3LS5H

Anti-tetrahydrocannabinol fab fragment, free form
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
219
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFTFNNYVMVWLRQTPEKRLEWVASISRGGSTYYPDSVKGRFTISRDNARNILYLQMSSLRSEDTAMYYCVRGTTIVAGDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Light chain of antibody Fab fragment
publication title A structural insight into the molecular recognition of a (-)-Delta9-tetrahydrocannabinol and the development of a sensitive, one-step, homogeneous immunocomplex-based assay for its detection
pubmed doi rcsb
source organism Mus musculus
total genus 45
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2010-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ls5H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ls5H01
3FAWA 4XCNB 1AHWC 4HBQA 4ZS6D 1NPUA 2IAMA 4Z8FH 3N1GC 5F89B 3QFDA 4OM1H 1BOGB 4NQDD 5HYQB 2AEQL 3NPSB 1F42A 1DEEB 4PJDB 3B9EA 1UGNA 2CLRB 4OD2A 4Y5VB 1CN4A 5KSAC 3U7WL 1MNUH 1T1WA 1FN4A 1RURH 3CX5K 2VDLL 4I2XA 5I1EH 5HD8C 3PGCA 2IGFL 5JW4Q 1H3PL 5DS8A 4S11A 3QPXH 3H42L 3EZJB 1MSPA 2XWTA 1SBBA 3DYPA 4PGDA 3B9KC 4XBEL 5GGUB 4LVOB 2CIIA 4ALAH 4KFZC 2VXTH 1AQDB 1X5JA 1IBGH 4JM4H 4P0DA 2KBGA 2HFGH 3RL2A 1J0ZA 4QGYA 1Q0XL 1NEUA 2XA8L 1GHFH 3QEQB 4K7PX 1XGQB 3MLYH 2I5YH 2FHCA 4O58L 2JCCE 3BYTA 5K9JL 3W0WA 4JGJA 4KUZL 3KJ4B 1R0AL 1NAMA 3HMXA 3O4LE 4MJIB 3EOTL 5KVDL 4YK4B 5GQBA 3UTPE 4KUCD 5CEYB 1VPOL 3SE8L 5H94A 4RZCB 1M05B 5KVMC 4I18B 4M5YH 4WDIB 1IAOB 1OAKH 4QXGH 1TTFA 4E9LA 2NY3B 3DYOA 5I19L 2HFEA 2ARJA 4CDGC 3FKUS 5C3LD 2LV4A 4CMMB 4LLWB 3OXSB 1WISA 1T0NB 4GS7B 5BS0B 3I6LE 5TQ2L 3LEXB 4G9FE 5DQJB 4AMKH 2Z31B 2AJYH 4HG4J 5E2TH 5EZOH 3BKJL 1MRDL 2VLLB 3UJJL 2IPUG 4OQ1A 3GRWL 3DI2B 5KSBB 2F8XC 4AIOA 3MOQA 3DETD 3O6FB 5EZJB 3BEWB 2XTJD 4F8TA 4YHML 1ZT1A 1X5YA 3CFBB 1NLBL 1JYWA 5IR1B 4XTRD 3P73B 1DZBA 2DMCA 4PV8B 5ETUB 1UWXK 1C5BH 1I3RA 5IT2H 5KSVB 2PO6D 4PJGA 5JW3L 4K7PL 5BV7L 5BQ7B 5BVPL 4GG6E 1ZMYA 3PWPD 4ISVB 3FT2B 1FNEA 4YXKL 5T1MA 4Q9BA 4ZSOE 4MXWL 5E0QA 4ODXA 2X9WA 3HZYB 1OWRM 3ZKMD 3DMMD 3RWJA 3QG6A 3OR6B 2WM0A 1QYGH 2AXHA 1HZHL 4E41A 3VD3A 4H25B 5HYSA 4PBXA 3V5HA 4DKDC 4JHWL 2YZ1A 1U3HD 3SGEH 3MGAA 1RK0B 5AG9A 3IS0X 5I1IL 5HDQL 1K6QH 3ARRA 3F7VB 1RK1A 3ARTA 2XG4A 5JHLH 4MNHB 2FBJH 2IPKB 4OGYH 3I85A 3X3GL 4ERSH 1AR2A 4QOKE 4W6WB 4MAUH 3VXTB 3PWLA 4CKVX 2IPTL 4KROB 1A4JB 4YXLL 5ITFA 3B3IA 4C56D 1AFVL 4C58B 3DO7B 3PL6C 3B6SB 4LHUA 1FO0B 4KK9C 1U8NA 1VA9A 4IOIB 4JRXA 5I17B 1YDPA 2ADIB 5JW4R 3BZFB 3FMGL 1NAKH 4IRSB 2D4FA 2HFTA 3MRQB 4R97B 4U1KA 2AABL 5D4QA 1CK0H 4PPTA 5CP3A 4LDEB 4K3DL 4XB7A 1JN6A 2A74B 3K4ZA 1WAAE 3AFLA 3C2AL 3FQUB 1BZ9B 4OZ4B 3NCBB 4NN6B 5F1OB 5JW4N 4X83A 1HWHB 3JV6B 3PG2A 3EYFA 5J3HC 3CJJA 1JGUH 4L4VE 1LD9B 1SJHA 5C0EB 2IMMA 4HS8H 4YHZL 3IXAA 5CMAA 4WY7H 6FABL 5M95B 1PY9A 5LBSL 3V5KA 4OZFB 4L9DA 3UX9B 1AI1H 5SV4A 3TJEL 1K85A 4MVBC 3MV9B 2JF1A 1QSVA 5D71L 3V4PH 4LQFH 4PIRF 2F15A 5AYUH 3AMKA 2VLJA 3TPKA 5L2KD 4DCQA 4M61B 4ORGA 1YMMA 2ZSWA 4F2MB 3T0XA 1MIML 2YEZA 3VFVA 3N9GL 1Q9LA 2K3TA 3X13A 3UTOA 1FLRL 3CMOH 1IQWL 1NLDL 1I3GL 1REIA 4N1EA 4TNVF 2BNQB 3UCRA 1IC5H 1AP2B 3MRBB 2XKSA 5T1LD 2NZ9D 3ECBB 4OZIF 1B3JA 5A2FA 3RAJH 4EN3A 1IGFH 3GFUA 3BKMH 1A2YA 1S5IH 3M8OL 3UDWA 5CGMA 1H5BC 4GKSA 4X6EA 4L4TA 4LLVA 4X8JB 3L3HB 1U2CA 4R8WH 4Y1AB 5H2BA 1A6WH 2ZG2A 4KTEL 1VEPA 1UC6A 1X5KA 2FH6A 5DD5H 4V1DA 4Z7VB 2J88L 4GRLB 3TBVA 4PG9A 1KN4L 1AGDA 4I4WB 2EDEA 2BXYA 4DGYL 3WHE1 5JQHC 1U92A 1CXEA 2D0FA 4J1UA 1WLHA 2YS4A 1IKNA 1A9BB 3WN5B 2QADD 3VW3H 4DGVL 2J8UB 4TTDD 5IHUH 4ELMA 3PE9A 2X1QA 5IOPB 5MHSE 5SV3A 3MNZB 3LQZB 4HH8A 1T4KB 1FZOB 3WFBH 5D1ZD 3NTCL 3SE4A 2VUOA 3C6LB 3GGWB 2GHWB 3G6DL 4JGUA 3CD4A 1J8HA 2CKNA 4RIRA 4X80H 5SWZB 1MAML 3WHXA 1NC4A 3T77B 4N90E 3MV8D 3O4OB 4KZEH 1F6AB 1UZ6F 3V52L 1ZVYA 5H37G 5HHOD 5I1HH 2HJFA 4XRCB 3DV4B 4GAFB 3ZDYF 1QLEL 4X7FC 3ZHKA 1FVEA 1XF3B 2CUMA 5D2LB 1A5FH 3P0VL 1JV5B 3BGAA 3JWOL 1F6FB 1KPUA 1S8DA 1AGFB 4M6NH 4V2CB 4QHUB 3W5MA 4HD9A 4OLWH 1ZHBA 2MQ3A 1IGML 3C5SB 1BWWA 3TYFB 3DRTB 3F65A 3RWHA 4G8IA 4MDIB 1YC7A 2DQTH 4C54A 4P23B 4P2CG 4LCIH 3HG1D 2R0ZL 1CR9L 3L3OB 4ZODA 1KIRB 1P2CB 3EFDH 2MJWA 3PV6B 1UA6H 1OD7A 2XIDA 4KMLB 5C0DB 2Q20A 2QR0B 3BZDA 1HKFA 4WW1B 1S78C 4Q6IC 4JY6B 3VRJA 4YHIA 3R0NA 1D5ZA 4P3CL 2VH5H 3FQXA 2CK0H 4R0LA 4XAKD 4OLEA 3JWDH 4ODSH 3AAZB 5T1KB 1GAFH 2HT3C 2B4CC 5C09A 2IQ9H 1N64L 5HPOA 4AT6B 1UKSA 1MIEH 4FZ8L 2ICWB 1A7NL 1KIQA 2F5BH 2SEBB 4JZJB 1Z5LA 1RMFH 1MJ8H 5F6IC 4MA1C 1IFHH 3S36H 2UUDH 5E2UH 1FP5A 1MI5B 3O6ML 1G6RH 1VADB 2H26B 2Y07H 3LRSA 4HFUL 3CDGB 5DC0A 4PJ7F 3RGHA 3MR9A 1F11A 3U1SH 4X6CE 2C1PB 3DX8B 1LDPL 1J7VR 4QTIH 2XXCB 3HUJB 4R4BA 6CGTA 1I1AA 5IESH 1Z9OA 2PW1A 4GRWH 5KS9B 1OY3B 5C0CB 3ULUD 2A0LC 3Q6GH 1SYVB 5A2KH 4PRDA 4PJ9D 4UTAH 2NX5E 3HR6A 5BZWA 1UB5B 3VXUA 5HYJB 3HR5B 1Z9LA 1A6AB 4K71C 3TV3H 4LCUA 5JOFB 5DI8B 5IHBA 3TYGL 3ZHDA 1P7KB 3TLRA 4ODHH 3BKCL 3QUYA 2DYPA 4I13B 2CK2A 1KG0A 2XZQL 4KVNL 4U1MB 4Z0BL 3VGFA 3MLTB 3FAXA 1U91A 5F7NC 2Z8SA 1A7RH 5F7UA 1RZ7L 3BE1L 3MLRH 3NIDE 8CGTA 4PJXA 2O5XH 1GOGA 1D5IH 3LPWA 4FQQB 