4MSWB

Y78 ester mutant of kcsa in high k+
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
212
structure length
212
Chain Sequence
b'DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
molecule tags Transport protein
source organism Mus musculus
publication title Using protein backbone mutagenesis to dissect the link between ion occupancy and C-type inactivation in K+ channels.
pubmed doi rcsb
total genus 54
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2013-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mswB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mswB01
1WICA 3RKDD 5CWSB 4M62H 3UTSB 5C07E 1OW0C 3KPOB 3EYOB 5IVXA 3BEVA 3CDGA 1W72B 1TLKA 1E27A 1JGUH 2Z31B 5D2LA 1S78D 3P9MA 4MCZA 4MA3A 4Y5VC 5FHBL 1RHFA 4M1CC 4PJXE 5T3XE 4JG0L 5F1KC 3TBTB 4ZYKB 5F9AC 4G8GB 4NQXB 2AJYH 5E94B 4LP5A 3MO1A 3E6FB 2OR8A 4PJ9C 2HVJB 2W9EL 1I8IB 3GHBH 2OQJA 4PGDB 4AY0A 3JV0A 2NY2C 3RL2B 4K9EL 1I1RA 2OX5A 3CFJB 4IMLB 3X14B 4MVBC 2D7NA 1EO8H 4EXKA 1J12A 4WWKA 5FK9A 5HPMA 3PGDA 3QXTA 1IKNA 5LBSL 1RUAH 1WAAF 3M45A 5CKAA 1RUQH 3SDXE 2DQGL 3RDTD 1LDPH 1M7IB 3DETD 4LLUB 1FO0H 3MCLL 2O5XL 2P5EE 4GW1A 3NIFF 4M7KH 1YYLL 4MDJB 3RGVD 4HPOH 5JOFB 4XP5L 4EN3A 4XCCL 4KQ4L 4YHNB 3T04D 3V5HB 1S5HA 3FN0H 3WDJA 4FFWD 5J4MA 4RGNB 4Q9QH 5IOPA 2QQNL 2CQVA 4X6FA 3MV8A 3ARGB 4N0RA 3U0WH 2AV1B 3Q3GB 1QHOA 2R0ZH 4OUUB 5EIIB 1FO0A 3FAXA 2V2TA 3DYOA 4QOKB 3GDBA 5GS3A 3LKSA 4I18C 4WHYH 1I8LA 1JRHH 1YEHL 2JIXB 1VCAA 4MD0A 4HIXL 3SY0A 5C3LD 4JKLA 2EO9A 3UTQA 3D48R 3BE1L 2IAMD 3WNPA 3HUJE 1Q0XH 5DO2C 1T83A 2JELH 2A9NH 2ZG3A 4X7DC 4B7LA 1YEKL 4NNXB 3V5DA 1BBJB 1C16A 4DK6A 5D7LB 1A9EA 1A6VH 4JM2C 3C6LB 1N59A 5SX4H 2ADFL 5DHYA 1QTYT 3E6FA 2FYYB 4JRXE 2P42B 1CDGA 2VDRL 2DLFL 4PY8I 1NMAH 1MI5A 1YPZA 4PJXA 4Y2DD 3WFHA 1T7YA 1RUML 1N7MH 4OIIH 5TH2A 3S36X 1BF2A 1KN4H 3GSOA 3TNNA 5GZOD 1IAKA 2FJGA 4RMTA 1A2YA 4JM2D 4XX1E 1CQKA 4MB5A 2H26B 2V2XA 2Z31A 5FV2A 1GH7A 5CFHA 3EDEA 3F7VA 1ZEAL 2VJXA 4Z77A 5HYSA 5JXAH 5TPWL 5IVXB 3HPJA 1XH3B 4HWBA 2YSSB 3FQTA 5I15L 1J5OL 3HZVA 1F4WH 3LV3B 1G7LB 1GZPA 3PHSA 3MUGA 3MOAL 3QCUH 1BLNA 3FO1B 2VAAA 4F33A 4CN4A 1KLFA 2ICWA 1AR2A 5ADOH 1S9KC 2GYSA 5CZXD 4XMLH 5HVHC 1GIGL 3F7YB 4OLWH 1MSPA 3RWHB 1UH2A 3T4YA 1QKZH 3GZKA 3QYCA 5DD3H 1T2JA 4ENED 1E6JH 3O6KL 1NUGA 3G6JE 4P2OB 4CVUA 5ICZB 1WBXA 3ROOA 4XRCB 3VGAB 1J0ZA 1QR1B 2W0KA 3V4PL 1BJ1J 4J4PD 4OLYL 3U6RA 5FEBA 1GPOL 3S5LG 2IJ0C 2NX5B 4DWHA 4OCSL 1KLGA 4M5ZH 35C8H 3IKCB 6CGTA 3CXHJ 3VE0A 3REVB 1G0DA 3TIDA 3KAAA 2Z91A 4W81A 2HH0L 4P4KC 5D5ME 3JWOL 4HCRL 5BQ7B 5CIPH 2AEQL 4I3SL 2VXUL 2UZXB 4MD4A 1KULA 3WIFA 3QHTC 4K7FA 5CINH 1GC1C 3N1PC 1F4YH 2XT1B 4JQXA 2XXCB 4U7KA 4NZRL 3G9VA 4Y5YC 4OLWL 5DR5H 1BD2E 3HS0B 4JKWA 1RHHA 2ZOKA 2JE8A 1RIUH 2AABL 5DJDA 3X11A 1U92A 5GSVB 3TBVB 3U46B 3DMMB 2AI0L 1F90L 1MNUL 4MAYA 4WW1A 3DX8B 4JZOA 5DZNA 5ESQA 2YKLL 2XKNB 5C7XL 1CZ8L 3MJ9L 4WHYG 1V3KA 5DRWB 5ACMA 1A5FL 3QUXB 1DVFD 2XIDA 2QV2A 1OWWA 1OT1A 5D93C 2YRLA 4KJYA 4TVPD 4I18B 5DMIL 2XTJD 3T0EC 4NQSB 1N7ML 1P7QD 2VDKH 1NL0L 3MLVL 2ZG1A 1SY6A 1Z5LA 3Q6GH 4GG8A 1YA5A 5I66A 1LE5A 1HINH 4HIIB 4I3SH 2Q8AH 3UTOA 3BRGC 5FDWA 3S88H 4JB9L 3EGSA 1JP5A 1RU9H 3VFMA 3WN5C 3DRTA 1C1EL 3BWAB 2M2DA 3C6LC 5DJYB 2YPVH 2E8ZA 3SDCB 3V6FA 1OCWL 4YHLL 1JTTA 5KVMC 1YN6B 5JQ6H 2ICWJ 1FV1A 4PTUA 4KU1A 1RJLA 4JO1H 3TN0B 3WDIA 1N64L 4Y1AD 1JNHB 4JGMA 4QRTB 5D7LE 1WIPA 6FABL 5F96L 5CBEB 5D1QC 1QVOA 4GSDL 4TUJB 5F7YC 3A67L 3FL7A 2FATH 3NAAH 1DUYB 1W2KT 1CD8A 3C8KB 4WO4A 2I07B 2Z4QB 5FV1L 4OGXL 3NPSC 1MFNA 3EYUL 1S9WA 5I9QB 5ADOL 1CD1B 4FTVB 2Z35A 3DUSA 4FXKA 4E0RB 5FYJE 1U9KA 1F4WL 3GUTB 2OI9B 4XX1G 1BBDL 1YDPB 2F53A 2ZCKL 3TJHC 2G60H 4N9GA 1NGQH 2P44B 2H2SD 3CFEB 5I18L 1FNEB 3THMH 1OLLA 3TBWA 5EC2B 1CU4L 2OP4L 3P73B 2JLLA 5TE6H 3W0WE 5KOMC 3RIFF 3QEQB 3NFNA 1R24B 1IGMH 4JPWL 5C0GA 4LKXB 5ADPH 3GI9H 4HD9A 2AJUH 2AJVL 4E0RA 3DUSB 4M6ML 5IB4A 1XZ0B 1FNGB 4JN1L 5B21A 4NZRH 1XGYL 3QCVH 2WQRA 5JO5A 1A3RH 2R29L 4NKOB 4AEEA 2F5AL 1DUYA 3F6LA 3UJIL 3HLAB 5JHDD 2EZ0D 1I1YA 1CGXA 4G8GE 3S35L 1KB5B 1DEDA 4LMQI 3MROB 5DK0A 5SX5K 4H1LA 4S1RL 4V1DD 4QXGH 5CBEA 1V7ML 5INCB 2FJFB 1WEJH 2BSRA 4HBCH 4KDWA 1Q0YH 4HQQL 4JRWA 5DEGA 1RY7B 3ARDA 1HIMH 3ISWA 1RULH 5EO1B 4UUJA 5BJTA 2EKSA 5AG9A 5CBAA 5HDQH 4HPYH 1LGVA 4BK4A 3HG1B 4LCWB 4XXDA 5D2NC 1Y6MR 4YXHH 1JF5A 2AQ1A 2GIYA 4OQ1A 4QF1A 5LXGH 3MLYL 4OSUH 2CKBH 