3UL4A

Crystal structure of coh-olpa(cthe_3080)-doc918(cthe_0918) complex: a novel type i cohesin-dockerin complex from clostridium thermocellum attc 27405
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
142
Chain Sequence
NTIEIIIGNVKARPGDRIEVPVSLKNVPDKGIVSSDFVIEYDSKLFKVIELKAGDIVENPSESFSYNVVEKDEIIAVLYLEETGLGIEAIRTDGVFFTIVMEVSKDVKPGISPIKFESFGATADNDMNEMTPKLVEGKVEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/protein binding
molecule keywords Cellulosome-anchoring protein
publication title Novel Clostridium thermocellum Type I Cohesin-Dockerin Complexes Reveal a Single Binding Mode.
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 31
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ul4A01
4DH2A 3KCPB 4UMSA 4WI0A 3L8QA 2O4EA 5LXVA 5G5DA 2OZNA 4IU3A 3GHPA 4IU2A 4U3SA 2VO8A 4UYQA 1ANUA 2ZF9A 4UYPA 3KCPA 4WKZB 4N2OA 3BWZA 1AOHA 3FNKA 2BM3A 2W1NA 1G1KA 1OHZA 2XDHA 3UL4A 2B59A 1TYJA 1ZV9A 2JH2A 2VN5A 2CCLA 2Y3NA 4FL4B 4FL4C 5AOZA 3F2LA 1QZNA 5K39A 2VN6A
chains in the Genus database with same CATH superfamily
1TITA 4LLQB 1VKXA 2NR6A 1HC1A 4UTBL 5DD0H 2Y2YA 3TPUA 5IG7A 1IC1A 3II3A 1QSEA 2NXYD 2WO2B 3DUSA 5CP7A 5ACMA 3N3EA 4YLQT 1BGXH 1U8MB 3HC4L 4HKXB 4IS6B 3KNBB 1LE5B 1KGIA 1P1VA 5DQJA 2J8HA 1NZRA 1FFNA 3AGVA 4RDQF 5KBPA 3HPJA 4XMPL 2MKLC 2PN5A 5D9SB 3SKJH 1OAZL 5ABDE 2Y7QA 1E28B 1RUKH 2H3NA 1NLDH 3HAEB 4RGNE 4AC4A 2XZAH 3MOQA 4UTAL 4HK3N 5AW9B 1EZUA 2B9AA 1AGDA 4YO0B 4U2YA 2B1AL 1QUPA 3IB4A 2HVBA 2Y7MA 3SN6N 1D7DA 4N24A 1FL3B 1F8TL 2A0LD 1ZANL 2O1AA 2G5BB 4QRPB 2BNQE 2EDTA 5CO1A 2CJUH 3IDJB 5FDYA 4QXUL 4YFDB 3MGOB 4OD2A 2D03L 3ARGC 1UC6A 3TA4D 2DJMA 3AM8A 3WNKA 5ISZB 2H3XC 4KJPD 3KEHA 1ZLVH 2GAZA 3CX2A 4K7PH 4YMPA 1PD6A 3KLAB 2KQMA 1DQJB 4YHNB 3M86A 1A66A 3O45B 1FFOB 1YQ2A 3T0XA 3V9CA 4NKQB 5D7LE 2E3VA 1ZTMA 3BC9A 1JZGA 1KCRL 3GO1L 3OPZH 4V2BA 1ADWA 3FB5A 2NQCA 3ILPA 5TE7L 2CXKA 2PPDA 3W9DB 4LPUA 3GSVA 4ANKA 4CJ0A 3T65B 4Q7DA 3BCDA 1EGJA 3LQZB 1KYOJ 4Y1AE 3OTTA 3ULAB 5B1BB 4NN7B 3V7AE 1DQVA 2Z34A 3T09A 3LRSA 3TA3B 4MMXC 2ZKMX 3ATAA 3JXAA 3AT9A 3VTTA 4E5XA 2DTMH 4F7TB 2PLTA 1W16A 2PO6C 4UU9B 1HOEA 2ENQA 1OARH 5IJKA 1ID2A 3K3QA 1RSFA 1RJLA 3QQ4B 5IKCB 5DHYB 2FQFA 4NQUA 1Y1UA 2H8PA 3O4OB 1S9XB 3FU0A 3IETB 5B39A 1OAYH 4XVUC 4HVBA 1I7RA 1CCZA 2Y1ZA 3C5ZA 2HSIA 2VDNL 4JO3H 3OKEB 4Q74A 4X9YA 5CJBA 2BY2A 3PGDA 5LBVA 4F8NA 5FO9B 3K6FA 4HJEA 4J2QA 2X6MA 1TJHH 2JIXB 4FF9A 1FLTX 2MHAA 4JY5L 4P23C 3RX7A 2BOBB 1I8MA 4OLZH 1PS3A 4L3FA 4ICWA 5KVDL 1BMZA 3BVUA 1GKEA 2ZYRA 1X4YA 1T6WA 3IJSB 5GGTA 4OTXH 4YHOH 4YDLC 3ILQC 4BRJA 4DTGH 5IOPB 4UM8B 4OI7A 3VXMA 3HKFA 4MYPA 3MV7D 1COBA 3NIGB 2Q7YB 2XPGB 3M1BA 2YA2A 3PWVB 5JUEL 4UQDA 3O41B 3G3LA 3DTUB 2ADJA 3JBG7 3L1OL 5GZNA 1UD8A 5BXFB 5FGBC 4PBXA 4XNMA 4GI8A 4KKPA 5LVEA 1A1NA 3EYOA 3LKQB 4I4WA 2LV4A 5EZIH 3D08A 1BQHB 3IE9A 1WAPA 4I0CC 2MQCA 3D34A 5LJYH 3U46A 4K3JH 1VEOA 1U92A 2NY2D 2R56H 2ADFH 1BSIA 2XT1B 2DI7A 4BJLA 1G7PA 1MJ8L 2ZOTA 1XH3A 1XIWB 3E3QC 4NO5B 3HNTL 3F85A 4EZJA 2XN9B 2MEJB 3REWA 5JMOC 4WNSA 1W72B 5IESL 2DLHA 2EUWA 5ESVB 4ZT1A 3IAPA 5DA4A 4S1QL 4MHHG 1BOGA 3S5ZA 1P6WA 1NCOA 1XGYL 2KDYA 3HAEH 3T4YB 3QI9A 4JO1L 3VFGH 5E56A 1OTTD 3NN8A 1U3JA 2VZTA 3KVQA 3EF7A 1TTGA 3WN5B 3ZT6A 1FBIL 3MX0A 4TULH 5F0LB 1V55B 4HPOL 4M9OA 3V5HA 2EDMA 5KVMC 3L4VA 4NN6C 3RWHB 1XR8A 3ARZA 2A6JA 2UXGA 3EH1A 4X5QA 2QPDB 2XQBL 2SEBB 2N59A 2VJ8A 3CZFB 3F7QA 5E24E 4P59L 4Y1SA 4OCYL 5BZWA 2XTJB 4OFKA 3UP1A 3UJJL 4FKHA 2ENYA 2MJWA 3D3VE 3DDGA 4EXPX 3RVTD 3QP3A 3ULSA 4TNWK 4FNRA 2PYEB 5KW9H 4RGND 2EH8H 4Y7MA 3R0NA 5CWSB 2CLRA 1IKOP 1MNUL 5DJAB 4TVSa 2ZWZA 1CD1B 3KBPA 3MRRB 2FX8H 1A7QH 2HN7B 1SFDA 1NC4A 2HFFA 3UZQB 3AY2A 3C8HA 5LXVA 4UT6A 2XWXA 3HZMA 4I18B 2FWOA 4B0MM 4AKQA 5I6MA 3JWDL 5IF0B 1TDQA 3WUWB 1R33A 1RHHA 5EUOB 4AGLA 1GS6X 5HYSG 1WPCA 2EDFA 2Y2WA 4PJGB 5C0AA 1HKLH 3U4BL 3VA6A 4PJCF 2VN4A 3HHMA 4XC3H 3BN9C 1HHJB 3OR6A 1QSZA 3PWJB 5ESQB 4DZBA 5IFAL 3B9KC 3F5WA 5KSBB 3LH8A 5DUBA 1BQKA 3L3GB 3H55A 3P9MA 3KPRB 4L9LA 4BK5A 5DMYA 3V7MA 3UG4A 1A6VH 3SOBH 4TUUA 5DHXB 1O6SB 3VJ6B 4P5TD 4F7CA 3KYNB 4JO2L 1V5JA 4Y1AD 1K8DB 43CAA 1G9ML 2W0FB 5FYLD 4W9HC 1DVQA 4XBGA 3ZDWA 3EOYG 5EOTB 1QBLH 4YSEA 3HFML 3SCMC 2QVKA 1IQDB 2R0ZL 1S6NA 1TSRA 2AEOA 2VWEE 3NJHA 3WS6C 1D5MA 1GGIL 2VXUL 2FSDA 1LK3L 1XD0A 4O5LH 1IM9D 1F2XK 5F9DC 1JGDB 1TJIH 1VFBA 3C6LC 4J3BA 3CFQA 2JELL 4DW2H 2V37A 4RFNC 3SZKC 5AL0A 4YSDA 4TQPA 3K2UL 4OBSA 2C9AA 4QHMA 3LDBB 4ONOA 4HJTA 3VYNA 4KZEH 3LMJL 2VH5H 1CL7I 3EFDH 4IRSB 3IDMA 2BVEA 4YDMA 2IADB 1EEUA 2P28B 4WQOA 1IGMH 4OLYH 3RWFB 5F89B 5I1AB 4U49A 4DO5A 4IMKC 1NBVL 2H2SC 3MOAL 1LP9A 1HCVA 1XGRA 2DYPD 4KKRA 4JE4B 1BOYA 1X6LA 3LRLA 4NFDA 4Y4KA 4RGMB 3KW8A 1HJCA 3WENA 1KN2L 1F02I 1BF5A 1JHLL 4C58B 2AJ3B 5GS0D 3MLSH 2OMUB 5F1KC 3D39A 1L7IH 3QO1B 5IM7B 3CN2A 1NJ9A 2IGFL 5JDSB 4OH2A 1TLMA 3HZKA 3Q48A 1XO8A 1MFVA 3D0LA 1ZLUH 3WSQL 1IQWL 4ELDA 1LE9A 4XP5L 3KG5A 3GZKA 5EZPA 1AHWC 1RI8A 2F53E 3EJYD 1UADC 1IKNA 3HS0A 4JY6A 1Q94B 2YBRB 3AGWA 5DJCA 4JZNB 5E4IA 4YPJA 1YEKH 1GC1C 4MA1C 2VXVH 5T5FL 5LDUA 4IEFB 1U8PB 1XH1A 3SD5A 1CI5A 1VPOL 