4P3DA 3VCLB 2EYTA 1GGTA 3TO4B 2HA1A 3WV0A 2JTDA 2AEQH 4G7VH 3BWUC 4OZHA 5IIEA 3KS0H 3MBEA 4BH8B 4JM2A 5DFVD 1Y6MR 5FO9B 2VDLH 5D7KE 2IGFH 4P4KA 1H3PH 3DTXB 3IU3B 3RZCC 2WP3O 3MRMA 1YJDC 4PR5B 3H42H 1Z9SA 2DQFB 4Y5YA 2H32B 4XBEH 2P5EA 3IJYA 3UMTA 5ESAB 2NY6D 1XR8A 2VYRE 1Q0XH 3TN0D 4WUUB 3BEVB 1BHGA 5A43C 2A9NL 2XA8H 1ZLUH 5E6IB 1LQSR 3GMRA 2YKLL 5CLWA 3ULVD 3B5TA 3FB6A 4NCDA 4WEBH 5E08L 4XNYL 4JFPB 4O58H 2CRMA 3BGMB 2VQTA 4KUZH 4Y4KC 1R0AH 2A73B 3EOTH 5GIRB 1XGYL 5KVDH 3RDTB 3GBML 5D7JC 1RVFL 1VPOH 2DBJA 3SE8H 4E42A 1QZ1A 1DQQA 5IFAL 1DSFL 3V0VB 3F7YB 2PTTB 2OCFD 1NBYA 5ERWA 2NY2C 5FO7A 2BFVL 5LJYH 3JZ7A 1JWUB 5I19H 5IVZB 1ONQB 4WTZG 2HH0L 1Q8MA 3QEQD 4NUGL 5TQ2H 4LBEA 1IMHC 1NMBL 4PJ8D 3MCLL 4L29A 2VLRD 5F9WC 2A83B 2YA0A 3WSQL 3C60C 5TPWL 4LASL 4YZFE 3BKJH 1MRDH 1RZGA 4NKQB 4OF8A 5EOTA 3UJJH 2DQCL 5EUKB 1E4XL 3GRWH 3AY4A 4N9GA 1FYTB 1NJ9B 3QIUC 4PJCF 1OSZB 4YHMH 3S4SA 1NLBH 3SE9L 4BUGA 2ID5A 1T6VN 2WLYA 2JKXA 4H8WC 4U05A 4APQA 3DUUA 3G5YA 4OUUA 3LSOA 2CKBL 3UTQB 4ZNEA 4L8CA 1WF5A 5I1CL 5JW3H 4K7PH 2NY3D 2A6IA 4MMZC 5BV7H 5BVPH 4EI5C 4YXKH 4D0CA 4HZAA 4MXWH 4UTBL 1YPZE 2FJGA 3D3VB 3T2QA 5FA4B 2FD6L 2I25N 3H7BB 4F7PA 2QSQA 1IAIL 3D0VA 3PWVA 1HZHH 1PG7W 4Y2DB 3BWAB 4G6KL 5DJZA 3ZKXC 2FR4B 1I3VA 3I75B 2RBLA 2UY7A 4PJEA 1EMTL 5JHDB 1B0RB 4JHWH 1QSZA 3OKMB 4Y7MA 5DA0B 4ODVL 5ID0B 4JRYB 3RY6C 2VQUA 1HI6B 4Y16B 4F7MA 5B38B 2R1XA 1EERB 4QRRA 5C2UB 2VDNL 5I1IH 1S9WA 3KPPA 1QEWA 5HDQH 2PN5A 3UO1L 4I2XB 3L3JA 5GGTL 4ZPVA 3WJJC 1CD1A 3X3GH 1FL3A 3R8QA 1AQKL 2R1WA 3QO1B 5DS8B 3VG9B 2LVCA 3O3AA 2AXFA 4GSDL 4POYA 3TVMD 2XWTB 4JQVA 2IPTH 4LLUB 2ZNWA 1KN2L 4YXLH 3EGSA 4LLMB 3D69A 1YNKL 1AFVH 1PKQA 1OTUC 5CWSB 3RL2B 4YX2L 3OKDA 3OG4B 4ORZC 1T20B 1S7WB 3H9SE 5DJYB 3MRRB 4KTDL 3SGDI 3WXVL 2DLHA 3O45B 3O8XC 4OAWA 3FMGH 4BKLA 2JELL 3VXSE 2AABH 3W0WB 4H0HB 5GS3A 2AXGA 1BGXL 3SJVE 3TNNA 1TTUA 4GRWF 3H0TA 4K3DH 4L8DA 1J0JA 4L8SB 1EHXA 4OZGF 5H94B 4CW1A 2DI8A 3U2SB 3KYNB 5B4MD 1LP9A 4IEFB 2ZZUT 3FT4B 3KPOB 5HHVL 3LKPB 3Q5TA 4KROD 4H20L 1QFWI 3OKEA 1T1ZA 4HH9A 4HLZG 3M1BA 4LCWA 5H37H 3VXME 3WIFB 5MEQA 5CFHA 4U1JB 1IZJA 4ZXBC 4DUWA 3NBNA 4YHZH 2VZSA 4GG8B 4XAWL 4YHYB 6FABH 4MD5A 5LBSH 3FQWB 5EO9B 1R3JA 5FF6B 2WINA 1IEBB 4FRWA 2CRIA 2RFXB 2R2BA 3EDKA 3IJHB 4EOWL 4LDOB 2ZUWA 5D71H 1S5HA 1GOFA 1TVBB 4MJ6A 5I9QB 3DOSA 3QFJD 5D93B 1QQDA 4JCMA 5DJ0A 2Z4QA 1CDIA 4KJYA 5B3NA 1LGVA 1MIMH 2GCYA 3N9GH 3SOBL 2X4RA 1FLRH 5DEZA 1NLDH 1TCRA 1I3GH 3BPLB 2DM4A 1DL7L 3GSXB 3BPOB 1YECH 3LN5B 4LIQE 3M8OH 5E99H 4ENED 1MWAL 5J8OA 4JPKL 4NM8L 4U6YB 1FZMA 5JDJA 3RNKA 1QPXA 4KTEH 4NDMB 4UQ2B 3NVQA 3RRQA 4QHLB 3OL2A 2J88H 1FHGA 5C0FB 1EFXD 4LPTA 1KN4H 3MUZ1 2HN7B 2J6EA 1QFOA 5EOQL 4DGYH 3TIEA 1UB6A 3KYMA 1V7NH 4E41B 1HDMB 3F7PC 4NKDA 3PWUA 2VZ1A 5DYOB 2BDNL 4DGVH 3HLAA 1U8OB 3E2HB 3FB5A 1J87A 2C3VB 3QP3A 3P4NB 5MEPA 1AGCA 2X89A 1OAXL 4Q0XL 1JRHI 3VXQB 1DBJL 5DF0A 1FAIL 5D5MB 2E9JA 1LEKA 5DMYA 4M8VA 2E7HA 4X5WA 1MAMH 3UTSA 2VZOA 3KWWB 1NEZA 4X0KB 5FUCC 2XWBA 3V52H 1NFDE 3FB7B 3BP7A 3RKDC 1QLEH 3WUZA 3MMEB 4QHNB 3ABZA 4XP4L 4YUEL 3V5DB 4MDJA 2ZG1A 5ADPL 1ZEAL 5LXGL 5AZEL 1QR1B 3P0VH 4D9QD 4P2QA 3U83A 3QWOA 4JFQB 3JWOH 4U0QB 4UT9L 1KEGL 4E5XB 1IGMH 4U1KB 2X70B 3H9ZA 5DVMA 4AQOA 1HOCB 4ODWA 1MCKA 5D7LA 1RZ8A 3SCMD 2ERJB 1CVRA 1A6UL 4PRPA 5TE6L 1KYOJ 2GJ6B 4GOSA 1IEHA 5GRVK 3UAJC 4LOUD 4Z7UE 2ARJQ 4KKAC 3LOWA 2UWEE 2VISA 4IDJL 2X4UA 4X5LA 4LHQB 3E6HA 4BQ6A 3VXNA 5E1AA 3DVGB 2VIRA 4P3CH 1M7DB 2W9EH 1VENA 3QRFM 1C12B 4MS8D 3I3DA 3ARBB 5E9DA 1SJHB 3SGDH 5JA8B 1HHHB 1H15B 4HULB 4LLDB 4QXTA 3V6BR 5TDOA 5DJ6B 4KUCF 3C5JA 4G6AD 1SYSA 4WU7A 4FZ8H 1UYWL 1A7NH 1CLYL 1PBYA 4RWHA 1PGRB 4P5KA 2EDKA 2XRAL 3RIAF 3WLWD 3O6MH 2KQNA 2ZSWB 4OBSA 2EEDA 3QUXD 3TA3D 1LDPH 1R5VA 2CDEA 2NNAA 3CFJA 4KV5E 3KLHC 4KC3B 4HWBA 5GSRA 1Z0NA 3CXHK 3Q5OA 1U8IA 4J4PC 4XVTL 1BJ1J 1BD2E 1P5VA 3KHQA 4GKSB 3VWKD 1QSEE 3QDGE 1JZ7A 4HUMB 4IIQB 5H2BB 3CIQA 2ED8A 4LCYB 3QWRD 3TYGH 1ZVSB 3BKCH 1AO7D 3RJDA 4GKOA 3SDXF 2XZQH 2W65B 4KVNH 4V1DB 4Z0BH 2J3SA 4OTXL 1RZ7H 2DWEA 3CUPA 3IJSA 1ADQL 5BCAA 4HJGA 4NCC2 5EU7E 3T2OA 1XH3A 4J1UB 1YEJL 4LF3A 4ZO6A 2BERA 2UVEA 1QLRA 3GIVB 3KLDA 2IWGA 4PTUB 5C9JA 1LILA 1U95A 5C0CD 2IH1B 3O41B 1YMHA 2PXYC 1MH5A 3OG6B 3SDAB 4YHKL 4XMLL 3L3KA 1U8JB 4G9DA 1ZGLA 5HTSA 4Y19D 4YPJA 5GGRA 5KAQG 3VFOB 4I9WE 3C5ZD 4KTYA 1OGAA 2G2RB 4W6XB 4P2OD 3O2DA 4FXLA 4JDVB 2A9NH 3WFCL 4LDLB 3TZVD 5T1DL 3IDJB 1S8DB 2YKLH 1QFUL 3DX9B 5AEAA 3TBSA 1WFNA 4NQVB 5E08H 4XNYH 3QIBB 4ZOEA 3TO4D 2F54D 5IVXE 5SWSA 3EAKA 1DQLL 4XZUA 3ZYJA 3P9LA 2P42B 1X5IA 4MNGA 1XGYH 5DEGB 3MJ9L 3MJ8B 3GBMH 1RVFH 5GGVY 1KCLA 3PHOA 5IFAH 1DSFH 3HCVA 5HHNA 4H26A 2NZIA 3GK8L 3MX0A 5EU5B 5HGGS 4F37K 3AU1A 3VRJB 4YAQA 3QDMA 1F58L 1U36A 5BOZG 4HDIA 4HUWA 2BFVH 4P2YA 3MRDA 5ITBL 5F7HA 3OPZL 4HKBA 2HFFA 4KJWC 4OCYL 3U0WL 5J12B 2HH0H 3I3EA 1N4XL 3WLBA 1EEUA 4NUGH 1NMBH 2XQYG 4HJ0D 4LP4A 3MCLH 5FECA 5B8CC 4TN9A 3RGVD 2P5WE 4EVNA 1Z5LB 3WSQH 4MSWA 2GKIA 5TPWH 4LASH 3JWDC 3A67L 2IALA 1E4XH 3GMQA 1L4IA 3FONB 1AR1D 4OM0L 3TT3L 1ZSDB 2NY5L 4Z7WB 3SE9H 3QUKB 3QQ4A 2O5ZL 5JXEC 2E8YA 2QQKL 2QJDA 