3UL4A

Crystal structure of coh-olpa(cthe_3080)-doc918(cthe_0918) complex: a novel type i cohesin-dockerin complex from clostridium thermocellum attc 27405
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
142
Chain Sequence
NTIEIIIGNVKARPGDRIEVPVSLKNVPDKGIVSSDFVIEYDSKLFKVIELKAGDIVENPSESFSYNVVEKDEIIAVLYLEETGLGIEAIRTDGVFFTIVMEVSKDVKPGISPIKFESFGATADNDMNEMTPKLVEGKVEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulosome-anchoring protein
publication title Novel Clostridium thermocellum Type I Cohesin-Dockerin Complexes Reveal a Single Binding Mode.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Cell adhesion/protein binding
total genus 31
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ul4A01
1G1KA 2BM3A 1ANUA 2OZNA 2VN6A 4U3SA 2ZF9A 5K39A 4FL4B 3UL4A 2Y3NA 4IU2A 4DH2A 5G5DA 2VN5A 4UYPA 1QZNA 2B59A 2O4EA 4UMSA 3GHPA 4IU3A 2XDHA 5AOZA 3L8QA 2CCLA 3FNKA 2JH2A 2VO8A 1TYJA 1ZV9A 4UYQA 4N2OA 3KCPB 4FL4C 1OHZA 2W1NA 3BWZA 4WI0A 5LXVA 3F2LA 4WKZB 3KCPA 1AOHA
chains in the Genus database with same CATH superfamily
3Q1SL 1JTTA 3PV7A 1T03L 1NGXA 3WMSA 2CRIA 3GZQA 2WYZA 4JFED 2G0KA 5ESQA 2DWDA 1C12A 3DUUA 4WEBL 3OJDA 1OARH 2B8OT 1IE4A 1UZ8B 5F9JA 2Q8BH 3HRZB 4LOFA 3ZIMA 4YSTA 5HI4C 3BH9A 3ZY7A 1A4JA 3MRDA 3EJTA 5E0QA 1L0YA 2J88H 3MSPA 5I1GH 2RQEA 3BD4A 1F3DJ 4ENEC 2F1BA 5DVNA 4J5VA 1YUKB 2IH1B 5DEGA 3RVXD 1B4JL 3AT0A 4LAQH 3UIYA 5GGUA 2VQTA 3PWJA 4K4KA 4IW4C 4MA3A 2QQNL 3OKMB 1J8HD 1HILB 2PP9A 5DGRA 3V79C 1IGML 5F7FA 1MHCB 6FABH 4JFYA 4K55A 2ALAA 1LD9A 4MNQB 4C56B 1OALA 5LGHH 4GUCA 1WC7B 2A74A 3ZO0A 3Q8BA 3MROA 2WWKO 5HYSG 3VVWA 4CMHC 4N0CC 3WNLA 3DMMD 5D9SB 3DV6A 4KJPC 5HYEA 4Y4HD 5ACZA 1PYWA 2GK2A 4YBQD 3OGCA 5I1EL 5HDRA 4JGMA 1RFDH 4XWOC 4UQ2A 2F6AA 4HX1A 4KNUA 3VI3B 4AI7A 4PY8J 1A4BA 1O75A 3VI4B 1RZFL 3MU3A 1ZHNA 3NEXA 5C08A 3KVDD 2AXJA 3T4AA 5HHPA 1OTUC 3NSDA 2WQUA 1FE8L 4P9HC 3KJ6L 4NT6A 3BQVA 2TSBA 5T3XH 5BS0E 1FRGL 4B41A 2WXFA 3FH5A 2O1AA 2IAMD 4M62H 4XBEL 3CTTA 3EH4B 2RACA 3MJ6A 3QUMH 4QXTA 5DWUH 3WIFB 1YMHA 1D5IH 1JAEA 4LNRB 1Q9OB 3MNMA 4LSSH 4D3CL 4DKEL 3AS3A 3M07A 4M43H 4PU2A 4CVZA 3REWB 3PYCA 4B9IA 4R6UA 4YSQA 3CLFL 2BSEA 2J6EH 3NGBB 1CXIA 2F7OA 4KMTL 4QLWA 4LIQL 3U0WH 1B4LA 1KYDA 5PCYA 2A2QT 1E4KC 2GKIA 3EHBC 2PABA 3L3JB 1DLFL 3P2BA 4KJWC 3FTWA 5AOZA 5GIRA 1G6RH 1JN6B 2Z93A 3VXRE 2C3XA 43C9A 2L7EA 5KBKA 1ZXQA 3JT2A 1F6AB 3BUIA 4WI5A 4WW1A 1RZKH 4YDIH 1QBMH 2E7HA 3BAJA 4XODA 3ARFD 4G1MB 1FIGL 2BS9A 2IMNA 1CFTA 3UG4A 3BZ5A 4I0KA 3VCLA 3MX0B 4WJKB 5LCVH 3IMSA 3OKDB 3DPDA 3A6OA 4W4OC 1MCDA 2D7QA 4PRPA 5AOJA 1N3NB 2JJWA 3FCBA 3PP4H 5L4JA 3UBGA 5CMAA 1G43A 5D5MA 5D8JL 1OCCB 2E27H 4M5ZL 4XX1E 3VI3F 4XPAL 5BPPA 4J3OH 2XBDA 3W39A 3VI4F 4UTAA 4PJCE 4YSAA 3OLEA 3BXNB 5CD3A 3FUFA 4QWWD 3FT1A 1DN0A 1ITBB 2QGDA 2YAEA 3HS0B 2HVBA 3COOA 4PRHE 1MHEA 1P6FA 4URKA 5ITFA 2G0LA 3B9KC 2J25A 1F1DA 2VABB 1FVDA 2DYPB 3K3QA 4X7FC 2BNRE 4AGLA 4DVBB 5IMOB 3P4OA 4NQSB 1A66A 2FX9H 3SKNA 3RWDB 2D9CA 5J6GA 3N9GL 1NBYA 3INUL 4AM0Q 4Q9QL 4BA8A 3R4DA 3A6BL 4QNPE 2HX9A 3L5XL 4XP5L 2GJPA 1WA2X 1W0VB 3GEWB 1U3HC 3L4TA 4FFZL 2HRGA 4ONFH 4M7JH 3TCXA 1ULVA 2D8KA 5HJDA 5I16A 5EU6A 5HGAA 3CCHB 3EO0B 4NHCH 2K8MA 1T2JA 1JF1A 3FUNA 1TENA 5GZOC 4AC2A 1E7VA 2Q3XA 2VW6A 5AW7B 1TQUA 2OR8A 1TT6A 3BUYB 2G30A 3FFCB 5ADOH 1P4LB 3C8DA 1V3KA 1TZHB 2X4SA 1HCFX 2MCG1 5DF0A 2WTRB 2WVSA 3NG5A 4X6DB 2DB8A 4PGEA 3KPRD 1S8DB 1QHOA 4ZAKB 4JQXA 5ADPH 3K6FA 3KPNB 1I31A 5CP3H 3T2OA 4R0LA 4B9FA 4UOJA 3VXSE 3Q8FA 1A5FL 2NYKA 2XNAA 3VJ6B 1U92A 4KWUA 3X13B 4JO3H 3DECA 1H6FA 1F42A 5CGYD 1RPQA 3OKOA 2QADB 3UBXI 4C47A 4RZCA 3TEZA 5F7NC 4UOW1 4MXWH 4Y2DB 1BLNA 4M61B 4TTDD 1UD5A 3UJTH 1F4YH 4QHNA 4JFQA 3BN9D 2Z35B 1S5IH 3LD8C 3WXWH 5E08L 1H15A 3WFEH 2BY0A 4PJ9A 1KV7A 1GYVA 3T65A 2I25N 5DRNB 4Z7UE 3D87B 5I19L 1FDLH 1YQVH 3WO4C 1A1OB 3KLQA 4N0UB 1ID2A 4MBRA 3FULA 3EGXB 3ZTJG 3U25A 1EMTH 3T6XA 1K3ZA 2IADA 4EUPA 4XO5A 2I07B 4LEBA 1HXYA 3QXAA 4UB0H 4NQCA 3W82A 4K9EH 1QASA 5F9OL 3O4LE 3QZLA 3S34H 4JQVA 4Y1TA 2EXSA 5FYKD 1DUZA 1GZQA 1MHPH 1T5XB 2NY0C 3VUAA 5DHYB 1QFPA 4KKNA 4HC1L 4KRLB 4P23A 5FYJH 3N06B 4XNUL 3FF8A 2XY1A 2WM0A 3Q2WA 5JHDA 3GJFH 1JTPA 2X2YA 3AUWB 3DETC 5DJZA 2O5YL 5EU5A 1HAUA 4ANWA 2WMPB 4NN7B 3VD3A 3MBXH 1U3ZA 1LEIB 1CGYA 4P49A 4G8EB 4I87A 2I85A 3O81A 5H37G 2XTLA 4XXDA 3O6FC 2W92A 5FKAA 1GS8A 5ICXB 5FOBB 2GAZA 3ULUF 1CLOL 2ATPB 3TTYA 4UT9L 4WKZB 1YPZE 1A14H 4X6FB 5G5DB 5B8CB 1HINL 1PX8A 1BPVA 4FNQA 1SJEA 1REIA 3E8UH 4LF3B 4M8RA 3VRIA 2VSDA 5GS1A 5MEOB 2RCSL 1MELA 1WISA 1YVLA 1WBXB 4ILDA 5HI4D 1QKZH 2EIBA 5E00B 5T5FA 1NKOA 3T2LA 3QUHA 1G7MA 4MVBC 4B9ZA 3AY4C 5D1ZC 3B5HA 5TF1H 3IFOB 3UGXA 4ENED 4ZX3A 2A77H 2B1AH 4FEIA 1NANH 3Q8EA 1HI6B 2J55A 3EBGA 4ZUTA 1LO4L 4OGXH 3B34A 1FH2A 1FV1A 2W65B 4XNMA 4RAUB 5E4OA 5JDSA 3ZDXB 4HCRA 3QUYA 3NOIA 1MW0A 3P9MA 5FGBC 1P2CA 5HTSA 1N4XH 5FO8A 1G7JA 1FNSL 5DHVH 2EDBA 4GBXB 3SHSA 3ARWA 3ZXAC 3SY0B 3T3ME 1TYRA 4E5XA 1MIMH 3QIWB 4N85A 2XC8A 1GCFA 1EO8L 2CPUA 2DRUA 3LKQA 4HJUA 5BMFL 4G5ZH 3UO1L 4MJID 4N0CD 2X6AA 4BH8B 4NBXB 3KWTA 4KQ3L 3VSQA 2GUOA 4F57L 3B9EA 5D7IF 4A2HA 