1Q0XH 4QEGA 3H42L 3TYFB 1F6FB 4WI2A 4Y4FD 2LU4A 1U8JA 2VC2L 2XY1A 1DQDH 1GOHA 3ALXA 2VTFA 2HWZL 3UJTH 2BHUA 3C08L 4X6FA 3CU1A 5FEBA 1CYGA 3EW3B 4PGJA 2EEDA 5C0FA 2ZP0T 4CVWA 4G42A 4Z7UF 3SJVB 1EIBA 4NHUA 4I0CC 5DMIL 5TE4L 1WWAX 3DO3A 3QRGH 3BFOA 4NJ9L 2PTVA 1UA6L 3KPQA 3SE8L 2R9HC 3GGWB 4ZUUB 1LILA 4H0IA 3U4EB 1I7RB 2NW3B 3GSNA 2YMXL 4K94C 5D1XD 1BAFH 4Y4HB 4HV8A 3BJLA 3H0TB 3DBXB 1GYAA 2HKHH 1QSFA 5T3XH 4P99A 3I75B 5EFIB 1SYVB 4R8WH 4ETQB 2HRLA 4Z5RA 4JFHE 1A6VL 5A2KH 2GSIA 1O7SA 1OWWA 5B3JF 5JLZA 3B5TA 1ONQB 1MI5D 2J12B 4OF7A 3LKNB 3O6KL 2CQVA 5EUKA 3TWCH 3VD4A 2BDNH 5F7WC 2X1OA 7FABH 3FL7A 3NABH 4KI5F 4PJ5D 1NKRA 3LRSA 3OHXA 4HIHA 3C8HA 3RUGF 5CAYB 3D18A 3ZMRA 2XKUA 1ADQH 4G9DB 3TIDA 3T0DA 1VACB 2CD0A 4J23A 5DC9B 1NANH 3LS4L 4R3SA 4YE4L 5KOMC 4OF0A 5C0CE 2XG5A 3QUYB 4JO1H 1HDMB 1I1FA 4I13B 4TUJA 4L4TD 1URLA 4WO4B 4N0YL 4NBYB 3HE7A 3PGDB 2VJXA 2ADIB 1JI2A 3H7BA 4M6ML 1CDYA 1BFVH 4YHZH 1IC4L 1S7SA 5IJVB 3P40A 2MWCA 2OQJB 4IDJH 3ZTJH 3S9DB 2DBJA 4Z8FL 3QIBC 1VGEL 1JJUA 4U1LB 3U7AA 1MWAA 4ZSOE 4P4RB 3S98A 4LIQH 2WIIA 1BHGA 3DVGA 4UB0L 2RAMA 3WDIA 4QRRE 1QFWI 1T83A 3NFPB 2H2PC 4XRCB 3T8XB 4YXLH 4MJ2A 3QIWD 5E4IA 1DBAL 3IXTB 5GSVB 5DQ9B 1G9NH 2NX5D 1RHHB 5E6IB 4XWGL 1FRGH 2B8OT 4I5BB 5D1QA 5I1CH 4M7LH 2A1WL 1XR9B 3JWNC 2ZUQB 5FYLE 2QV2A 4XPAH 5C0BD 3NN8B 3V0VA 2J8UA 2Y36H 1I8LA 2IAMA 3MRBA 1IAKB 5E94B 4S0TD 3GI8H 4E41B 4JFEE 1WCBB 2ZG1A 1HQRA 2QQQA 3SY0A 4ONOA 5HHOA 4LVHC 1CL7L 4XVTH 4HUUA 4PJIA 4PLNC 5FO8A 4YXLL 2R1YA 3VRJB 1GRWA 5HYJD 4RAVB 3QFDA 1JYWA 4FQIL 1FBIH 1PLGH 4G8EB 2OTWB 5F6IB 2RB8A 4LCIH 3B9VA 1F5WA 4GW5B 3ESVF 3PNWA 5EWIL 3X3GL 3NGBC 4DZ8B 3BIKB 2CGRH 4FXLA 5LWYL 4GRLC 2P48B 4I48B 3W82A 3DV6A 3CFJA 3P4NB 3JV4A 5I18H 2YRZA 1H5BB 5LAXA 4WEMB 1F45A 1WBZB 3E0GA 4Y5VA 3U7YH 5IB1A 