3LS5H

Anti-tetrahydrocannabinol fab fragment, free form
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
219
Chain Sequence
b'EVKLVESGGGLVKPGGSLKLSCAASGFTFNNYVMVWLRQTPEKRLEWVASISRGGSTYYPDSVKGRFTISRDNARNILYLQMSSLRSEDTAMYYCVRGTTIVAGDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light chain of antibody Fab fragment
publication title A structural insight into the molecular recognition of a (-)-Delta9-tetrahydrocannabinol and the development of a sensitive, one-step, homogeneous immunocomplex-based assay for its detection
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 45
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2010-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ls5H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ls5H01
1JFQH 2VLJD 4OFYA 2PO6A 5DD0L 1HYSC 2XN9B 5L6YH 2BY1A 3KHQA 4D9RE 3TIDB 4C83A 1JUFB 4BA8A 1XGYH 5EC1A 3N1QC 4YIQA 4I1NB 2XYCA 2CMRL 5I1CL 3F5WA 5IM7B 1CF8H 3V6ZB 3EZJB 3O4LA 3T0XA 4OZIF 2F54E 4K9EC 4ODSH 4DGYL 4AK1A 5AAWA 3RNQB 3BJLA 3MLYH 3GSXB 1C12A 4ONOA 1M7IA 1IC7H 1S7WA 5F89A 3ULVC 2BC4A 3QR2A 2ZZUT 3O0RH 3UBXI 3SBWA 1YNLL 1FIEA 4OD1H 1GIGL 2VXVH 4HBQA 4ELKA 2F58L 2QTEA 5IJVB 4C4KO 1BM3H 4XCNB 1QEWB 3PWUB 2FX8H 5HYFA 1CD0A 3ARRA 4KTDH 2HAZA 2OTPA 3CAFA 4PB0H 4PP2A 2VR5A 4XNYL 4Z18A 2EO1A 1JPGA 2APVA 2A6DA 1B4RA 1NKRA 1B6UA 3HE7A 3UX9B 2AVGA 3RDTA 4HKXA 1YEHH 1UM5L 1IAKA 2AERT 5JHDE 1CG9A 3WDJA 2PXYD 5IESL 2GFBA 4QRQA 1BVLB 3RUGE 2B5IB 3KLSA 3PL6C 3WS3A 3QI9A 1KFAL 1TQBC 2RJMA 1MCSA 4KGJA 5IP4A 5BOPA 3S9DB 1Z6JT 2NY1D 2XTJB 4UU9B 2J3SA 4PTUA 1HCFX 1U8JA 4XNUL 1A9EB 1ERNA 1D3CA 3OJ2C 1EH9A 5ABDE 5LCVL 4KVCH 4U6TA 2EH7H 5INCB 2VLMD 1AO7A 5LGJA 4K3EL 5C0JB 3D25A 4N0UA 3ZDXE 5EBWA 5FYJD 3JWDC 4N9OB 4GKZA 1F97A 3TH4T 1Z3GL 3O9WD 3QHFL 5E2WL 4JRYB 1J5OL 5ID0A 1HNFA 2VABA 4FXGB 3MNWA 2H26B 1BJMA 1MCCA 3OR6B 3IDIB 5GXBB 3MRQA 3KPRB 5IMKB 3IFLL 1H3UA 4KRPC 4M8QB 1T66D 3RUGF 1Z0NA 3EJYC 3BZ4A 4G7YH 5I1AA 1IRAY 4FQIH 2DYPD 4K3GA 3DBXB 1MQ8A 3DHJA 4XNZB 4PS4L 1KSRA 1KTDA 4ZFOB 1F3DJ 2HT4D 4HWEH 1KEGL 3JV0A 4F3FB 4YBHA 1T5XB 5IFAH 4M7JL 2I9TB 4KY1L 5CGMA 3SDCA 4KI5E 4ZXBB 3ZDXF 4MCZB 5IR1A 1GGCL 4XP6H 1FIGL 4LARH 1WZLA 4LP5A 4PY7A 4MA7L 3ZLQC 4LLVB 5M7QA 3LOWA 2J5LC 4ZFZA 1L6XA 4KWUA 4K7FA 2O61A 3EYUH 1KJ2A 4P46C 3NACL 2P24A 1QOKA 3LQAC 1FVCB 5FB8B 1UWXK 2OLDA 3DGGA 2NY5H 4N0RA 1IGML 3K8LA 2PO6B 4LLDA 2P8LA 4TNVK 4WI8A 4L29A 4JO2H 3VGDA 4PJ5A 1EJOH 4PV9A 4C83B 4UAOB 5EC1B 4OZHE 4YIQB 4DK6A 4AY0A 4H1LA 4KI5F 3ZDZE 4NQDE 4ZFGH 3F5WB 2IFFL 2EDTA 4ETQB 3O4LB 1LDSA 1RUKL 8FABA 5CSGA 1RUPH 2CR3A 2NY0D 1CGSL 3W0WD 1C12B 4Z7VA 4HX1A 1M7IB 1S7WB 3QULA 3I9GH 5F89B 4OKDA 5GRZA 2BC4B 4KMTH 3K2UH 5I2IA 3OKNA 3VFOA 1MCIA 3BIAX 5C0CD 3CH8A 5E8DL 1D5IH 2ITCA 2KL6A 4ELKB 2Q7YA 5BS0A 3ABZA 2R0KL 4WW2A 1SM3H 4ZS6D 5TPWH 1ZLSL 2ERJC 4WEMB 4KKLC 4PP2B 4ZFOL 1JPGB 4DKAA 4OZHF 4Z7QE 2A6DB 4WUKH 2P1YA 3TZVD 1A21A 2CDFA 3HE7B 3X11A 3ZDZF 5LVEA 1YEGH 3RDTB 4HKXB 2R1WA 1AD0A 3EDJA 1IAKB 4PLJC 1B90A 1CG9B 3P0YH 4DJMA 2DD8H 2GFBB 4LGPB 3O41A 3U6RA 4YDKL 1WCQA 2B0SL 4QRQB 5EH1A 2HTLD 2A9NH 3ALWA 4J4PA 1OTUD 4KRLB 9CGTA 3TPKA 4F15B 3BX7C 1NAMH 3WS3B 1HXMA 3QI9B 5DK2A 4WHTA 2AEPH 5CEZE 1TZGH 2NY2D 4TSCH 1T21A 5ENWA 5C0AD 1IZJA 5D7IA 4PTUB 1U8JB 4LOUC 3T0EC 1NCCL 3QXAA 2VAAA 3C60A 3DETC 1AO7B 5LGJB 3D25B 4N0UB 5EBWB 2HYMA 2FEDD 3LN4A 2HRPH 4NN7B 5JXEA 3MJ6A 1RZJL 3KPOA 4R7DA 5ID0B 1U3HC 2VABB 3QUZC 3VFUA 3MNWB 4P2OA 4P59L 5B22A 5T3XL 1FCGA 3H42H 4I48A 4H5SA 4LSDA 3MRQB 1DBBL 3GRWA 2ESVD 4CBPA 4AYFA 3A6OA 4Q7DA 2DQIH 4Y1AD 1PSKH 3BZ4B 1OP3K 5I1AB 1I85A 1IGIL 4WGWB 3VFGH 3DSFL 1TTGA 4WDIA 1KTDB 1MHEA 3M8OH 1NFKA 4BQCA 3D9AH 3B5HA 1YN7A 4N0CD 4G9DA 2NY3C 3SDCB 2J1KA 5GSVA 1CCZA 4ZD3H 5IR1B 2APWA 4FMKA 4YEFA 3NFSH 1V7NH 5L7XH 3HKFA 1AJ7H 1JTPA 5D7SH 4PY7B 1ZLUK 2DQTL 3LDBC 4WTXA 4HG4K 2N1KA 4ZFZB 4XHJD 1T2XA 3IJYA 1F4AA 1W72H 1CBVL 4K7FB 4LLYA 2O61B 4BSVB 1KJ2B 3V7AE 2P24B 3U7YH 2FWOA 2C7UA 3DGGB 3MLWL 5SX4I 1BEYH 3KPQA 3GIVA 2VISA 4FZEH 4LLDB 2P8LB 1D5ZA 4L29B 1UZ6E 3RX7A 5DMKA 4PJ5B 2ITDA 3UYRH 5HYQA 4PV9B 3WKMH 3VRLE 4YBLB 4OCYL 1Q9LA 3BPLC 4PUBH 4H1LB 4FQQA 4M1CD 3O6LL 5DD6A 4OI9A 5HVFB 2HN7A 8FABB 1IM3A 4NQSA 1OD7A 3H6JA 3LSOA 1ND0A 1E4XI 2X89A 3INUL 4NQEA 4Z7VB 4HX1B 3QULB 3NA9H 5F7KC 3MBEA 1FLRL 2GTZA 1MFNA 2C3GA 2XXMB 5I2IB 3OKNB 3VFOB 2ADFL 4OTXL 5I6XC 1OQOA 4KHXH 3DI3B 5MHSD 4ZNCD 2ITCB 3ESVF 2Q7YB 3MYZA 5BS0B 2X05A 4WW2B 5BVPL 2IQ9L 5EU7C 1E6JH 2C5DC 1UZ6F 3S8WA 4EBQL 2ID5A 3VRLF 1EBPA 2P43B 3S3PA 4WFFE 3VXSA 2CDFB 3UPCA 3X11B 3CLEL 4ZSOE 2R1WB 2E5EA 1I7RA 1AD0B 1TENA 2X9YA 2BNQA 2NR6C 4LLUA 4X6DA 1BGXH 4M3JA 3O41B 3U6RB 3ZT7A 3A6CH 4KC3B 1AXIB 3CVIH 4B7IA 4YDLC 4Q9CA 3T0DA 1MCHA 3FKUS 1HXMB 2MKWA 4X80H 5DK2B 5DMYA 1LO0L 1FAKT 4WHTB 1FRGL 2ZCLL 5I1KH 5I8OL 4OLUL 4LIQE 1U8HA 3D18A 2DIBA 1S7SA 2VLKD 5LG1A 5IQ7L 4PRAA 1T21B 2YEZA 5ENWB 3UTPE 4S10A 1KJ2L 3EYVA 5D7IB 3TJEH 4HC1H 3BIKA 3QXAB 1RULL 3R06A 2VAAB 3C60B 1T83A 4BH8A 2VDOH 2BOBA 3U4BH 2WUBH 4OLXH 3LN4B 3QCVH 3GM0A 1UEMA 4DTGL 4FTVD 2AS5M 2VDLH 2P5ED 4PJGE 5DQJA 4JFDA 4EDWH 2R23A 