3UL4A

Crystal structure of coh-olpa(cthe_3080)-doc918(cthe_0918) complex: a novel type i cohesin-dockerin complex from clostridium thermocellum attc 27405
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
142
Chain Sequence
NTIEIIIGNVKARPGDRIEVPVSLKNVPDKGIVSSDFVIEYDSKLFKVIELKAGDIVENPSESFSYNVVEKDEIIAVLYLEETGLGIEAIRTDGVFFTIVMEVSKDVKPGISPIKFESFGATADNDMNEMTPKLVEGKVEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel Clostridium thermocellum Type I Cohesin-Dockerin Complexes Reveal a Single Binding Mode.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Cell adhesion/protein binding
molecule keywords Cellulosome-anchoring protein
total genus 31
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ul4A01
3F2LA 4UMSA 2W1NA 2VO8A 1G1KA 4UYQA 2VN5A 1OHZA 1ANUA 2VN6A 3KCPB 5G5DA 3GHPA 1AOHA 3KCPA 4WKZB 4FL4B 5LXVA 2JH2A 2OZNA 4DH2A 2BM3A 4WI0A 4IU3A 5AOZA 2XDHA 1QZNA 2Y3NA 4N2OA 5K39A 3UL4A 3BWZA 1ZV9A 2B59A 4FL4C 4IU2A 2O4EA 3FNKA 4U3SA 2CCLA 1TYJA 2ZF9A 4UYPA 3L8QA
chains in the Genus database with same CATH superfamily
4GQRA 1JK9B 4NQTA 4DAGH 4NRYA 2V0AA 3HN5A 1UT1A 1WHOA 4ZJ9A 3KDMB 3QNYA 5DEZA 3Q8FA 2CG9X 1TR7A 3ULVF 2DWDB 4KXDA 5GGVY 1OTSC 2AK1L 3FHQA 4A7TA 1I9JL 3KLHD 1QEWB 4C56D 4TTDC 4N86A 4ZBJA 4WWPA 1KTDA 3NEEA 2FE0A 1IM9B 4UOQA 1KXTB 5C8JA 4MZIA 2RR3A 3NZ8A 3QEGH 1JPGB 1C08B 3F2LA 1KIRA 4KK9C 5I1DA 3P1VA 3C6LC 5IHUL 1HZKA 1AZNA 2IAMB 4YSDA 4JHAL 4M00A 3BQUD 1KGJA 4YHIB 4DN4L 3OXRB 2W9DL 1KT2B 3MRLA 4ELME 2YO3A 3HI5H 3UEZA 1G1OA 5T3XE 3TA3B 4HS6A 4WU7A 5E8OA 4AEEA 1ORSB 4LLDB 5GGQH 1KJ2H 5HDBE 5JIDA 2NZ9C 1HNYA 5BV7B 1V7NH 3JBG7 3ROOB 1HXYA 2WO4A 2F7OA 3PPEA 5E5MA 5F7DA 1CDHA 1A1MB 4L4TE 1KPVA 2AV7B 3A23A 3S88L 3HUJA 4AL8C 1WSST 3EJYC 4ALAH 2V17L 1XFPA 3MUUA 4HKBA 1UZ8B 4M1DL 4JFOA 5E03A 2AJ3B 1FFTB 2FD6L 4K71B 4B96A 4FLQA 4NQCB 5E08L 4R5XA 1EUTA 4GAJH 4ZFQA 1S9YB 3CK0H 3AU0A 1UGNA 4OIIL 2OTWA 3OAYH 4WI6A 4HFUH 1C5CH 5I0VA 1TZ8A 1QFUL 1F18A 2WKOF 4LCCC 1FF5A 2CO4A 4PS3A 3B7YA 3FO2A 4N4YB 1O7DC 2XIDA 2OCFD 1BZOA 4LGRB 2DMKA 3CZGA 3FQ4A 4GMSH 1D3CA 5T5FA 4TULH 1Z3GH 4B6ZA 4FE9A 5GS0D 1RZ8B 3EF4A 4WW1A 4ICXA 4J3UA 3CDZA 2OSXA 4OZHA 3FB8B 3P30H 4HEPG 4WHYG 3BGMB 4QY8B 5AVWB 3NTCL 2YQBA 4X8JB 5FHBL 1KB3A 5I5IA 3Q8AA 1S4IA 2BRRL 3FB6A 3BAWA 1ASPA 4JPVL 4XGZB 4HJIA 4XNZB 4KKCD 4MA1C 3PFQA 2RGSA 4Y2OB 3US1A 3SGDH 1X7SA 1ZT7B 1FG2A 2ZCLL 3RJOA 1GRWA 5ADOL 4TNVF 5I1CH 4Z7NB 5CWSA 4JRYB 4WEUD 2VIRA 4QRTB 1U9KA 3R1GL 3ZTCC 1AXTH 5IVNA 5JPMA 2ARJB 4NCC2 5GRVL 2VDQL 1CLVA 2C1PB 2HKHH 3D2UA 3WKQA 4DWHA 1S9VA 5AL8A 4GKLA 1IFGA 2ZXDA 2X41A 4TNFA 5L88H 2L7EA 3X12B 1ACCA 2FBRA 3F8UB 4PJDB 4POUB 1FE8L 4NCDA 2G4GA 3ZHLA 5AAWA 2ZP9A 3JXAA 1NCIA 1T0MA 2YD8A 1AHWA 2JJWA 1ZS2A 2R7EB 2UWEF 3MA7B 3QJXA 4MXWH 1W80A 3DDGA 3VRJA 3SE9L 1GGBH 4RRPM 3BAJA 5GGTA 2AHIA 3ULVD 1XXDC 4QHMA 2RD0A 1SFDA 5ECGA 3SZ6A 3VACA 1TT6A 3MLUL 3QZWG 5GIRB 1PAMA 2XX0A 2X4NB 4MMZC 4GYBA 3WCYA 2LR4A 2QR0B 4KUZL 4OFIA 3U4KA 2CM5A 3V6BR 2CCWA 1NCJA 1KB5B 3FT4B 1AR1C 3BJ91 4J1UB 2M83A 2Y69B 2R8SL 4BSWB 1PFOA 1G0YR 1L0XA 5L2KD 2EE3A 2DJMA 2EKSB 3AADB 3WGVB 4UTAH 1S7XA 4LOUC 4CNIA 5T1LB 1GAFH 1INQA 4BXVA 1R34A 4QJ5B 5C92A 4JFFD 1FIGL 3Q9QA 1TQWA 4ANUA 3PXLA 2OTPA 4OVUA 4UQBA 5HGBA 1X6NA 3VFOA 1HL4A 4W9GC 4LLVA 5FOBB 3SPVA 3KH4A 3D06A 4YL9A 1A22B 3NJMA 2Y2YA 4PB9H 3P3UA 3O4LB 4HWZB 4U3SB 4AGNA 5T5FL 1TIUA 4H8PA 3HI5L 2A9AA 2YRLA 4NYLB 1AD0B 3T0WA 5L7XL 4PD4K 3ZE2F 1SXNA 3VFOB 2L0DA 3DX6B 5B39G 5AYUH 3U36A 3QHZL 3KWXA 1I3UA 2F8XC 1SQ2N 4PH8A 3SCMA 4E41E 4G8AC 5IJCC 3K8KA 5HDLA 3F7KA 4LVOC 3I6GB 3X11A 1G9NC 2GK2A 3IDXH 3PL6B 3Q6GH 5JOPE 4PBXA 4XO3A 4KY2A 3FT4A 4J1UA 4S1DD 2EYSA 5KVDH 2QQNL 3FFCD 4NUQA 3H9SD 3QXDA 5JHLH 3X3FH 3QG6A 1JNLL 1ZT4B 4L29B 3GIVA 3PDOA 2X42A 3RPBA 2Y7LA 2L7JA 1BAGA 1HEHC 2HB0A 3K8MA 3VI3A 5HI5C 3QAZC 5TF1H 1XF3A 4PJCE 1I9RL 1P5UA 4LCWD 2NDGA 1J11A 4JFOB 3E7JA 4WLCA 3T65A 2NSXA 1SXCA 4M1CC 3U4AA 2FL5B 5GGTH 2HG5B 3VM5A 2EIKB 1OQOA 2GBVA 4X98A 4XVJH 1AI1H 3N06B 1HDMB 5D1ZI 4W6YB 4YDNA 5C0BB 1BM3H 1JF5A 4XVOA 1UACL 2FAUA 3QPXH 5AYQA 4ORGA 5FK9A 3MRPA 5JYLA 3MFFB 3C60C 3FB7B 4R0LA 5DZAA 4PAZA 5CN3A 1LO0L 1DO5A 2ZWKA 4KO5A 3SY6A 2CLVA 3TJEL 4OCYL 4AYID 1M57B 2A38A 2WJ5A 1VSCA 4CKQA 1T4WA 4NIKB 4O2CB 3Q06A 3GBNL 1GHFH 3O3DA 5FO2A 3NA9L 1OGTB 4OCRL 3WUZA 4J4PD 1AJ7L 1TQCC 4BWTA 3BH4A 3APCA 5TFSL 2ATPA 4M6MH 3DTXB 1P0SE 5I6XC 3M07A 5HDWA 3RVXC 1B0WA 1I9RH 3BWAB 3UBFA 4XNBA 1QFWL 2YGPA 1URIA 3M1CA 4BH7A 1PG7H 3IWUA 3RB5A 4BUGA 2Y72A 3LKQA 2F54B 2W0PA 2H6PA 4ZG1A 3G08A 5FW7A 4L0YA 3B83A 4NP4L 1IAMA 1KLFA 1DVTA 5SWSD 5AUMA 4PRNB 1LNUB 3K81A 5D7JB 3S4SG 2GI0A 5IEHA 5I5RA 1MRCH 3C09C 4Y5XB 1I9IH 5E95B 5EOTB 5ABAA 3CHOA 4DQAA 4D3CL 3K5RA 4PJBF 2GJZA 4PRPD 3PHQA 4W6WB 3L5JA 3V4PA 5KWYC 2CALA 3KNBA 2A6IB 4OJYA 1P1ZB 5FFLA 1NDMB 4KDWA 2DQFB 4WW2F 3LS5H 4NUJB 3MA9H 3GXNA 1IT9L 3MXVH 2XFXA 3EDDA 2BIQA 3L5WB 4LDCA 4MKMA 1EDYA 1FH2A 3OJ2C 1PLGH 1FFQA 2YR3A 1UT2A 1UZ8A 3KE0A 2CO2A 4JGJA 3GBML 4KRPD 3IJSB 4G59C 3LNFA 5C09B 3RVWD 4JO3L 3NSFA 1G9MH 2YQGA 3HC4H 2NNFA 3KPPA 3HKFA 5C0EB 4NUJA 2J1YA 4D7PA 