2B1AH 1C5BH 2YD4A 4LQFL 3EUUA 3PL6D 4O2EB 4PLOB 3GMNA 4IOFC 1WUNT 4JM2F 5F8QC 4LPTA 1RZIA 3WO4B 3C5JB 5E03A 1GSMA 4LRIC 5JXED 2AS5M 2R56H 3VFRA 3CPLA 2Q7NA 3T0EB 3H9HB 4B50A 4GG6A 1OP9A 3NABH 5DT1L 2NY7L 1RVFL 2JK5B 1U8MA 1KF9B 4JZOB 4JRYE 3BVNA 1G7IB 3VGFA 3DMMA 1AHWA 1OSZA 4AENB 1FAKT 5ID0B 3O6FB 3IYLW 3WN5B 2OZ4L 1GHFL 2EC9U 4DGIL 4UT6H 1QLEH 4HV8B 3REWB 5CP7A 4JHWH 4K7FB 1JYVA 5FA4A 1ETZA 2DQJH 5CEXA 2Q7YB 2FLRT 5LGJB 2GQHA 1UZ6E 4X6CF 1TPXB 4U1LA 2Z91B 2ZWLT 2VQ1A 2X7LA 2ZCHH 3BXNB 4UU9A 5C08D 5GS0L 4FTVD 4KVNL 4NZUH 3PGFL 4K23H 3N50A 3GSNA 4EXPX 2ERJB 1FNGA 4BQ9A 4OCWL 4R3SB 4LEXL 1OAUL 5KSBE 2CO6B 2VKXA 5JTWA 5DJ0B 5K9OB 4KKNA 1R24A 5EA0L 3TT3L 4QY8B 3FQNB 1QR1A 3UYOD 1NEUA 1QO3B 5J57B 5I73B 1OAKL 3TFKD 3PQYD 5F88B 5E70A 4YDLB 5ISZD 2UWEB 4FP8H 3B83A 4RAUB 1BJ8A 4FTVE 4X6CE 4N9GB 1W72L 1MHHB 1PY9A 5BVPL 4XC1H 2AXGB 4OCXL 2VZ3A 2DBLH 2Z35B 4FXKB 3H3BC 3BEWB 1U95A 3V6ZA 1KNOA 3FO1A 3WHXA 2R69L 1TZIB 1U3HC 1ZTXL 2I07A 2Z4QA 3IDGA 5INDA 2BVYA 3LV3A 4O58H 3RY4A 5IROA 4K8RL 4EOWH 3DROA 5KVGH 1EK3A 1HH9A 5KSBA 5FUZH 1QVOB 1FFNA 4WW2B 2A6JB 4K2UL 2EDRA 2OTPA 5DK2B 1YY9C 2R2CA 3C2SA 2FEDD 1HHHB 3L5XH 3ZDYE 3KPRE 1A6AB 4D8PB 3SJVA 1TZGH 3OGCB 5ALCL 3VFMB 1N59B 1RURL 2DQFB 1ZSDA 4IRJD 1PVHA 5A43C 5IUSA 2RGSA 4XVTH 4ZO9A 1DEEB 3LOWA 1YQVL 4P4KD 5F6IC 3P4MB 2V5SA 5E8NB 3SGDH 4GW5A 1L6XA 5AG8A 5IP4A 5L88L 4MNQE 3VXSE 1OQXA 5EU7C 3LHPH 3TC9A 4PJ5E 3WJLC 3NN8A 3WHE1 3WFDL 2BVOB 1IAIL 3NCBB 4BQCA 1P6FA 1A4JA 2ITCB 1EA9C 4PJ8C 1BQHA 3OMZA 2BVUA 5IEKB 3DX8A 1IZJA 3BP5B 4BZYA 3RBGA 3O0RL 1NCWH 3IETB 2FRGP 2MMXA 1VDGA 2FBJH 4GMTH 1P4BH 3HMWL 4XP6H 5AAMA 5EO0A 2B5IB 1XCTB 5GIRB 1JNLL 4EN3B 5HBBA 1T5WA 2C7UB 5J9PA 2NY5C 5EU6A 4N5EC 3PJSB 1NBZA 5MENA 1MH5A 3VMNA 3S4SB 4RGOH 2PXYA 3D69B 3UZQA 4AEHH 2FZ3A 3MREB 3KPPB 5FK9B 1RIVL 5IV2A 5LAXB 1KLGB 2L0DA 5I0DA 1INEH 2HKHL 4I2XA 2CPCA 5TE4H 3RX5A 3VWJA 2X4NA 4ZDHB 2VH5H 4PGDA 3CH8A 5ILTL 2C1PB 2YA1A 4F9LA 4HMEA 4LLMB 1X44A 5F3BB 1FZMA 3PDOA 1L7TH 1QLEL 3NCJL 4YDLC 2VLRA 1A6WH 4D0DB 2VDKL 3MRMA 1MFBH 2DJ4A 3TO4A 3R0NA 5FYJL 4LK4A 5IB2B 1RZJL 1H3PH 2YUXA 3CZFA 1EGJH 4N8VG 2Z31C 3RRQA 4GS7B 3BO8B 3RFZC 1LO5B 3U4EA 1YEGL 3O3EA 1NFKA 3MFGB 3QUYD 4LLWA 1A9BB 1GGYA 4S2SA 3NFSL 3RBSA 1BZ9B 1F4XL 5D7IA 3EOAB 3VFTA 3QFDA 3BO8A 2Z0BA 2W60A 2PTTB 1T22B 12E8L 4OLXH 4PJ9B 1QQDB 4XPGL 5HD8C 2NY2B 4HWBL 4AK1A 3MLRL 4GBXA 5KS9E 1X3DA 4U31A 3MLTA 1NAKH 4OB5H 5TH2B 4J8RA 3UXFA 2VLRE 4NWTL 1PKQE 3KXFB 4LLMA 1Q1JL 3I3DA 4HKXB 4LPUA 3U9PH 5F7NC 1PAMA 3TZVA 4DW2L 5HJ3A 4Y4FA 5JA9A 1IGCL 1LO0H 1YECL 3C09B 1N64H 3HE7B 3NGBB 2WNGA 3MV9D 5AEAA 1N0LA 3I2CH 4L9LA 4OZGE 4ZPTB 5F44A 3V52H 5I8EB 2IAND 3MLSL 1U8QA 3F5WB 1G9MC 3VFWA 1FPTL 2WBJD 5A2KH 5F6IB 2GY5A 2JIXA 4N90E 1YNTA 2XZAL 2A74A 2VC2H 3EO0B 3HPLA 5FF6B 4ZUSA 3NFPB 4OUUA 4IBLT 2NYYC 4UILL 4XP9H 5EIIA 1G7JB 2PYEE 3OKEB 4O9HL 1RJZA 5F7EH 1T0NB 3FT3A 5LJYH 4OQTA 4PJ5B 3QXVA 4PP2B 1XGYH 4HWZA 4LCYB 3ZKNC 5TDOA 3CMOH 2EYRB 2DQEL 2J7LA 4PJFB 1FH5L 5ETUA 2ZUTA 1NDMA 2VR4A 1F3JA 4YX2L 2ZG2A 1YUHA 1A4JB 1EEZA 3M1BB 3T1FB 1IMHC 3QRFM 4WI3A 3V2AR 2H45A 3T4AA 1R0AL 1JPSL 4KUCF 4MXVE 4ODVH 1Y18A 1AHWC 1CGSH 4WWKB 5E6ID 3QIUA 1BIHA 1U8LA 5GPRA 4YDVA 1T6VN 1ZHNA 4FFVD 4FMFA 2AEQH 5EZLA 2H8PA 5ANME 4F7EB 1JPTH 2OQJB 2IALB 3FB8B 4KKCC 1I9RH 1ZT4B 4ZFGH 5EBMA 3EHBC 2DQTL 3V6OE 4YK4B 5E2UH 3HI5H 1A21A 2EIDA 4O2CB 5KSBB 3VI4E 3BX7C 5DO2D 3W11C 3MRDA 1DVFA 3LRHA 3RZCB 5C0BA 4TVPE 4U1HA 1AIFB 3LSOA 3QQ4A 2ICCA 3QDAA 1TVBB 3SJVD 3OKDA 4HDIA 3B3IA 4PJCF 2MCPL 2VDMH 3H3KA 2YUWA 4YR6A 5HYQA 2ZSVA 4MNGB 3L3JB 5HVWA 3MBXH 4NRYB 2AJVH 5EU6E 4NO5A 5TJWK 3VH8B 5B38G 1ZLVH 1TENA 5BRZE 4MSWA 1KCSH 4LGRB 4NN5C 1U3YA 5KSUB 4I77H 3EYQD 4WGVB 2UWEA 5CZXC 4C56A 2HJFB 1SMOA 4K7PY 1HQ4A 1XGQB 2CR3A 3D2UB 5C7XH 4P4KB 3MLRH 2Y1VA 3KYOA 4GKSB 1RK0B 4XPGH 4WNQA 4WI7A 4UINH 3GIZH 4HF5L 3VXUE 1WWWX 1ND0A 1OTSC 4JDVB 4PRID 4QRPA 5HI3C 4OJFH 2WBJC 4DN4H 2G75B 1U8IB 5A2JH 3WNKA 4MQSB 4UQ3B 3V8OA 3L7EB 3AS3A 2PO6D 43CAB 3WV0A 3NIDE 1KELH 5CSZA 5C0AB 5IG7B 2J5LB 1FGVH 4G7YL 5FHBH 5KVEL 3ZHLA 3Q1SH 1GL4B 2FL5A 3GMQB 4NZTL 2OS7A 2XN9B 2DQDH 4J3WA 1HILA 5E99L 4YHIA 4ZFZB 3O6FA 4YHKH 1LDSA 2XZQH 4BZ2H 2HFGL 5MEQA 1Z9MA 4L8BA 3VI4F 5FHAH 4O4YL 4HC1A 3RWJA 2KKQA 4HAFA 1SQ2N 5D1XA 4XBEH 2QQNH 3MTRA 2E5EA 4X4XB 1UB5B 2DKMA 1QP1A 4YBHA 1CFQA 4POZC 5GHWL 1SJVA 3I3EA 4WUKL 4GT7A 5F7MC 3CSYB 3SDCC 