3VNZA 3CHXA 3CSGA 1OVZA 4XO4A 4L4TB 3B7RL 3H0TB 2X09A 4R83A 2C8NA 3AQYA 4XHJC 1BWMA 5E8OA 4XWOD 4E41A 4D0BB 2D7MA 4GXVL 1E9QB 3DGGA 4ZW8A 3N50A 5DRZA 1IU1A 3JV6B 3RB5A 1PAMA 5CHNB 1CGUA 1OTUD 5C09E 1HHKB 2NQDA 1KBPA 3BN3B 3RX5A 1UWEH 2D0FA 5AUMA 3D1MC 5M7QA 1FVEB 3U36B 3UEQA 1JVOA 4YHKH 2VDML 1E90A 2NY2D 3V6BR 4IK6A 3NN8B 1JPSH 4BQ8A 1OARL 1NDTA 3DXAA 2D0GA 2Q8BL 4CDGC 3KWXA 3UYRH 3ZRFC 3MTRA 3ZTDC 2PCFA 2VQUA 1KLUA 1Z3RA 3AVEA 4MMXA 2H41A 2VSMB 1KG0A 1QA9B 2AP2A 2Y2TA 1AQDA 3M17A 5HHMB 4ZD3H 3OAZK 4DZ8B 1JPEA 5I1GL 3NZ8B 3EHBD 2VM9A 4MZRA 3C75A 2ZUQC 1QLFB 2OMXA 3T0XA 2CRZA 3RFZB 4HS8H 5GGTH 2BC4A 4BBWA 4LAQL 4IOIA 3NIFF 3QQ4A 4Z3TA 4WY7H 3AQDA 4PCTA 4AYID 1D5XA 1D7FA 1WFTA 1LEKA 3L3DA 1N19A 3H3PH 3HVDA 2ITCB 3IVKA 3NSXA 6FABL 3VDCA 5SX5K 3NJJA 3S35H 4NO5B 1QSFD 4LCIH 5LGHL 1WIUA 2M2DA 3NCBB 4PJ7B 1GCYA 3VFPA 1HWWA 4L4VB 1A4CA 3JVGA 3GHPA 3L1GA 1TVBA 4PGDA 2XWBB 1AZBA 3EAKA 1LVEA 3M7FB 3UGUA 1V3LA 3FB6A 4FGMA 1OGAE 5TDPB 3G9VA 1ZGLA 3T6QC 1KGXA 2F19H 4ZTEA 1RFDL 4ZMWA 3B9KD 1FNHA 3GSVB 1ES0A 4F7PB 2HWZH 3GFUA 1P53A 4YAQB 3CLWA 3KLAA 3LEYH 4MJ4A 5T3XL 3RZWA 3J27A 3J7HA 3WN5C 2WQ8A 1BD2D 3B6SB 1NCTA 3CXDH 4HYTB 2A38A 2FH6A 4M62L 5DWUL 4WK4B 2YPKB 5BRPA 1ZS8B 3MGTA 1D5IL 4LSSL 3QJHB 3MPCA 5D96B 4XHQA 2I32A 3HBGA 4PLOB 3MV7A 4L8SB 4M43L 2BNQA 4OGQC 2KT6A 1WF5A 2VDQB 1LK2B 4IIQB 1UT9A 1D5ZA 3BC9A 5CN3A 5GZOD 1T20A 4HHWA 3T8MA 2VLJB 5J13C 1JK9B 2J6EL 3U0WL 1M3JA 3RWIA 3NZHH 3VAEA 5FO9B 3VFOA 1KJVB 4LPWA 1EO7A 1PY9A 3MNWB 4AQAB 2C7FA 1DVYA 1TEGA 3TPUA 1MQ8A 5E70A 4PJXA 4DP6X 4WGKA 1G6RL 1DSWA 4Y4FC 5T1MB 3E9TA 1UD8A 3ZVVA 1RZKL 2OQJB 2ITEA 4YDIL 1QBML 2Z31A 2R29H 3G6JF 4P04A 4RGNB 5L9DH 4HV8B 1RAMA 5LJYH 5BCAA 4PJ7F 3EO1A 1BAGA 3MUHL 5AVZB 1DLHA 4KZEH 2H32H 2IQAA 1KPRB 1IAIH 5LCVL 2FT7A 1HHGB 2X10A 3WNIA 2ZSVB 1VKXA 1PZSA 2BIPA 1YYCA 3NRPA 4YN3A 4WV1C 3PP4L 1FBIH 4JFOA 3LNDA 2NNCA 3D39E 4FRWA 5JW4N 3CVHA 3U82B 2E27L 3WSQH 3BI9X 3MMEB 5FGRA 1GOHA 4QRTA 4UIKH 4HLEA 3DX0A 1UWXH 3C60B 4Y8AA 4WFED 3WS6C 4NX0A 3GZKA 2AJXH 4ALAL 3FHEA 2BH0A 3TS8A 1Y6NR 4AZ8A 4XMVA 4YMPA 5I9QB 1IFRA 3RWJB 4CVWA 1YUHB 4TQ8A 2UY6A 3QFDB 1VCAA 2C7UA 2ZIDA 2FX9L 3ATAA 1XB8A 2XXCB 2AV7A 3ZU8A 5C0JB 4ONFL 3MUGB 4M7JL 3HNVH 1Q0EA 5GZNC 1KWKA 1KCRH 4NHCL 5DRXB 3F6IA 4JRYE 5CEXB 5FYLD 1FYHB 1JV2A 3KS0H 3T0AA 3BP7A 2JJTA 1N68A 3REVB 4OZGF 1ZK9A 1QO3B 2FYYB 2P1YA 4FXGC 4HIIA 3VA2C 3EGDA 2N01B 3IDUA 5ADOL 2NY0D 4N2FA 3FONB 4F8LA 5C86A 2X0UA 4M8QB 3ASNB 3MACH 3CQQA 5TFSL 1JNNH 4TUJA 1KIRA 3MRJB 4UILH 5TK2A 5FGCB 5B1JA 3EH5B 1BCIA 2ITDA 4KMQA 1R3KA 3HI6H 2AJ3B 3DETD 5ADPL 5E4AA 3TO4C 2XACC 4L8CA 2K70A 3CDGA 4FNRA 2V17H 4L23A 1USZA 2HG5B 3CIAA 4IDJH 1FYTD 4PIRF 2CDGB 3O6FD 1EBPA 5IKCB 4N9GA 5HYJB 1IJNA 1L9SA 1URZA 4HJSA 5EO9A 1S7TA 2WV3A 3MRLB 3QYCA 3MRKA 4HPYH 2BOLA 1R3HA 3RHWF 2X70B 5ANMA 4CVXA 3FQTA 4NN6B 3CH8A 3OD3A 4F92B 2UY7A 1YN6A 5KYXA 5CD5C 3PABB 3ARSA 1EAOA 4MXWL 1LE5A 3GSWB 3TYFA 3QVAA 1FHNA 1F4YL 2VITB 1E28A 2NX5B 3ZZQA 1A21A 1S5IL 4JFDD 4OCLC 3WXWL 2ICWI 3VU2A 4DCQB 3WFEL 2FGWH 4TXVB 3QCVH 4ZUUA 1FDLL 1YQVL 1UWFA 2EICA 5D1ZD 2YA1A 5CXPA 4FQHA 4ICXA 4ODXB 3SQBA 5F1SA 2D4FA 2X4PA 4KHXH 3HNSH 1EMTL 1SEBB 1UOKA 1WAAA 2O30A 2R1YA 4UB0L 4HHAB 1ZA3B 1UKSA 3MV9A 5EZLA 1ETZB 3OAUH 4QOKD 1X5FA 3S34L 4RGMC 4LVNC 4OT1L 5IB5B 4XXCA 4OZHB 1VPOH 1MHPL 5KANI 2HFEB 1OD9A 1QLRB 2C9UA 3S5LA 4ACPA 3OM3B 4ZFGH 3FO1B 2GJ6B 2EDOA 5FYJL 2VZTA 1RMFH 2EEDA 3UZVB 5BW7C 2ZOKB 3HG1D 2C1OA 3L1FA 4L1TA 5BOZG 3DOIA 1ZLWK 4KNQA 4WGWB 3FT2B 1CXHA 5A16A 2RHEA 3D08A 3MBXL 2E7MA 3MJ9H 4XHJD 3HAEG 3NA9H 3NDYE 5FUZH 3W0WD 1BQKA 3PQYB 4O2EB 2EYSA 2X4UB 2HVKA 4MNHB 1F00I 1V54B 1ZE3H 1MCSA 4N2GA 1QBLH 5K1JA 2AK1H 4NM8H 2HTLC 6CGTA 2QPSA 3TBTB 2R1XB 5DZNA 5HVHB 2MIZA 5C3IA 3AXLA 4JAMB 2DL9A 2EUZA 5IMKA 4MNGE 1A14L 3IE4A 2OMZB 1F56A 3DHPA 5F71A 3D4CA 1E43A 3VG0H 4YPGA 5CLZA 4ZDHB 4XNDA 1J05B 4RNRB 1IAII 1UCBH 3WJMA 3FO9B 2KYIA 3M1BA 1QKZL 3T0DA 1N5YL 1YECL 2R7EB 4KAQH 2CBOA 2GTWA 3KPSD 5FR3A 3GF8A 4ZZFA 4PM1A 4X5LA 4GRLB 5TF1L 2OL3B 1E3XA 2A77L 5IJKA 3SPVA 4PRIB 1RU9L 3O6MH 5EH1A 3E7JA 2NTSP 4OZHF 3LKPA 1SYSB 3W38A 1N8OE 4OGXL 5EBWA 1NL0H 1P84J 3BMVA 4MAUH 1CDYA 3S4SA 5HGHB 5FECA 1T2QH 5KBMA 1N4XL 4AQ8C 4A39A 3PWUB 1QWNA 2DM3A 3S37X 2BM3A 4KBPA 4POYA 5F21B 4G5ZL 1NCJA 5SWSA 3GSOA 3L9BA 3SKUD 3FTYA 1CLYH 2VLRD 3CNKA 3N5AA 4WGVB 1NFIA 4OF6A 3OTTA 2XN9D 4AW7A 3D48R 2Z91A 3IKCB 2NDFA 2QSQA 3I9GH 4GSUA 5IREA 1U2HA 1WG3A 4WTQA 3ESNA 1AY1H 4MCYB 2R0ZH 4FL4C 1CFBA 3TZVD 3U0TA 1R5WA 2FAUA 5C0BB 2KL6A 1XF3B 1KNOA 1T0OA 2BPBA 5EUKB 2FO4A 1J8HE 1UWEL 1NCGA 1WFUA 3EFOA 3QRGL 3DDGA 1HSAA 3ARED 4U1IA 4YHKL 2VJXA 3I02A 4J4PC 1IGJA 3SPHA 5B39A 1JPSL 4Y7OC 1X5YA 4XAWH 1AI1H 2H6PA 1BZ7A 4O2FA 3UYRL 3BZEB 1C08B 3RNKA 1JMXA 3WO3B 4ZD3L 1C8QA 3SDCB 1CI5A 4PRNB 2A73B 4AYFA 1F8TH 1ND0B 4TQHA 4K73A 3V9FA 4HS8L 1FF5A 3H3KA 4Y4FD 5GGTL 3WJLA 4YLBA 2P24A 1V10A 3V6OC 4LHUB 5I66A 3B2DC 1ECYA 2VDMB 3NJFA 1M6OA 4WY7L 5D72L 5J11B 4Q56A 4XOAA 4HIEB 2R0LH 3O3AA 1TMQA 2K6ZA 3H3PL 4PREA 4IBUA 5EZIH 1NJ9A 2Q10A 2QPEB 2V9RA 2YA0A 1U2CA 2CWRA 5DFTA 3S35L 4LCIL 1JTOA 