1G9HA 4RA0C 5DZNA 1IC7H 1ORSA 2P42B 1IVTA 2ZG3A 1IEAB 3RU8H 5L2KB 5L2JB 1RSFA 1JI2A 3BIKB 1UT9A 2WINA 3JVGC 1EJ8A 1NCCL 2VISB 5CEZH 5DO8A 1TQVA 2ZYHA 2XWTA 3BQUA 4TVPH 3WS6C 3A4FA 5F2FA 2IFFH 2CUMA 3KPRB 3WY2A 3CSPA 1SLWA 1NUDA 3CCHA 3FQWA 2P8LA 4ES8A 4D2NA 1SOSA 3KGSA 2WXQA 5DQ9A 1E6OH 2VR3A 3NFPA 3GINA 2WD0A 1MDAA 5I0XA 5HYQA 5I8CA 4GBXD 4ZX4A 2ROYA 4TSCH 3IFLL 1MXGA 2C4XA 4EE2A 4Y9GA 2QHRH 3MV9E 5KJRH 3CU1A 4APQC 3NAAL 3O3DB 3A67L 5F7EH 4OF8A 3ZIMA 1UM4H 5F0LB 2X4SA 2XKNA 1ZHNA 1I8IA 3INUH 3LPFA 4PRBB 4TNGA 3UBXA 4WFED 3H42L 4YO0B 1XB8A 1UA6L 2R69L 3AG2B 4HWBH 1IZKA 2CGZA 3EG9B 3B4NA 3GMPA 1MCPH 1CURA 3Q3GA 1N0XH 3DOSB 3IJYA 5DEGB 3RTQB 2EUZA 5I8OL 1OAQL 2VO5A 4UTBA 4AQ1C 1URZA 3PGCB 4FMVA 1A9EA 4JQIL 4IBTA 1BVNT 3X3GH 5JIMA 1MLCB 3OHXB 3QEUA 1OW0A 4NWTL 1DL7H 1TO4A 4RQQB 1I1AC 4U1IB 5E08H 2W88A 5HVWA 5IVXF 3HHSA 1UYWL 3UH8A 3GSNB 4QGTA 1D9KD 4HGWB 3ARBD 4QTIL 2YBRB 4MJ4A 3R7RA 5DJXB 5JXAH 2FSDA 1EBAA 3OWRA 4KQ3H 1YQ2A 4NRXA 2FQGA 3AMKA 5F72S 2NNRA 1AFVL 5J11C 4W9DC 3MLPA 2LTQB 2YPKA 4LLQA 1E6JL 1HCZA 3MZGB 3EUDA 1YMMA 5MENB 3LN5B 4JG0H 5JXAL 1RQ5A 2X6UA 3QO0B 5I5JA 4I3SL 3ZDZE 6CGTA 2VJ8A 2NY1D 1WTGT 1P4IH 2EUWA 4NQCD 2YPVH 5KVEH 1XCWA 2CHXA 3FU7A 3HBZA 5GGRB 2OULB 3FT2B 4ELMB 2X2YA 2HFFB 3GDCA 5BQ7B 5I8OH 3LHPL 1DVFB 5FCSH 3H7LA 4UM9D 2H1XA 2X0WA 1IFHL 4FS0A 3DUUA 4YHML 5FKPB 1AR2A 5MEPB 2F7PA 4H8WL 5IT2H 1LVEA 2UZYB 1S7VB 4PJ9A 2NSQA 3BPNC 3CX5K 3NESA 2YUVA 1NCTA 2WZ0A 3GI9H 4PJEA 1H6FA 5J13B 5CLWA 4BEIA 2X89D 2B14A 5JW4R 4JJ5A 4PB0H 4RMTA 1SXZA 4KHXH 2MTAA 1JNHA 1K8IB 1UHVA 1KWGA 1T22A 2EKJA 3DJZA 1JZGA 4JB9H 5E6RB 2CM6A 2RQEA 4Y4FB 4F8QA 1PZSA 3BW9A 3GBMH 5D5ME 3SGEI 1YPZA 4TUOB 3QYMA 4PQXA 3FFCB 1FORH 1QBLL 4PGEB 4NN5C 3HUJE 4DERA 4F58L 4G6KL 4JREB 3BUDA 4G3YH 3Q2LA 5B1BB 4JCWA 4L8SB 1VFUA 2WWMD 3KYAA 4MNQA 3L5WA 3MC0A 1MNUH 1N6QL 1YMMD 3BVDB 4EMZA 5EDSA 1ASOA 2CWRA 3QIUD 2WV3A 5C7ZA 2EXTA 3L95A 1F8TL 4UZSA 2EH8L 5HJ3A 2XYCA 3RU8L 1GGUA 3FUKA 5JW3H 1D5MA 2ARJQ 3GSRB 1FNLA 2NZ9D 4MMXB 3VXSA 1UCBH 5LUMA 4PR5B 4AYGA 3EFDH 3QARA 3LZRA 4LL4A 4Y4HA 4QO1A 4WWNA 2G9HB 4BE6A 1SYVB 3U1SL 3VU2A 1QR4A 1ICTA 5AW2B 4MJIA 4L3EB 3WMSA 1U8LA 1JFHA 3L1OH 5D4QA 2XZQL 4FZEH 4TLSA 2WY3B 4UTCA 1ZWIB 2WZPD 4N6QA 2OL3H 3CZJA 5D70H 4OFPA 4U6HB 5E9DA 2WWMC 1XZ0A 3QAZB 4P23C 1FLTX 5AVRB 5IQLA 1OL0A 2GJRA 3RYMA 2Q9OA 8CGTA 2CGRH 4XXDA 4N2DA 1IGCL 4D9RE 4HISA 5E6IB 1UWYA 4NS0A 3TX4A 3RIAF 4XN7A 5HYEA 4RGNC 2WBWB 3E9UA 4HSQA 1XIWB 2HRGA 4HV8B 3U1PA 2NY3B 4DGVL 4ICWA 2NY7L 3UC0L 4PJXB 5KTEL 3ZQXA 3UJTH 1AXIB 1LWHA 1PD1A 1HNFA 3CUPA 3STLB 2RFXA 1JUFA 3LPPA 5CBEA 4XVJL 1YLBB 2R9HD 1DQML 4RH4A 4UYQA 4PGCA 1CFMA 2E9IA 2DWTA 2R51A 2WLYA 1J0ZA 1SBSH 3ALWA 2VN4A 4LSVL 5IJVA 3TZVA 2V6HA 4XP4L 3D3VD 2DRUA 2B1AH 3CC5B 3SYPA 4YX2H 5D7LE 4Z7OB 1HKFA 1E5CA 1ZLWH 3ZT5A 1AIZA 3JTBA 5DT1H 2G9KA 3EBGA 2EDLA 4L4VD 3H3PH 4B9KC 4WIQA 2PYED 4AV4A 3JYCA 1E8ZA 1FC1A 1S6NA 2PXYC 3C5ZB 4EKJA 1WP6A 3GEWB 3QJSB 3KL0A 5JHLL 2VKXA 1YPZE 1H8OA 2VDRL 2XWXA 4LCWB 4BCYA 3QK0A 1QFWI 3D2TA 2KL6A 4JZOA 2DW5A 2CKNA 1MREH 3KGTA 3ILPB 2ITDB 2D9CA 2G75A 3RGVB 2PMZA 5D96B 3K4AA 4F9LA 3JVGA 4R4BB 3MCKB 4BD4A 2LT9A 4I77H 4KH2A 2HVBA 2AXHA 4L3EE 4ZMZA 1JCVA 5DJ6B 4U2ZA 1DE4A 1S3KH 1J5OH 3LKRB 1QLEB 4ZRGA 2X40A 3GNMH 5D7IF 1DJGA 1ID5I 2JXMA 3EH4B 2IQAA 2JE8A 3NYKA 3UZVB 3PWLB 3M1BB 3AS3A 2HFTA 4XCEB 5D2NE 3RIFF 1J5CA 1AGCB 4JFTA 3VXSE 1YECH 3FZUD 1J7VR 3US0A 4ANXA 1RUQL 2WBJB 1AKJD 5F9DC 1BVLA 2Q76B 3QUXC 2BINA 4LP4A 1VF5C 5HHPA 3FU5A 3O2DH 4E2OA 4AYDC 4GW4B 3X3FL 5FKAB 1EXUA 3GSNH 2OJZL 5DFVC 4PUBH 4D9QD 5CO1A 3BD3A 3PHAA 1R17A 3MZTA 4A04A 4DOHE 5DZOA 2ZG2A 5DGRA 3S3JA 1FGVL 3LZOA 1ZGLB 2J57A 2YPVL 4HJJH 3UZEC 1HKLL 1JS4A 4NKMA 2LQRA 4PJCB 4XXCA 3TVMB 5I8KH 3CSYB 4K7PL 3VD0A 4JFZH 5GGRY 3VFRB 3FFCE 1EDHA 1CPUA 1Y18B 2H3XC 5F7LB 1TMQA 4KXAA 5HBBA 2OL3A 5F9AC 5FO8A 3SSGA 2QQLH 2OZ4A 4G5AA 3ZW3A 3POHA 5ESAB 3MJ9L 4IOFD 3VWJC 4DUXA 1OT4A 1EAJA 2VXUH 2BJMH 5J3HD 1VHPA 3SE8L 1EHXA 3IFOB 3VVVA 2VN7A 4FGMA 4M9PA 1TTFA 4BV1A 1KDIA 2J1XA 1EK3A 3FU8A 2F0CA 1ODAA 1TZHB 4PJ8B 3NDYE 1BM7A 5ITFB 3TEUA 1B4JH 1MPAH 1PG7L 3V5HA 5L88L 3AB0B 2C9PA 3L9YA 5E4EB 2C5DC 4LVEA 1HINL 4N2GA 5EMYA 3SO5A 3EBHA 4QHNA 4CJ1A 4JM2A 4IBLT 2HKHL 3BP7B 4WTXA 1G7QB 4ZX5A 1JFQH 3RUGF 2ZWZA 2EDMA 4FXKC 4AE1A 1T66C 1G4MA 4WZ9A 3B2UD 2BSBA 4TOYH 1WAAA 4CL7A 3B2PA 5FGRA 3RVVC 5DMYA 4H8HA 3DTXA 4WV1A 3IDNA 4NOFA 1L6XA 4NZ8A 3KXFE 1A9VA 1N8ZB 1H3PL 1IBHA 4D7BA 3QGVA 2HJLB 3BH8A 2IGLA 2YAPA 5BS0E 2C3GA 4MS6A 1Y6NR 2ICES 5EOCH 2FX7L 3UG5A 1QSFE 2B7DT 4OLWL 4XO5A 2Z34A 1K2DB 1YMHA 4HUWA 4G7SB 4PWJA 4Y0GA 4C56A 4BXSV 5I1EH 4JRYD 3FDWA 3PL6A 1NA8A 3OF6D 4WI0B 1AQDA 1T2XA 5BCAA 3RX9A 3BPCA 5IBUG 4LAQL 5CIPA 2F5BL 4NUMA 4X8JA 3WFDL 2UZIL 3H9YA 1W72H 4HG4J 1PAZA 1Q1JH 2K6YA 2B1AL 2BXZA 2GG1A 4FXKA 4M61B 4YLQT 3GMQA 1CDCA 4PGDA 1FHNA 5BOPA 3QEQA 1J86A 2EIBA 3DV6A 1XF3B 4E0RB 1DCEA 2OBGA 4TUJB 5HHQA 5C09E 1LO5A 3O6FD 1U4EA 2C1OB 4XMWA 3ULVL 2WWKO 4ODUB 3DNKA 1R46A 3DGGA 3PFUA 1R3LB 2V5RA 5KSBF 4J27A 3EOTH 5AOKA 4PHXA 3VXMA 4HIEB 1OW0C 1UD4A 1YQVL 1IC7L 2XN0A 1OARH 5FCUL 