5IM7A 3HC4L 5C6TL 1DQTA 5K33A 2BNUB 2FGWL 3MX0A 1MI5D 3ARQA 4RIRB 1OD9A 1MCNA 1RURH 1T1ZA 3NFSH 4QXWA 4MXQD 3C9NA 4JM2A 2H2PD 3AU1B 4NNPL 1BIIB 5H94B 2Y07H 1YC7A 4F3FB 5GGSB 5M7QA 1QFUL 3IDNA 5DD0H 4JCLA 2IAMA 4OF6A 3D3VB 2A6DB 1IEAB 1NDGA 3NPSB 4QHMB 5ESVA 5DD1L 5KTEH 4KROD 5I9QC 2BSTB 1NJ9A 5DK0B 4NFBA 4NM8L 4NDMA 1KIPB 3OQ3B 2LU7A 4HJ0D 3BKYL 2VIRB 4GKNB 3NIGF 1P53A 3AB0C 4RFEB 1YN7A 3OAZK 2NY2D 4RMRA 4Y5YA 1EHXA 5TE7H 2X40A 3ARZA 5SWQA 1IL1B 1YEKH 3S8WA 2D03H 4NQDB 3P11L 3B9KB 4M3KB 1J0KA 3BGFC 2F8XC 1OAYL 4A6YL 3O3AA 1PY4A 5CCKH 5SWZA 4AEHL 5HHQB 5T33L 4PJDF 1BQSA 5CHNB 1KJVA 1AJ7H 1FRGH 2EDFA 1P2CA 1KIRB 2WBJA 4XC3L 2O93L 1IGFH 2ATKB 4PBWD 1VEOA 2HTKD 3HRZA 4P4RB 1QKZL 4PRDA 5C1MB 5BRZB 1BQHG 3X3GL 4H20H 1G7QB 1G9EA 2MHAA 3RA7H 3C60B 1JWSA 3MRCB 1QSFA 4K8RH 2BRRH 1FZOB 1MQKL 4LSUL 4FXGB 2F15A 4HK0A 3VXTB 3ZDXF 3FRPG 4IOSD 1NEZA 2Y6SC 5MEPA 1UJ3C 4G6AC 1EBAA 4YHIB 2ADIA 1XGTB 4YFDB 4OF8A 5DJ8B 1G6RB 2W1NA 4ETQB 3MSPA 1OY3B 5CSZB 1IGFL 2FX9H 4DGIH 2VNCA 4TVSa 2J5LC 3VCLB 1NEZG 2ITDB 3VFSB 3CFBB 1CFNA 4NQTA 4PJHE 5DJYA 3BWAA 3IFNH 5LVEA 5J6GB 5KG9B 1QHPA 4J6RL 2BRRL 1I1AC 2XG5A 4LRNL 2N56A 2K9UA 3QHFH 1KCRL 2VABA 5ITBL 32C2A 4D94A 1M71B 2HT3D 2YD9A 3QWOB 4JY6B 4KVNH 5HDOA 2QSCL 5I1DA 2C4FU 5E24E 4NQSA 2P1YA 3MJ8B 5E4EC 4N9OB 4S0TD 3D2UA 3CCHA 1Z3GL 1MVUA 2Y7QA 4XBGA 4LCCB 5D70H 4TNWK 1GGUA 4I3RH 5KSUA 3BOVA 3E0GA 4OSUL 2BNQB 5L2KB 4HHAA 2IMNA 2HTKC 5F9JA 3N9GL 3U46A 5C0CD 2AAVA 1U91B 3MGTB 4OZHA 1ED3B 3IJYB 1ZS8A 4QWWC 5E99H 5E8PA 4A6YA 5L2JA 5CD3B 5BXFA 5IESL 1ZV5A 3UPAA 3S36L 4IM8A 1IAMA 1P7QA 1J0IA 1UA6L 2VXSH 3LKNB 4NO0A 4TUOA 2OM5A 1UM4H 2VDNH 2A0LD 5CGYD 5D71L 2GK0A 2EXYC 2C26A 3FRPA 1WWCA 4C4KT 3GHEL 2APBA 3QEGH 1VADB 3OKOB 4Z7NE 4N8VA 5BW7C 4QLRA 4HXBH 3SKNA 1TCRB 4O2FB 1JN6A 4RRPA 2KL6A 2UVEA 4HKBB 5EUOA 3FOMA 3HC3H 2X42A 1P4LA 3D9AH 1AKJB 1U8KB 3CZJA 3N1MC 4LSQH 3QZWG 4NSKB 4NZJA 3RUGE 4MDIB 1WIOA 4F7EA 5MI0C 3KLSA 3LZFH 4PRIA 4XRCA 3QUMH 4MJIE 1ZLWH 3ECBB 1UZ8A 1X5GA 1QR4A 2I5YL 4G80A 4ZXBB 5J56B 2JJSA 2EEAA 3DSFL 3U9UB 5A2IH 5A2LH 3Q5TA 2C3XA 1OW0A 2CJUL 2J8HA 4DKEL 4ZS7H 3TYGL 5SX5H 1H5BB 3E6HB 3FHQA 5DRZA 1SEQL 4F15C 2PO6B 2YEZB 1UKSA 5AWNL 1UXSB 1UB6B 1JF6A 1F3JB 4Z18A 2F53D 2M8XA 4KV5F 2HFGH 3ZKSD 5IIEB 4YHZL 3KR3L 3QWRD 2PYFB 5ACLA 3RUGA 1NBQA 4Z7WB 3UTZA 1TDQA 2LTQC 4DCQB 2AQ3A 3UTPE 3KLHC 1U3ZA 3FT3B 4M6OL 4HSQA 4FMKA 3CX2A 4Y16A 4TTGA 2V2XB 1WBYA 4PJ8A 4KRNA 2X1QA 3U4AA 3IJSB 3NFPA 2H3NA 2R2HB 1MUJA 4L8DA 1E4KC 1CE1H 2B7DT 4M6NH 1YPZB 3WFHB 2P5WB 5CSBA 1I3RA 5C0FA 2K7QA 1EEUA 3IDYC 4Y4KB 1DE4A 4WI4A 5I8CA 3BKCH 4PLJC 4ZPTA 2VDML 4OAWA 2NPLX 4OCWH 4MJ2A 4YUEH 3KPNB 1YC8A 1JPST 3OXSB 4AT6B 3QG7H 3ZT7A 1UT9A 3P77A 3O41A 4XCYB 2J2ZA 4D0CB 1D6EA 1DL7L 4G6JL 1CL7H 2X4PB 2VWEC 4JO4L 2HLAA 4KAQL 1S7QA 1X5KA 1I85C 3BPNB 3IDIA 3V0VB 2N7AA 4LGPB 1DSFL 4MS8C 1G6RH 3H7BA 4XI5D 4PRHB 4YIQA 1F2XK 2BOCA 2PYFA 3AXLA 1I7TB 1OOAA 4LARL 1S5HB 4ZAKD 4XGZA 5HDBF 3ESVF 4PV9A 3TVMA 5JIKA 4P9HL 4WO4C 3O3EB 3DX9A 5J7CC 3TBYB 3TYFA 1DBBH 5IHLB 3E6HA 3QB7C 4N0YL 3JWNC 4M48H 2I25N 5F96H 4HUNB 4Y19A 1KUMA 1BGXL 4KVCH 1I3GH 4L29A 2D7TH 5B8CA 1C12A 5D7JA 5IMMB 4ZNEA 5F3BA 4N0CC 5DUPH 5MHSE 4PG2C 4M61A 2NQCA 3GNML 3BH8A 1BM3L 3B2UD 4OF3A 3I6LD 3TP4A 3S88L 2XQYG 3K7UA 4LRIA 1QUNA 4WTXA 4M61B 4I2XB 4UV7H 1Y6KR 3GMLA 1CE6B 1FG2B 2RQ8A 4JKPH 1X5AA 4FHBD 1ZGLP 4JAMB 1EH9A 3EDKA 1CFSB 4HFWA 3MRIB 4NQED 1JWMA 1E27B 5D2LB 4HC1H 4PGEA 3EFFB 3LB6D 4XMLL 1K2DB 1Q9OB 4LU5H 1UQSA 4NNPH 1O5DT 3EYOA 4KRPB 1HE7A 1RZ8A 3IRPX 3UTSA 1JGVH 3DX9B 4NO3A 4LSTL 2YPVL 1BVLA 4F15B 3C8DA 2PW1B 5J06A 4ZOEA 3QO0A 1E4XH 4RFNC 1PG7H 1MAKA 2VAJA 3PXJA 5I1EL 2R29H 1I1FB 3SGKC 5D5MF 2YRPA 3ARFC 3QIWD 5DTFA 5E8EB 3CXDH 4I77L 4R9HA 1ZS8B 3IJYA 1ZEAH 3DARA 4HGMA 3RPKA 3AS2A 5H35A 2P5WD 2CDFB 1K6QH 1AGFA 3PHOB 2B2XL 2HLAB 4QNPE 4NKMB 1CU4H 2OP4H 1A4KA 1B6DA 2ED9A 3NN8B 5T1LB 4P23A 1OAXH 3EOYG 5F9OH 1LK2A 2AJSL 4CW1A 4OTXL 3JVGC 5I1DB 4KZDH 4Y0GA 5C0RL 3IDYB 4F57L 1JGEA 1N5YH 4Y4KC 1N6QH 2BERA 2QTEA 1MCBA 5C0AE 1UWXH 3HB3C 3OZ9H 3Q1SL 4JVWA 4P3CL 3HI5L 2P5WE 5DR5L 4JFDE 4LVHC 5T1MB 1FORH 2G5RA 5T3ZH 4ZFGL 3OGCA 4WENB 3C6SB 3PWJB 4FQXB 1Q1JH 3CFBA 4UNVA 2WBKA 4JVUA 3HG1E 1MFEH 3HNSL 2J6EH 4XPHH 3IJSA 1N4XH 1A6WL 3K74B 3MV8E 4TPRH 3ULUH 3K1KC 1T66C 4ETQA 1MRFL 5F1SA 2BC4B 4OIIL 5A16B 4GMTL 4XMKL 3UTZB 2JTDA 3QNYB 2WWKT 3SCMB 2YN3A 4WJ5A 