3RI5F 2CKBH 4LCUB 4X4XB 5I1CH 1PLGL 3PGFL 4XVSH 5EUOF 3QUYB 4HLZH 4RGNE 4KZDL 4UTBH 4F3FB 3STLA 5MENA 3U30C 3QIWB 2FD6H 4JO1L 1BOYA 3B9DA 1IAIH 3LQMA 3QI9B 1BX2B 4HUVB 1U42A 4G6KH 2R0LL 35C8L 1T1YA 2AK4E 4AEIL 4PRBB 4P3DB 1IEAA 1I7ZB 4RQQB 4PJIB 5IFJA 1FYTD 3K46A 3MLSL 1EMTH 2D4DA 4NC2B 4Z7QF 2WP3T 2X4QA 2DM7A 4ODVH 4I0PD 5FDWA 1JI2A 4OZHB 5D6CA 3G5XB 5C71A 4JANB 2VDNH 4OIAA 4ZAKC 1GC1L 5IHZB 3UO1H 5ACZB 4HIIB 5GGTH 4ETYA 3RTQB 1AQKH 3OX8A 1KBGL 4HLJA 4GSDH 1T5XA 4L5FH 1C08A 3O6KL 2P45B 3GJFH 4HS3A 3VJ6B 4JO3L 1RHFA 1KN2H 4JFEB 3U46A 3BT2L 1YNKH 5F9AC 4KK6D 1XGUB 2R39A 3KJ6L 4YX2H 2ZOKB 1FRGL 4KTDH 5J6HB 5CD5C 1QPPA 3WXVH 5CGTA 4RAUB 2IAMD 4FHBD 1EX0A 2JELH 2I60L 5IROA 3IF1A 5F93C 1MFBL 3O9WA 3KXFB 1A6PA 4P46A 1BGXH 4X6DF 1W72A 3QEHA 2JK5B 2FEEL 4L1HA 3UTTE 3D18A 1ND0A 3PNWB 1ZGLM 4KJQC 1N7ML 5KANG 2IFFL 1RV6X 5DTFA 1GCFA 5D2NE 4GBXD 4X99A 1PSKL 1XZ0A 3KPNA 4JFYB 2ZCLL 5ERWB 2X05A 5HHVH 1MCJA 2ZG3A 5FO7B 5GGRY 4H20H 1T04A 4UNTA 1QSFB 1H3UA 1NSNL 3IRZA 4RFNC 1IGTA 1KB5B 4NQDE 3JTTB 4PJFA 4GFTB 4KQ4L 1UM5L 1WCBA 4XAWH 4U6TA 3FO0L 3KNBB 2Y25A 2HT4D 2C7UA 5TQ0L 1TXKA 4YFLI 2GAZB 5MP6L 3VI3F 4EOWH 5I18L 2X4OA 1WICA 1FZKB 4MQXD 1T0MA 4M7KL 5EOTB 4CJ1A 3W0WD 4E0RA 1DE4A 3VFWA 3KLAB 3BIKA 2DBLL 4TUOB 2EXYD 1NQBA 2HTLD 5HDLA 4MCYA 1AHWB 4KQ3L 2VLME 4YR6B 3SOBH 3CSGA 5JPMA 3IAPA 1HK6A 1EIBA 1F4WL 5J57B 4J6RH 1DL7H 4PJHE 1P7QA 4I1NB 1WZMA 4K94L 1K3IA 1ACYL 1MWAH 2X1XR 5KSAB 4JPKH 5E8NA 4PJAA 4NM8H 4AY0A 4L8CB 2BVEA 1L9NA 5EU6B 3T04D 3EO1A 1CT8A 3OKKA 5ACLA 2FJGB 2IMNA 4GKNB 3B9KB 1INDL 3MUY1 3OAZH 3ULUF 1DDHA 5J56B 1M4KA 2G9HB 3B8YA 1RD6A 5BV7C 3MV7A 5INDB 4PJEB 2BDNH 4KMTL 5E1HB 5E8DL 2YPLE 3O8XA 4WRLA 3G5ZA 1B90A 4Z77A 5HGAA 1OAXH 4Q0XH 2PYEA 5ICYA 2WW8A 1DBJH 4GW1A 1FAIH 2B7DT 2WK2A 1RJZB 4YXHH 2MCG1 5AYQA 1K4DB 3GSWB 1S7QB 4KI5D 4LCCC 2VAAB 1EUTA 2HRLA 4HKXB 1RPQA 1T89C 2J7LA 3D69B 3QNZB 1J12A 1NAML 3HMXL 4XP4H 4YUEH 3TPUA 1I7RB 5ADPH 4JFHD 1ZEAH 1MFAL 4LPXA 5LXGH 5AZEH 2AKRB 2EDYA 3FCTA 5BVJB 2W38A 4E41D 5EO0A 4OAWB 4CVZB 2FX8L 4ESKA 3SDYL 1YNLL 4UT9H 4Y0GA 1KEGH 4NNPL 2JIXA 3L1OL 4DZBB 3BO8B 3QEGL 4TVSa 3V6ZB 1A6UH 5GRZA 3TNNB 4Z78A 5TE6H 5A1AA 3CFEA 3FB8B 2GJZB 2XTJC 5FOBB 3HAEB 4CW1B 1H3WM 1KXVC 4PJBF 4NRZB 1CVSC 1U8LA 3EIFA 1BFOB 4IDJH 3GSOB 5EIVA 3BPCB 3Q1SL 5I1GL 4OLYL 2PO6C 3IXTB 2B1AL 1G7IB 2QLVB 3M1BB 5MEQB 2APWA 5SX5K 4JZNA 1S9XA 4LHUD 3SPVA 3UBXB 3PV7A 3ZKMC 2XA3A 3DMMC 4JRXD 4RNRB 2WINB 2V6HA 5F72S 1L6ZA 5BW7A 1IT9L 4LMQE 2R2BB 1UYWH 1EZVY 1CLYH 3RWEA 2E9IA 4MA8L 5CZVL 1BVKB 1QQDB 3N50A 1FL6A 5GS0D 2IJ0C 3F6IA 3VG0L 4DFHA 1ES0B 3RWIB 5C08B 4B50A 1TIUA 4ELKA 1JWMB 1TCRB 4BSWB 1JPFA 4LGPB 4KRNA 3ZT5A 2ZUYA 4Z76A 4GLRH 3PHSA 1ROWA 4PRIA 3ARWA 3QXAA 3L7FA 1UVQA 4XVTH 3H9HA 1L0QA 5D7IF 2VL5B 1TQCC 3QA3B 1BREA 3QUZA 1BFTA 3RNKB 1EK3A 4YEEA 2D31A 5DHVB 4JDZA 4MNQB 3RVXC 5C86A 1QVOB 1RJLA 3OKLB 1XGTB 3EZ8A 4OTXH 3RWCB 3G08B 1RJCA 1ADQH 1X4ZA 2AQ3A 5C0AB 3PL6B 1QRNA 3TIEB 1ZWIA 1YEJH 1HILA 5JOPE 2VLJD 3S7GA 3VFPB 3OF6A 1YMMD 4W4NA 3T09A 1MHHB 4PRHA 3RX5A 3PDDA 3FB5B 3FN9A 4HUXA 1N59B 2HLAB 1GIGL 2VUYA 1ED3B 3OHXA 1B9ZA 4XT1C 4YHKH 4XMLH 4EBQL 4EN3D 1I8LA 3U4AA 2FEEI 5KSUB 2A6JA 3GSNL 4L4TD 1SHMA 4OT1L 2XWBB 2DLIA 5C0BA 1HSAA 5L2KE 5DUML 3KVQA 4V1DD 4BQ8A 1CG9B 2W07A 3DHMA 3HE6A 1TVHA 2B2XL 4UOJA 3PXHA 2ATPA 5FYLD 5FM4A 3L3IB 3FQTA 3WFCH 1KGCD 2ILLA 1YUHB 4KKNA 3QWOB 5T1DH 3QUML 5J89A 1QFUH 1I8IA 5HPMB 4XXCC 5EORL 4G8GE 5CILL 1MJ7H 2V2TA 3ZMRA 3EFFA 1KPVB 3VH8A 3FHQA 2P8LA 1S9VB 4O2CB 1DQLH 1RZ8B 3QULB 4PRPB 5L2JB 1IZKA 5HGDA 5IB1B 3MFFA 5CP7B 4WWKA 3MJ9H 4G80A 5ICZB 1JTOA 3JWOC 4XCEB 2PUQT 1J8HD 2NZ9C 5F3BB 3G6AA 3MRIA 5TE7L 1S7UB 3GK8H 1NC4D 5GRYA 3AXLA 3K81A 1F58H 5HYSG 2DWDA 4JFDA 4TNVK 3RBGA 5BXFA 5ITBH 4K3EL 4A6YB 3B43A 3OPZH 4J4PA 1H5BB 4N8PA 4TNWF 4ZFZB 3IAQA 4OCYH 4PTTB 4XNMA 5HHMD 1MPAL 2HTKD 5DRXB 1N4XH 4HGMA 1VHPA 1SYSB 4M9OA 2OTUB 5DEFA 2DL2A 1A02N 1TVDA 5DDHA 1IGYA 5IQ9A 1FFOA 1RUMH 5F3HA 3A67H 2QADC 4WW2A 2AQ1A 3PWNA 4O51B 5EU4B 4TTDC 5IM7A 4U2ZA 3MNWB 4G8EA 1C1EL 1R5VB 5ESVA 2BZDA 1HHJA 5F6HI 4LHUG 4OM0H 3TT3H 2NY5H 3RUGE 1HQ4B 4L3EB 5GSRB 3P9MA 3RX8A 1G7MB 2ESVA 2O5ZH 3MYZA 2QQKH 3VDBA 2BVPB 4PY7B 2PXYA 3VFNB 1LO4L 5HHXL 4S0TD 1PLGH 1TJGL 3NAAL 2VQ1A 3PGFH 5CEXB 3VDAA 4F80A 5C09D 2JB6A 1DTUA 1SEQL 3ZE2E 4PBVC 4KZDH 4LVHC 2UZXB 1UM4L 4JO1H 4WI7A 4PJCA 5HYIA 1Q72L 1KJ3L 4N0FB 1DQML 4AIXA 2BSSA 4ZO9A 1XH3B 2R0LH 5CS7A 1ETZB 35C8H 1LE9A 1KPRA 1F4HA 4AEIH 1JYVA 3NACL 4U6VL 4XBPA 3TM6A 4LF3B 3MLSH 3BOVA 4R3SB 1RFDL 3ARFA 4K2UL 4NHCL 4AH2B 3BW9B 1I1AD 2YOCA 1F02I 2FHBA 1YMHB 43C9B 1YEHH 1GC1H 1ZHLB 4KXZH 1HHIA 2XN9E 3VXUD 3ZE1F 4X6FA 4G9DB 5IP4A 4D0DB 1QNZL 2Q3AA 1KBGH 5EO1A 4LVEA 2A6DB 3T0EE 1ODAA 2XQBL 1JVKA 2N56A 3O6KH 3QUYD 2DYPD 4JO3H 3W9EB 4Q6IB 1Q9OA 1JUFA 2WLZA 4R4ND 3BT2H 2NW3B 1OGAB 2WWKO 1T7XA 3KJ6H 5FHBL 2VN4A 3F8UB 4XB8A 3LN9A 3MA7A 4Y5XC 4KU1A 3ZDZE 1FRGH 3GUTA 3TBSB 5JLZB 3EYVB 2X2YA 5IB2B 2I60H 1N8ZA 4TULL 1MFBH 5ELIA 4XZUB 5D1QA 2NXYD 1E4WL 3PDOB 4GKZA 1ZLSL 1FLTX 2BC4B 5F6IB 3C8HA 4MA1B 4FS0A 4PJ5A 1D7FA 1N7MH 3MBED 2IFFH 3QT2A 