3H9SB 4ODTL 3WIFB 4P3WA 3LKPA 5DVOA 4Y2DB 5HYIA 1Q9KB 3HI5H 5FYJU 3CD4A 1NCDH 4P2RD 4PJFF 3OJMB 1BBJA 4UUJA 4I77L 5C09E 5DJYA 5H2BA 2P5EE 4NPYA 4XMPL 2Y5EA 1X5HA 5EU6B 4AEHH 4EIGB 2RCSL 3T2PA 4OLYH 4G6KH 4OUOA 1OHQA 1JYXA 4XPHH 4CMHC 1H3UA 2FJHB 5IT2H 1YYLH 4K3DL 2GK0A 2EC9T 4HWZB 1R6VA 4ODXB 4LVNB 5J6HB 4NQCE 3K1DA 3INUH 3NAAL 4NUGL 4UDUA 1FO0L 3FAWA 5IB5B 4F9PA 5KVGL 5ITBH 2Y07H 5JHDA 1CTNA 2Q7YB 4MQ7A 4GRMB 4LSSH 3N1GC 5GS1B 5IW1A 2H8PA 4OZHB 4X7CC 3MNVB 2EO1A 5MI0C 3ULVL 3KGRA 4X80L 2O5YH 5D1XA 3FRUA 2NY2B 3HG1D 4U1NB 2XWBA 4TPRL 1KEGL 5JDJA 1MJUH 4GFTB 2DWEA 4YR6B 4GJTB 4LU5L 1YEHL 3G5ZB 4K9EC 4PJ9C 3NZHL 3TBSB 5IGXH 1MCPL 4NKOB 3HG1E 3KPTA 2UWEB 3BP5A 1KLGA 4PV9B 3QIWC 4LHQB 5KSAD 2AQ3A 1XR8A 4KDTA 5IW1B 3W39A 2QQNL 4X8XA 3RTQB 5C0GA 1U3HB 3B6SB 4QRPE 2MHAB 4ODVH 5JHDB 4OI9A 3X17A 2LV4A 5IWLC 5BQ7A 2G5RA 2HH0H 2BNRE 2JB5L 4UIKL 1AFVL 3QUMH 2L7JA 5CCKH 1T66C 3AS3A 2XWBB 5FDWB 4NRXA 4Y88A 4RQQB 5L88L 1IGIH 4HQQL 4OLUH 4Q97A 2IAMC 2YXFA 3IDGB 4JGUA 2ITCA 5C86A 5FF6B 4QXWA 3DVIA 3TBYB 4C56E 1HCVA 1J1XL 3GSRA 4TNVF 1WFUA 4NKIH 2J88H 1KC5H 1HXYB 4JDZA 3L6FA 4Q0XL 1A1MA 3SDDB 3IDJA 1CTOA 2P5WB 4RX4D 1NLBH 4AIXA 5L0QB 3NZ8B 5F1SA 1VFMA 3NFNA 2YZ1A 3V6ZB 3ZE2F 4EVNA 3QR2A 2EIEA 5IP4A 4U1KB 4KU1A 5FB8A 3KPRA 1OGTA 4GAYA 4G3YL 4Q9QH 3RWIB 3KWWA 2KQNA 4JDVA 3O2VH 2WQRA 2DI7A 3PNWB 3Q6FB 4PJ8D 5HBBA 4LRNH 1NH6A 1TPXB 4XC1H 2F53B 1ROWA 3F7RA 3IKCA 1U2HA 2G75B 4PP1D 4PUBH 5LBSL 4HBCH 2E3VA 2Y06H 5ELIA 2MOVA 4KJWC 3VH8B 3WYRA 3FFCB 1SEBA 2LTQC 3QFJE 3VXMD 4Z78A 3FONA 3RIAK 1N26A 4ZYKB 4JCMA 5JIHA 5A1AA 1VFOA 4C56D 1FJ1A 3IDUA 4LARH 4Z7UA 4HXAL 4LCYA 2DQJL 3Q3GB 3N1FC 3EHBC 1UWXK 5DJDB 1JZ3A 1GOGA 4NO0A 2AEPH 1ZHKB 1IGYA 2FBJH 2ORBL 4JREB 3WLBA 1MJ7L 5GGRY 1D5MB 2P45B 4LP5A 3HMXH 1G7LA 4Y4FB 1ZT4A 