2R2EB 4LMQE 2R1WB 5FKPA 1S78C 1YMME 3O11A 1R0AH 1BEYL 5IFJB 1UB6A 5HHVH 5L8LB 4HPOL 5SWSB 2QKIB 1SJXA 1U95B 4KI1A 3BPOC 3GI8L 4GKZA 4PR5B 1AH1A 3TCLB 3HUJF 4XB7A 5F1NA 5EULV 4OZIB 3FAWA 1YYML 4HH9B 3UC0H 1FYHB 1SBBA 3RVWC 4PJ7F 2A2QT 2NY3B 5FA3B 5CS7A 2VH5L 4QY8A 4UOW0 4GXUM 1KGCD 3QI9D 4LAJH 4NKMA 5LWYL 3G04A 1HSAA 5JPMA 3KNBB 5C0EA 3QT2A 3DLQR 1OWRM 5JHDB 1ZHKA 1FPTH 3C87A 2XFXA 1VADA 3LVEA 5HVFB 1YEEH 5LGJA 4U33A 4D9QD 4XZUA 5DTFB 1CD9B 1MCOL 4OLZH 3I6GB 3JSSA 2M1KA 2KH2B 1NJ9B 2BSTA 4KHXH 4I8DA 1HDMA 3T77B 1D9KD 2D7QA 4UT7L 5CP7B 3EW3B 4UV7L 4G9DA 3S37X 1JHKL 1MIEH 2R0LH 5I1LB 1AGBA 4N8CH 4F3FA 1RZ8B 1KIQA 1CE1L 3DURA 4JZJA 4M3JA 2J6EA 1RZKL 1KCLA 1ED3A 3MYJB 4JFFD 1GVIA 1G7IA 3VXPA 3LEXB 3ORJA 2VLLB 1TJIL 1UVQB 1KV3A 4XBGB 4WUUE 3QRGH 3QNZB 2NXYB 4P9HH 3DIFB 4LLYB 3CU7A 3KJ4B 3CX5K 5H37G 1VGKA 4LF3B 4OFVA 7FABL 5IF0B 5I6XC 3ZSTA 1DBBL 1I8MA 1OAQH 4LAQH 4UDTB 1T0PB 3BH8B 1S7WA 3ARUA 2VDLL 2R4SH 4NRXA 1OP3H 1RZJH 5CMAB 3TYGH 3QUMB 3QIBD 5HYIA 2A6IA 1L9NA 5E0QA 5J6GA 1N8ZB 1YJDH 3D1MC 3JTSA 1B0GB 3BZEB 5J1TC 1KIUA 1SJHB 5GRZA 4NPYA 4P2RB 5C09B 3G5VA 4ZFZA 2XZAH 1S8DB 2HFEB 2D31B 3RZCC 1HKLH 1CGYA 3VRJA 3GMPB 4L4VD 4OBRA 4PJ9D 5F8RC 1I7TA 4JFDB 4S1QH 1YNLH 1DBAH 4GAGL 4RWHA 1E0OB 5L0QC 8CGTA 1EV2E 2QSQA 2LVEA 3SKMA 1Z0MA 1IAOB 2EDBA 4M4RA 3BZEA 3ESUF 1MEXL 5I1IL 1NUDA 2EE2A 4DQOL 4KI5D 4HEPG 2QL1A 1B4JH 4Y8AA 1QACA 4JDVA 2FX8L 5EBLB 5FO8B 1HEZB 1RMFL 4BYHA 4JZNB 2R0WL 4NRXB 2X4PA 5L2KE 4WY7L 3DXAB 2DBLL 2R56L 4PJ7E 4JFED 4CU7A 4S1QL 2HFTA 3HC0B 3QFJB 3KYOB 3QEQA 3SPVB 5EUKB 1UH3A 1UH4A 3UPRB 4R2GB 3LKPB 5DFVD 1GAFH 4I13B 4R90L 2WBJB 4TSCH 1LK3L 1RJCA 2HP4A 3O6LL 2BVPB 1ZVYA 4JHWL 1P2CB 2D4FA 4LSUH 3TN0D 3R8QA 3C5ZA 4CADB 3PP4L 3KLAB 4GXVL 2NY3C 4TULL 4NRYA 2P24B 3TV3L 2VDLH 1I3RB 2O26U 5C0FB 5DWUH 4MNHA 3DBXB 4ONHA 3A6OA 1S9WB 3ETBF 3U2SB 3W81A 3PGFH 3LHPL 4KI5E 4PJ5D 5I1LA 5ICYA 1F42A 4ODWB 5BZWA 2P4AB 3QXDB 5TFSH 3LIZH 1E4WH 1KG0A 3Q48A 3L3IA 3QJFB 1HNFA 4O2CA 1KFAH 4YFLF 5KSAB 1RD6A 4EVNA 1Q8MA 2A6DA 4QHMA 4QRUB 1MAMH 3QDJA 4ZPVB 3VGEA 1CI5A 5HXMA 4G7VH 1A3RL 4HZLB 1CTOA 1J0HA 2NCMA 3KNBA 1FYTD 3ZE1F 5C0EB 5JPMB 5MEOA 3OPZL 5I1KH 5GZND 3U4BL 1Q38A 4M8QA 4YDIL 3ZE2F 2DQCL 4UTAH 5E2WH 3GGWA 3U30B 3IDJA 5FDWB 5AZEH 1RVFH 2BDNH 4UQ2A 2Q87A 1LEGA 4OKVA 3NA4A 2XQBL 5CZVH 4JREC 3ECBA 3HMXH 1OB1A 4L9LC 2BHYA 3TCLA 1XCQA 5TFSL 5D9SA 2NXYC 4V1DE 5K9KB 4ZTOH 1AKJA 1U8KA 4FQQB 4NSKA 5FUOL 2F19L 1K3IA 3QUXA 5I6XB 5IKCB 2JJSC 4FOMA 2DL9A 5DRWA 4KY1L 2Z8VC 5MEOB 3MLYH 1SY6L 3MXWL 1AP2B 4IRSC 4OM1H 2ARWA 4MAYB 4UAOB 1OTUD 3KPSD 5DDHB 4QRUA 4DTGH 3UC0L 2EYRA 1YPZE 1KTRL 2ZOKB 3AB0B 4AH2A 2FSEA 2W9DH 3MXVH 2AEPL 1JJUA 1T0NA 3SDDA 5JW4M 3IU3A 1Z3GH 3W9EB 3U0PA 4LNVA 3SQBA 2R1YA 1YY8B 2CGRH 2NY1C 2BHUA 2P45B 2A74B 4XBPA 2EE6A 3ULUF 3THML 3HUJA 5SWSD 2H1PL 4L4TA 2OYPA 1E6OL 2Y25A 2J8UF 5E00A 4BZ2L 3PNWB 4JCMA 5CEZD 2G75A 1U8QB 3HAEH 3KS0H 3PGCB 3NMEA 3RY5A 5LGHH 1ND0B 3EYUH 1GGIH 1CXKA 3DRQA 3F58L 3QFJD 3FB7B 3T3ME 3IJHA 2EDEA 4Y2DA 5JDJA 1MFDH 3HNTL 4KPHL 3BN3B 5IJVA 3VRIB 4JDTH 1ACYL 1WBXB 3DXAA 1OM3L 3O6FD 4PJEE 2OZ4H 1C5CH 1C08B 4I5BB 4KZEL 2CDFA 1QZ1A 3ZZ1A 2EDLA 3CU1A 4Q2ZB 4EDXB 2BVQA 3NPZB 4MSWB 3V0WH 4DGYL 1NLDH 4XBPB 1ZVHA 1OPGH 4EDWL 3VFTB 3N1QC 5F7DB 1G7PB 1U3HA 1VFUA 3LSOB 3QO0B 5HHXH 3W9EA 3MRDB 4QHKI 3SDDB 3VXQA 3MGOA 3CZFB 3NTCL 2YR3A 1CF8H 2ADIB 1C5BL 4LQFH 4X9HA 4G3YH 3G5XB 5IQ9B 1A02N 1E4XI 4Z77B 3WIHH 1SJHA 4OQTL 4BQ8A 5EBMB 4OCLC 5DDHA 2E7HA 2BY0A 2BXZA 1LNUB 2N4IA 3N1FC 4JRXA 5HI5C 4WU5B 2E9IA 1GC1L 3VXUA 4OBSA 4O51A 3HE7D 1XCQB 3U30C 3LKRA 1B9ZA 1MCQA 4PB0L 3H8NA 4KHTH 1IKNC 1HHJB 2CIKB 5DMGD 5EU5A 2FECL 4UQ2B 3SE4C 2PTVA 3DV4A 3SE4A 1K8IA 1X4XA 3MREA 4HEME 4MZ3A 2UWEE 5KSVB 1CR9L 4Y19B 3F62A 3NCCB 4L5FH 1BZ7B 2CKBA 4PJBA 4PD4J 5EU6B 5CUSL 2VRAA 1DQDL 4XGZB 4YHOL 1VEMA 1MHEA 3P4LA 4X6FB 1AO7E 4UIMA 4NQCB 4WDIB 4WTZG 5C0BE 4XCEB 5TGBA 5IOPB 4YIQB 3NACH 4XZUB 3QXDA 4M1DL 1XR9A 4EBQH 2BSSA 5CD5D 5I18H 1JGLL 1FNSL 1AQDA 5BZDB 3V0VA 2IAMB 4HKJB 1OAXL 2WUBH 4OKDA 4OF5A 3U2SA 4N5UA 3KYMB 5GRVK 1YNTB 3GSUB 2GT9B 2F74B 3AAZB 3DX7A 3FN9A 3KPRB 4KKBC 4XNUL 1QBLL 4HS8L 1HIML 2VB5A 2Y06H 4HH9A 3UJTH 2DYPB 3X14A 2X1WL 3LDBC 3DWTA 3QPXH 4P5KB 2DQFA 3OAUH 1IC4H 5DEFB 2HVJA 4J3XA 4QXGL 3O6ML 4PTTB 4YHPB 3ULUL 4Q74A 5IWLA 3VXSB 1OCWH 3OX8B 3KXFA 4K3EL 4DUVA 4X5XB 4Z7UF 2H3NB 1DBMH 3MLXH 4CJ1A 4HUVB 2EECA 