2D3NA 1QP1A 3FKUS 3FQNA 2FT6A 4L8CA 3GKWH 4MJIB 4P5KB 1JZ2A 4LHUB 5JPNC 2HG5B 3N9GH 1I1FB 1BZ9B 1OIOA 5T33L 2XG4A 1SJEB 1JV5B 3L5WA 3NCCB 3ZMRA 3NPSC 1NMCC 2KBGA 5JIHA 1FAIH 4OGXL 5GJTH 1YEGH 2ZWSA 2Y72A 3WKQA 2N01B 1UWGL 2FX9L 3FCGA 3P4NA 1SUJA 5C9JB 1JXFA 2VZUA 2AGJH 1BAGA 3NFNB 4ZMTA 2XG5B 5F3HB 3LQMA 2OFQA 1N59A 2FECL 1JNNH 1DBMH 5JXEC 4BV1A 3IBEA 3ZZ1A 4KRPB 4HLJA 2OJZL 2B4CH 3MFFA 4L3CB 1CE6A 5L9DL 2ZXAA 1LM8V 4WEBH 4XWGL 2BSBA 3VXUE 2CJTA 4AGQA 1FI8C 2JK5B 1QBML 3RNQB 3NABL 2IPTH 1CDBA 4JFYB 3S36X 1NIFA 2E4FA 2PR4L 4FMVA 5HVHC 2DWDA 3V0JA 1BAFL 4A7TA 4K8RC 3K71B 1RAMA 2M8XA 5AW7B 4ANVA 3T0DA 1J8KA 3QIWD 4DT2A 4BKLB 4NXSA 5FAAA 1TZHB 4HUUB 1IBZA 5HHOE 5CEXB 1TXKA 4K71B 2Z4TA 3OLDA 3EFOB 3N41F 1ZKAA 5J6HA 2NW3B 3ETTA 3QFJD 3QR1A 1UM4L 2VZSA 5HDBB 1AYRA 4DUXA 4OB5H 3S4SG 4NQDA 5I8OL 3BH4A 1KEML 1JTOA 5CJOL 3LQAH 3T71A 5MEPB 1OCOB 3ECBA 5SX5H 1MQKH 4TQ8A 2A1WL 2HKFL 4XN5A 1CURA 1JPGB 4IDJL 4XP1L 3NBNA 2HT3D 2WTRA 4OSUL 2WUCH 1QSFB 1CD0A 5SWZD 5HGBB 1FNEA 2A74A 3F58H 4ZW3A 4IIQB 4XZ4A 4H1LG 1CL7H 4U1SA 2MFNA 4PG9B 5T1MB 4Q0XL 2FSEB 3DHJA 2FEDC 4AQEB 2H6PB 4YSOA 1AP2A 3BI9X 3MBEC 4FC3E 4FA8A 5JHMA 2R0WL 4JN2A 4IOSA 4EQ2A 2DQUL 1K3ZA 5I1KH 1PL3A 4D9QD 5IMLA 3HE7C 1Q9LB 3MA7B 3I84A 5IJVA 2P9RA 5AB9A 1WTLA 1KYFA 4M7ZB 1ZHBA 1OGSA 4PCTA 1YPZA 2ZCHL 4L29B 4IBTA 4Z7UF 1MCPH 3W56A 5DR5L 2YZ1A 3BD3A 1G9NC 1L9MA 1I1AB 3U6RB 2CJSA 1J9SA 1JSYA 5IQ9A 3VG0H 1MELA 5ECGA 5KVFL 3WEAA 1R0AL 2DY2A 4P5RA 4PJHA 4RQQA 2MPAH 4W70A 3R1GH 1Z9MA 1XAUA 1LO0L 1JXGA 2FH8A 4GRWB 4KH9A 3VH8G 4KAQL 1L5GA 3ULUF 3GMOB 3WLWD 5DF0A 2YRLA 4Y19E 4YIQA 4F57H 1W2KT 4ZMZA 1K4CB 4APXB 1YQVH 3D69A 4HZLB 1TZ8A 2F53D 3G6JB 4ODHL 1AO7E 4PMEA 4XNZC 4B53A 3TF4A 4XNDA 4YWGH 5JXAL 4TUJB 4G8FB 1GZPA 1W0WA 1JK9B 1ZWIA 2QSQA 2X41A 3HIZA 4KKLC 4OZHE 3V4UH 5J56B 1OTUC 4RWYH 4N5ED 1OT2A 1I9RH 2PP9A 1ZRUA 5I1GH 1J1PL 3QIUD 5D8JH 1AGFA 3GSNB 2MOQA 4W9JC 1TENA 1AZRA 1K8IB 2C34A 2J71A 1F3JA 4HXAH 3TV3L 4XXCC 2YFOA 3OXRB 3EHBB 4RFOH 3T8VA 3CVHA 4BQ6A 1HZLA 2X4UA 1A25A 3DMMA 2WB7A 4TTDD 3TT1H 5FUZH 5HDWA 4DH2A 2QLVB 2YLHA 4YSQA 4DP5X 3DETC 1NC2B 7PAZA 4DP1X 5E00A 3O9WB 2HUHA 2X89D 5HDLA 3VXPA 1P1ZB 4DFIA 2VQ1B 3B1TA 1S9KC 1O7DC 3O4LA 4Q6IA 2HVJB 1AVAA 2CHDA 1KLGA 3H7LA 4PJDE 1SDAB 3EADA 3T6ZA 3WTUA 2CO7B 4X6CB 5D2LB 2XWBB 2ZZUT 4PJAE 1VACB 5EWIH 1BX2B 1R5IB 1KTLA 1DN0A 4Y5XC 4MWFA 2CJ3A 4R7NB 3V6FB 1EHNA 1EERB 1HL4A 2O5YH 3QUYD 4GQRA 3VXUD 2I07B 1MWAB 2J88L 3HN8A 3QPXL 1KELL 5LNEA 3CQQA 2Q6WB 2YD2A 3EYVB 5J3HD 3PFUA 4FZEL 4XVOA 3W39B 3FZUD 4P4KC 1A6TA 4F15B 1MRDH 5EIIB 2W9LA 4WUUE 4RFEA 2ITDB 3WNIA 3UZEC 4LFHG 4PJEF 1NDMB 2EC9T 1S5HB 5D7SL 1GHFL 4HF5H 4WI2A 4IU2B 3TVMD 4JQIH 4CVXB 4ZXBC 5TE4H 5AENA 4CSZA 4LBAA 3QJTB 1TNMA 3GZPA 4O4YH 1UFUA 4YFEA 4WKZA 1KXTA 1NOFA 3VGBA 1MI5B 2CSPA 3RIFF 3RVXC 5CSZA 2XV3A 1FVEA 2Y06L 4Y2OA 1TZGL 4JRXB 3FU7B 4JHAL 1IGTB 2O5ZH 1D5BB 3ARSA 3HNVL 4XC1H 1PD0A 4F8TA 2IFFH 3BT0A 2R8SL 4CA4A 2VDMH 1GIGH 2R9HC 4Y4HA 3ARYA 4NO0B 2FATL 2ZX8A 1RD6A 4DGVH 4O9HL 3RWIA 2OL3A 4XCYB 4HFWA 2G3NA 1EUUA 3DO7A 4PB9L 2CMRL 3REVA 2E7MA 3EO0A 1AXTL 3IRPX 3MRHA 4Q9CA 5B38A 3PJLA 5I8CB 4JM2A 1IC7L 3LS4H 4WO4D 1JHKH 4PWEA 4GRWH 5D2NC 5IOKA 4J7RA 4OLUH 1MY7A 1U3HA 2XVGA 1RJZB 4QHNB 3NJIA 3QWOB 3U7WL 3L7EA 3BWSA 4PWIA 3QZWB 1TZIA 2GCYB 4AL8L 2BSCA 4LEEA 1IEAB 1XF4B 1ZIBA 4HS8H 3O6FD 4JKPH 4XN7A 4CSSA 3RY6A 2P52A 5DJDA 4PRIE 3TN0D 4OCXL 4R4BB 4XTRC 3PWUA 2PYFA 1E6JH 3FULA 5LGKA 4OW6A 3LJ3A 2PTTA 3MLWL 2Z91A 2VR3A 1U91A 5E03A 3IVKB 4M1DH 4ANWA 4J4PD 3I02A 2ZIDA 3OG4B 1HOCB 5C09E 4N2HA 2ZWNA 5J12B 5F1OB 5CN2A 2IWKA 4OQTL 4Y19D 2IH9A 2UZPA 3GTTA 1SHXA 2CZNA 2I32A 3KWXA 4FTVB 4XWOD 5AVZB 3GHEH 2BZDA 2EDKA 2GIXA 5DJYA 5EUKA 3V4PH 3QULA 4QXTA 2V2TB 3BH8B 4MAYA 2QL1A 2ZOOA 3WHE0 1TU2B 4UINL 1H3WM 2QBWA 2WIIB 5EBLB 1P7QB 4PGCB 2WB1A 3QNXA 2C9RA 4LQ1A 2UXVA 3QXAB 2M83A 2Q8AH 5I15L 1JZ6A 1MFAH 2BJMH 3IDUA 3V9EA 5FECB 2XRAH 5EO0A 3VFUB 3GSQB 4K9EH 5IUCA 3S0PA 1MLCA 5I73C 2AP2A 4PFEA 4GO9A 5TFSL 3C60D 3WCYA 1C08A 1U95B 1GPOL 4GKLA 2BPBA 4TSCL 4NSKA 4NNYB 3HG0A 4FQQB 3GMMB 1EO5A 3CLEL 3F3HA 4XAKE 5IW6B 2Z3FA 4TQEH 3MROB 4JQXC 4HX1B 2OSLA 3AT8A 4U3CA 4TNEA 1JNHA 3GTVA 1B9ZA 1BYNA 1M71A 3TWCL 1XF2B 3GI9H 4C56E 4LLYB 4AK1A 5KJ4A 2A38A 4F7MA 1V8HA 1MW2A 3LRHA 1ZA6B 5PAZA 1YJDL 3MODL 1U2CA 2OSXA 4M56A 3V0DA 4J3OC 2Z93B 5TK2A 5DS2A 4JREC 4KUCF 3DROA 5BRZE 5DVLA 3D52A 2VLME 1SJHB 2WTOA 4LCYA 4LVNC 3D1MC 3OJDB 2AABH 4FHKA 4GI6A 1J5CA 1QLEH 4A7GF 5FHAL 2E9GA 1PCXA 4XNAA 3HR6A 3DOIA 1CLOL 3NCBB 5BV7B 2YPLA 3NRFA 1PFOA 1B2YA 1A5FL 3EBAA 4P3CH 4JAMB 4QRRD 4J2XA 2XX0A 5E23A 2UXFA 5CGTA 3MRJB 1CFSA 1ET7A 1YYML 3A6BL 4A68A 1JZFA 1FNFA 2V9RA 4I0PC 1JGEB 4JO4H 1J1XL 2VOTA 2OZ4L 3PL6C 1W0VB 2XN0A 4TPRL 1CS6A 3NZSA 4MA7H 2HA1A 8PAZA 5FW7A 5A1AA 2N1TE 3EYQC 3VXOA 4HQQL 4R2GD 4FQXC 2NUTB 2W65A 5K9OB 1ZT7A 2XA8L 2FJSA 2LE9A 4N25A 4YR6A 4P05A 1UWEH 2OI9C 1NBZA 4AQZA 2WLKA 3SKMA 4FQIH 3L3DB 1IX2A 5BQDA 2X2IA 1EBAA 5DWUH 1LMKA 3H2WA 3EXLA 2PF6A 2Q7NA 1KB5H 4HU8A 1NUFA 3BAKA 3BW9B 3DK0A 2F8OA 2B39A 3H9HB 3P30L 3ZDXB 3PDOB 3GMLA 3QUXC 4NUGH 5EORL 