4JM2D 3KPSA 3WUWG 2Q76B 3ULUC 4ZPTB 3ROOB 3FTGA 4P4KD 3IGAA 3SGKA 4RFEB 1PSKH 4I77L 4LLYA 5IEKA 1RAMA 3WNOA 2ZCLH 5ANME 1E0OB 5EB9A 2P5ED 1NSNH 2C1OA 5JXEA 4OB5L 4OGXL 2VLKE 5JOEA 4HKBB 1KCRL 1ZAGA 4KQ4H 1BQLL 1TFHA 1UM5H 3DXAE 4NBYB 5IW6B 4K71B 3FO0H 4LRNL 5CINL 2EO9A 5CBEB 3RVTC 4U1HB 1PG7X 5TQ0H 1IRAY 1KXTB 1Q9KB 5MP6H 3BP5B 5FECB 5I18H 3X11A 2F53B 4XHQA 4M7KH 3VU2A 2BSED 1GH7A 4W68A 2DBLH 3SDCA 3CLFL 1NH6A 4DVBB 4KQ3H 1DUYA 1ZXQA 1TMCB 1F4WH 4LMQI 5CZKA 1B4RA 1MF2L 5DFVC 3QQ4B 4OUOA 4BZYA 4K94H 1MCHA 1R3HB 1ACYH 1C5CL 4ZAKA 5KVFL 1MCLA 3ULVE 3RJQB 4DK3A 1ZHKB 3I9GL 3KYKH 3RZCB 1NFKA 5FB8A 3JVGC 4RRPG 4FMKA 4PJDE 1OP5H 3ZLQC 4GMTL 1A21A 1INDH 5EG6C 1S7SA 3LY6A 1QKZL 2XFXA 4R6UA 5SWQB 5TF0A 3PHQB 4Z7NF 2V2WA 3GMLB 1IEAB 2EDHA 1JF1B 2ARWA 4NRYB 2VDKL 4IMLA 5J1TC 5IFJB 1WTLA 3KHOA 3HHRB 4KMTH 4NOFA 5FO8A 5E8DH 2HRPL 1A6TA 2ED9A 3FFCB 2FWOA 2ORBL 5FDWB 4PY8I 2ITCA 3HC4L 5I8EA 4Y4KB 5C8JB 4APQD 1NCWL 3QEQE 5DMIL 1O5DT 4U1SB 1KTLA 5D7JB 3RZWA 4RMWA 5ICXB 2EDOA 4F7EB 4F15C 4FTVA 2ATKA 2X4NA 4RDQG 2ED7A 4BYHA 1T21A 4WI2A 2MHAB 1JNHB 4MJIE 1G7JA 1I8MA 5EBGA 1NAMH 3HMXH 2NY2B 3KYOA 4P2RB 1AGEA 1DUZA 1WEJL 1MFAH 1LEGA 2J1KA 3LKRB 4XWOD 4N9OB 5FM5O 2I07A 4BSVA 2MSPA 5C3TA 2XZCL 4PJ8C 2EDDA 2FX8H 1MUJB 1RI8A 1YNLH 4UB0H 1S7RB 4NNPH 3V9FA 3L1OH 1XAUA 4OD1L 3QEGH 3EDDA 2OJEB 3WXWL 5F9WB 2PCPB 3GIZL 1W72B 2FGZA 4U1IB 4RAVB 3C60B 3ZZ1A 5DC9B 3D18B 4QRRD 1A1MB 1NUNB 2DF3A 5DTFB 3D25A 5BS0E 3DGCR 5F9DC 3QIUB 1WV7T 4TOYL 3TBYB 4X99B 1XZ0B 1MFNA 5I1GH 4OLYH 2IQAA 2B1AH 4LPWA 1I85A 2IH3B 4HIHA 5IJVA 1FFNA 1K8IB 2AJXL 3QZWB 5KSBE 4QF1B 4LLQB 4Q7DA 3GRWA 1L0XA 5FCSH 1RZKL 2W1NA 4FFZL 2EIDA 2C7UB 4EI5B 3DX6A 4RX4A 1IT9H 3PWJB 4YO0B 2VZVA 5IHLB 4ZO7A 1V5JA 3IDUA 4MA8H 3WE6A 2PW2B 4E0RB 1T0MB 1AXTL 5CZVH 3UZEA 1DE4B 2COQA 3P40A 4NO2B 3W81A 3VG0H 3MUJA 1DQTA 4MCYB 1PVHA 4HS6A 5I74C 3ZKXB 5ENWB 4KH2A 4HIJA 4I48A 3BSZL 3OJDB 4F7CB 2YRPA 4YC2C 4FQHA 1I3UA 3EOAB 3MJ6A 2NCMA 4OJFL 5E8NB 5J1AA 4PJAB 3TVMC 1GVIA 1BQHB 4LCWD 4G9FA 3HI6H 1WBYA 4YPGA 1AKJA 1IC4L 5IMLA 2O26U 3BXNA 4LCCA 1L6XA 1PJ9A 1C16A 1EV2E 1TZHA 1A1NA 1JGLL 4LSRL 3MBXL 1WCQA 2QEJA 2VOTA 3MO1A 4EUPA 4DUXA 1MCNA 4M1CC 4OZIB 3ARXA 3K8LA 5C0RL 3HC3L 4QRPA 5LAXA 1ZT7A 4MA3B 2OBGA 1K9TA 3O8XB 1I9JL 1YEIL 1DBAL 2WMPA 3GMNB 5F6HJ 1GIGH 3DNKA 5HGAB 1CL7L 5JIIA 4N68A 5ICYB 3WFHA 2YXFA 2AK1L 5IBLC 1G1YA 4EBQH 4JPIA 4GG6A 9CGTA 2DTML 1ZA6A 5IMKA 3N1MC 4ZSOA 5B4MC 3M07A 3GSNH 1IAKA 3D39B 4OT1H 1LMKA 4HWUA 4I0CC 1AD9A 2BHZA 5DUMH 3NZ8B 5CP3H 4Z7OE 3S5LB 4KPHL 2B2XH 5FUZL 4DAGH 3IFLH 1UXWA 4FXGA 1WWAX 4HK3N 1JMZA 1W0VB 1KCUL 2B1HL 4ZXBB 3QUMH 4MD4A 4J12A 3GSRB 5C07B 5E2VL 5EORH 3DVNB 1A1OA 5CILH 1MHEA 5I1AA 4PGCB 3VFMB 1IILE 1QBML 1FNHA 4PGEA 1X5GA 2X89D 2MQ0A 3K80A 4QOKA 4R7NA 3ZYIA 1FFRA 1W0WA 3OWEA 3FOMA 2YRLA 5CJ5A 4H1LA 2F58L 4M7LL 5TE7H 1FO0L 3UTSD 3MV9E 5JW5A 2W91A 4PG2A 3TH3T 5ALBH 4ENEC 1G9ML 2ICEA 3WBDA 2EC9U 3TESA 1XIWA 4NPYA 2Z0BA 4K3EH 4LAQL 5DJ2A 4U1LA 5IK3A 3QQ3A 1AXSB 4ZYKB 1ZV5A 2BCKA 4OV5B 1MPAH 2CD0A 3EDFA 4P2QD 1G9EA 2BNQE 1NUFA 4UDTB 32C2B 3IDIB 1N0XL 4PYHA 1I4FA 1KF9B 1OTSD 2CH8A 1ZLUK 5EZLA 4MVBD 5C0GA 2DJUA 4KMQA 5D7LD 1WAAA 2E8ZA 4Y1AE 3MRCB 4PRPD 2RJMA 4MJ2A 3BZEB 5DJDB 1Z3GL 3ILPA 1C1EH 2A6KB 1IM9B 4Z7VE 4W70A 3ZE0E 4DZ8A 2G75A 4MMXC 5HI4D 2OL3A 3DIFA 2XKNB 4L4VA 5LGJB 5CSZB 3WFDL 3Q0HA 5C9KA 5A3ID 2R2CA 1TQBC 1LO4H 5HHXH 2C3GA 1Z9MA 3QNYB 5GJSL 1TJGH 3NAAH 5E9DD 1HEZB 3QAZC 3EO0A 5HI5D 2J8UE 1SEQH 3LKNA 4NUJA 4QHKI 1GPOL 1T83C 3FQNA 1UM4H 1R3KA 1UXSA 1YY8B 1U8KA 2CJUL 4PJ7B 3REWA 4BFEA 2Y5TA 2ZSVA 4MCZA 2K1MA 1QTYT 3MRFA 1Q72H 2P7TB 1QRNB 1KJ3H 1T3FB 1DQMH 3WJLA 5I16A 2EEBA 4YNYB 5SWZE 3FT3B 1CFNA 2LFGA 3NACH 4U6VH 5D1XB 1HILB 1G7QA 1WIPA 1AIFA 2F74A 4N8CL 1EFQA 1RFDH 3SCMC 3DURA 4K2UH 4NHCH 4HUXB 3IAGC 1OVZA 4K7PY 3BRGC 5J9PA 4LOUC 4I5BB 5D2LE 3NCCB 3WS3A 4HPOL 3IVKB 1JPSL 1FG2B 4PGJA 4PFEA 5MI0C 4JAMB 1QNZH 2A6JB 2DQJL 4Y89A 1H3VA 1KIPA 5E94A 4P4RA 2XQBH 4TVPE 2VR9A 4MS8C 3ZDXE 5C0BB 1E4KC 3MSPA 2Q7YA 4NO3B 1UCTA 3SY0B 1CI5A 1TVHB 4WU5A 5FHBH 4M4RA 1ZA3B 3RBSA 4WFFD 1BAFL 4C57C 3VWJC 2OQJB 3DVFA 4LNRB 1YEDB 5HY9A 4XCFL 4AIZA 5IVOA 2O61B 5JIHA 5CJOL 4IM8A 4WFGE 4X98B 3EFFB 4PJGF 3WLWC 1YQ2A 4TULH 43CAB 3OAYH 5EBMB 2JJSA 1CZ8L 1E4WH 4KI5F 1ZLSH 3QUXC 3TA3C 2L0DA 4PY8J 4G80B 3RIAK 2BNUA 4NQSA 2CLZA 5E4EC 1SVZA 3IKCA 3HPJB 2BNRB 1I9EA 4I77H 2FHFA 1N5YH 3EDJA 5GRWA 5C2BL 2YK1L 2DWDB 4ZDHA 1MI5E 4K8RH 4OB5H 1DJSA 4OGXH 3QISA 1OGAD 2WSKA 3QH3B 1KCRH 2Q87A 1BQLH 3HUJE 4XNMB 3DVIA 4LRNH 5CINH 5KS9E 3CFDB 4KDWA 2GSGA 4HWBL 3L9RB 1J18A 1GSMA 4XP5L 1RUAL 4QCIA 3UZVB 5HYJE 3P0YL 1NEZG 5SWSD 4KKCC 3PQYA 4UIMB 1J1PL 5L8KB 3CLFH 3L6FA 3S96B 5I0ZA 4LEOA 3KPQA 1HHJB 3BN9C 3S6CA 1GGBL 1E28B 3P4MB 5DD6A 3MYJA 3CH1A 1EVTC 3LKQA 4LSUL 1MF2H 1BMGA 2ESVB 4WTZA 5CIPB 4XGZA 2MCPL 4DOHB 1HNGA 3QDMD 3JV0A 3T65B 2PXYB 1B4JL 1C5CH 5I76A 5KVFH 4N0UB 4HKZA 3I9GH 3PABA 1QLFA 5J6GA 2NY5C 3C5ZC 5EBLB 3T3ME 2C3XA 2EDTA 3B83A 4P2OC 4GMTH 5CSBA 4PJCB 3TZVC 1QKZH 3WIIL 4YGAB 4HFWB 2BSSB 1F00I 3W82A 4PRAB 4BQCA 3HC0A 3BDXA 2R23A 2VDKH 2C9AA 