3S3SA 4ZMXA 4JFHE 2IWFA 3D07A 3TYFB 2QPEB 3HC0B 3L3IB 3L3OB 1JRHI 1K5NA 1N3NB 1DLHA 3BFQG 3C8KB 3MO1A 1ROCA 1U42A 4N2CA 1YEHH 5I73C 3GXFA 4U1LB 1HNGA 3NCFB 4YAQA 3DX3A 1GGCL 2Y25A 2E59A 4XXCC 4KO9A 1AQ8A 2OW7A 1M1SA 1OP9A 1W0VA 4NKDA 5IROD 2W07B 3CHQA 5F8QC 1E5AA 3QW9A 1B2WH 5DFTA 3VGHA 2Z7WA 4FQXD 4XOEA 3SO3C 2AJUL 3EYSL 4H1LB 3W0WA 3O41A 4MAYB 3F84A 1YY9C 2ZSWA 3L4XA 3AG3B 2VLJB 1NUNB 5JIKA 2FB4H 2QSTA 5DK0A 1X5LA 1N5AB 5JQ6H 1DJXA 2H4EA 4EUPG 1C1EL 1TTAA 3HAEG 4O00A 5HHOB 3MRFA 2Y36H 4U6HA 2DQCH 5I1JH 3OZLA 1INEH 4OZGE 3MV9D 1U30A 2FTAA 4GQ9H 1EZVY 4NPYA 3CVHH 4DOHB 4C4UA 4X4YA 1IQWL 3FU3A 2KPWA 3H0TB 4LVHB 3SE3C 1KLGA 1V7MH 5A6IA 4MB3A 2YBGA 5DJZB 4ZW3A 1DYZA 4EQ2A 1I8IB 3R18A 1IJ9A 1MVYA 1U36A 3Q01A 4PRBA 3O4OB 4BK8A 2WTRB 2Y06L 3QQDA 4QRSB 2G9HA 4XHJD 4DZ8A 4H5SB 4NB7A 3UTSA 3IBOA 1F5WA 2UUDH 4NDMB 5K9OA 3O2VH 1QI4A 1GHFL 5CJQH 1UH4A 3SY0A 3OKNA 1RUML 4G9FE 1FVCB 3RVXD 2ZWLT 2FX7H 2VZOA 4UNTA 5JPMC 3DGCR 3TJEH 3H6JA 4HHGA 2QPDB 3B9KD 3L3DB 5EOCJ 1HWWA 3BN9D 3QEQE 4GAGH 1HILA 2AEPH 1RIVL 2H9GB 2XWEA 3PPSA 1QEXA 4WNQB 5JHBA 2X4QA 3F85A 3QH3B 3PWUB 5TH2B 3BP5A 3MROB 4O5LL 1YUHA 1JF1B 2QEJA 3TV8A 2AABL 1UEYA 4LF3B 1S7TA 1II4E 4ONFH 1FNFA 4RGNB 1XSIA 5EC1A 1QFPA 2IPUG 3H4FA 4QRPA 4N6RA 2WVVA 3DGDA 2R1WA 5DTFA 3SGJC 3BIBX 3VFNB 2OX5A 1Y07A 4YDIH 5EUOA 4Y4KA 2D8KA 2WC7A 2EIZB 4MWFB 1BYPA 3AAZB 5I19L 1LD9A 2K3HA 4LSVH 2VDMB 2X4OA 2P80A 4JDEA 1ZLUH 5EC2A 1MFCL 1EHKB 3KXFB 3NIGF 3SDXA 1LP9F 4BCZA 4JKLA 5KTEH 2VXUL 4KVNH 3MLXH 4LCCA 1UXSB 4YPJA 5T3ZD 1GZHC 5KW9L 3LN9A 5KOVC 3H53A 1VFAB 3O45B 4GS7B 4IIQC 2GBAA 3DX9A 3T08A 2IBZX 1IM3B 2HPOA 3TZVD 2ITCB 2A6DA 2FQDA 2J20A 2Z1KA 3K8LA 1JTTA 3UAJC 2EE9A 3WFBL 5ISZD 2ZX5A 4P9HL 4O4YH 3OXSA 1BVKB 4NNPL 4FNUA 2BNRA 3Q0HA 3VWKC 2GBTA 2VWEE 4JO4L 2Q87A 4ADGA 5E1AB 3WTYA 2IXQB 2B39A 1NEPA 4C4BA 2CJUL 2NY1B 1BFVH 5I1DB 1P84K 3E9TA 4YGVA 3OMIB 2FJHA 1NBQA 2HVJB 4LBAA 4P46B 4Y8DC 1JV5A 5CGYD 3FUEA 4XMVA 4Z5RA 4BZ1L 4DZBB 4JHUA 1RZ7L 2V2TA 4N90E 4KWUA 4E9LA 1AHKA 1FIGH 5SWQB 5DJXA 1YEGH 2IDSA 2R0ZL 4MA7H 3ARED 4WEBL 1JZJA 5GGQL 1TETL 1TZIA 2WB1A 3RWFA 3U1QA 5A2IH 5E9DD 2QBWA 3GMOA 4P07A 2D03L 3O6MH 4DO5A 5LJYH 2F53E 1HYSC 2KZKA 4Z0BH 1R3KB 3NIFB 2FBJL 3NN8A 2CLRA 1BPVA 1JTOA 5J9PA 4JPWL 1F00I 1L9SA 1TVDA 4GG6E 4O02A 2WLLB 2EDFA 5E4OA 1E6OL 3HPLA 4FFWD 3EFOA 1MCSA 4Q9QH 3FL7A 1FGVH 3DBXA 3MR9A 3IJYB 1IQDA 2QKIA 2FGWL 3DIFB 4HV8A 2VJ0A 3K6OA 1QVOB 4XPFH 1NCUA 2FT8A 3VDCA 1TUPA 4OZIF 3CZLA 1YYCA 4MZ3A 1P9MC 2WNGA 4YO0A 5FYKD 3ZE0F 5B3NA 1OM3H 1ZS8B 4G8GA 3AG4B 3V95A 3U7AA 3ULSB 4UOJA 1N2RB 1NDGB 4HKJA 4GRMB 1XBDA 4IKIA 5FA3A 3A4DA 1G7HB 1D5ZA 3D9AL 4G6JL 4U33A 5I30L 3OSVA 3UFIA 3S3DB 5C0FA 2V33A 5IT2L 2WXNA 1DQQB 1JHLH 3V52L 4TUKH 2NCMA 4NLAA 3UG4A 4A63A 3GMMA 3QJVB 5FXCH 2PNDA 3RZCA 2ZYRA 3TEWA 3PP4L 1DQMH 4P04A 1IU1A 3SDDD 5CEZD 1BEYL 2FWSA 3IF1A 1AR1B 3OKLA 1GIGH 3M7OA 2YAFA 2PW1B 1VERA 3MNVB 1B2YA 3PQYA 3QUYC 4RX4A 1P7KB 2WXMA 4LU5L 4WO4C 3SGEH 4I0PD 1HL9A 2DEWX 2YUWA 3K80A 3LEXA 3AMLA 1XCQA 4Z7QF 2IDQA 3S96A 2CK2A 3PQYD 2QKSA 3NZUA 1A9BB 3T8VA 2BRRH 4HALA 3OKEA 5D1ZC 1NLBH 3I3EA 5DRZA 5EZOL 2IQAB 2AJZA 4UDTB 1KN2H 1V54B 4KFZC 5IQ9A 2BSRA 3QQXA 2IAMC 3MRKA 5C0IB 2VERA 4HWEL 4PJ8D 5DC2A 4KNTA 3N1MC 1CGSL 1UJ3B 1Z0MA 1BIIA 2B0SL 2QZQA 2XFGB 1ZCRA 3CIAA 3L4VA 5A2AA 3IYLW 1U93B 5JA8B 5C1MB 4X4XB 2CDEA 3QCVL 1TDQA 2OI9C 3P2DA 3V0AC 4KRPB 4KZCA 4J3OF 3LPOA 5I19H 3U48A 4DGYL 4DP5X 1RUAH 3E3QE 1TNNA 3V7AE 4HC1H 3U0WH 1GL4B 3BUQA 2JI1A 1AHWC 5JMOC 3Q5YA 3Q8BA 1PKOA 4S10A 1NH6A 1X5KA 4LF3A 1DEDA 2YMTA 4L1BA 4WNSA 3K0YA 1RIUH 1FI8C 2YD5A 2R9HC 3MNMA 4OZFG 4I1NB 1J0YA 4XB7A 5ID0B 1C5BH 1WBYA 1G0XA 2KS0A 2R29H 3KYOA 5EOTA 3BHBB 1COBA 4AI7A 1M7UA 4V1DB 3RWEB 3ZTDC 1OV8A 4WWKD 4F7EA 1SDYA 1RJZB 3TPUA 4JRYE 3OG6B 3FU7B 1YDPA 2NY6C 5FA3B 1XSJA 3IETA 5C9KA 3NQKA 1ZA3B 1SHXA 4PY8J 5AVZB 2XN9E 5D6DC 1Y0LA 1WFTA 4XE5B 3DROA 4N2IA 1PY0A 4KUCD 2JIXB 1P7HL 1OIOA 2AK4D 4TUUA 3BUBA 1VRSA 4K23L 1L6ZA 5FYJH 1E4WL 4FQJH 2CR0A 3N1PC 1CIDA 4P4RA 4AIOA 2KPNA 5A7EA 1CS6A 2WW8A 4WHCA 2I5YH 3IU4L 4TVPL 1A6AA 5E5LA 1XF2A 3FAWA 4Z7QE 2WWKT 3QA3B 4RRPA 4M7KL 1NMAH 4NSKB 4XNXH 1KBBA 3MLWH 4PN6A 3DUHA 4RQQA 4U1IA 3O41B 1X9LA 3HJEA 1WZKA 4MAYA 2XDHA 4RA3A 3W2DL 3FTXA 2JCCA 1S8DA 3PAZA 1DJHA 4HH9B 4XZUA 5HI4C 3R0NA 2WNXA 5ESQB 3AUVA 3FTWA 4M62H 2F53D 4HIIA 2FL5A 2N4IA 1UWXK 1Y6KR 1U58B 2HJFB 3T3PE 1MWAB 2WM0A 3BKJL 2OMZB 4FABL 1TZOA 4DZBA 3CJJA 3D08A 5DHXB 2I07B 1RLWA 5TE6L 1T5XA 3C5ZD 1T04A 15C8H 4R8WH 2GSIA 3ZKXB 2ZAIA 4LOFA 2CJSA 1FJ1A 2GJ6B 2P5WE 4DO6A 2BLFA 3DV4B 4QRAA 3QDGE 1Z32X 3LKRA 1MXDA 1A1NA 5IJBC 2L7QA 2V3EA 5D7JC 1S7WB 1YQVH 4AMWA 4DQOL 2Z92B 3L6FB 1WA2X 1AFVH 3BAYA 2VH5H 4YHPB 3G5XB 1IC5H 4L18A 1YNTF 4FL4C 2EDDA 3GFUA 2E9BA 1UJ3A 3AY2A 1JERA 5AB1A 1MFAL 4W93A 4UYPA 5I6PA 1CLOH 2HP4A 2YJQA 5C08A 4ETQB 3JTSA 2AQNA 4OI9A 4F7TA 3EOTL 4CU6A 4YPGA 4ZQKA 3UBXI 3V2AR 4NWTH 3OLEA 4L4VB 3UPAA 3HNSH 2OQJB 3I9IA 1R5IA 3UZEA 2AI0H 1T3FB 3GSUB 1KTBA 1VGEH 3QDJA 3QQ4A 4IRJA 5DUBB 3EYUH 2J1WA 3TN0A 2BX5A 2G0KA 2XTJC 3ZRCC 1T5WA 3ULUC 4HVBA 2XQ0A 2PWGA 2DTSA 4YDJA 