1EZLA 1UURA 2IH1A 3FYEB 1BVKB 3RVWC 1N0XL 5KSAD 1Z9SA 2GFBB 3MLXH 4YEEA 4QUOA 3DOSB 3X1EA 1CU4L 2XYCA 4UQCA 2FX7H 3KYMA 4TVUA 3OMNB 2BCKB 5B8CC 3RFZB 1M4KA 5DYOA 5DFVC 4EDWH 3LN4B 1T0MA 1IZKA 3MLRH 3ZE2B 4PRID 4HXBH 4R8WH 3S35X 2VGLM 1N68A 4Y5YB 5CNHA 4N4YB 4HC1L 2PXYB 4XRCA 4M5YH 1R3HA 4NIKB 4U1KB 5MENA 4N1CA 1IC5H 2Z31D 4OIIH 5GGQL 3X2QB 1F97A 4AG4L 1F90H 3M7FB 1U2YA 2R2EA 3HC3H 3QUZA 2O26U 2JSFA 4JRYE 4JHZA 4TNWF 1DL7H 3E1ZA 2HPTA 4X8XA 3VTMA 4OUOA 4HEMA 4KMLB 3VQMA 3P69A 4KROD 1BBJB 2IQ9H 3NJNA 3RVVD 3ZMNA 3GXTA 2ZUWA 1E4KC 4LRIA 4QWWD 5F1SA 2WWKO 3RWEB 1OALA 5SWSD 4YS4A 2F68X 4HKXA 4IS6A 4GJTB 3NGBC 3BVNB 2RD0A 3KNBA 5AVSB 1LE5A 3PQYB 1JBJA 4TYUA 3QWQB 4A37A 4Q8BA 2FJGA 2Z64C 2QQLL 2VL5B 3EO9L 4G7VH 3BZ5A 4D0CB 2Z8RA 4HMCA 3V4VL 2B2XL 3JWNC 5I30L 3WY2A 2NLJA 1E28A 2Q9OA 3HAEA 5E95B 1PLBA 5ILTL 1J0ZA 4K94L 1PYWB 4YO0A 2ZKHH 2CO6B 2MCPH 3S2CA 1WWCA 2LFEA 2EDBA 1K4DB 3ROOB 3VO0A 1QG3A 3EIFA 4P99A 4ZAKC 1ECYA 4ERSH 3UYOD 1FL3A 4QRPA 2G5BA 2CDGB 1F1DA 3D51A 5DCCA 1QI4A 4FABH 3IDJA 3CZUB 2ITCB 3QE5A 1KCSL 5EZJB 5FLVA 3MGOA 5EC2B 3D0VA 2R4RH 4GQPH 4C56D 1M2VB 4B9PA 3BUPA 4Q9BA 3H3PL 3IXAB 4BDVB 4EXKA 3SDDD 3KZ8A 4GBXD 5ISZA 4YHNA 2OCCB 3KLAA 4XB3A 1DQJA 3TYFB 5AYUH 3RZCC 3HN3A 3O45A 4AV5A 1R47A 4R7XA 2FLRT 5BRZD 2YEQA 2HFTA 2VLMD 3VGGA 1XCWA 1LK2A 4U6VH 2C3VB 1RUKL 2R29H 2JWYA 3MLZH 4P57B 3BRDA 3T65A 1T03H 3V6BR 3SKOB 3LQZA 3UAEA 1JMZA 4WI5A 1OY3B 1IC0A 1C5BH 4DP7X 4JRLA 1EO8H 5JPMC 1H3UA 4CN1A 2G75B 1HEZB 3OKMB 4OF5A 3TA3A 1ZGLP 1ONQB 1LMIA 4FFWD 4F7TA 4FFZH 1W8EA 5A43C 4UU9A 3V4LA 4LMQI 3QQ4A 3Q7JA 2D7PA 5IKCA 1HT6A 2ARJQ 1KPRB 2BERA 1WE5A 5DHYA 3S37L 3K0YA 4D7PA 4N90D 1BQLH 3DX9A 1AKJB 1XWVA 1S9XA 3IETA 3N85H 1BMWA 3GBLA 3RWDA 1E6OH 3R0MA 5K1NA 5F6HI 5DVNA 3OKEA 3U36B 5FA3B 5FO9A 5A6IA 1N5YH 2JIXA 3SDCB 4AQ8A 2O6EA 2BIQA 4W81A 4Z6AT 2BOBA 2J55A 2XWDA 3LKPA 4LE8A 5GRJH 2EEAA 3LZRA 4KDWA 4IBWA 3IJSA 1SEBB 4DN3L 3TZVB 3QZNA 1NCAL 3LZQA 2DTML 4R97C 1AANA 3GMPB 5IOPA 3JTTB 2ID5A 1Q0EA 3IDXH 4PLKC 1OARL 2Q7YA 5DO8A 3AJ7A 3T04D 1JZ7A 4A2FA 2ZAHA 1VZHA 2XPGA 1NPJA 3UTTB 3O41A 1CI3M 2QKIB 4UUJB 4U0RC 2X3AA 4YSCA 4JGJA 3NH7L 4NX0A 3D4CA 1X5HA 5IHZB 4MXQD 5CILL 2DIJA 3LKQA 4JO3L 1EX0A 1BQHA 4U2ZA 4WK0B 1WFOA 2J8OA 3AG4B 3DV6B 1B4LA 4K15A 5LN4A 2NR6D 1N7ML 3B37A 4EN3A 4AM0B 4N2OA 1AQKL 1G5GA 3US1A 1DP0A 1XIWA 4NO2B 3BVTA 4NO5A 4OTXL 2XN9A 4WI0B 3BPOB 4YGAB 4XNXH 5D7IE 1W72A 2FZ3A 2V5TA 3P0VH 5ESVA 1OK0A 3WKNA 3WJMA 4LSTH 4JRYD 5D1QE 1NCCH 3T4YA 1LEKB 4K2UL 1QPPA 3DLQR 3NIDE 5G2NA 4XVSH 3FRPG 1IGCH 4HT1H 2IWGA 4XO9A 2NOYA 4M93C 3WN5A 1SXAA 1W8NA 3LEYH 3SBRA 2HG0A 1TCMA 4XOAA 3RU8H 4HCRH 5T5NG 1JYXA 1BWWA 4JY4B 1UM5H 3RWHA 1U93A 4YE4H 4ZUWA 3BAWA 5I1DB 4I1RA 1BVLB 5F7YC 2R56L 3QRBA 2SEBA 3CZFA 3R7RA 3SDXB 4XPAH 1HILB 3TS8A 4ZOEA 4OUUB 1EJOH 3G08B 1HESA 1KGXA 1CLYL 4XCEB 4HSAC 4GS7B 1C12A 2E9BA 1X9QA 4H0HB 3E80A 4DEPB 3ZKXC 3TM6A 5B1JA 5BS0E 2PYEA 4K55A 4PW9A 5I1JH 5E6ID 2FRGP 5AZEL 1FNGB 3QHFL 5D4QA 2LLNA 1ET8A 3WMSA 3QXDB 2FT8A 3V10A 5CD5C 1MJUL 2PTVA 1YEEL 3MRRA 5LGJB 1JI1A 2HN7A 3RWGB 4TULL 1NFKA 3S5LB 1IFHH 3UZQA 1IBYA 3H7BB 1E3ZA 4PRHE 4AQ1C 4I18A 1E4XI 4MD5B 5IF0A 1K6QH 2NX5B 4M7KH 3C2AH 5EUOA 5EB9A 4HBQA 4LCWE 4PJGA 5LWYL 1L9NA 4M8VA 1UACL 3NRQA 2EE3A 5I74C 3IFNH 4KTEL 3K6NA 3GMNA 1RZJH 2R0LL 3PWJA 5ESQA 5AW5B 2K6WA 4MA8H 5KSBA 2VERA 2OMNA 3EYSH 4G43B 4TRPH 5EU6B 4WJ5B 5AVXB 5IB2A 2GSIB 4HS3B 4F7EB 1PG7H 5TQ0H 3AWFA 1O6SA 3G6DL 3VJ6A 4AV0A 3KYNA 1FORH 1K8DA 2FX8L 5ISZE 2W0FA 2A3TA 5KAQF 1OB0A 3QGVA 2FJHB 5EOTA 1BDYA 1MCJA 2B3RA 5HY9B 3DIFB 1QZNA 2JKRM 3A6CH 3CZGA 3F6JA 1JGDA 1YECH 4HJGB 2MNJB 4OJAA 5E5UB 2DV6A 3T3MB 4E42B 3BP4A 2E7LC 4KTYA 1HKLL 2HZHA 2VSMB 4ZMNA 1BF2A 3IKCB 4JKWA 1WGVA 2EEBA 4XC3L 5I0WA 2WLJA 3TNNB 2ZX7A 1AR1C 5FUCC 2J20A 3L9EA 2UWEA 3MNZA 4NERA 5DC4B 4B9JA 4IRSA 2H9GB 3EDFA 3MGAA 4ALAL 4WVRA 2IADA 5E9DE 5LGHH 1DVFB 1A6VL 2BOCB 2WVUA 1FG9C 3QEUB 3RWFA 5F89A 3K6SB 1U8CB 5CJXC 1FIGH 2BRQA 2XWCA 2ZT9C 3ZTJH 3LPOA 5DUMH 4HWEL 5F7MC 3VWJC 4R5VA 4DGIL 5C86A 3U2IA 1BVOA 5CJ5A 3WFEL 2ZCKH 4O5LL 3EZ8A 1YYLL 1TJIL 2CQVA 3UJIH 2AJ3A 4FFYL 4Z95H 5ADOL 4GG6F 2OMUA 2ICCA 2ZNXA 5DD5H 5IM7A 5JDSA 2QEJA 1QACA 3RKDC 5EEYA 2VH5L 3EUUA 2ZP9A 3EFDL 3DXAB 4Z0XB 5F44A 3WE6B 2ZUXA 3O81A 4KX7A 3QI9D 4XHQA 3FU6A 2FR4B 1IGML 4MASA 2WN3A 1Q94A 2YBRA 3W37A 4FCHA 4AEHH 4JZNA 4DKDC 4HZ1A 3SO5A 3B5HA 5C0RL 4IEFA 2YAEA 4FLSA 2J2ZB 2VLKB 3ZUNC 1JRHH 3FT4A 4OR1A 2EEXA 4S1SH 4MJIA 4P5KA 2AXGA 3OAUL 4LHUA 4OF8A 5D1QD 2PW1A 1CFBA 1Q8MA 1YNTF 2ZXCA 3ISYA 4LAJH 1BZ9A 2G9KA 2YEZB 3VRJB 4YSSA 1SJEA 2CRIA 1JV5A 3KGRA 3MLSL 3PF2A 4UQ2B 4OGYL 1AGBB 3IS1X 4ADGA 3RY5A 3U9PL 4MB4A 2XZCH 2G4EA 2DIBA 2FD6H 1KJVA 1AE6H 3Q8FA 4UAHA 5E5MB 5C9JA 5E2UL 2R2BB 3VFMB 2XG5A 5F3HA 1SQ2N 3VD4A 1S4IA 3Q01A 2VXVL 1GYAA 1MRFH 3PLYA 2DKUA 4XXDB 1T83C 3TH4T 3WJJC 5IHLB 4BCZA 4L3CA 5BS0D 4I3RH 4KUZH 1E4XH 1I85C 3EYFA 4ZTEA 1T7XA 2JK5A 3MZGB 3RNQA 3F2LA 3CU1A 3NP4A 1MFCL 3C08H 4JFYA 1TJMA 3ZQXA 1EBPA 3NCFB 3W3BA 5GJTL 5KYNA 2EKJA 4PRHD 1DJWA 4OKDA 3VCLB 5DSCB 3O3BB 1UKSA 1EFQA 2A4EA 2YMXL 1CFNB 3ZL1A 3CSYA 