3UL4A

Crystal structure of coh-olpa(cthe_3080)-doc918(cthe_0918) complex: a novel type i cohesin-dockerin complex from clostridium thermocellum attc 27405
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
142
Chain Sequence
b'NTIEIIIGNVKARPGDRIEVPVSLKNVPDKGIVSSDFVIEYDSKLFKVIELKAGDIVENPSESFSYNVVEKDEIIAVLYLEETGLGIEAIRTDGVFFTIVMEVSKDVKPGISPIKFESFGATADNDMNEMTPKLVEGKVEII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulosome-anchoring protein
publication title Novel Clostridium thermocellum Type I Cohesin-Dockerin Complexes Reveal a Single Binding Mode.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Cell adhesion/protein binding
total genus 31
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ul4A01
5G5DA 4UMSA 3BWZA 4FL4C 1QZNA 4U3SA 4WKZB 1ANUA 3KCPB 4IU3A 4WI0A 1G1KA 2ZF9A 2O4EA 1ZV9A 2BM3A 2Y3NA 3F2LA 2VN5A 2OZNA 2JH2A 3GHPA 3L8QA 2CCLA 4FL4B 2VO8A 5AOZA 3FNKA 1AOHA 5K39A 1OHZA 4DH2A 3KCPA 5LXVA 1TYJA 2B59A 4IU2A 3UL4A 2XDHA 2W1NA 4UYQA 4N2OA 4UYPA 2VN6A
chains in the Genus database with same CATH superfamily
1T6WA 1CVSC 4PP2A 1XGRA 2R2BB 1FNLA 1B0IA 2VMCA 5LJYH 1ASQA 2WGXA 3DRQB 3IBEA 3QDHA 4MBRA 4H25A 5JYLA 1KDJA 3B2MA 1QYGL 3K6FA 1IC7L 5FWQA 3I6SA 3U0PA 4ZAKA 4KJYA 2DW5A 4FFYL 5EH1A 1FZMA 1MJJB 5BJTB 1WLHA 3OB0H 4IU3B 3MRGA 2YAQA 3O4LD 3TT1H 1MCLA 4GP5B 5DHYB 2ICWJ 4I8DA 3PHQB 1WC7B 1TCRA 4BFGA 3WHXA 3T2NL 1GGIL 5ICUA 5GS3A 3G08A 4DTGH 1YEKH 1MXDA 1P7QD 5E2JA 2ORBH 2ZXWB 4IGBB 2W07A 5FOBB 2LVCA 1UENA 3FOLA 5KBKA 3DOIA 3MODL 4LCVA 1KYFA 4GSXA 4I89A 1T0NB 2X9ZA 4RVBA 1RHHB 4N5ED 1KIRB 2OI9C 3MRIB 4KTDH 2GABA 2J73A 3SJVA 4HUCA 5FA3B 2F7PA 1F3RB 1P6FA 2KYIA 4UT6A 4EDWL 1QBLL 2MOGA 4HWEH 1CN4A 5C0BE 1JNLL 3L9YA 1BEYL 4UTAA 4RA3A 1CL7I 4HIXH 4A7GF 5HDRA 4WEUD 5TE4H 1GS8A 1NBYB 3D4ZA 4JR9H 2DQHL 4NSKB 5GGRB 2YD5A 3SO3C 2YUXA 4HZLB 3IXTB 1E4WH 2BNRD 2QKIC 4ODSL 1IQDA 1VAHA 2GJZB 1MH5B 1XGTA 2YRBA 1AXTH 2FUTA 2PP9A 1Q9LB 1Y6NR 3PG2A 4M6OH 2V9QA 1JIBA 1T0MA 3HMWL 3VXSB 4I3RL 2X10A 1RIHH 2X70A 3RL2A 4WO4C 5KSBE 2DB8A 5L4MA 1E8YA 3CX5J 1OO2A 4QNPF 4F2MA 3WJJC 4LSQL 1XTMA 3NSDA 3S96B 3VFVA 1AZRA 1JSYA 3K2IA 5GGSB 2FQEA 2GK0B 2LU5A 3T1FA 1LQSR 2UZXA 1JAEA 2E9WA 4CUCA 2I85A 2AXJA 3KWTA 2Z8RA 4TL4A 2IAMB 4LLDB 4WRLA 2YC1B 5EEWA 3IJYA 3P2DA 4MGXA 5E51A 5G4NA 3D9AL 1JNNH 4OGYH 3OSKA 1FN4A 4G8IB 2Z8SA 4U1LA 3IFLL 4ZG1A 5L0QB 5FR3A 4UQBA 3VGEA 4NP9A 3W0WB 3DJZA 3GBNH 2J44A 4RFOH 3EJRA 2FX9L 2BFGA 1HEZB 3OXRA 2ICCA 3VXNB 2EQDA 4GKSA 1TFHA 1VPOL 3DI2B 4WO4D 3SBWC 3ZLQC 5KVGL 3APNA 4FFYA 2W8CA 1OTTC 2X2HA 1TSRA 1XIWB 5DA4A 2WCGA 3TIEB 1CLZH 1A7NL 5K39A 4LO9A 4OLWH 4CSZA 2VLME 1BQHG 3CCHB 1OK8A 4PJGA 4HDIB 4AH2B 2CIIA 1BVLA 4MJHA 1VSCA 1VACB 5C0GB 1D5MA 4MTMA 5AQ0A 4NM8H 1I1AA 3DPBB 4YLBA 4UAOC 3IMSA 1H8LA 1DEDA 4N2DA 3HG1A 4PJHF 3SGDI 4YHNB 4GKZB 4L8DB 2APWA 1TZAA 3HHSA 5GS0L 5IVXA 1M56B 5ECGA 2IBZX 4PTUA 1HK6A 3T2PA 1VB9A 1A9EA 4W9CC 1RZKL 3MR9B 3Q1EA 3HKZA 4LLMB 3I6KB 4J3BA 4FFVC 2BDNL 1WQVT 3CSFA 4RAVA 1RK0B 1LK2B 5IHUL 3QAQA 3QP3A 1QSZA 3LRHA 1D7FA 2G60L 3L6FA 3IM1A 2ZWZA 3ZYZA 4JFEE 3M17A 3RGVC 4WHTB 3ML9A 4HUXA 2PCFA 2M1KA 5DLMH 2YAOA 4XN1A 3LKQA 1OTTD 2A1WL 4FGMA 1WTGT 3IFOB 3HNTH 3MLVL 3I75A 4MCYB 2WJ7A 1U8JB 1KGCE 4O9HH 1PZCA 2FIKA 2QVKA 1JN6B 5JW4R 1DUYB 4AQ1B 2F53D 3D4CA 2F9BT 2WLNA 2EINB 3ETBJ 4ODHH 4Y1TA 3UTTE 1B9ZA 3QK0A 3EJYC 4WI5A 4X50A 2EKSA 5ESQA 4DH2A 4O2FB 5CINL 1SJHA 2UZYB 2FHCA 15C8L 3HS0B 1YEGL 3MLWH 4TYUA 2ZWKA 1SLVA 4U6XA 3X1EA 4P2QA 2ZIDA 1T5XB 3NJKA 4HD5A 2YXFA 2UXVA 4FFVD 3MRLB 1F4WH 2VIRA 4KPHL 1ZSDA 3DC0A 1D5BA 3LNIA 4XNXL 3QO0B 3F7KA 4G7YL 3WMQA 5CZKA 1P5UC 2DI8A 4ZTPH 1NLBH 2YD6A 2DJMA 1TVHB 4DGVH 2O6FA 2GIMA 2CBTA 1JK9A 2W88A 2DH2A 1E40A 1LO4H 1WZAA 2WLJA 2YK1H 4NZRH 4WUKH 5HYIA 3O6FC 3B8YA 3BAWA 4U1IA 4QRPE 32C2B 2ZOLA 2NQ3A 5IQ7L 1OTSC 3QDGB 5FO9A 3IN2A 4HF5L 2NPLX 4JKPH 3ES6B 3BH8A 3RNQA 3EO0A 5FYJH 4JNXA 4DPBX 1XGYL 2HLAA 4YHOL 4P5SA 5H35A 2X4RB 4GRLC 4KJPC 1BYPA 1SN5A 3PGDB 4A7UA 3EJYD 1HZKA 3CBRA 4K9EL 3F58L 3MV8D 3MV01 5IM7B 2FO1A 3LS5L 5ISZA 1OXYA 3ZL4L 1KEGL 2VQ1A 5EU3B 3B34A 1AZCA 4H2CA 1CU4L 3VFOB 2I27N 2J56A 2CGRL 4K7FA 1Y0LA 3A4DA 3ELQA 3PWVB 4LPVA 3ARGA 1R3LB 2FB4H 1F4HA 1H3VA 3ZPDA 4LQFH 1U8MA 5IK3A 4IKKA 3SDCA 4GXVH 5MI0B 5E2VH 3BXNA 4M02A 5BOPA 2L8AA 2PPCA 5EB9A 3CXHJ 4F8TA 5KUKA 2HJLA 1PEZA 3Q8BA 3SKJH 3IDYC 4U6HB 5HYJE 4BA8A 1LO3L 3IB4A 3B9DA 5HHMD 2PR9A 3HC4L 3O6FD 3KWVA 1J10A 3TA3A 4I4WB 1OTSD 3TPKA 1B4JH 4PIBA 3DHUA 3R8QA 3VJ6B 3DNKA 5ANMA 3BZDA 3CGTA 2N0MA 1HE8A 4G42A 1NBZA 4KKQA 5HDQH 2FL5B 4KJPD 3HA0A 4MB4A 1UGNA 4OGAC 3MROB 1DTUA 5AAMC 5JMOC 3IJHA 2UXTA 3ZVVA 5DQ9A 4E9XA 5E4EB 4BELD 3L3OA 1SQ2N 1GHFL 3EIFA 3GBDA 4EQ3A 1IAMA 2NYYC 4PWKA 1JGUL 2WAHA 4HJ1A 4KNTA 5K1NA 2O5ZH 3DA0A 5D6CB 1C7TA 1JXKA 4WY7L 3ESUF 2QQLL 3IJ9A 4FLQA 2GTWB 2LAGB 2NY3B 4E41A 1EGJL 4KI1A 2O26U 4AEFA 4PR5B 2XN9A 3V0HA 5JQ6L 4PRDA 4M7LT 3DGGA 2OSXA 2N7AA 3LSOA 1OE2A 4QHLA 3QA3B 5JOFA 3QI9A 4JQIL 5T5NF 3GHEH 3SOBH 1T83A 2JCWA 1HL9A 1T66C 3KMDA 4NQVB 1AHWC 2IQ9L 2XETA 3V6BR 3EO9H 3BKJL 3NESA 3S37X 1IM3A 4G8EA 4LF3A 2W94A 4M43L 