1HYSD 2WP3T 4G6ML 5DZVA 1T1WB 4Z0XA 3C9NB 3AQZA 4IMLA 1KTJA 2XXCB 3GJEA 3HRZB 5F1OB 2YXFA 2EIDA 4FEMA 4L37B 1HHIB 1SJXA 1MH5B 1AIFA 4P3WA 5FDWB 4MXWL 1GH7A 3WTWA 1S5IH 5KBPA 3G08B 4N2KA 5K9JH 1L0PA 3CZFA 4FYRA 3KPSA 4LSSH 1U91B 5D71L 5EA0L 5GZNA 2BOBA 1EX0A 4IBWA 3TN0C 1ZDQA 4QKXB 4BKLB 1I8KB 3VRLE 3ZZSA 1A6ZA 1BWMA 2VLJA 2NTFB 3HS8A 3BMVA 3RURA 5IW1B 4YXLH 4Q9RH 3QUHA 3DRQA 1A3RH 1H8SA 3Q8EA 3IDJA 2XPYA 4DPCX 3N40P 3FPXA 3VGAC 3MTRA 3RL1A 1NL0H 2A7BA 4J7RA 3UPRA 3BE1L 2A74C 4I0PA 4KTYA 1NLDH 1XVSA 4QO1B 2ADJB 4ADJA 2EZ0C 5GJSL 4U1LA 4YAQB 2COVD 3N42F 3UBGA 4DP2X 1Z7JA 4IJ3C 3P69A 4P5TB 4DTGL 3VYPA 3HBGA 2NY1C 1UG9A 1QSED 5SWZB 4FEIA 4GQQA 2A9BA 2DEXX 5IIEA 3WSQH 5I6LA 4OFQA 1E4HA 5ACLA 5LBSL 2AXFA 1UFUA 3ZQ9A 4MNQE 3ARTA 2O5XH 3C8DA 3RTQC 3LSOB 3LMJL 1U2HA 3QUXD 2YKLH 1FIEA 5TDOB 3THML 4JFFE 4TULL 1SVZA 1SXSA 4GQZA 4FFTA 3VH8A 2BHUA 5EFIB 3CSTA 3FUJA 2WBJD 2FEJA 1CICD 2SEBA 3GRWH 2EDKA 3MRKB 5I75B 2DQGL 4ZUVA 4GO8A 4MHHI 2EH7L 3QWRD 4Q6IA 4FHKA 4PCTA 4DSYA 2ENYA 3VQLA 5HYJE 4PI2A 4GAJL 4X6FB 5ESVB 2DJ4A 2BY3A 5GGUB 3SD2A 4AEIL 4WF7A 4HXAH 1ZK9A 1FPTL 2AQRA 1RI8A 2DICA 3QRGH 2NOYA 5JW4M 4EAEA 3EH2A 1DO6A 1PY9A 3MBWB 3NBNA 4XWGL 3ZGHA 4BUQA 1E9QA 3L3GB 4MB4A 4YX2L 4M3KB 1S7VA 3HC4L 4NM8H 3SCMD 4IRSD 2IWEA 4HXBH 2W0KA 4XNUL 5D6DA 5B4MC 5GXBB 1ACZA 4MNGE 1YMHB 4HUWB 3WL9A 2XA8L 5ANHA 2B5IB 4P5MB 1H15A 1MEXH 4NKIH 4EI5C 5FR3A 2QL1A 8FABB 2FH8A 1B6UA 5DCCA 3VXMB 1ES0A 4G1MA 3PG2A 1IBGH 4OB5H 4BFRA 3BIKA 2VLRD 5B21A 1FO0L 1HH9A 3SBQA 1WFNA 5EWIL 1LQSR 2GT9A 1FNEA 4ZYKA 5K9KA 3QFJE 2P5WB 1SDAB 1HKLH 2NR6D 4LSSL 1IGJA 2Q7NA 4UT7L 3G5VB 4WKZB 4ZMWA 4ETYA 4JR9H 3L4TA 1WA1X 5CXPA 1DUYB 5LNGA 4GSUA 1GOGA 3RUGE 4IU3A 1W9XA 3U46B 2GIXA 3F3HA 4X7DC 2OMXA 1SJEA 3QUYD 5CIPB 2GSIB 3V5HB 3CVIL 5E5MB 1CK0H 1XSOA 2NQCA 4ENZA 1DVZA 5DRNA 1B3JA 5CD5C 1MUJA 3QI9D 1GTNA 4XP4H 3BCFA 4J23A 5AVUB 3KPQB 3LS4H 4H0LC 3CH1B 4PJFF 1LO4H 5EU7C 3EYUL 1P1ZA 2FYYB 4KKCC 3T0VA 2PCXA 4CMMB 4FXLA 1JPST 1LMKA 2WHVA 3T4YA 3MJ7A 4ZAKA 5CJOL 4DCQA 2ADFH 1OCCB 3WL9B 3F7VB 4GG6A 4PVNA 1SBSL 5D7KD 4JFPA 5B8CA 4NJAL 3B2DC 4PJAF 4ZMNA 2NTSP 5FO9A 4KAQL 4K8RD 3ZR6A 1P7QD 3IRCA 3IDMB 2ISDA 4L5FE 1ZJAA 4JO2H 6PCYA 4PJCA 1ZLWK 3WD5L 4I0CC 3S34L 2B4CH 3IDXL 3K1DA 2HJKA 3R06A 4A7UA 1SJHA 2MMXA 5CINH 5K9QG 5DA4A 3GRWA 4HIXH 4FFYL 1SN5A 3EGSA 4PRDA 4UQIM 1RIHH 3N85H 3RWCA 4AL8H 3HMWL 4MNQD 1KPRA 2H0FA 3RJQB 5B8CB 2YD4A 1FZKB 1U3NA 2A74A 3GSXB 3IB4A 2M8XA 4FFZH 3F00A 1KYOJ 4E9XA 5DS1A 3OJDA 4N0CD 2EUXA 3O11A 1F45A 1PW3A 3CDGB 4Q6IC 5L7XH 3M6DA 4BHUI 4P48A 4C57C 3QZWA 4PP2B 1WEJL 3ZIYA 1Z5LA 1T1XA 3CQQA 1UCBL 5F9JB 3U6RA 5LWYL 4M02A 1RK1A 1KENH 1AQHA 3FH7A 4QRQA 5E2UL 1MUJB 4JFHD 4R6UA 3MGOB 3CZSA 2WQAA 5CBAB 3KBFA 1PU0A 3SGKA 2XXMB 4P3CH 3FU9A 4NC1C 3ESPA 4G1EA 3RFRA 1UOLA 3X12A 2X3BA 5H2BA 2ZT9C 3HPJB 2DYPA 4KVPA 2CR3A 2BXYA 5CJBA 2A3TA 2O93L 4AMXA 1V3KA 2X6BA 3L9BA 1X5JA 1U6AH 2ARJA 4MAUH 5TDPB 1S7WA 1UD5A 3ROLA 5AYUL 4PRPB 4MS8D 2VW4A 1JHKL 1EFXB 3IJ9A 3MODL 3K6SA 5F96H 4D9QE 4FFZL 2ZCHL 2ZXBA 3HNVH 4PWFA 2VAAA 5ENWA 4ZMTA 5FYKL 4KK6D 1ADQH 2JWYA 4NQCA 2V3DA 4DKFH 2C3HA 2DQHL 1T2QH 4DK5A 2XWBB 2A83A 3FULA 3CN2A 4MD4B 3VD7A 4A2FA 2YPLB 3PWLA 5IR1B 1X5YA 3GKZA 2F74B 3C5ZC 4M1GH 2NY4C 3PHOA 4BINA 2HLAB 1GCYA 1W0WA 5IB1B 1T89C 2A77H 3UTPD 3CDCA 1FGNH 5F7NC 2RFXB 5EU6E 5E8OB 4XX1E 3SEPA 5D72L 1GAFL 4EXKA 4I89A 1PS3A 1SOXA 4AQZA 1NMCB 1W16A 5FYJL 4HOMA 2WLKA 3ZL4H 1SMAA 4WU5A 2F61A 1GY2A 4Y2LA 2B59B 1THCA 2WTRA 3SE6A 4N0YL 4DGYH 3P11L 3RWCB 3SPVB 3PQYE 4S1DC 3V4VB 4XMKH 3QORA 5DVNA 1RU9H 4GB9A 1D6EA 4IKJA 2QJDA 4PREA 3VRLF 4YHLL 1MCEA 4L4VA 5I76A 1Z5YD 2J3SA 4X8CA 4JG0L 2F19H 4FQCL 3MV01 4YUEL 4JHWL 3MBEA 1FZMB 3TURA 2VW7A 2PW2B 3X1BA 1CN4A 1ZTMA 5JPNB 4KO7A 4OCSL 4P5RA 2R29L 5HGGS 3MOBH 1T03L 1OE3A 1M53A 2EADA 4LARH 5JHDA 4A67A 4H44C 4Y7MA 2VRKA 4JR9L 4FFYH 2OMVB 4ODSL 1F6AA 3CPLA 2MQGA 3MR9B 1NBZA 4NUPA 3MNZB 4HA1A 3HMXL 5I1HL 1QR1B 3C2AH 4Y5YC 2VL4A 3HZMB 3COOA 1UKSA 2ESVB 5E2VH 1CFTB 1A7PH 3D69B 5JDJA 3NPSC 5AOLA 4QHUB 4XCNA 3WKYA 2BP8B 1FLRL 1P4BH 4IK6A 2R4RH 1KFAH 35C8L 1JPGA 4KKLC 4Q4IA 4HHWA 1RP8A 2VLRA 4LIQH 5I18L 3ZUCA 2H0PA 4X7TA 4G7YL 4IGBA 1M7DB 2XRAL 4XWGH 4OD1H 3ZDXB 3NJHA 3DETD 1CGSH 1MJUH 5I1LB 1QQDB 4HLJA 4H7VA 2AANA 3CD4A 1ZGLA 5HHNB 3LNEA 2VDKL 2QDVA 1VCAA 2CIKB 2ZOLA 5LNDA 3DO7A 3RAJH 2CPCA 3HG1D 4JRXA 1U8LB 2MH4A 4Z7QB 1A7NH 2KMWA 2Z93A 3GWJA 2XTJD 5FHBH 3VFSB 3CQPA 1DBMH 1DVXA 1NBYA 3ZU8A 2OMTA 2AEQH 1OKEA 2X28A 1A9BA 1RK7A 2QZ5A 4HIQA 3VXSD 1F58H 2E76C 2VRQA 4XCCL 3VDBA 3PL6D 4EEEA 1LE5B 2BOLA 5LHDA 4IS6A 1CZ8L 1ZT7A 1A5FH 5D7IA 3II3A 2ZX9A 1GGIL 1J5HA 5IZ7A 3NFSL 1QFUH 4OZFH 1BJMA 2XU9A 4ELMF 3A6BH 3TTYA 3DVNB 1NSNH 2D3LA 3CFEB 1ZEAH 3TPUB 4WFFD 4I3RH 5J8OA 5KBNC 4PRHD 5CMAA 3V0FA 3RA7L 3FN0H 4IBUA 2X9ZA 4MMYA 4EIZC 2PPAA 5CFHA 2QVIA 5IGXH 4ORZC 3TO4C 4LCWE 5C0DB 2UY7A 1ZHBB 4OUOA 3SKUD 1IC4H 1LYQA 3DUSB 4GRLA 2NCEA 2YD2A 1JGDB 2EIZA 2O6CA 3HMXA 5AVYB 1FVDB 4CVXA 3FCUB 3OKKA 1RPQA 3BZEB 1MHPL 2QDWA 4H2AA 5FO7A 1GKEA 3PJLA 5AFAA 2MNWA 3UP1A 4ILDA 4AM0A 3HNVL 2IALA 2W9EH 3RGHA 1QVOA 4IU3B 