3IU3A 3KPOB 3QZWA 4R7DB 5ADOH 3VFUB 1OGAD 1CL7L 4P2OB 4W6XB 3KPMA 1A0QL 3O8XA 1BMGA 1U58A 4I48B 2UZIL 4H5SB 4HUUA 4EIGB 1KJ3L 1T7XA 4Y8AA 2AJZA 5E95B 1WIUA 4OCWH 4OIAA 4JFFA 1S5IL 4GT7A 2CUHA 3CX5J 1FO0H 3ALXA 5T1KA 3DV4A 5FYLE 3JV4A 1FNEA 1P5UA 4WDIB 3RQ3A 2VDKH 1H15A 1PBYA 1MHEB 4LCCA 3ZL4H 4EUPG 4AG4H 1MFBL 4LCWA 5JUEH 4RGNC 1YN7B 4XVSH 4G9DB 4DKFL 4XNXL 4S1QH 3VRIA 1AR1D 3MRPA 3C6LA 3VFRA 5JOPE 5GSVB 3DYOA 4KK5D 1PDKA 3EYQC 1DR9A 4NRZA 4U0RC 3V0AC 3ULUL 2BXZA 4HIJA 3KJ4B 1VB9A 3IFPA 4Y4HD 3RKDD 3VW3H 4PJGF 5EZJA 4Z0XA 5A40E 4JPWL 2JELL 3DURA 2PTVA 3B83A 2R2CA 1XF4A 3O3DA 1TCRA 2AJVH 2AQ1A 1R5IA 3IJYB 4WWKC 1ZHLA 4LLYB 3FO9A 4YXLH 3KXFE 4BUGA 1JZ5A 4PJ7A 2DF3A 4OLYL 2QQNH 1XGTA 2FWOB 2C7UB 2X70A 4NNPH 3KPQB 3GIVB 2VISB 5KSBE 2APTA 2BVQA 3MUGA 4JG1H 3WJJC 1D5ZB 1DVFC 5E2TH 5JMOC 2BNUA 5DMKB 2ITDB 5HYQB 4P2YA 4LIQH 3A67L 3NMEA 3VA6A 1RK0A 1Q9LB 4I3SL 3W2DH 2Z8RA 4FQQB 4C54A 3H9HA 5DD6B 4BJLA 1S9XA 4ZPTA 1I3VA 2HN7B 2VLJA 4Z5RA 4N1HB 1OAKH 1IM3B 2VDQL 4NQSB 3LSOB 2HVJA 4JRXE 4MHHG 4UV4L 1ND0B 1EFXD 1PGRB 4NQEB 2VITA 1CZ8H 3ZKSD 3MBEB 5DEZA 2GTZB 1YYMH 2X1PA 2HKHL 1CIUA 1ZEAH 2H2PD 1UVQA 3GRWL 4LPWA 2EDOA 5JHDD 2VZ3A 3CFCL 1CFVL 3HUJE 4KFZC 2QHRL 4XPBH 3V2AR 1P69B 5KSBF 5CJBA 3OKOA 4HD9A 2RGSA 1WZKA 1XMWA 1OCWL 1DDHA 5FKPA 2HJFA 5FYLH 5E6IA 5H37G 2ZJSH 2RIKA 4YXKL 4MNQE 1YMME 2C1OA 3VXSB 2DMCA 3WFCH 3VFWA 1I7RB 1Q38A 4YXHH 1PAMA 3KGRA 2BNQB 5D1ZD 4LLUB 4X6DB 3DUUA 1G7PA 1XCTA 3QHZL 2AJUL 2EDYA 4J23A 4WU5A 3BDBA 1JNJA 1RUAL 4D0CA 5C07B 3T2QA 2GY5A 1ZHKA 5BRZE 1NFDE 5IF0A 1SJHA 4P3CH 5C71A 4XAKE 2CIKA 5F96L 4KKBD 1OT1A 4CU8A 1U8HB 4BZ1H 3D18B 1S7SB 3HUJF 5BJTA 4M62H 4JRWA 1I1AD 2YEZB 4PRAB 4R4NC 4FFYH 3MXWL 3EYVB 5DYOA 3IDYB 1OPGH 3BIKB 5TH2A 2NW3A 4F7EA 3R06B 1QFWL 2CIIA 3KLHC 4BH8B 2DWDA 2PETA 4DN3L 3L6FA 5IUSA 4OFKA 4MNGA 3WHXA 1YC7A 1GHFH 3GK8L 3NZ8A 5DQJB 5MEPA 4JFDB 2R23B 3IU3B 3QZWB 5A16A 2IPKA 1M05A 1MAML 2WBJA 3KPMB 3VXME 3O8XB 4IEFB 4XMLL 1U58B 4X8JA 4HUUB 4GQ9H 4APQA 4OD3L 3BO8A 3AUVA 4OIIH 4HPOL 2BSTA 2J2ZA 1MI5D 2IADA 3BDXA 4JO3L 1NL0H 4ZOCA 3NFPA 1NFDF 4JFFB 1I75A 1L7TH 3SKMA 5ELIA 5F93C 2AK1H 5T1KB 2XA8H 3DV4B 5LKNA 1DBKH 3CXDH 5LBSL 3JV4B 1FNEB 1I4FA 4TOYH 1H15B 4G6FD 2VE6A 4LCCB 5AZ2H 3GKWL 5EORL 5E8OA 4H0GA 1SYVA 4LCWB 5EOQL 4OM0H 1I1RA 3FQNA 4M9PA 2I5YH 3AXLA 1OW0A 4K7PX 2B1HL 3OAZK 3VRIB 2CJUL 3MRPB 3C6LB 1WWAX 2PTTA 3VFRB 2BRRH 4AQ1B 1U42A 1R5VA 4M7ZB 5IMMA 2MTPA 4NRZB 2ZSVA 2YRLA 1SBSH 5DJDA 3VJ6A 2J6EA 4HIJB 3IFPB 5KSAA 2R2EA 3STZA 3G6JA 2JE8A 3VI4E 2F9BT 3STBA 5EZJB 4Z0XB 3ZTJG 4NBZB 2P5WD 3DURB 4D8PA 3H9SE 3NGBB 2LE9A 3QIUA 2V9RA 3MJ9A 3MLXL 4NZJA 1XF4B 5DUPL 3O3DB 2B5IC 3H9ZA 1TCRB 2APBA 3I6GA 2VKWA 1DN2A 1ZHLB 4N1CA 3EOTH 3FO9B 5TJWK 4PJ7B 2EC9U 5CGTA 1XGTB 3DROA 3CFJA 2X70B 4U31A 1MRDL 1HINH 5KVGH 3DUSA 4X9HA 3MUGB 4J2XA 1GCFA 2XTJC 2YHGA 4A6YH 3SKJH 2BNUB 4LHJB 2X4PA 1TJIL 5B3JF 3VXUE 1RK0B 4P2CG 1DE4A 3U4EA 4LDOB 3H9HB 4XVJH 4KHTH 1S9XB 1N59A 4ZPTB 5B39A 5D96B 2VLJB 4Z5RB 1PLGL 3HCVA 2HVJB 1QLEH 2Y07H 4LSRL 4M7LT 2VITB 1FGVL 3HMWH 4NZTL 1DSFH 1E4JA 3VFTA 1BLNA 4IDLA 1RJCA 1UVQB 3MRBA 1DQQA 3SJVA 1LEGA 2VN7A 5GRYA 4DZ8A 1GZPA 5C0GA 4XNZC 2Y1VA 3W0WA 3IRZA 3F6IA 4JPKL 3QXTA 4LRIA 5GQBA 1T2QH 1ZXQA 2YUVA 3PQYA 5FV2A 4RMUA 1WWCA 2VIRA 3OKOB 3RJQB 3S3SA 3NZHL 5FKAA 3U9UA 1DDHB 5DHXB 5FKPB 2HJFB 3A6BL 1A6PA 5I0DA 3PJSA 1K4DB 4ZXBC 4PRHA 2HT2C 5CEZD 2C1OB 1FZMA 1DBAH 5IBLD 3VFWB 2WWKO 1JGLH 3B5TA 4LCUA 1IAIM 1FE8L 3DUUB 1G7PB 4FS0A 4WU5B 3K4AA 3QEUA 4D0CB 5D2LE 2ZUUA 2VL5A 3G9VA 3NCYP 1ZHKB 2Z31A 3MRMA 2Q8AH 5IEHA 1RFDL 5IF0B 3DMMD 1SJHB 2CIKB 1CR9L 4OJFH 4KK9D 4XPTH 1AC6A 4YGAB 3BKJL 5BJTB 2PO6C 4FQXD 1NEZG 1NFIA 2AGJL 5DYOB 3BHBA 3MZGB 3T0BA 2NW3B 5TH2B 4F7EB 1IT9L 5DZOA 2CIIB 4ONGH 5I19H 5CINH 3U0WL 3ARBD 4N90E 1JNLL 2DWDB 1RZJC 4KU1A 4TTDD 3TH2T 1U6AL 35C8L 3L6FB 3QUXD 3VFNA 3O2VH 3D39D 4POUB 4MNGB 3D69A 3WHXB 1JWUA 4RMVA 2NY1B 5MEPB 3NZ8B 5A16B 1UT9A 3G5YA 2IPKB 5DJ2A 4OLZL 1M05B 2PYEE 2WBJB 3V0WH 2DQUL 4X8JB 3HNVL 4APQB 3MUY1 3BO8B 5HGDA 5D2LF 3SBWC 2BSTB 1KGCD 2MCG1 2IADB 5DMIH 3NFPB 4LNRA 3SKMB 1S9WA 3N9GH 5C3TA 1JK8A 4L4TE 3BKMH 1I4FB 4R8WH 3KPPA 2VE6B 5DRZA 5E8OB 1SYVB 2VDNL 3RIFF 3FQNB 1P7QD 3AXLB 1CK0H 4K3DH 2NXZB 3SOBL 2PTTB 4PJXA 1ZANH 1R5VB 5IMMB 2F8OA 3SE9L 2AJ3A 2DI9A 2ZSVB 3HE7C 1A6WL 5DJDB 2W9EL 1WFNA 3GIZL 3RDTC 3VJ6B 4L4JA 5KSAB 2R2EB 3STZB 3G6JB 1JGEA 4NO2A 4WWID 2E27H 1LWRA 1DL7L 3UP1A 4NWTL 4D8PB 3QIUB 3HAEG 5I1HH 2DMKA 5ALCH 1AR2A 3I6GB 4F15C 2YC1A 3QI9C 4FNLH 4OZFA 3DROB 2B2XH 3CFJB 3MBXH 3S4SG 4TUOA 3DUSB 2DLHA 1UZ8A 1UH2A 3BP6A 2F8XC 3MA7A 2X4RA 1ZT1A 1SMAA 2X4PB 3L3OA 4EI5D 4KK8C 5F7EH 3BE1H 1DE4B 2JJWA 3U4EB 5AG8A 4WI5A 4M4PA 1BFOA 1W2KT 4H0HB 1RJLA 1N59B 1AQDA 5HHPA 5B39B 3HCVB 1MWAH 2Y7QA 2J8UA 4MS8D 4LSVL 5EZIL 3LPFA 1F8TH 1OM3H 2OP4H 4WFFD 3VFTB 1BLNB 1OP5K 5C2BH 1MCWM 3IAGC 3U30B 4A2LA 3IAPA 3MRBB 1DQQB 1LEGB 4DZ8B 3QCUH 4R4BA 1GZPB 1YA5A 5C0GB 2YZ1A 1KLUA 3W0WB 5T3ZH 1NGPL 4NZUH 4KJYA 3UAJC 3PQYB 2VIRB 5FKAB 3U9UB 3WN5A 3SDCC 4JREB 3WHE1 3MCG1 3PJSB 5F9OH 5E9DE 3QDHA 4I4WB 4PRHB 4IM8A 4KUZH 1FZMB 