3BZFA 4ETYA 4OGAD 1KGYE 2AK4A 1MFBH 1BOYA 3VGAC 2DWDA 3Q06A 1IGIH 3PWNB 3VACA 3WFHB 4BWTA 5C08B 3PREA 1ZANH 3G6JA 2Q7NA 3WIIL 4BJLA 1XZ0B 4PJHB 3S9DB 1I9RH 2AXFB 2NYYD 3IEAA 5LDSA 1E5YA 1EHNA 3BSZA 5HYQA 3UXFA 1S9WA 4P4RA 2VLJB 5KJ7E 2NX5E 1VERA 1RFDH 4QD2E 3RFZA 2A6JB 1SXSA 4PJCE 2D9CA 3R0MA 3BIBX 5FYKE 3Q01A 4KQ4L 1JPEA 4JPKH 4OIIH 3UTSB 1E4XH 1MN4A 1FI8C 4CDGC 2W60A 4ERSL 4NWTH 2KH2B 4DFHA 5KVDH 5E6IB 1XMEB 4FDWA 1T66D 4CU6A 1MOEA 4AK2A 4E9VA 4PLNC 2Z7ZA 4L9LC 4XMLL 3VFSB 4GO9A 5I8OH 2PYEA 1WZLA 2WLMA 2UUDK 1HYSC 1BW8A 4GSDH 4LRIC 1HDMB 1I8IB 2B3IA 1AKJB 5D55A 5D7EA 4PAZA 5EIIA 1Z9LA 4JRLA 5F21B 4D9RE 4TVSa 3NK3A 4BSWB 3UZQA 4BXVA 3APCA 4GS7B 1INEH 1JPST 25C8H 3BI9X 3L95B 2OMYB 4YO0B 2J7LA 3PJNA 3GSOB 2E6PA 2H26A 1CDBA 4JS7A 1MCRA 6FABL 3E6HA 3BAEH 3D1MC 4TNWF 4LMQE 2WCSA 5DUML 3GS0A 4WGWB 4ENZA 3OMIB 2AEIT 3UBXA 3FQNA 5IW6B 1ZD6A 1MQKL 2G2RA 2NDFA 4W9IC 4L0PB 4GIAA 4TOYH 3CBKB 3W82A 1WWBX 4IRJD 3CHQA 4IK7A 2VMJA 3C5ZA 3FC8A 3OB8A 3U2SB 1K8DB 1MHEB 4HIIB 1TO4A 1RJZA 1SJMA 2FWSA 2JJTC 4OI9A 4PWFA 5IVZA 1HYSD 4KROB 2YXWA 3WG7B 2ZWSA 4P4KA 3M6DA 4NT6A 2CR3A 2WHVA 2OJEA 3GJEB 4M48L 4PREB 3L3IA 4HIPA 5MEOA 3PL6A 3INUH 4JQIA 4J4PC 1IEAA 3EDEA 3H7BA 3UL4A 2WIMA 1TITA 2ZD0A 2ZX8A 1A66A 4EIGB 4OZHE 1BP3B 1RERA 3I3DA 3HZMA 3QDME 3WS6C 3IJSA 5CIPA 5AKRA 2F68X 1S7QA 3DETC 4JJ5B 4A39A 4OM0H 1DJZA 3FU7A 1BIHA 1F4AA 1LVEA 2W0PA 2WWKT 1UB5A 1S3RA 1MFAL 2JF1A 4ZNEA 1T7ZA 1N0LA 1N5AA 4WK2B 1ZT1B 4X4YA 4OY9A 5D7IA 3U4EA 4IIQC 4A2HA 3HBGA 3R8BB 3WJLC 4JM4H 2AK1L 3KPSE 5DJAB 2VLMD 4WZ9A 4TQEL 4J8QA 5HGAB 3RBSA 4CC4C 5I0VA 4LVNB 2VN6A 3FSWA 3IFNH 2ZKHH 5C0FA 2QQQA 2Y1ZA 5EBMA 1EHLH 2LT9A 1KCSL 3NSJA 2DM7A 1IJNA 4XO4A 5F72S 1ZHNB 4JLRB 4N0UE 4PRHB 1CLVA 1FVCB 1NCWH 1M05B 1P2CA 4R7DA 2ATPB 4FG0A 3MO1B 1A3QA 3GPSA 5D1ZA 5EU7E 3ZKQD 1TTUA 1A6UH 3POCA 3RWCB 2HWZH 2X7LA 1ZS8A 1C8PA 4ABVA 3DVGB 3HE6B 2Z8VC 5ANHA 5AYUH 1JV5A 1T21B 3OQ3B 2CPUA 2O6CA 4LQ1A 2IQAA 2WINA 3DETD 3N0AA 3NTCH 3QJHB 4TNGA 1HHKB 1KELL 4XAKE 3O3UN 4AGMA 1OGAE 3C6LD 4JFED 3UBHA 3TBSB 4GG8A 3UBGA 4LZKA 4NNPH 2CLRB 2P8PB 1T1WB 2XC8A 4D9LL 4F2FA 1C7SA 1B0GA 2JV6A 3CLFL 3OPZL 4UAHA 3PWPD 5HJ3B 2XZAH 1KGCD 1PQZA 3C87A 2ERJB 3S37L 2CAKA 3U9PH 3A4AA 1P7KA 2ZXDA 4N0CD 2YPKB 1RVFL 1VKXA 3D39D 4OZ4A 3UTTD 1BBJA 2EEFA 3S2CA 4NXKA 5ACZB 3QFDB 1XF3A 5I0ZA 5CZRA 1MVUA 2WW8A 2JI1A 3KDMB 4RCAA 3HLAA 3QYMA 1DFBH 4OFIA 4TKWA 1YJDC 2V9TA 4WO0A 3V0VB 2YN5A 1KZQA 3FPXA 4HLZH 3OF6D 2FJHA 1MCKA 2KLSA 3LN5B 2DQTL 4L8CB 4EBQL 5LLIC 4M61B 4Y4FA 4W6XB 4AJWA 4UDUB 3CH8A 5A16A 1PYWB 2Q3AA 4M8QA 3HE7B 2VO5A 3PQYA 4G82A 2A9MH 1JV2B 1Q9KA 2XN1A 4AVHA 5C3IA 1WE5A 5KVFE 1P1VA 1EPFA 3LZLA 4NIKB 4PJ8A 1J12A 1K2DA 4HFWB 1PSKL 1RZGB 1MFDL 2NY2C 1IKNC 3VD3A 5F6IB 4Z9KB 4C56D 5IFHH 5FGCB 2ATKB 3BC9A 4ISVA 1U8NA 4K2UH 1JGEA 2VERA 4F8PA 3DKHA 4Y5VA 5I6OA 1HINH 3WFBH 2C9QA 5AKVA 2ENYA 4LAQL 1BLIA 2JJVA 3G6AA 1NCBL 2G3NA 5DZOA 3RDTA 1A4BA 1Z3GL 1KCUH 2WBJB 1H3WM 1CG9B 1CR9L 1S7VB 2WOYA 2HRLA 4RGNB 1OCCB 1BQLH 1ITCA 1IB5A 5BO1L 3QUMH 4FNUA 4KRLB 5DR5L 3QPQC 5FO8A 4FA7B 3G04B 4U1NB 2XHNA 3QRGL 4NNYA 4P5TA 3IPFA 3VDBA 2DIEA 4HMEA 5I1IL 1MRFH 3UTZA 4ZDHB 4ABWA 4BZ2A 2RH0A 3KEHA 4N2BA 4S1SH 4MCNA 1HQ4B 7PAZA 4HJSA 3TIDB 1Q9OA 2YARA 1CLYH 2HB0A 2WCPA 3ZQWA 2YD3A 5HYJD 5T3XE 1P84K 5I1GL 2NY2D 4X6CA 4APQA 4MD0B 4N6RA 2XQBH 1KBPA 4GAGH 3ECVA 4QF1A 1N3NB 3F7LA 3L1FA 1ET5A 4OD3H 4YE4H 2W9LA 1PKQA 2V9UA 2DIAA 3GINA 3NMEA 4PY8I 2VZTA 5D7JA 4HKZA 5A2BA 1X5IA 3PGFH 4Z0XB 1V3MA 1MJ7H 4YDJA 3BYYA 1KB5H 3CXFA 3VAEA 2HRHA 2FD6H 3QJFB 3TT1L 2EE3A 1DANT 1O6VA 4U3CA 3QPQD 3JYBA 3UEZA 3VD7A 3L5WA 4DEPB 2MHAA 4U2ZA 3ZO0A 1D7DA 2VUKA 1Y07A 4GW1B 3MRJA 4XPFH 1YEKL 4DTGL 4F2EA 2ORBL 2PCPA 1ODUA 2PKDA 5I23A 5FGBA 5A7EA 2DEXX 4PRPB 2WB7A 4YDVB 2P28B 4JO2H 4KTDL 4Z7QF 3E80A 1KB5B 1SOKA 2G0KA 2KPWA 2YUZA 5F9OH 1QFOA 1I3RB 3STZA 5HI4D 4XH2B 3QUGA 1PKOA 3C75A 3S4SB 4GYBA 4E5XB 2ATAA 4G7QB 5CSGA 2BHUA 5D5MF 3IWVA 4HWEL 2Y5TB 4HIXL 4OCRH 5CBEA 5TE4L 2EYTA 4JR9L 3AZUA 3QUKA 3UH8A 3T09A 3LQMA 2B8OT 3N42F 2WO2B 1F6FB 1FL6A 1HEJC 4U1KB 1E4WL 3FTZA 3BJLA 2QTEA 4GRWF 2ODIA 4JHVA 4S0SD 2I69A 1AXTL 4XNUH 5GJSH 3V6ZA 3L3GA 4YSTA 3BH9B 4DVBA 1L9TA 5ICZA 1PLBA 4M6OL 3GB7B 4Z7NE 1QFUH 5LN4A 4ADGA 1FCCA 2NX5D 2P5PA 2TRHA 1L9SA 3LKOA 5KAQG 1G7HA 3T4AB 1T7XA 1RIHL 1KCKA 5CMAA 2B15A 3SCMC 3ZYIA 5GISH 4GOSA 1A3LH 4XMKH 2AJXH 3G5XB 3S8FB 2V0AA 3SZ6A 3V8CA 3E9UA 2R2BA 3VWJA 3EG9B 3CIQA 1SFHA 3MRPA 3LDBB 4JCLA 1JNNL 2RALA 4OGYL 3BSGA 2A2QT 1NANI 1E5ZA 3MNZB 3HUJE 2PWHA 4FXLA 1MJJA 3HBQA 4J8RA 1U0QA 2BH0A 3VVWA 5BJTA 5FHAH 2BS8A 5D71H 5D2LF 1RULH 4ZAKC 5DHYA 1ILSA 1C16B 1KTRL 5BQDA 2VDRL 1WC7A 2PPFA 3PHQA 4UM8A 2Q6WB 5A6IA 4RFOL 3JZYA 5C07B 5M94B 5EC2B 5F9DC 5C09E 4IGBA 3GSQB 1RUAH 5FOBA 3H9HB 1NDMB 4JFQA 4NPKA 4AT6A 2J12B 1PD6A 5AEAA 2WKLA 1T0NA 2YD9A 1RHHA 3E3QC 3MX0B 2IMNA 4U6VH 3CZJA 1AO7A 2FGWH 4N2OA 1KIRA 2VMFA 3SCMD 3WAJA 5FA3A 4FJ6A 3TGXA 4OF8A 4YDLC 2NW2B 1CLZL 3MUHL 1F6AB 1HSAB 4OLWL 4QRFA 4WTQA 4YOKA 4LLUB 4BKLA 4NX0A 3OHXB 2VM9A 4PWJA 2JKRM 5HXMA 2YS4A 1UYWH 2AXGA 4MXVF 4NKIH 4NM8L 1NBYA 1I7ZB 