3N1GC 2EDTA 4WHTA 4YUEL 3BP7A 4XAWH 3CDGB 1H8NA 1NFDF 4M6MH 5IMLB 1EAPB 3WFBL 2W60B 2WWMC 4U0RB 2EH8H 2OL3L 3NIGE 1HH6A 2PETA 1DQML 4JE4B 1UZ6F 4U1IB 3MV7E 4NRZA 3RVXC 3TH4T 3MLWL 3VRJB 4U1SB 3UCRA 3ZKMC 1TZIA 2FHCA 4NOFA 4ISVB 4DJMA 4K94H 1K3ZA 3D6GA 3WEXB 4HLZH 5GGVY 4M7JH 4QOKE 1BOGB 4WWKD 5DQJB 4PRNA 3JTSB 2OZ4A 1IM9D 12E8H 1EMTL 5F6HI 1NFDB 2MCPH 1DBJL 5CMAA 2W0LA 3WKML 1AXSA 1EXUB 1LO4H 3L3DA 3AM8A 4JFPA 1JUFB 2VTFA 4LLYA 1N0XL 4KK8C 3WKNA 3HZMA 3W0WD 2HJFA 1NLDL 1TCRA 1HXYA 3BPCB 4RISL 1MFAL 3C2AL 1FSKB 1PBYA 2FZ3B 3O8XB 5GRJH 3SE9L 1RFDL 2GAZA 2NZ9C 1BQLL 3UO1H 3MYJA 4M7JL 2CO7B 1JGLH 3ARFB 3KS0J 5ANMA 4HZAA 5HYQB 2R9HC 3IGAB 2HKFL 5J9PB 1ETZB 3KPLB 3B3IB 4JFOB 4TUOB 3ARDD 1CGVA 1N3NA 5GIRA 5K9JH 4Z7VF 3KPLA 1RIVH 3OGOE 1UQSB 1Q9OA 2F54E 1BX2B 1E6JL 1XF3B 4HGKC 3BRFA 2HMID 1JPGA 1VGEH 4G6FB 5F9JB 1MWAL 5JHDA 2RAMA 1I9IH 3L3HB 2JK5A 5D71H 3HZMB 2JJWA 1T80A 1A7PH 4PJIF 1AD0A 2DQIH 4CNIB 1UACL 5DXWA 5E5UB 4GRWE 3BIKB 4JVPA 2X70B 4HULB 3L3OB 1MPAH 4JHAH 3P4MA 3SHSA 3MNWB 1M71A 32C2B 5KVFL 4DZBA 4D9RE 4F58H 1S9VA 3JWDC 4NQEB 5DFTA 3ZSSA 2ADGA 4L3EA 4C83B 3WFDH 5JLZB 4HFUH 1WISA 4F7CB 5BJTB 3SCMC 1SYSB 4WW2C 1CF8L 2YHGA 3EOTH 3WXWH 5DYOB 1F11A 3TVMB 2ADFH 2FJFA 2NY4D 3WJJC 1JK8A 2ZUYA 4B7IA 4C59B 3UP1A 3DVFA 1HH9B 1JZ7A 4F37F 3ZTJH 2FX8H 5MEPB 4WHTB 2FHFA 3VXTA 1MCWW 3T0EE 3MNZB 1NFIA 4U3XA 4UT9L 3UTPD 5JO5B 4OI9A 3FFCD 1ZT1A 3U48A 5AD0A 3VFGL 3UZVB 3C6SA 3PWJA 2FX9L 5T1KB 1KYOK 1NC2A 4P4RA 3F5WA 3VFWB 3HNTH 5EU3B 3MV7B 5B3NA 3GHEH 3AS0A 3FTGB 4XNZC 3RJQB 3CVIL 2C3VB 1GGCL 3P73A 2XWTA 3ULVH 5A3ID 3RIFK 1SEBB 1ZTXH 2NXZD 1HWHB 4LOUC 4XCCH 3BZ4B 1HQRA 1RIHH 4KK5C 3KR3H 4LHUD 4P23B 3LS5L 1J1XH 5IQ7H 2IG2L 5CSGA 5TPWH 2WLZA 2J8OA 4UBDC 4QXTA 4XPTH 1MCPH 2R2BB 2R2HA 4PJGE 5BO1L 2MPAL 5CJXC 5LQBH 5D7JD 1QD0A 4GKNA 4NFCA 4Y16B 3F7QA 1TJHH 5IJKA 4WFFE 4Z8FH 4I9WD 5E6IA 5AZ2H 4K7PL 3QFDB 4LSSL 5KANG 3WFZA 1IEAA 1NDGB 4Q0XL 3OKLB 5CKGA 4P49A 2VE6A 1G0YR 1NBYA 1JNHA 4HV8A 5TE4L 2EDDA 4LLWB 2P8PA 2FCBA 1OAYH 3BPLB 1S7XA 3S5LB 3DYPA 3U82B 2MKWA 3AU1A 3SDCA 3WN5A 3AGVA 5D7KE 4RDQF 1NMBL 4OGYL 3INUL 3ZLQC 3UBXG 1RUKL 2RCSL 5I66B 3QEGL 2IPTH 3FQRA 3B2VH 3ARBA 3LKRB 3LEVH 3EYSL 3MRPB 5IM7B 4H88H 1NCDH 4PRIB 4URTB 3VI3F 1UXWA 4QNPF 4NM4H 5C9KA 4NQCE 3I3BA 1KB5L 4M9OA 5EUOB 5H8DA 1I7ZB 3KLDA 3C08H 3WLWD 2WSKA 3DUUA 3ZTNH 3HMWH 4XP6L 3KPPA 1GCFA 3BFOA 1FZJB 1A0QL 4L8BB 3VGAC 4PRBA 4PYHA 4RGND 5FYKH 1XIWA 1NCWL 3X11B 2Q3AA 4PG9B 3MRBB 4KC3B 5IW1B 1NBZB 2IWGA 4WUKH 5IFHH 7CGTA 1T7ZA 3RQ3A 4H20L 1R5IA 5FM8A 4XWGL 2YPLE 3VJ6A 2IANE 2W07A 1FIGL 1KBGL 1AFVH 4QOKD 4WFHD 5C0AA 4XVUC 4U1MB 3KPMA 3K8KA 2GJZB 1KB5A 3OPZH 2E8YA 2EO1A 5FCSH 5DSCB 4UQ3A 1KC5L 1IBGL 2FEEL 4IOIA 2GY7B 5KJRL 3REVA 4HWNA 2BNQA 5DHVH 1CK0L 2XTLA 5J13C 1RZGB 3AUVA 1UM6H 4NIKB 2OSLB 5I1CH 1LK3H 3QO1A 2BNQE 3CCHB 3OL2A 1NPUA 5GS0C 4CMMB 2DQHH 2MCG1 5GRJL 4GMSL 1MREL 4GW5B 4Y2DB 3P77B 4XCYA 1A22B 1IAIM 4HJJL 4UT6L 1JNNH 5BO1H 3QWOA 3B2VL 5MEND 4ACPA 1EEQA 5EC2A 1MFEL 1NC4D 3ULVF 3RWCA 2VZTA 4XNZB 4UT9H 1DQLL 4Y4KA 3RWIA 3GSXA 3C8HA 4J2XA 3RWHA 1A14L 2IH3B 1C8PA 4JRYB 1KOAA 4M02A 2G2RA 4YR6B 2VITA 2Y72A 2H6PA 3VCLA 5KW9L 3WJJA 4Z7VA 2R1YB 4MNQD 1FZKA 1YNKH 1NGZA 4NQVB 4OCMC 4S1SH 1AIFA 3U0PB 5GGSY 2C1OB 5L0QB 4MGXA 5CGMA 1HOCA 4TUJA 4Z8FL 3PXHA 1HKLL 1I7UB 5JUEH 4OD3L 3JWOC 4EI6A 2D0FA 4JR9H 3UYPA 1MJ8L 1IGIL 1R3IL 4ZNEE 4RNRA 5DRZB 1JWSB 2WP3T 3DXAD 2P47B 4XBEL 2G2RB 5KVFH 4PFEA 5IKCA 3D0LB 4AL8L 3QDMA 2LVCA 5K9KA 4OI8A 4R2GC 1KTDB 1K5NA 1R6VA 1RAMA 3LQAH 1JVKA 2H8PB 2Y9RT 4R4ND 2W38A 1FE8H 3E3QC 4TSBH 1C16B 5E6YA 1L0XA 3CH1A 2DQTH 4X4ZA 3BI9X 1V8HA 5JW3L 4CMHC 1SHMA 3QIBA 4YE4H 2F5BH 4I18A 3GGWB 3RVUC 5A1AA 1JFQL 5FOJA 1IM3A 4HKBA 3UBXI 1ACZA 3QO1B 4EI5A 2R4RL 3KDMA 2Y07L 1N2RA 3DTXB 4GAFB 4Y4FD 2AV1A 2R0LL 4N8VB 3OKOA 4RFEA 3U1SL 4GRWB 3MV01 3FMGH 4PJAF 4MJ6A 1CLZL 1QG3A 4UBDD 2EKJA 1B88A 2IANA 3DMMD 2DM3A 1T03H 1B0RA 2YD3A 3QI9C 3HFML 4K3HA 5ICYB 3MRKA 1JPSH 4LLDA 5GGSA 2W91A 1T2QL 2B0SL 4P0DA 1QPPA 5E8PB 4A6YB 4P2RE 1OARL 3CLEL 4L4TE 5ID0A 2P24A 2LV4A 3S34L 4NCC1 1H9VA 1SBSH 3VE0B 3TT1L 1U8MB 2VR9A 4X6EB 4L9LB 1CLYH 1RZKC 2NR6D 4QT5A 3T0AA 4IMLA 2NX5A 1MJUL 4WFHE 3OG6B 3SPVA 5K59F 1A3LL 5E7BA 3VA6A 4G8EB 4LCIH 3MRPA 3H42L 1L7IH 3GMNB 3PIQB 4Z76B 4Z7NF 3TBTA 1BZQK 3FFCE 5DGRA 5EBLA 1EO5A 2FX7L 4MAYD 5KG9A 2FIKB 4PJ7B 1KTKE 4G6JH 3P9MB 3QP3A 