1YEKL 4ZQKA 3RZCA 5DQDH 4LCUB 1MJJA 3G6DH 1J1XH 2CXKA 1I9EA 2J6EL 1ULVA 1UCBH 4QHLA 3QEUB 1INDH 4JFEE 4YLQT 1KN2L 1NH6A 2BCKA 2BK8A 1OQXA 2VL5B 4MVBC 5D72H 1EHXA 4NCDA 2Z31B 4NJAL 3MRMB 5D71H 5IEHB 3MJ9L 1DQTA 2R9HC 1UB6A 6CGTA 2BFVL 2W65A 1Q9OA 1IE5A 1ZAGA 4WY7L 2PCPA 1U8LA 1IZKA 4M4RA 4GRWE 2XZQL 3SGJA 2KUTA 1NFIB 1NCDL 3N85L 3BHBB 4G6MH 4L3ED 1IC5L 3SO3B 3GMQA 4M7LH 4YBLC 2R4SL 4ZNEE 3FHQA 3UTTE 2DQEL 3UO1H 2RR3A 1JMXA 5FGBA 3VFNB 4WVRA 1QSFA 3D69B 4C58B 1JWUB 2NY2B 3GUTA 1I3UA 4NJ9H 4YDVA 5MP6L 3U0PA 3G5YB 5DJ2B 1N0XL 1PY9A 3WIHH 4EKXA 2F53E 1F4XH 5B4MC 3RKPA 2YKLH 2ADGA 3NH7L 5GS0H 25C8H 3OTTA 5HGDB 5JOEA 3LKQA 3P9MA 5I8KH 1RV6X 1J8HD 4LNRB 2ICWJ 4WUUE 5BMFH 1T1XA 1S9WB 4WEBH 1E0OB 5IB2A 1I9RL 1KEML 1JK8B 2R8SH 5DRZB 3KPPB 1P4IH 1X44A 4WW2C 4B7LA 4GRWF 3MCKA 5ALBL 4KGLA 3WIIH 3ULUC 3ROLA 4OZIA 2FHFA 3FQUA 1JP5A 1RK1A 4PJXB 3TN0A 4LLMA 5KG9A 3OXRA 2AJ3B 5F7UA 3TA3A 5L8LB 1V3MA 1HXYA 3IKKA 1JI2A 3W5MA 1JGEB 4NO2B 6FABL 1M4KA 3F6LA 4LGSB 1GGTA 1QKZH 3EO1A 3Q6GL 4YHIA 1J1PH 4J4PC 3UTSE 3P3YA 5C6PB 3ARGA 4Q6IC 5KJRH 5HXMA 2YC1B 2BDNL 4JRXD 5F71A 4OZFB 2A9MH 3CMGA 1S5HA 1MEXH 4TUOB 1UKQA 3FONA 5GJTH 1UZ8B 3BP6B 3MA7B 2ZUVA 2X4RB 4R3SA 1ZT1B 1PG7X 3QWOA 3MOBH 3C60C 3L3OB 2F54A 4GRWH 1L7IH 3MOAL 2FO1A 2DS4A 1FL3A 1BFOB 4JB9H 1B2WL 1RJLB 4HIXH 1UWEH 5D7JA 1AQDB 5HHPB 3BGFB 4YUEH 3CDGA 2ZCHH 1EO8L 1KCKA 3F65A 2Y7QB 5FM5O 2J8UB 3MR9A 4P2OC 3ME0A 1RZ7L 1DUZA 3BFOA 5E99H 1ZGLM 4Q0XH 2Q87A 4JM4L 4PRNA 3QISA 1I85C 4YWGL 5HI5C 1T03L 5MENE 4X5LA 4R4BB 1EFXA 1D7FA 1KLUB 4XCEA 1YJDL 2QQLH 2FD6L 4KJYB 4LKXA 3STLA 4FFVD 4UT6H 5I1GH 4LSTL 1CFNA 1EEQA 5FHAH 3GM8A 1HQRA 2O93L 3I50L 1X3DA 4HCRH 5JHDA 3W5NA 4NKIL 4PREA 4ZQKB 1CDBA 3RZCB 3FB6A 3KJ4C 1P53A 4EZMA 1A7PL 2QQQA 2XKNA 3RUGA 3ZE1E 1MJJB 1DANU 3FHAA 3T0EE 1Y6MR 1OTSC 2IC2A 5I76A 4RMSA 4HFWA 4OQ1A 4R9HA 4QHLB 4XPHL 3F58H 2BCKB 3T77A 1P7KA 3S88H 1T4KA 3FL7A 1UB6B 3PGFH 3V0VA 4Y89A 4ACPA 3C5JA 2W65B 4WENB 1N7ML 5IOPA 1X5AA 2PCPB 1U8LB 5E8EA 3MLPA 3GSNH 5EIIA 4M5ZH 1BFVH 4NGHL 2DLFL 4MGXA 2W9DL 1YQVH 2FNBA 4DWHA 4I2XE 4ZTPL 4Z7UE 1EGJH 2KQMA 2YPVL 1QSFB 2YD2A 4M6OL 1LVEA 3GUTB 4PYGA 1A6TA 4MHHI 2FATH 4YDVB 1I1AA 3U0PB 1VFMA 3U9PH 3ZE1F 1BQLH 1WFTA 1KB9J 4LSPH 2ADGB 3MBEC 4XP9L 4BUHA 3MUJA 3PDDA 1NQBA 3LKQB 2R56H 3P9MB 4LU5L 4X9FA 1XF1A 2BERA 2M2DA 1T1XB 4UNVA 2GHWB 3BPNB 5IB2B 3PDOA 3H9SD 4WFED 3RTQD 4KH2A 3ARWA 4UOW1 3MCKB 3R0MA 1UCTA 5DS8A 5DGQA 5AZEL 3R8BB 3ROLB 4OZIB 3GKZA 1EVTC 1KXTB 3FQUB 4K8RH 5HDBE 1RK1B 4JHZA 4JKPL 3TN0B 4LLMB 5KG9B 4NKOA 3OXRB 1NAMA 3TA3B 1KF9B 4Z7UF 5C6TH 4MQXC 1HXYB 1MSPA 4RNRA 4HBCL 3EO1B 1I9IL 1N26A 5D1QD 1IFHL 4YHIB 2FCBA 5ECJE 3RL2A 4FZ8H 4HJ0D 1JFQL 4K7PH 3ARGB 4FFWC 4DAGH 3EZ8A 4C55A 5L6YL 2A0LC 1YYLH 2ZG2A 3B9VA 4LKCA 4P2RD 4D3CH 3NCMA 1S5HB 1A7QH 1AQKH 1CD8A 4RMWA 2E9IA 4OZHA 4NUGH 3FONB 2E7CA 1DQLH 4S0SD 1CF8L 2WINA 3IDYC 4R3SB 4NQDA 3QWOB 5GJSH 4ODSL 2XWJA 2AXGA 1T83C 2F54B 4WI3A 5ID1A 3MLYL 2F15A 3OR7A 5HDBF 5FM4A 1FL3B 1IC7L 5D7JB 1J0JA 4MQ7A 5DJXA 4S1DD 3CDYA 4CN1A 3CDGB 5TDNA 3O0RL 5GRJL 2H1PH 2B39A 3S7GA 3MR9B 3UXFA 4OD1L 3O8XC 4M93B 5GRXG 1BAFH 2ZUQB 1EXUA 2FECI 1DUZB 3G5XA 5GZNC 2BHYA 4WNQA 2FX8L 3W11D 3O81A 1SJEA 4KTDL 4PRNB 3RVUD 3CJJA 1VGEL 1F6FB 2EIBA 1BECA 5C09E 4PB0L 1EFXB 4XCEB 5IHLB 4S1RL 4LCCC 2XNAA 1FNHA 4LKXB 1YECH 3STLB 4JQVA 3RVTC 3NIDE 4IBLT 3VDAA 1CFNB 2GQHA 3C6LC 1HQRB 4PJCE 4M7ZC 1W72A 5JHDB 4PREB 3TO2A 3HNSL 3FB6B 5EOCH 3RWDA 4DGIH 4NNYA 3RU8H 1BD2E 5J89A 2XKNB 3RUGB 1MVUA 3FO1A 5E5UB 2DM3A 5I76B 2KZ1B 3NGBC 4ORZC 2R0ZL 3DTXA 3ZHKA 1I8LA 4HFWB 3HFML 4R2GB 5D1XA 1F4YH 2VLRD 2EC8A 3RIAF 3T77B 1P7KB 3D3VD 1T4KB 3CSGA 2EYSA 3O45A 1P1ZA 3LS5H 3V0VB 4KVCL 3C5JB 2OX5A 5IOPB 5E8EB 2HJKA 2YUWA 2DB8A 1JWSA 3P4LA 3BRGC 3QAZB 2ZNXA 4NN6B 5EIIB 3NIDF 1L9NA 3UYPA 5FGCE 4PTTA 1EZVY 3VA2C 1HZHH 4PJCF 2OMBA 5JHLH 3QFJE 4FQLL 4U1JA 1A6TB 5D96C 4Z8FH 1I1AB 4G7YL 4G43A 4FQIL 1LE9A 1MELA 4EJ1C 2G60H 2OZ4A 3VXRD 3DNKA 4EDXA 2AQ3A 4C57C 4HWEL 5J06A 4HS8H 3U7WH 1VPOH 4FOMA 5IFAL 4QHUA 1HYSD 5F9WB 3VGHA 3PDOB 2YBRB 3LN9A 4TRPH 2V17H 1V8HA 1AKJA 2E9BA 1WTGT 3WUZA 5DS8B 1NCWL 4MCYA 1HSBA 1U2CA 4XP6L 1DLHA 5E6IC 1RUML 2D0HA 1QR4A 4NKOB 4LEOA 4Y0GA 1NAMB 5CJXC 1CDUA 1JL8A 3PGDA 3E6FA 4G6FB 5ESAA 4JG0H 4RNRB 3ULVD 2YD7A 2VDML 3FMGH 4FQCH 1CFSA 4E41E 3QRFM 2KBGA 1S7VA 4FQPA 5JZ7C 3MRIA 3EYUL 5TQ0H 3AS1A 1UWGH 4HC1A 4XT1C 3RL2B 5SX4H 4D94A 4RA0C 2NY5L 2B8OT 1ZGLP 3NIFE 2A73A 4JO2L 2ZUXA 4GMSL 1QD0A 3R4DA 1EJOL 1C7TA 4LKCB 1GGBL 4ODUA 5LQBH 5GGSA 4OGXH 4OZHB 4HMCA 4ZFGL 4R7NA 1EVUA 2WINB 4NQDB 1KELH 2AXGB 2XWJB 3KYOA 3RGHA 2WUCL 5ID1B 1RUPL 2FJGA 5HHVH 4F9LA 3OR7B 3F7PC 2V5MA 3UEZA 4PGCA 3I9GL 3QH3A 4MQ7B 5DJXB 4CMMA 1FO0A 2X9XA 5HHMD 5TDNB 3CDCA 2WBJC 3GMOA 3PL6D 3U7AA 1EXUB 1A6AA 1D5IL 5E9DD 3G5XB 3C2SA 4K3HA 4APQC 4HIIA 4LDEB 5DJYA 3QDMD 1G1CA 4WNQB 5DVKA 4X7CC 3H8NA 1SJEB 4PJIE 3NIFF 2LTQB 5TPWL 2P48B 4RX4D 3OKYA 4XWGH 2KH2B 1I7ZA 2XNAB 4WUKL 2Y4SA 1OW0C 3MJ7A 4ZSOA 2NXZC 1QLFA 3G9AB 3P0YL 2DD8L 2WM0A 1W72B 1C8PA 3TO2B 2RCSL 4ZDHA 3RWDB 5SV4A 3VG0L 5KSAC 4NNYB 2R39A 2A9NL 1EV2E 1Y6KR 