2GBAA 5F1NB 3BVTA 1FFOA 1ML0A 3UFIA 4KO7A 3KLKA 1V7NH 3H9SD 5EUOF 1BIHA 3WTYA 2BZCA 2QZ5A 1CFQA 3UBXB 5IW1A 3ZDYE 3HIZA 1Y0LB 1EFXB 3JSSA 2F19L 1EEUA 5BQ7A 3FQNB 1N0XH 1OCOB 5CJOH 3T08A 1OW0C 4X0KA 5IUSA 3ABGA 3SKJH 1MCIA 2HWZL 4HLZH 5EBLB 5IEHA 4ELDA 3BD3A 1UXMA 3LEYL 1A1NA 3FN9A 2DQCH 3FFDA 2NXYC 3NSJA 1Q0YH 1NFDE 4G9FB 3CXDL 4I7ZC 4KC3B 3JV4A 5EO1B 4AGNA 2W88A 4G6MH 3ZPDA 1ZSHA 2OXHA 4X8GA 2XXFA 2XA8H 5E4IA 2NYZA 3C5SB 4OZFA 5SWZE 1FZJB 2SEBB 3TESA 2ZNXA 4FNTA 1N5AA 1Z9PA 2BMKA 4JANA 4RZKA 5E4EC 2P28B 3FTVA 2B5IC 1XF2B 4XVJH 4N1CA 5BRZB 3D12B 3L9EA 3NZHL 1CDIA 4ZO9A 4ZMYA 2NTFB 3F7PC 3F00A 1TQSA 3FHAA 1MW2A 3QC5X 1EUTA 4NO2B 5FIEA 2IWEA 2R2BB 3GDBA 3RIFK 3LJ3A 2ZX8A 2NRDA 4R97C 5CCGE 1FZMA 1S7WB 4HD5A 4FQIH 4NO3A 4XNZB 2DOCA 5GGSY 3ZZ1A 5L9DL 3TO4D 2R29L 5B38G 3GWJA 4KX9A 2XTJE 3DWTA 1X5KA 2GITB 4JZJA 4LQFH 4Y7MA 2DICA 3N0PB 3F5WA 3TX4A 4KZEL 3MRHB 1IAIL 3PPSA 2HT2D 2WXHA 4JDTH 3UZEA 1PY0A 1RZ8A 3I75A 5EFIB 1FBIL 3ULVD 4H8PA 4W9FC 4F91B 4MSWB 1RJYB 2MOQA 4IJ3C 4KI5C 4XPFH 1ONQB 3WU1A 4YS4A 3WSQL 3BVXA 2G5BA 3MLYH 4GO8A 4UIKL 2EYTB 4RSYA 4S1SH 3WD5H 1GJUA 5EU6E 2AJXL 2Y72A 4AEIH 3LKRB 4MX7A 4F3FA 3D30A 5F96H 4M7KH 2XCMC 2YAOA 3CPLA 2XWXA 3KPRE 3GGWB 2Z64C 3FB8A 1AKJB 4OZIB 3VYNA 4LVOB 1NSNH 2DQ6A 1A4AA 3STZB 2I9TA 3OZKA 3DOSA 1KJ2A 2EKJA 2XWJA 2IGLA 1FJ1A 2E3VA 3HNVL 5IBUB 3SGEI 2VLME 1KCRL 1WHOA 3FZUC 1ZHKB 4HFWB 1ZDSA 5FO2A 3U9PH 4UNIA 1NMCB 3PPEA 3WY4A 4IRSA 3VRJB 3T2QA 5D7LE 3SCMC 2Z3FA 1WIPA 5EBMA 3GZOA 5ENWB 2CR3A 5C70A 3ARZA 3MACL 1JNNL 3PNWA 2J8UA 3GXMA 4UILL 3RL1A 4BGDA 4Q6YA 5HHQB 1LILA 4UM8A 4YSCA 1J9CT 1H0DB 1O9WA 2CUMA 1RL1A 4LLVB 1LE9B 4TNEA 3HI6L 3QCUH 1E6OH 4FD0A 4BK8A 3PJSA 1HNYA 4U1NA 3VXMB 1A9EB 1O6SA 2V17L 3UC0H 4F9PA 3SYCA 4NAMA 3DVGA 4G8GB 4IDJL 5INCB 4G80B 4TNVF 2VR7A 3I6KA 1YY8B 1WFNA 4FQPA 2CM5A 1R6VA 3QXDA 4BFJA 3G6DH 1TCRB 2HTLD 4NC0B 3QI9B 5CZXC 5IOKA 5IM7B 4JR9H 4RFNB 4HPYL 1QTSA 1ZY9A 3BLKA 5FYKE 3TBVA 1KTDB 5IP4A 3WHE1 2Y23A 1IM9A 4KNTA 2YEZB 3NJMA 4AVHA 1HWGB 2CO6A 1BF2A 5C8JA 5HI3C 4OQ1A 3RZCA 2BFGA 5KOMC 3EYOA 4AVIA 4EXKA 4F7EA 3NSCA 3GXNA 3Q3GA 1S7SA 1UURA 5D1QA 4IKLA 4YL9A 3RL2B 1MFBH 2FGWL 3QCVL 3B56A 1GGTA 4OBRA 4YWGH 4HS6A 4FZ8H 4GEJA 4ZFZA 5LN4A 4F2MB 1DZ0A 4KHXL 3HNSL 3PXLA 2EE2A 2XZQH 4LB8A 3UTPD 2JCCF 1MLBB 1NAMA 4JCWA 1LM8V 4F80A 1IO4C 1DE4A 2HKAA 1G7LA 1N2RB 4IHOB 1JG9A 1LL1A 1UKQA 3OAUL 1DO6A 4O51A 3ULSA 4CC4A 5H94A 5FV2A 4F7TA 3P3YA 1VPOL 5HDOA 2RH0A 4H2AA 3CBRA 1JZFA 4PJIA 5CO1A 2HUEA 3OJVC 3NJLA 3SE8H 4U31A 1WPCA 43CAA 4ZFGL 2BVTA 3B3BA 3B9AA 3VWJA 1GJWA 2YQ3A 3BSZH 1RMFL 1ZTXE 1HOEA 2BSTA 3GTVA 1JXJA 2A74C 2FT8A 1O7DC 1SLXA 1XQ4A 4ZO6A 1WT5A 2BIOA 5F7DB 4Q2ZB 5EN3A 3QWOA 4A7UA 1IAOB 5MEPB 2YD7A 1N67A 4CJ0A 3NA9L 4YBLC 5FUZL 4HOMA 4A2MA 5ERWB 5HI5C 5D7IA 3FT9A 2IANA 2CLVA 2EUWA 3FFOA 1QBLL 2AK1L 2ROYA 4NM8L 5D1XE 4ONHA 4WEUD 2WNGA 1KGIA 4FTVB 1IM3D 1RERA 2EDNA 3S88H 2W59A 3DX7A 3T4AC 2BVPB 2ZF9A 2DWEB 2DEXX 4D9LH 1VGKB 4B9GA 5L2KB 2Y22A 1INDH 4P57B 1BVZA 1JGUH 4J4PD 3D2UA 5INDB 2EIKB 1YN7B 3VG0L 1A7RH 5CSGA 1IEAA 1I8AA 4Y16A 2YMOA 4NN5C 3EGSB 1AS6A 2AVFA 3CZJA 2M26A 4MJ2A 3C08H 3ZMNA 1ADQH 4UQBA 2YWZA 4KAQL 5BO1L 3DTUB 1VFAA 4JDVB 5JO5A 2XWEA 4K3DH 1NIFA 2GJJA 3QDJD 7FABH 3ZMEA 1JZ4A 2Z4QA 1BMWA 5J1AB 3O6ML 3GLDA 2NZ9D 1NL0L 3BIKB 5C07D 2HJLA 1AYRA 2Z9TA 1AD0A 1T2QL 1X9UA 4OJDH 1PJWA 1C8PA 1YEEH 3D85B 1DJIA 4EZKA 1RHHB 3ABKB 5T3ZD 1L9RA 3SYPA 2MCPL 1HK6A 1OT4A 1P1ZB 3IN0A 1PJ9A 3AC0A 1NIEA 5T1KB 4R2GB 2OMBA 1CLYL 4Z7WE 3RJOA 4JM2F 4LLDB 3T6ZA 5E7FA 4FQXD 4XBGA 3P11L 2WLJA 4AV4A 1BFTA 2BWQA 1RZJC 4G43B 2NXZB 4OZ4A 2WBJA 3QDMD 3I9GL 3QJRB 2JI1A 3TP4A 1ACYH 4I2XE 2WGXA 2YHGA 1AY1L 1MRDH 4JN2B 4OGYH 3QYMA 2R0ZL 4KJYB 5D7KD 1WAPA 4YHIA 3QG7H 3ZE2E 1HT6A 2FATL 3DC0A 4DZBA 3LV3A 3ZKXB 5IFHH 1NOLA 4HIJA 4YSPA 4Z78A 2NXYD 2AK4E 2CO4A 2FJGB 1TU2B 4EN3B 4W6YB 3L6FB 4JHBA 4ZX4A 1S7VA 4QI3A 5HJBA 1U3NA 3ML8A 4H8WC 3TV8A 3VXNB 5HPOA 2EEBA 1B6UA 3IDIB 1FNGA 1AI1L 1GAFL 2BP8A 2DIEA 2JE8A 4L29A 4XAWL 4YZFF 3SDXE 3TJPA 2EIZA 4D9RE 3T77A 5DD6B 3RB7A 4OD1L 5D7JA 4KKBC 1TR7A 1RULH 1DQQB 2EDWA 3PFUA 3CFKA 5I26A 3ZBMA 8PAZA 1CBVH 2AEIT 2ESVA 4OV5A 1OAXL 1S9VB 1WCBA 3MO1B 1F8TL 1DEEA 1LO5B 2YMXH 3LVEA 3PLYA 4GG6B 3T1FA 1OTTC 4CSSA 2YSSA 2E9BA 2AQRA 1KJ3H 4CSPA 1WWWX 4P06A 4ZMNA 1VCBC 2HLFC 2XRAH 2R0LL 1Q94A 1G9NC 4PJHF 1FFNA 3MRGA 4UQ9A 5EZIL 4JQXC 4KQ0A 1H8SA 2VDRH 1M05A 4ANVA 4Q7DA 3RPBA 3DURB 1R3IH 2LABA 4Z5RA 3K6OA 4JFEB 1QW9A 3EUDA 4XCEA 4V2BA 1RZ7H 1CT8A 1UT2A 1UM6H 4Y5VA 4OJEH 1DYZA 1GKOA 3CFIC 4X4ME 1V7NL 3IGAA 4KI5D 1F4HA 1CE6A 3B4NA 3IPBA 4PAZA 3AXHA 2R59A 3MGOA 4EOWL 1KTBA 1CBJA 4MMZB 1HTYA 4PTUB 2QMJA 4FHKA 1KBKA 1N0XL 5CJOL 3N40P 4JB9H 4YR6B 5IHZB 3SKJL 4D8PA 1U0QA 2VR8A 2AQ3A 1PD6A 1XF4B 3SEPA 1UXWA 1WUNT 4NBYB 4A2LA 2DQCL 4PJ9C 5BOJA 2WIIA 1Q0YL 4DP1X 1WS8A 4DW2H 1XGUA 4L3EB 4P99A 5LNEA 1HHHA 2LLLA 4HIHA 4G6ML 1MREH 1K6QH 1BAFH 2GQHA 1WFMA 4DVRH 5DHEA 2XA8L 3KJ4C 3SDDD 3FZUD 2F8IA 2BIIA 3QS3A 3E38A 4GG6F 1CZ8H 1MG3C 3SCMD 2GPZA 3DMMB 3HZVB 3FN3A 3SGKA 4XVJL 3T5WA 3WY1A 3DX2A 3QJSB 4JQVC 1OGTA 4AUJA 4Y4HB 5JOPE 