1HI6B 5CBAB 1UCBH 3KYKH 4X5WB 4ZAKB 5IROC 15C8L 2PTTA 5T3XL 2NTFB 4C58B 1S7XB 3OF6D 4DAGH 4ELKA 4BSWA 4XPFH 2VE6B 3WBDA 4ONOA 4P5TC 1G6RA 3U9PL 2J6EL 4XPHL 3VFUB 3QUZA 2YSSA 4E41D 1S8DA 4K94C 5DD3L 4IRJB 3UMTA 5J3HD 4EIZC 3ZYIA 1J8HB 2D0GA 1N8ZA 4U6YA 1IAKB 4PG2A 3C2AH 2G60L 2A6IB 4M1GH 1FZOA 2E6JA 1MCJA 4TOYH 1KACB 1T83C 5EZIL 5AYQA 3VFPA 4PY8J 1XZ0A 2W65B 3UJTL 3BMVA 3MJ7B 4BKLB 3O2DA 1A1NA 4ZD3L 4YX2H 2WUCL 4UDTA 1A9EB 3DIFA 3C5SB 1BBJA 4C56B 4XP1H 3B4NA 2ERJC 2BNRE 5ICXA 2WUBL 4PP1D 5JW3H 3RTQD 1YDPA 2F53B 3G6JA 3SY0B 3U7YL 3D69A 1NCBL 1SM3L 1WWBX 2VZUA 3VH8A 1JNJA 3V7AE 2X89A 3K0WA 2ZSVB 3AREC 3V0AC 2ADJB 3NACL 4QOKA 3MA7B 1EFXD 3QDGB 4P46D 5HHVL 5ERWA 5B4MC 3H9YA 3GSNL 2Y5EA 3QQ4B 1N6VA 1I85A 2HFFB 1IBGH 3Q3GA 2YK1H 3CVHL 5F7UA 1C1EH 1S3KL 1E6OH 3KJ6H 3ZYZA 3VMOA 1FL3B 2BP3A 1CDYA 2Z8RA 2E7MA 5DMGC 1XT5A 1NL0H 3D0VB 3MLVH 5TQ0H 3I50L 3SKUD 4LSRL 4AEIH 1ZHKB 3DECA 1ZT4A 3QHZH 1BMGA 4HIJA 3H9SB 4ELME 5DI8A 5F1IB 3LDBB 4GW1B 3L6FB 4JPKL 4TVPH 3WNNA 5JLZA 2X1OA 4G6MH 1P7HL 2PYED 3S34H 2FJHA 4KK9C 4X7SH 2E6QA 4FQJH 4HIIA 2YPLD 1HHIA 3BP4B 4M6OH 4QRQA 5DRNA 3TO4D 2B0SH 1XGRA 3FOLA 1FH5H 1G6VK 4YDVB 3EJYC 4UOW1 1JYXA 5BV7C 4FG6D 4WCYL 1I8KB 3OAYH 5E94A 2CUMA 4NQXA 4UILH 4XP9L 1OM3H 4V2BA 2VXUH 3NCYP 1IQDA 1DQJB 2GTWB 4LPCA 5LBSH 1JZ5A 2CLRA 2NNAA 2Q6WA 4JFEE 4F7TA 1MELA 1U92B 3TBVA 1VKXA 1ADQH 1UWEH 1BX2A 1FFNB 1XF3A 3PV7A 4HWZB 3QXWA 5IBLD 4R97C 2Q86A 3QHFL 1RJZB 3BW9B 1N3NB 5INDB 3IDGB 4KJPD 5ACZB 2DBJA 1LP9B 3R4DA 2EDJA 1JGVL 2ICEB 5JR1L 2QHLA 4G3YL 3VWKC 3L5XL 2XICA 3ARFA 5EIQA 2VZ1A 4XWGH 2B5IC 5E4EB 3TIDB 1DL7H 5E1AB 3SDXA 3AC0A 2EH7H 4RAUA 3BQUA 4QRPB 1BVZA 5M94B 2ESVD 1G9NH 2G5BA 4Y4HD 1AQKL 1RK0A 5T3XD 4JFPB 3FQNA 1CDJA 1TIUA 4K71C 5T1LA 3ROOB 4NHUA 2DD8L 3CDCA 2Q20A 5I71B 1T7VA 3TZVD 1YMHB 1NMCB 3GKZA 2BMKB 4JO2H 4ODXB 4R6UA 2APFA 2R1XB 3GSNB 4KKAD 3T4YB 1PYWB 5GSRA 3O0RH 4KPHH 4APQD 3BQUC 1CICC 4KQ3H 4NO5B 4RWYH 1UADC 4ZS6D 1M6OA 4JN2A 5J0BA 2ICWB 3NTCH 5D2LE 3VFUA 1I1FA 3REWA 1BZ9A 3RVUD 1H3TA 4QHUA 4LEXH 3UAJD 5BCAA 3RZCA 4NO3B 3HZVB 5SWZE 3VXNA 4NJAL 3FQTB 4MXWH 5ITFB 5FDYA 4MJ5A 1SEQH 1CQYA 1T89C 5HYSB 3BE1H 3TA3C 1HI6A 1JWMB 4ODHL 5DMJB 4KKLD 4HUVA 4QXUL 5F72S 5C70A 2AVGA 4QYOA 4JGJA 3S6CA 5F3HB 1IQDB 4OLEA 4ZXBC 4AZ8A 3GMLB 1MI5B 1YEHH 2VDQL 5D8JH 5DD1H 5IHBA 1MFDL 4JFXA 3C6LA 3K4AA 5AYUL 4OFDA 3WNLA 5DJXB 1RZIB 4K07A 5DD0L 4FQXD 1T1YA 4G9FB 5IQ7L 2ARJA 2YPKA 4X6EA 4QRQB 5DRNB 3PWPA 4XXCC 4KJWC 4XPTL 3U7AA 4L29B 2A0LC 5CGYC 3SJVE 3QCTL 3QIUD 4QF1B 4Y2OA 3P9WB 1GGBH 2FBOJ 2CR6A 5DVKA 4JHZA 3NVQA 1B3JA 4PS4L 2XNAA 3WDHA 4R90H 3LKSB 3PJSA 4LSVH 1LEIA 3AFLA 1KCUL 4JQXC 1M05A 5DEGB 1YUHB 2O5ZL 1VFOA 1NDMB 5HSFA 3I75A 3QXAB 1UA6H 4P2YA 5INCA 1RUQL 3AXLB 2BSSB 1X5ZA 4LCYA 5TGBB 3P30H 4W6WB 5IEHA 2R0KL 2E3VA 4XVTL 1A6PA 5E08L 2D0HA 1OSPH 4K9EH 5FB8A 1N2RB 4JFEB 4E5XA 2XYCA 5IB4B 1PKOA 2BVOA 2AJYL 1RPQA 3DSFH 4X5LA 2JB5H 4F37K 3O41B 4K2UH 1MFAH 3C60D 1FLRL 3S37H 3MRHB 2O5YH 4OAWB 3VXRD 4U7MA 5FECA 1ZSDB 4APQC 1TZHA 1JI1A 4C57C 3TZVB 3HKFA 1JYNA 4F2MB 5C0AD 3OBAA 3IFNL 3MJ7A 3PQYE 5MHSD 4BSVB 2F58H 4E42A 3TVMC 1A1MB 1AFVL 1J8HE 4JRXB 4IIQC 3T2QA 2AJ3A 3C8KA 4WO4B 1KJ3L 2WANA 4GBXB 3RKPA 5TE6L 3QRGL 2VLJE 4WW2A 1TQBB 2QSCH 1FCCA 1I7UA 3FB6B 4K94L 3KPOA 4L4JA 3QUZB 2HT2C 1HOCB 3RUGB 2VUYA 1ONQB 2CXGA 5C6WH 5IIEA 4JFFB 1RV6X 4BSWB 2QHRH 2HVKA 3QHZL 3K2UL 4KTDH 3D5OF 4YC2C 3OTTA 5C71A 1SJEA 4TUKH 3P4OA 3CFCH 4JRYA 1DP0A 5CJQH 1K85A 1MF2H 4YXLH 3SOBH 2BVQB 3JXAA 5FYLL 3LQAC 3CMGA 1LILA 2ICES 3RWCB 1VSCA 4NKDA 4RA0C 4Z76A 3RU8L 1Z5LB 4PGJA 4KRLB 3SKOB 3VW3L 2BXYA 1Q0YL 2IFFH 4A2MA 2C1PA 4WUUB 5T33H 4GLRI 3U7YH 2VLKD 3WIIL 2DQUL 4JO1L 1A6ZA 5I17B 5C09D 2CUIA 5LAXA 4J6RH 4Y16C 1RK1B 1ZA6A 4RFNB 1AD9A 1FGNL 2UUDH 2GFBB 4JDZA 4W4OC 3BKYH 5E9DA 4RAVA 2ZKHL 1QBML 3OXRB 1T5WB 3BD4A 4LLDB 1EDQA 3IU3B 4JO2L 3MV9A 4P2OD 4XCFL 2NMSA 4Z7UB 5EORL 1BVKA 4XT1C 5IW1A 1AGDA 2UWEF 2DS4A 1PJ9A 1QLRB 1UACH 3VGHA 3W9DA 3OAZH 4KFZC 5IEKA 5L2KA 4Y4HA 3CVHB 1B2WH 5GS2D 5I74B 4LCCA 4OCYH 1U2HA 4HPYL 3CPLB 3VD7A 3VFRB 3X3GH 1V3MA 1IM3B 4PJGF 1OP5H 3RPIA 1J1PL 1XIWC 5E8NA 3WJLA 1RZFL 4L4VA 1UFUA 4IRSA 4RMQA 4IIQA 5ICZA 5M95B 1LE9B 3DGCR 4NGHH 4OFYD 4Y19D 5TF1L 2L7UA 1K5NB 3SKJL 1DQQA 4KDVA 4ZUUB 3GBML 4APQB 3P11H 1CFNB 1QFWH 3TZVC 3OR7A 4XMPL 1TITA 4I4WB 3RZCD 4PJHA 3ILQC 3GSWB 3MRFA 1NBYB 2VDOL 8FABB 4MJ4A 3NZHH 4OQTH 