2MPAH 4KRPD 4XBPA 2JIXA 5SWSD 2C4FT 1MVUB 3FO1B 4RMRA 1NAML 3EJYD 5C0EA 3AS3A 3DTXB 1AGEA 3QIUC 2AEPL 3K81A 5HD8C 5D1XB 1EIBA 1VADA 3FFCD 3VGFA 1WTLA 4TSCL 4HWBH 4XBGA 3TBWA 2EYSB 3O45B 1P1ZB 1MIMH 1TITA 4PJIF 4QRSA 1K9TA 4J3XA 1NC4A 1LK3H 4ERSH 2HJKB 4TPRH 1JWSB 3E3QE 3DIFA 4G7VH 1MOEA 4PJGA 3RVWC 4WUUD 4PTTB 4QRRD 3H42L 4U1JB 1DP0A 4LEXH 1P4LA 4R97B 3LKRA 3K4DA 2DQIL 1PSKL 3CMOH 3UPAA 2GSGA 4G43B 4LRNH 1LE9B 2EXWC 4P46D 5J6HA 4EDXB 5CD5C 3M8OL 3U30C 3KYNA 5F1SA 4X4YA 4ZUVA 4QHUB 3AROA 5IVZA 3OKMA 4YHMH 4LRIC 4J3VA 1QA9A 5B3NA 4PJHF 2VZSA 4AIXA 1AKJB 3X12A 4AEHL 3NFSL 4MCYB 4UB0H 3RVVC 1HSBB 1V7NL 4JREC 1DLHB 4NOFA 3PXJA 3OF6A 5D7SL 4LEOB 4WGVB 3D5OF 5F7LB 4CVWA 4DFHA 3PGDB 3E6FB 5ESAB 4UQ2A 1FFOA 4YPJA 1W72L 1CFSB 5E2JA 1FYTD 2EDWA 1S7VB 3MRIB 5DT1H 3KXFA 5ANME 4I18A 3U7YL 1WBXA 2DM7A 1BEYL 2Z31C 3QP3A 1IQWH 4K94C 5KSBA 2A73B 1E28A 2ZPKH 1SYSA 3ECBA 2ZG3A 2GYSA 3WKML 5CEZL 3FZUC 4ODUB 1F6AA 2R15A 5GGSB 4KKLD 1PJ9A 3RVXC 2EDNA 3V6FA 4R7NB 4Y2OA 4XNQA 2AV1A 3SO3C 3KYOB 3TYFA 4YHZL 4XVUC 1V3KA 2FJGB 4JRXA 4PLJD 5MEND 5FUOH 5CP7A 5GGTA 5EBLA 3D87B 4PGCB 1MPAL 3QH3B 3NA9L 2JJVA 4POZC 2H41A 4CMMB 1FP5A 1FO0B 3BRFA 1S7XA 1I3RA 1WGOA 1J10A 4C4KT 2VERN 2HFGH 2ORBH 5GGRY 5C0RL 3GMOB 1RIUH 4KHXL 2D7MA 5KN5A 1OAQH 3U82B 1A6AB 4TSBH 4WCYH 4HIIB 3OAYH 5DJYB 3HUJA 1PG7H 5A2LH 4KPHH 1YJDC 2VKXA 4LOUD 2OZ4L 1E6JL 3TBVA 3QG7H 3T0ED 4BZ2H 1JRHL 4W70A 1GH7A 5DVNA 3DETD 3MV8D 2X7LA 1I7ZB 4MNQA 1YMMA 5I66A 5JA8B 1I1CA 3QQNA 3ARFA 3MJ7B 4ZSOB 1QLFB 1U3HD 3QUZD 3OJVC 3QUMH 4Y5VA 1L0XA 3WS6C 2W60A 4CVXA 5I18H 1U8KA 4OV5A 5DK3A 2Q8BH 4ZDHB 4UTAH 1PQZA 1B0GA 3BUYA 3CVIL 4XBPB 2JIXB 5TQ2L 4UMGA 5BRZA 1FCCA 1W0YT 5C0EB 4X80L 1NFDA 1AGEB 4A6YA 3OPZH 5I1KL 2ZUSA 1N4XL 1XGQA 3HA0A 4O02H 4UDTA 1VADB 3Q48A 1EUTA 2X42A 3EW3B 4XBGB 43CAA 3KS0J 3UTOA 2NTSP 1YEJH 4HC1L 4OZGE 1UFUA 2AEIT 3Q2CA 4QRSB 1GGIH 1NC4B 2NY3D 2VDOL 3B9AA 4Q9RH 5FUCC 2DBJA 2WUBL 4OLXL 4LLWA 3QCVL 3DIFB 2WZPD 5EU6D 2VDLL 1EAJA 3PGCA 1UENA 1TZIA 4D0DA 4EDWL 5DD1H 5ADOL 4PJGB 3VE0A 2A2QT 2I24N 4WI7A 2EDRA 3VXMA 1IC4H 1P4LB 3LKRB 2MCPH 5LAXA 3CFDA 4OCWL 4XC1H 1MIEH 2GSGB 4NSKA 1FO0L 2GI7A 4JFZH 5J6HB 2VDKL 3ZL4L 1JTTA 3WIFA 2DBLH 5IVOA 4AG4L 3KYNB 4XVSL 4X4YB 4ZUVB 5K9JH 5IVZB 3RX8A 2R29L 7FABH 3OKMB 4S1QL 5IV2A 4KJPC 3SPVA 1QA9B 4FHBD 1Z9LA 3BH9A 3X12B 4B53A 1TDQA 3DWTA 3WN5C 3VW3L 5SWZD 3U1SH 3C8HA 1FYHB 3RZCC 3H9SA 3J7HA 3RTQA 2I9LA 2AJVL 1FPTH 4UQ2B 3CVHH 1FFOB 4UV7H 5EBMA 1J9CT 3O2DH 4YXLL 1HIMH 5GPRA 3MRDA 4H25A 3KXFB 2GJJA 3F7YA 1WBXB 5DFWH 4NNPL 3WD5H 4JG1L 1OSZA 2D4FA 4HAFA 5E2TL 2VUYA 5KSBB 2D4DA 1KTLA 4OF8A 1E28B 2K7PA 1SYSB 3ECBB 5EZOH 4LIQL 1KCUH 3P11L 1F6AB 4J12A 4U1GB 3DVGA 3SGJC 3VXUA 3V6FB 4XNQB 4MDIB 2AV1B 1OD9A 3RA7H 5TDOA 1OAKL 3TYFB 3WFEH 2C1PA 2V7NA 2NR6D 4JRXB 2C3VA 1X9QA 5FGBC 5CP7B 5EBLB 3OL2A 5EPMA 3I6LE 3Q6FA 2FBJL 3TT1H 1FORL 1CZ8L 3WLBA 3D85A 3H2WA 4LVHC 4PJBE 1S7XB 2IAND 5CCKH 1I3RB 1YYML 4JN1H 2CO6B 5F9JA 4RGOH 4U4BA 5EB9A 5KN5B 1ZEAL 3KYAA 4UOW0 2Z92A 3O11B 1KV3A 5KVFH 3OG6B 2D31A 1QBAA 1AI1H 4XPBL 3HUJB 4YDIH 3EDKA 3ZDYE 4ZFFA 1XH3A 1P7HL 5ADPL 1UEYA 3TBVB 3DV6A 3LKSA 3BPNC 5FYLL 1CQYA 3CUPA 5JW3H 2X7LB 1KACB 1AXTH 3HR6A 5KZCD 2DQCH 2XACC 4MNQB 1YMMB 1IGJA 4GH7B 3WFCL 5I66B 3ARFB 4YXHL 3BT2H 4Y4FA 5DQ9A 4Y5VB 3TN0C 4X5XA 2W60B 3TA3C 4CVXB 4OV5B 1U8KB 5J0BA 1PQZB 4HG4J 2ICCA 1B0GB 4XXCA 3BUYB 5D2LA 1YN6A 4PJBF 2OK0H 2VSDA 3NABH 1T2JA 4C56D 5BRZB 1NFDB 4P3CL 4A6YB 4O2FA 3WKNA 5ITBH 4Q9QH 1XGQB 4UDTB 5F44A 4BZ1L 4HV8A 3QFJD 3ARGC 4M62L 2GUOA 2JB6A 3U2SA 4I0PC 4FFYL 3VWKA 43CAB 1Z9MA 4RGND 2DDQL 3T3PE 2YN5A 4MAYC 1CXKA 3ZZ1A 3M17A 1MWAA 4LLWB 5JDJA 3EYQD 2EICA 1GHFL 3PGCB 4Q97A 1TZIB 4D0DB 1XFPA 5D2NE 5GHWH 5T5FL 3VE0B 4M6NH 4RRPA 4X6CE 3RBGA 2C3HA 2PYEA 5D7JC 3VXMB 4GQ9L 4OIIL 5LAXB 2O5ZL 3CFDB 2W91A 5B39G 5GGTL 5JIHA 4I3RH 1NL0L 2EKJA 3JBG7 4M93C 4WWKD 4UDUA 3SY0A 1MCWW 1L7TL 2AK4E 2ZUQC 2J88H 3DVNA 4NSKB 2AK1L 5I8CA 1DBKL 4YHKL 3IXAA 4TOYL 4L4TA 3WIFB 3MV9D 2VH5H 4OM0L 1DVFD 5BO1H 2L7JA 4PJDE 2I5YL 3N1FC 3MGOA 4WJ5A 1QSEE 4F7PA 5IV2B 3SPVB 2FGWH 1ORSA 3GSUA 3EYSL 5KOMC 3BH9B 1VCAA 1RURH 4ZOAA 1QBBA 5KANI 3SO5A 2V7HA 1DEEA 3H9SB 3RTQB 2I9LB 1MREH 4JGMA 5HGAA 3ULSA 2NY5C 4NQUA 4Q6YA 2ZCKL 5EBMB 4FQ2H 4HZLA 2EEAA 3FAXA 2ZG1A 3MRDB 4H25B 4R2GC 4UOJA 5HI3C 3F7YB 3V8CA 1AGDA 5KVGL 4TVPE 1OSZB 3V95A 1Y0LA 4A6YL 1KTLB 2IGFH 3SKJL 4PY8I 1MLCA 5ACZA 4PJDF 4D9LL 4L8BA 3DVGB 3VXUB 4G8GE 3WIHA 3FQTA 3QNXA 4KHTL 3QAZC 1TNMA 4NN6C 5ILTH 2ENSA 5TDOB 4KJWC 1O5DT 4O58H 2C1PB 2OM5A 2V7NB 1QLEL 2CLRA 2C3VB 3LEVL 5EPMB 3Q6FB 3FQWA 4K07A 3WLBB 3D85B 3HMWL 3CFIC 2Y5TA 3MLVH 4F58H 5F9JB 1U8QA 1HNGA 2Z92B 1A14L 4NO0A 4LLAA 2D31B 2GSIA 3QEHA 5IBTH 1T2QL 5CIPA 4KKAC 4ZFFB 4R4ND 1XH3B 3DV6B 3OMZA 3V8OA 2XN9D 3TV3H 1H3XA 3LKSB 3TO4C 5CKGA 5F9WC 2RAMA 1OOAA 2BJMH 3CUPB 1CDYA 3KLHD 4KI5C 1Q72H 5E9DA 1ZA3A 3KR3L 3H3KA 4OCXL 1IGJB 2CRYA 1TLKA 4RWYL 4MA8H 4HF5H 3GO1H 4I0CC 3G08A 3TLRA 4LK4A 3UYOD 4Y4FB 1RSFA 5DQ9B 3LCYA 4X5XB 4WI9A 3W9EA 4JFEA 1I7TA 5D2LB 1YN6B 4AJ0A 2Q8AL 4ZO9A 4X7FC 2ED8A 4GXVL 1CIDA 4O2FB 3O6FA 2ZNWA 