3T2NL 5JNYA 1S8DB 5F7MC 3TM6A 2R8SH 1KPUB 4G8FB 3CH8A 4QRPD 4U6YB 3U2SA 4IIQA 3EOYG 3W9EA 1EJOL 1LEKA 5E24E 4X4XA 3TV3H 1Q8MA 4EEEA 4X9IA 4QYOB 5DA0B 1I1YA 1Q9WA 2HMIC 4E41E 4U6XA 1L0XA 4LGSB 3SJVE 1VKXA 1AE6H 4LASH 2ZCKL 4AT6B 2OX5A 5KG9A 3AY4A 2K1MA 3HAEB 2YMXH 3U4BH 1EHLL 5TH2B 4AIZA 4ZO9A 2A74B 2XKSA 3T2NH 4HBCL 3HE7B 3PGDA 3GSXB 5FKAA 4NBZB 4NN5B 3UP1A 5DMIH 5TE4H 3DNKA 2DOCA 3SQOH 2X5PA 3QA3B 3FCTA 4OZGE 4R7NA 2GUOA 4ORGA 4GW4B 1KIPB 4XBGB 1GC1L 5I71C 4WU7A 3PF2A 1SEQH 3AMKA 2CLVB 2Z8RA 3LDBC 2CMRL 1T03H 4M7LT 3O2DH 4G8IB 1ZK9A 1X5JA 3O4LB 2NY5L 1AGDA 5DZOA 3QUZC 1KJVA 5E4EC 1HSBB 4YHLH 3DO7A 3SPVB 5TQ0H 5C09A 3ZKMD 4TULH 2E7LC 5I8KH 1T0NB 2ADIA 2IGFH 4KGLA 4LAQH 2F74B 3NBNA 4MNQE 4XC1L 5ESVA 4WW2A 1I3GL 1R0AL 1T0NA 2IPUG 1RZIB 2X09A 3IYLW 3VMOA 4X6DB 2FZ3A 3DMMA 3SQOL 3ZT5A 3OQ3B 5ICYB 5LJYH 3RWJA 1RD6A 3O6FC 4AEIL 4U1HB 3N0PB 1X5LA 3TA3C 3VFMB 1SQ2N 1R3JA 2FD6H 5KVFL 3DBXA 3QUXD 5ADPH 3EYQC 3MRFA 3QDMB 1W72A 1F3DH 2W38A 4QRTA 3FQRA 4MCZA 4ZPVA 5EOTA 1R5IA 5D7LB 1QRNE 3MBEC 5F9AC 4UINH 3HCVB 4TSBH 1IEBA 2X1XR 1AE6L 1JF1B 4CMMA 1QBML 3LKNA 1RJYA 3CK0L 3LB6C 1DBJH 3MA9L 4K71B 5SX5H 2GSIB 4YQXH 2OJZH 2V7NB 2APFA 4X9BA 3WE6A 5J1TC 1X4YA 4KUCD 5JZ7D 2VRAA 4JN2A 1ED3B 2R4RL 1WICA 4R2GB 1NAML 3E8UH 1XF5A 3MPCA 1G0XA 3SQBA 1QHOA 3U4EA 5BO1H 1DFBH 3NCJL 3RGVD 4LASL 4XCCH 2PXYA 2ICWI 3IXAA 1LNUB 3T3MF 3O2DA 1Q1JL 2ZSWA 3PHQA 4XGZA 5D96C 4LCWA 2Y6SD 4KZDL 5DI8A 5E6ZA 5TFSH 5ADOH 1ZGLB 5ACLA 5TGBB 5J8OA 1UCBL 4Y4FA 4HT1H 1OP5K 4CJ1A 3U0WL 3DGGB 2AAVA 4F8TA 1JGDB 3ZYJA 3VD9A 5EZJB 3MLSL 1T21A 4OZGA 2R2CA 4NZDA 3AB0C 4HIJA 2HLAA 2A83B 4TPRH 2OK0L 5TE7H 4JM2A 2GYSA 1EA9C 4RNRB 4URTB 3BP7A 1VB9A 1SEBB 4WW2C 3GEWB 1RVFL 2A6IA 3H9SD 4LL9A 5GZNC 3RVUC 5KSAC 1IBGL 4KJPC 4RGNB 4EN3A 4LPWA 4Z77A 1IEAB 