2BZ7A 3EIFA 5IWLA 2ZWYA 4JUTA 4OZGA 5DS8B 5F3HA 1WBYA 2GJRA 1RJZB 3QH3B 4PJFB 2IXQA 1MUJB 2L04A 3LOWA 5IQ9A 3KPPA 4FQIL 2QHRH 5C0FA 4YGVA 1QRNA 2MMXA 2XWTA 4P23C 2XN1A 2YOAA 4BSVA 4ZMQA 5LGJA 4FYRA 3SO3B 4IBQA 3RWEB 4YZWA 3AAZA 1X4XA 3HLAB 4N2OA 3WNMA 1AHWB 3PFQA 1IAIM 1I82A 4LQFL 2X6BA 5EIIA 2HTKC 4XGZA 2IAMB 3W1ZA 1LQSR 4GMTH 4G8FB 3BPCB 4FI6A 5FYLE 5CZXD 5LAXB 2YUZA 1BV8A 1D3CA 4XPFL 3AY2A 4PSPA 4B9JA 1I3VA 1A6TB 3ARUA 3MLYL 3GMRB 1BZDA 4S1SL 3WD5L 5HPMB 3VSVA 4Z3GA 5DA0B 5HI3D 1D6EB 2X42A 4I48A 4P3WA 5F96L 5DQDH 4M7KL 2BSSA 4IMLB 1JS4A 3W5MA 1KC5H 3NQKA 4RDQF 1NSNL 3X1BA 3BPNB 1SVCP 3ARFB 2IFFH 5DK0A 1XVSA 3G5VB 3C5JB 4X9FA 1K8DA 1YYMH 3AMLA 1G87A 1WDAA 5DC2A 4QR7A 5JQ6H 1Y18B 4LASH 2X4NA 3GRGA 4TVPE 1XO8A 2GY7B 4H1LH 3ASWA 3FB5A 4I18B 1BZQK 1A7PH 2BP0A 4GI9A 1S6NA 4BDVA 4WJ5B 3NIGB 2NY1B 4N8CH 3U9PL 1MCFA 5KJRH 3QFJD 1B90A 3QUYC 1BREA 5DZPA 3CIQA 3BP5B 3GMPB 2N1TE 1BQLH 4PR5A 4WWPA 2XOTA 4A66A 4ZJ9A 4FFZA 1UWXK 4U0RB 3GXTA 4E9RA 2OTWA 1E6OL 1BXXA 3LRHA 3VE0B 2GTZA 3AWFA 3P77B 2VLKE 5TQ0H 4OFVA 4TRPH 3UC0L 4GUQA 1OP5H 5IIEA 4LSQH 5D7EA 5HI5D 2VOTA 1PKQE 3ARXA 4FG6C 1UZ6F 3I84A 1UOWA 2ZYSA 3OF6A 5H2BB 2ENQA 4PGCA 4OCSH 3ROLB 3G6DL 5JOFA 4QOKE 2CHZA 4JR9L 3TH3T 1JWSA 3H9HB 1XSIA 5DEFB 5F7MC 3MKKA 3VXQB 4NOBA 1RJLB 4HWZB 4I0PB 4LPUA 4NDMA 3QQ9C 4M1GH 3T8XA 2FJFB 4DPBX 4FQQA 2PTTB 3K4AA 1T7VA 2YC1A 3WE6A 1B9KA 2UUDH 4GAJH 3HG1E 1JNHA 2VDNH 4HKJA 4KTEH 1NGZB 4KXBA 5DZVA 5J5EA 5DYOA 1G7IB 3ZKMC 5KN5A 1FC1A 4H25A 4K8RH 1MFBL 1CDBA 3DTDA 2R69H 3K72A 3QO1A 5E2WL 1G9HA 1AZZC 4LLMB 3DVFA 4YWGL 5C0GA 4FZ8L 1UENA 2V5RA 1NH6A 4ABUA 5DRWA 3GSRB 5AG8A 3KYKH 1G1KA 3NFNA 3HS9A 2XZQL 1A1MB 5F9WC 4MB4A 2OMNA 3X3FH 3Q6FA 4PJAE 4XP4H 3HG3A 2XZZA 4QO1B 1VZIA 3K91A 4ELMA 3D18B 1T21B 4KOBA 5CZRA 1G7PA 2XVKA 4DN3H 3CVIH 1HSBB 3ALWA 3SE8L 2CCLA 3ARPA 2CJTA 4LEEA 3BSZL 3VGEA 3TASA 2B2XH 2AJZB 4PRPD 5EOTA 1P5UB 3O3EB 4TUKL 1XSKA 4WENB 2WXLA 5JYLA 3JVGC 3HB3C 4XT1C 1E9PA 1U8KA 4W9IC 2JKWA 2OSXA 3NCYS 2UXFA 1DVTA 2F5BH 4HZLA 2JKSA 3P1VA 1MNNA 3TIEA 4GUPB 5FFLA 1S7XA 1USQA 4AENB 1Z2KA 3OSVA 3S88L 4AMKH 2YD9A 3LXAA 2PWDA 4D9LL 4MKTA 1INDL 3IEAA 4BUGA 4GKOA 4ZXBB 1JGUL 4LDEB 4Z95H 4S2SB 2J44A 1KY6A 1IIIA 3MCLH 1A7RL 1E5BA 3MR9A 3P4MB 4C54A 2ADIA 4U6HA 4Q89A 2ARJA 3AITA 5MHSD 2APFA 1XTLA 1EH9A 3C08L 1ADQL 3MRQA 3QJZA 4PP2A 1N9PA 2XN9E 2KZBA 4I3RH 2QVIA 4F7MA 4QRRA 7FABL 2C9RA 2GSGA 1C5DA 3ILQC 3ZSSA 4YDKH 1KTKE 1OTTD 3IK2A 2YQBA 4U1KA 1BDYA 5AYQA 3WUWA 1HH6A 1IBFA 3E3QC 3OR6B 3TNMA 4HJGA 2FNWA 3LMJH 2HLFD 5EG6C 4FA7B 3DVIA 1OY3B 2DN7A 1AJ7L 1DVFA 5EF0A 2NY5H 2DLGA 3D4ZA 2Z31C 3PWPA 2N7SA 1C1EH 1QNZH 4HGWB 1YEEL 4AK2A 3G08B 5MP6H 2CLRA 1I9RH 5BUAA 2E9WA 2PCXA 4AGQA 1W9XA 2BFVH 2BCKA 4WHTB 3DK0A 2PN5A 3DX9A 5IEKB 4U7SA 2JKJA 1U91B 3BW9A 2ERJC 3TFBA 3SBPA 3MUUA 3ZN6A 1SFDA 2Q20A 4JPIB 4X9BA 5DFWH 4Z0XB 2PYEA 5IB2A 3L3HA 3S8GB 3MJGX 1ACYL 3L48A 1KB3A 1J0JA 1MRDL 1XGYH 4OGYL 1IRAY 2VXSH 3EBIA 3SIKA 3C9NB 3L9RB 1M71B 2DIAA 5JLZA 4ZPVA 1PW3A 3QG7L 3BWUC 1PBYA 3K2MC 3VFVB 4AGPA 5I6LA 3US1A 4Y19A 2Q76B 5IFHL 1HJCA 4PJ9D 4QRQA 3PGDB 3BPOC 4W68A 1U8HB 3DI2B 1IAKA 5F7EH 3VH8G 2O6CA 2J73A 4XZ4A 3QG6A 1BQRA 1F58H 2HKHH 3O11A 2Z34A 3QULB 5CBAA 4TSBH 4ERSH 3R1GH 4C83A 2WWNA 3DX4A 2PTVA 4MJIB 4CMHB 1WUZA 4PJBB 3BEVB 3DSNA 5B1KA 3H9SE 5SWQA 3FQRB 4BWUA 2X3CA 1CBVL 1RULL 2P8MA 2JJTC 5CNHA 4UM9B 3DYOA 4JBSA 1BOGA 1F1GA 4LLAA 5KSBB 2VRKA 4ESKA 2P44B 2ZOWA 4TMPA 5FW8A 3QEHA 2EDEA 2YMXL 2XVGA 3FMGH 4P4KA 2FBJH 4DH2A 2XI9A 4NQEA 3LXBA 3CUPB 2WXOA 1FGNH 5GGVY 1E7UA 1EHLH 5C6WH 2X2HA 4OVUA 4QJ5B 5B1JC 1T0MA 2LFGA 3HE7B 1SN5A 2XRAL 3DX6A 4ES8A 1ZV9A 1ZHLB 2FIKB 4JEGB 3GRWH 1UGNA 2HTKD 3H8NA 2VDRL 5DJ0B 5DQ9B 4HJ1A 2ZXWB 1OZTG 1R3IL 2ZOLA 3IJ8A 3QIUD 2WQWA 4ATTA 3CFNA 5BJTB 1MJ7H 1AMXA 1AIFB 1MFAH 1RZ7L 3BVUA 5DYFA 1UM6L 3D0VB 3QUXA 4M9PA 3UC2A 1SOXA 1BZ9B 2V2WB 1XB6A 3KHQA 2L4OA 4JKWA 1WAEA 4E9WA 2IF7A 3NRQA 1EEZB 4CL7A 4XCNB 1IQWH 3AW5A 3NJHA 3FQWB 2J43A 3R06A 4FQ1H 4UDTA 3EHBB 3L13A 4NWTH 2GEEA 1L9TA 2EO7A 4WI9A 1MCCA 1JPGA 2K6WA 3EW3B 4WSKA 4KFMA 1JUFB 4JB9L 3OBAA 3ZW3A 4GKSB 2NR6A 4CW1A 2C1PB 5C0IB 3AROA 2WPGA 2VQ1B 2ZP0T 4OCYH 3L3IB 2IWFA 4PJBF 4DW2L 5BQDA 5F9AC 3QCTH 4MJ5A 5DA4A 1MREL 1K6QL 1BAFL 1NGPH 3JWDH 4YNYB 1QSFB 4MJHA 4JK0D 5E1IA 3US9A 4CADB 3ULVE 3P3SA 4RSVA 3S4SG 1R9FA 1RZIB 2WUCH 3KWWA 1FVCA 1CZ8L 1HQ4B 1OTSD 2PWHA 1XB3A 4J8RA 3QUYD 4ZODA 12E8H 1Y6MR 2HLEB 2M8XA 3CFTA 4HFUH 5TDOB 4AIZB 5HYSB 3ARYA 1G9MH 4XXCC 5LLIC 4WVRA 4DKFH 1COBA 2Y3AA 3KPOB 1YEDB 5E9DD 2WZ5A 2QR0B 2F68X 1IBZA 2B4CC 2QHRL 3B9KB 2RBLA 3QUMA 2ZCKH 1EZLA 3PWLA 4IBLT 2X1OA 4E2OA 3NCYP 5B3SB 2G3ZA 2C9XA 2Z1PA 2QFRA 4PBVC 2VC2B 2Q5BA 3AJ7A 4Y8DC 1VEMA 4NRXA 3TIDB 4P05A 1BD2B 2J6EA 1U3HB 5D4HA 4FG6D 2DV6A 3GMLA 4GMTL 4O02H 3IDNB 2NSMA 3PE9A 1ZLSH 3LCYA 3IETB 5DQJB 4FNPA 3GI9L 3S5ZA 4LCCA 1LMKA 3FJTA 5ID0B 1W2KT 4QF1B 1VLXA 4TN9A 3BQUA 4NP9A 1IBDA 3WKYA 4YFEA 3QQ9D 2O6FA 4NKDB 3QXVA 1KTCA 5D71H 1MSPA 1UASA 4KXDA 4U6XB 2X6MA 1PX4A 1T66C 4HOXA 3IJHA 5DQDL 5FUCE 5LCVA 1GYAA 4QXGL 4J3VA 3CFJA 3FK3A 3CV5A 2JH2A 2OR9H 1ZS2A 4Q0XL 1N59B 