4XPTL 3QO0A 4HV8B 4IOFD 5DK0A 5JORA 5CJQH 1CDIA 2GUOB 2JB6B 3U2SB 3ZKMC 3D2UA 3VWKB 1GGYA 4U2ZA 3HZVA 2EDDA 1UXWA 1MFCH 3MRRA 3U0TA 3P4NB 4ONGL 3M17B 3UBXA 4ZNEA 4TVPH 1MWAB 3UTTA 4QXWA 1IGCL 3SE3A 1L9MA 3QDAA 2DICA 4IRZH 4MZ3A 2J8HA 4B41A 4P23A 2HG5A 5GGVH 3GBLA 3MA9H 3V0WL 2PYEB 1R3IH 4X6BA 2F53A 3MODH 1N0LA 2NLJA 5T5NG 1PKQE 1Q0XL 5DMIL 2A38A 4UDUB 5DRXA 2X40A 3SY0B 3DVNB 4WUUA 5I8CB 4N8VG 2ZOLA 4YK4B 1QHPA 3WO4B 3N9GL 3IXAB 4M1DH 1TMCB 4L4TB 2RBLA 4R8WL 3NCJH 3JTTA 2XTJD 4HCRA 5DR5H 2LTQC 2AV7B 4NYLA 1CK0L 3MGOB 4WJ5B 2BP3A 4K3DL 4OLEA 4P2QE 4F7PB 3S5LG 1T0MA 5F8RC 5KVEH 1ORSB 3GSUB 3QIWA 4JQVC 5HSFA 1RZIA 2XTLA 2KQNA 4QNPE 2E27L 4JRYD 4U3CA 1B9ZA 3L5IA 4JGUA 3N1PC 2QSVA 2K9UA 1DEEB 2V7HB 4HIHA 3BN3B 4PJ9A 5I1HL 3KPRD 5ALCL 3QQ4A 3GBNL 4M5YH 5HGAB 3ULSB 4RAVA 1I3GH 4OLVH 3UTSA 4MQSB 5SX5H 2IPTH 1I8LC 4HZLB 3GSNA 2DQDL 5D1XC 1TJGH 2B2XL 3MBXL 1J0YA 1AGDB 3BQUA 5K93A 3PHQA 4L4VE 1Y0LB 1HH9A 1JYWA 1EGJA 1MLCB 2VR9A 5ACZB 3DXAE 5GGRA 4Z77A 5CS7A 5F7EL 3BE1L 4L8BB 5DURB 4RDQF 4RFNB 4Y5XA 2FLBT 4ZXBD 3FQTB 2HT2D 3QNXB 1JTOA 4JANA 3TESA 1MWAL 4CRPA 1ITBB 3ARPA 2BVPA 5C86A 4QNPF 1U2HA 2CLRB 1F4WH 2X41A 4KTYA 5CZKA 2YR3A 1WT5A 3FQWB 4R97C 1OM3L 2OP4L 2A1WL 4PRBA 5K9QG 2Y5TB 5M95B 4NC2B 5C2BL 1U8QB 3EIFA 1X4ZA 5L2KE 3SDXE 1CFQA 4KUCF 4LAJH 3TT3H 4EUPH 4NO0B 3UROR 5MENA 5TFSH 1IEHA 5D70H 2GSIB 3QEHB 5HHOE 4NZUL 5CIPB 4OFYD 2PO6D 3VFPA 4QLRA 3W39A 3MJ8A 3QDJE 1IKNA 1X5ZA 4RAHA 1JHKL 1ZS8A 1OF2A 5F9OL 3Q1SH 3OWEA 4P48A 4KUZL 5IMLA 5E9DB 1ZA3B 1BJ1J 4RQQA 5JW4R 5T3XD 3O4LD 5I73B 1A22B 2NQCA 5DQDL 2E8ZA 3G08B 4X7SH 1MCNA 1D6EA 3T2PA 2VN4A 4DKDC 3T0EA 1UCBL 4CAGA 3B9KA 1N8ZA 1INDL 2LAAA 2HTKC 3W9EB 4JFEB 5D72L 1R0AL 2CQVA 1I7TB 1N6VA 5D71L 1HI6A 4MD5A 5DSCA 4OGZA 3VXQA 3I3EA 1KLGA 4HK0A 2VDRH 3O6FB 3CSPA 3QO0B 1U3HA 5DK0B 2HVKA 5JORB 1SEQH 3SDXF 5IJKA 3BYTA 2R1YA 3D2UB 3L3HA 2HH0L 4GRWB 4K9EL 1OAXH 2C3WA 4CDGC 3HZVB 1UXWB 4KRPB 3MRRB 3U0TB 1A02N 1NLDH 2NX5E 3UBXB 3UO1L 3UTTB 4LSUL 4WI4A 3WNLA 4I2XA 4OM1H 4Z7UA 3HE7D 5FB8A 3RDTD 4NJ9L 1GOGA 1XF5A 4P23B 2HG5B 2F5AH 3WIHL 3V4PL 1F4XL 2YKLL 4X6BB 4XP1L 2F53B 1QLRA 5GS0L 2NLJB 2CO7B 1QHOA 1VEMA 2EH8H 4QYOA 5I8KL 4LCIH 5E6YA 4V1DE 4U7SA 1KULA 3GMRA 3QI9D 5DRXB 5BMFL 4WEBL 4WUUB 1PX3A 2ZOLB 2ZUTA 2XQBH 1HKFA 2R8SL 4JQIL 1ACYH 5DO2C 1A7BA 4IIQA 1P4IL 2IF7A 3GNMH 3JTTB 1FFRA 2CRIA 2Y72A 4XAWH 1FGNH 1AD9A 4NYLB 2N7AA 1N5YH 2E6PA 4DK3A 1RHFA 3BKCL 4KK8D 1AO7D 1T0MB 1EAPA 3QIWB 1BHGA 5EO1A 1RZIB 4HUVA 4EOWH 4U2YA 4XB7A 4IS6A 2AEQL 5GISH 1JZ3A 4F33A 4PJ9B 3SGEI 4TTGA 2IMMA 3QQ4B 3CU1A 1LP9E 4ODTL 4RAVB 4EI6A 3UTSB 4UNTA 5KJRL 4Z7NE 4O2CA 4TSAH 3MX0A 3GSNB 3VH8A 2A9ML 3Q0HA 1MEXL 3BQUB 1RU9H 4Z0BH 3PHQB 3LKPA 1HH9B 2K3TA 5GJTL 3UAJD 3UDWA 5GGRB 2X1XR 3MOBL 4Z77B 5F88A 3SDCD 4Y5XB 3KNBA 1L7IL 4JY5L 3D0VA 2V2XA 4FQHA 4JB9L 3DO7A 3G5VA 4HIXL 1UWEL 4JANB 4YUEL 2ZCHL 1FJ1A 2AQ2A 2BVPB 5FDYA 5H35A 1LO4H 3LH2H 4HJGA 1CLYH 1CWVA 5E99L 2L4OA 3AC0A 5AEAA 2G5RA 4MVBD 4Q0XL 1LP9F 4Z7NF 1VA9A 2R9HD 1CFQB 2DLEA 1HHIA 3FO0L 4MX7A 5E1AA 5MENB 5EA0H 3S98A 5C09A 3EYOA 1NCNA 3ZHLA 3VFPB 2WLYA 4OT1H 2DMBA 3MJ8B 3W39B 4UT6L 3VU2A 5I1GL 3C8KA 5FHAL 4PJ5D 3D1MC 4AL8H 2WWKT 1UG9A 1ZS8B 1OF2B 5ESVA 4HCRL 4JFHE 4P3DA 4PJCA 5IMLB 4MJ4A 1MCQA 4RQQB 3ZTJH 4XCCL 4J6RH 1A1OA 2CKBA 3UZEA 1BD2A 1D6EB 1B88A 5CMAA 4Y4KA 1M71A 3T0EB 2P45B 1WV7T 3B9KB 1N8ZB 3RIFK 4YHPA 3VWJA 5B4MD 3F58L 5DSCB 1DTUA 1HI6B 3KDMA 4MD5B 3S88L 1K6QL 3VXQB 2PW1A 1KLGB 2QADD 4HK0B 1NGQL 3AMKA 3PGFL 1UJ3A 4IRJA 1QUNA 4I18C 5JR1L 1U3HB 2HVKB 4ZUTA 5L88H 2PKDA 2AKRA 2R1YB 3L3HB 1REIA 3IFNL 4Q2ZA 3GSNL 1UM4H 4M5ZL 1JGVH 5TE6H 4L8SA 3WNNA 15C8H 4U1GC 1PY4A 4XVTH 1A2YA 1AXSA 1EGJL 3ALPA 4I2XB 4Z7UB 3QFJA 5J3HC 2DQHL 4HZAA 5DVLA 3PG2A 1XF5B 1JN6A 1RUQH 5D6CA 3KJ6H 3SJVE 3GHBH 1G7LA 3D0LA 1A64A 1BQLL 4NFDA 4LSPL 2NY3B 1QLRB 5KTEH 3P0VL 1EDQA 4QYOB 1RZKH 3X17A 3WXVH 3BDYH 3GMRB 4DFIA 1IGFH 4ODBD 3PIQA 4HUWA 2APXA 1C16A 1V7MH 4IIQB 5T1LA 3T09A 5HTSA 1YC8A 3ZTNH 2WIIA 1AD9B 2OTUA 3K0WA 1OLLA 3C60D 4K8RL 4UILH 1EAPB 2EDQA 1SY6H 5HYJE 1JHLL 5C6TL 5EO1B 2ZUYA 3ARFC 4HUVB 2VUOA 1F2QA 1KJVA 3AU1A 4HDIA 4NKDA 4LHUD 2VZVA 1V05A 4IS6B 4HWBA 4Y5VC 4P2OD 3QRGH 4FXLA 4E41A 2V6HA 3C5SA 5I8EA 3RWGA 4F33B 1TNNA 4JHWH 4QRPE 3QHTC 4K7PL 4DAGL 4EI6B 5HPMA 4O2CB 1YYLL 5HI5D 2IG2H 1AQKL 3T1FA 3ETBF 4OGAC 1U8OA 4G8IA 4OCLC 3FAWA 3LKPB 1G6RA 4FN0A 4JPVH 4NUGL 3VFSA 3WUWG 4EEEA 1DBMH 5F9AC 3MUHL 2F74A 1T0PB 4HGWA 2EEDA 5GJSL 5F88B 2YD5A 5DUBA 1F90H 3KNBB 2H6PA 3D0VB 2V2XB 4FQHB 3JWOH 1MCPH 3G5VB 5DLMH 3DO7B 4HK3J 1FJ1B 2H1PL 2OL3H 2WAHA 1OTSD 5H35B 1BAFL 3FN9A 1GOFA 2AP2A 4HJGB 2VDPL 5F6HJ 3TGXA 5D7KD 4HJJL 5AYUH 1A9BA 4PJIA 1MJ7H 2EE3A 1HHIB 4MX7B 5E1AB 4FQJH 2XOTA 5C09B 3EYOB 1NGXA 3MRFA 4HWZA 3ZKQD 1MAKA 3C8KB 3SDAC 4YNYA 4ZUSA 1MFDH 1T6WA 4MZ2A 5IB4A 5E6ZA 5ESVB 4ALAH 4P3DB 4PJCB 2IAMA 3MYJA 3GHEH 3GBMH 4GW5A 5EOCL 4DGIL 3RU8L 1R5WA 5FM5M 1A1OB 4YHLH 2CKBB 1BD2B 3HAEH 5CMAB 2MNUA 4Y4KB 1M71B 4Q74A 4NQED 3P9LA 4YHPB 3HN3A 3VWJB 3RTQC 5FUCE 3KDMB 4P3WA 5LJYH 3LS5L 2G9HA 3VGAB 1QFHA 1UJ3B 4IRJB 1A5FL 2RFXA 5JW4N 4ZUTB 1OTTC 