4L4TE 2FO1A 4E42A 5IT2L 3B2VH 4UQ3B 1TJHH 3PP4L 3T3ME 3LN5B 1CICC 1CFQB 1TZHA 3T09A 4KJQD 5MENA 4BH7A 5C3LD 1N0XH 1CD8A 1D5ZA 4YXHL 1AQKH 3HE7D 1T1XB 4TSCH 3D39A 3IDIA 4OCRH 5IF0A 4MDJA 2GJ6E 1FV1B 2OMBA 1FGVH 2QBWA 3BQUA 3DI3B 1OW0A 1XT5A 1YY8A 3RFZC 1X5AA 3ARFD 4HZAA 4WVRA 4XBEH 1G7IA 4NQEE 1XCTA 3QUYD 5TJWK 4J6RL 3GSOB 1KLUA 3LSOA 1MHPH 3EFDL 5CMAB 2LU7A 3CC5B 4N8CH 3FQTB 1JBJA 2Z8WC 2W9DL 3NACH 3VRIB 1YECL 5GJSL 2LAAA 3B6SA 4PJ8C 4TUOB 4NZJA 3SE4C 4R7DA 3BYTA 5C07A 4LFHD 1QFWL 3SDXF 3MUGB 5D6DA 3BH9A 3QCVH 4BQCA 5BV7B 3H9HA 1H15A 1FZJB 3ILPA 1F02I 3TFKC 2VDRL 1T1ZB 2NY7H 4XVSL 1G1YA 2D4FA 4K8RL 1YDPA 3PXHA 4Z8FH 4LU5H 2PR4H 3VXMA 1QNZH 4H0GA 4L8BA 4Z7QF 2F58L 4XWGH 4HUKB 1NUGA 5EUOF 3PQYA 4Y5YA 4N0CD 4JRYD 3L3GA 3MV9E 3S4SG 4PJHB 5EUOA 3UZVB 1S9VB 1CQKA 2W0PA 5HI4D 3F7YA 4L8DA 2VZSA 2O5YL 3NCYS 2VXUL 5DC4B 4WHDA 2DMCA 3QUXA 4HWZA 3WSQH 3Q6GH 4HS8H 2ZUYA 3WS6A 1J5OL 5GHWL 3HMWH 1CIUA 3MV01 1NC4A 1Q72L 4QRPA 1NBYB 5J0BA 3QIUD 1S7UA 4MNQA 4EDWL 3HPLA 2V9RA 5AUMA 3PL6C 4AIOA 1DVFB 5I1DA 1HQ4A 1MJUL 1T5WA 1DTUA 4YDIH 5DFTA 3VWKC 3ZDXE 2VE6A 5FYKE 3U46B 1MF2L 5GRJH 4JHWL 4HPYL 4OLWL 3RP1A 2AXGA 5JQ6H 1XF2B 3FO9A 4P5TC 4G9FB 2D7NA 2R2HA 5ISZA 1NAKH 2KUTA 3U83A 2CLRB 1QNZL 4BSJA 4POZD 5CD5C 3ARXA 3UTQA 3QQNA 4ONHA 5HYSB 1EPFA 2YD7A 4GQPH 4M3KB 1F90H 4Q6IA 5CD3A 1WT5A 3FN0L 5GRUL 3P11H 3MGOA 1Z2KA 4OV5A 4Z7VA 5MHSE 1IM9D 3QIBA 5CZVL 1WCBA 4PRPE 1HCFX 4DTGH 1CICA 5C0RH 5I1LA 3T2OA 5JW5A 1A7RH 4LSTL 3U0TB 3MNWB 1XAUA 4MD5B 2R23A 4Z7NF 2E5EA 4OZHF 2EIBA 4QHNB 5CMAA 1DQMH 5F96H 5E6ID 4BQBA 2RBLA 1RJCA 2M2DA 4Z7WA 3BGFC 3E6FB 2NY0D 1C08B 2PO6B 3G08A 4NUJA 4QRUB 5JW5B 5I1LB 3VFGH 1GGCL 1ZS8A 2YPLE 4FP8H 4ZNEA 3Q5YA 5I1CL 3TZVB 5JPNB 3QDGB 5FGCE 1B0WA 1YMMA 1P7QA 1KV3A 2VLRD 3VXSE 1UCTA 1WZKA 5HI5D 5CJ5A 