1Y1UA 1KELH 5GPRA 1KLFB 3HUJB 1YYML 4OD2A 5JQ6L 2R9HC 4LASL 2H6UA 2BVOB 5DU7A 2GK0B 4HUVB 4P2AA 2VR3A 5A2CA 5IJKC 3HPJA 1Q8MA 4N8CL 3MRMB 3ERXA 1UM5H 1S9XB 5KJRL 1Q1JH 3F64A 3VFUA 3TCLA 5E5LA 1Z1WA 4PJEE 4YUEH 3S35X 3OKKB 4NQDD 1AR1C 4MA1C 2A83B 3TVMC 3V6FB 1BQLL 4AYEC 3NH7H 3WHXB 5GRVL 4YLQT 1YEHH 3LKNB 4ZZKA 1RK1A 3IMBA 4BWTA 3LD8B 5DURD 3HC2A 4AL8C 1T1WB 2QSTA 3MLZH 4F8PA 3RUGB 3LNGA 1QTPA 4JFFD 4MXQC 4OLEA 1SJHB 1V05A 3HB3D 3K1DA 3WO4B 5TQ0L 2AEPH 2ADYA 1XGTA 4TRPL 4GI6A 4LSQL 5JNYB 5I1IH 2MSPA 1NOAA 2H45A 5FB8B 4J27A 4GAGH 1YAZA 3MZTA 1YNKH 2P42B 5DJDB 1PCXA 3E2HC 3D07A 1A6ZB 4GSXA 1URLA 1H9VA 4H26B 5DD5H 2WBXA 3MRRA 5M94B 4XCCH 3I6GB 1WFJA 4GRWB 5F3BB 3K5SA 2NY0B 2Y24A 2YPVA 3P73B 4M1GL 3OHXA 4OZFG 5CP3A 5SV3A 1FG2B 4LKCA 4CN1A 3J07A 4GAJL 1U58A 2VDNL 3V5DA 3K46A 3G3LA 4HUXB 1TQWA 1KIQA 1ZIAA 3MV7D 3CSTA 2BNQD 4K8RL 3UTTA 1O5PA 2R69L 2V5TA 3KPQB 4GAYA 3RY4A 3O3DA 3RJQB 2JCWA 4UAOB 5ICYA 5AZUA 4NQXB 3TT3H 3KYKL 2OXGA 4MB3A 1DQMH 2DM7A 4PB0H 4UIMA 5DD1H 1FYTB 3H53A 4TNWK 3O6FB 5TH2B 1KFGA 5D2NA 2K4AA 4NRYB 4JPVH 5LDUA 3X3FL 3WJLC 5F8QC 4XP4L 2NY3D 1SDAB 1CR9H 4I4WB 1YY9C 3ALPA 4XPBH 4X5XA 1M6UA 2GSMB 2Z31D 3EG9B 5F88A 4NHUB 2WD0A 5EIQA 2EYRA 4OFPA 2BJMH 3F7VA 4R4BA 4DN3L 3KNBB 2UZIL 1QUNB 3CVIL 3RUGF 1OAYH 4GO9A 3BAEH 5ID1A 2FVNA 2VLLA 5GHWH 3LXCA 4EQ3A 4X6CA 1NC2A 3P3UA 1G4MA 2B2XL 4EPSA 4JFDB 5DZAA 1T1XA 1XCXA 4Y1AA 4AJYV 4GO6B 4YEEA 3M1CA 3SJVA 2NCMA 2X2UA 5AVVB 5C0EB 1MVFA 2DKUA 5D1ZB 3PXHA 4JM2A 3JTBA 3GZPA 2F5BL 4JFSA 1CQKA 3APDA 4YGAB 3ILPA 2CIKA 4LLUA 4QKXB 2QDWA 1NTDA 5JIMA 1RP8A 4GKNB 4NKMB 4HWUA 1IT9H 4IRZL 4AJVA 1I1YA 3DUSA 4XOEA 1NBZA 3RHWK 3PIQB 4ODSH 1LP9A 2DIJA 3OHMB 5IB4B 1J48A 3MV01 3GJFA 1ZT4A 2IG2H 2YRPA 4YDNA 4WCYH 4XCYA 3LN4A 4Z95L 3TNNB 1MWAB 3HBPA 1AACA 3MCLL 1O6TA 4P46C 4RAVB 4YDLC 5BZWA 1QVOB 1AO7D 1NBVH 5EBGA 2HSIA 3LIUA 2ICWJ 1SFHA 1FLRH 5E6RB 2J12B 2J20A 3KWUA 1LMIA 5F93C 3HZKA 1P7QA 4I3RL 4UV4H 3QDME 5HDWA 1GTFA 4H0LC 3QRBA 1HN1A 1N0LB 3DO7B 4YDKL 2EDJA 3W0WB 3KAAA 1XR8B 2CDFA 3QJXA 3DGCR 1C7TA 2QZQA 2X05A 5DSCB 3F3HA 3BUPA 3LMJL 1JHKH 5FDWA 1SF5A 4Y4KC 4Y88A 1TYJA 2NY5L 4KOCA 4BSWA 1TZGH 1C1EL 1EUUA 1QNZL 4MAYA 3OG6B 4MQ7A 2PCYA 4PJHA 5DZLA 5MP6L 1I9RL 4HJTA 4J6RH 1S3KH 3POCA 2BFVL 5E94B 5DD3L 4G83A 1FFPB 1DZBA 1ZPUA 3UZEC 4R4ND 4ZW6A 4FNUA 5K9OA 2Y5TB 1A7OH 1UH2A 3EUUA 2XIDA 1YEFH 3KPSB 1S7UB 5L8JB 4N2HA 1LO0H 3CSBA 3NCWA 5DHVA 3IS0X 2ZUQB 5K1VA 1JWMB 3MLRH 4J28A 3D0LB 1OQXA 2HLAA 1IMHC 4EZJA 4A7SA 5I28A 5AVRB 3EJRA 4MD5B 2YPLD 1FP5A 5JIKA 1RJCA 3VU1A 3SZKC 4PG9B 1VERA 5F7EL 3M1OA 3U7AA 1QFWI 1T3FB 5TDNA 1F58L 2HKHL 1A6UH 2JQAA 1CYWA 1F3RB 4TSBL 4EZMA 1CIDA 3R1GL 4ERSL 4L1LA 5IJVB 3WAJA 3IF1B 1IGYB 3FTGA 4WUUA 2KC0A 2JJSA 2VLRB 2E47A 4N28A 3K2IA 4ZMAT 1NLDH 2IPUG 4IRSC 5FYKH 3TO2B 1WEJH 2OBGA 4K23H 4PJDE 4C59B 3IDGA 3FMGL 4FX5A 2FBJL 2XV0A 1S3RA 4HUWB 2G2RA 3LZFH 1JDCA 1FGNL 1IC1A 1EHLL 2JXMA 4R5VA 4UBDC 1R5VB 5EC1B 4DOHE 2DDQH 4NFBA 4PLJC 2ROXA 1W91A 5HJ3B 4ZFOB 3VQLA 5CEZE 2XU9A 2BVQA 4MLIA 3GRWL 3NPSC 3QPKA 3WN5B 2CUHA 3L7FA 4H8QA 4MXVE 3U2IA 2Y7QA 3PL6D 1CG9A 3BO8A 4MB1A 4C8XA 1TNMA 3OZ9H 1OF2B 4LCWE 1JXGA 4MJ6A 1MJ7L 5FF6A 1JNJA 3ELAT 1MFAL 3X12B 4XXWA 5CF3A 5GGTA 1J7VR 2CHXA 1C16B 4XC1H 4NUJA 5DVMA 4K94H 4LHQB 5J13B 3HBZA 1IQWL 1OB1B 1SJMA 2I7SA 3NSFA 1A6WH 4XZUB 2VR5A 4FQ1L 1YAIA 3BZFB 4AOFA 3KS0J 1HQRA 4NWTL 4JZOA 1F5WA 4OI9A 1T66D 3ULUC 4PHZA 3HA0A 4LLYB 1RK0B 3B37A 1NUGA 1QR1B 1SGKA 1ZTXH 2ICWA 4JFPA 5CJBA 3RZCC 1R1CA 3AUVA 3HNTH 4WNQA 3I50H 1ZT7A 1TVHB 1IIKA 1X5HA 4HSAC 3ZJAA 1IAMA 1INEH 2WJ5A 3APFA 3E1ZA 5D1QC 2X4QA 3KYAA 3LQAH 5ALCH 2R83A 3WL9B 1EO5A 4OCYL 3D3VD 4NNXB 5CIPB 3OXSB 4ZQKB 2R9HD 3QCTL 2X41A 3JWDL 1NGPL 4BE6A 3RWHA 4WV1B 1S9YB 2WUCL 1GC1C 4UT7H 5T5FH 4GQZA 1R47A 4ZTPL 3STBA 5I17B 1E67A 1DEDA 5EN2B 1FO0B 4CC4C 5I1LB 12E8L 4HFUL 5FGSA 2GI0A 4I9XA 4DN4H 1G9ML 3TVMD 1WO2A 4DKFL 5JHAA 2GJZB 4ODUA 4AUUA 4A7TA 3ZT6A 1KB5H 4U2YA 1PZDA 3PWNB 4OF0A 1UJTA 3PP3H 4TS6A 1DQIA 4UYQA 3VWJC 4ES9A 2ZCKL 4M03A 4UDUA 5SWSD 1BQSA 4MXQD 4A7GF 1OAQH 3H55A 3ZKNC 3QZWA 4NN7C 1WT5C 3BVWA 2GW5A 1ZLUH 3C5ZA 4PJGA 3S36H 3RFRA 2DJ4A 2P43B 4O02L 4KU1A 1XGZA 3BT0A 1U4EA 3UABA 1KXQA 1ZLSL 3LNHA 5I2IA 5KJ4A 1JYNA 4FXGB 4OCNC 3QFJE 5LAPA 1XH1A 3P4NA 2R29A 5HYIA 2C9SA 3HZ3A 2VWEE 3A4AA 1F4XL 5D71L 5DJAA 3PHAA 5DGQA 1XCWA 2H32A 3T09A 3WKPA 4X6EA 4R26H 1G1CA 1EXUA 4PN6A 4WF7A 2OTPA 1K5NA 3Q2LA 3KXFB 3TO4B 4A6YB 2OR9L 1WIOA 5EU3A 4ZSOA 3J8F7 2O4EA 3MLXH 1JV5B 4GS7C 2CO1A 3Q8CA 1IKOP 1WZAA 4ZTOH 5J7CC 3CSFA 5KAQG 2LT9A 4EVNA 4XB8A 4WI3A 1CDJA 3RPIB 1HEZB 3VW3H 2EECA 4PFEA 1JVKA 2XG5A 3FU6A 4ZFFB 1QEXA 1YY9D 1UM5L 4QT5B 2WY3B 4DGWC 1Q1JL 5EZJB 3ARRA 4CMMA 2G3NA 4X99B 2JQZA 1OM9A 4YUEL 4MNQD 4XTRC 4G1EB 1KCSH 4UQ3B 1HOCA 1QSEE 2OMUA 3NH7L 4JVWA 1YEHL 3ME0A 3ZQXA 3UEZA 1BF5A 3MRPB 2GIXA 3L2LA 3T04D 2NY6C 2O6PA 3FUMA 3MLZL 3QW9A 1T0NA 3LAFA 3EDDA 4JPWH 2Z7YA 3L8QA 3D34A 5B22A 4UQDA 1X6LA 3IFNL 5HVWA 2A6KA 2AEPL 4JRXE 5LGKA 2OR7A 3E8VA 1DANU 5I1IL 4L48A 3SY6A 1WSST 2WBJC 3KBFA 1ZVSA 4GAGL 3KYOB 3VD0A 4Q6IC 2AKRA 3V5KA 3WIFA 4PWKA 3MBWB 