4AG4L 1UWGL 4Y5XA 1MRFL 3C8KB 3G9AB 1UQSB 5JDSA 3VGAC 2NX5A 2HRPH 2AEPL 2YHGA 2ZWLT 4PLJD 5C6TL 2ORBH 1FNSL 5EN2B 2P48B 3RPIB 3HC4H 4WUUE 5HDOA 2W0PA 3O2DL 5CEZD 1S3KL 1HHIB 1T0PB 2CRZA 2WWKT 1NCWH 5EWIL 4NKMB 3SE3C 5DMIH 1UH4A 3OKNA 3RIFF 1A8JH 2ZKHL 1KOAA 4KRPD 2R8SL 1Q9OB 1JUFB 2GITB 1QOKA 1OWWA 4K7FA 1OQXA 4FXKA 2YA1A 4WTWA 1G7PA 1UACL 5MEND 3FO2A 1GC1C 2Z93B 2B0SL 3BZ4B 5DURD 2V2XA 5FV2A 1O7SA 3MA7B 4HJ0C 1HHGB 2XZCH 1W0YT 3RGVC 1T1XA 2FEDD 2Z35A 4RA0C 4M8QB 1DN0A 4OD1H 1MOEA 3WXWH 5B8CB 3GIZH 2JJTC 5DJXA 4HHAA 5HHQA 2LU7A 4JZOA 5E2JA 5GGSB 5HGHA 2EKJA 2X9XA 4CNIA 2DRUA 2BVUA 5DRZA 5C0IA 4TOYH 1U8MA 3IGAB 5F1IA 4FA8A 4GRMA 5IEKB 3MA9L 1NGXB 4JN1L 3FO1A 3I2CL 2AJXH 2BOCB 4WTXA 1BLNA 4ELMF 1G6RB 2NY2D 3RI5K 1RZKH 4PREA 4S1SL 4FFZH 1CDCA 2P43B 3BN3B 4GRWB 4Q9RL 2RCSL 2YN3A 4OZGB 5CEZL 3TCLB 5FAAA 3U30B 1TNMA 3X11B 3DBXB 1ZS8A 4PJBA 1AXTH 3QQNA 3O9WD 1EEYB 2X4TB 2YUVA 2DDQL 4P46D 2CKBA 4WO4C 4IHOA 1CFVL 1CE6B 3EYSL 1JK8B 4I0PC 2R4RL 3D3VE 1NANH 2WUBL 3BSZH 2JJUA 1DBKL 3DECA 3S3JA 1VERA 3FQRA 1S7XA 3AGVA 5DRWB 4OCWL 4OJFH 4ZAKB 3FJTA 3CVHA 5HJ3A 2P8PA 3BFOA 4ZUWA 2GSIA 5JHDE 3IFPA 4X4ME 1CFSA 5BJTA 1IC4H 4JRYE 4KK6C 3M17A 3PP3H 1QFWM 4YBHA 3MPCA 3K7UA 3RL1A 5C7XL 4I2XE 5JR1L 1JGLH 2EDJA 4LSRH 3MBXH 2BSTB 5IUSA 5GGTA 2IAMC 3DGGA 5HHPA 1IQDA 4NC1C 2EIZA 2XG5A 2YBRA 4B0MM 3DI3B 4ONGL 5C0RH 3HC3H 2NLJA 2D7OA 2J8OA 4O2EA 5GXBB 3NABL 1I9JH 3L5XL 2VXVL 1YEIH 5GRUL 1DBAH 2V5TA 3OKOA 1CL7H 1P7QD 4G6ML 4U3XA 5C70A 5I8EB 2AK1H 1ULVA 3LV3A 4WV1C 4GBXC 4RCAA 1P84K 2DTMH 5FYKD 4JFFA 3TBWB 4CU7A 4W81A 1YPZA 4ZTOL 3V7AE 4FTVB 2X4NB 1Y0LA 4Q9CA 3BQUA 4JJ5B 4QHKJ 4MXVE 3IDGB 4PS4L 5DHYB 1M7XA 4KPHH 1TZIA 5FUZH 4RFNB 3ESUF 2IANB 1A47A 1K5NA 2HT4C 4PV9B 3REVB 4BSVB 1KCUH 2B1HH 5F7WC 3VXRB 1B0GB 5E2VH 3MV7D 4N0YL 4Q6YA 3VD4A 1QBMH 3O8XD 2EXYC 2HTLC 2CIKB 2V9TA 1KCSL 2PYED 1MHPL 4M6OL 4U7MA 1KT2A 2F58H 4PJXF 4DN4L 1A4KA 1FO0H 3JWNC 1R24A 4NSKB 4TSCL 1K2DA 4NIKB 1WZKA 2Z92A 1G9MH 3BVNA 1G9NL 5IJVB 4HGWB 2NW2A 1OCWL 3H9SA 4LAQH 1I1FB 3D0LA 4OQTL 5E5MB 3QB7C 3ARYA 4H0GA 1CBVL 1C7SA 5IEHB 2B8OT 4JN2A 4FQPA 3VXSA 4JG1L 1P6FA 5IKCA 2ICWI 4JM2F 1P7HL 3MQIA 1OHQA 4UDUA 5BMFL 4MAYC 1N0XH 4HJJL 3GB7A 1I8KA 2JIXD 5FYKL 3OXRB 5FCUL 1LNUB 5DK0B 2IADB 3LMJL 5I1DB 1FFPA 2K7PA 2L7JA 3SEPA 3FOLA 4FP8L 5BV7B 1Z3GH 4DK6A 4P48A 1N3NA 3I6KA 3VXMA 5E8OB 3WFDH 4PB9L 5SX4H 4WFEE 3HZKA 5J1AB 4P5TA 3MXWL 5GJSH 4KI5C 2R15A 1URLA 4LSQL 1AKJB 1GPOH 2PF6A 5F9JA 1RSFA 2CJUH 4BQBA 4LCCB 2RIKA 1C16B 4WI3A 1EUUA 1TZHB 5D5ME 3O11B 4FFWD 2HVKB 4NO5A 2QTEA 4X6BA 3KPLA 4ZFOL 1EPFA 4N8CH 1RZFL 4QRPB 5L8JB 1ZT7B 5ECJE 4JY5L 4R2GD 5B3JE 1A6ZB 4TRPL 4QTHB 2E7CA 3MRGA 5A40E 2HP4A 5GSVB 4YGVA 2BRRL 4G6FD 3GSQA 4OD3L 1D6EB 3MCKB 2WWMD 1UEMA 3WFHB 4HPOH 1YNTB 1WQVT 3BESR 3SDXB 5I2IB 2WIMA 4PRID 1JPSH 1ZA6B 2XTJB 3P0GB 2DQJH 4YJZL 1GOHA 1KLGA 3CFKB 1OF2B 3QUZD 4J3TA 4L8BA 3ROLA 2W60B 3V7AG 2AVGA 2PO6B 1OGTB 2GJ6E 1X3DA 5DMJB 1MHCA 2MMXA 4ZUUB 1X7QB 4LPCA 3RKDD 1BAFH 3UPRA 3PWPB 1QRND 4XCFH 4ZNCD 1HXYA 5CJOH 4XWGL 2H2PD 3BI9X 3DMMB 1EEZA 3OF6D 1YYML 3VFUA 4PRHD 5GS0C 2VDRL 5EZOL 1CZ8H 2X1PA 1ZLVH 3NIGF 4A2LA 1AGBA 1JL8A 3FOMB 4XC3L 4ETQB 5I1LB 3A6BL 2ZUTA 1NFDA 4HCRL 2HLFD 4KKAD 3D2UA 1KJMB 5C2BH 1XCQB 2YK1H 5JO5A 2C4FU 4X4YB 2BVQA 2EZ0D 1QA9B 3U7YL 1T22A 3BUYA 3U0TA 4DJMA 3HE6D 5IK3B 2R2EA 1TQCB 4F7TA 4J3UA 4DN3L 2BCKB 3GJFK 4U6XA 3IETB 4NZRL 1FVCA 4NNXB 4HWBH 3IKKA 4C56B 2MOVA 4XP5H 1RUAH 3NFPA 4NBZB 4W6YB 4FZEL 1T83A 2AXJA 3L5HA 4QY8A 1I4FB 3WEXA 1U8QB 4MJ5B 3HZMB 3P0YH 3CC5A 1INQA 3NN8B 4WUKL 3X17A 2UWEA 4W4OA 1J1PH 1S9KC 5F1NB 2ITDA 4ZUVA 2NY1C 4WWKD 5F88A 3ILPB 3NOIA 4V1DE 1MFDL 1I9IL 5CAYB 1GGBH 4DZ8B 2G75B 3S9DB 1MVUB 4LSUH 5FYLE 3IDNB 4EN3C 3WKML 3UDWC 4C83A 2VTFA 4JFDD 1B4JH 4X8XA 2F19L 4J4PD 5DT1L 3G6JE 4YBLC 1UXSB 3REWB 2Y5TB 5IW1A 3SKNB 3BDBA 3WIIH 4YDJA 1IKNC 1QFHA 1LP9F 1GZPA 5F9OL 4NQTA 4Y4FC 1KB9J 4ZOCA 4M1GL 5FKPA 3VWJA 1NBZA 3KG5A 3L3GB 4HMCA 1PZ5B 1UWGH 4UQ3A 2KUTA 3MJ7B 1MRFH 3DURB 2AEPH 1XGRA 1CICC 1HCFX 2Q6WA 1FNSH 1BD2A 2DQEL 5I30L 5EUOB 1QSEA 3QDGA 3VD9A 2ESVD 1JGEB 3O2DH 1S3KH 3B9VA 4QT5B 3V6OE 5EWIH 1HSBB 2X42A 1QO3A 3NIFF 5TDPA 2PXYD 2GK0B 2VZTA 3O2VL 5C0ND 1ITCA 1WZ1L 2ZKHH 3KPRA 3U9PL 1MCSA 2CLVB 5T1LB 1WWWX 2GFBA 1YY9D 2A77L 2R8SH 2OK0L 3BH9A 4DEPC 1UACH 4CL7A 4EDXA 1YA5A 2B0SH 1JGDA 2HTKC 5HGBA 1VGKA 2XOTA 3MJ9A 5HY9B 4AIZB 3HRPA 4B5EA 3CDFA 4NT6A 4TNWK 3GMMA 1IARB 3DV6B 1HH6B 4UZGA 1RHHA 5DK2A 3OAZK 4RAHA 2NTFB 2D7MA 3ARFD 2OSLA 5DUPL 3OKYA 5T3XL 3JTSB 2LVEA 1X4XA 5FGRA 3CLEL 1J0KA 1E27B 3CVIL 2QADB 2H32H 2BNUB 4ZO8A 3WYRA 2CLZB 1CDUA 3O3UN 3IKCB 2R1YA 5E7BA 3W39B 1SBSL 1IM3A 4FNLL 3MA9H 1UWXH 1X5XA 2AV7A 4JN1H 4S2SA 3U4EB 4BFIA 1OW0A 4GAYA 4R0LC 3I2CH 1TJIL 3QHZL 1S7TA 1F2XK 3C9NA 1I7TB 3MV8B 5A16A 4R8WL 3JUZA 4S1SH 2VXQL 4X6DB 5HHOB 4Z7WE 4L9LA 2GSGB 3O2WL 1JF5A 2QSCH 4XNXL 2RCSH 4LVHB 1C5DA 5CEZH 3ES6A 1Y18B 3U0PB 4OFYD 4JFXA 4AEFA 4DWHA 1NGWA 4JB9L 3PQYB 2DDQH 5D1QD 4MLSA 3V6FB 1CFVH 4NNYA 2R29L 4PJ5D 1I1AC 4LEOB 3EYSH 5BZDB 1KJVA 2R4RH 3KPSD 5JNYA 3D6GA 2WUBH 2YD1A 1BZ7A 3HG1B 1DBKH 2W9LA 