2D9QB 4FA8A 3TT3L 2KDGA 2NY4C 3WS3A 3NIFF 3WIIL 1K4CA 3HR5B 2Q8BL 1A5FL 2K9UA 3QNXA 1XGYH 1F90L 4I3SL 3EFDH 2AXFB 4PJFB 1VCAA 4L4TB 3DSNA 4OTXH 4UQ3A 3C60B 3OAUL 3O4LE 2MCPL 1I85C 3RWCA 1HYRC 1EFXD 2VE6B 2X4RA 1AO7A 1NMCB 4IM8A 1GGBH 1NFDA 4PJ8B 4UU9A 5IG7B 3V5HA 4C57C 4X7TB 1YEJH 3OJDA 1S7UB 4MNQB 4KVNL 3MR9A 2AXGB 5FGRA 4KMTL 3CVHL 5JA8B 1E4XL 5GS2D 1ZA6B 5GS2H 3VXNA 4DJMA 3ULUD 3PL6D 1JHLH 1SBBA 2A6DB 3CFBB 4LHUA 5E5MB 3THML 2DDQL 3UTTD 1DVFA 1NCBH 1T4KA 4KI5C 3TO2B 2AJ3A 3J7HA 2J7LA 3UYRL 5JLZB 3GMRB 4UNVA 4OCLC 2ENSA 1V05A 4UDTA 2Q6WB 3CSYA 5JMOC 1B2WL 2V7HA 4LLYA 5KSBA 3DECA 3VD5A 2APWA 1KIRB 1RUKL 3HNSL 4X6EA 1W72H 1KB5B 3TNMA 4G8GB 4GKSB 1A5FH 5EO0B 3NPZB 4OM0H 3BP6B 4WFHD 4DAGL 3HUJF 2ESVD 3MCKA 1V7MH 2X4TB 4C56B 5EU5B 2XXCB 5E95B 1T22A 1UADC 3R4DA 1A6TA 4LKXA 5IVZA 3ZTJG 1A3LL 4GXVH 1J86A 1N3NA 4YX2H 1FIGH 2YBRB 2ICEB 1INQB 1BFTA 2DTMH 1NC4D 2C4FU 2Z93B 4KKAC 5EIQA 4MD4A 1OD9A 5I8CA 3BIAX 3T0EB 6CGTA 2DIBA 3T3PE 1H3PH 5LGKA 3S88H 5E2VL 4EI5C 5CBEB 4GS7B 4P23C 3KPSA 1U95B 2DD8L 1KCUH 5GJSH 2P5WD 4DVRH 3V6FA 3DI2B 4ENEC 1LO2L 4XP6H 4PG2A 3DX9A 3UPRB 4ZFFA 1J8KA 3EZ8A 2OM5A 1JGVH 4MDJB 1HOCA 5I1HH 3Q1SL 3OMZA 1MRCL 2IFFH 2Q76A 4NC1E 1I9IL 5KVEH 3O8XB 1L7TL 3QSKB 3IJHA 1RZFH 4KXZI 4HS3A 4B0MM 4GSDL 3V4PL 1GZPA 4LSRH 4NIKB 4MWFA 4CVXB 1WGOA 4YUEL 5L6YH 2VZTA 1V7NH 1SEQL 3PV6A 3JBG7 3ROLB 4YZFE 5HYSG 4ZXBD 2BNQA 4R96B 4L8CB 1IQDA 2YPVH 4XP9L 4PJEF 5GRXG 4OM1H 2XTJD 5DYOB 1NCAH 4QT5B 4YXKH 5B38A 1UC6A 3DUUB 4Z0BH 3QJHB 5F7NC 4HK3N 5FIEA 3BESR 2W0FA 1UM6L 3ULUC 1MFCH 3SO3B 2P46B 1AXSB 1M7DA 3EDKA 3TZVC 1NUNB 1I7ZA 2OBGA 2A6IB 2WBJD 1NJ9B 2UYLA 5F1KC 4UOW1 3ARBA 4U6XB 4YE4H 3GKWH 4DN3L 4RGMC 5IBLC 4MVBC 5MERA 3GMQB 5I6XB 1R24B 4XXCC 5HDQL 3VI4E 4OGAD 4HIJB 4ZS7H 4QF1A 4LCWB 4K23H 3ZE0E 