3WAJA 4P2RE 2A6JB 3CE1A 3RZCC 4M5ZH 1KIPB 1X5XA 4LEEA 4XAKE 4Z0BL 5KOMC 3STZA 3MACL 4PGBB 5C7XH 4ODWA 3KLKA 5D1XE 4PJ8A 1IBGL 5JZ7C 4KXBA 3SB3A 5BRZD 1H5BA 2RJMA 2EDOA 2B1OA 4HD5A 2MCG1 1XEDA 2RHEA 2P49B 4QRFA 3IJEB 1PZAA 3V0JA 1NCHA 3T8XA 2VDLL 3IMSA 4OM1L 3WHE1 3O11B 3UTTE 2IO5A 4BUHA 4M5SA 3QUZB 2OXGB 3WFEL 4ZQTA 4FLOA 5D96C 1KEGL 2BIMA 2O1AA 4G70B 4XR8C 1WIUA 3UZQA 3DVGA 4NCC1 1P7QB 1ITBB 5J6SA 3SDAC 4B7LA 3GD1C 2VXTH 5CLYA 3PDDA 3SJVD 1W6WA 1KTLA 3WIFA 4JRXE 1BX2A 1NL0L 3KEHA 3ARPA 2Z1PA 4FX5A 1TYRA 2OXGA 3SPJA 3ARBA 2ZXAA 1ZV9A 1NAMB 3KHQA 2FEDD 2VDMH 1G7IB 3MRGB 1QBAA 3RI5K 2ATPB 1MFAH 2R2EA 2Y7OA 4MJHA 4RRPG 1MLCA 3BO8B 2CA4A 1SYVA 2VDLH 3QJUB 4FQPA 5JIHA 3ECBA 4M6OH 5E2TH 3IGLA 4Z7UF 1YA5A 3B9KB 5DWUL 4L0ZA 1HQ4A 3MLTB 4XI5C 1TENA 5KYNA 2EXYD 3LZPA 4S1QH 4CVWA 3KD4A 5KSAB 2FR4B 3UDWA 5HXMA 4QHLB 4UT9A 5JOFA 1UWGL 4TM9A 1MJJA 2ZX6A 4HFWA 2H6UA 2DWEA 1HXKA 4YVUA 5PAZA 2Z31A 3K6NA 1SJEB 4CJ0A 3QUMB 4D0DA 4MNQB 4F7TB 3KPRE 1BBJB 5TDNA 3HI6H 3CZEA 4UQ3A 4IEFB 4EXPX 2GTZB 1QPPA 2NW2B 4JPSA 3BH9B 1KULA 4RZCB 1ZHBA 2PCFA 1LK3H 1L4IA 2L7UA 2QQNH 5FYLD 2F53A 3I9GL 4HWUA 3T2OA 3MBED 3ARBB 1TPXC 5L0QB 1UOWA 3RPKA 1BZ7A 5B3JF 3DMMC 1M4KA 1ZK5A 2VXSL 4P2RA 1QSFB 2EH8H 2O5ZH 5AZ2L 1N0LB 5GSRB 5I76B 4B9JA 2V4LA 4QR7A 1OAYL 5CJQL 1WPCA 1RERA 5C7XL 3PE9A 1P7KA 4XPAH 1OAZL 5H35B 3OKNB 3EBAA 2BNQB 4OSUH 4UOW1 4W9IC 2V9QA 3TF7C 5DD3H 5CZVL 3GPSA 1FO0H 4L48A 4N3UA 3VG9C 5D5MB 2Y2WA 1JSYA 3NJLA 5L2KA 3MRNA 3IE9A 1MRDL 3P77B 3Q48A 3GSQA 4LK4A 4PGZA 4RFOH 5DK2B 3OAZH 2ZXWB 1JWUA 1B6DA 1GYVA 1K2DA 2Y6TE 3U7WH 2J2ZA 4AXWB 2ARWA 3GS0A 2DQCL 3N9GL 5C0FB 5A43C 1HESA 4G2AA 3LH8A 3U2SA 4ZO6A 2VDKH 1ZTXE 1JTPA 3FQYA 4R7NB 2XWBA 5E6ID 3S2AA 3QUXA 2X70B 3VMNA 1J0JA 3CFDA 2VLRB 4R2GD 1OWRM 2AQ2A 3DI3B 4IIQA 1M71A 4OD1L 4FNLH 3U0WL 3DX4A 4FC3E 4FJ6A 5J3HC 3BX7C 1BMZA 4FQIL 4HPYL 4LLMB 4NQVA 3KNBB 5FUCC 4N5UA 4O2CA 4AYFA 3O81A 1A47A 2EDQA 5LWYH 3OV6A 1BG1A 3FB5B 2VMFA 3SOTA 3SKMA 3VFMA 3VM7A 1W72L 5KS9E 3LQMA 3MQIA 3ECVA 3HKZA 3RWJB 3BGFC 3VWKB 1NANI 2WIIA 4OLEA 2DQEH 4R84A 3O8XC 5I0WA 3EJYD 3EOYG 4BZ2A 4XPTL 5C07B 2XVBA 3NCYS 2H47C 4QCIB 1X5FA 1OLZA 4JPVH 4FMFA 2YFNA 3CMGA 2OMZA 4I48A 4URTB 3U7YL 2BMKB 3V0WH 4XVTH 3T2QA 2BNUB 1OE1A 4BZYA 3WIHH 1J1OL 2FCBA 3ARFD 3MLWL 2CCLA 3NSXA 4JFYA 4NIYE 4UQ9A 1U8IA 4I2XE 4KRMB 4Y4HC 4X0KB 1DQLH 1TEGA 3WIIH 3ZKQD 3DYOA 5LVEA 5EBLB 2OTUB 5FA4A 1I8MA 4IOSD 1YEKL 3B9VA 4YXLL 1A6AB 1XF2B 5LQBH 3PAVA 4XMPL 3C60D 4GQPH 4Y16A 5E2VL 1NPNA 4L23A 1SJHB 4OI7A 2X10A 1KPUB 4JKKA 2WNWA 1NCAL 4KZDH 1OTSD 4ODSH 4D94A 5J6GA 3FRUB 3SE3A 3F01A 5I6XB 2EAEA 4X7TB 1BWWA 2CUAA 1QP1A 3OGCA 4Y2DB 1AYOA 1AQDB 2PR9A 3TF4A 1W2KT 2CJTA 4LCYA 3UAFA 5KYXB 4BBWA 4XCEA 3LQZA 1YY8A 4JAMA 3GMMB 2DMCA 2X4UB 1DVFA 3GLDA 1RZKH 4P23D 1WAAE 2X4OB 4LSRH 4E9VA 4PJEF 4PSRA 1QYGL 3GI8H 2Y7QA 3MRHB 5LO7A 2DZEA 3NTCH 3BAXA 1L9QA 1QNIA 5F96L 3S3PA 4ES9A 4YHYC 2HT3D 2Y5QA 4R0LC 4X7SL 4XO9A 3TBTA 4RNRB 1T20B 1IC1A 2WLNA 1VGEL 3KCWA 4APXA 5KS9B 1HINH 2I9LB 3P2TA 5AVVB 5JPNA 2DJUA 3MGTA 4FNRA 1DVYA 5F97E 1CGTA 4RGOL 2QSCL 3MBXH 3QUYB 3EYOB 5DS8B 1DN2A 4NNYA 5E9AA 3VYNA 1JYVA 2EEFA 4U1KA 1V8HA 2YD1A 4HMDA 5DD1L 5D1ZB 3HPLB 1JRHH 2XV0A 1MIEH 1DBJL 4ODHH 1MJ8L 2Y22A 4X5PA 1JNNH 3K91A 4WDIB 2ZYIA 2KT6A 3MV7E 4XP6H 4M7JL 2QHRL 2WOBA 3WMQA 2CUIA 1OT1A 4O58H 1TZGH 2ZNXA 2F6AA 3LEYL 1UKTA 1J5IA 4FXGB 3NGBC 3WOVA 5IQ7L 4JFEB 2HT4C 2Q0ZX 2ZKHL 1FHGA 4GMTH 3M46A 3R06B 3L4CA 4OH2A 3HNTL 4WUUE 2G60H 2FNWA 4JFDE 4AQAA 1WHPA 1C08A 3H9SB 4PLJC 3GHBL 1KG0A 2IFGA 1JE6A 1CXLA 2VC2H 4OAWB 1C5CL 5E6UB 1PNCA 2NLJB 5DU7A 3ABMB 2XVLA 5L8JB 4FQQB 4XC3H 4PBWD 4QRUB 1ZHLA 2FATH 1ZGLP 1JZ8A 4NKQB 4Z7UE 2QR0A 2DY2A 3GZQA 4DP1X 3CHSA 3T8XB 2VR8A 3QCUH 2PCFB 3QRLA 2PR4L 1TQUA 3SBRA 5DQ9B 5I66A 2DYPB 1M1XB 2EYTA 3CVCA 4KPHH 2X53A 4HJSA 3IDUA 2YGQA 5C86A 4OF7A 4Q56A 4AIZA 3QWQB 2CO7A 4P5TA 3RWDA 1MF2H 5I8EB 3ZKMC 2OR8A 3HTLX 4O4YL 3SDXB 2HT4D 3HC0A 3L3IA 4XPBL 4QLRA 4PBDA 1QO3A 3BKYH 3DBXB 3QQ9D 1Z5LB 3GHEH 4FDWA 5D71H 4LEOB 2AJYH 4N9OB 1E8YA 3REWA 3VXUB 3AGVA 1JGUH 4NN5B 3V9FA 3FU0A 3DRQB 2YLHA 2DQJL 1J8HE 4QF1A 3X1GA 4HK0B 3BPLC 4G83A 1LO5B 1WLHA 1YNLH 1T6VN 2XG4A 2YAQA 5CF3A 3MBEB 4JZJC 3P4NB 3SE4C 2HKAA 4Z95H 1QX1A 3MRCA 4E9SA 4G9FA 4OV5B 5D9SA 1EZSA 4R7NA 4GT7A 4ADIA 2XA8H 4XCFL 3FB6B 3QZMA 4GQ9L 4N2FA 4XGZA 3L3KA 5DJ0A 2FJHB 2D3JA 1PY4A 1VEPA 3OMNB 3QC5X 2K4WA 3PWPE 3PREA 3D87B 4R26L 4WUUB 3RY6C 3WS3A 4YWGL 1MFBH 4F3FB 3REVA 4I7ZC 4N2OA 4P5SA 4WU5B 4I8DA 4YFLI 3V0GA 1FFNA 3ATEA 3UTPE 1AGEB 5DJDA 1UWGH 1F4WL 2LHAA 3RGVC 2CMRH 1MAML 3FO2B 3C5JB 2E7MA 3WKML 4Y9EA 4YSOA 1QHPA 5EFIA 3BCDA 4ONHA 4WUUA 3CHRA 4B60A 5E6IA 3SIKA 1C7SA 3GSUA 3QQ4B 1G7JB 1P4LB 2QELA 5EWIH 5DD5L 4B7IA 5C0CA 4UAOC 5GHWL 1N0LA 2X9WA 1N12A 3NIFE 5I17B 3KH3A 1EHLL 4JDVB 1C8PA 1U95A 3IFNL 1JDAA 2C3WA 3WXVL 1IAOA 4OCMC 1OALA 5C08B 1Q0XL 3U1SH 1A1MA 3IDYB 5C0AD 2XWZA 4L0PB 4XP6L 1ZSDB 2IBBA 5KS9F 4L3EA 1RH8A 3MRDB 1T7ZA 2DN7A 3BVUA 5CP3H 4M62L 2R56H 3ECQA 3QE5A 1O7SA 4UM8B 4D0BA 3D85D 5DRXB 4NKDB 5DD1H 3TBSA 2DLEA 4QRPB 1AOZA 3W37A 4F9LC 3F05A 5KBLA 4QRRD 