1USZA 4NSKA 5D96C 5GGRA 5ABZA 5AVSB 3TVMB 5DUBB 1QNIA 1R3HB 3B9KC 1PY9A 1OP9A 5B39B 3IXTA 5EU7C 1PX4A 4CGUB 4NO3B 1U9KA 2ODHA 2XI9A 2GJZA 3KPQB 4F93B 1MH5A 2P7TB 3R1GH 3ARXA 1OF2B 2X4OB 3NIGF 4CGTA 4N24A 1Q9LA 2NY1C 3QDMD 2BP0A 1BVZA 1UWXH 1CI5A 5I26A 1G6VK 1HT6A 2JLPA 4E9RA 3VXSA 4E2OA 2P5EE 3C5SB 5EEUA 3T0EB 3ZUNC 3CVBA 1OK0A 3D2UD 2J8HA 4TNWK 5J57B 2C7UB 4A04A 5DLML 3S96A 3S2AA 4NFDA 1K4DB 5GGSA 4IJ3B 3SGEH 3HNTL 3MA7A 4I88A 4O9HL 3KPSD 4IS6B 1AG0A 1OE3A 3DMMB 4OFYD 3AXIA 2YUWA 2X6BA 3REVA 2IAMA 4LLDA 5I6XB 2Z91B 4ODHL 4WTXA 3C08H 1YEDB 1JZ4A 1AD9B 3TL5A 3QDJE 3H55A 4FHJA 4NS0A 4ZMOA 4XN9A 2O6DA 3B9KD 5LG1A 3SZKC 1BDYA 2Q76A 5SX5H 3ZHNA 5E0QA 3V52H 1TTGA 3MLWL 1X4ZA 3UG3A 3E9TA 3W0WA 1O7DC 5DU7A 2A38A 3N1FC 1E5UI 1X6LA 1YN7A 4MZRA 1F4WL 2NY1D 4PI0A 3W81A 5MENB 3ZE2E 2F7OA 4A67A 4ZTPL 3W39B 4DHLA 3UJJH 2Q9OA 1NLBL 4JM2F 4QTFA 4ODTH 2XVGA 4PJ5A 4DGVL 3B7RL 3FF8A 3AAZB 3JV4B 5E6RB 1H8NA 1LO4L 2YK1L 1S2EA 4WUKL 5JOPE 4NN5B 1XIWA 4XAWH 3TIEA 4Y8AA 2FHBA 1OSEA 1SVCP 3AACA 4Q0XH 4XO8A 3CCHA 4NZUH 2H4EA 2IOIA 3SDXE 4HWBH 4HDIA 3RG1C 4AH2A 4Z7QB 4JKPL 1VACA 5FYJL 5C0GA 2EC8A 4R0LC 5CSZB 1P4IH 4L05A 2R8SH 12E8H 1QATA 4GRWH 1K9TA 1ZGLB 4BINA 3DPBA 2AV7B 5D5MB 4YHNA 3AG2B 3C6SB 4NBZB 3K4AA 2GIXA 4PJ9B 1CICD 2Y36H 3CWGA 1T7WA 1R4XA 4X6BB 4LLMA 3I6KA 3N42B 4APXB 1U3HB 5E9AA 3A4EA 4JQVA 2B1OA 1PZ5B 3KLDA 1T4WA 3WS3B 1LK2A 1ONQA 4HV8B 2FB4L 4LQFL 3RHWF 4GRWB 1QRNA 4WFGE 1P1ZB 1EEQA 4GXVL 3P3TA 2Y6TE 4P3DA 5E2VL 4AX3A 1MVYA 3GPEA 4WHTA 4OLZH 1FYTB 3SKJL 1ZVHA 2R2HB 1JTOA 1TYJA 3G9VA 5EU6E 3RKPA 3FUDA 4JZJA 3QEUB 3A23A 1U8JA 4U0QB 1WPCA 2Z1KA 2CO7A 1B4JL 1JN6A 4AQ1A 4Y9GA 3GI9H 2IPUG 5CXPA 1FFNA 1KYUA 3QCVH 5F6HI 4PJBF 3VU1A 4N0FB 5HDQL 2E6JA 5A2CA 4FXGC 2HT4C 4O2FA 3WEXB 1SNRA 2YAMA 1R1CA 2UZYA 4JGMA 3HS0A 3AFLA 3IFPA 4OU3A 1YPZE 5IZ7A 3E38A 5HYSB 1K4CA 3COOA 1GJWA 3FNKA 3HG1D 3WL9B 2WAQA 1T5XA 1RMFH 4GW4B 2O5ZL 3MRLA 3RX9A 5CCGE 5FLVA 1WFNA 3QO0A 4D0CA 5D2LB 2OSWA 1UASA 1D9KC 4X4ME 2CCVA 5SWSA 1AE6H 1TVHA 2PPAA 1X7SA 2ZAGA 4ZW6A 5EUOF 4N1EA 4EUPG 1DQMH 2AQNA 4OUUA 1PG7X 2XKNB 5KYNA 3KYKH 3S6CA 2NZ9C 1MCPH 3GHEL 5T3XD 3SOBL 1ML0A 3QDGA 5I1CH 3ES6A 3EO9L 1WFUA 3FJTA 3M8OH 1NGPH 5IIEB 5EWIH 4NXSA 2X4RA 3RX5A 5I1GH 1U95A 4V1DE 1WFJA 2X3BA 3EJTA 3PGDA 1FG2B 1E4KC 1MFBL 2NUTB 1F86A 4J1UB 3EHBC 2HT4D 4BEIA 4A7GA 1IGIL 5EU3A 4BFBD 1A6TB 3FS9A 5FK9B 3BQUC 1TJMA 1ZANL 2FNWA 1Q1PA 3BVDB 1HNYA 3NZUA 5DJ2A 5EZLA 3UC2A 1I9RL 2N1TE 3WKNA 3SY0B 1WHOA 1RJLB 3R19A 1KJ3H 3PWVA 1R3LA 3GSRB 4U3SB 1U8HA 1RFDL 1D9KD 4LCWE 4HS6B 1RZ8B 3NIGB 4XNMB 1G9NH 3ARGC 1T5WB 4OIIL 1G1YA 4JPKL 1DVYA 3AQDA 3CE1A 2EDXA 4U6HA 4NWTL 3WCYA 2X0UA 2NZ9D 5KVDL 2EKJA 1ORQB 4HT1H 4I4WA 4JFXA 5GS0C 4X6FB 1UWXK 1FDLH 2N3JA 1FBIH 2MKWA 3GJFH 3VJ6A 4BCZA 4M7KH 4NENA 3TA3C 5I8OL 4AYGA 1ZT4B 5EUKA 1LL1A 4GSDL 3UTPD 1Z5HA 2DLEA 3BPNC 2NXZB 4PM1A 3LH9A 4OJAA 5K5YA 1UJ3B 2F1EA 1IMHC 4BD4A 1MRDH 3ZJAA 4GO8A 4JPWH 2NXYB 1B4RA 2X3AA 3L81A 4FQQB 1T2XA 4L5FH 4BFNA 1INEL 3BQUD 1NFIA 3BQVA 4U1GC 1VENA 3EYVA 1TCMA 3L3DA 3QZWB 1AJ7H 3AM8A 2YPVH 3GJFB 1BWMA 4X6DE 1FUNA 5D6CA 1A1NB 1D6EB 3U30C 2GTWA 3BAEL 4M8RA 2GEQA 3OKMB 3ARSA 4PR5A 2IBZY 3UAJC 1SOQA 3ARGD 2E47A 3GMMA 3BVNA 3IGAA 5SX5K 2VDPH 5ESVA 3QA3A 5CEZE 4TOYL 3DUSB 4JM2B 1MW1A 5DI8B 2FIRT 2H2SC 1NFDF 4DP5X 5GS0D 5I1DB 2E7LA 4GLRI 5ETUB 4TL5A 1T83C 1XSIA 5DO2C 5F89B 3WU1A 4ZOBA 3MAWA 1KLUB 5ADOH 4Y5XA 1RLWA 1SLUA 3KGRA 2YFNA 2VDPB 4EQ2A 3PWNA 3WKYA 1F45A 2W9DH 3LX9A 3WFHA 3ASOB 4NQEB 1YYLH 1D5ZB 1FC2D 2WZAA 4DGYH 1XZ0A 3KVDD 5EA0H 4PJHA 2DAVA 4S10A 2AXFA 3CN4A 4V11A 2Q20A 1I8LC 5F70A 4ZFFA 1EEZB 2X12A 3B9EA 3DXAB 2F74A 2Y7NA 2A6JA 4OM0L 3MA9H 2V2WB 4FZ8H 3UAJD 1XAUA 3UTSA 3UAEA 2JXMA 3X1NA 3NDZE 4CVZA 2IWKA 4K9EC 1KXQA 4X42A 5E6IA 1A2YB 4ZD3H 1K5WA 1DQVA 2H2SD 4JM4L 2HFTA 3I9GH 3UGEA 4YHIB 4U0RC 5C0AB 2G9KA 4W9GC 3VFSA 3ETSA 5CJBA 4ZSOB 4FCHA 2GY5A 3IFNL 2ZKHL 3I6GA 5DO2D 2AJUH 1LO5A 1PX8A 4L1DA 2LLGA 3VI3F 1I8IA 4U1SB 4Q7DA 3NGBB 4TUJA 1UXSA 2VC2H 1IM3D 3OG6B 5I8EB 3LQAH 1NCWL 4BA0A 5IWLA 5BMFH 4AGLA 3WNLA 5IG7A 4KK8C 2B59A 4PJBB 3AUWB 4PSPA 4BSWA 1VFUA 1A6UL 2AK4D 9PCYA 5AAWC 2XV0A 3L95A 2HWZL 1E9PA 1XCTB 1U3ZA 3P40A 2O72A 5AYUL 1BXAA 3EF4A 2VXVH 4IQHA 4Z7VF 3B3BA 3BD5A 1WGVA 1Z9SA 5K9JH 1ET8A 3BWUC 3L5IA 3NTCL 4X98B 3IKCB 2A5UA 2VC2B 1TEFA 4KGJA 1QSFE 2DD8H 4IRSB 4QRRE 2IANE 4NERA 4F7CB 1HCZA 4IHOB 5IMMA 4MMXB 4NNPL 4NO5B 4X0NA 3VTMA 4DT2A 2O93L 2YAFA 3O6LL 5EUOB 2XZAL 4MQTB 4O2CA 4UTBH 1MHEA 4HIIA 1SLWA 1OAQH 3U9PL 2B5IC 2H6OA 1ZJBA 3D0AA 2CBMA 5K93A 1FGNH 3CFCH 4ZO6A 3X17A 1LWJA 2Q2LA 4OZGF 1KXVA 1DFBL 2CUIA 4LOUC 1PNCA 4KK8D 3CFKB 3UYRH 4P4KC 1JGLH 4J23A 1IGFH 4Q6YA 4HK3N 5F9JB 1F8TH 1WSST 1YEEH 4FQ2H 4HWUA 5FA4B 3IN0A 4JJ5A 4LPYA 3EADA 2E6QA 4FMVA 4ZQKB 4BCXA 1AIFB 4HUWB 2A9ML 3WN5B 4QXTA 3RPBA 5ABAA 2HMIC 2WXHA 1ZT1A 3BWSA 4XB3A 4DOHE 5JOPD 3TPUA 3WIFA 5IFHL 3D34A 1CDYA 1XVSA 2ZF8A 1N9PA 4J12A 4NRXB 4M8UA 3CZGA 5DJAA 4LGRB 2A9AA 2XBTA 3ESNA 4K2UL 3PAYA 5I15H 4ZW3A 1HINL 1NCOA 3WFBL 1MHHB 4AE0A 3P3UA 3UZVB 1CDIA 2H47C 5TF1H 4POZC 1KCUL 2QBWA 1ZHNA 4JLRA 4PRHA 3BEVB 1FVCA 