4LNRA 1AGBB 1YNKL 3LKOB 3SSGA 1JJUA 4RGMB 4LVNB 2FSEB 2AS5M 3V0DA 5DD5L 2UWEE 5CR1A 1ACZA 2D2OA 1KXTB 4XCCL 3STLA 1AD9A 5DS1A 2M83A 4BCYA 1EEQA 2CXKA 4K3JH 3IJSB 4P46D 2FWOA 4R3SB 2F08A 2A3TA 1J1XH 3V5HA 4JY5H 2VJ8A 5K1NA 3HPLB 5IOPA 3ML9A 5D7JC 4DGIH 4G1MA 3U9UA 4BKTC 4N90D 4MD4A 5MENA 4JCMA 4NCC2 5E95B 3TT3L 3LRGA 1DQML 4PB0L 1S7RB 5AKRA 2EDLA 5DD1L 4P4RB 3ALXA 4JPVL 4PWHA 3UCRA 4BGLA 4Z7OB 4TSAH 4LL9A 4NCDA 3CN3A 1CR9L 1N3NA 1RLWA 3DTXA 3HE6A 4XPBL 4Y4KD 3AU1A 3WEXA 3VVVA 5BZDA 2BJML 4RMWA 1VFOA 3P30H 3RKDC 2W9EH 1OAYL 2BSDA 2D7PA 3BAEL 3NJGA 1VAHA 5GHWL 2F54A 4YXKH 4N68A 3UYOD 3L7EB 5HGBB 3RPKA 5MHSE 5DLMH 3D4GA 1T7YA 2R23B 2CR0A 3EZJB 4JJ5A 2UUDK 1UXSA 2FE0A 3GJEA 5EU4A 1T1YA 5TE6H 4GOSA 4TNVK 1KTLB 3L9YA 4O58H 4GW1B 1XSOA 3IJEB 1RZJL 4PGJA 1YEKH 3VXUB 1PNDA 1IT9L 3CCHA 4ZW7A 4HUUA 4OF7A 1UEMA 4QRPA 4ODSL 1GIGH 3HFML 2AERT 1ANUA 2W0FA 5MI0C 2IG2L 5DO2C 4WI7A 3TN0C 1I3UA 2QGEA 4WCYL 3ZLQC 5F89B 1F90H 1KN2H 3EFFB 1SBSH 3FFCA 2IVFC 3MJ9A 4YH6A 4X7DC 2YD3A 1N8ZB 4I9WD 5F0JB 1WP6A 4L8SC 5FYLH 4C57C 2I26N 4P5TA 5AL0A 5AYTA 1NBVL 4F2EA 5MERB 4J3XA 1FLRL 4IRSD 4V1DE 1SJVA 4M7ZC 2QGCA 4H5SB 4Z7OF 1JI2A 4AT6B 2EINB 3I6LD 4UV4L 3SGKC 5AOMA 4IKJA 4AV0A 4MRBA 4NUGH 4CGUB 5IWLC 2Z92B 3A4DA 2E7CA 2ZE0A 4FL4B 4ISVA 4F8TA 2F7IA 4P2QB 1CXFA 5JW5A 3QDGA 4HKXA 4PTTA 4UBDD 3HAEB 5ELIA 1ZCRA 4KHTH 3SE3A 4PLJD 4ABVA 1JHKL 1CD1A 4IK7A 2F7PA 3FQ1A 4N87A 1IM3B 2PYEE 1TZGL 4PI0A 3LEVH 4KDVA 1A4KA 5C0DB 4QCIB 3WEBA 1I8UA 4J6RL 4TVPH 2V37A 2BOCA 1S3KL 5CCHE 3CX5J 1P5VB 2FNBA 3O3BB 3QAQA 2DH2A 2HFGH 2R1WB 2NUTB 2Z35A 5ICZA 4LDLB 3E6FB 3ZHLA 1A7OL 2YQ2A 4QHPA 4M8VA 4Y0GA 5IW6B 5F1IB 1F4WH 1YEFL 1ZKAA 2WLIA 4JY4A 3UX9B 1BM7A 1LO0L 1IM9D 3QDJB 5I1DB 3ULUD 4N0UA 3MLRL 4XMKL 4JUSA 1HL9A 2K7PA 4QYOB 4QGYA 2NW2B 4OKVB 4J2XA 5CWSB 2O61A 4TL5A 3VXTB 5C07B 5JZ7C 5D1QD 1IL1B 1LLAA 1OF0A 4G7RB 3VSTA 3BP4B 1W72B 2X4RA 2H6OA 3IXTB 1KIUB 1Z5LA 2EE6A 1PZ3A 1A6UL 2QLYA 5GS2D 3Q2NA 1RZGB 4ZW5A 4X6BB 3OXRB 3ZTJH 1VACB 5I6XC 5IMLB 5E7BA 1XZ0A 4YE0A 1AZVA 2CPCA 2VL4A 2ZXCA 3FTZA 1SLWA 5IVXB 2C9QA 5LHDA 1GGBH 4NAQA 5KVFH 1WEJL 2ZKMX 2WSDA 2CD0A 3T0EA 4K23L 1VIWA 4AH2B 1BLIA 2J8OA 4HA1A 1E2VA 1HWHB 3QZOA 1RH8A 1TZIA 1J0IA 1WQVT 3HHRB 3LZFL 4FHBD 1PG7W 2IH9A 3VWJD 2EDQA 4IOSA 3PHQB 5ICXA 2DDQL 4APQC 1RCYA 1MAKA 2ZCLH 1OGPA 1IKNA 5ESAB 1P7KB 2YOCA 3X2QB 1XEDA 2NXYB 4K7PY 4NLAA 4YSDA 4GQRA 5ECJE 5KYUB 1HDMB 3VXOA 2QFPA 1MAJA 3ES6A 4WKZA 3U6RB 2F2HA 1ZDQA 3MCYA 3MJ8B 3OZ9L 3W11C 5I5RA 4FYTA 2YGQA 4BK5A 3EDJA 2ZONA 1U8NB 4Z7QB 4OR1A 4K2UH 4OIAA 3EOBA 4XC1L 4NRZB 2F53A 5E4EB 4K94L 1FIEA 2B5IB 3G6AB 1BM3H 3IMUA 1A6WL 1IC7H 3NABH 2DLTA 1J10A 2XVBA 2BSCA 5E9DE 5C0CE 1NBCA 2PCPA 3BGMA 1A25A 2CKBH 4XMWA 2W80C 3E80A 1ZTXL 1M2VA 4JJHA 4JKPL 4N0RA 1QLEB 3HNTL 1XH0A 3PS6A 3I50L 2W07A 1FCCA 3CZEA 2BRRH 2PWFA 1INEL 3IDXH 2B9AA 4G6AC 5ALCL 3SDAA 1XBRA 3LQAL 3W9DA 1Z9OA 4XC3H 2BHFA 2K3TA 1OE3A 2BVEA 3RWGB 5BO0D 2O6DA 4N2AA 4B7IA 1UVQB 4GBXA 4WW2A 4FQ2H 5IVXF 4DUWA 1BZEA 1OT2A 3NDZE 4R7NA 5EPMA 4P2RA 2VL5A 1R3JA 2VYRE 4NI3A 2GCYA 4UT7L 5T5FL 5IK3B 1JYXA 4IJ3B 3QEQA 1KJMB 5AVXB 4KZ0A 4ELKB 3R8QA 1WH0A 2A9DA 4LT7A 2OJEA 3TBYA 5B7MA 4XTRD 5EEYA 4LCUB 1WCQA 4LSRH 3X14B 3DARA 5DVLA 3UROR 1NCDH 3H0TA 5C6PB 2OCFD 4HCRL 4X7TB 1BIIB 1URIA 2ZD0A 3GUFA 4U3XA 2NY6D 3WYRA 4B96A 1E9QA 4YSEA 1KYOK 3O2VH 3MDJA 1OAQL 3IU4H 1SXSA 2FWLB 5HHOE 5I5MA 3RGHA 1K8IB 2OMVA 3WLWC 3HR5A 4BYHA 4L4TD 5EIVA 4BH7A 2WBJD 3S36L 4IGBA 3U36A 4P2OA 3S2AA 3CJJA 5EULV 1RIHH 4EO5A 4Y9EA 3KPMB 1DVQA 3L54A 4WTXA 1SDDB 1UGKA 3ZL2A 1U8CA 3SCMB 1ET8A 3V4PH 4NQDE 1QNIA 2AQ1A 4F7KA 4KDTC 2N1KA 1WHPA 3JV5A 3ECVA 1OAZH 4PCYA 3RVVC 4ZG1A 1D9KA 4GI8A 3SDYL 5J9PA 1FORH 3BUTA 4R26L 2G9HB 2CHWA 4X5WB 4JFFE 2EKSA 2VMEA 1SXAA 5FO7B 5KEZA 4HP5A 1L0QA 3GMNB 5D7JD 1KT2B 3MLXL 4GUOA 2JV6A 3MJ7B 1VGEH 5J12C 2ZNWA 3U30C 4ZTOL 5B38B 4ZX5A 4KI5F 3PGCA 1Q9WA 4HALA 3QWNA 4NQTA 1AGFB 1XR9B 1PIFA 4N1EA 5EEVA 3VW3L 2IWGA 5CBEA 4F93B 3QNYA 1CGSH 1YMMB 4PSRA 4MGXA 2FL5B 1A3RH 3UG5A 5D7SH 3M45A 4HAGA 4XMXA 3QIBA 5I24A 1DVFC 1TTGA 1T22B 2BIMA 3EOAB 1KCSL 4AKQA 2XQYK 3GK8H 3II3A 4PV9B 2Z7WA 1NGXB 5C0AA 5TDPA 5JIDA 5ESQB 2DWDB 4L4VD 1C12B 3DUUB 3UTSA 4N8VA 3OJDB 4JPWL 4WK0B 1SHXA 1QFWM 2WXJA 3GSVA 3FXIC 4QKTA 3MRNA 3UBXG 4BFRA 5F9JB 5I75C 4MQTB 2Q7NA 1PTZA 3TV3H 3N1QC 4QJ3B 3BH9B 2F9BT 1A4JB 3MRDB 3WDIA 1PCSA 2LAAA 3ZHNA 2RJMA 2ED9A 4Z7VE 4KH9A 5JXEA 2RR3A 5DEGB 4N2LA 4FMVA 4GSRA 5GGUB 1WGOA 2UXTA 1S9KC 3PWJB 4MA3B 3NQIA 1E5CA 1LK2A 4IIQA 5E6IA 4QPEA 3P2DA 5DO2D 3TN0D 3QJQB 4P8QA 4U6YA 1OP4A 4JFYB 4K3JL 3MOAH 1KJVA 1ACXA 2E6JA 1EJ6A 4FDWA 3D69A 1J1XL 2A74B 1TSRA 4UZSA 3NK3A 4JY5L 2VLJD 2FECL 3PHSA 4N0FA 2B08A 2VM3A 1A2YA 3DV6B 1HS6A 4DGIL 4NO0A 5ACZB 3QUGA 2WNWA 1PYWB 2OFQA 4YBLB 5DMKA 1EZVX 3OGCB 4D7PA 1E4XH 4P4KC 3FL7A 3LTVA 4PJ5D 4KTDH 4UQ2B 2VZOA 4TSAL 2QBWA 5DMGD 5I8CA 1QRKA 3RNQA 1QRND 2RMNA 2WZ6A 3QA3A 2E4FA 1XMEB 4AJWA 3U6XA 1ZHNB 2WKOA 5HHPB 5C08B 5D2LE 3T4AB 5C71A 4X4ZA 3S6CA 4NT6B 2WVTA 2W9EL 4P07A 2YD0A 3PDOB 4Y2OA 5KS9E 3DJTA 4YXKL 3RDJA 3TH4T 3N43B 4QXTB 4DGUA 1JZHA 1YMHB 3ULVH 