1P5UC 3K71A 4WSGA 5PCYA 3BRGC 3I2CL 4PB0H 4BKLA 4LCWD 1A64A 1JNNL 1AMYA 1TZHA 4HUUA 5CEXA 3ALXA 3CXDL 5IBTL 2YPVH 3EFOA 3PPEA 4QYAA 3ARGB 1C1EH 2NW3A 3ETBJ 1GOHA 4EZMA 1AI1H 3CXHJ 4MSWB 2Y4SA 3K72B 4GY4A 5A2JH 3L4WA 1DDHA 4PJIE 4WEBL 5HI3D 1S3RA 4OFQA 2NNXA 1CTOA 1JPGA 2CWRA 2IPTL 2YMOA 1QSFA 2ZPKL 4PTUB 5HGBA 3OR7B 4IIQA 4IHBA 5HHNB 4LSUL 1VZIA 1PCSA 2A9DA 5C97A 4KX8A 4NLHA 4PG9A 5T1MA 5DHDA 2FSEA 1JZDC 2KL6A 2WXPA 3QUMB 4W4OA 5E1GA 2H6PA 4AQEA 5FOBB 2HT2C 3BIAX 3NQIA 4KJQD 5KZCD 4FI8A 4WTZA 4KPHL 2PPFA 4ZD3H 5LCVL 2DEYX 1UGNA 2YSSB 2PO6B 4FXGC 2DF3A 4OB5L 4JQIA 1Q9LA 1YLBB 1LHZA 3MA7A 4HLZG 3QNFA 4LSQH 3UTOA 3CFEB 2ZG3A 1DQML 2H0FA 1BG9A 2IANB 2VUKA 4HCFA 4HH9B 1JPSL 5CGYD 2D7OA 5CP3H 5ANMA 4OLXH 5E9DD 2QV4A 3JWDC 3RDJA 3AM8C 3ARPA 1U8QB 3LB6D 3MCG1 2IBGA 2EDQA 4L29A 5CCHE 3F58L 3WIAA 4ZNEA 1MFNA 2VXQL 3U6RA 1I1AA 3SPVA 1YHPA 4XT1C 4A55A 4P23B 1E7UA 1UD6A 1CD9B 3PHAA 2XWTA 2X4SB 4JGUA 4LCCB 4FADA 1T5WB 4YDLB 1JPTH 1YSOA 4TF4A 4ZMQA 1G9MC 5EIQA 3GMOA 1RUML 1VENA 3IJHB 1GGBL 4WW2C 1K4CA 2DMKA 2DM3A 3WFCH 4APXA 4HZLA 3HKZA 1ZV5A 4M7LT 1I9EA 3G6JA 1DLFL 1FZMB 3W82A 4TUJA 4NIYE 5AWNL 4ZMWA 4G8FA 3FMGH 3OSVA 1SLVA 5IJKC 2DMHA 2HKAA 2ODIA 5EU4B 2KUTA 1E42A 2QVTA 1IBHA 1MCPL 1NMBH 3LIUA 2QSCH 4LCIH 4NAQA 1K8IA 3LKRB 1CK0L 1K9TA 4JJOA 4D9LL 2YUWA 4JFQB 2NY3C 4MB1A 4V33A 3OXRA 3HUJB 1DQTA 3ZE0B 4EIGB 4IOIB 5CU5A 1QABA 4QHLB 1IFGA 4XHJC 1V10A 1U0QA 4KKAC 1E5AA 3CU7A 1YQVL 3DJZA 3O9WA 1AGEB 1VGEH 1KXQE 1E9QA 4L18A 3H9ZA 2W59A 1A6UH 1P1ZA 2VQ1A 3CHRA 3SSGA 5I6NA 2HVJA 3U1PA 3V4PA 2IAMD 4PJCE 2UYLB 3V4UL 5ERWB 4HIXL 2CO7A 2GBUA 3P73B 1HSBB 1D5RA 2FHBA 2XWBA 4X6CA 4XPFL 5D2LA 4Z78B 1CQKA 1VACA 2FAUA 1BX2A 1MWOA 1R5IA 5ETUB 2EE9A 4R7NA 3G5VA 3V6FA 4HXAL 2HFGL 3MTXA 5TQ2L 1UXLA 3O0RH 2I07A 4RFOL 1MWAA 3D18B 3JVFC 1TO4A 4UDUB 5T1LD 2Q6WA 5E51A 3TT1L 2WZPD 3ULUH 3W39A 1KJ2B 2E86A 3PWPB 4HOXA 5K9JL 3AG3B 3KWVA 3GMQB 4MJ6B 5I1CL 4PJ9B 3T0EE 5EIIA 3OMIB 1CXKA 2ITDA 4X8JB 1U4FA 4BBWA 4LRNL 1PMYA 4MHHI 1BHGA 4P2YA 5CSGA 1NDMA 3B4NA 3UGUA 1EH9A 1S5HA 3O3UN 4LP4A 3QJOA 1OGPA 2WBWB 4IU2A 5A7EA 1XF1A 1KBPA 1RZPA 1QHPA 2DICA 3ECWA 3VAEA 2NUPB 2WN2A 2H2PD 3OQRA 5CZVH 1YNLL 5EU5B 1MI5A 2FBRA 1UASA 1R3IH 2JQMA 3FFOA 5CJQH 1TTBA 5FEBA 3B9KB 1ES0B 4JRXA 5I8EB 3RGVC 3TWYA 4UNVA 4ELME 1IGTA 1D5BA 2VR9A 4XMWA 1I1YB 1ESOA 1QNIA 5MI0C 2EINB 4NO0A 1GS8A 3P02A 2EH7L 4A7SA 3BESR 4XCYA 4PR5B 1NPUA 4PBVC 3O2WL 3SCMB 3KE0A 3LXUX 5I8CA 4UILL 3VYOA 2A83B 2HJKA 1LVEA 3A3YB 3LRGA 4NGHH 5AEAA 4RZCB 4ZPVA 5C6TH 1PF3A 1RJZA 1XGQB 3AXHA 3FW6A 3OZ9H 3QWOA 4DP2X 1G5AA 4RFNB 3QZWA 4QPEA 2C9QA 4MQTB 3M17B 4H0IA 5DEGB 1JVKA 3BE1L 2GCYA 3GJFB 4JFDB 4UNUA 5CLYA 1IEAA 1XF4A 1N6UA 3P4MB 4RRPM 5FIEA 1I8KB 4MGXA 5DRXB 2EXYD 3IWVA 4F3FA 2YK1H 2O5ZL 3IDNB 4RA0C 4XC1L 2IFFL 3CFNA 4R4BA 1QMUA 4ABVA 5INCB 2QELA 2VDML 4UT7H 4DGVL 2KI6A 4IKJA 3LIZH 4BK5C 2ICEA 2VC2H 3IVKA 2HTKD 2OMBA 1QO3B 1SEQH 3BH9A 2EVGA 5FFLA 4F9LC 1CR9H 5GZOC 1T5XB 3LS4L 1JHKL 3QUKB 2QPFA 4JX0A 3BP5B 9CGTA 3JQOB 3H4FA 1FV1B 1ZT4B 5T5NF 4FTVA 4GG8B 5FR3A 2OM5A 3DMMD 1IARB 4L37B 4YHMH 1TTAA 4JKPL 3CLWA 3BH8A 2V2TA 5IB5B 1TU2A 3SE8H 4X6DF 1XL4A 4ZX6A 5BZDB 4PHXA 1BBDH 2VLRA 5EBLA 2D7NA 4PGCA 2AEQH 2W9DL 5GISH 1NUNB 3KYOB 3M7OA 3QXAA 5GRUH 2WQUA 3ABGA 3MXVH 4CC1A 5L2KB 5FECA 3A5VA 3VFUA 1SOSA 2H6OA 1NFDF 3GSQA 4PJ8C 4BCXA 3ME0B 3AT0A 3EJZC 3VI3B 3HE6D 4QYOA 5JPNB 1BM7A 1NTDA 1J5HA 3CDZB 4NNPL 3MJGX 1ODUA 2X3BA 4Y4KC 1CDJA 1D5IH 3BKCL 3NPSB 1U8IB 4NNYA 1SMOA 3BKMH 3GMMA 5IW6A 3GHEL 3NJKA 5I71C 3EJPA 3WO4C 3MI6A 2C9SA 3L3JB 3LV3A 4JKMA 1HN1A 1DBAL 1QHOA 2M2DA 25C8L 4PJBA 5LN8A 2YOAA 2B5IC 1BW8A 1J0JA 4OFVA 4KFMA 4KK9C 4TN9A 1QNZH 4PJ7F 1XF2A 3T2PA 4LLYA 1AKPA 2MMXA 2M26A 1MFAL 1YO4A 5E2VH 1ZA6A 3HS0C 1IC4L 5I0VA 4RISH 5TF1H 2E9IA 2D0FA 3B8SA 2Z93A 2KHAA 4Y5VC 4O02H 1EMTH 2F7OA 2VDLB 1SJHA 3B2VH 5KUMA 1H9DA 3SYCA 1A65A 4WK4B 1IGJB 1A6ZB 1RUPH 3OJDA 2C9PA 4HHGA 3VXQA 4TTGA 1V3KA 3D7PA 2F61A 4AOFA 3ZRSA 4B0MB 5HVHB 5AALA 3BPCB 3HLKA 3NSFA 2ED8A 1LO4H 5IIEA 1S7TB 1CE1L 3L16A 5I26A 3GI9L 2XPYA 3TBYB 3MRFB 3MRJA 3LX9A 3DI3B 4PJFB 4X4YB 2ESVA 4G5AA 2KYIA 4GAYA 1M7UA 1CDHA 1SDDB 3NMEA 1DVXA 1JGEA 1UD5A 3BUYA 4JM2D 4L1TA 4P07A 4MZ3A 3TF7C 2YWZA 2CPCA 4Z7UE 2J4WL 4HAFA 3VU1A 4NM4H 5DURB 2AXWA 3O11B 4FQCH 2VDKH 3VXNB 2GSGB 2VE6B 2NUTA 4HWBH 2K45A 1PX4A 2AABL 5EULV 4G1MB 3DECA 5IROD 4TSAH 2GIYA 3T1WA 3ARBA 2PETA 1M1SA 1QLEL 1KLUB 1QKZL 4HUXB 3L3DA 5D1ZI 4WTQA 5EU3B 3SDYL 1TQTA 4IK6A 5DZAA 4WW1B 1TFHA 3LHPH 3Q9PA 3ULUE 2DIAA 1PIGA 3H9HA 4P3CL 1NCWH 3HC2A 3PDOA 1A9VA 4OZ4B 2H1XA 5D5MB 1EAPA 3A47A 1JGVH 1BVKA 4PRAB 4XCCH 4LLWA 2EEDA 2GFBA 2X5PA 3BIBX 3C87A 4KO6A 5FCUH 1XHHA 4P2OB 5D1ZB 3C75A 4N3UA 4HMEA 4ZS7H 3UBXG 4PJXB 2BCKA 3HE7B 3RFZA 4K5PA 2J57A 1OP4A 3DBSA 3LN4A 4KKCC 3BVDB 2QZQA 4U3SB 4XBEH 1NIEA 2I7OA 2OMTB 4YHKH 4PJ6A 3GSUB 5CUSL 2PXYA 4FZ8L 4U1KA 4ZQKB 4F7PB 4FQIL 3V52L 4MAYD 3BEWB 15C8L 3O2DL 1KTDB 1KB5L 3MGTA 4YVUA 5FV2A 1CVSC 1DSWA 4YHLL 2A74C 1ZPLA 4I3SH 4AI7A 4LGRB 1HE8A 3I50H 2DMBA 4P2QB 1UJTA 4FNSA 2LTQB 3M8OH 1YY9D 2WPGA 1KIRB 3Q5YA 1QX1A 4KZ0A 4WENB 