1CXFA 3CLFL 3K6FA 3FOMB 3KPMA 5GISH 3QEUB 3RGVD 4FFVD 3QFJA 3IKKA 1HDMA 3LPWA 1ZJBA 5FF6A 2PCPA 3UMTA 2ITFA 3QYCA 4U2YA 1V3MA 4ZOEA 3RA7H 1R0AL 3KZ8A 1BLNB 2DD8L 1CE6A 4KRPC 4CMHB 4JO5A 3CXDL 3UPCA 3TYFA 4Z5RB 1PD0A 1JZ6A 5J6HB 2QV2A 4GXUM 1DQDH 4GAYA 2VZTA 3AY4C 1GMIA 1LE5A 2ED6A 4O58L 4PTUA 3ZT6A 6PAZA 4B5ZA 3P9LA 2B08A 4ZXBB 3I74A 1ZT4A 3FO9B 2AQSA 1GC1C 2VLME 3PCYA 4QRUA 3GIZL 4LQFL 1TETH 2A74B 1OOWA 1OP3H 3QQDB 2VUYA 4QRSA 4U6YB 2CHZA 2XV2A 1F0LA 4NHCL 3FTVA 5FPIA 5F88B 1BD2A 3BSZL 1UENA 3BZDA 3NT0A 2YD3A 2HVKA 5A7BA 5L8KB 2IADA 2F58L 2LGNA 1QQDA 2WIMA 3C6LA 4QTIH 2PP8A 1P5UC 2GIYA 2EACA 4OGXL 1J9TA 4ZFOL 3JT2A 2V7NA 1MN4A 2Y1VA 5GRJH 4PGJA 4ZUWB 3L3JB 3SZKC 1I8UA 1WBXA 4NC0B 3FUNA 4E9TA 4KX9A 2APWA 2HFEB 3BQUB 4F2ME 4LIQL 2KHAA 5IMOB 5KVEL 3PWPD 4OD2A 1LDPH 3KBEA 4F7KA 1ZPUA 4KKAD 1OK8A 2FYYA 3J2PA 4CMMA 5EEVA 1ZHKB 5D8JL 5L2JA 3NPZB 4HDIA 5BO1H 3QC6X 4I87A 5DJYB 1VEMA 3VNYA 1D5XA 5IMMA 5F7WC 2OMVA 4FG2A 5ALCH 1GS8A 4GSRA 3LRMA 3U9PL 1WF5A 2TAAA 3ZZQA 4AM0B 1OD9A 3GSVA 2NTFA 3JWNC 1HSAB 3OZ9H 2DI7A 2HWZH 3WG7B 5BO1L 2P7TB 1OAJA 4U4IA 4NNXB 3MGTB 1LEIA 4PI0A 3MOBL 4V1DE 2OMUB 3IFLH 2Z9TA 3B3BA 5C0CD 4ABWA 3VG0L 4FZ8H 1DSFH 2PPFA 3MGOA 4BSWA 3B7TA 1IEBA 2EDXA 5KJ4A 2EVGA 1N5YL 5K9KB 3KW8A 3SKJL 4ZO8A 4AW7A 3U0PA 4JLRA 5CMAB 4N2LA 3IFOA 3E8VA 4K3DH 3SY0B 4F2FA 2FWLB 1AGFB 3MNDA 3GXTA 1ANUA 2VLMD 1RZIA 4HLZG 2DLIA 4OTXH 1FLRH 2E4TA 5DD6A 1HEZB 5KYYB 4GT0A 5CJ8A 2BSTA 2BVQB 3M17B 1KB5L 4WFHD 3VRJB 3D12B 1YRKA 2IH1B 2XTLA 1QWHA 5ISZE 1KCSH 5A2FA 3NCBB 2BVPB 3LVTA 2OP4H 1IMHC 3INUL 3FAXA 3QDJB 4IRJB 2VZ3A 1D2OA 1IKNA 5DJ0B 3LNIA 1YG9A 1A7QH 2H6PB 1UZGA 1S3RA 1T7WA 1YJDH 2FK9A 2ILLA 3HB3C 4AYBA 2IOIA 4YOKA 4XNZC 4NO2A 5TGBB 3LXAA 3D52A 4AG4H 4X5XB 1PJ9A 3AREB 5CP3A 1MCFA 1WK0A 5FYLH 3GSWA 1J1PH 2YEZA 2CIKA 4GG6B 1IL1A 4EN3B 5CUSL 2HJLA 5F71A 2ENPA 3DVFA 4FYTA 4XMLL 4CVZB 4EI6A 3KYOB 3UGUA 3VXOA 4G7QB 2XN1A 4LO9A 4G5ZL 2HG0A 3ES6A 3SGDI 1MCJA 3II1A 4WSGA 4XPAL 5I6OA 5KUKA 1HJCA 5IKCA 3VXSB 3HRZC 5KSVB 4Y7OC 1T4KB 2Y36L 1JPSL 2AGJH 3HS9A 1XH0A 3VSUA 2AC0A 1IIIA 3ETBF 2FX8H 4LLQB 5TE4H 2NR6C 2V7HA 3O3BB 4OGZA 5FLUA 4CW1A 3SDAD 1F4WH 3QUGA 2BP8A 2Y6SD 2Q2LA 1A4JB 3ZE1F 4NFCA 4APQD 1NCNA 4A2HA 4NQDB 2V5YA 3G04A 1FP5A 4EBQH 1UH2A 1E4WH 4AVHA 4ODXB 4JN2B 3Q5OA 3ES6B 1N67A 4GRLC 1RZ8A 1G94A 4Y5XC 4JE4B 4GP8B 4BSVA 5LN4A 1NC4D 3O2WL 5FB8B 2Z35B 2NXYB 1DFBL 2FBOJ 2G3ZA 3L9EA 2YXMA 5EN2A 3RBSA 4UNVA 1G87A 2ZQKA 2EVFA 4NGHL 1J8RA 1G7IA 3MRGA 5HHMB 2XI9A 3VFWB 3ESVF 2K45A 4XTRC 4ZFZA 4JZOB 5T1DH 2XWJB 1M71B 5DYFA 3V7MA 1X5GA 3EG9A 3WFHB 1DDHB 1EEZA 3EO0A 3BKJH 1I1AD 1TVBA 4NO3A 4OCRH 2NNAA 3ASWA 4NZDA 5IHUH 4BJLA 3ZYZA 3BUYB 1DQJA 3KWWA 3TBVA 2XIIA 4PJ7F 2X6CA 1DJWA 2NY2C 1BYNA 1UCTA 2VN3A 2B4CC 4HCRL 4A6YL 4PYGA 5I71C 2M26A 3U36B 4LGSB 4PJBA 4DJMA 5HGDA 2ADIA 3PYCA 3QPXL 4LSTL 4UNIA 4X6FA 5GGUA 5GS1A 2E7LA 4GSQA 2FGZA 2CBPA 2XPZA 4XNDA 3HE7C 4OZFA 5DUPH 4WHYH 4AJVA 1Q4NX 1E5YA 4GW4A 4LBEB 3GBEA 4QXUL 3QUMH 4NBXB 5CJOH 2VLKA 3HE6A 5I75C 4LLVB 4N24A 1ZPLA 3T4AA 4OV5A 1GYAA 4GBXB 4KO6A 3ULSA 4CN1A 5LN8A 4PRHE 3MV8A 5EUOE 1TKWA 4N9GB 3U4BH 3VD5A 3RKDC 1IGMH 4X5WB 2IANB 4QHNB 5CLTA 3V8OA 2JB5H 1RIVH 4H88H 4OM1H 4A6YH 4Y4KB 4G8EA 4Z7IA 4LU5H 4FHJA 2YAHA 1U92B 1X5IA 1GC1L 1QBBA 4PWHA 4IEFA 3W81A 1A66A 2R4SH 2VXQH 3KM1A 2PTTA 1LEGA 1JF1A 2VRAA 2DWSA 4TNWF 2Q8AL 3BRGC 5HJ3B 5D70L 3O3BA 1XCQB 1E27B 3FT3B 1K6QH 5ABDE 5KSAA 1ZGLM 1S9WA 5LGJB 3GI9L 5C09D 1CDGA 3KPSE 5CZRA 1M2VB 4LL9A 2CRMA 2D7QA 2V2XA 2FATL 3H4HA 3LIZA 3S7GA 4UF7C 1X6LA 3SQRA 2MQ3A 4N5ED 4XOCA 1KPUA 4F37F 3FYEB 4YHKH 4OIBA 2I60H 4HOXA 3QXVA 1U8NB 2BJML 2DF3A 4O2FB 4ODVH 4J3BA 2FJSA 1MCLA 4GAAA 1M3IA 1NAMA 4RGOH 5DHDA 1UM6L 2FUQA 3ESOA 1WZMA 4G8IB 3NJNA 1TYJA 4B9CA 2HJKB 4KTGA 4JY4B 1KJ3L 3H2QA 1BOGB 1F90L 4FRWA 4JFZL 1EHNA 2FRGP 1OF0A 3S35L 2HX9A 5LG6A 5C3IA 2RMNA 5DEFB 3HG3A 3SQOL 1QRND 4F92B 3AS0A 3ASNB 1AC0A 2Y7MA 2D0FA 4PV1C 3SDXE 1TSRA 1GZPA 2VMDA 3U9UB 4KJPD 3N41B 4RMSA 5DFWH 1YEDA 4U3XA 5EBMA 2N7SA 4KX8A 2ERJC 3SN6N 2I60L 2WO2B 1A7NL 4OGAC 3T6QC 3DSFL 5IROA 3RUGB 1OVZA 1MIMH 2WLLA 2BDNH 4X4ME 3FT2A 4KY1L 1P6WA 3OKMA 4FCAA 2MKWA 2WLMA 4JJHA 4K0OA 3OVUB 3KPPB 5C0EA 2DI8A 2CO1A 4D9LH 2NDFA 2PW2A 2ZIDA 4KKLD 4NO0B 5GGSY 4UOZA 1U8HB 1YEKH 2KQMA 3WFCH 3ZE2E 1GGIH 3K72B 5HHME 4QIRA 1DDHA 4LHUG 1AXTL 3KM2A 3NZSA 4BFGA 2VLKD 2ZUQC 2GKIA 3HE6D 5F9WB 5LDSA 1OGAB 2YKLL 5DDHB 5I23A 3WLBA 3QAQA 3KPSB 4JVPA 4WGWB 5TQ2L 3WN5A 3FCSB 4GUQA 4OQTL 3QIWD 2OCCB 2Y07L 3GLAA 2BNRB 2H1PL 1YY8B 4ERSL 4I3SH 2WXOA 2AXGB 1M2OA 1QPKA 1IJNA 2CRYA 4JPIB 2H32A 4JHVA 4C4KO 3Q1SH 1JZ3A 2OYLA 3RIKA 1JDDA 4DTGH 2DV6A 3EYFB 2WZPA 1E8WA 4TQHA 2D7NA 4ODTL 2J4WL 4KJQD 2XPGA 4QRRA 1MZYA 4FCHA 3VGBA 4JFXB 4GY4A 4OCXH 4TKWA 4Y1TA 1L3WA 5JR1L 3U0TA 1Q9KA 4K73A 1UD6A 2RTTA 3FF7A 5KBMA 5I5MA 5ESVA 1ZANL 4QHLA 2VABA 3QR1A 1RZGA 3G6DH 3NZHH 3ZL2A 4AW4A 3IWVA 3SGKC 1HH6B 3B6SB 2JQAA 3NCMA 2YIHA 5G5DA 1AD9B 4U6YA 4ZMQA 1YC7A 3GM8A 4YBLC 4RGMB 5CILH 3SYCA 3E1F1 3FT9A 3IDIB 1BZEA 1WQVT 4QRBA 4XN1A 5LQBL 1K8DA 1KELH 2E7LC 4P4KA 4GAGL 5ID1A 5F70A 4BE5A 4IRSA 