5DLML 4NN5B 1D7BA 3CH1A 3QUXC 2GG1A 1ZPLA 4PYHA 4QJ4B 4CVZB 3KL5A 3ZQWA 3UAFA 4UQIM 4YDJA 5TE6L 1HKLH 5A43C 3SGDH 3WXVH 4NQUA 3JZ7A 3K80A 4O58L 5BS0A 2E5EA 4AYBA 5GIRB 2Z93B 4L3CA 3BSZA 3CN0A 1MQKH 43C9B 1UTDA 4M1CC 2NR6C 4NQVA 3N44B 4WW1B 1HKFA 1GIGL 4U49A 1XHHA 4PGZA 4WU7A 4POZC 1CFTB 3VCLB 1E6JH 1F90L 1KN2L 1SBSL 1X5AA 5IZ7A 4KUCD 3FQXA 5HGDA 1WZKA 4XO9A 2LU5A 3C6LA 1KEMH 4PRPB 2V7HB 1DFBL 2G2NA 2AQQA 3ARVA 5CMAB 3LNEA 4EF3A 3VXRA 4RWHA 5I71C 2JKTM 2EIMB 5D5MB 4XVSH 5GRYA 3HI5H 4GLRI 3MLSL 2K3HA 4NUGL 3W39B 1RURH 1H3VA 2D31A 1U95A 3BCDA 5CD3B 5IG7A 1DN0B 1INQA 2F7RA 4KH2A 3AFLA 1DN2A 2WAHA 4APQD 5ITFB 5F72S 3O3UN 1FVDB 2YPLE 3Q05A 3P4OB 3N43F 2H1LM 1KPVA 2IOMA 2YD1A 3CZUB 4R8WH 3SKNB 5J6GB 1ADQA 3LEVL 1NBYB 2X70A 3ZDYF 3GSXA 3ZDZB 2W0KA 3W11D 1OPOA 4TVPL 4PJCA 1AQ8A 5ILTH 4Z7NF 2VITA 5I16B 2WK2A 5HGAB 2HFGL 3CBKB 2C4FU 2VM4A 3LPGA 3QHFH 4N25A 4PRHA 4OTXH 4X9HA 2LU7A 4JG1L 1SNRA 3MV8E 4U7MA 2BNRA 1F4WL 4LCCC 3PDDA 4LGSB 4DP7X 1RZKC 4HEME 1JHLH 3BQUC 1QI5A 1S5HA 2NX5D 2P5ED 3GXPA 5DVPA 4KKZA 2X4SB 3X1NA 2IMMA 3WLBA 4ZI8A 1CLZH 4G6AD 4PGEB 5K5YA 2IGFH 1SHSA 3ECQA 2IJ0C 2OTUA 1JPFA 3Q0HA 3G9AB 2ZJSH 5DVKA 3NJVA 4J3OC 5D5MF 2FHBA 1SN2A 2XNAB 2O72A 1U92B 5IESH 2R0WH 1FWXA 1ZANL 1GGBL 5KVFL 3RY6A 1VZGA 1J1OH 3UTQA 1BVLA 3OKOB 4J3SA 1SHWA 3RWCA 1Q9KA 2GJ6D 4DUVA 4NPYB 1BLNB 4U7KA 4FYQA 4QHNB 4JFQB 4O2EA 3VXSA 3ZDZF 2ZCLL 1U21A 4EQ2A 1H15B 4OU3A 4PJ9B 2VO8A 3D3VE 3T65B 3PDGA 1PSKH 3PQYD 3GXFA 3KJ4B 5A7BA 3GB7B 3WV0A 2BIHA 2IADB 5DUJA 4EUPB 4K2UL 1SUJA 3ZTCC 1HXYB 3QXAB 4RNRA 3S3SA 1E4XI 3B8SA 4NQCB 3BUDA 5TE4H 4LKXA 1BM3L 4N24A 3DI3B 1IC7L 3GMQB 3NABL 4Q4IA 2GY5A 3RVVD 4Z7UA 1DUZB 1GZQB 2QELA 2AQ2A 3L81A 3LNFA 3OHXC 4M3HA 3JYCA 4PRIA 4KPHH 3APNA 4P23B 3CK0H 1SYSA 3QO0A 2XHNA 3G7TA 1FFRA 2B14A 1GXEA 2BRRL 5EEWA 3IDXL 4KXZI 3O8XC 5JHDB 1DJGA 3L5WA 3LS4H 4XC3L 5BRQA 3O4LA 5DJZB 3M7OA 2HX8A 4RX4A 1TJHH 2P5WE 5EU5B 1W8OA 2FO1A 4FQ2L 5L8KB 1X5GA 1EJOH 1EAPA 1MI5E 3EF7A 2WZPD 1QQDB 3O41A 2AAAA 3TJEL 2XYBA 3SGDI 3NFPB 3MA7A 4GP5B 4LP8A 4XXDB 5D2NC 5KBLA 5FKAB 3BJLA 2CA3A 4EI0A 2V2XB 3RU8H 2GAZB 4A7QA 1U8MB 2B20A 1KEGH 3ZE0B 2E75C 2LW3A 4LSRL 4O9HH 4HK0A 4E9YA 2YR3A 4WEEA 3ZZLA 1GMIA 1J9SA 1NCDL 3UYPA 4CUCA 5IJDC 5DCCA 2Q3ZA 1SJEB 4GRMB 3VRIB 1BECA 2DQIH 3O2VL 5AOIA 2GB2A 1FCGA 2G5RA 2QGBA 3IU4L 4K7FA 3NA4A 1SXBA 3QUZA 2FJHA 1QZNA 1AZUA 4K9EC 1G7MB 4GAAA 3H4FA 4LZKA 1J8KA 2R4SH 4JM2C 1YPZA 3VTMA 4XRCA 4UQEA 1NIDA 1RIHL 1DVSA 3RX8A 4NNYA 1HJBC 4ZUTB 2WVUA 1FV1B 4WFGE 1CLCA 4XNMB 3CC5B 5JDSB 1YG9A 4ONGH 5K9QI 3QUYB 1CYXA 1MCLA 2P48B 2VDPH 3G5XA 3P9MB 2QVMA 1P2CB 4Y19D 1XAKA 4RMUA 1G7JB 4MNQE 4B60A 4C56E 1I9IH 3E6HA 1XH3A 2WSPA 4IS6A 1L4IA 3HEIB 4D7BA 4E5XB 3SDCA 1FORL 1ND0A 1VZHA 4YIQA 2BY1A 4J8QA 4MJJA 3LKQB 2ZX5A 3OAZH 3ZYJA 4H0IA 1JGVL 4LHUA 2J2ZA 1CN4A 2M1KA 4HOZA 2GUOB 2QSCH 3NCJH 1CURA 3TA3A 1VGEL 1RUMH 5EZOH 2VKXA 5AB1A 3DYMA 5A6MA 3VI3E 4EAEA 3ZE0F 5E8OB 4NQED 3VI4E 4E41B 5JORA 3H7BA 3DGGB 2BVUA 5DRZB 3WN6A 5SX5H 4E68A 1NWPA 3W37A 2JB5H 1A3RL 4Q14A 5D7SL 2CG9X 3LRLA 3SE9H 4E9LA 3UAAA 2J1YA 1BXUA 1RVFH 4WWKA 5AUMB 5BV7H 1CTOA 5HVFB 4MAYC 3UAJA 3GK8L 1U8QA 4M93C 3V4VH 4DESA 2DJSA 2ZG1A 2Y6SC 4H1LA 4L3FA 3UCQA 3DXAB 2IBZY 2WSKA 2PCFB 1QTYT 4LMQI 3TV3L 3VB9A 5C09A 4MMXB 4N90E 4FQLL 1KG0B 5IJCC 1AQDB 1ZEAH 3M17B 3OC8A 4AEHH 5EC2A 4FABH 5F7UA 5BVPH 5IQ7H 1A9VA 5F9WB 4CC0A 2OMXB 4HH8A 2YLHA 2BC4B 3IAQA 4IOIB 1ROCA 2ED8A 1MCPH 2NR6D 3QQ4B 4LLWA 3FSZA 4M1CD 4X7EC 5DWPA 1C5CH 1S78C 5ICUA 5D70L 5CEZH 1ZGLM 1MRFH 4LSDA 4DERA 1D5XB 1LEKB 5L8LB 4POZD 3L3DB 5J6HA 4HSQA 3IVKB 2MTAA 3MOAL 1PEWA 2VZUA 1FNEA 1TOXA 3F2LA 1E27A 3CU7A 4HCGA 5DURB 3GBNH 3B5TA 3FCTA 2D0HA 5E5UB 3VFPB 1BFOB 1K2DB 4LCVA 5DHMC 2OMYA 2Z7ZA 2B9BA 5BRZD 4PGDB 5DMYA 1TVBB 5F7LB 3HB3B 2A6IA 2JJSC 1KULA 1WWBX 4HWBH 5F3FA 3SGJA 4DP0X 1E3ZA 2GITA 2FO8A 3FB6B 1SLUA 5T3XD 3MRHA 1E4XL 3ZR6A 1ZGLB 4XMPH 4KTDL 4BRVA 4WO0A 4RFEA 2C26A 2HJFA 4HAKA 3LY6A 1J9RA 4TPRH 1NGWA 1ES0B 1QG3A 1U8LA 4Y5YC 5EFIA 1RJYA 4AWJC 4B7LA 4N0YH 1CQYA 4WWNA 1ONQA 3KLAB 2NPLX 2FLMA 3FCUB 3C12A 4WIQA 1K85A 2ZSWA 5I1KH 1ETJA 5AKSA 2OKMA 4TVSa 1KCWA 1OGAA 3MOQA 3ULVL 2B59A 2HT3C 3MV7B 2BNQB 3RIAF 1D5ZB 2XN2A 2AEWA 1T20B 3FFCE 2FLRT 1JCKA 4HDIA 4N20A 1HKLL 2DQEH 3BQUD 3BMWA 2WLMA 1PZ2A 3OMAB 4PWEA 3RWIB 3SYQA 3TEUA 3VFOB 3WXVL 5A40E 4WWID 1RV6X 4X6DE 5DJ6A 3TPUB 1YNLH 4PJXB 2LLGA 1AKJD 4JW3A 4ACTA 1WD8A 1MQKL 1DVUA 1G7HA 4HFWA 3WFDH 1IC4H 1JHTA 2Z31B 4G9DA 4MQXD 3OX8A 2ZOUA 4F33A 3EO1B 1E6JL 1DLHB 1VKXB 4PBDA 1CD9B 2YFOA 4I5BB 2XPGA 3HMWH 3QARA 3UJJH 4JREC 2CNYA 2Q2LA 3FO2A 1KEML 1J5OH 3G5ZA 4JFOB 3GKZA 5BXFA 3GYRA 4UV7H 1M7UA 4PHXA 3CVHB 4XVSL 2PF6A 4DP2X 3ETBJ 2ERJB 3HI5L 4DO6A 4QRTB 3VXMA 4NZDA 1RURL 1GZHA 4NZRH 3SKMA 2OMTA 1N70A 2XWDA 4G8GA 2IALA 3GPEA 5C7XH 1I8LA 2G4EA 5EU7E 2UY6B 1OCRB 1WFIA 4GINA 1HVXA 1XCQA 2PW1A 1FZKA 3KBEA 3L1OH 2C7UB 4N0UE 3BPOB 3D39A 1J5HA 4R8WL 3LVTA 5D2LB 4FP8H 4BZ2H 4D2NA 5EDXA 3X17A 2AV7B 3ZKSD 3C5ZC 4WU5A 1CPUA 4XI5C 5ILTL 1RUAH 3QI9D 1MCHA 1GVIA 3ETSA 3QHFL 1SOSA 1AO7B 4OTXL 1JV2B 1KSRA 3BP7B 2NQCA 5FFOA 4HIIB 