5DEJA 2FX7L 2WXOA 4UT6L 1BBJA 4R96B 3LCYA 4I85A 5T3XD 3RWEA 1CDGA 4XNZB 3DYMA 2JKIS 3SQOL 4G9FB 2BWQA 3PQYA 4G6JH 2CHNA 3KD4A 2QTVA 4O2FA 1FZOA 1WLHA 2VL5A 2BDNL 1F90L 4H88L 4XO4A 2VDLH 5KN5B 3ZK0A 2YD3A 1KBKA 1BXVA 1P4LB 2IPUK 3ES6B 1FWXA 1O5PA 4X7FC 4PJEE 1PYWA 5KJRL 4NQCB 2CBQA 3BCFA 2CO6A 4P5MA 2VR7A 3U48A 3HNSL 3BAEH 3L54A 2VDRL 4HJUA 2CDGA 2NT0A 1E4WH 2ITCA 2PWEA 1YEFL 3MYZA 4YDKL 5EC2A 4BFOA 1XFPA 3RUGB 2JKSA 4F80A 3B2DC 1ACCA 1M2VA 3V7AG 4BDVA 4JHUA 2ZJSL 1I8IB 1BLIA 4IRJC 5KVEH 4U1JA 2K7QA 3L2LA 5FGSA 3TYFA 4A6YH 4LPVA 4JFFB 4Y5XB 1UXSB 2JCCB 4CGTA 1J9TA 3OD3A 4ZJ9A 3VI4F 1CD8A 4M1CC 4XPTH 2C3VA 3VDAA 4J39A 2LGNA 3FUIA 2WAHA 2YXFA 4P57A 4DGWC 4LGSB 2H45A 5HVGB 4JFEB 4A7UA 3L95B 3CC5A 3BZEB 4P4KB 1MW3A 3ELQA 1OD9A 1O9WA 3SKOA 3WV0A 3DWTA 4GKOA 4RSYA 1HWGB 4FQJH 3U0PB 2HX7A 2G75A 1HEZA 3BQUC 3OKMA 4AJYV 4FABL 1ONQA 4J6RH 1P9MA 4BQCA 3WU1A 3QWNA 2EDYA 1WFMA 1Z1WA 2R4RL 4BWUA 2YXWA 4N68A 3SGDH 3ILDA 2JQZA 5DRWB 4L2YA 4NZJA 1ZVYA 2DOCA 1Z0MA 3QEQE 4W9IC 1AKJA 1L0QA 4Q6IC 2RCSL 4UT9H 2KKQA 1BXUA 5GHWH 3FT0A 1KBVA 3NYKA 1MKFA 1P7KB 5IWLA 5FA3A 1F4YH 2YS4A 2R29L 1YEIH 3SDCA 3HG3A 1DCEA 1MCLA 3MCKB 3MLZL 4KHXH 3W0WB 1T03L 3D2UB 5HYJE 4UV7L 3P3UA 1C5BL 1DVSA 1YJDC 1SEBA 1EO8L 3TZVA 3GBEA 1L3WA 4PY7B 5HDOA 3D0AA 5DK3A 3QXWA 1MVFA 2BVOB 2Z4QB 4HAGA 4MX7A 3GMPA 4FFZL 2HLFC 3JTTA 3SE9H 3UADA 3ZRCC 5F1NB 5FKPB 1A21A 4PVLA 1ZV2A 1OO2A 3AW5A 3PV6B 3UTTA 5I16B 4UUJA 2QKIA 3UYRH 1LL1A 5JOPE 3N85L 2XTSA 1ULVA 5IHZA 4MBRA 3ULVE 3E8UL 2F54B 2V8MA 2GIMA 3DOHA 4H8WH 4PSPA 4H1LH 2ORBL 3DV6A 3VMNA 4P9MH 4AYID 4OT1L 4OM0L 4JGNA 3D50A 2A73B 2X09A 4YXHH 5D70L 1QFOA 1RUQH 2ZOUA 5GRJL 1GR7A 4NO2A 4NPYB 2J8UB 1GGYA 4Q9RL 5I18H 4C4KT 2VW7A 2IBBA 4ZO9A 5IB1B 3ASWA 5HXMA 4GIPD 4KK8C 1PFCA 3NIFF 3WBDA 3IDYC 4Y4HC 1OP3K 5DMGD 3IE4A 4FI6A 1JYNA 4C55A 3QEGH 1RJCA 1CTMA 3QW9A 5C07E 3TNMB 3U30C 4JY4A 1F42A 1I75A 4D0DB 35C8H 2JH2A 2J1WA 1U3HC 5I1DA 1BVLA 5KEZA 1VLXA 3LTVA 5IFHL 3FT2A 3SDXA 4OUUA 1INEL 1J5IA 2Y36H 3G08A 1NCGA 5EPMA 5BCAA 1IEBB 4GP4B 3OMAB 1ZDSA 2UY6B 1FNGA 2IAAC 3NA9H 4NEHB 5ISZD 3QXDA 2OMZB 3AMKA 4HT1L 3B5TA 1PU0A 5LGJA 3RWGA 4KTDL 2B1HH 4MA3A 3ZO0A 3S5LA 2QPEB 4HCRL 3RDTA 1IIIA 3H7BA 2AV7B 2ITEA 4R5XA 1UM5L 4YE4L 3QC6X 3KPRE 5CBAA 2NDGA 4MD5A 2NX5A 1AFVL 5E9NA 2F5BH 4G8GB 4XPAL 3RVUD 3UTSB 2ZOKB 4X83A 4CILA 1DSYA 2GUOA 3TA3D 5AYTA 4GO8A 2CU9A 2EABA 4KI5D 4B9GA 1E43A 3NCWA 1RZIB 4G43A 3NZHH 4WJ5A 2A9AA 2CGRH 2GSIA 4Z7OF 4HS3A 4NCC2 2YAQA 4NM8H 2VISB 4N2KA 3SE3C 1PBYA 5EOQH 5LXGH 3SBPA 1A6AB 4JREB 3W1ZA 3T8MA 2VAJA 3L17A 4OF0A 2FJHA 2MH4A 2LLLA 2QADC 5HJBA 1D6EB 4EIBA 5CEZD 8FABA 4LVNB 2ROYA 4MNQB 4XX1G 3NJVA 2X6AA 5HY9A 2HVKB 4UIMB 4OZIB 3DIFA 2MOGA 3P3SA 1K6QL 4M7KL 4HJGA 3C2AL 3LZOA 3RNKB 1V7MH 4QOKE 4JUTA 4K94C 3KLHC 1CGWA 3IKCA 3QEQD 3DTDA 4JHVA 1SXCA 3IFNL 4I2XE 5IV2B 2YSTA 3TNNA 1MAML 3ESPA 1RZJL 1N67A 3AQDA 1M05B 3DVFA 2H9GA 4MA8L 3EYSL 3LD8C 2FL5B 2NZ9C 1IKFH 4OJEH 2BOCA 4FLRA 3QEUA 5EEZA 3K6SA 3PL6B 3C6SB 5JMRA 3DNKA 5DMJB 4MCZA 2FEEI 4FQXB 4I9XA 4F93B 1CGXA 4L1HA 1Q9KB 2KLTA 2OI9B 2VWEC 5F88B 4DUVA 3A6CL 1YECL 2WXKA 1HL9A 3CVHL 4NQEB 1S7QB 3VSTA 2G9HB 2SODB 4XI5C 3UYPB 1CC3A 4B5EA 3QG7L 1PJWA 5JOPD 1V27A 2L8AA 1E5CA 2UV3A 1XF3B 3QUXB 3B9VA 1OE3A 2DBLH 4JDEB 3X11B 3ULVD 4F24A 3DXAA 3I85A 4AK2A 3HZVB 2C9VA 4U6TA 3VD3A 3WE6A 4D8OA 1J8HA 5LGHL 2OZNA 3NJJA 4S2SB 2FR4A 2OJEA 5IBUG 3IFPB 2BINA 2BWIA 4TOYH 1LNUB 3B9EA 1MCIA 1HCYA 3NCYP 4N8VG 1WAEA 2PCYA 4KO7A 1XEUA 2VSDA 2J2ZA 3Q0HA 2YA0A 3TBSB 2WWMC 3MYJB 2ZCKL 1FH5H 1BFOB 2QSTA 5SV4A 3UJIL 3DRQB 3BT2H 3L1FA 1UKQA 2YEZA 3VRJA 4P4RB 4Z95L 4ACPA 4QTFA 4UQ2A 3MCYA 5JW5B 2YXVA 1AGBA 4JFVA 2F19L 5DD5L 2VW6A 4QAMB 2QZ5A 1PNCA 1IJNA 2F8VA 1D7BA 1OAQH 4KQ4L 2PYED 1OB1B 2BRRH 4HGWB 5E5MA 3KDPB 1W8OA 2R2BA 1U9KA 1ZPUA 3VFMA 3JV0A 1XB3A 4XN2A 3P2BA 3VGAC 4RETB 3SYPA 1HK6A 4KQ3H 3SD2A 1YMMB 3ISRA 5B1CA 1TPXC 4HIEB 4LHQB 3GK8H 4XXDA 3QDJB 4FG6D 2Z8SA 3NGBB 3EJCA 1JRHL 1OAKH 3MLVH 4ZBJA 3F12B 3BFOA 2RB8A 2VAAB 3AZUA 3N6YA 4YBQD 3H9SA 1RIHH 5J57B 2R2HB 3QFDB 3M45A 3W11D 4Z0BH 5K9QI 5LBSH 2VDOB 1FCCA 1VFMA 2E7CA 2FD6L 4GUOA 1J88A 4GW1B 4XOCA 2FT7A 4MNGE 3O3BA 5DSCA 1CFNA 1YEHL 3KPRD 2DLEA 3MJ9L 1KDJA 2DD8L 1YN6B 3QUZC 3ZE1B 1EXUA 5LO7A 3FH8A 4ZAKB 1PQZB 4ZSOE 5GGSY 5IK3B 2JI3A 4IU3B 1X5GA 4NHUB 4OJYA 1T04A 4PH8A 3WHXA 1MRFL 2AQSA 4KVCH 4KXZH 4R0LC 5DZLA 2RALA 3KXFE 1L0XA 4MSWA 1JWMB 3G9AB 3K72A 4LRIC 4JHWL 1NH6A 5CR1A 1FGVL 3WY1A 1JNLH 1LDPL 2VUOA 3C08L 4P48A 3STBA 1T6BX 4PTUA 4TM9A 2VDQB 3EDDA 4UZUA 3WTWA 3OR7A 2P8LB 5HHNA 3VGFA 2AF2A 1ZHLB 3J2PA 2CDEB 5CKAA 4H13C 2V0AA 4X8GA 5CCJA 1OQXA 5FOBA 3UGEA 1ZEAH 4RIRB 2IDSA 5F1IB 3V0WL 3FXIC 4XCFL 1E9PB 4CAGA 2YPVL 5EZOL 1Z66A 2R69H 1KB3A 2JQAA 3QCTH 3T8XB 1AI1L 3US9A 4V1DE 3RTQA 2CH8A 3PXLA 1SN0A 5BO0D 2QR0B 1A7RH 2KZ1B 4HCGA 2IANA 3A6OA 5MEQA 4HH9A 3MRCB 4U1MB 3VGHA 4N9OB 4HOMA 3NTCH 5K93A 4NUPA 3NT0A 1L7TH 1QEXA 3KWWB 3KPSE 2V8LA 2LLGA 3MV9B 1U8QA 4OBRA 4CKVX 4BQ9A 2G5UA 1BEYH 3GINA 4GSQA 4MTMA 5GS2D 1FZKB 5F7FA 1P2CB 3ILEA 5KTEL 3F7RA 4P23A 4F58H 4QR7A 1B88A 3D8MA 4AYGA 3QJQB 5IZ7A 