1M05A 3MO1A 4LOUD 1CYGA 3NDYE 5I1AA 5A2KH 1BQLL 1FNEA 2ZSVB 5DJ8A 5HHPA 4I87A 3PHOB 5E94B 3RWCA 3GJFK 3QUML 5F8RC 3D5OF 3EOBA 3DVGA 3HE6A 1RSFA 3LZFH 1Z3RA 4MVBC 3GTTA 1T21A 3RJOA 3UIYA 3H85A 2CHWA 4AXWB 2N4IA 3QQDB 1MRFL 3HVNA 3QJHA 3GS7A 4WFGD 1HHKA 3L2MA 3O9WC 2P45B 4O58H 3H2QA 4MD4B 4S1SL 5F2FA 1UZ6E 3TBSA 2HMID 1QFPA 3UDWA 1CLYL 2CLRA 2FVNA 2ZOTA 3WTWA 1BG9A 5EU6D 4FQXB 5HJ3A 3QC5X 2OM5A 4Z7UA 3TASA 1TPXB 2X87A 2HJKA 2XQBL 4GAGL 2ARJB 2H1LM 1ANUA 4CSSA 4OD3L 4YE4L 1UM6H 3F7PC 5EOTB 5IQNA 5GSVB 3V0IA 4Z77B 5KSAB 1NFDB 3FFCE 3SYQA 2GYSA 4POZD 5FUCE 1X6NA 1O7VA 3T9WA 3KDMA 5JHLA 2DQUH 3LN4B 1V27A 3PGFL 1MJ7L 1HTYA 5GGTH 3WIAA 1KB5L 2OXGB 2NNCA 3U1PA 3V0VA 2FD6L 3GIZH 3WAKA 3JT2A 5FEBA 2EXWC 3P4MB 3GZKA 4MVBD 3N43F 2XDHA 4MAZA 3BZ4B 4XPFL 2VJ0A 5EFIA 3QQ3B 3ZGIA 4M61A 3ABGA 2GBUA 5C0EB 5TGBB 1PYWA 4B9FA 2PMZA 4MS8C 3NSYA 3CZFB 1JV2A 3O9WD 3RHWK 3CN3A 1Z9MA 4Y4FC 1A4AA 4UQIM 4WWPA 1AQDB 4JO2L 2ZUTA 4HFWA 1GW0A 5J12C 3FFOA 2JJSC 5F9OL 3APDA 2IDSA 3C09B 5K9QG 3O11B 4X7EC 1CD1B 2NYKA 1SUJA 4N2HA 3TNNA 2MPVA 2OW7A 4PJEF 1I9IH 2X4QB 2D0GA 1DVSA 4OCRL 1J0IA 2QKSA 5JMRA 4V1DD 5CJQH 1GA2A 3CSTA 4HS8H 4Y5VC 5CP3H 3NABH 4E9YA 4YK4B 3IGFA 1RPQA 1IUZA 4CJ1A 3ISRA 3E8UH 1CG9A 4UQ3B 2J6WA 3VI3B 5L8KB 4G6JH 3RDTC 4Q56A 1A8JH 2EIBA 1ZTXH 1HOCA 2ZOOA 4UI2A 3GYRA 1R19A 2EXWD 3HZKB 4FI8A 1H6UA 4U1NA 4MB3A 3THMH 4XNUL 5GJSL 1JYNA 3N91A 2JI3A 4Y2NA 3I2CH 3VXMB 3WY3A 1QFUL 4ONHB 3SKMA 5C7ZA 2UXGA 4BFIB 4PJ7E 3OL2A 4ZDHA 2GC7C 4MS8D 4P5TC 3PXJA 3NRPA 3OR6B 4PVNA 2RACA 4Z7VB 1G87A 1G6RH 3TIDA 1IRAY 1WIOA 3FHQA 5GISL 3GLEA 1MFEH 4ODXA 1A3LL 2YD2A 4UV4H 2AJXL 3QUMA 4XMKL 4LOVA 4MD0A 2DZEA 2EIKB 3IMUA 4Y5YB 5F9WB 4WFFE 4Z5RB 3VQLA 5CGYC 5KVMC 1UM5H 4APQC 2EABA 1T2JA 1WFTA 3FSZA 3KYNB 5GRXG 1G6RB 4W4OC 5B4MC 4Z0XA 4AJYV 3HN3A 4Y1SA 1KFGA 4PJXE 3K2KA 5FHAL 3OD3A 1XF4A 1NEPA 3RDTD 5D71L 1RULL 3QJFA 2FX8H 5D7JC 5AW3B 4MSWB 4OZGB 1IFGA 5KS9E 4UOJA 2BOCB 4BHUA 1Y7VA 3MMEA 5C2BH 4C4KT 2VRAA 3LEYH 3RWGB 5DZLA 1RUAL 2EDEA 4MLIA 5EZOH 3RB5A 5C0RH 2XKUA 4P5TD 1CUOA 4PRPA 4U6VL 1BOGB 4AENA 4YLCA 5H4ZA 3GQFA 1MFUA 4K9JA 2FGWL 5E8EB 4EI5B 4WNJA 1KB5A 5CEZD 2AI0H 4HJ0C 5AVRB 1I3RA 3BFQG 1A25A 1XF5B 4XH2A 3Q6FB 1MJ8H 4E5XA 4ZXBC 3NAAH 5AB2A 2VN4A 3RUGF 4RSVA 4BIKA 1TG8A 2Y5TA 3CFMA 3QPXH 5BUGA 5CGYD 3KPMA 1UYWL 4ODUB 3N3EA 4AVKA 5DJXB 5C0DA 3PDOB 4NKIL 2V4LA 3MDJA 4I9WD 4NKQB 5DZJA 3QZBA 4E0RB 1OAJA 2AMUA 3P11H 3CSGA 2WQVA 5B4MD 5DK2B 4KFZC 5AG8A 5CFAA 3HB3C 1A3RH 4U1KA 2CDFB 2KQNA 4PVMA 1Z9NA 2APBA 3F12B 3VI4F 5I1JH 1NCUA 5ILTH 1GW6A 2OR7A 3B1UA 3BH9A 3GB7A 4OBSA 4D7BA 1CDGA 2UXFA 3T4AA 2E56A 5FYJE 1WAEA 1UWEH 4L1BA 4OD2B 3KBPA 3OX8B 4OF6A 4PB9H 4LL9A 4OKDA 4R96B 3JTBA 4HJ0D 6PAZA 1VZGA 3C8DA 3U25A 3QW9A 1CGTA 3JZ7A 3EG9A 4ZXBD 4BCYA 1R0AH 1SJXA 5I17B 1W0VB 4KO7A 5CP7B 3MGAA 1NGYA 2RR3A 4QNPE 2IFGA 3C08L 4OF5A 4LARH 5IJBC 3AGVA 2WYHA 3MNZA 3NIDE 5G2NA 5IUSA 4WQOA 3LIZA 3AQZA 1REIA 1JXJA 2BVPA 5FCUH 3V52L 1NKGA 3ARTA 1C16A 2Q6WA 2HT3D 3AMLA 4B53A 4MMZB 4Z3EA 5C07A 5AVVB 1F3JA 4Q9RH 4ZYKB 2JFCA 3VSQA 3ILQC 5EC2A 2WQXA 4LVHB 5EBWB 4AZ8B 2ZOUA 3GSQA 1E50A 3P9WB 2ZF9A 3FT3B 3H9HA 1NDMA 3UJJL 4HIHB 4QJ5B 1FZOB 3N85H 1FC1A 1MUJB 1ZRUA 4ODTL 3MX0A 3N43B 3S5ZA 4ZFGH 1QSFD 4IGBC 2PYFB 5F0JB 4QRRD 3FO1B 3QUYD 4LEBA 2IAND 3EOAB 5HHVH 5LAXB 3EJJX 5J3HC 1R6VA 4XAWL 2NW2A 1EAQA 2AAVA 4Q0XL 3X1BA 1F6AA 2OKMA 1EAPB 2CRYA 4GJTB 4HWBL 3IJEB 3OHXA 4L3EB 5TQ2H 3INOA 4AIEA 4ZFOL 2EICA 3RY6C 1P4IL 3TFKC 1DJGA 1LYQA 2R8SL 1AVAA 12E8L 3CPLB 3D85B 1B9KA 1ZS2A 2Z0BA 3EGSB 4PG9B 4PJEB 3TVMA 1R3HA 5B39A 1HWHB 4NO3A 4AUJA 3UGXA 3KPQA 4K71B 2EAEA 2P7TA 2BCMA 43CAB 3GTNA 1YSOA 4XPBH 2X4OA 4NAMA 4WI0B 5FKAB 2WZPA 4JPIB 5C08E 2EECA 4QPEA 3ILQD 2IWEA 2XCMC 2PO6B 3DYMA 1M7XA 4KMTH 4N2EA 2CK2A 1E8XA 3C5SA 3QJOA 4YSRA 4UT9H 5CD3B 1H6EA 4KX8A 3T0EA 5F7DB 1YY8B 2VLJE 1L7IH 2Y3AA 3KPOB 2AC0A 2C7UA 3L9RA 4OLZL 3HBPA 5KW9H 5J3HD 3QYNA 5E8PB 4XP6H 5L8LB 2EO7A 3QIWC 3T0EE 3K8KA 2Z91A 3GI9L 5DEJA 3TFKD 2ZXAA 3NCXA 3QCVL 1CC3A 3VYNA 4MB1A 1YEDA 1AD9A 5DVNA 4A55A 1Y6MR 4KKPA 4K55A 5J6HB 3IE9A 3V0EA 5B3JF 4O00A 1JXFA 1GYCA 3AABA 3L5XH 1IL1B 1LGVA 1X5KA 1HX0A 3S3CB 3CC1A 5L0QC 1RMFL 5KVDE 1NC2B 4JO8A 4RBPH 2A4EA 4X8XA 1B3IA 3QXAA 5L9DH 2WBWB 4G11A 3UYOD 1VFBB 1TF4A 3W39A 5DXWA 4F15B 1AE6L 2FATH 3CNKA 3CDGA 4ZO8A 4LHUG 1DQML 3JV4A 2XG4B 3WFZA 5HDBF 3ARYA 2GJRA 2BMKB 3MRKA 3VXSD 5BZXA 3KYKL 5E8OB 1RV6X 2HRPH 4LHUD 4GG6E 4R84A 4NN6C 5I1CL 3QIWD 1XIWC 1TTCA 3J8F7 2N01B 3M8OL 1NGPL 3R7QA 5EWIL 3JVGC 3HW7A 4PGEB 7TAAA 3X11A 3I3BA 3ARUA 3FFCD 4WEBH 1ZGLA 4NYLA 2DJUA 1S4IA 2AV7A 2R2EB 5DRZB 2WUBH 3GTVA 2RD0A 3C6SA 2CG9X 1U2CA 3DX3A 3FSAA 4PJ9A 5TPWH 5EO1A 1JZEA 1F6LL 2ED9A 2XV3A 3NFNB 1OALA 2PF6A 4HWBA 4ZFOA 4APXA 1U3HA 1CWVA 1OT1A 1KJ3L 3BN3B 1PZ5A 5E4OA 5J1AA 1FV1B 2V5MA 4ZOEA 3FXIC 4XPAH 5TD4A 3W0WD 3VI4B 1P1ZA 2IWGA 2QHLA 4JQVC 1G9NL 5DZ9A 3GGWB 2G5BB 1BA9A 1MSPA 3MUUA 2Y4SA 4HJGA 4Q9QH 1Z9PA 2IBGA 2R2HA 4X5PA 5PAZA 5KJRH 4CU8A 4NCC2 3ABKB 1E30A 4JO4H 1ZDSA 3FBQA 3AADB 3QEUA 4HT1L 3OGOE 4PTTA 5CKGA 1FDLL 3JSSA 1FBIL 1Y1DA 2EDQA 4P46B 3WTSA 1H3UA 