2GY5A 3RDTA 1TQBC 1L6ZA 4JGMA 1JGUH 4XH2A 5FM4A 2GJ6A 2Y5TA 2LABA 5HD8C 5EDXA 1QYGH 1A64A 3MLSH 1JNHA 2AI0H 4Y5XC 1S5IH 4YPGA 1N5YH 3GSWA 3LN9A 4NO0B 1GGIH 4WI9A 4ODHL 2DQJH 5FK9B 2NY0B 3NPSC 4JFHD 1JF5A 2VLMD 1QQDB 1X4ZA 3EO0A 2EE3A 3KLAB 3OXSB 2HKHL 1S7VA 1UWGL 1MCWW 1TJGL 4DW2H 4M1CC 5JORA 3M17A 3O4OB 4Y2OA 5CJXA 4N0UB 1RI8A 4DZBA 1DDHB 2IMMA 1QSFE 2BOCB 3L3HB 5D71L 4F7MB 5C9JA 1HEZB 2GCYB 2CXGA 5CJBA 5BS0E 1JPTL 3NIGF 3KYOA 3TJEH 3QAZB 5HHVH 1VFBA 3UC0L 3DURB 3GMOA 4EBQL 3WO3B 2QQKL 3RY5A 3LOWA 3DHJA 3MX0A 1CE1L 1JP5A 3L7FA 4JQIL 3WDHA 4EVNB 1HZHL 1MIMH 5TE6L 3DROB 2PO6D 4M5ZL 4Q9RL 4X5XA 3NPSB 2GHWB 1QFOA 4ZUVB 3SKNA 3QI9A 3GJEB 1F3DJ 5E1AB 4BUHA 3SPVA 4P2QE 2FO4B 1AGEA 5DHXB 3RZCC 5JIIA 2W92A 3TBYA 1NAMB 1NMBL 1W8NA 1PAMA 3UJJH 3O6ML 5K59F 4O2FB 4KQ4H 4F57L 5IW6A 2XNAB 2FBOJ 5T3ZE 2XKNA 2VO5A 5DUBA 4FZEL 3O6LL 4JFXA 1FL6B 4OQTH 4CU7A 1G7JA 4NCC2 4FQ1H 1OTTD 5D7KD 1CFNA 4Q9RH 3QPXL 5AD0B 5GRZA 5FO7B 5HYQB 1U8HA 4FTVB 1JNLH 1GH7A 5B3NA 2PO6C 4S1DC 2FNBA 3E6HB 3GNMH 3MZTA 3ULSB 3SDXB 4PRPB 4FXGB 4XNYH 1A9EB 1YC7A 3LMJL 3NIGE 1KULA 2H6PB 3C5ZB 1FL5A 1R5WB 3RAJH 4YHKL 4R0LB 1DBAH 4G43A 4JRWA 2DLFL 3GJFA 1CWVA 1A7OH 4D9QD 3CSYB 2CUIA 5BJTB 5I66A 2ZJSL 1Q9WB 3QQ9C 3MBED 4HZLA 4QYOA 3OKMB 4YLQT 3GMRA 1KEMH 4UV7H 1YMME 2CLZB 3RDTB 2XQYG 3N1PC 4RGOH 1MCKA 1F97A 2NY3B 3O9WA 6FABH 3GMQA 1XZ0A 5FUOH 5JUEL 2NYYC 3VI3F 5IGXL 4XT1C 4HHAB 4LSDA 3CFCH 3VXRE 3D3VA 1FNLA 3C2SA 3VXSB 4AH2B 1I7ZB 5ID0B 1C12B 4PJDE 3TBTA 2EH8L 1L0YA 1BECA 2EC8A 2SEBA 4XVUC 5KW9H 3RWDA 1LP9B 3WHXB 2BSTB 1PY9A 1P9MA 1UFUA 3BD5A 3FO1B 4MNHA 4TYUA 5IQ9A 3UTZA 3HZKB 4L8SA 4TUKL 5C08B 4QLRA 5FYKH 4HKXB 2AK4B 2DBLL 1S9YA 2X4OB 4G80A 3VXPB 4X6BA 3BN3B 2WAHA 5K9KA 2Q3AA 4TSAL 5E8PA 1EFQA 3F7VA 3QUKB 4P3DA 3QHTC 3RWDB 1IKNA 3VW3L 