1EGJL 3MRLA 4OCWH 3S37X 3MCG1 5JXED 4PJIE 3VH8G 3OJVC 4QRSA 5EC1A 1VEMA 3PABB 4WWID 1QLFB 4R4NC 1XT5A 3CX5J 2PYFA 3VE0B 3K8KA 1OAQL 2P5WA 5EDXA 4OZHE 1CFQB 2ICWJ 1KB9K 5C7XH 5JR1H 3VI4E 2VL4A 3ET9F 5FUOL 4H5SB 1WUNT 3ARDA 4XH2A 4DW2L 4IRJA 2XNAB 3SDCD 1YQVL 4Y5XB 4ONGH 1XCTB 1G6VK 5JDSB 2MNUA 2NXYC 2YXMA 5FYJU 3MNVA 3NABH 4JFEE 3R06B 4U1NB 3L5XH 2VXVH 5GRUH 1HQRB 1ZTXL 4JE4B 1O0VA 1CLCA 3EYQD 3MBEC 4JM2C 1ZKAA 4G6MH 5F7KC 4YDVB 5DUBA 3EJZD 5H35A 4ZAKD 2BVOA 1VKXA 3OKNB 4ZTOH 4Y5YC 1FVDA 1HH9A 4BQ9A 3KXFE 3JV5A 2EE6A 3QDJA 4PS4H 2IBZY 3CNKA 1N2RA 3QPQD 2AK4A 1U8PA 4HIEA 3EJJX 4ODSL 4S0SD 4ODTL 4WNQB 2V2XB 5TGBA 1DLHA 4O00A 2V5MA 1MFCL 3WIHL 1T1XB 2D7TL 2KKQA 3WNPA 4Z9KB 4N0YH 2R9HD 1A0QL 4LU5L 1QSFE 3ARUA 1RMFL 2ZOLA 3S37L 2F8OA 3KPTA 4JREC 2VDQL 5DJXB 1KCSH 5LQBL 5HHQB 2Y07L 3V2AR 1MHPH 4M6OH 4WO4A 4FABL 5E6ZA 4CVWA 4JJHA 5C0IB 3BMVA 4G43B 1P4LA 1GZQA 1IL1B 1LK2B 4ZUSB 4DN4H 5IESL 1T5WA 3VXPA 4TSCH 1JWSB 1LO5B 3FO1B 1S7VA 5GS1A 4FTVD 1G9NH 5F7DB 1OCWH 1BLNB 4GAGL 5DD3L 4OQTH 4YE4L 3HE7A 4PREB 1XR9A 3T8XA 1CBVH 3Q5YA 5KVGL 1J88A 4JG1H 2KH2B 3RHWF 2XWJA 1WIOA 5T5NF 3MTRA 2LE9A 5BMFH 3UTTA 4LGSB 4HJJH 1EAPB 1ZS8B 2Q8BL 4PJBB 5FYKH 5AD0A 3AY4C 5FCUH 5JIPA 5D2NA 3LMJH 2CKBB 4IHOB 4DKAA 1RZKC 3NGBC 5EU6E 3T3PF 3R4DA 4FP8H 1JZ8A 4OFIA 3GJEB 1CE1L 3OGCA 5IG7B 3RWDA 4G7VL 1QACA 5CJBA 4APQC 3BRFA 4N1CA 1O7VA 3FQRB 1WBZA 3GMOA 4YHPA 4PB9H 1LO2L 1JHTA 4UIKL 2KDGA 4WV1A 4GBXA 4PJEE 3MXWH 5FYJE 1VFAA 4LSQH 5BJTB 4HUUA 4D0BA 4F15B 1R6VA 3IDXL 4XWOC 3OJ2C 4RX4D 5DJ8A 5J13C 2EDBA 3AMLA 5E95B 2RAMA 3UTPD 3P30L 4GQPH 1CGVA 2FSEB 4PJHA 3HZVA 1RZFH 4PJ8B 1F3DJ 3MGOB 4JY5H 2VLRB 4WEBL 4TRPH 5D7IB 3ZKQD 3GJFB 3C6SA 2GY7B 4X9IA 2FIKB 2BRRH 4OD3H 4G8FB 2LQRA 3BISA 5DMKA 5IMOA 3SGJA 2OXGA 3MZTA 1EXUA 2DMBA 4JFFB 2CDGA 5CHNA 3MROA 1YPZB 4JQVC 3I6LD 2YD7A 4G9FD 4DFIA 3VA6A 1AKJD 3L95B 3L7EB 4PUBH 3VGGA 3EDEA 3WL9B 2QHLA 4PP2A 1PKOA 1RIVL 4N5ED 1RZIB 4NQXB 5FYJL 5E5RB 3MXVL 3T2NL 4PD4K 2DI9A 1RJYB 4C59B 2X44D 2OMNA 2YPLA 1BFVL 3QO0A 2APXA 4KRMB 5L9DL 4XWGH 3G9VA 3ZTJG 4X7EC 4WGWB 4JKWA 5IMMA 1YYMH 4QRPD 1WFOA 2VKWA 3GI8L 2VDRH 4MAYA 4X7DC 3T4YB 1OPGL 4XC3H 1LEIA 3A6BH 3H3BC 1KT2B 2AJ3A 4XCCH 5I74B 4HCRH 4TPRL 3RQ3A 2FO4A 4P5MA 4PRNB 4JY4A 3CCHA 4WHTA 2IG2L 2V7NA 3JV4B 2Z92B 4HUKB 3BVNB 4LEXH 3U7YH 4ODUB 4YC2B 2FGWL 4M1DL 2YD9A 5C08E 4Q58C 3VRLF 3TVMB 3IDYC 4DN3H 1XF2B 3DJ9A 5IKCB 4NO0A 4NZRH 3F5WB 1KC5L 4UDUB 3D1MC 3K74B 3HMWL 3QJHA 4FZEH 1SJEA 5ACMA 1U58B 4BSJA 1D5BA 4MJ4A 3NPZB 4WUKH 1MWAB 1FFPB 2DQUL 3C8DA 3I02B 4QOKD 5E8EA 4MNQE 2OR9L 1MFDH 1I9IH 5EIIA 3I6KB 1V8HA 5FXCH 1DBBL 1VFBA 2CDFA 3WKMH 5C0AE 4XBGB 1ORQA 1S9YA 1RIUL 2R56H 1BBDL 1KTRL 1XIWD 2V9QA 4QNPE 5T33L 2BOBA 1XF5B 3W11D 2F19H 1SEBA 5DT1H 4MD0B 2MKWA 4XPHL 3RWFA 3G04A 2FIRT 5J7CC 5FKAA 3RVXD 4F9PA 3F12B 2FYYB 5F9OH 3R8BB 4X6BB 2I9LA 3T1FA 3VRIB 4M1GH 4PGBB 4X5XA 3GSNA 4IDLA 7FABL 4FOMA 3E3QC 3PGDA 4NKOB 4PJFF 3QFJB 3MUGB 4YGVB 2DQEH 5I30H 1N5AA 1WK0A 3N1PC 4ZOAA 4HIXH 1B88A 1NC2A 4L4VD 1HYSD 5ID1A 3QJFB 3TT1L 2BY2A 3O2VH 3QUMA 2LTQC 1WZ1H 3U9PH 5IGXL 4XXDB 3IFOB 1G1CA 1G7HB 4L8BB 3ROLB 2A77H 4Y2OA 2OK0H 2FL5A 1I7UB 4PRPE 4UU9A 2AI0L 3T4AB 3C87A 1KJ2A 3DPBA 1XF4A 4NYLB 3BH8A 2VABA 1R3LA 2H9GB 2FZ3A 1X6NA 1YN7B 1HXYB 3HTLX 3ZYZA 4HEME 1GGIL 3HAEG 3WDIA 4IJ3C 1OP5K 1OTSC 5DD0L 1MCBA 1EFXB 4PJAF 1KCKA 3DX7A 4ZFFA 3X14A 5DUPH 5T3XH 4Z0XB 1FDLH 3CLEH 1AGBB 1DQJB 4JG0L 3CVIH 2C4XA 2GUOB 3AVEA 3ZL4L 5HI4C 5IV2A 3BAEL 4O2FB 2WBWB 4CADA 1SBSH 3ZT6A 4FNLH 1NGZB 1FV1B 1CU4L 3Q3GA 3MACL 5A3IC 4WEMB 1JNNL 4OSUL 5JO5B 4EUPG 2VE6B 1YECL 1T22B 1UJ3A 4LSPL 1TJIH 3QHZH 1BIIA 1U8HA 5E99L 5HI5C 5K59F 3U0TB 5TDNB 3BIAX 5FK9A 4F7TB 1TQBB 3ULSA 4KDTC 4G8GA 3VFTA 3MLVL 1D6VL 2LAAA 2VXQH 1KV3A 1AE6L 3U6RB 3QAZB 4L3EE 3O2WH 1FVCB 4XNXH 1Q9WA 2OL3L 5TH2A 5MHSD 4JVUA 3WUWA 2GT9B 4QY8B 3WEXB 1NGPL 1WTGT 4FQCL 5JTWA 2EYSB 1F4AA 2DLGA 2WIIB 4JB9H 1V7NL 5B39G 4QRUA 2Y6SD 2M1KA 4R9HA 2ITDB 4ZUVB 2R29H 3I6GA 4Y4FA 4N90D 5HBBA 1FL5B 3MREA 2BVYA 3SCMB 1KCVL 1CICA 3Q6FB 5DRNA 4C83B 1EGJH 4GW4B 4BH7B 3QRGH 1KLUB 1PYWB 1Q1JL 3QXTA 1P1ZB 1MLBA 2ZUVA 4MX7B 5MI0B 3MRNB 1OAQH 3HS0A 1FC2D 3MGTA 1M7IB 4LL9A 2I9TA 2D0HA 1RULL 4H1LG 4YDJB 5FUOH 2FLRT 5DWUL 4JFZL 5JUEL 5E00B 4DW2H 2P8MB 3VWJB 5EOCJ 3PQYD 3S35X 1CXFA 3RUGA 3BGFC 1YQVH 1N6UA 3NA9L 5ISZE 2Q86A 1XGRB 3QCVL 3ILQD 1OGAE 2AV1A 1ZTXH 1IE5A 4WHCA 4XVJL 3QUXB 2FJHB 3TA3B 4JDTL 4RRPA 3S3SA 5TDPB 2Q1EA 5E4EB 5GZND 4K07A 2YC1A 3KPRB 5IB4A 1P5UA 1VACA 2QSTA 3VXOA 2W9EL 2PETA 3VWKB 4H88L 3CXDL 4EDXB 4ODTH 5HGBB 1N26A 2OTWA 1AO7B 4JPVL 5DFTA 1MFCH 3FRUB 2VERN 1G0YR 3WIHH 1MCCA 2VITA 5I15L 2Y7QB 5I66B 2D7TH 4KK8D 3PJSA 4XPBL 1A0QH 5E8PB 1R5IA 2VR4A 5ALCL 3GSUA 1RUQL 2NX5D 4LU5H 2XN9A 3S37H 2VDQH 2EDFA 5LQBH 4L3CB 5IB5A 3T0EA 1QFPA 4FABH 3HI1B 4D2NA 1MVFA 3WO4C 1BJ8A 1OB1A 2VDPL 2CO6B 2ENYA 1QFWL 2F53E 2BVTA 1CD9B 2YUZA 3UBXI 2ZCHL 3HPLA 4Q2ZB 3BHBA 4Y19B 3C9NB 4GAGH 3EOBA 5DD3H 4EIGB 5A16B 1R5WA 4YE4H 5E24E 1CGTA 5EPMA 5KVGH 1A9EA 1ZE3C 1JPTL 3OBAA 2BJML 3G5VA 4XP9L 3C5ZB 1F3JA 1C5DB 3ES6B 1UZ8B 4P2OB 3RVTD 4NHUA 