2I25N 4IBZA 4LCCA 2X4SA 4QTIH 1A6PA 4Q52A 1T5WA 2APTA 1UM6H 4AYFB 4R97B 2QQKH 1RPUA 3U0TB 4U4IA 4GXUN 3OX8B 1XSIA 2Q76B 4MJID 1JPEA 1DQQB 3QDGB 2YD6A 1KCVH 2DB8A 4LSQL 1D6VH 4ZW8A 3MCLL 3IPFA 4U0RB 2X87A 1FZMA 2Q3XA 3BVVA 4OLXL 3UC0H 2BNUB 4DCQB 5FGBA 5A16B 3ZHKA 5EU4A 5D4HA 2VN7A 3MRDB 4PRPE 4Y9GA 1TMQA 3LKRA 4Z7VB 1YDPA 1ADQH 2BIOA 3QDHA 5FM8A 4C59B 2AJSL 4JFQA 2PNDA 4N2IA 3X17A 1D9KA 3KVPA 3W5MA 3I3DA 3AQYA 3HUJA 2AJXH 4AQ8C 4IOIA 1JPTL 1FLRH 4X5PA 4KRPD 2VXSH 4L0PB 3T6QC 3UP6A 3OWEA 3HG1E 3AU0A 1CG9B 5ELIA 4M93B 1MHPH 1AS8A 1NOLA 1NCBH 1P0SE 2MSPA 1AY1H 5JR1H 3DPBB 1CGSL 3D33A 3RAJL 2UYLA 1I31A 3IK2A 3FQRB 1NMBL 2EDDA 5ERWA 3P73A 1HSBA 4IOFD 4Z78A 1PSKL 1WEJH 2QSCL 3M1CA 3P4LA 1EVTC 4JLRB 2C3XA 4RMWA 5TK4A 5I0XA 3DSNB 1E3FA 4H8PA 4XP6H 5L88H 5E99H 5BPPA 2CAKA 2HRGA 3O3EB 4LP5A 3D18A 4J28A 2R4SH 4UDUA 4EN3C 5GSVB 3JSSA 3ZKXB 3DVGB 4F5CA 1S7WB 2VDQH 1KJ2A 4MJ6A 1F58H 3GMQA 3QK0A 4PJ9A 2H3KA 2CK2A 1KB9K 5DZVA 5C0IB 4LBEA 4X9HA 3TPKA 1A6UL 3TH3T 1DVZA 1U4EA 3NSYA 5H4YA 1BM3H 1QSFD 3BP6B 4IJ3C 4AQ1B 3PWNB 3VFVB 1WHOA 4L23A 1MH5B 4E9QA 4IRZL 3RILA 1BZDA 4F1SA 1DQLL 1N5AA 3OAZK 2NUPA 3U6XS 3ZDYB 3UTQB 4AEEA 4WSJA 5HHPB 3VD0A 1G6RH 5I74B 3NFSH 3KCPB 4H2AA 2AK1H 3VVWA 1OHQA 4ZMOA 3BKYH 5EU5A 5FO7B 4KMTH 3B9KA 2VRQA 1CYWA 3ULUL 4XMLH 3BMVA 3NVQA 5I8EA 2AW2A 2CR3A 3C8DA 4X9GA 3DUUB 1RULL 2Z0BA 1IT9L 3S88L 1I1YA 5IVXB 4K3GA 2MRYA 4DEUA 4PR5A 4GG6E 4DQOH 1CIDA 1FDLH 3SCMA 3DX6B 3FFCB 4PEEA 4OJCA 2AMUA 2ARJB 2OK0L 1J18A 1ZHKA 2A83A 3WS6A 3FONB 1I1AD 4HJSA 1ROWA 3ZHDA 3IN0A 3QIBC 3GS0A 4RZCA 1XGQA 1LYQA 2DLGA 4O2CB 3I9IA 3M17A 4JR9H 5DEGA 5GRWA 4EKJA 5CZVL 4JFDA 2O6CA 3KPSD 2WVVB 1AR1B 3LKSA 3P4MA 2XZQH 4ZUSB 1ZLDA 3RX8A 4JZOB 2DI8A 1I8KA 5DRXA 4X7CC 1IO4C 5A3ID 3M1OA 3IDNA 1XZ0A 1M56B 1ZVNA 4HPYH 1FYTE 3I9PA 5HHXH 4HWBA 4ZS6C 1A4AA 2B4CC 3WFBL 1FCGA 1EJ6A 3ARFD 4IMKA 1MPAL 4NCC1 4Y4FC 4Y9BA 3K4DA 2QQQA 5E2JA 4EI5C 4E9XA 1K2DB 3SJVB 1QO3A 2GQHA 4NC1E 3FU3A 1T5XA 1SF3A 1ZSDB 3AXLA 3QUKA 4WHTB 3BP5A 4BE6A 1CN4A 1AIFB 2N7AA 2Z7YA 2ZF9A 3OZ9L 1FV1A 1ZT4A 4JN1L 1X3DA 3D25A 4GG8A 4GMTL 2OQJB 1GZHC 4L37A 1PKQB 2WXRA 4HFUH 3BOVA 5IB5A 1NC2D 4G6MH 5H2BA 4L4TE 3MXWL 1A02N 1DUZB 3B9DA 3O9WD 1KULA 3KCWA 3LDBC 1UCTA 2F5AL 3KYOA 4KFZC 3CPUA 5L2KA 4LASH 2CBPA 3LIZL 3DRTB 3LQAC 2O30A 3WIHH 2R1XA 2VC2L 5GGRB 2W0PA 5CZXC 3ZIMA 1CR9L 1FN4B 3ME0A 2XQYG 5ID0A 4OZFB 4F92B 3VI3A 5JPNA 4KX9A 2X4RB 3HR5B 1IAIL 3CDZA 3HG1D 5TDOB 3DARA 4MB5A 4AT6A 3OSKA 1XAKA 4Y2DA 4D3CL 1U8IA 3RPKA 4FG4A 4B3EA 1Q0XH 1EHKB 3GBNL 1DE4B 4OCWH 1GGCL 5EA0L 4YHML 5IBLD 3L3JA 5E9AA 4F37F 1DJGA 2DJSA 4M6OH 4ZYKB 5EOCH 4E41E 3L3KB 4F2FA 2C1PB 1JGIA 1HU8A 5E6SB 3X3GH 3EOAB 2YJLA 1MUJB 1I1CA 2EDJA 1HQRB 3CBRA 3VNYA 4TLUA 4R83A 3TEZA 3GGWB 5GRUL 3MXVL 4QY8B 2IG2H 5HI5D 1WZMA 5JXEA 4OJDH 2XACC 1ACYL 3FHQA 4ZTOL 4UTBH 5F3BB 2IWEA 1KNOB 4ZFFB 1P5VB 2VKXA 1NBCA 3FN9A 4ZFOB 1KENL 3Q2VA 3WJLA 1NQBA 2XIDA 1IGJA 1U30A 1A6ZA 1D5IL 2XV6B 3T6XA 3BKML 4OZGB 1XTMA 1T1XB 1LQSR 3ETSA 1QBAA 1SBSH 4ZUUB 2X4OB 4JRXD 5M95B 1XBRA 3BPCA 4XMPH 3GI8H 3P3RA 1P5UB 3MRBB 2VJXA 4NYLB 2ZYIA 2HP4A 3TBYA 3MRFA 4UTAH 4Z3HA 2BM3A 4PJFA 1HVXA 3NUKA 4X4YA 1VKXB 3JTSB 3INUH 1SYSB 4QO1B 4TSBH 5ACLA 3FH7A 4KY1H 4L4VE 5TF1L 3GXFA 4I3GA 4NRZB 4A6YA 5FPIA 1F8TH 1ZANH 1A9EB 1QSEB 3DUSB 3U0WH 2V5YA 4JG0L 4QXUH 4RCAA 4JZJC 3O11A 4BFIB 2D03H 3BUIA 3EF4A 3VXNA 2GJ6E 2GSGA 1E27B 1RUPL 2VE6A 4ODSL 5HI4C 2NNRA 2WC7A 3VXSB 4G1MA 1X7SA 2DM2A 3KPOA 1JNJA 5DQJB 3IJ8A 1T1ZB 5D7HA 5AVUB 1IMHC 4P2AA 3L5HA 4HUXA 1KLUA 1FFNB 5EU3A 4URKA 3ULVL 3G5ZB 2WZAA 3CH1B 4EN2A 4FAAB 5C08B 4OZ4A 2J73A 1UZ6F 2WLHA 3CIQA 4PRAA 3LNDA 3L48A 1KPVB 2XKSA 3UAJD 4P2OA 5D1ZA 4OIBA 4FXGB 1LTXA 4PJXA 4J8QA 1HYSD 3HE7A 4UT9A 4YSAA 3L9RB 3TBWB 3PJSB 1JYVA 4NM4L 3DIVA 5TJWK 4PJ5B 3FU8A 2VDKL 4U3SA 4K5LA 1JG9A 3GFUA 2E0PA 1JWUB 3FO2B 4CKQA 2OMTA 4C83B 3GSUA 3MUZ1 4ETYA 3S3BB 4TSAL 5HD8C 3LY6A 4ZQKA 4F7PA 4JFOB 3SKNB 2B08A 2E47A 2Q2EB 2EECA 3BEWA 2F7RA 1QATA 2JMRA 2CCVA 1P7QD 3OKKB 2C26A 4ONFL 2MQGA 4E0RB 2VDNH 1GL4B 3Q5TA 3MACL 4IIQC 3ZX1A 3S4SA 4P2QA 1MCOL 4GQ9H 2JE8A 3EJJX 2NY5H 2VQUA 3ILPB 4OY9A 4JY5H 1B3IA 2P46B 3BFQG 2P5EB 3BWUF 4G1EB 4MS8C 4W4OC 2XY1A 5KVDH 4WW2B 4R96A 5C0FB 5F7EL 3AG2B 1GRWA 1WT5A 4E5XB 2G30A 4UOW1 5HJDA 4APQB 5B3JF 2Y25A 4YHKL 3HS9A 2RH0A 2EZ0C 3DJSA 3L1OH 5D71H 4PVNA 4YZFF 4M7ZC 5JYMA 2TAAA 2FE0A 4BQBA 4JVUA 3WNOA 3PABB 4I3SL 5KN5A 2XETA 2C4FU 4M5TA 4XXCA 3I50L 1P4LA 1T89A 3M8OL 3BZDA 2DM7A 3FQYA 4NQCA 1LD9A 2B0SH 3WXWH 1ZMYA 3GPSA 1MJ8H 3OHXC 5AKSA 1BZQK 5MP6L 2HTLC 3Q8CA 4FX5A 5IESH 3LYRA 2V7HB 4S1QH 3L5JA 3UX9B 3VXMB 3O2VL 3RUGA 1XGYH 1O9VA 1X5AA 3F7KA 4C54A 5B39G 2BSED 3OMZA 4JO1H 1I8IA 2MKWA 2NW2B 2DBJA 1L0YA 3IU3B 4G6JL 4G9DB 4X6BB 2W9EH 1FBIH 5KANI 1JZ5A 4HPOH 4JFFA 3PS6A 1UXSA 2JCCA 4Y5XA 1PPIA 1NCJA 3EYOB 4PY8J 1IGIL 2AQTA 3FU9A 4HIHA 3H6JA 2O5XL 3QRLA 1BVNP 1KCLA 2KPWA 3SKUD 2XQBH 4YVNA 4JFEA 4P59H 3L95A 4OCYH 4P4KA 3H8NA 4U6HB 5F3FA 3BZEA 3UJJH 1J9RA 1DZ0A 4MS6A 1X5IA 3TONA 2JJUA 3AS1A 3MNMA 4IK7A 3AQXA 1UD4A 2GHWB 1S78C 1B9KA 2GTQA 1TQWA 1MNUH 4HH8A 3NN8B 5DRWA 