5E4IA 4GI8A 5DC4B 5CGTA 4DGUA 1OCRB 2GAZA 4G72B 4RFNC 4MJIB 2XNAA 2JI3A 4P06A 1QO3B 5TJWK 3FSZA 4NO5B 2B20A 4R97B 5E4AA 2D7PA 1AACA 3P30L 2FX9H 2XZAH 3ESMA 1H0DA 1OAXH 4Z7NE 4QJ3B 1VB9A 1CE1L 3QEHB 1NIFA 3HR5A 3N04A 1T04B 1BBDL 3V4VH 1NC2D 3WJLA 1FH5H 1HHHB 3H9HA 5E8EA 3UTTD 2X1WL 4JFFB 3MODH 2CIIA 3KJ6H 4OKDA 1D5RA 4IHBA 5FUOH 3SOBL 4Y1AA 2W0FA 3FC8A 3QS2A 1NBZB 1TQBB 2BVYA 4HYTB 3TIDB 1TJHL 2IPTH 1OCWL 4KZEL 3OAZK 1A65A 4TPRL 2BSDA 2ZKYA 4HPOL 4FTDA 2J6EA 2CLZB 1IAII 1F8TH 3ARSA 4ODVL 3OZKA 1CU4L 2FLBT 3VD9A 5DJZA 1WJ3A 2C4FU 4H8WC 5KZCB 4M7KH 1V55B 2ODHA 3QIBB 3UERA 4XX1G 1IGFH 2L04A 1JZIA 1J8SA 1R33A 3TONA 2ED9A 3QORB 1PTZA 2ZF8A 2FZ3B 3MV8B 3U6XS 1UM4L 3HI6L 2IC2A 4NO0D 4C59B 2J6WA 2PUQT 3W1ZA 1EEUA 2UZYA 5IBUB 4OGYL 3GC3A 4GIAA 1REIA 32C2B 3UABA 2F18A 1WCBA 4YIQA 5TE6H 3O3UN 2AXGA 2DLFH 2AEIT 2PO6D 1D5BA 1PMYA 5IJDC 3DJTA 1HWGB 1ZVSA 2NXYC 1HX0A 4UM9A 3UTOA 4O9HH 2FSEB 4R7DA 3MXWL 4TF4A 3CQFA 2IAMA 4IRZL 3KPQA 3TASA 1BQSA 1PEZA 1SDDB 4WW2A 3HFML 1DBBH 2GSGA 5A2JH 2W92A 3MRJB 3PWNA 2AK1H 1D7BA 1N9PA 4M8RA 5E2WH 3ZLQC 1U8HA 4J6IA 4PEEA 3AT8A 3CTTA 3BWAA 4CBZA 5DRWA 4IDLA 5E8NB 3QHFH 3MLRL 3ZHKA 4TTGA 2UXVA 2WINB 4TLUA 2J8UB 4YWGH 5LXVA 1EEYB 1MHHB 3ZKSD 4CVXB 4I0PC 2GY7B 1V3LA 2G75B 3GRBA 4JG9A 1CGVA 5HHMD 1UTDA 3UAAA 2EC8A 2JSFA 4DEWA 3U7WL 4DP9X 4PTTA 4LNVA 1XWVA 1A3LL 4JL2A 2JJVA 2YA1A 4IU2A 3FUMA 5EHFA 1C12B 3ZR5A 4HUCA 4JAMB 5IFHL 2P5EB 4W9JC 1B0RA 2LABA 2ZP0T 4Y1SA 2ZXEB 4K71C 2XY1A 3O6FC 1A0QL 1CTNA 5DD5H 3CFNA 4PJHF 4KTDH 4N8VG 3L3GA 5CZXD 1RVFH 2CBQA 1OTUD 1KYUA 2EECA 1IFRA 1NC2A 5L8LB 2AZUA 3T65B 3FH8A 3B3IB 4L8SC 2JH2A 3L48A 4KKQA 5DJ8B 2Q6WB 3GZKA 4U1NA 3U6RB 4UT7H 3TL5A 2ZUXA 3QI9A 4Q4EA 4UINL 3N3EA 3HS0A 4YMPA 4KTDL 5FX3A 3T09A 4WGVB 3WHXA 1DL7L 3FONB 4M7ZC 3UTSB 1MRCL 5JIIA 5I1AA 2GJZB 3FHAA 5F21B 1RCYA 2VDML 4FNTA 3RL2A 2C4FT 4GOSA 4WTWA 2J7LA 4U31A 4I18B 4K7FA 1EEYA 1BAWA 5ISZA 3LVEA 3VGFA 2ZOLB 1CXKA 5CM1A 2O6FA 2HLFC 1UM5H 3OQ3B 2A6KA 4J6RH 4ANVA 5F7UA 2DQ6A 3AREA 3LHAA 3LIZH 4LGPB 3T77A 5F1NA 4F15B 3BPNB 3N1GC 3TBCA 4F7MB 3FSAA 2NUTA 3TCLA 4ZFFB 4F37K 3TIEA 5EZJB 4PREB 1XAKA 2FVNA 4NQDE 1ZWIA 2P5PA 1JF6A 4I9WE 4RMUA 3PJSA 2HPTA 5KJRL 1CJYA 4NYLA 3ET9F 1LGVA 3TO4D 3C2SA 1OM3L 4FJZA 1YCSA 2OR7A 1KMGA 4S1RL 3BT0A 3U30C 3ZKMD 2IQ9L 1S3KL 1ZE3H 4JHBA 5I8KL 1NOLA 1EMTL 5DJDB 1R1CA 3FTUA 1ZTXH 1LD9B 2ZE0A 4L3ED 4M29A 2FGWH 3L5IA 1ZIBA 3NJGA 4MA3B 3WEXB 2RCSH 3QHZH 4JREC 4J5VA 2J8UA 5IVXA 3CFIC 1OLLA 5KG9A 4AG4L 1KCLA 4AQEB 3TBYB 1DVFD 1VFBB 2A9NH 4WWKB 4DHLA 3ARQA 5F7HA 2VXTL 1XEUA 3QIBA 2APFA 4XP9L 5D9SB 1MPAL 4G9FB 4NX0A 2QFRA 4C83B 2A0LC 4PJHE 5L4FA 2C3XA 4W1TA 4AEIH 4OF3A 1SLXA 4OI8A 4YGVB 4MQ7B 1QKZL 1FZOB 4XN5A 5LAXA 3IMWA 1F3JB 1IGYB 3D33A 1A6VH 1BZ9B 4XVSH 4LFHG 2LV4A 3EYQC 2QGCA 4U1HA 2BSEA 3MJ9H 1BVKA 4XX5A 1CQYA 5DJ2A 1U3HA 3ZE1E 2ZOUA 5DZPA 4X7FC 5D7JD 1T1WA 2AFNA 2APBA 4JFWA 5BS0A 3VB9A 1E7VA 1IE5A 1OSYA 4KK5C 3TJPA 4H8VA 2F7QA 3HUJF 4XNQA 2JQMA 2CK0L 4PY8I 4YQXH 3SOBH 3UC0H 4CU8A 1H8LA 1Q0YL 3MBWA 3LYRA 5FWRA 1SM3H 2XT1B 5JA9A 4AIZB 2HTKD 1I4FB 2OMNA 4H40A 4X50A 5GRUH 1SYSA 3LKQB 4Q2ZB 1TEFA 5LDUA 1Z9NA 4BK5C 5D2LF 3TPKA 4WI0A 1U8CB 3WJMB 1J88A 1KCKA 4MA1B 2QSVA 5E8PA 4AT6A 1OO2A 3B2VL 4YSSA 4ZFZB 1JK8A 3HZKA 2YUXA 4UCFA 1DBML 2BIPA 4OJAA 3OX8A 4Y2NA 4NKOA 2DH3A 1RMFH 3T3MF 1RZKC 4CGUB 2XETA 1Z9LA 1K8DB 2WLIB 1LO2L 3RL2B 5BV7C 1EANA 1UM5L 2NW2A 4U1MA 4AEHH 1H5BC 4RAVB 5CLXA 4CUCA 4RDQG 1CFSA 2Q3XA 4G8GE 3ZK0A 1T7VA 1D5MB 3PS6A 1EVUA 4OZHF 1PLAA 3H9SA 1KCBA 4Z95L 5FK9B 2F54E 4XCNB 5AOZA 4HQQL 5HYJA 2AW2A 1S7UA 3NZHL 1YUHB 5MEND 4M6ML 1WS7A 2PXYB 5EU3A 1MVFA 4DKAA 3PV7A 2NYZA 1T0NA 4HWBL 5IUCA 1J1OH 5JR1H 2FJGA 4MBRA 1JPTL 2FH6A 1F58L 3FB5A 3MCLH 4FI6A 4Z7VB 3KS0J 5T1KB 3QIBD 5HVHC 4POZD 4MASA 4ZZKA 2YMOA 3ARUA 1ULVA 4LKCB 3LB6C 2F8OA 2FDBP 1XD1A 3PGDA 5EU6D 3PP3K 1N19A 1PX3A 1AS8A 1LWRA 2B2XL 3NK4A 4XXWA 2BPBA 4TUJA 5I2IB 4RVBA 1G6RA 2N01B 2IIJA 1WRFA 1QZ1A 3UBXB 3D8MA 3FBQA 3OB0H 4YHOL 1E50A 2AV7A 1VZGA 1M7XA 1KGCD 4KU1A 2W94A 4KI5C 4QT5A 1XXFC 1P4BL 1JNJA 4WEMB 3OG4B 2XPGB 2I9TB 1E5UI 3QZOA 2A6DB 1FZJB 3O4LD 4TQ8A 3KBPA 5F1IB 4N2NA 3NP3A 4X9IA 1IIKA 3C5SA 3HMXH 2QMJA 4ZAKB 4EDXB 4QRTA 5KAQG 1T0OA 3U7YH 4Y4HB 3F7YB 3S8WA 4DQOH 4JQXC 4ODWB 4PJ5A 2P8LB 2Z91A 1Z0NA 4WAFA 3SKOA 3EYSH 3UJIH 1GZPB 1WDAA 3B9DA 4WTZA 4WV1B 3F5WA 3V9CA 2DPKA 2BZ7A 4HS3A 4EN2A 4JZJB 3UAJD 1QHOA 2GEQA 1XGQB 1SHWA 5FOJA 3LEYH 1EJOL 3X17A 2ZAHA 4P2RB 1IAIL 3C09B 2R2BB 1U4FA 1NGZA 4OZHB 1AP2B 1HQRA 3CN3A 3MMEB 5IHZB 1BECA 3EIFA 2VMEA 4P2YA 3SDDC 4P57A 1MG3C 1R3IL 3ZQWA 1OAXL 3ARDC 2OFQA 3LS5L 2FHFA 4NQEB 1IGFL 1NKRA 3I3DA 5DLMH 2C34A 3NCXA 1HHKB 5LNEA 3GZPA 4XNXL 2IOMA 1PLBA 3QEGL 2DWYA 1FBIL 2JK5B 1EH9A 5CGYC 1SMDA 4QHKI 4ZW7A 3S36X 5ESAA 2IPTL 4WWKA 3KVPA 4YHKL 3ULVH 2Y1AA 1FYTB 1JPSH 3LEXB 5AW1B 3N9GH 4I5BA 3V4LA 1WFJA 5FUOL 3P0GB 2YSTA 2R7EA 4JM2D 4ENED 5IESH 5JXED 2PO6A 1HQ4B 2E6QA 2NUPB 5FYJD 4J8QA 1XR9B 1ZANH 1ITCA 1KBGH 2XYBA 3PWVA 2X6AA 1RZKL 4LLUB 3VXQB 5DVOA 3DDFA 5AG9A 3PV6B 1XF4A 1MJ7L 4GIOA 4GW1A 1T6BX 2XNAB 4HUKB 4NSKA 5FYKU 5BQDA 4GKSB 