1XIWD 4M7KL 2MEJB 5E1AB 3DURB 5AOKA 4X0KB 2V2XB 3KNBB 1JZHA 4MJIE 5MEPA 1QUNA 4URTB 3NJNA 4X2UA 4AQ1C 5FB8B 1E3XA 3LN9A 3V5DB 5ICXA 3WEXA 1MRDL 2VW7A 5DJCA 4JPWL 5FFGA 4L5FL 4Z1PA 1U2HA 5HYSA 3WL9A 5GGVY 3PU7A 3SGJA 3HS0C 1AJ7L 4GW4A 2YPVL 4KDWA 4PS4H 3ZY7A 1H19A 5AVUB 5D2LA 2HAZA 3B7YA 4FL4B 1L0XA 1S8DB 3AS1A 2H3NB 5JXEA 5J11C 4L4VE 1WFMA 2VXTH 3ATDA 5E8DH 4JG1H 3FCUB 5H37A 2VDPL 3SYAA 2XKNA 3S5YA 2BK8A 4S11A 1B0RB 5LBSH 8FABA 1QOKA 3LMJH 4Y4KB 4TNEA 2ED7A 4AYFB 5JLZB 4NKMA 3BUQA 1EBAA 1OCZB 3DVNB 4WFFD 4AW7A 4YSEA 5IIEA 5ADOL 1EZLA 4Q8BA 1NDGA 1SYSB 2YFOA 1FG2A 4HKXB 2A99A 2AGJH 2ITEA 2XTJB 4RQQB 2VQTA 2EIZB 1YYLL 5FK9A 3D3VA 5H4YA 4DGYL 5HSFA 2YLHA 3KL3A 1XDTT 3KPPA 1CCZA 5EA0L 3AY2A 3TBTA 2N7BA 1U8CA 5SWQA 1HHHA 1RJLA 3SY0A 3UPRB 3OGCB 3TWYA 3VYPA 1TUPA 2FNBA 4HS6A 5JDJA 1RZ8A 2IBBA 3MA9L 4FRWA 4HHGA 4FZ8L 4G9FB 1OGPA 2ADIA 1WBYB 4WDIB 2JH2A 5MI0C 1FZJB 1J1OH 1QWNA 3OZ9H 2VAAB 1CTNA 1ORQA 4H5SB 4ZD3L 1FPTH 3QIUA 2F0CA 3I9GL 3BPOC 4X6FA 2MWCA 3T3ME 1WGOA 2VRQA 1GMEA 1KTDB 5FGCE 1QD0A 3VM7A 2AJUL 3WUWA 4IBZA 5C3LD 3GSUA 2C3HA 4F9PA 1X5HA 1Y6KR 3FTVA 2VC2L 4G1MA 3LQAL 3TBYB 5BMFL 5J56B 1E42A 1F02I 4FQQA 4R4FH 4JFDE 2J55A 4FNLH 1I4FA 1UD5A 4CA4A 3SPCA 5E4EC 3QZWA 4RGNE 3GJFA 2VXVL 3VQ1C 5I74B 1H8OA 1D6EA 1H3XA 1DJYA 1KN4H 1H6TA 4L8SC 4E9SA 5K9JL 5KANG 1A6ZB 6CGTA 5FYJD 2VJXA 2Y7QB 2CO4A 4AZUA 3WEMA 2DD8L 1BZQK 2NY3C 3IDUA 5J6GB 4P99A 4WGVB 3DUSA 4JM2A 5DI8A 3ATEA 1DQQB 3GF8A 4WSJA 3OG4B 4RBPK 4UTBL 5I1DA 2HG5B 3AU1A 2YPVA 1HN1A 1J5DA 5HDBB 5ETUA 1OAQL 1RK1B 5F89A 4LGSB 1FGNL 3CFCL 2BFVH 4OLXH 4AEHH 2E7LC 1DFXA 5DD5H 5HTSA 3I9IA 5DQJB 2YUVA 2WVVB 5BQ7B 4XOBA 4BWWA 4WWOA 1KNOB 3UYRL 1JGLL 4N6QA 1I8UA 1IGFL 1U41A 4IJTA 1KWGA 5C0JB 1F8TL 1NMCB 4NC1C 1AHKA 1YEEL 2C9RA 2IF7A 3MRMB 4FQ2L 4R7XA 4K0OA 5FYKU 1CFQA 3SB3A 1KXTB 4ES8A 1CDUA 3QRLA 3EYFB 2IH9A 3Q5YA 4AKOA 1DUZA 5BS0B 1FA4A 4WGKA 2BIPA 2WN3A 4HUVB 3KZ8A 2NY3D 1PJWA 4HXBH 2UY6B 1UFUA 3VXPB 1YUHB 4J3OF 4FERA 3BRGC 2C3WA 3TYFB 4YHIA 4XXDB 1S7XB 5I15L 2EDYA 4ZSOA 5E6IC 1AACA 2NOYA 2XJLA 4K8RC 5IREA 2BNRB 2H6UA 2YR3A 5BUAA 5GS2H 2LQRA 3VVVA 3K4ZA 2HX9A 5CF3A 5TF1L 1RPKA 3OKLA 3FB6B 5I8EA 3ZMNA 1BV8A 5LKNA 4PJBA 5MERA 3K6DA 3CQFA 3MLTB 4UM9B 2XWJB 2LTQC 3BLKA 4FYQA 5E95B 3LZFL 1SBSH 5C08D 4GS7C 4YSQA 2I24N 4HJJH 1D3CA 1EBPA 1BF2A 2P42B 3HG5A 3KS0J 5TH2B 4X98A 4O58L 5E2WH 1UUSA 5F3HB 1L0PA 1TZIB 2VLJD 3MUGA 1P9MA 1YMME 4IRSA 5FAAA 4B9KC 1A0QH 1UVQA 4F7CA 2KZWA 2B16A 4IHOA 2FK9A 4HHAA 4MMXA 2GC4C 5D1QB 1QFWH 3MGOB 1PZ3A 3QUXD 4AV5A 3MOQA 2FWOA 3PPEA 4XC1H 3SD2A 3FH8A 5E6ID 5IHHA 2PXYD 4K8RD 1UM6L 5H94A 2V3FA 1MI5E 3GXMA 4KJWC 2WIIB 3UBXI 5PCYA 2G3XA 5LXVA 1LDSA 4NM4H 2BVQB 1FFOA 2DQUL 2DQ6A 5GGTL 4KKCD 3WY4A 3VMOA 2FT7A 3CFKA 4KROC 1AKJD 3S5LB 4OLEA 4PLJC 4HEPG 3GIZL 1I7TA 4UTBA 4I77H 3GDBA 1NQBA 5B1KA 1MNNA 2RIKA 4IYKA 1OL0A 5FA4A 3TH2T 2G0LA 3RWFB 4X9BA 4H8VA 2FEDC 4ZQKA 4OFKA 4WWKC 2B20A 4B3VA 3SYCA 4AGQA 1AIFA 3CFJB 1KT2A 3LZNA 4HUWA 4ATWA 1CFBA 3WN5A 5BVJA 4JGUA 4RAUB 1UG9A 2HKFH 3MTRA 4TV3A 1U92B 1CTOA 3VFNA 3GMOB 2VE6B 4OJFH 3WXWH 4PHXA 5L4FA 4NRXA 3KPRE 3A6OA 4IIZA 1ES0B 3BVWA 3BIAX 1SXCA 1MCWM 4IBVA 3KL5A 1CT8B 2WQ8A 1I9IL 4YDMA 1KPUB 1MHHA 5EEXA 1G0YR 2BHZA 1NCAH 4XP4H 1RPUA 1GCYA 4LVNC 5CJQL 5IB4B 4HS8L 1ZWIB 4UNIA 3NABL 4W9EC 3BEVA 2AANA 1THAA 3E8UL 1G7QB 1HI6B 1AGEA 3C60B 2NR6A 5B1BB 4KROD 2ZSVA 2WWKO 4G6JL 1HS6A 3PHOA 4PLJD 1ZTXL 3H8NA 5AL0A 5E94A 3A0OA 4B7LA 3UIZA 1A1OB 3ORJA 2GI0A 3VGHA 3I2CL 1ADQA 3QQDA 1C12B 5DYOB 3W38A 1PMYA 4WWKD 2DICA 1U58A 2F8XC 2OCCB 1O9WA 3U0TB 1JF1A 4MD4A 3DRTB 1SQMA 2WSPA 3VQMA 1G6RL 3T6ZA 3HHRB 4LDCA 5D1ZI 1A21A 1FP5A 1MFEL 2DQEH 2VR9A 4UV4L 4WWNA 1NUFA 3PUUA 2DRUA 2ZG3A 1OB1B 3UDWC 2XICA 4R2GB 5E9NA 3UBFA 4ATTA 2GBTA 4ELME 4Z77A 5H2BB 1KJVB 2A0LC 2WZ5A 1UM5L 5EN3A 5KSAA 1NFDA 3E1F1 2ERJC 1E28A 3ARFA 4MJID 2ICES 5KSBF 1I7RB 1E4HA 1PLCA 4Y1AB 3BUTA 4DP7X 3BLBA 2OXGA 3KL0A 4CVUA 5DHMC 3S36H 1YO4A 4FJZA 2FX8L 3H4HA 5GZOD 1UEYA 4YLQT 4UILH 4LLAA 1K8IB 3NJIA 3V9CA 3MV9B 4AMWA 3TM6A 5IQMA 5I1EH 5GXBB 3KLKA 5C2BL 4LNVA 2BERA 1YNTA 3LEYL 4J3OH 5EZOL 5C0EA 5TGBA 2Z8WC 1A14H 3QNZA 4EF3A 2ZX5A 3CZFA 1LEGB 3OKNA 4L4VD 5C0RL 1FE8H 3FUEA 5MENE 2ZWYA 5GGTA 1AQDA 3SE6A 3ZE1E 2EYRB 3HE7C 3LZRA 4LIQH 2DKUA 4OD1H 1PVHA 2AI0L 3RL1A 3H42H 5I5MA 3KLSA 1C08A 1CD1A 3U6XA 1MJ8L 1NKRA 2NSQA 3ESMA 2EEDA 4WFEE 2XRAH 3NAAL 2F6AA 2MNJB 3AGWA 5I2IB 3QPXL 5F6IC 1ACYL 3M1BA 4R4BB 5F1IB 3MOBH 2A0LD 5T5NG 1JWSB 3IPBA 1XR9A 3ZGHA 2B3RA 1O6TA 3TV8A 5IB2A 2AQ2A 2CCLA 4AJ0A 1FRGH 3P11L 1BF8A 4ODVH 1A3RL 4JHUA 2CJUH 2LLLA 3VI3A 2D2CC 1ID5I 2Z4QB 2WBJC 3K91A 3P73A 4L4TE 5D5ME 5E9DB 2ADFH 4LNRA 5ILTL 5I1JL 1NFAA 4RGNC 4KX9A 3RU8H 1EEUA 3VXMA 5DSCB 1M1XA 3CK0H 3F5WB 3NJJA 4GAJH 4WHCA 1NOAA 1OSYA 2Y5EA 4F5CE 3OR6A 1DLFH 4Z7VA 1UWEL 3VSUA 4PB9L 4GRWE 3EGDB 2O5YH 1HL8A 5ID1B 4PRBB 1F2XK 3FTYA 5IJVA 3HE7D 2YPLE 5AVZB 4WU7A 5K1VA 2BIQA 4EPSA 3MACH 4ES9A 1FYTE 4U31A 4Y5YA 1AGDB 4HLZG 1GYAA 1R0AL 4Z5RA 2DMHA 4YWGH 2WUCH 3MJWA 1FIEA 3LKNA 4LARL 2WZ0A 2Y2TA 4MDIB 1G6RA 4OM1H 2DM4A 4Z3JA 3QZMA 3V6FB 3FQUB 2MOQA 2E4FA 