4RISH 4Y5VA 4BFBD 2OJEB 1WV7T 4NCC2 1A6UH 1MCOH 3Q6FA 4OLZL 5B39B 2QR0B 3K81A 4Y8DC 3QDHA 3DROB 1GOHA 3STBA 2C1OA 1U8NB 4ORZC 1NGZB 4NQVA 2H9GA 4I2XE 4L3CA 4IMKA 1OPGL 4XH2B 3CK0H 4EDWH 5FO7A 3D2UD 5DQ9B 1IQWH 1KNOB 3V6ZB 5EWIH 2BNRB 4EBQL 3D39A 1LQSR 2UYLB 5K59E 3IFPA 1G7QA 3NCYS 5D7SL 5T5NF 3KLAA 1CLZH 4PRDB 2AXGA 1S7SB 4Q6IC 4GH7B 4NGHL 3QJHB 2WIIA 2GK2A 1DQDH 3LPFA 1KXQE 4WUUD 2C3VA 1V7NL 4JPKH 4HBQA 3ROLB 1HNGA 5C0BD 3UPRA 4I0KA 3QUYB 5SWZB 5HHQA 1G9MH 4MD0B 5T3ZL 2IF7A 1DQMH 1DANU 4UZGA 2VDOH 4R3SA 2EIZB 1UCBL 4JZNA 4YDKH 1HYRC 5T3ZD 4F57H 1CGTA 3H9SE 2X89D 4YEEA 1YPZF 1KIPA 1MI5E 4NDMB 3MV9E 2LAGB 3EJZC 2DQDL 5CEXB 4D9QE 3ZDZF 1JZ8A 4BQBA 4GUPB 4KK8D 2BVEA 4NOBA 1L7IL 5ALBH 5GGVL 1B6UA 3L95A 1MRDH 1R5IB 3QPXL 1OAZH 3L1OH 3RDTA 3BHBB 1X5LA 4JG1L 1FL6A 2GKIA 4M4PA 4YO0B 4ZD3H 1I4FB 3KYAA 2DLIA 1S9VB 4JGUA 1ZA3B 3DMMC 4P57A 1LE5B 5L9DL 3V5KA 3PDDA 4E41E 4GG6B 4YXKL 1T1YB 4G9FA 1NH6A 3PWPE 5I74C 4U1NA 4K55A 2CLVA 3N85H 3RL2A 4RMWA 2A38A 4OLUH 5HVHB 1YYLH 3QUXC 4XAKE 3C5JA 2AJXH 4ZAKC 1EPFA 4KRPD 5HTSA 5B3JF 1Y0LB 4HX1B 3ARED 1H3PL 3FQRB 4N0FA 5J6HB 2FD6L 2VR5A 3AY4A 2XKNA 2MJWA 4QYOB 2VLLA 4DAGL 4WW1B 4GAYB 1KJ3H 1JPGB 5I1JH 4HJJH 1X4ZA 4XHJD 2DQEH 1W72A 3BEVB 2EKSB 5DURB 3DURB 2H32B 3ARDB 3HS0A 2XN9A 4P2QD 4DTGL 3UPCA 4LCWD 4NCDA 1M4KA 1BFVL 1DSFH 2BY1A 2VN4A 4GQ9L 4PRPD 2J8UA 4QHUB 4YGVA 4UB0H 3DVNB 4OUOA 1GYAA 5E6IB 3I6GA 5HDBE 3L7EA 4J3TA 1R3LB 1IM9B 4P59H 1CVRA 3T0DA 5BQ7A 3HLAA 4NT6A 2GAZB 1S7UB 2IPUG 4X4MA 3MRRA 3O8XA 3G5ZA 5IESH 2R1XA 3CSPA 3EYVA 4FQHB 4DKFH 5ESAA 5F7KC 3TV3H 4JY5L 1JBJA 3ULVC 1HQRB 4OD3H 5L6YH 3NFNB 2FDBP 5FYKL 2B4CH 3IXAB 2XWTB 4KUZH 4B5EA 5DUPL 1MCDA 3SE3C 3ZTNL 3CFEA 4WI2A 1T1WA 1XF2B 4FFZH 3E2HC 1O0VA 4KJQC 2N7BA 4KDTC 5D93B 1A7NL 3GUTA 4AM0B 3QUYC 5I8KL 1CD1A 4FTVA 3GB7A 5JZ7D 4DGYH 2Z31D 5GRXG 4WI8A 3JUYA 3JV5A 2D7OA 3EIFA 4HDIB 3OKDB 5IFAL 3DX6A 1LP9A 1F6FB 2DLFH 5E2TL 1DVFB 4QTIL 1A7BA 3PL6B 3UJJH 3KG5A 1JE6A 1VB9A 1W8NA 2W0FA 1WWAX 1CR9H 5F6HJ 5A16A 2GJ6B 2CMRL 2Z92B 4LGSB 2NNAB 3PG2A 3ZE0E 4QRTA 4OCNC 3KPRD 5EPMA 1P4IH 5CJOH 2GSGA 1UM6L 3OX8A 1CG9B 2LABA 1PEWA 4N0CD 1L9MA 3VRLF 4HK3J 1I8KA 5DEFA 3EGSB 5GGTH 1WIUA 4LBEA 4NQEA 1MQKH 3MLSH 1DLFL 5I75B 1BREA 1KC5H 3LCYA 4XP4L 2R23A 4XPBH 2R4SL 2HKHH 2DLEA 5HDLA 3ARWA 5EN2B 2YD5A 1G0XA 3LEYL 3L3OA 1A7OH 3UTQB 3AREB 3PP4H 5D8JL 4GRLC 1IVLA 1IE5A 3T1FA 5FYJU 3RUGF 1X5FA 4M5YL 4OIBA 1ZOXA 4V2CB 5IFHL 4GG6E 3Q5OA 3GJEA 3H9SA 2FLBT 1JNLH 1AQDB 5BZDA 2NY1B 4PJFA 5ETUB 3MV8B 5IB1A 4NHCL 4YBLB 4XCEA 1ZGLB 3O6FC 4RSVA 1INQA 4R4NC 1K4CA 3PABA 5IW6B 3BN9D 4DQOH 1XF4A 1OVZA 1U42A 3EO0A 3HPLB 3BP6B 4ONGH 1T6WA 2UUDK 4LLUA 4J23A 1DLFH 2LU3A 5E95B 4GQPH 4AIXA 4LPYA 1DBAL 4GAGH 5KSVA 1W0WA 1EO7A 3M8OL 1YEDA 1FNAA 1HKFA 4ZO7A 3VXOA 4FNLH 3X3FH 1JHLL 1HHJA 5EU5B 1HYSC 2XA8H 1UYWL 2EIBA 2ZNXA 4Z7OF 1J18A 3S35H 1U36A 2AQ2A 1CT8A 2YZ1A 4JLRA 2IGFL 4LSSH 1EXUA 3PWUB 4P2QE 3J7HA 3MO1B 2EIEA 2W65A 3QQ3A 1KSRA 4ZYKA 2YN5A 4U2YA 1U8OA 4D0BB 5E56A 3HMXA 5D7JB 3MLTB 5KZCB 5DD6A 5EZJA 2EXWC 3GRWL 4MA3B 1D5IH 2A1WL 2VXQL 1JPFB 1Q9WA 1JCKA 5KS9A 3E2HB 2DQIL 5J11C 1T22A 4AG4L 3PWVB 1I7RB 3MGOB 4H26B 1RIHL 4UI2A 4BUHA 3PP3H 3VFNB 1CDHA 2EDWA 4PS4H 4S2SB 2CIIA 1U3HB 3QQ9D 2D03L 4U1IA 2A73A 3OB8A 2XXMB 4X7CC 1CFVH 4PRHA 3L3KB 3IDXH 1DJSA 1D6VH 4M93B 1I1CA 5HHME 3N0PB 2QBWA 3U36A 3MRMB 1UM5L 2H26A 3MOBH 4G8FB 5L6YL 1QSEE 1T20A 4WW2F 4PJ7A 3IDIB 5AYUH 4R2GD 2FJGB 5E6ZA 4I3RL 4I5BA 5C0JB 3PDOB 1FZMB 3FO2A 2HT4C 3P40A 3RWDA 2XRAL 2ZZUT 4XTRC 3VGDA 4U1GB 2I9TA 5FAAA 5I1KL 1FC1A 4P59L 1N5AA 5D7LA 4OGYH 3KPNA 4QT5B 3VWJD 4NJ9L 5DRXA 4LLAA 1WTGT 5FGRA 4XB8A 4XVUD 5GGTL 2DI7A 1OQOA 4X9IA 4OV6F 1MHPH 4L4TB 3KYMA 4UOJA 1EJ6A 2NTSP 1FBIL 5D96B 3MRLA 4MA1C 2V2TB 5MENE 3RNKA 4HKJA 4PGBB 1ZVSA 4KQ3L 5ALBL 4O5LL 5GGVH 5CJBA 4PJ8B 1FYTB 4YDJA 3ARGA 3MBXL 3G08A 3KHOA 3QULB 4H5SB 4R7NB 3VFOA 3QXUA 4LASL 3RNQB 2VISB 5B38B 3HI1A 3DHMA 4KTYA 3V5HA 3HZYA 5DD5H 2VN7A 1AP2A 2E7BA 1NKOA 1BQHB 3B43A 1X5IA 4HJGB 1QSEA 5E5RB 5DC0A 4YPGB 4MDJA 4NKQB 4EI5B 1M7IA 4PJBB 5K93A 5IB3A 4PRAB 1VGEL 4HMCA 3SDAA 1PDKA 3QIBB 3X17A 5DJCA 4ZXBA 1OB1B 4AYFA 3ULSA 4JG1H 2NLJA 2CIKA 3SEPA 1ROWA 4BH7B 1I75A 2NY0C 1U8PA 2CKBL 3PV6A 5HGDB 4MDIA 5C08A 1TQBC 4ODSH 2DI9A 1KT2A 1IGJB 4EJ1C 2AP2A 5J8OA 4OFYA 3GEWB 2APWA 1Z6JT 4NP4L 3ARXA 4NZTH 4ZTPH 1GRWA 3SO3C 3SE9H 5IVZA 3U83A 5D7JC 4OLYH 4MCZB 