1EGJA 3EDKA 4PJXF 5CJXA 3MNZA 3L4WA 4TULH 1KIPA 3BAWA 4FQCL 1JHLL 3EGDB 5DHXB 1H3TA 1I8KA 3A24A 3P0YH 3L1EA 4PGBA 4WHDA 4TUJB 1KIRB 4KKCC 2IBBA 4LSPH 1BFSA 4M7LT 1CS6A 1CLZL 1LEGA 4NOFA 3O8XD 2ITDB 1BBJA 1R3KB 2EQDA 2IGFL 2R27A 4IHOA 4JRYA 4KJQC 1QI4A 3UTTD 4BXVA 4YHZL 4TYUA 2WCGA 4L8CB 1X7QA 4DK3A 4TOYL 5CJ5A 4IHBA 3SD2A 2WINA 3CDGB 3GBMH 2VR4A 3TURA 3VNYA 3T3PB 2A9CA 3S3BB 2XFXA 4JHWH 1THCA 2OK0H 4DK6A 2FRGP 4N9GB 2VDLH 3CFEA 4DIXA 3GSUA 5ESVB 1TLKA 5IESL 2XPYA 5EO9B 1DDHA 1S7TB 2KKQA 2R0WL 5F0LB 1AGDA 1CFNA 1Y6KR 2J3SA 1R3HB 2CGRH 3WEOA 4F58H 5ANMB 5AW5B 3FQTB 1J1OL 4CVXB 3VGFA 2UY7B 1YN6B 4Q2ZA 1ZLWH 3TBBA 3GSNH 5KYXB 2LLNA 3EH2A 2CLZA 3TYFB 2FR4A 3OB8A 2ICCA 4R7DB 2PWEA 1UB5A 3D25B 2DLFH 2VDKH 1CK0H 2XZCH 4R7XA 4Y1AD 1VB9A 2X38A 3SJVD 4FTVA 5CGMA 4ZUUB 1S4IA 1PSKL 3OB0H 5K93A 4FQHB 4JM2D 1FA4A 3FQ2A 4P57A 5I82A 2X4PB 3GMOA 5J89A 1JSYA 3QP3A 2CRMA 4PD4K 4WNJA 3ZDXE 3DX3A 4NGHH 3KM2A 1V3JA 3MV9B 4HCIA 4L0YA 5EZLB 5TE4L 2PP8A 3EGSA 5F7WC 3GBLA 5A6LA 5L2KD 2V2TA 2V8LA 1FC2D 3LZRA 1MJJA 3GRWA 1LWHA 3S5LB 3FCSA 3OWEA 3LZLA 2XN0A 2WLZA 4UINH 3KH4A 4KPHL 4AY0A 3CK0L 4K5OA 1OSZA 2C1OB 1BG9A 3T3PF 2KZ1B 3MREA 5F7KC 3LS4L 3ZZSA 5KSUA 3FRPA 1NKRA 4P5SA 3V0EA 4L4TE 4F37F 1TJHL 5A16B 1P7QD 1CO1A 2A7BA 5ABZA 3IGLA 4IRJA 1KGCE 5SV4A 1EJOL 1XWVA 4L1DA 2EYSB 3LHAA 2HVKB 1I8MB 3DK2A 4PRBA 1H5BC 4XWGH 3RU8L 2B1OA 1OD7A 5F6HJ 1KEGL 3HE6C 4KKLD 1HL5A 4LLDA 3E1F1 2WKGA 3L3GA 3MOBH 2EO9A 4O9HL 3AXLB 1JPTH 3PY9A 4MAYD 2XPZA 5IMKB 2J6WA 2Z8SA 2PW2A 4E9QA 2L7QA 3AG4B 5B1CA 2Y6SD 3N55A 4L4JA 2N7BA 4YPGB 5T1KD 2E74C 4KVCH 5E2VH 2DQIL 4GW5B 3X1GA 2E86A 3NCXA 5HHME 4N5EC 3WJMB 3S7GA 3UPRA 1WAAF 3M1BB 1A8ZA 2GC4C 2GTWB 2ZXDA 3B5GA 1RP9A 5HHVH 4EN3A 1ECZA 1LDSA 3AABA 2R4SL 3SPVB 5I30H 3SBRA 2FUQA 3LKPB 3IDIA 5TQ2H 5EBWB 1S78D 1JWUA 3IWUA 1DQTA 3S4SB 3BEWB 2VDPL 5FXCH 4TNFA 5DC0A 3FNKA 1DQQA 1AR1B 1I9IL 3FU7A 4MA1B 2WUBH 2Q6WA 2C3GA 1S9VA 1WZ1H 5IQNA 4PJ7E 4FEMA 5DZOA 4PJAF 4L4VE 2NY7L 4O02A 5SWSB 1HHJA 3UH8A 1KENL 3GSOB 4D0CA 4WUUD 3N40F 2ZP9A 4FLSA 4P5TC 2ZG3A 3EFDH 1ZE3C 4ZK8A 4YHYC 1T7XA 2QSCL 3ESMA 3NCJL 1NFIB 1RUML 3NPZB 1WGVA 1BEYH 2X2IA 5EZOL 4AUYA 4B0MM 2JK5A 2Z91B 4WTZA 4GEIA 5GSRA 2VXQH 1HCVA 3DURA 5ALBH 4ZMPA 2LHAA 4PV8A 5G4NA 4XN2A 5LUMA 4MTMA 4WHCA 1R5WB 3E2HB 4LCYB 3VB8A 4DK5A 2JB5L 1BQHA 1KNOB 2WB1A 3N85H 3SE3C 2FO4B 1L9OA 2GSIA 3SE9L 2WO4A 1RVFL 5BV7L 4S0SD 1ZRUA 3EFOB 3K2UH 3V4VL 4PJ6A 4C4KO 1HSAB 4U1IB 4XN1A 1PU0A 3FSVA 4XNBA 3I02B 5A2JH 2EE9A 1IGJB 5LG1A 5B39B 1TPXC 2HT3D 3ZYZA 2YGOA 2VLJE 2H6PB 1BZ7B 4Q9BA 4O2FB 2CO2A 3VYOA 2DTSA 3QJOA 5AYUH 1SXCA 1YEGH 3RNKB 1T5WA 4QD2E 4LOVA 9PCYA 1J8HA 2VXVH 1ZEAL 4RMSA 3ENEA 4AEHL 1BW8A 2P80A 3EF4A 4FABL 2Q0ZX 2DM2A 4AYFB 2QEJA 5IQ7L 3VD7A 5D4IA 1B2YA 5GS0D 3ABMB 2P24B 4W9HC 1FN4A 4RGNE 1MCPL 3T8VA 5I66B 2VERA 4NKOA 1M6OB 5E9NA 1C5CL 5CEZL 3GQFA 4JGUA 5IV2B 1MRFL 2WZAA 3O3AB 3HZVA 4K5NA 2LQRA 4X5PA 4L3ED 4PREB 4PV1C 2JLLA 1NJ9B 5DFVD 1FI8C 1CFSA 4QHMA 2ODIA 2BSRA 3ESOA 3O6KL 3GBNL 3HZMB 1MUJA 4L0PB 1FFOB 2P7TA 4HLZG 3HVNA 1PG7H 1MCWW 4HWBL 2XXMB 3RBGA 2CIIA 1RI8A 2XV2A 3T0EC 1CFQB 5IW1B 4WSGA 4Q52A 4NAJA 3UERA 1AANA 4XMPL 3V95A 1FL6A 1I7TA 2IPKA 5BQ7B 1OCZB 2J5WA 3NAAH 3B2PA 3UDWA 4LOUC 4TPRL 4X0KB 3VO0A 4FTDA 4WWOA 3HE7C 3HG0A 2YKLH 1OE2A 3VFSA 1OHQA 5FM5O 3FUDA 5IEHB 2EEAA 3KLSA 3S36X 1A1NB 4X5QA 3ESUF 3FFDB 1MVUA 1MFUA 2BP5M 4P3DA 5I1KL 3JV4B 4LBEA 3C5ZD 1U33A 2A9AA 4B95C 5I1CH 1DL7H 1M9SA 3LH9A 4P46B 1T6BX 2OXHB 2CA4A 4YOKA 3LQZA 5IBLC 2D73A 4HU2A 4Z6AT 4YDLB 1J18A 4BK5C 4OZFB 2BP3A 4F2FA 4AQOA 4FNLH 1CGVA 3LZNA 1N5AB 3ESVF 2BMKB 4JANB 3MUZ1 2VMCA 1RQ5A 4QHUA 1PX3A 2DQEL 3Q5YA 1NFDA 1O5DT 2AV1A 5FGCE 3EBHA 1YNLL 4KKCD 1PLBA 1FZMB 4CDHA 4CKVX 4Z76A 3SO5A 4Y4KB 5SWZA 3WFDL 3CZLA 1IC4L 4JE0A 1F0LA 2CXGA 3FT4B 4UTBH 2MPVA 3SDAC 1I7ZA 4B3VA 2R2EA 4R7VA 2WCSA 4IQHA 2VN6A 3F5WB 3H85A 4H0GA 5HYJE 4KROC 1M56B 3HMWL 3BP5A 4WW2C 3UJJL 2QJDA 2NY1D 1N6QH 1J5OL 2ODHA 1RZ8B 3I75B 5LBVA 1DTUA 4UV7L 4XMLH 1HXKA 4JG5A 1JZ2A 2H3NA 5JHMA 2BO0A 2VJ0A 2G5BB 1IZJA 4B9PA 4NZRL 4PQXA 2NX5E 4N8VG 4MX7B 1DQJA 4F3FB 2FWUA 5C7XL 5KYWA 3F01A 1GSKA 2CE6A 2PTUA 4X9GA 1LO2H 1OLLA 2JFCA 3CPLB 3FB8B 1G0XA 1KPUA 1M9WA 4F7CA 4X50A 3VMNA 3W2DH 1WICA 4G7VH 2I9TB 4LESA 3U4BL 1QR4A 1KJ2B 3DOSB 1EDHA 1RJLA 1J11A 2XWJB 4NSKB 1LHZA 4IGBC 3DKHA 5IHWA 2PTTA 1P6WA 1RUAL 1X5IA 4P2OC 2WLLA 2K9UA 4ADJA 3K74B 4CGTA 1GOFA 1WA0X 3GC3A 4OZHE 5F70A 3KPRA 4IRSB 5EF2A 4UQAA 5E8PA 5LXVA 3DHJA 3KGRA 4I0PD 1EHNA 2MHAB 2GJ6E 4BQBA 4E9VA 4UNTA 2OV0A 3L3OA 4U2ZA 3P0YL 4GXUN 4ZS7H 3GSRA 1IVTA 1RZQA 3PNWB 2J8UB 3RL1B 4ZUSA 2DQUH 4LSPL 3ZRSA 1DQVA 3KPLA 4UM8B 3B7YA 4I13B 5JW4R 5L88H 1VESA 2FHFA 2IFGA 2FLBT 2JTDA 4O2CA 2YPVH 3NPSB 6PAZA 4U1NB 3GBML 5D7LA 1O6SB 4M6MH 3LZOA 3PQYE 4KRPB 5MEND 2FDBP 3OMNB 1JZ7A 3DVGB 4R7LA 2NNAA 3RI5F 2OK0L 3I6KB 3INOA 2VDLL 1OK0A 3ZTNH 4XE0A 1NGYA 3QXDB 2NYYC 4G42A 3F65A 3FH8A 2FHCA 2V4LA 8CGTA 1T80A 2X2JA 5I76A 3W5NA 4NUQA 2CGRL 3LYRA 4MDJA 1DQDH 5FM4A 3TBVB 2RGSA 4F58L 4EBQL 2P26A 3QIBC 1B6DA 1IM9B 3GSNL 2QTVA 3GUTA 1X4YA 5BOPA 1SUHA 1MFCH 2CO6B 5C8JB