3NP3A 4FKKA 4JFDD 2C9XA 5FCUL 5AZUA 2WBJD 3VRJB 4DETA 4MSWA 1HHJA 3HFFA 4U1HB 7FABH 4K7PH 1U8PA 4RGND 2BOCA 4Q9RL 1BZEA 5IJCC 4B60A 2OMBA 2XV6B 1I1FA 1U8KB 4ZUVB 3KR3H 4DEPC 1DJWA 1AIZA 2VLLA 3N85L 2APFA 2AEOA 4JPQA 5ACMA 4PW3A 1BOGA 1PZBA 4ZFGL 5EDSA 5IEHB 5E8EA 4EI5A 5I28A 4FNPA 2E7CA 3DI3B 2X05A 2QFPA 2G5UA 5B1JA 4WK0B 4N2NA 3UEQA 3KEDA 4WI6A 4BYHA 3ZYJA 1AYOA 5DD1H 1HIMH 5BOZG 4LSPH 4YHYB 1HSBB 5DJXA 1L0QA 2CHZA 3PDOA 3O4OC 1AR1C 3DGCR 3ZDYE 4AIOA 1Q38A 4X8GA 5DK2A 4J3UA 4EZJA 2Y25A 1DCLA 2CDFA 4LASH 2QR0B 5E5MA 3CJJA 1USQA 2C8NA 4XO5A 3HS9A 4XPBL 2DN7A 4MXVE 1DQJA 1CXLA 3ZHLA 5DHVH 1GOHA 3NP4A 2HTLC 5AVWB 3TA4D 2BVTA 1AD0A 4FD0A 2Y7OA 4KMTL 1V5JA 3NG5A 4LCUB 5J6SA 4DK3A 1NAMH 4UT9L 3KJ4B 4XXCA 4HSAC 1JF5A 4OD2A 1L7IL 3GMRB 3OX8A 5C0BB 4I0PB 2WBKA 4R96A 5L88H 1HE7A 3T4AC 4S2SB 1LE5B 3NIGE 5KW9L 3TCTA 4PRPD 4XP6L 1XGPB 1RZPA 4LSTH 2R29H 3CDFA 4PJFA 2K4WA 4XODA 4EI0A 1JPFB 4JY6B 1YLBB 4MA8H 2Z34A 5I17A 5DHVB 3S4SG 5CP7A 2HG0A 1JZGA 4HEMA 3N0PB 1XT5A 3DJSA 1NAMB 4QXVA 1SHMA 1AR1D 1FH5L 1QTYT 3LDBC 3FT4B 4B0MM 4KKLD 4LSUH 4PU2A 3L3JA 4FS0A 5BXFB 1RHFA 3K2MC 3L5XL 2P24B 5KSBB 4WIQA 1NCTA 4MMZA 4WI3A 5KYYB 3MCLH 5DK0B 2P47B 1JZ5A 4ZYKA 4AZ8A 5EBWA 2ZJSH 3S48A 2HTLD 2K7PA 4OCXH 5A7BA 4IRJB 4XNAA 2AABH 5L9DL 1IEHA 3AROA 1MUJA 2A74B 2DYSB 2YXMA 5FW7A 2FATL 4TNFA 1LEKB 1DDTA 2PYFA 1CFVL 3FO1A 3OKOB 4L9LB 4CC0A 2OMWB 2HRPL 2VDNH 4YN3A 4TTDC 4R5VA 5AUMA 1J8HA 2ZSWB 3IJEA 1NOLA 4LHJB 3O45B 1JHTA 4GXUN 5GHWH 4LLYA 4UMGA 3DYPA 4WEBL 3CPLA 3OHXC 4IKLA 1J5OH 4JMXA 4PG9A 3EGSA 4PJEA 2WUBL 3BMVA 3LKPB 1N6UA 1AMXA 3T5WA 4XWGH 4JPVH 5TPWL 3X3GH 2VDNB 3L45A 4P2OA 3TVMC 1RUMH 2QVFB 3KVPA 3NJVA 3S3BB 5FKAA 3QFJA 3BP4B 4WI0A 1P7HL 4LKXB 4JPIA 2F8VA 4NQEE 2YD1A 4GAFB 1Z32X 5CZXC 1AOZA 3QC6X 4XPAL 2PO6A 3AB0B 1J1XH 3SBQA 3GXIA 2LW3A 5CD3A 3DXAE 1NWOA 3UCRA 1BWWA 3D4YA 1YY8A 3B3IA 4TSAH 4OF7A 4MQSB 4Q9QL 5BW7C 1JG9A 4YE0A 5E8PA 3T0EC 5KJRL 2VABB 4JO4L 4TTDD 1KPVB 5GRYA 3FB7B 4QHUB 3CFNA 1VLXA 2BVEA 1UHVA 5B21A 1JJUA 1YAZA 1RAMA 1VESA 4N2LA 1AR2A 2ZYRA 2W59A 5C0AE 3RVTC 3DMMC 1H9VA 3PAVA 3QJSB 1P4UA 4UT9A 1TO5A 5I6XC 1NCDH 5J6HA 5C6PB 5KSVB 3CHSA 4YR6A 2ZX9A 2DQCH 3BHBA 2IC2A 1IL1A 5B39G 2C4FT 1CDHA 2YOAA 3CH1B 4Z7WE 5FXCH 3C6LB 4AQZA 5I8CB 1DZBA 4PS4L 1NC2A 3Q8CA 4DP1X 3CD4A 5CZXD 2WP3T 2WTPA 1OT2A 1VFBA 3AXLA 5DEZA 3G5VB 4M9PA 4PI2A 1NINA 4RH4A 2WZPD 3VGFA 4RNRB 2VXTL 1J11A 4POYA 3H9YA 5E8DL 3DUHA 2XG4A 4JG1L 3D87B 3IJ7A 2BMKA 1CGVA 5E8OA 5LBSL 3UTTB 3T0ED 2QFRA 3ZSTA 3LMJL 3KLHC 2O5XH 2WXMA 2A83B 4P5KB 3WMPA 4NN5C 4XC3H 3OAYK 5EUOE 1BQSA 5TK4A 3RVTD 4AG4H 3CN0A 4F58H 3DMMD 2QVTA 2R2EA 1CGYA 2FSEA 4NC2B 5DRZA 3F7YB 1D7BA 2AGJL 2NNRA 2XFXA 1CS6A 1Y1UA 4CNIB 1A6VH 4BRJA 3A22A 1PY0A 4CAGA 3VFGH 4RWYH 3QG7H 1VF5C 2W65A 3LH8A 4G9DB 3NFNA 3F83A 3L4YA 2H5UA 3P69A 2X1WL 3N40P 4PJ9C 1YC8A 4P5RA 4ZJ9A 1FV1A 4AL8L 3HAEH 4AM0Q 5I76B 4PBXA 3WO3B 3VI4A 2WXIA 3ZQ9A 1RP8A 3QNXA 1BFTA 1I75A 1S7RB 1U3HC 1S78C 4QRPB 4AIZB 1F11B 3K71B 3GGWA 2G5BA 3CFUA 2NCMA 5MEND 3ILEA 2UVFA 3OKDB 4KOCA 3MNMA 1I53A 1J1OL 2MOVA 3OZ9L 1KTBA 1ED3B 2NDGA 3ZZLA 3KLHD 1FPTL 2IDFA 3FPYA 4WFED 1T80A 2D3LA 4OZHF 3DX2A 3CU1A 5IEKA 5E1AA 1N19A 3HAEB 1QSEE 3DURA 3U7WH 4X0KA 5ERWA 3GK8H 3DBSA 3ZYOA 4MNHB 1EZVX 5FB8A 1W72H 3VXUE 3V5DA 1X5YA 4PV9B 2H2PC 3VD2A 2FH6A 1Y18B 4R4FL 3EDDA 4XNQA 4FNLL 2G4GA 4L4TD 4GUPB 4M29A 4WI2A 5IW1B 5KVEE 3QSKB 1EJFA 3MLSH 4PJ9D 4M8VA 1WRFA 5ENWB 3QQXA 3NSXA 2MIZA 4YAQB 4BK5A 1KN4L 5KEZA 2NY2B 2NY5C 2ZXGA 5DA0B 3RQ3A 3T0DA 4PWEA 1S78D 1W72B 4M93B 3RPIB 1PAZA 4N0YH 2OMXA 3IAGC 5JXEC 2ZUXA 3OSVA 3HLKA 1B0RA 3FQ1A 4XBMA 2W0FA 1JBJA 3JXAA 4Y4KA 3B7SA 3IE4A 1HYRC 4AYFA 1IC1A 2HVKB 3VE0B 3CMGA 3V6OA 1FYTD 5JLZA 1JRHI 1ZHKB 3TNMB 1CYWA 1LTXA 2I60H 3DVNA 4NHUB 1QACA 4BH8A 1N4XH 2WXFA 4GBXD 3VA6A 3AW5A 3JBG7 1CFTA 1MCWW 4MXQC 5I18H 2BFVL 4WHDA 1HHIB 4OLXL 4AEHL 1SYSA 1UD3A 2VERN 4TXVB 5DD5L 1OZTG 4HKXA 3PLYA 1DQTA 3FTSA 4YFLI 2H2PD 3VGGA 5LBSA 2ZP0T 1DSYA 3IPEA 1QW9A 1IEBB 5DRNB 5HYSG 3UPRA 3U7YH 1M7IB 3OGCA 4ADIA 4YHMH 2XVKA 3DX6B 1F4XH 3Q2VA 4N3TA 4G9FA 1NIDA 2JK5B 3O81A 4UANA 3G5YB 3BVVA 4AUUA 1FZJA 5JXED 1M53A 4HXBL 3V0DA 5HGBB 1R75A 2VAAA 4H5SA 1HCYA 3WN6A 4FNTA 4G3YH 5FYKH 4B9CA 1A02N 2YQ2A 1ACCA 2VR6A 2EVIA 4QRTB 1R17A 2EZ0C 2IAAC 2XIBA 2LFEA 4MXQD 1BMWA 4YSCA 4PFEA 1L9OA 3O2WH 3UAFA 3O3AB 1AXSB 1G1OA 4B7IA 2RMNA 2ZCKH 3IXAA 2XX1A 3TBYA 3NEXA 5I9QC 1KB9K 2NX5B 4XX1E 2NXZC 4F9PC 5IR1B 4JFFA 2Y69B 3D7PA 1MCDA 2XZZA 1ROWA 1UJ3C 4PJCB 5CZVL 5IMOB 3T6QC 4PGCA 5CLWA 2NXYC 4WHYG 1FZKB 1SBSL 3PP4H 4G1EB 5FM8A 1BBDH 1GYWA 4QRSA 4HJJL 2R0KH 1JXGA 1IBFA 3C8KB 4PIRF 1IIKA 3T8VA 4A2EA 4G5AA 2WPGA 3KYMB 1A6ZA 1MZZA 5CR8A 2K1MA 2Y7QA 4IBTA 1JZ6A 3EW3B 5E2WL 2Q10A 1F56A 2XBZA 1PLAA 1A0QL 4EE2A 1ZVSA 2X42A 3WEOA 2YQ3A 1QFWL 1V05A 3S8WA 2R9HC 4XE5B 3GBLA 3TBWB 5C86A 4FYRA 2HG5A 4Z3FA 4F8QA 2Q8AH 4JM2C 3WNIA 3U0WH 4OW6A 1RK1A 1ZTXE 4XC1L 2VM4A 2Q86B 5AOMA 3O4LA 2EZ0D 1UOVA 5C9KA 5E0FA 3UACA 2M26A 1JHKL 5DQJA 2WVVA 5KWYC 3CXDH 4FQLH 4NM4L 5HDOA 1KNOA 3L48A 2NXZD 4BH7B 1BG1A 4I77L 5C0JA 2C3GA 2IMMA 2NXYD 3KE0A 2OL3A 