2Q8BH 3CSYA 3D48R 2NY4D 3ZTJH 4LKCA 4XCYA 4YIQB 3TZVB 3CAFA 2DI7A 5D7KD 3O3BB 2G5BB 4PLJC 3TIDB 2F54B 2IFGA 3GMPA 1CE1H 3S88L 5JORA 3VGAB 2X4PA 2VLKA 1VGEL 2AERT 1J05A 3V7MA 3DXAA 1LO2H 3BP6A 4JVWA 1KXQE 4GJTB 4UIKH 1JNLL 5HDBF 3VGDA 2GTZA 4BZ2L 5I8CB 4KRPC 1LO3L 1U9KA 3FFCE 3WNNA 4QRQB 3VFRA 3RIFK 4CBPA 4HZLB 4EI6B 3IDXH 5CBAA 2VDML 1I9RL 4LVNC 4N8VB 1J9CT 4EXPX 3P4OA 2H8PA 4YFEA 2FEDC 4XH2B 4XNQB 3FO9B 1VB9A 3P30H 4OFPA 3V95A 5E5UB 5MERB 3RWGB 3RGVB 1KLFA 1JRHL 2P24A 4P2RE 4XCNA 3N0PB 5IB3B 3D87B 2R2HA 5F89A 4F9LA 2H41A 1WSST 3KPMB 1BOGA 4HQQL 3X12B 3BP4B 2XY1A 5IWLA 4IS6A 4K55A 1BBJB 1HH9B 4PJDA 4PLKD 2CLRA 4WW2F 2OMBA 3WMSA 4LQ1A 2E6JA 3HKFA 3QDJB 4Z18A 1HINL 1RIVH 1X44A 1U8PB 5A2IH 5FYJH 1T2XA 3MXVH 3T2NH 5TGBB 1DLHB 4G42B 1MJJB 3F6LA 2HJKB 5GGUA 1BFVH 3RX7A 5KG9B 5L9DH 4DQOL 1AQDA 4TTGA 4RFOL 5IROC 1OL0A 2FECL 5EIQA 3O9WC 4FQXC 4HV8A 4P46C 3GI8H 1TITA 1FZJB 1OPGH 1ZHNA 2H2SD 3LRGA 3KDMB 5F7EL 4WO4B 1SMOA 4TPRH 4JFFD 5BOPA 1X4YA 4I0PB 4MJIA 2DQHL 1T5WB 2IG2H 4XPGL 1M71A 5CEYA 2Q8AL 1XGPB 4UUJB 3BQUD 5KOMC 2FGWH 4HX1B 4M1DH 4B53A 4XPTL 2E7MA 1M05A 1NDGB 4I18A 3T8XB 4XVSL 3MRKB 4WDIA 2NY0D 1FCCA 1IAOA 3MRPB 1EJ6A 4J23A 4J8RB 3ZKNC 3A6CL 1NUGA 1IGCL 1KC5H 3DUHA 1G7LB 1RUPL 2YWYA 3HMWH 3FZUD 4CMMA 5HI3C 4LLWA 3HAEH 3OXSA 5AD0B 4XNUL 1T0NA 3CVHL 5BS0A 2NMSA 2DQUH 3LEXA 2CR3A 5DQJA 3VDCA 2Z31A 2IAMB 2RR3A 3QFDB 2OR9H 3THML 3OAYK 2VLLA 1RZJC 2Y23A 3RY4A 4NZJA 1DBBH 5KSBA 1F4YL 4OD2B 3O6FA 4ZD3L 3ZSSA 1RIUH 1T1WB 1BBDH 1FN4B 3BEWA 4HBCL 5T33H 3PGCB 3H9SD 4WV1B 5F7YC 4GBXB 4AEHL 4EUPH 4OZIE 5IR1A 1BF2A 3LHPL 4DKEL 4PV8A 5ETUA 3QXUA 4L5FL 4HUUB 4XPHH 4PGDB 1OAUL 3VXSD 1JZ3A 2CIIB 4D3CL 5BQ7A 4ISVA 1X5LA 1YEKH 3H3PL 3K2MC 3HZYA 2FH8A 1NCNA 3D39E 7FABH 3OR6A 2GK2A 4M1CD 3ARPA 5DVOA 4H25A 2NXZD 1NAMB 3VXMD 4J3SA 4M03A 4CDHA 3BPOC 3TT1H 5C07E 5M7QA 5IBLD 4P5TD 5CKGA 3W2DL 4HGKC 4YHLL 5IGXH 4XX1E 1AH1A 3F7VA 3UEZA 2IPKA 4RMUA 4PP2B 4RISL 2AI0H 5CZXC 1E6JL 5DSCA 1UZ6E 3S97C 4M43L 2HFEB 2ARJB 4U4BA 3ZDYE 4XMPL 1A4JA 1UWEL 4H1LH 4UNVA 1K4CA 2FNBA 1GGIH 3DO7A 3B6SA 5DD0H 1FO0A 3CZJA 3VMOA 4IOIA 5I17A 4MAYB 2ADIA 3BZFA 1Z6JT 2C3WA 4JG0H 4IRSA 4NKIL 2WNGA 3MRQA 1OAYL 4DVRL 3ZL4H 2Y9RT 3BAEH 5EU3A 1BJ1H 3CCHB 1ZT1B 4WHTB 4J6RL 1CU4H 2DQDL 3MACH 1JNNH 4OSUH 2DD8L 1ORSA 2A74A 1L7TL 4AL8L 1I3RB 4LSPH 3L5WA 1BZ9A 3O3DA 5CSGA 5KN5A 1SVCP 3CDCA 1HYRC 4PJGB 3CXHJ 3MLVH 1D6VH 1FNEB 1AE6H 5T1MB 5BW7C 2DJ4A 3JV6A 4ODXB 2OL3H 3LB6D 4FFWC 1LD9A 3HN3A 1NGQL 5C0EA 1NGPH 5DJAA 3RWJB 4FQCH 3QG6B 3RY5A 4OZFA 4LFHD 4R2GC 5FGCB 5HYSB 4FQ2L 1FAKT 1NBQA 3MV9A 3V5HB 5C1MB 4YEFA 1BQHG 3BX7C 2W92A 2BP3A 2VDOL 2DLFL 3NZHL 4OGAD 5FUCE 4PJ7E 1JHLL 3N06B 5K9QI 2WWMC 4A6YH 1KCVH 2CDFB 4M61A 4F2MA 1QRNE 3D2UD 1MCRA 4V2BA 3UP1A 1S9YB 3HI5L 1RK1B 4K3HA 2ADFL 1Q1JH 4BZ1L 3V4VL 3QUZC 2BNQA 4YXHL 3MRBA 3ECBA 3PWLB 1KUMA 4LIQL 5ITFB 3BDYL 3B3IB 1K8DA 1NFIA 4X8JA 3L3HA 1RULH 4J2XA 4FQIL 4LHUB 5EA0L 1U8NB 1BJMA 2H2PC 4JRXB 5DWUH 4JFZH 4Z7VA 5JUEH 4GRLA 1YDPB 3NA9H 4KY1L 5C0BE 1II4E 3JXAA 1KULA 3QCVH 2FECI 5TF1L 2BY3A 1A9BA 1JJUA 2JCCF 3WN5A 3GNML 4XVJH 1I8LC 5A2JH 2HLFC 4JDTH 2J8UA 4OKVA 1JN6B 5ID1B 5IOPA 1H0DA 3MNZA 4FFYL 1KTDA 1T4KA 1OSPL 1FZOA 2EZ0C 1CGUA 5DLML 3C6LA 3GGWA 2FL5B 3HE6C 3MV11 4H88H 5SWZA 3CXDH 1V3KA 3EYFB 3T77A 2VABB 1PAMA 1R3LB 2E7BA 4JPVH 3IXAB 5CMAB 1I75A 4XRCA 5CKAA 3PP3K 4KDTA 3V5KB 2BNRE 5I15H 4MZ3A 3VWJD 4XPBH 5D2LA 4ZFFB 5ALCH 1RUQH 4WI8A 1SM3L 5KBNC 4WWKC 1BD2D 1AGFA 3OB8A 1HCVA 2VLJB 1QSED 3LN4A 3QDGD 4DCQB 4ORGB 1YMMB 2N7AA 3TYFA 1L0YA 2YEZB 3DRTA 4ACPA 3VFVB 1Q9LB 4MDIA 3X13B 2NY1B 1AY1L 1TDQA 4P23A 4CADB 2VDPH 1OQOA 3L3OA 1KIRA 4URTB 1QFWH 3KPRD 3PV6A 5C0DA 1RQ5A 3MODL 4EN3B 5I1JL 4NFBA 1A2YB 2QR0A 2ZCHH 5IBTL 4X6EB 4WW1A 4L4TB 5FDYA 4LLVB 3LS4L 1T7YA 3NCYP 3NMEA 1H8SA 4ZQKA 3WO3B 1JPTH 5I71C 1FPTL 4OCXL 2ESVE 1Q9WB 1V3LA 2BJMH 5E4IA 4XP9H 3AAZA 5BRZA 5T1KA 1UH3A 4GG6F 5DMGD 1FQ9C 3O6LL 2LU4A 3TBVB 4YBLB 4DOHE 1GXEA 4PG9B 4NJ9L 1AGDB 5DK3A 4LGRB 3BD3A 4WW2C 4AT6A 4NJAL 4CVUA 4N0UE 1U92B 4KKCD 3N85L 4Y4FB 3WS6C 2SEBA 4JZJA 3UJTL 3LVEA 2N7BA 1WVZA 3S88H 4ELMB 1MI5A 2H26A 1VADA 2WANA 1CICB 4PJCE 3CDGA 4I9WD 2E27L 3BN9D 4LSDA 1VGEH 5JZ7C 3DX8A 1K3ZA 5C0NC 4OBRA 1J5OL 1DCLA 5KS9A 1JNLH 3L5JA 1J8HB 4BZ2H 4RIRB 1T6WA 1YY9C 1SYVA 3WHXB 1NC4B 4ODBD 1LO3H 4LFHG 2W9DL 1UB5A 5HYJA 3HR5A 2F9BT 2HJFB 3CFCL 1A6AA 2VDMH 1I9RH 5JOFA 3NCEB 4DEPB 1FVEB 4MB4A 5HHMB 4NQEA 2APBA 3MLTA 3WCYA 3TH2T 4AJ0A 1XMWA 1KPUB 4U3CA 2Q86B 3ARFC 5I6XC 1ZHBB 3P77A 4M7ZC 4EQ2A 5C6WH 5JPNA 1MJ7L 1JGVL 1F4XL 1JRHH 3RNQA 3RWHB 4G8IB 4FQQA 4GXVL 1TZGL 3VCLA 2F8VA 1YJDH 4HQQH 5D7SL 5AUMA 4JVPA 1Q94A 4LSSL 1WAAF 5E2WL 4BH8A 4YHIB 1X5FA 3B8SA 3QXDA 1D5ZB 3S36X 2P5WD 4ZMAT 1HINH 3DTXA 3FQXB 4R0LB 4PR5A 4AM0A 5LVEA 2DQFA 5C09B 5I75C 2ZUQC 2H32A 3EOYG 3ARDD 2YR3A 3GZKA 4DQOH 2Q7NA 5ESAA 4IRJD 4RFOH 4JKKA 4WUUA 3BEVA 1KIQB 5D1QC 1TJHL 5E6IA 3WNLA 4LP5A 4AEEA 1RUML 3TO2A 3LRSB 5IB5B 2YPKA 3MR9B 1F11B 4FN0A 5F7EH 5I1KL 1FIEA 4RGND 3EBAA 4GRWE 4MXQD 3BGMA 4R4BB 1I1AB 4IOSD 3SGKC 1OB1B 2N1KA 2PW1B 2YD2A 5IJKA 4OZGE 2DLTA 2A73A 