1FNSH 5I9QB 2AKRB 3LN5A 4YH6A 3V7AG 4Q2ZB 4HQQL 1Q9WA 4IRSA 4RISH 4B5EA 4L8SB 3O6MH 3K74B 5FGCB 1A2YB 1JZ2A 1AXSB 5JHLL 5JXAL 3CXHK 3ZE0E 1JBJA 3VXSD 3QFJB 2WMPA 4Z8FL 5MEOA 1JN6B 5D6CB 4WHYG 1G7LB 1YNLH 3D0LB 4JE4B 2G60L 2OJEA 1CICA 5DJ0A 4PV8A 5BV7H 2LU4A 4FQ1H 4FFWD 5IHUL 4M6AA 4CNIA 1VPOL 1OWRM 5TF0A 2A0LD 2CSPA 3PIQB 2FYYA 2IBZX 4HUWB 1C16B 3PHSA 4TRPL 1DQJA 2V17L 5T1LB 2B4CH 2Q20A 3L5JA 2WIIB 1XGPA 2OTUB 3B2VH 4NCC2 1UM5H 2DM2A 1G7QA 2VZTA 2LABA 4CMHB 4ENEC 4XX1G 5HGGS 1UC6A 5IESH 1HE7A 4GRLA 1WAAE 3ZE0F 1FNLA 2O5XH 3HMXA 4H8WH 2WBWB 1KJVB 3AU1B 3DI2B 4G8FA 4HDIB 4JFDD 4NKDB 4Y4FC 5E08H 3DXAD 1A4KA 1U8PA 4E41B 3O8XD 5TQ0L 3C5SB 5I8EB 3RWGB 3TNNA 5JA9A 4OCMC 1KFAH 3T04D 5DHVA 2CKBL 4XXCC 2EDKA 5ANMA 1S7TA 1UH3A 5GZND 4TVSa 3TVMA 2CH8A 5KS9E 1KIQA 4X9IA 4Y88A 1NPUA 5HPMB 5BVJA 1T7YA 4JFFD 4XNUH 3L7EA 3P4MA 3PXHA 5T1KD 3T1FB 4OGXL 1U8OB 4G8IB 3EFDH 1G6RB 4K3EH 3VFSB 3VWKC 2MSPA 4LVOB 4LCWD 2F74B 3PWPE 4HGWB 3EOBA 1KELL 3QHFH 1UM6H 1E4XL 5DUBB 1J5OH 3C6LD 1UACH 4YGVA 2H6PB 3RWFA 3TIEA 1H8NA 4XPGH 1WAAF 3TH3T 3GI9L 4XXDA 1VFAA 4P9HH 3K80A 4LSQL 3WNMA 2MJWA 1PW3A 5KS9F 1A9BB 4Y2DA 3WFDH 4PJIB 4HKJA 5CLWA 4YK4C 3WO4C 4M7JH 1IAOA 1KPVA 2PF6A 4XWGL 1NGXB 3MRFB 3FQXA 4HWZB 2D03H 2HFTA 4YNYB 4ZUSB 5IB4B 4PJFE 3CVHA 3RWHA 3LKNA 1IJ9A 2JJSA 2IAMB 3MYJB 3HE6A 3B2UC 3BESR 4GW5B 1EEZA 1R5WB 1GC1H 4U6YA 1C1EL 3LY6A 3LB6C 2MFNA 1YDPA 5A1AA 1B0WA 4CL7A 3P9LB 3EOYG 5C0BE 5D6DA 4HWBL 1IGMH 3GDBA 1DQDH 1MIML 4U3HA 2G9HB 3N0PB 3VDCA 2XKSA 4OZGA 3X3FH 1GVIA 1JPSH 2RFXB 3BMWA 3DX8A 1LK3L 4ERSL 3BKYH 3LN5B 5IVXE 1AFVH 1Q9WB 4IRSB 2IFFH 1IC1A 1CXHA 3ARVA 1G6RL 2VTFA 3GSWA 5E6ID 4RFNC 4PJFF 1ODAA 1CGSH 3UMTA 3X3GH 5A2FA 4MXVE 4LEXL 5MEOB 5GS0C 1X5KA 3CMOL 1XEDA 5JZ7D 1KOAA 2OJEB 5E8DH 1CICB 4HH8A 4QGYA 5CHNA 5DJ0B 4PV8B 3LMJL 2R0KH 1WISA 4CNIB 5BOZG 1NAKL 4YHML 2FYYB 3FRUA 1ZLSH 1DQJB 4R4FH 4JCLA 3I84A 5IVXF 4ODXA 5T1DH 4UB0L 3BAEL 1XGPB 4EQ2A 1W0WA 3TCLA 1G7QB 5IW1A 4KV5F 1UYWH 3PUCA 5EWIL 2CLZA 4GRLB 3AY4A 4YDKH 1I8KA 1F3JA 5I73C 1BBJA 4MXVF 4G8FB 2QL1A 4CN6A 2Q3ZA 1YEFL 1A4KB 3IDXL 1QFWM 1QYGH 1U8PB 2WBJD 4GAJL 5DT1L 5EZLA 3TNNB 1IAII 1MCDA 2WW8A 3LRGA 1EBAA 5DHVB 4APQD 5ANMB 1S7TB 3TVMB 1IAMA 1IQWL 1KIQB 3O3EB 5DWUL 5BVJB 4X8XA 3O6FC 2AABH 1WJ3A 3L7EB 3P4MB 3ZYIA 1OAUH 2I60L 5SWQA 3EBAA 4N8CH 3EOBB 3L3GA 3RIAK 2NXZD 5KVMC 4RMTA 5FUOL 3RWFB 3TIEB 1X5HA 5I74B 3SE3C 3V5HA 4TUJA 5T3XH 1ADQH 4P23C 4MDJB 2UUDH 5KSAD 3TM6A 4PJBA 1X7QB 2HFGL 4XXDB 3S34L 1VFAB 2FZ3A 1RIUL 5IG7A 4TSBL 3QIUD 2FH6A 5JDSA 2UWEE 4LPVA 1SVZA 5HD8D 3U4AA 2QBWA 2BVEA 4CGTA 1UGNA 4O4YH 4NM4H 1RZFH 4Y2DB 3TEUA 1WZ1H 3QG7L 1H3GA 2YPLE 4HKJB 4JDVA 4XBEL 4BZ2L 3MZTA 1L6ZA 1IAOB 1KPVB 3PP4H 5FO9A 3ZKNC 1XIWA 1BIHA 1FFQA 1JF1A 2F8VA 1OB1A 3FQXB 1EJ6A 1BREA 3REWA 3L3JA 4FRWA 2J12B 4XHQA 5DRNA 3CVHB 3RVWD 3LKNB 3RWHB 4MB4A 1J7VR 3QIWC 3HE6B 5I18L 3S36X 3T0VA 3B43A 3CH1A 5I75B 1EEZB 2Q8BL 4DQOL 3QFDA 1RHHA 3OAUH 4U6YB 3C2AH 5ISZE 4W6WB 2DAVA 4M6MH 4NO3A 1MLBA 1YDPB 1CLOL 3OPZL 3HMXL 4PJ9C 4O02L 4U1LA 2EXWD 3ZMRA 4U6VH 2UWEF 5FCUH 2V9TA 5CD5D 2QSQA 1YEJL 3PABA 5GS2D 5IW3A 3PV7A 4OZGB 3SJVD 1GGIL 3BQUC 3DX8B 4Q9RL 1SBBA 1XGUA 4F37F 3PQYD 3L5XL 5KVDL 5DD1L 3RVVD 3DVFA 4QO1A 3GSWB 1LMKA 5D2NA 4Y5XC 4CW1A 4X6CA 4WI2A 4PRHD 2W0KA 3INUH 3QPXL 2H9GA 5GGQL 1IC4L 2P8PA 3O6KH 3RX5A 4EVNA 1QBML 2MCPL 4XC1L 1I7UA 4DKEH 4ZO8A 4G6KH 1T1YA 1MIEL 1WT5C 2OSLA 5CJOH 2AK4A 3SCMA 3DYPA 4U33A 5CHNB 2BVUA 2XZZA 2Z31D 3F7RA 4NFBA 2J8OA 3GSRA 2CUIA 4J3UA 1KPRA 4GJTB 5BVPH 1BX2A 2IQ9H 4PJDA 4X98A 5CSBA 3FRUB 3FZUD 4K8RC 1A47A 4OAWA 3QWRA 1QSEA 1ORQA 3RVXD 1IKNC 4MD4A 3IDUA 1KJMA 1KT2A 4ODXB 2LVEA 1W0WB 4Q6IA 3TCLB 4GKOA 4O51A 4XVUD 5IW1B 4GOSA 4R26H 5AAMA 3JUYA 3KPNA 2CLZB 2BY0A 1HEZA 1I8KB 1F3JB 4POZD 1BBJB 1FPTL 7CGTA 3CVHL 3N1GC 4UV7L 1U8NA 3IDJA 2G2RA 5EZLB 3B9KC 4BM7A 3P77A 1B3JA 3WD5L 4BQBA 4GKZB 5IQ7H 4GRMA 1J8KA 3QQ9C 3TNMA 5EZOL 3BISA 4LHUA 1KCUL 1ZT7A 1RULH 3ULUF 5IJKC 4GO6B 3UC0L 1FBIH 4YFDB 1CXEA 3CLFH 4P57A 5SWQB 4G8GA 3L3GB 4DTGH 1X4YA 4F57L 2Q86A 2MMXA 4NZRH 3V5HB 4TUJB 3P2TA 1KCRH 2UZIH 3OV6A 3DGCR 5CCKL 5IIEA 4PJBB 1KJ3H 4RGOL 2FZ3B 3K2MC 3VD3A 5IG7B 4RRPG 1PEZA 5JDSB 5DFTA 1J18A 4WFHE 1K3IA 1J0KA 1AI1L 1DLFH 3G5ZA 1QRNE 5DVMA 5FGSA 3TJHC 1MFBH 3W82A 1TTFA 4Q58C 2LV4A 5JW3L 2YN3A 1AXTL 5FO9B 2BNRE 2VQUA 2DQCL 4IIQC 1XIWB 4JDTL 3L7FA 3SDDA 2ICEA 1JF1B 1OB1B 1GRWA 3LZFL 3AGVA 5D7LE 3REWB 4BK5A 3L3JB 3ULUH 1G9NH 3BT2L 2IBGA 5DRNB 1EEYA 4N5EC 2MQ3A 2K1MA 2JELH 3JWNC 4JPWH 4M03A 5IMOA 2CK0L 2Z91A 4XCFH 3QFDB 2VXTH 3QDGE 1RHHB 3NABL 1J0HA 3ZSSA 4YHYB 4NO3B 1MLBB 4QHNA 3BW9A 3IDMA 4Q9QL 3PWVA 3SKOA 4U1LB 3KWWA 2A6JA 1SQ2N 2W0FA 4FXKA 1JYVA 3PABB 5B38G 1JNHA 2WV3A 4WFGE 1XGUB 3QJHA 3OAYK 2XY2A 3Q3GA 4KJPD 4JZOA 3AREA 3UDWC 4AENA 2XQYG 4TNWF 3RGVD 1PZUB 5ACLA 5D2NB 2QADB 5LWYL 4CW1B 4X6CB 4JZJA 2H9GB 1MQKH 5D5ME 3RZCD 2P8PB 1ROWA 4EVNB 3MLRH 3GMNA 1I7UB 1PKQA 1T1YB 2LAGB 2J88L 2OSLB 2AK4B 4NO5A 3SCMB 4MJ2A 4O5LH 1NCBH 1KN4H 3VD7A 2E6JA 2QHRH 4PRIE 5B8CA 4ZG1A 3GSRB 5T33H 1B4JH 5BO1L 1KPRB 1NLBL 3FFDA 1BX2B 1BZ9A 3GMMA 4PJDB 2EDLA 