1Y18B 1ZS8B 4HF5L 2ATKB 3IFPB 4NUJB 4QRUA 3P0VL 2Q76B 3ARGD 2F8XC 1F11A 1G6RA 3KXFA 1FQ9C 5BRZE 2ZSVA 5HHOB 1KJ2A 1A1MB 1UM4L 3L6FB 5EO1A 2X9WA 2DQCH 3FAXA 4MSWB 4YBQD 2MPAL 3MV7B 4YAQB 2B7DT 1CL7I 2ITCB 5A2LH 3K80A 4XNZB 1TETL 5BQ7B 4ZFGL 1HHHB 2R23B 3HN3A 3V0VB 4M6OH 1WC7A 1YJDC 3WNPA 2OS7A 2O93L 5D70H 4PRNB 5DQJA 2BSSB 1S5HA 1P1ZA 3U0PA 3SCMC 3O2WL 3DVFA 1G7MA 2HT3C 2FEEL 1RULH 4KPHH 1IT9L 3QUZB 5EA0H 2AKRB 3QEQA 1GGCH 4XCYB 2I60L 1KTKE 4WTZA 4ZPTA 3O3DB 4ZUTB 3RX7A 4YC2B 3O0RL 4OI7A 4L4VB 3U4BL 3MSPA 4J3VA 5DD1L 1BQHB 3ZTNL 4FMFA 2A0LD 5F9WC 2V2XB 1JTPA 5DEFB 5EZIH 5KSBE 4OLVL 4P5MA 3T0EE 4PJIE 2YA2A 1HHKA 3HI6L 5IBUG 2QHRL 3B8SA 3OR6A 5GISH 3BGMA 4YX2L 3H6JA 2BFVL 2QJDA 4P9HL 3S4SA 3U0PB 5FA3A 3WJLC 5F9JB 5HPMA 2R39A 5CUSH 5IK3B 3KPRE 3LPFA 4GRMA 5LKNA 1V7ML 4R3SB 3UTTE 2ATPA 2FBJL 1FIEA 1SJEA 4JO4H 3CFBA 4LHUB 5E5MA 4MAUH 2JJTA 2R0KH 4NQDE 2X4UB 1MLBB 4LOUC 4U6VH 1F8TH 4P9ML 4MQXD 2EIZA 1KJMA 2BCKA 2A0LC 2CIKB 3GBNH 4H26A 3RX5A 2A9NL 1I9JH 4N90D 5LBSH 1YJDH 4UU9B 4MZ2A 3V5HB 1NCAL 1H5BA 1MJ8H 1X5GA 4NQEA 1MCFA 2XZAL 1DVFD 4PYHA 1GGUA 4OZIE 3KJ6H 4L29B 3UDWA 2H32A 2A2QT 1LO5A 4MJIA 3LZFL 1FNGB 4GRWF 1VERA 4HKJB 4NUGH 2VXSL 2JJUA 4EXKA 5C08A 2YPKB 5EULV 5L6YL 1IKNC 1TXKA 1N8ZB 5DJAB 4HK0B 3S6CA 1YEJL 2IFGA 4XH2B 2QEJA 1M71B 4HD9A 1A0QH 5FO9A 2BJMH 3HUJB 3KYNA 2DM4A 3BZFB 1TQCB 1T1YB 1KC5L 2MQCA 3SKOA 3M45A 3GHEH 3MRBB 4ZOBA 3E3QE 2G2RB 4PD4J 1C08A 2PO6A 2YA0A 4C83B 1KFAH 3DYPA 3ESUF 1C1EH 5KJRH 3IDYB 2OP4H 5FYLH 3GSQA 1HQRB 1J1PL 4YGAB 2R56L 3UBXG 1NBVH 5DFWH 3GSOA 4NSKB 5DTFB 5E6YA 4KY1H 1BZ9A 2R56H 2YK1L 4AEFA 2E6JA 3QWRD 1E27A 3VJ6A 3BKCL 5DC0A 1T66D 2G60L 4HXBH 3T08A 3ECBA 4HJJH 1DSFH 5DFVD 4KRMB 5EU6E 4YO0A 1AGCA 3VFPB 3CXDH 4LNRA 5D7JA 4HJJL 1P7QD 4M8VA 5JZ7C 2FEEI 1N4XL 1CDUA <