2DQHH 5GIRA 4HWNA 3RDTA 4PRDB 4XPGH 2EYRA 5DZNA 2R69L 4PLOB 5BZWB 2Q8AH 3P11L 3VXUB 3QDJD 3HPLB 3V0VA 5F44A 3D85A 2AK4D 4XPTH 1R5WB 4IRZL 2PTTA 5EPMB 2YA2A 3MLXL 1A9EB 2DYPB 3A6CH 1A3RL 1KG0B 5E03A 1IGCH 1A64A 1RUPH 1U91B 5IVZA 1ONQA 4NHUB 2DIJA 1CDHA 2X41A 4XNUH 4PJXB 4M02A 3VFGL 3CVHH 4LKCB 3SDCC 4U1GC 2IEPA 4WHYG 4HMEA 2PR4L 2EYTB 3THMH 2OZ4L 1F45A 3EYQC 1KACB 4WO4D 3O3EA 5JORB 2J5LC 5EUKA 2NXYB 5T3ZE 1F4YH 1NJ9A 1FORL 5IIEB 1YEHL 3EJZC 3MBEB 1QUNA 4ZD3H 4JM2B 4HBCH 1OSZA 2JE8A 1F2QA 3BUTA 4P4KB 4AEHH 3EW3B 4IOFC 3LHPH 3MRMB 3SGEI 4X9HA 4DKEH 3HE7D 4D94A 4Y5YB 1F8TL 3QPQC 2HKHL 1OAUH 3VFRB 2WAHA 3UTQA 2P5EB 3IJYB 2GIYA 4D3CH 2VSCA 4YFDB 1XR8B 3UTTD 1JPGA 5EFIA 3H3PH 4UV4L 3WDJA 3D3VA 2R9HC 3GMRB 4HSQA 1QBBA 3H7BA 4FTVE 3FB6B 2H6PA 1MCFA 4F8QA 4Y2DA 3BWAA 2WBJC 2P24B 4FQXA 2FR4A 4EXKA 2R2HB 3I75A 2IANE 1UT9A 5JHDA 1B0RA 4JREB 1BP3B 4X4MA 3OKMA 5ID0A 3VXRE 4E42B 4JRYA 4IS6B 1HI6A 4Y16A 1DQQB 5B38A 5T3ZL 1HHKA 3W2DH 4YHLH 3OZ9L 1NBYB 4I3RL 1TENA 4ZOBA 4RISH 4UAOC 1E6JH 2OI9C 3QO1A 3QR2A 1JZ6A 4M43H 7CGTA 4XMPH 4LLUA 3GI9H 1UWEH 3CSPA 2VLMD 4LLMA 2K7QA 1MY7A 5CWSA 4GT7A 4LBEB 3MFGB 4HV8B 3RHWK 4L29B 4M9PA 1T20A 1S7WA 3RVVD 4KHXL 5DA4A 5DJYA 5IFHL 3MRRA 1RZGB 4JR9L 1ZHNB 3O45A 4N9GB 4NKIH 1HWGB 1OAYH 4OQTA 4DVRH 4KVCL 4M4PA 3NGBB 5I8KL 3V0AC 3QQ9D 4X6CF 3S4SB 2XT1B 2DQDH 1I85C 2DD8H 4L8SA 1M71B 4JQXC 5TFSL 3CFIC 1L7TH 4AL8H 4APQB 3DUUB 4O4YL 3G5YB 3U2SA 1CQKA 3LSOB 4OUUB 1NUDA 3KYNA 4NN7C 1EVUA 2A6IB 5JMOC 3FT4A 3KPOA 3KYKL 3LKPA 4D0CB 2HYMA 2YPLD 2BY0A 3LDBC 3WIFA 3BMWA 1DVFC 4U1JA 4F7PB 1NGQH 1WFTA 3D0VB 1PEWA 1FYHB 4GG8A 1UFUA 3PWVB 2DM2A 4N0CD 3FQWA 5EO9A 5J13B 5FF6A 4MAYD 5DJZB 1IEBA 3NIDF 4WFHD 4MHHI 4LK4A 2YRZA 2RFXA 4FQ2H 3IJHA 3NZHH 2VDOH 2DLFH 1TVBA 1IC7L 1JHLH 2IC2A 1M1SA 4F7MB 3LIZL 2R1XB 5CJXC 5B21A 4QRRB 2OJZL 4K9EL 1S9WB 3AM8C 3KPPB 1QEWB 1RY7B 3HI5H 3DO3A 2ADFH 3L3JB 4QKXB 2WZPD 4ZPVB 2WUCL 1CD1B 3V4VH 4BZ1H 5KJRL 1FL3B 3GSXA 2R1WB 4QRPE 4U7KA 4ZFOA 3O3AB 1KNOA 2AXFB 5L0QC 3LN5A 4N5EC 4M93C 4LIQH 1WT5C 4NO0D 4RGOL 3BDYH 3EGSB 1W8NA 3GM0A 4BK4A 4U6YA 1PKQB 3SDXE 4CJ0A 4FQIH 2PTUA 5EA0H 3OKDB 4ZFGL 2XTJE 4NDMA 4UQ2A 4QHLA 5C0FA 4KY1H 2HN7A 4BKLB 1CXKA 4UB0L 2I24N 3B9AA 2AXGB 5TF1H 1HDMA 3GNMH 5DYOA 1JZ5A 1NCCL 3PWPE 1U2HA 3V79C 3S98A 3T0WA 3BJLA 3GHBL 1U8OA 3H0TB 4L8DB 4R4FL 2C3VA 2B39A 2EKSA 4AENA 3P4NA 4Y4HC 2V7HA 4FFYH 1OSPH 2X1WL 4LPUA 3VXQA 1LP9B 4K3JH 5D5MA 5DLMH 4LRIA 5DSCB 3S3PA 4HC1L 1CF8L 4G7YL 3KWWA 3OKEB 1T1ZB 4HH9B 4X0KA 4LCWB 2RQ8A 3ESVF 2AQ2A 4PYGA 3FB7A 2HWZL 4MD5B 1K4CB 3MRJA 3N1QC 3IDYB 3E1F1 3OB0H 4HCRA 1R3JB 3MMEA 4QHNA 2AJUL 1OTTD 3V5DA 3VD5A 5J11C 1QR1A 2CQVA 1S5HB 4MJ6B 1SM3H 4JFQA 4NM4L 2JB5L 4L3AA 5DJ0B 2Z4QB 1DQDL 4KJYB 4YZFF 4U0RC 4M62L 4E5XA 2X70A 1NC2D 2GCYB 1HOCA 5EU3B 2X4RB 4C56E 1AY1H 4PG2C 3ARED 4N5UA 4YWGL 4FMFA 2CUIA 2GJ6A 5FHAL 1ORSB 1TTGA 1XIWC 4RWYL 1QHOA 3MODH 3W11C 1UCBL 5I1JH 3L5WB 1Z0MA 3O3DB 5IBTH 4QWWD 1EO5A 1JTPA 5KN5B 5JIKA 3GO1L 1FZMB 3DVGA 3LS4H 5JOPD 1M7DA 2A9ML 3T0VA 5KVEL 3HI6L 1C12A 1FPTH 4OCXH 3SBWA 4XPFL 3ARBA 3QCUL 5K93A 5AWNL 3O6LH 1HHHA 4NJ9H 5DJAB 1H15A 1YPZF 4LLDA 4HG4K 4NJAH 1LO0L 3ARSA 1UB6B 5DJ6A 3KYMB 3O81A 3NCFB 4NKDB 4LPVA 3PWUB 5LWYL 3N85H 3H7LA 3UJTH 4P9HL 3VA2C 3HLAB 2D9QB 2NY1D 5MEPB 1YEEH 1HYSC 2E27H 1AGCB 5FGBA 4QHMA 1J5OH 1LEKB 5DQ9A 5AAMA 4X5WB 3UTSB 1XF1A 2VWEE 1EBAA 1NEZB 1P9MA 3QEUA 4G8GD 2LTQB 2W9DH 2EH7L 5EUOE 3BP7B 1K8DB 1NFIB 3CFCH 4NQCA 2KL6A 4IIQA 3OTTA 4LCYA 1ITBB 1ZVSA 3WJLC 4HKJA 4MDJB 4CMHC 4DAGL 3IFLL 2W65A 5GS2H 3QYCA 4P2QB 3ARVA 5KW9L 5CIPH 2Z91A 5DZLA 4Y4FD 4IJ3B 4WHYH 3ELAT 1JGVH 1F4XH 3K4DA 4ODWB 5D7LB 2IBGA 4Z7QE 4GXVH 3Q48A 1TZGH 1KJ2L 3IT8D 1CICD 2HT2D 5GRXG 1D3CA 4OKVB 3GIVA 1SMAA 5GISL 5D7SH 3G6JA 4PTUA 1H0DB 3QCTL 1KTDB 2IH1A 2VISB 3O41A 4LSSH 2X4UB 3E6HB 5E2WH 3VXNB 3SDAA 5E1AB 3U48A 2VIRB 1U8JA 5ALBL 3FRPA 4RSVA 3UTZA 3QWQB 3Q2CA 5E9DB 4QXTB 5TDOB 3VFOA 3EYOA 4XI5D 3BD5A 3EKCA 1WBXA 2G2RA 3C5JB 5LGHL 2NQCA 4HWZA 4WU7B 2JJSC 4OCLC 1GYAA 2Z9TA 1TJHH 4FFVD 4JDVA 2Y6SC 4P5KB 3V6OA 3IDJA 3H6JA 1NMCC 3DX9A 3MV8E 3LN4B 4NQVA 3QIBA 3MV01 4X6DE 5HHOE 5DVLA 5I1KH 1FH5L 2CDEB 4OIBA 3WS6A 5AG8A 1IKFL 2RHEA 2EEAA 2NNAB 3CFJB 5DEGA 4OLUL 5GPRA 3MJ8A 2R69H 4BJLA 4NQUA 2BRQA 1IVLA 3P11H 1U8IB 3PQYE 3DLQR 3RVWD 2YPVL 2AEIT 5EU5A 4IRZH 1P6AB 3MLXH 4YDLC 4ZQKB 1A3RH 3HG1E 5KZCD 5BRZB 2DS4A 3HNTL 4YBQD 4HAGA 4P49A 2CRYA 2DWEB 3CUPB 3IJSB 4HJGB 3VFGH 1EGJA 3VI3E 2XN9D 4K8RD 3DYMA 3C08L 3ILQC 2PR4H 3T0ED 3TC9A 2OZ4H 3BGFB 1QLRB 4XAKE 4DKFH 4WIQA 3SDDC 4HPYH 1DFBL 5C9JB 1U95B 1FORH 1MH5B 4IMKA 1WWCA 1CGSH 3FONA 5GZNC 1AC6A 3L3KB 4JKLA 5JA9A 1ZSDA 3QHTC 5IBUG 4Z7WA 1ZGLB 3QUKA 5GGRB 2CGRL 1F8TH 2HKHH 3C2SA 5KAQF 3UYPA 3MC0A 2CSPA 1AJ7L 4X4XA 1NFDF 4MQ7A 4NQEB 5BO1L 4F3FA 4UV4H 3K1KC 4KK8C 5DQDL 3ULUE 3QIWA 2CO7B 2V5YA 3P77B 1A14L 5JPNB 3QI9A 1BX2A 4HUVA 4KKLD 4OFYA 4TQEL 4S10A 3RNQB 5SWSB 4PRBA 1Y6KR 1I7ZA 4RQQA 3P9LB 4PJIA 4UOW1 2VLKD 3NH7L 4MNGB 4WCYL 3AS2A 1YN6A 1OT1A 4GMSL 2E9BA 3SO3C 5GRJL 5JXAL 3DXAD 5ABDE 3CX2A 1IAMA 5AUMB 4HT1L 4S1QL 1FNGA 3PHOB 4YHOL 4Z7UF 5T3ZH