3SPGA 5IQMA 2FECI 2IVFC 4L4VD 1NLBH 3CFUA 1XX9C 2DQHL 5CS7A 4XE5B 3WUZA 1VGKB 3B2UC 3MMEA 5AVYB 1S3KH 1UCBH 1ETJA 3E2HC 5KS9F 1AC0A 1XR8B 1BQSA 1P7KA 3S34H 1IRAY 3W0WA 2DH3A 5EF2A 3U4BH 4OZHF 2F7IA 3RGVB 2RHEA 1FNLA 3D2UA 2CD0A 4YE0A 4YDIL 4K9EC 2QFRA 4PY7A 5IFAH 3L8QA 3CDYA 3MV8E 3P11L 4J6RL 2BVOA 2Z4QA 3K8KA 5MI0B 3NK4A 1ITBB 4UMGA 2E5EA 3TXAA 5FKPA 2BOLA 4BXVA 2FUQA 1YZZA 4XN4A 2COQA 4JO2H 4QMEA 3PV6A 4K5NA 5I16A 3QZPA 1G9MH 5I8KL 2O6FA 3DVIA 1OEZW 3S6CA 5J11B 4UZGA 3SYAA 4G83A 1L9RA 2BW5A 2F54A 2FWOB 2QDVA 3FT1A 3N40P 1GGIH 2ZD0A 2VXUH 1LK3H 4WHYG 1GW6A 1TQBC 1E5UI 1U8NB 1N4XL 2XUWA 1UTDA 2EUVA 2JELH 2A73A 4PJDF 4WI6A 1NFDE 3PAYA 5EO9B 3VB8A 1A22B 5A2KH 3K2UH 4NPYA 4NT6B 2F1AA 3O6LL 3NCYS 3OZKA 4DZBB 3LMJH 2FQGA 2VKWA 3L2MA 3H0TB 2W91A 3IJYB 5B7MA 5IB1A 3S8GB 3P9MB 4UQAA 2GK2A 5FGCB 4HLZH 2I9TA 4F7CB 3LKOB 4BQ8A 3N2JA 3SGJA 4MD0B 2V2WB 1NBVH 2WJ5A 3MOAH 2JJTC 4BFGA 2WKGA 5B1AB 3BDXA 1BZ7B 3TNMA 1PAZA 2WHVA 1D5MB 2VT0A 2VMEA 2VQTA 4PJ7E 1RU9L 2QMKA 2MOVA 3BIKB 4F9PA 9PCYA 2JV6A 2QV2A 5IHUL 1RERA 4YXHL 4K7PX 2IGFH 2XC8A 2XFGB 4QRSB 5E8DL 2EE0A 3FUHA 2WXLA 2YBGA 4NZDA 3WSQH 5C6PB 1IQWH 1IEBA 1O5DT 2C3GA 3QVAA 1LWHA 1BD2E 3BPLC 1B4JL 1SQMA 3ZT5A 4Z7WB 1M1XB 2UY6A 2JJWA 4PJ8B 2XWJB 5KG9B 3KLQA 1SN2A 4W9GC 1MF2H 3K7UA 1YG9A 5T3ZE 3OM3B 1MXGA 1GSKA 4QXGL 3TCTA 2FGWH 5T5FH 3X1BA 1S8DB 3UROR 3QPQC 1XD1A 3ZKNC 2ICEC 4GT0A 1XGRB 3S35H 3QEGL 3QJFA 1VPOH 5IVZA 4XO3A 4Y4KB 5E6ZA 1XSKA 2AV7A 5DO2D 2Y7OA 5EU6E 1CDIA 2XJLA 5ALBL 2NY7L 3QA3B 5T33H 4Q9QL 2X53A 3OLIA 2K0RA 4G8GA 5JIPA 3UTSA 4CC4C 3U1QA 2ZOKA 4RMSA 2NXYB 5IQ7L 1CICA 2B5IB 1BREA 2Y36L 3H9YA 3HZKB 1JFQL 2WQRA 1EVUA 2CO2A 3BDBA 3QPKA 4Q4IA 4N87A 3ARWA 4ZFGL 2FX9H 4BRVA 5HBBA 1JZHA 1FNHA 2PWHA 1RZIA 5MHSE 1PEZA 3DDFA 1FL5B 4P2RB 1S7VB 1TNNA 2EXWD 2L7EA 4PBWD 2VISA 5E7FA 1SFHA 1A6AA 3QZBA 4Y5VB 2AZAA 3DYOA 1AKJD 2AQQA 2FYYB 3TX4A 5LBSA 2N1KA 1ZOXA 3K91A 3IDGB 4HETA 4OVUA 4OLVH 2KDGA 3LNHA 2OJZH 4PGZA 3DTXB 1KXVA 2QVFB 4XE0A 5L9DH 3VXRA 4EUPB 3UO1L 5C0GB 4YL4A 3FF8A 4XWGH 3RNKA 2DI9A 1QBMH 4A2MA 3NABH 5KYWB 1A0QL 3MA9L 3EJTA 4JDVA 3TZVD 2L0DA 5IV2A 2HKHL 2VITB 1S7SB 3Q8AA 2PW2A 1WWAX 3NSJA 3FPYA 1M05A 4F8PA 4QGYA 4NKIL 1G7QB 3FSWA 3LZLA 2CGRL 4RLDA 3WD5L 2FL5A 1UOWA 3N43F 2AK4A 1WCBB 3TO4C 1LXMA 3Q06A 5EOQL 2Q10A 3PL6A 3UBFA 4RH4A 3C6SA 5BOPA 5E8PB 1I4FB 1QVOB 5DHVH 2AJVL 3GSNL 1TEFA 1UM4H 2WYHA 4H7VA 1CUOA 4PS4H 4FQXA 4JGMA 4QD2E 1OOAA 3RLSA 3MFFB 3AREA 1Q9KA 3BSZA 4POZC 5I8OH 1CE6B 1EAQA 5CJOH 3QS3A 3RJQB 4P0DA 3ZTCC 4NQEA 1Y0LB 1S7QA 4UBDC 2G9HA 5TPWL 4KITB 3MAWA 2O5NA 3UYPA 4BINA 2DJUA 3FOMB 2LU5A 4OSUH 2H26B 1SXSA 2R69A 1S7XB 4FNLL 3VM5A 3PREA 3ESUF 1XF3A 1WWBX 2VLKE 4GRLD 3X11A 2DWDB 1F86A 3CN0A 1L9TA 4YX2L 1QR4A 3HZVA 4Q0XH 1FNAA 4S2SA 5CGYC 1SOKA 5I6PA 5C0CE 3T3PB 3E0GA 1LO3H 3IFPA 1NEZB 1WVZA 2R0WH 3J27A 1LNUA 3QH3B 3MSPA 2OR8A 5J6HB 2JJSA 3HMXH 2DQUH 2V9QA 3IWUA 3VD2A 3LHAA 4NQDB 1C5DB 4MB3A 4GUPB 3TBSA 4EDXB 3MYJA 4B3VA 1BFOA 4Z7NF 1MWAL 3STLB 1IV8A 3DRQA 3P1VA 3QARA 4P4RA 3U2JA 3UTZB 5IHHA 4GRMB 4GH7B 4GUQA 4BFKA 2WMPA 3NJFA 2WTRB 1R46A 3TP4A 1FNEB 2A74B 2C9UA 2KERA 3ARBC 5GQBA 4PRNA 4AV4A 1N8ZB 1BPLB 1OB1A 4HGWA 2IDCA 3QFGA 5C6WH 3LNGA 1QI3A 3CZLA 3FSZA 4ZTPL 5KVFH 2K8MA 2NXZC 1NM9A 4KXAA 1T1YB 2EEFA 1YMMA 4TOYL 1E4KA 1LO0H 3QJVB 1AYOA 3L4CA 2ALWA 4LVOB 5JYLA 4KAQH 4L3EE 1SM3L 3QDJA 3JTBA 3VI4E 4X0NA 1J10A 2O6DA 1BD2D 1URIA 2NY2B 1NDGA 1FH5L 3F12A 4M1GL 4ODHH 4PGDB 3BT2L 4QTHB 4CU8A 1UB5B 5JXAH 5T3ZD 2R2HA 3QFDA 1X44A 2CUMA 1UT2A 1YC7A 2OR7A 4LU5H 4CW1B 2PXYC 4MJ5B 3IJEB 2VXTL 1DBBH 5G4MA 3GLEA 3P54A 5EU6D 4U05A 3P9LB 5JA9A 2VO5A 3EGXB 3TV3H 1YN6A 4EUPH 2DQFB 4ZAKA 1PQZA 3HTLX 5J6GA 1NAML 3FBQA 5IK3A 4IU3A 5DQDL 3B9AA 1X5JA 1M6OB 2NNAB 4HJ0C 4ENED 2IAMC 5F6IB 2DEXX 3EBGA 4FCAA 2J25A 5JHDE 3Q44A 3TBVB 5BVPL 5I17B 2HRPL 3MLVL 1TEYA 1FFPB 4IRJB 1JWMA 1PD1A 1GTNA 5MHSD 3TFKC 2Z7ZA 1JIBA 1HWHB 3GT6A 4WV1C 1RIHL 2YUVA 1J48A 4RMTA 1GZPB 1W0WB 1N19A 1ZWIB 1OCRB 2QQNL 1B4TA 5EC1A 1DJSA 3S97C 1VIWA 2G4GA 2KH2B 4M7LL 4NP4H 2DQIL 4L1LA 2Q5BA 3FTZA 3Q6FB 7FABL 1XGPB 2P8LA 4Q89A 2CDEA 4RGNB 4NAMA 3AU1B 2BHZA 3TIEB 1DVFD 4RIRA 4NCDA 4ECNA 5DC9B 5F1IA 3B56A 2IO5A 4HD9A 2J88H 3BQUB 2BY1A 5ID1B 2BNQB 1E9PA 1KELH 3QPXH 4KVCL 3T8XA 1UA3A 3U25A 4BZ1H 3QUGA 5D1XA 3WXVL 2BSTA 4ESKA 2QR0A 1B0IA 3CN4A 5AOLA 3MRCA 4U1MA 2CRMA 3NDZE 4IGBC 4Q6IB 2Y5EA 3KWWA 1JNLL 3MV9A 5HJGA 1GHFH 5D7LB 1RZ8B 2H47C 4ILDA 1TTUA 2BVYA 1OGAE 2DQDL 1A1OB 3BWAB 3QAZB 2LABA 2K70A 1FZKA 3KBEA 4OIFA 1O0VA 1P2CA 3TEWA 4MWFB 4JS7A 4UZSA 3IGKA 1ZEAL 3F00A 2ZP8A 1SJXA 2QMJA 4CADB 4FQ1L 2OMWB 4CGUB 4ES9A 3GB7B 2ZOWA 3NIFE 5BO1L 3ZOAA 5IW3A 1ERNA 2GBTA 4AYFA 1MCQA 1R5VB 3HC0B 1U3YA 1TZGH 5AAMC 4JHAH 2VLKD 3ZZLA 3KR3L 4LIQE 5LG6A 3HNVH 1CFVL 3EOBA 3OX8A 1X7QB 2Q76A 2PWGA 4HISA 1DQQA 3QDGA 1VJSA 2FATH 2I24N 2X6CA 4O9HH 3L4XA 4DCQA 2BNUA 3MKKA 4U4BA 4PB9H 2CMRH 5A16A 3RTLA 3FUKA 1IC7H 4PW4A 1T21A 4C4BA 2JF1A 3P0YL 4HKZB 3OVUB 2M1KA 1RZJC 2FNBA 3CZSA 3U7WH 1E2WA 5D7EA 5F72S 4UDTB 4GFXA 4Z7VA 1NFAA 4N2DA 4NRYB 5G4NA 4AL8H 2HRHA 4Z7IA 1F6LL 1ZT1A 3MRNB 3SDCC 