5D6CA 5PCYA 4AX3A 3ZX1A 4PJ9D 2QHLA 2NX5D 4PV9B 4PLJD 1OTTD 4PJIF 3VH8B 5EUKB 2FEDC 5DMIH 3HBQA 4N1EA 5D1QC 1UURA 2JIXA 2VNCA 2NLJA 4U1GB 1NFDF 1L6PA 1S9XA 2FJFA 3NSJA 3ULUE 5C6TL 1S78C 3QDGA 3BZ4A 3GJFB 3TCTA 1SOKA 2GSMB 4A66A 3SDCB 3FT3A 3RKPA 3W11D 5BMFL 5I0YA 1TSHA 4OZIB 1F42A 2ZSWB 4DGIL 5FGBC 2VDPL 1M3JA 3Q5TA 5D2LA 3FK3A 5BNXD 3M1OA 1DVSA 1JFQL 3O9WD 4HQQH 3IM1A 2XBDA 7PAZA 3B2XA 4M8UA 3BP4A 3E3QC 4TS6A 4JFXA 3GS7A 2V37A 3V7AG 4C55A 5SV3A 2R69H 4K94L 4H26B 3ARDA 4P2OB 4AMKL 3FHEA 2VR9A 1IBZA 3IPEA 4WDIA 3ISWA 3Q2VA 3JWDC 4FF9A 4YDJB 2VLJD 2HX8A 3QJQB 2CBTA 4AL8L 1FZMA 2PCYA 3JV6B 1J8HB 2DQGH 1JZ2A 4R4ND 5DDHA 2GK0B 1SM3L 2EEBA 4PJXE 1P5UB 3NDZE 4H8QA 4GUPB 5D4HA 2AJ3A 4OJFL 5DA0B 1MHCB 5ADPL 1OPGL 4J12A 4IU2B 1AS6A 1ZVYA 2B3RA 1LEKA 4Z1PA 1A4CA 3U2SB 5SX5K 2IXQA 5LGHL 1ZHNB 2X4SB 2XZCH 5EF3A 4A2EA 1OB0A 1TYEB 5L6YL 3OPZL 1GYUA 1PIGA 43C9B 3WDHA 1DJSA 2DM2A 2NYKA 3SO3B 2IDUA 4UBDD 3U30B 1DDTA 2WXRA 3RWIB 4QTFA 3H3BC 4FJYA 1MEXL 1E0OB 4NKIL 4ONGL 2F8VA 1RV6X 3ZOAA 3KJ4B 1F4AA 4KQ4H 2NW3A 1ETB1 2FJUB 3WS3B 2WXIA 1TCMA 2XJLA 1X9QA 3S5LG 1ZA6A 3RDJA 3QDJD 4IRJD 4DP8X 3D18B 1DVUA 2YA2A 4MX7B 4GH7B 4A38A 1B0GA 1F41A 2PWFA 3DBSA 4MCYB 3FQTB 5DHVA 3VXMD 3UO8B 4HEPA 1OAKL 2QPSA 5GRVK 3WTUA 4KVCL 3PF2A 5DEFA 1QSFA 3WEMA 3QNFA 2LU7A 5EC2B 1HCYA 2R23A 1AZRA 1I1RA 4S11A 1OSZA 3CZKA 4QF1B 1IZJA 3D30A 4PJGA 3VI4F 4WO0A 5ES4B 1XGPA 3P4OB 4WK4B 1HXMB 3LZFH 4MXQD 4YSQA 2AEWA 3MCKA 1G0DA 4PJAA 3HC2A 3AT0A 1R9FA 3R4RA 4BFKA 4Z78A 1R24A 3NJXA 4I77L 4LHJB 4X9GA 5K39B 2ZUWA 2OMWA 3HAEH 5TPWL 5ICZB 5JXEC 5DJCA 4HKJB 4KKAC 1SJVA 4NENB 1S7TB 4P3DA 5E5RB 2CKBL 3AT9A 3CFKA 4KFMA 1AG0A 1YAZA 1I3RA 1TG8A 2P24A 1CDIA 1YJDL 5HYSA 4R5TA 1N18A 3MOQA 1S9WB 3WIAA 5LGJA 2EJ1A 1MAJA 3L2LA 4I2XB 4KHTH 3O2DL 3ZDYB 3FS9A 2VXVH 2XX1A 3EF7A 4GP4B 4IOSA 1GS7A 1XB3A 3WEOA 2KUTA 5I1GL 4V2CB 1UUNA 1AGFA 3IDJB 1NMBH 4L5FH 4YR6B 3KBHE 3LDBC 1IGYA 2J5LC 3BLBA 3UADA 1ZHLB 4K5MA 1L9RA 4A2GA 5IB4B 4U6VH 4LHUA 4QLWA 1JYNA 2K8MA 5DUPL 3WO4C 3RFZA 3D39B 4ZD3L 4I13B 4QYAA 3WIIL 3WXVH 4Y5XA 1A3RL 4UIMB 5T33L 4JM0A 5E1IA 3T0AA 1F56A 2VDLB 1AHWB 3MA7A 3EYQD 1KLGB 2F1BA 1DEEB 1S5IL 5GRZA 1EWHA 5GSVB 3IT8D 3VI4A 4JJ5B 3OKDA 4DKEL 3F7PC 3UTQB 3ENEA 4KXZI 4TNWK 4H0GA 1CFNB 1F1AA 1HCFX 5FO9B 2CU9A 3AU1B 4PJAB 3O3EB 1FWXA 1Q0EA 3CDFA 5C70A 3D4YA 3CZNA 2CDEB 3GUFA 4XOAA 2XVGA 1PDKB 4KZ0A 4X9YA 3DUUB 1A7RH 4M56A 4X9FA 3M86A 2BFGA 5ALCL 3D50A 2W65A 4BH8A 3IJEA 3B34A 2XRAH 2W07A 1Y7VA 2HLAA 1DHKA 1YEIH 4AYSA 3WEBA 3AXLA 4B97A 5KVGH 4FZEL 1PZ2A 1FSKB 5L0QC 2OQJA 4Z9KB 2VDPH 2FO4B 1S5HB 2NXZC 4LLYB 5DFVD 1HSBB 2BZDA 4EVNB 4XMZA 2FYVA 1BAFH 1Q9KB 4IKKA 2H2SD 4NPKA 4TMPA 2OMXB 1O7VA 5C07E 1YNTB 3JZYA 3PHSA 2R1YB 3H7BB 1CFVH 2ADGA 1SLVA 4LKXB 4DVBB 3FUFA 3SQBA 3TNNB 4WI9A 4UBDC 4YFLF 4NZTL 4M8VA 4E9QA 2GHZA 4QAWA 4ZFGL 5DJ2B 2R0WL 3S88H 1VENA 2YK1L 5IROC 2C7UB 2JJSA 2ADYA 3MV7B 4JQIA 5F3BB 2Z4TA 3SYOA 1NWPA 1IM9D 3OBAA 1F4YH 4E9YA 2V5TA 3HPJA 5KVMC 1Y6MR 2LFGA 1NOAA 5LCVA 1UGKA 1ADQL 1UVQA 4LVNB 1U8OB 4YBHA 1CE1H 1SHMA 2AJZB 3EHBC 2DLFL 1JNHB 3UYOD 3RIAK 1FAIL 1WCQA 3ML8A 3GXIA 3QH3A 4WV1C 4JN2A 5K69A 4ZPTB 3SKNB 1GGTA 4WFFE 3H9SE 4F5CE 3L3DA 4FXTA 1NEUA 4WVRA 4O2EB 4N1CA 4IS6B 4QHUA 5C9JA 3QDJE 4M93C 1E9PA 4E5XB 4K55A 3P0VL 4Z7WB 3WNKA 1NBCA 3F12B 2P48B 2C1PA 3D2UB 3K6IA 1YPZF 2DMGA 2MOGA 1PF3A 4N90D 2Z8VC 3OMAB 4RISH 5HVFB 5DZ9A 3MSPA 1DVFC 1PFCA 3MRDA 2Q20A 3RQ3A 3NFSH 4LXFA 2D7MA 4TL4A 5A16A 3PJSB 5L4IA 5HHNA 4K5NA 5SV4A 3MRMA 5DO2D 3NZ8B 1CF1A 5E8PB 4X5XA 2BMKA 5AALA 4AQ1A 1GJIA 4FKEA 4CAGA 3L7FB 5CP7B 1J1XH 4LPXA 4XN8A 1E3XA 2GSGB 3O6FA 3ZT7A 2JNZA 3VG9B 4OGYH 4ODTH 1UXMA 3E2HB 3EZJB 5EULV 3SPIA 1G1CA 1T1ZA 3D25B 2ZPKH 2BHFA 1OGTA 5T5FH 2VLJE 3ILQC 5BV7L 1TZHA 3CLWA 3NCEB 1JNNL 3SKMB 3NCJL 3VFMB 2FX9L 2LU3A 1RZJC 2KERA 2YHGA 1MJUL 3WE6A 2IPUK 4APQA 1I8AA 3SGJA 5C97A 2CMRL 4AGPA 3NK3A 3PP3H 1W0WB 5IB1A 2VDQH 4NJAH 4J2XA 2K7PA 2CHWA 3WKNA 4AUYA 2YWZA 4U6VL 5KVGL 2OW6A 4X98B 1KELL 4XP5H 3CVDA 2LU4A 1X5HA 1TLMA 4YHOH 5D1QB 5FECB 2YXVA 4LDLB 1TJHH 3O45A 2A0LD 2R1XB 1NCBH 2VZUA 4DF9A 4N2EA 5IY5B 5J1TC 2E9WA 2DTMH 3MRCB 3RLSA 5GRJL 4HUUB 3I9PA 4IOIA 3D9AH 4G6JH 1PYWA 5KSAC 1BF8A 3HUJB 4MMZB 4Y5YA 4J8RA 1WA0X 4AEHL 1N4XH 3BDBA 2EILB 3V4UL 2ZCKL 4UMGA 1QYGH 3GI8L 3S8GB 4PCYA 4EI5B 2WZAA 1P2CB 5GS1C 2JJUA 1UA6H 4XH2A 4JKPL 8FABA 1HXMA 1AQMA 1Y1DA 3TFKC 2BWDA 3OXSB 1F4XL 1KN2L 1A1OA 1TJIL 2QFPA 1C5DB 2XZZA 2J12B 2NY6B 2G30A 2OXHA 5IG7B 1FCCA 3OXRA 3QO1A 4JQVA 3RNQB 1PEWA 3VO0A 4FXKB 5E70A 2IPKB 5IVZB 2YRZA 1GR7A 5TH2A 3TVMD 5MEPA 1I1CA 4OT1L 1ESOA 1HSBA 4OV6F 3DHPA 5KVDE 4ZFOB 2YPLA 3PU7A 1VFAA 3EJPA 2UWEE 4G6FD 1OAUH 2VO8A 4IBVA 4JVUA 2X4RB 3FRPB 5EIVA 4RDBA 3V5DB 2VDQB 4C4KT 1DZBA 4QNPF 4NM8L 3TA3C 3PIQB 5EBWA 3X1NA 4PRPA 1G7HA 3D3VE 1KNOA 1NTDA 4NHCH 3BESR 3GKWH 2OJ1A 4UQAA 1RULL 5AW9B 4DKFL 3VTMA 4TVSa 4XCYB 3HI1B 2OSLB 3RWDB 4OT1H 3CNKA 4Q52A 3S35H 4NRXB 1J10A 3QYNA 1VPOL 1DANT 4JY5H 3TEYA 1OWWA 2MPAL 2CK0H 4YQXL 5MHSD 3CXHJ 2LFEA 3NIDE 3HBPA 1ZTXL 5D7LB 2L4OA 4YL4A 2CSPA 1CYGA 4B0MB 3DOHA 1LLAA 2ESVA 4P4KC 1A7OL 2E9GA