3QZWG 4K7PX 4TPRH 1WIUA 4FFWC 3GSVB 4UOW0 1KXTA 3GT6A 3GMNB 3EYFA 4OZGE 4JFYA 2C7FA 3LXBA 5BS0A 2CBOA 4KXDA 3GSWB 5EZJB 4NOBA 4XX5A 3OZKA 3KCPB 3T0WA 1SN0A 2EVJA 2UY6A 4GUCA 3SDDB 3VXPA 1YUHA 5JTWA 4OJFL 3WXWL 5IOKA 3IT8D 3SSGA 1KTLB 5EBLB 3TYFA 2CNYA 2VJ8A 2V9RA 4JM2D 3L13A 3ZHFA 3PP3H 2BNRA 1F13A 1U8QB 5AG9A 2FUQA 1NCAL 4XP4L 5EU4A 4LP4A 4OZHB 3FB6A 3BZEA 5DVOA 2BCKA 2C1PB 3WDHA 2O61B 4W9JC 1KCLA 2X4UB 3NGBC 3LRKA 2FQDA 4PS8A 3WELA 1QLEL 3MLTA 1YQVH 1UACH 2FJGB 4XCNB 1OPOA 3D2UB 4RISH 3KPNB 1TJXA 3F85A 3IRZA 4NQED 4NUQA 4ADJA 1EZSA 1IAKB 4FFWD 2VLRB 5TH2A 2KZBA 4Y2LA 4AYID 3ME0A 1LO2H 1XR8B 2ZG2A 3DXAD 5EOCJ 1TZIA 4N2KA 1A9VA 3R4DA 1N7MH 2XA8H 1IBBA 4ACPA 2DQEL 2IH3B 3MGOA 4HALA 4IRSC 3LQAC 5ESAA 4OQTH 1G7IB 3ATBA 4MMXC 2E86A 4IDLA 4N0UB 1TZ8A 1HC1A 3BDYH 2DJSA 3EOYG 3FO2B 4NLHA 4PGDB 1BAWA 2QKIA 1YAIA 1CF1A 3BKMH 1GC1H 1ZEAH 5C0AD 5AKTA 2LVEA 2WIIA 5JW3H 2BP8A 1PEWA 2NY1B 2XQ0A 3ZDXE 3ZHKA 5A6LA 1QLFB 3S5LA 3QGVA 3UX9B 2YOCA 3S36L 1TLKA 2BNQE 2B14A 4RAHA 1R5WB 4WO4A 4UILL 3KXFE 1OGAB 3WJJA 3RWFA 5I1EL 5ID0B 1A14L 1YQ2A 4LU5H 3PCYA 5IJKC 1FE8L 4P8QA 4RAUA 4N9GA 3WKQA 1XH2A 3TF7C 2CM6A 4NKOB 3HUJF 3RI5F 4LIQL 3MRBB 4OD1L 1AZBA 3GMOA 2VE6A 3WN5C 2XSKA 4XNBA 3H42L 3ULSB 4IRSD 1SVZA 2ZXQA 4JX0A 1ES0A 2D7OA 3CSYB 3RIAF 5KVFH 2XRAL 1J18A 4HLEA 1CICB 1CT8A 5AAPA 4LL1A 1KPUA 3KD4A 1GL4B 1UA7A 3MOBL 2FDBP 5EC1B 3Q2LA 5IB4A 2XYCA 3KH3A 4L3EE 2M2DA 1ZWIA 1FRGL 3MRRB 3C12A 1G7QA 1HI6A 4H13C 4ODVL 4JZOB 1A6PA 1VADA 2CJUL 3MYZA 5D7KE 5E08H 2AEPH 2DEWX 2K45A 1WFIA 3QHTC 5AENA 1G9EA 4XN4A 2NR6C 1A1OA 3LXUX 3RU8L 4JRYE 3CK0L 3K8LA 4GAJL 4UOQA 1C12A 3QJXA 2FLRT 1QASA 4HPOH 1N64H 1II4E 2LV4A 1NGQH 4JO3H 1GOFA 2C9SA 1DLFL 2ARWA 3VCLB 2ESVE 4RZKA 1LK3H 2F53A 4M5TA 1J8SA 3L3KA 4Y19E 4RRPM 2G30A 2O5YL 1BM3H 3M7OA 2OTWB 3B2UC 3HZVB 3MACL 1AS7A 1SPDA 4CADB 1G7JA 1HWGB 1QSED 4FQXC 4YWGL 1DEEB 2DEYX 2WUCL 3P4NB 5T3XH 2YGVA 1T0OA 1TPXC 5HGHB 4HSCX 4N9OB 4W9KC 1G4RA 3ALPA 4OM1L 2ID5A 1KGJA 2WLIB 3KG5A 4L37B 3UFIA 1I7RA 5KSAC 1NM4A 5DGRA 5C70A 4DO6A 1NDTA 2QHRH 5B1AB 4X83A 4XVJH 4N68A 5E8NB 1K8IA 3ARBB 4QOKB 3MV9A 2G2PA 4NCDA 4K7PL 2NR6D 7FABL 3LEXA 1IIIA 2GCYA 1ZK5A 1JYWA 1X44A 1KFAH 5I6PA 2EUVA 2XWTB 2VMEA 3KR3L 4U3XA 5IB5B 3Q2CA 1AQ8A 1E5AA 2QL1A 5FF6B 1BPLB 4F27A 1WBZA 1NCGA 4HAFA 2BRQA 2FGZA 2YBGA 3UPCA 4YIQA 4QLRA 1KLFB 4JDZB 1UCBH 4IBQA 1WAAA 5AB9A 4F7EB 5DD1L 1HIML 3C09C 5I2IA 5F1IA 4LSPL 3VFPA 1EFXB 4FQXD 1JWSA 4W9LC 2O1AA 3ZE2F 3ZRCC 4FQCH 3RWIB 4OJYA 2COVD 1SYVB 1GTFA 5E03A 3UERA 2P8MB 1D9KB 2Z4QA 1QBBA 4LASL 4LHQB 3RUGE 3SO5A 1PZAA 5DFAA 3UG5A 1DN0A 3PP3K 2CKNA 2UZIH 1KCBA 3SDXF 3ZE0E 4RFNB 2MMXA 4G7SB 4J28A 4OIFA 5DSCA 4EKXA 1NIBA 3O6FA 3NCCB 4LCIH 5T33H 3LNEA 4HUKB 4LB8A 2LU7A 2OMZB 1NAML 2X4NB 4IBYA 4DESA 3A21A 2XTLA 1JUFA 4PMFA 3VX0A 3EGDA 3IU3B 5L88L 3QJQB 4IEFB 4PRBA 2GFBB 3ROOB 3Q6GH 4DUWA 5ID1A 3M1OA 5F7FA 5FW8A 4NQSB 3CHPA 4O4YH 3LCYA 1G1KA 4WEEA 4LSTL 2R29L 1O75A 2HLEB 4MA8L 1ETA1 5EF0A 2EEXA 3IWUA 4KXCA 3CC5B 4F7KA 4Y5YC 1UT9A 1K6QH 1JDAA 5F9WC 2V7NB 4QYOB 2GW5A 4P2RE 3S7GA 3V6FA 1JPGA 1H15B 3FQUA 4Z7NB 2CJ3A 4LSUL 2EXTA 1BLNA 3VRJA 5DJZB 1TJHH 4YDZA 4KK6C 4XPHH 1MLCB 4U1HA 3AJ7A 3O3EA 1ZXQA 3MCLL 2JJWA 2OYKA 4LEXH 2ZJSL 3ARPA 4F7TB 4OCXL 1U8KA 5DVKA 4ZUVA 2AABL 3ZDZE 4HCGA 3OLGA 3VXMD 2FO8A 2GVYA 2C3XA 4UQDA 2OP4H 3H9SE 4HZAA 4NZ8A 5KUMA 1I8AA 5JPNB 3U7AA 3MLXH 4QKXB 2JKLA 1MCQA 1GXEA 3LNFA 2VDNL 5AAMA 5DC2A 4EI5C 1YPZF 4X7TB 2MKLC 1IGTB 4CVXB 3HUJB 4BHUI 3LPWA 3KDPB 5B1JC 5E00B 2ZXCA 2CLZA 3MXWH 1T3FB 4K5PA 3HJEA 5GHWL 1AANA 2BY1A 3BAJA 3BRFA 2YEQA 1IAIM 2WQRA 3EGXB 1J5OL 3VD1A 1J9RA 4X99B 3QQNA 1ZIBA 4C4KO 1BZ7A 4P23B 1I1CA 2DQJH 5C09B 4KDVA 4XWGL 4JPVL 3X3GL 2DKSA 5AWNH 5A3IC 4KK6D 1RUML 3TS8A 1XGZA 4Z7AA 1W2KT 5E1IA 4G6AC 1L4IA 1ZPLA 3T2LA 3SE4A 4J6IA 5CN3A 5KBMA 4KHXH 1XXDC 5J1TC 1ECZA 1J1XL 2WXJA 4LCUA 4N2AA 2DBLH 4MLSA 1AHWA 4M7ZB 2DLHA 4TSAL 1P4LB 3EJCA 5C0BA 1CDCA 5J06A 1EJ8A 4PV1C 4S2SA 3JWDC 4M3HA 4ZNCD 1XGPA 3HS8A 3QNFA 4U05A 1P53A 3SDYH 1JPFA 4XN7A 2LFGA 4R7NB 5DHVA 1U2YA 3PJSB 2OPCA 2EIDA 4GQZA 2E7DA 3QG6B 1NAMA 1F1DA 2DJ4A 1NCDL 3FTUA 3ARDB 3R18A 5HGGS 5TDPA 4IOIB 2XPGB 1OM3H 3FYIB 2DQCL 3STLB 3U2IA 5DK3A 3L4VA 1BCIA 2R29A 2P5EB 1BD2E 5A3ID 5KSBA 3ZKXB 5D2NE 5FECB 5KYYA 5DK0A 1EERB 3P30H 4G6AD 4F33B 4JVPA 4LGPB 1A6WH 4NN7B 1FNHA 4IRJA 1ID2A 1JNHB 2JCCE 5EF3A 5HGDB 4MMZC 2ZXBA 1MPAH 5E5UB 1NCCH 2A74A 2R1XB 4LVHC 3KWUA 3HI1B 3OKOA 4L9LA 3WLBB 3AITA 4S0HA 1YMHA 3QWRD 2OMWA 4RX4D 1VFMA 3MYJB 4HIJA 4NQXB 1JL8A 1TTAA 3QDJB 2O5XL 3MNDA 4N28A 1GS7A 3B2XA 1KYAA 2ZSWA 2QVIA 1F58H 5KYWB 4XC3L 3NSCA 1CF8H 2KLRA 4X6DF 1AHMA 4C59B 1MCFA 2D0HA 4CKQA 4F3FB 2DLTA 3GUFA 4AG4L 4F58L 1OAYH 5ITBL 4O5LH 1BZDA 4UB0H 1A6VL 2NNFA 3ZE2B 2Z64C 1X3DA 3OXSB 1WH0A 3VFGL 4DPAX 4RWYL 3BEWB 5DFTA 4RWHA 3E7JA 4YXKH 3BP4A 4LKXA 4NGHH 5FYLH 2H3XC 2Q7YB 4K71C 4B9IA 2GITA 3IDJB 2X6VA 1G9HA 2EDNA 5CJOH 2VR4A 5T1LB 4ZMYA 3SDXB 3KGSA 3LRSB 1Q1JH 1QABA 4OAWB 3DUUB 2BWQA 3L8QA 5DT1H 1GR7A 4PJAF 1EVTC 2VISB 4P49A 5LWYH 1KPVA 3HRZB 1FGVH 3FU8A 3KM1A 3FB7A 4LLQA 3NPSC 4QHUA 2J8OA 5F1NB 