2W60B 4TQIA 2AXFB 1VDGA 5D6DA 1CLZL 2VLJE 4D0BB 1YEWA 2BVTA 2DIEA 4OCXH 5DMIL 1T1WB 3GLZA 1CG9A 1D6VL 4C4KO 3IDYB 4Y4HB 1VAHA 2CKBL 1AGCB 1VESA 3MLWH 5DZNA 1XH0A 3DO7B 2GBVA 4Y9FA 4FN0A 1PDKB 4J6IA 2HT4C 2YAFA 3DPBA 4K4KA 3U30B 5J13B 4OCSH 3FQRA 3PWPE 2P5WE 5E70A 4OF6A 4OQTH 1U3HB 2WP3T 3UFIA 4AKPA 1E5YA 5B22A 4LO9A 1R5WB 2ZTBA 4JLRA 3DSNA 2E6QA 4Z7OE 2J6WA 4WI7A 3WIHA 3O3EA 2A6DB 2PUQT 2AJXL 4KU1A 5GSVA 3ARGD 2Y23A 3DVGA 3TEUA 1S7WA 1XH2A 5FYKD 1IBFA 3GD1C 3V0VB 4DAGL 4Z3GA 3Q13A 5B38G 3BPOC 1JF1B 5LGYA 5DLMH 5C0IA 2JNZA 2BC4B 3UPRB 1RUAL 5ENWB 5AW2B 1K85A 3BKJL 4MQ7B 1HDMA 4N0FA 1AY1L 3UZVA 4DETA 1VCAA 3I02B 1BJ8A 5CBEA 4EAEA 3BP6A 4AQ1A 3PWNA 4WGVB 4LK4A 3VFVA 4FDWA 4JDZB 5JHDD 3GRWL 1T4WA 5F70A 5JHLH 1MH5A 3HI1B 1DTUA 1M9WA 4LEOB 1GPOH 3K8LA 1WBZB 3UTQA 3LKNB 3BPNC 3ZTNL 3CLEH 2ALAA 5EIVA 3TGXA 5C71A 3KCPA 4UTBA 2RR3A 3TU6A 3DX0A 5FO8A 2FHFA 5FO7A 2R4SL 3MREB 3D3VB 4QXTB 2EYSB 2D3LA 2YGVA 2BHUA 2PO6D 5ADPL 3QBTB 1RIVH 1F58L 3DUUA 4AEFA 3T0EC 3TWCH 2QGBA 2IAND 4P2CG 5IVXA 3RI5F 3SGKA 3UABA 5FYLH 4XVUD 1XGZA 3MODH 2DLFL 1BM3L 4AW7A 4DK3A 3DX6A 3FFCA 5E5RB 4X6DA 5INDB 1YMHB 2L7QA 1KYUA 2Q8BL 1GVIA 1N12A 2RQEA 3FONA 3V4VB 3VRIB 4P23D 3RDTC 2WM0A 3H6AA 4UTAA 3QCVL 1REIA 4O2CA 3NIDF 1G6RL 3OLEA 2E8ZA 1ZVSB 4GEIA 4GUCA 2EIMB 2WVVA 3BKYL 3ILQD 4KMTL 5FHAH 2Q86B 4ZUSA 4JZOA 1CXIA 1OGAD 2BY3A 4XPHH 3LD8B 1A5FH 4MJ4A 3WI9A 1P4UA 4PV1C 2WNWA 2D8KA 3A6BH 1YYMH 3HPLB 4F7MB 4EO5A 1HS6A 3D48R 1P4IL 1K2DA 3SJVA 3QSKB 5DHEA 1J1XH 5IVNA 4OV5B 1BFTA 5J7CC 3DROB 1ZSDA 4WHTA 5EEXA 4LCYB 1FF5A 1HIML 1AIFA 1CXFA 2GABA 2FLMA 5GS0H 2XA8H 4JR9L 4ACTA 4M62L 2A9NH 3FO1B 5DFAA 1MJJB 1RLWA 1EIBA 2OQJA 5T1KD 4J1UB 3S36L 5LNDA 2XZQL 3FB8B 4W68A 4UMSA 3BGMB 1WHPA 2XLLA 1DVTA 2FJFB 3P30H 2R7EA 2YXMA 1TKWB 3VUAA 5AKTA 5HHXL 2E7DA 2X9YA 4LSRL 4UTCA 1N0XH 4XO5A 4Z76B 2NY1D 3K1KC 5ALCL 3DRTA 3IXTB 1CU4H 5GGRA 4KGJA 4GSXA 4ANXA 4KWUA 4H0LC 1FN4A 2ADGB 3F6LA 4GW4B 4FXTA 4OZFA 2X4RA 1MQ8A 3QXTA 3VXOB 2KZBA 4MLIA 5TDOA 5E8OB 3V5DA 1YEJL 2L3BA 2AMGA 1DE4A 3OAWA 2IDUA 4HFUL 1DJXA 4M29A 5GGQH 4ZYKA 3PWPD 2UVEA 3L3KA 2C1PA 2O6PA 4DNLA 5LQBL 4G6ML 3EOAA 5I9QC 4YHPB 1MUJA 2XJKA 4QNPF 1HQRA 1XQ4A 1F41A 4QCIA 3WEXB 4N2BA 3MV7E 1HHKB 3FCTA 4ZW6A 2DEWX 4ZO6A 3PY9A 4FYTA 3THML 2F6AA 1TPXB 2BLFA 5F3BA 2ZG1A 2FQEA 1LP9F 2F7PA 3WJJA 4E2OA 1RHFA 4ZFFA 1P5VA 4TL4A 4YH6A 4A1RA 1IILE 3V0AC 4DVRL 1I85A 3BP7B 3WYRA 2CA3A 1EJFA 4L1DA 1I3RB 4DP4X 2X2JA 4PU2A 5DJXA 1KCUL 1IU1A 3BN9D 4OZGA 4OCWL 5MENB 2VL4A 4ATTA 1SNRA 2DKSA 3B9KD 2WJ7A 2QQLH 4ZZFA 2X4OA 5EOCL 1U6AL 1I9IL 3EO9H 3LEXA 7PCYA 3RL1B 2ENSA 3QJUB 3QUZB 2A9ML 3MRBA 3V4VH 2B2XH 5I30H 1KV7A 4NYLA 4UQ3B 5A2AA 5ILTH 4MD4B 1KBBA 4LDOB 4N0RA 2V5RA 1IAIM 4A7QA 3JTSA 1SGKA 1SYSA 4QO1A 3SCMD 5C92A 4W6XB 4R0LB 5FW8A 4HIPA 4NRZA 1D7CA 4K0OA 1A9EA 1OCWL 4QRQB 3L9BA 1KCSH 2F58L 4BFIA 3C6LD 5D5ME 3VXUB 5EN2B 4Z5RA 4AVKA 1E27A 3H3PH 4GO6B 2GTZB 3VXSA 2EVFA 4JFDD 2IDQA 2K3HA 3KWTA 1T1ZA 5FKAB 4BZ2L 2FJGB 1O6TA 3U7AA 1MJ7L 2IC2A 1SBSL 1IVLA 1ETA1 1JZIA 2CPUA 3FUEA 3G5ZA 1JP5A 2K9UA 2NSXA 3CH1A 3GI8L 4X6FB 5C08A 4Q6KA 1F4XL 5F0MB 2NLJB 3DO4A 3TL5A 4CMMB 3APFA 3DO3A 5HHOB 4HOWA 3VSQA 1KPVA 3OJ2C 2H2SD 1WAAA 1F2QA 3INUL 4TSBL 1Z5YD 4KY1L 4CMHC 4FXGA 4DSYA 1A47A 4FE9A 4NPKA 4AC2A 4CL7A 3L9RA 4NP9A 3PJSA 4HKJB 4M8QB 5DC0A 2XXFA 3TBWA 3U0WL 2BSSA 3L5IA 5EOCJ 5KSVB 4PJ5A 3D0VB 1VFOA 2WXGA 1OE1A 4N85A 1JWUA 3FO2A 4C83A 4NXKA 4WEEA 1PLAA 1XSOA 3S37H 4GQZA 4JFOA 4TNGA 3SKNA 1A4BA 2P44B 3PJNA 3HAEG 2PTUA 2W5PA 2CK0L 3OKKA 3ZR5A 4KXDA 3LOWA 5J1AB 1MCWM 1AACA 1LK2B 1C8QA 3ULUC 4E0RA 5DRNA 4QF1B 3HI6L 5IB3B 5C0DA 4QGTA 5L2KD 4G9FE 4PP1C 2APBA 3BSGA 2ZUTA 3V5KB 2GEEA 2N7SA 2P5EA 4G1EA 2JXMA 1BIHA 5FYLE 4TKWA 4WW2A 3LSOB 1KTRL 1I3GL 1SXNA 3KYKL 1CWVA 4RAVB 4DN3H 4PYHA 3Q8EA 4EBQH 5C0FA 4GKNB 3KJ4C 3X1NA 1NCAH 4YLCA 1TG8A 5EHFA 4B9FA 4APQA 1WH0A 5T3ZL 3BD5A 4HHWA 3RTQC 1OT4A 2IGLA 3DX9B 3NH7H 3HJEA 4UNTA 2J43A 3RWDB 5EF0A 5CILH 2CCWA 3PABA 1H8SA 5CAYB 5FV1L 3V6OA 4XMTA 2F74A 2YRPA 4PJIF 1G1KA 4GQ9L 3K2MC 2NY5L 2OX5B 4ZMAT 5JXED 4FFVC 1N7MH 3WGUB 2ZUYA 3LKPB 1AQKH 1OP3H 4LCCC 2R51A 5J9PB 4Y19B 2DQCL 3EZJB 2V5SA 2XIIA 2E7BA 4RBPK 2V7HA 2IFGA 1AO7B 1PZDA 4HEPA 5I76B 4JFPB 4L48A 4K2UH 3RA7L 2NW2A 3ENEA 1YPZF 3IU3A 1T5KA 4G9DA 4X6BA 5D71L 4YGVB 5J89A 4K8RD 2YKLH 3CHOA 4K9JA 2H0PA 1JYWA 4G7QB 4E9RA 2OXHB 2G60L 1QPKA 3IN2A 4O51B 1TZOA 4PJHF 4EN3B 2B0SL 4HOZA 3WXWL 4ZX5A 1UUNA 2PMZA 2UUDK 4U6HA 5T5FA 4F27A 1CLYH 1INDL 1D9KC 3S9DB 1QFWL 2WNGA 1FFTB 1PTZA 2FZ3B 5C3LD 1ORQB 4ZPTB 3JZYA 2WVSA 3WJMB 1HNFA 1JHTB 5LB1A 5AZEH 3QHFH 4IJ3B 4H0GA 4AITA 3RVUC 1MJUH 1YEEH 2W9EL 1AXSB 1BQHG 1H0DA 3OXSA 4PJAB 5KYUA 2BS71 1HXYB 3U2SB 1VGKA 2FEDD 1NBYB 1QAWA 1U93B 4WCYH 4ZUWB 3MBED 2ATPB 4MDRA 3POCA 4N0UE 4U3XA 3GLDA 5D2NE 2UY7A 5LWYH 3RGVA 1RIUH 1V7NL 1UACH 3DGGB 3WFHB 3HE7D 4HP5A 3V6ZA 4KTEH 4GXFA 4EZKA 3CZNA 1C12B 4WUUB 2RTTA 2R0LH 5DK0B 3N06B 3GNMH 2LR4A 2LT9A 4PJ9C 5T1DL 3G6DH 3A0OA 1UATA 5F2FA 4I1PA 1NLBL 2JB5H 3RWCB 2J8UE 4LOUC 4TNFA 1XGUB 3P9WB 3QIBB 5IQLA 4D9RD 1HINH 1S3KL 1UCBL 1SYVB 4U33A 2WBJC 4X4XB