3L5WA 4X98B 5DMGC 5LXGH 3K7UA 5I1EH 5J7CC 4XCYA 4OAWB 1QSEB 4P2QA 4YXKH 1ORQB 4MD4B 1KJMB 1KT2B 2MKLC 5D8JH 1EO7A 4BH7A 1RURL 4Q6IB 1MJ8H 2VL4A 3FRPG 4O51B 2UV3A 3S35X 1F2XK 3KPNB 3MACH 1QSFD 2AJUH 3FB7A 5JMRA 1HEZB 5FYKE 2IPUG 1MREL 5D5MF 1RUAH 1ZLVH 3ET9F 2NY6B 4HHAA 2E6QA 1U8NB 3IDJB 4Y4KC 1KCSH 2G2RB 4PRPE 4TN9A 3VWJC 3P77B 1I8MA 2EIEA 3TFKC 4RBPH 1KC5H 1BQHG 4L4VA 2DJUA 3VGAC 1AHWA 1FDLL 5H94A 2JB5H 1UJ3C 3GJEA 3IJSA 4GRMB 4IRJC 3TNMB 4LHUB 1ZT7B 3DXAA 1QFWH 4DVBA 1A3RH 5I9QC 1CU4H 1KCVH 1QG3A 4OLWH 4P57B 4G8GB 4JO1H 5ILTL 4LQ1A 2HFEA 4L8SC 4G6JH 1YEDA 5FUZL 2AAVA 1NUFA 4HLZG 2Q86B 3TN0D 5JQHC 3UBXG 3TA3D 4OKVA 3IJHA 5CFHA 4KROB 1MRFL 3MLVL 5IIEB 3HB3C 2Y06H 4HPOH 2VRAA 3WNPA 5ERWA 5L2KA 3IS1X 3SDXA 2EE6A 4ONFL 5IBTL 2EECA 3G5ZB 3ARGD 1EHAA 3MRNA 4I0PD 5HHOA 1OAZH 5EORH 1JPTH 3QDJA 1MRCL 3BI9X 3TV3L 4NKMA 2GJ6E 3VD5A 4MAYD 2BJML 4U1IA 5DTFA 4D9RD 4ZS7H 1Q72L 3L7FB 3SDDB 2ICEB 4XMKH 4LHQB 5C7XL 5JW4M 3GO1L 4BQ9A 4JFXA 3RY5A 4OBSA 1EEYB 2F54D 3SE4A 3KPSE 4CMHC 3FJTA 5IMOB 2Z91B 1MF2H 3QT2A 5D7JD 2HKFH 4PY8J 4XWOC 3I3BA 5DUPH 3HC3L 5I1JL 4ZAKA 5FK9A 1BBDH 3ZE2F 1S7RA 4QHNB 4X5WA 3BW9B 3IDMB 1TJHH 3PWVB 4GAGH 3SKOB 4AH2A 4RZCA 1QPPA 5E2VH 5FYKH 3KWWB 2A6JB 5GGUA 1JNNH 5J56B 2PNDA 2W0FB 4Y19E 1MRDH 4CVZA 4FXKB 1JNHB 3QUYA 1MFCL 3KAAA 1IQDA 1XGRA 4TVPL 1A6UH 2NX5A 3QJHB 3Q3GB 4PIRF 4LVOC 1UKTA 2ZUWA 4JZOB 4OI8A 3AREB 4AENB 4V2BA 3O3AA 3MA9L 1TVDA 4OQTH 4W68A 5BZWA 1R3IL 1A6VL 4JZJB 4LSRH 2GT9A 4N1EA 1R3LA 2W92A 4NZTH 5EIVA 3GMNB 1N3NA 1PKQB 3CPLA 3O3UN 4MLIA 4F8QA 3JUZA 4V1DA 3HC0A 4R2GD 4P5MA 1MHPH 3SQOH 4GS7B 4NO5B 5HI3D 1KB5H 5J12C 3LS4L 1K3ZA 3NCJL 5B8CB 5CJXA 5AUMA 2QV2A 4JM2F 4F8TA 3FFDB 3RI5F 1BZ9B 2CUMA 3GMMB 1EEUA 3L5WB 1TPXB 3NZHH 5L0QB 5DJ8A 3A6BH 3OXSA 4XCYB 5KVEL 4P2QB 5IT2L 1DCLA 3WCYA 2YUXA 4GAYA 1U8IA 2ATPA 1C08A 2QQKH 2WBKA 4BH7B 5L9DH 4KJWD 3RWCA 3LEYH 4XRCA 2IAMC 1LE5A 4H0IA 3SGEH 3TWCH 2N56A 2FH8A 3FB7B 3WYRA 4YC2B 3VG9B 4M5YL 1FQ9C 4HHAB 4OLVL 1LP9A 2IPTL 2NTFA 2J4WH 1TJGL 3E0GA 3KPLA 1CR9H 1QZ1A 1I8MB 2BOBB 2F5BH 2PR4H 4M1GH 4L4VB 2VB5A 4KKAD 1AHWB 4MA3A 5H94B 3IJSB 3GJEB 1QFUH 3DXAB 3TO4D 1IT9H 4DVBB 3U0WH 1J88A 3RY6A 3V79C 3BGAA 5CZXC 4KI5D 3E3QC 1NCUA 4IRSC 4J3SA 2IMNA 4OF0A 2V5SA 5CJ5A 2HFEB 1E4WH 1YEDB 2AJZB 3RWEA 1VKXA 3JSSA 1F4WL 5HI4C 5F21B 2VLME 4IOFC 1J1OH 5E8PA 4OKVB 3IJHB 4UQ3A 1P9MA 2FHCA 5FYJE 4HPYH 2O5YH 4QHKJ 4KRMB 2YD4A 2H32H 4XP5L 3VGBA 5GRVL 5B3JE 3BGMA 4X9BA 5DZNA 5ERWB 5L2KB 1CICC 5TFSL 3SDXB 5D70L 1R3JA 1C7SA 3JV5A 3MRNB 3BJ91 3ZKMD 5HHOB 1SY6A 2VDNH 3QDJB 1HH6A 4NKMB 3FOLA 4U1IB 5DTFB 3C08L 3Q1SL 4MAUH 4I5BA 3OKEA 1NBVL 5EUKA 1F5WA 4HFUH 4KQ4L 1RIVL 1CS6A 4GAFB 3OJDA 1A6WH 4NQDD 1R5IB 1D5BA 1CFTA 4JFXB 4X7SL 4TQEH 4P5TA 1WIPA 2VMFA 3ARUA 1DFBH 4GRLC 4CVUA 4HXAH 4ZMAT 2Y25A 2BVQB 3RHWF 1NEZA 4ZAKB 5FK9B 1JYNA 4QOKE 1S7RB 4X5WB 4AH2B 1E27A 4RZCB 3TBYA 5GGUB 1BQSA 3TVMC 4FA8A 4CVZB 2Q3AA 5CILL 1OAXL 3ILQD 1OLZA 3FOMA 3QUYB 1AIFA 1IQDB 4I77H 1NLDL 3S36H 1XGRB 1T1ZA 2NX5B 3QBTB 4G9FE 1WK0A 4OM1L 4P4KA 1LO2H 1OAYL 3O3AB 1GZQA 3G6JF 4JVPA 4NQCA 4AMKH 1LD9A 2A83A 4PJ8A 2LFGA 5BZWB 5I74C 2GT9B 1QBLH 1LHZA 1JZ7A 1R3LB 4DUVA 3MXVH 4PD4K 1N3NB 4LCIL 5DA4A 2W07A 3K4ZA 1O7VA 3CPLB 4V1DB 3HC0B 3ARDA 4P5MB 5D1XD 5E6IB 3WDHA 5FYJH 1ACYL 1BVKA 1G7HA 1KPUA 1U41A 5AUMB 3GNML 3DHMA 4Y2DC 4XAWL 1FGNL 4EXKA 4QXGL 4NCC1 4LLQA 5DJ8B 5C0CE 1JCKA 3OXSB 1XCTB 4OGYH 2YA2A 4GW4A 2ICWI 4GBXA 1IEAA 4GAYB 1VESA 2DTML 2FX7L 1U8IB 4FG6C 2ATPB 4HMEA 5HYJA 1C08B 5E8NA 4EOWL 3RWCB 2NZ9C 4XRCB 2JJSC 2UY6A 1ZA6A 3HE6C 2C9AA 4X83A 5GISL 1LE5B 5I75C 1MCBA 4CDHA 2HWZH 1KBGH 3SE8L 3C5ZA 4QRPA 2H45A 1LP9B 4MLSA 3QPQC 4TSAL 1S9YA 2NTFB 5JTWA 3MJ9H 4CADA 3KPLB 2IFGA 1GYAA 3BH8A 5D6DC 3WFBH 4Z0BL 5TF1H 2X1WL 3NN8A 5HHXH 4EQ3A 1PEWA 4MA3B 3DO3A 4WTWA 4D9QE 2N4IA 3N85H 4KKCC 1IC5H 1EFQA 1KIUA 2R4SH 1MCEA 5E7BA 2C4XA 5BQ7A 4Y16D 4ZOEA 1AKJD 4ELME 5T3ZE 3F7VA 5C0AE 1T04A 3RWEB 4BFIA 1VKXB 3M07A 5JW4Q 4E0RA 1BJ8A 3L5HA 1NC2A 2FECL 4I0KA 1LO4L 2ADJA 1P4BH 4PG2A 1DJSA 3WEXA 5E8PB 4UQ3B 1CLYL 1G1YA 2VXUL 32C2A 4RIRA 2HTKD 3NH7H 2X09A 3OZ9H 3LIZH 4C59B 1CGVA 3T4AA 3BGMB 4MJ5A 5A3ID 4XZUA 5EA0L 1R3JB 1S9KC 1KEMH 3WS6A 4OT1L 5HHNA 2ESVE 3ZKXB 1HH6B 4Y1AE 4AL8L 2JJTA 5ALBH 2W59A 5DA0B 3WMSA 1PYWA 3FOLB 3NIGE 5AG9A 4I5BB 3OKEB 2PN5A 5EUKB 3HC4H 5A2IH 5CJ8A 1D9KA 4PP1C 1DQMH 2X10A 3OJDB 4ELMF 1D5BB 1CXFA 1CFTB 4P5TB 6FABH 3BUTA 4AEIH 4POYA 4S1SH 3NPZB 3AY4C 3Q6GH 1NEZB 3ARZA 4V2CB 5GS3A 2PTUA 3P40A 1YUHA 4U1HA 4ZYKA 1KLFA 1E27B 3RP1A 3TBYB 2FB4H 4LP4A 5L88L 4LVNB 3M1BA 5DO2D 1NGWA 3JXAA 4E9LA 2DQGH 3RY4A 3FOMB 5FYKU 3HZYA 1AIFB 1JGVL 5GRVK 5TE6L 3QSKB 15C8L 4XPAH 1JZ6A 3NIGF 1T1ZB 3ZHDA 4YDJA 5GGSY 3GSXA 4O9HL 3NAAH 2P8MA 2PUQT 4P4KB 4PRID 4EN3A 3NCCB 1GZQB 3F7QA 3KJ6L 1LD9B 3GHBL 2A83B 4HUNB 4PJ8B 3SJVB 1VERA 4H88L 5KTEL 2A77H 2DKUA 4RCAA 2JIXD 1HILA 1RZKL 3WXVL 1MJUH 4JM4H 3RGVA 1CD1A 3RWJA 2AJXL 1T03H 3ARDB 4XGZA 5E00A 2J7LA 2PW2A 1S3KH 2ZWLT 1V7ML 1BVKB 3NCFB 5F3HA 1G7HB 1KPUB 4MXWH 5HYEA 4JO4H 3RL1A 2FD6H 3ZYJA 1VACA 3UTPD 4JPIA 1TETH 3IT8D 3H9YA 4UILL 4LLQB 1NC4D 