2NQCA 2I9LA 3U7WL 4EVNA 1HESA 3GK8L 3ILPA 2KLTA 4L3ED 2B2XH 4L2LA 1W72L 3O0RH 3WS6A 2JVUA 3MJ7B 1OVZA 4J5VA 1JYXA 3B2VH 5D7KD 3D85D 1V10A 4RMWA 1NA8A 5FUOH 3CH1A 1BZ8A 2HA1A 4C58B 4JFEA 3A67H 3C6LA 4PVLA 2AJ3A 5I8CA 3MLSL 4DP0X 1A6AA 1T5KA 4X4KA 5EU6B 4LBAA 3CFTA 4IIQA 1F0LA 5BRZE 4YQXH 1M3IA 4KDTC 1JZ7A 1HVXA 1YNLH 1FL3A 4N0YL 4AKQA 1BVNT 4Y19D 3H6JA 4F15C 3SGEI 1Q0YH 3DPDA 3RWHB 3UTTA 2J2ZA 4B9ZA 1DE4B 3BVXA 3VRIB 5SWZE 4R9HA 3RI5K 1L9RA 1VGEH 1YEWA 4JEGB 2A83A 4P5KA 2G3ZA 5D1QE 2I60L 2NT0A 3RIAK 1N4XL 1I3UA 4F7MB 1FFTB 1ZHBB 1YPZB 5E5RB 5I18L 5I6KA 4PCKA 4EOWH 1A7PH 3RRQA 1T20B 2GKIA 5A2AA 3F7YA 3DV4B 1CGSL 3S3DB 4HXAH 4CNIA 3QIBD 3BPLC 2UVEA 5AW1B 2FO4B 5D7LE 1V8HA 5F3FA 4ESKA 4RMQA 3G7TA 2OTUB 4G9DA 5JHDE 3O9WB 3Q44A 1MKFA 3ECQA 4Y2DD 4I1RA 4PLKC 3WTUA 3BO8B 3U7YL 3BAIA 5I76A 4YHML 3U79A 2Y7MA 1F4XL 1S7RA 4QRPA 4AIZA 4PGZA 1F11A 3K71A 4L1HA 3AT9A 1T1YA 2CD0A 3D0LA 3Q5TA 1ETZB 2GHWB 3OKDA 2D73A 3PDDA 4XCCH 3VSTA 1NANH 2FBRA 3N9GH 1SOSA 2V37A 5C97A 5FOJA 2IG2H 4UQAA 5FYKL 3HPJA 4G3YL 1PCSA 4FA6A 1KGXA 5JR1H 4A7SA 1TNNA 2MQ0A 4MNHA 3BUYB 4P46C 4FXKB 3P4LA 4D0DA 2ZUYA 4D0BB 3O2WL 4EN3D 2ZCKL 3DDGA 4PV9A 3MRHB 4XMZA 1MG2C 3TURA 2J88H 2WKOF 4LCWB 4GUPA 3V55A 5IW1A 1ETJA 3PP4L 1AC0A 5ENWA 1W0WB 1BBDL 4PLKD 4HUUA 4E42B 4YAQA 5HYJA 2MQCA 2R0KL 5C9JA 4TSBL 4RFEA 1XF2B 5AW7B 2ITDB 3IDGB 1W72A 4ZUSB 1E6JH 2PW1B 4P9HC 5INCB 4FL4C 3RPIA 4BK5C 4UQ9A 1DLHB 1JZFA 4N2FA 3WTVA 4I1PA 4IU2B 3W37A 1FVDB 4GI8A 1NTDA 2G9HB 3GC3A 2HVKA 2FEEI 3VE0A 4P59H 4EXPX 4H2AA 4WAFA 3GXTA 4LSDA 4UIMA 2Q8AL 3U0WL 4NHUA 4WTZG 4Y4KC 1J88A 5CEZH 3NZHH 1I3VA 2CKBH 2OQJB 3EFOB 5DEGB 3V6OC 1HHIA 3PWJB 4P46D 1YYMH 4NRYB 5DF0A 3CXDL 3VB9A 4FQLL 3V7AE 4X6DB 1UZ6F 3NJXA 4HG4K 1TZGH 3HBZA 4X7SH 1ZSHA 2XTJC 1H3GA 5A1AA 5DRNA 1E6OH 4BFEA 4Y1AE 5KBLA 5F0MB 1PIGA 1M7IA 4DEUA 4QEGA 1BFOB 4O02H 3M1CA 4TPRL 2CKBB 2C1OB 3HN5A 5GQBA 5CJXA 4RDQG 1B4LA 2JK5A 4UDTB 3QUZB 2VGLM 3OLIA 3G5YA 3H9SD 3ELAT 1EXHA 1TVDA 2EEBA 2X41A 5HGBA 5IW3A 1KEMH 4OGZA 3RNKB 1HEHC 2OLDA 5JORB 4MA7H 2XPZA 4OVVA 4O02B 5IROC 2X88A 1AC6A 4PJAB 1AZNA 4KRNA 1L3NA 4PUBH 3I6LD 4Y4KD 2D7PA 1ET7A 1QKZH 1OAKL 1UXWB 4ZMTA 3QQ9C 1OAXH 3O3AA 1AXSA 3BZ5A 5T8IA 2GJPA 2GUOB 2VN5A 1KWKA 1GZPA 2NW3B 4HG4J 2NX5A 4QI3A 2XG5B 2J8UF 4PJCA 1YQVL 1UACL 3ECBB 3NRQA 4RISL 3T04D 1FZKA 4G1EA 3VXRB 5KN5B 4EI6B 3KBFA 5E9DE 4AQ8C 2RHEA 2QT6A 2XV2A 3OKEB 2DIJA 3I02B 3LZQA 3C8KA 3B4NA 5LHDA 3SBRA 3KYMA 1O9ZA 4GW5A 5E7FA 1QR4A 2VR8A 2ZNXA 3TO4B 5I74C 1X5AA 5DS8B 1LO2L 1PW3A 2VXUH 5C6TH 3WOVA 2AQ3A 1N7ML 1S9YB 2XA8L 1G7MA 3BH4A 2CUHA 5TDOB 3QO1B 3TBWA 1P6AB 2CA3A 1K5NB 4DERA 4AYSA 3QFGA 3BDYL 2Q86A 5IROD 4OJCA 4UT7H 1WS7A 3BKML 1GC1L 1ZEAL 4K23H 5HHXH 3V0JA 1E9QB 3QB7C 4LCYA 4JFHE 3QQ9D 5AW9B 1LMKA 5JW3L 5I1LB 1JNJA 4LPTA 5G4OA 1MNUH 2AQ1A 2IGLA 4ZX4A 2K9UA 4AQAB 3J7HA 3JV0A 4B9JA 1BD2D 2JI2A 3LD8B 4FTDA 2IJ0C 2OSYA 1KV3A 3RWEA 5JW5B 1EZVY 4QRRB 3QUYB 4Y9EA 1E5BA 1VA9A 1VIWA 4TVUA 2DBJA 2CALA 4N5EC 1O7SA 2CR6A 1NMCC 4YDIH 4LU5L 2OK0H 3U4AA 4M4RB 2DI9A 2DL9A 2WQSA 1PFOA 1ESOA 1WD8A 2E8YA 1TTBA 1E2WA 3HJ0A 3HC0B 4PJ6A 5EZJA 3U46B 3WHE1 4PJIF 3RLSA 1J8KA 3MRFB 1L9NA 3GO1H 3AWFA 3TLRA 2BVYA 4PJXF 3TH3T 5EBLA 4AYBA 2KDGA 5IB1A 4ANVA 2P49B 5KVFL 1RZ7H 3MBEB 1MREH 1X5XA 3US1A 2DM2A 1N26A 3EBAA 3NFSH 4WF7A 5KS9F 2F15A 3X3FH 3A6BH 1U8QA 1QR1B 1I31A 2CK0H 4N87A 2BSRB 2JIXB 4OZHA 3VMNA 3H3KA 4DWHA 5CLTA 3KVQA 2C1PA 3QDMA 4NFCA 5JNYA 2O61A 3TTSA 4A7TA 2VSDA 3CFEB 2X4UA 2YSSA 3ARQA 4XCEB 4ALAH 5E08L 3PXLA 4Q4EA 2AEPL 4XCNA 3D2UA 3KPNA 4PRIB 2D3VA 1UOWA 2A77H 3IKKA 4DOHB 1OSZB 2VLKE 2A4CA 1N64L 4HPOL 2VSMB 3CX5K 3IF1B 3KPSA 2FR4A 1NGQL 1XR8A 4JO3L 5CEXA 2DMGA 4OFYA 1MY5A 4TM9A 1LK3L 4N8CH 1TQWA 5ADPH 1DYZA 2YZ8A 3OTTA 1BM3L 1LLAA 3EJSA 5TJWK 5BS0D 4B96A 3ATAA 3EJUA 4Z76A 2DV6A 2ZX6A 4N0UA 2EDHA 3JQOB 1YG9A 1OT4A 4PRNA 3B9KA 5D1QC 3NCMA 1FQ9C 2UY7B 3D50A 4KI5E 4Y16D 4FADA 4PGDA 5CN2A 5T3XL 1B2WH 3GXUB 3PIQB 4NRZB 1ZLDA 3BD4A 4UUJA 2APTA 3NZ8B 3B43A 1QLFA 1NMAH 2PNDA 5E6YA 4IKJA 5EEZA 1HNGA 2QHRL 2YAEA 4WV1B 5I24A 1FO0H 4XVJL 2LU3A 4DKEH 4WNSA 2HJFB 1OGAA 2ZX7A 4ZPTA 1SOXA 3TC9A 2P43B 1ADWA 3K4DA 1BMZA 1DL7H 1KFAL 3FKUS 4JFSA 4LHUB 4UM9D 4YHKH 3HG0A 2X3CA 4C55A 5ID0A 5T3ZH 4RETB 4PSRA 1IARB 5GRVK 4AEEA 5F7HA 4OFVA 3QIWB 4E9WA 3TN0B 3OJMB 3VYOA 4HJEA 3NIDF 4NDMB 4NKOA 2ALAA 5GS2D 2IOMA 5AW8B 1OOAA 4M62H 3MRBA 1F4YH 3FFCB 4KRPB 1J05B 1ZHLB 1UCBL 1FO0B 1IAII 1IGJB 3ARZA 3F7RA 5L4JA 4LPXA 4ZMWA 5IHZA 5D1QD 5FFLA 5CNHA 1CICA 1P0SE 3FQXB 5I73B 4G7RB 3L9EA 5F93C 4OFDA 4XMTA 5EC1A 4FQCL 3BVTA 3SPVB 5C92A 3FO9B 2P5WE 1INQA 2FZ3A 4OI8A 5IVOA 5D7LD 1TDQA 2LLNA 3S5LG 4RGMB 1XH0A 3ABZA 3C60C 2UZIL 4JGJA 5DTFB 4QAMB 3S3JA 2J8UB 3GNMH 1KMGA 2EDOA 1U93B 2H6PB 4LCIL 5T33L 4GLRH 3VFUB 5B7FA 3MLRH 1KBGH 3VCLA 4NN6B 3OQRA 4R0LA 5DMJB 1NWPA 2IGTA 2NZIA 5DC0A 1NCJA 3OAZK 3Q6GL 4PWIA 5GS1C 2EDRA 3MFGB 4K7PY 4O4YL 1XGUB 2BIIA 4XN5A 3LIUA 1ITBB 2OTWA 3HZVA 5DRWB 4DO5A 1D7CA 2CBQA 4MJ6B 1U3JA 3DHMA 3MFFA 5EO9B 4MXWH 1DEEA 1QHQA 3P4NA 5HGHA 4BQ8A 1K6QL 4JDEB 2ZAIA 5C7XL 1I8MB 4R2GC 1FH2A 1IGYB 1MW2A 2WLIA