1F3DH 1XIWC 2R4RL 4GW4B 5DD3H 3B9DA 1SY6L 4GBXB 1GL4B 5T5NF 1IEAB 4LPCA 5HYJB 1WAAA 5E8NB 2NY7L 5MERA 1T0NA 3WLWC 3VXOA 1ZA6B 2HMIC 1BWWA 4PFEA 1EUUA 3BN9C 1JV5A 4O2EA 1NUDA 2A74A 3C5ZB 4QRPB 1A7RL 4YHYC 1E6OH 5KS9A 1S9YB 4UU9A 2XV6B 3VD4A 4CADB 2IG2L 4TULL 5HVWA 2JKXA 3BH8B 1N7MH 3NN8B 4JPVL 5FYLD 5ICZA 2OTWA 1DBML 2COQA 2OR9H 3S35H 2DOCA 4W6YB 3PWPA 1QO3A 3VFVA 1ZE3C 3BEWA 4NGHH 1F90L 5FFLA 3BD4A 1RI8A 2YK1L 3JWOL 5JOPD 1MCPL 5DLML 5BQ7B 2VLKE 1AE6L 4M6OH 3WNOA 5E56A 3F7VB 1T04B 4K23H 1LNUA 5D9SA 4BFIB 5D2NC 2QADC 3OF6D 4E0RB 4MWFA 5BV7B 1NC2B 5I71B 4XC3L 2ADJB 5IFHL 4YX2H 1MY5A 4HUMB 3WEXB 2DLIA 32C2B 4KAQH 4RIRB 4DVRH 4FTVE 5HYSA 2P5EE 3T4AB 5AYUL 1H8SA 4ZO7A 2AJSH 4MJ5B 1MJ7L 4U1NA 3AB0B 1MFAH 4XZUB 1OGAE 1HHGA 3KXFD 3SCMC 4FQJL 1DUYA 5I15H 5EG6C 5IGXH 3IRPX 3MCLL 5HHNB 5C6WH 1Z9OA 5EOTA 3WNKA 3EHBC 2VJXA 1PYWB 1QP1A 4PJFA 3MGAA 3GBML 1D9KB 2Z9TA 5J3HD 4YHLL 3N1MC 2OR8A 4I0PA 3CD4A 3P4OA 4MAYA 4RFOL 5HGHA 4MYWB 5C0BA 4K94L 3DARA 1NBZA 2R2HA 2I27N 2NY6C 3NCYS 1RIHH 1YUHB 3EDDA 3MLTA 4U1HB 3VCLA 4ZYKB 1NGZA 1ES0A 2EKSA 2Z8VC 2YWZA 1YEIH 2OJZL 4B50A 1FNSL 3M1BB 1NGWB 4E5XA 2VR4A 4HAGA 4ZOBA 5IVXA 4RISL 4AIOA 3HZYB 4ETQA 5SV3A 1HHJA 4JQXA 1ADQA 3O6ML 5F97E 4KVNL 1YEEH 4M48H 4J1UA 4YDJB 4UINH 1R6VA 2X4SA 4MNQD 2YRPA 1RZ8A 1YMMD 2FJFA 2P8MB 3VMPA 4LBEA 4NHCH 3ARFD 4EN3B 4PLNC 2HLFC 4GFTB 5GRJH 5CP3H 5TE4L 4MMZC 2W1NA 5ICXA 2E7LA 2JCCE 2IQAA 3T8XA 4N0YL 4KROC 4B0MM 2KDGA 5FHBH 5C2UB 3DRTA 1FL5A 4BSWA 5BV7L 5JO5A 1HILB 4FQ1L 5BRZD 1Y6NR 4Q9BA 3RGVB 3WN5B 1CD1B 3RWJB 4XGZB 5E00B 2PW2B 4XAKD 1VGEH 4HXBH 1YNKH 1HOCA 1A3LL 4OGAD 5F3HB 2V2TA 3GJFH 4BQ6A 4YHOH 1PKOA 2B4CL 4S1RH 1EA9C 3RL1B 3U48A 1VACB 4JPIB 5FYJU 3B2VL 1Z2KA 4CN4A 5H2BA 3MNVA 5CZVH 4UIMA 4F80A 3VRJA 5FA3A 3SDDC 4LGRB 5IROA 3JVGA 1H3VA 4URTB 3HNSH 2O5XL 4H8WL 4IMLA 1OP9A 1Z5LA 5JOFA 3IGAA 5E08L 5MERB 1T0NB 3VXOB 4ZUUA 1IAIH 5F7YC 2NCMA 1Q9OB 2R0ZH 3VXMD 2HRLA 2JCCF 3HFMH 1JV5B 1X5JA 4CU7A 1MUJA 4O2EB 1G9ML 2GW5A 2YD6A 2A74B 4ODHH 3MLZH 5KS9B 2FIKA 2EC9T 3GMQB 4HLJA 5E5MA 5I1IH 4PJAE 3EFDL 1FV1A 4NQXA 5ICZB 2OTWB 4LVHB 3ZYZA 1UM6L 1C5BH 1QO3B 3PWPB 3SDAD 3VFVB 3WV0A 3BEWB 5A43C 1L0YA 2EXYC 1UACL 3QCTL 3LPGA 2GEEA 4XPGL 3AREC 5J9PA 1BWMA 4FQLH 3UJIH 1U8MA 5C08A 1LNUB 5D9SB 4QY8A 4MWFB 4UIKL 2H8PA 4XP4H 1XAUA 4KZEL 4JZJC 4P9HL 4BSJA 3TO4A 1ZVYA 2NPLX 4JZNA 4KXZH 2UWEA 5I0ZA 1U3YA 3MGTA 4J3TA 1CYGA 1RVFH 4TUKH 1A7NL 1TCMA 3C09B 5HYSB 3NBNA 1G7MA 3WFDL 4U1NB 1ACZA 2R0LL 1HHGB 4GS7C 2YPLA 1DUYB 3ZT6A 1AC0A 1OTTD 3V6BR 2P46B 4PJAF 43C9A 5B8CC 4JKWA 1FAIH 5EOTB 2ADIA 1MI5E 1DBJL 1NCWH 1TPXC 2D03L 5L0QC 5DJ6A 4QCIA 4QOKD 1RUMH 4PJFB 3VXUD 2VWEE 4OFVA 5GZOD 1ZWIA 1GC1L 4I0PB 2VDMH 2ARWA 4YEEA 2QSTA 2R0WH 5ISZA 5IVNA 3P4OB 4MAYB 4BSVA 5E1HB 1XGYL 5HGHB 5LGKA 4YC2C 1FC2D 4G9FD 5C0BB 3VG9C 3D85D 3PWJA 1NBZB 2R2HB 2EE2A 3MLTB 1DQDL 3VCLB 4HSQA 1NGZB 2Y6SC 1ES0B 1VEPA 2EKSB 2ZKHH 4PBWD 4GMSH 3X3FL 2P5WE 1JPSL 3BKYL 1R3KA 1GGBH 1CGTA 5DHYA 4E5XB 1AHWC 1HK6A 1AFVL 5IVXB 1SJXA 4YE4H 3OB0H 1HHJB 1II4E 2EZ0C 2WUCH 2Z35A 2DL2A 4J1UB 2VXVL 3IS0X 1TQCB 3X3GL 2X4SB 4ENED 1RZ8B 2FJFB 1BM3L 1QNZH 4LBEB 4WHCA 1RMFH 4Y4FD 2VZUA 2XZCH 5ICXB 2IQAB 3T8XB 1T80A 5K33A 1CLZH 3DRTB 1FL5B 4S2SA 4BSWB 5JO5B 4YBQC 4JFYA 1S78C 1YEHL 1BIIA 2DJ4A 3SN6N 2FRGP 4LFHD 4NIKB 1HOCB 1IMHC 4HWUA 3F8UB 2V2TB 4R4FL 1KUMA 2DL9A 3VWKD 1P5VA 5T1DL 3BEVA 3OKDA 4JGJA 1INEH 3HRZA 5H2BB 3MNVB 4UIMB 5F7WC 3VRJB 2P7TA 5FA3B 1UYWL 1J86A 4N90D 2UVEA 1A1MA 3CCHA 2Q7NA 4IMLB 2NXYB 2RCSH 2ZP0T 5HDLA 1Z5LB 3VG0H 1MNUH 5JOFB 4D9QD 3IGAB 5F7MC 3RJDA 3SE4C 1V3JA 1QYGL 3EJJX 4ZUUB 3K3QA 1KTRL 2EH7L 2PYED 3MRLA 3R8QA 2YOCA 2KKQA 1MUJB 3HG1E 4ZAKC 1WCBA 5T3ZD 5C9KA 1A1NA 2FIKB 1YY9C 2AABL 4U3XA 2V5YA 3QXVA 5HVGB 5E5MB 4WI6A 1OAUL 3SQBA 1FV1B 4NQXB 4L4TD 4H1LG 3QUYC 4Z7QF 4N8CL 4PR5A 1O7SA 1VSCA 1T20A 1RZGA 3CXHJ 3QEQE 5F6IB 3BP7A 4QRTA 5J9PB 3B2UD 1ADQL 1U8MB 5CUSH 5C08B 2BZDA 2UY7A 1X6LA 4QY8B 4WO4A 2H8PB 3LB6D 2XKUA 3RAJH 3TO4B 5CD3A 3DJ9A 4JZNB 5INDA 2UWEB 3D39E 3MGTB 4KDWA 1CVRA 5DZLA 4Y16A 2DI8A 2NY4B 4O4YL 3AMLA 4NM4L 4LSSH 1RZFL 1YPZE 4U1SA 1G7MB 1QRNA 1WZ1L 4M7KH 4JKKA 4LARL 4DGVH 2YZ8A 2YPLB 3PP4L 43C9B 5FDWA 3GMPA 2BNRA 4KI1A 1CDHA 4AEHH 2ADIB 1KGCE 5D7LA 5DJ6B 2YRZA 3AM8A 4QCIB 5DURD 3MOQA 4P4RA 1EZVX 3E2HB 4HKZA 3T2OA 1Z9SA 1ZWIB 3OAUL 3QDGA 5GS0D 3C2AL 4M6ML 1ZLWH 5ISZB 1NDMA 1V5JA 4U6VL 3PWJB 5FCUL 3LAFA 1EO5A 2BVYA 1QPXA 5HBBA 1YPZF 5DI8A 4NO0D 1R3KB 5CEZH 3QWQB 1NMBH 5DHYB 4JHAH 4WHDA 3CIQA 4KMTL 2WIMA 4WW1A 3K2UL 4I13B 4GSDH 2Z35B 4YHZH 3RY6C 1U3ZA 1EHNA 4LHUG 1IKFH 2NMSA 1MPAH 2YA0A 3O6KL 4NRYA 3HR5A 5D5MA 1ZHBA 1CDGA 1M7XA 1SM3L 4DKEL 4G6KL 1RZKC 3WSQH 5C0RH 5CJOL 5DGRA 2Y9RT 1P9MC 2D3VA 5I30H 1RAMA 2OS7A 4JFED 3ORJA 4S2SB 4JFYB 1YEGL 3HTLX 4PRIA 4NKQB 1BIIB 1NGYA 3O6FD 2OZ4H 5FIEA 1OL0A 4XX1E 1JRHH 3FCTA 2I25N 3O3BA 1J12A 3D2UD 4MA1B 3UTQA 3ZKXC 3BEVB 2XA3A 3OKDB 4NZDA 4U1KA 5E4EB 4DOHE 3HRZB 2EEBA 4MJ6A 2CRZA 4MB3A 5FO7A 2P7TB 2YMXH 1ZT4A 4R26L 3UTTD 4XB8A 4PB9H 1A1MB 3CCHB 2N7BA 1TZGL 2HT3C 1TVBA 4FABH 1JJUA 5C07A 3H3PH 4P23D 4P5TC 2X2YA 4PBXA