2J88H 4PJBF 4RGNC 4Z95L 4AEFA 5EBWA 2IEPA 3BYTA 3QJFA 3L3IB 3O3DA 1CN4A 4NN6B 1U93A 3L3GA 1QPXA 3SQOL 4YZFF 4WRLA 1B4RA 3MLUL 2GJ6D 1REIA 4FFYL 4UIKH 4N0UB 5LXGL 1AXIB 4ZODA 3WS6C 1GHFH 3O81A 5CIPA 5DLMH 4L8CB 1CLOH 5BXFB 1G7MB 3V4VL 4MNHB 4UDUA 5F1OB 3MGTA 4NNYA 1F90H 1MNUH 2XPGB 3IF1B 4M93C 1T5XA 1PG7L 5JW4R 4YQXL 1V7MH 4HC1L 5IVOA 1F8TH 3ZMRA 2CRYA 2VZOA 2ZCKH 1I9IL 1UKTA 4NP4H 4YPJA 3QUKB 5CINL 1T03L 4BA8A 4V1DB 3FN3A 1CLYL 4CAGA 3IS0X 2OL3H 3FMGL 2AGJL 3LD8C 1Q9KB 1FQ9C 5DFWH 1N4XL 4U1LB 1KENH 4NYLA 3WL9A 5DSCA 4C54A 5E00B 3GK8L 3QUZC 5DHVA 1YEEL 4OD2A 1FDLL 3T0BA 2ITDA 3VFSA 5HHNA 1I3GL 4H8WC 5D1XC 1ZT7A 3GJFH 2XA3A 1CFTA 5I16B 1NUNB 1CS6A 4KMTL 4YBQD 1XGUB 4U6HA 4E41B 3L9RB 3PP3K 4KJWD 1CIDA 2VLJA 2BJML 3QEUA 4BZ1L 1V5JA 4KZDL 5DFVC 1FGNH 1XIWB 3T0ED 4D3CH 5DC9B 4RCAA 5CD5C 1WT5A 3IFOA 4F9LC 5B8CC 4UINL 3C60A 1I7ZA 2W92A 5DJ6A 1NC4B 2DQUH 5DJAA 4YHYB 4EI5C 1UXWB 5IHZB 3I6KA 4C56D 5EU6D 2AV7B 4O2EA 1FNSH 2ILLA 5JZ7C 5GQBA 4XNMA 2PCPB 3LRSB 3IU4L 3KYNA 2B1HH 1II4E 2HJKA 3IDJB 1IKFH 1JV5B 4AL8H 5D1ZC 2F58L 1IL1A 1AR1D 2BFVH 5FM5M 5SV4A 2UVFA 3P2TA 2YUVA 4HZLA 1A7RH 1HSBA 3QUXD 2MNUA 3BKCL 4Y5YB 1F4YL 2V2WA 3ULVD 2Q76B 4Y4HC 2VIRA 3T77A 3RL1A 1DBML 2H41A 1QBAA 2ZP0T 1A8JH 4FQ2L 4PB0H 4PD4K 4ODWA 2C4FT 4Z7VE 4P9HC 4Z6AT 3GNMH 3IDNB 1J7VR 3IDMB 4I1NB 5H94A 5FO9A 3D18A 1LD9B 3TBSA 4CN6A 1FFPA 3DBXA 4ONHB 4OGAC 5SV3A 3DGGA 1TQCC 4OIAA 3UEZA 3BZ4A 1T1ZB 4UIKL 4P2CG 5F7FA 4JB9H 2HJKB 2VO5A 3V4PH 2IADA 3HZKA 4LP4A 4RA3A 4M48L 1YEIH 3OJMB 3SQOH 2FECI 2BVPA 3B9VA 4TSAL 5JUEL 1WFOA 1T7XA 5F93C 3FONA 2VOTA 3RI5K 1H3VA 3HC0A 1NC2B 3QFJA 4M1DH 4FQPA 3MZGB 5ITBH 3I2CL 3V52L 2I5YH 3MCKB 4P5TA 3TPUB 4WU7B 4X9GA 3RWJB 3VG0H 3JV4B 4EUPA 4LPWA 2BDNL 5BMFL 3ULUC 1WFUA 1WJ3A 5ENWA 3CMOL 1IAOA 4WJ5B 5L8JB 1VFBA 3G5YA 3C08L 3RIAF 2OR7A 2YZ8A 3MUHL 3U4BH 1DBKL 3MACL 4OB5L 1BOYA 3MBEB 4XNYH 1AXTH 2OXHA 3KPQA 1H8SA 4L8SA 4JKPL 2CH8A 5I16A 1F11B 4UAOC 5DYOA 4H88L 5CEYA 2DLHA 2BNRD 1N26A 5IMKA 3S37L 2JB6B 4QHLB 3V6FB 4IJ3C 1FFOB 3G5VB 5SX4I 1YEJH 4Q6IB 4R26L 5JNYB 3WL9B 2PR4L 1AI1H 5T1DH 1QA9A 4G43B 2NW2B 5T5FH 3LQAL 4LCWE 5HGBB 5EZOH 1YEGH 3FZUC 1JGEB 3GSQB 5SWZD 3ZE2E 2X70A 5JW4N 5D6CA 1JRHI 2APXA 4N0YH 1WAAA 1TJGL 4HUKB 1A4KB 3QNZA 3ZL4H 1IAIH 2CK0H 5HHOD 3EJZD 3O6LH 3CIQA 2EDKA 3MXVL 4NQCD 3L3HA 5DA0B 3IF1A 1DCLA 5GSVA 2NYYD 3QG6A 1H0DA 5TDNB 3GJFB 4RQQB 4H0HB 1A64A 4W4OA 2FBJL 4K23L 3QCUL 3LS5H 5D1ZB 1RMFH 2DJSA 5IHUL 2DKSA 1MIEL 4U1HB 2RIKA 2ENSA 2P46B 1HDMB 4LFHG 3WIFB 3FCTA 5CJOL 4M7KL 2V7NA 1TTFA 1ZKAA 2GITB 5FGCE 3WFEL 3OKKB 4LSQL 1CBVL 2XFXB 3D39D 5HGAB 2R0ZL 1O7SA 1RUKH 1F6AB 4DKDC 3ARSA 4OGAD 1HSAB 2JKXA 3LN4B 4LSPL 1EO8L 4EQ2A 5D72L 3SE8L 3X13B 4M1CD 1JUFA 3H2WA 2I9LA 4XVSL 4AIOA 4CJ0A 5KJRH 5HGDA 5T3ZE 5FA3A 4K3DH 1FLTX 3BKJL 5IHUH 3QWQB 1INEL 2V7HA 1GOGA 1G9NL 4KMQA 3PE9A 4FN0A 2NLJB 1U8LB 1NFDA 1MJ7L 1C12B 3LPGA 3QIUB 4IRZL 3LRGA 1UWEL 1H15A 1RI8A 3LIZL 1WSST 4H25A 5L88H 1J0JA 2ZCLL 3ARDC 3W39B 3VWJC 1T04B 4MQTB 4OZHE 3M1BA 3H0TB 1BLNB 3LQZB 4O4YH 4HIHA 4X7EC 1ZWIB 4KXZH 4FS0A 1X4YA 4Y5XC 4GAJH 5FKPB 2AK1H 4W6YB 4XTRD 3KXFD 4GXVH 4IDLA 2R2EA 5TDOB 5HYFA 5AUMB 2MSPA 4PP2A 2P8LB 3DUHA 2BC4A 1CYGA 3HCVA 1AKJD 3P9LA 1IC7L 4B53A 3OKEA 1G7JA 3HMXL 1MJ7H 3RNKB 3MBEC 4ZUSB 2IBGA 4J7RA 3VXMA 4M00A 4QHNA 4PJXB 3P0GB 2DOCA 3UBXB 3F12B 5C2BH 1PKQB 3KXFE 3G6DL 4X7TB 4G9FD 1Z9LA 2DIBA 1HHKB 3TT3H 4BM7A 5BVJA 4GO6B 1NMBH 5TDPB 1BHGA 1WITA 4G8IA 4P2OC 4RWYL 3DX7B 3B9KC 2FH8A 3K3QA 4Y16D 2X1PA 1IKFL 2O5ZH 4JANB 4JFYB 4PJDE 5D1XD 1T7WA 4L8SC 3MUZ1 4P9ML 2C3HA 3BDYL 2OL3B 4L1DA 4NQDD 1JL8A 3ULUD 4MA7H 4OFKA 4ORGA 3CAFA 4R7DB 2Z9TA 1AQKH 2C3WA 5HYJA 1CXLA 3C60C 1CXHA 1MHEB 3EOAA 1J1XL 3OJVC 5E2TH 2YK1L 2BY2A 4MB4A 4ZFOA 4WFGE 1EEYA 1JWUB 3LKQA 4PUBL 3I84A 4D2NA 5JOFA 3V4UL 3VFNA 1ZWIA 1NLBH 1UXSA 3QDMD 1CL7I 2HKFH 3PWVA 1LP9E 1OLZA 4ZO6A 5IB2A 1I3VA 2YC1B 1AJ7L 1FRGL 1KLUA 1NAMH 3DO3A 5SWSE 1DLHB 3MRIA 1SVCP 2VLRB 4ZSOA 3RAJL 5FKAA 4AJ0A 3ARBC 4OM0H 5JORB 1U8OB 1FG2A 1OAKH 1LO3H 3UJIH 4AIZA 5ELIA 4NC0B 2YD7A 1XEDA 4DN4L 1JPTL 1TVHB 1P69B 2OTWA 1I8IA 3S7GA 3BESR 1JHTA 5L7XL 1BWWA 1JYWA 1H3XA 2EYTB 4OZGB 3TVMD 1OP5K 2JJUA 4AIZB 3ARPA 2VWEE 5GGRA 2YRZA 3OZ9L 2DL2A 5JIHA 3SKNB 4PJCB 1PSKL 4S10A 1F3RB 1S9XB 4KGJA 1L6ZA 3QIUC 5IT2L 4LLVB 4YNYB 2PXYB 4QRRD 1J05B 1EX0A 3MOQA 2E7LC 5GRVL 4W68A 5JR1H 3FCTB 1AR1C 1M1SA 2GK0B 4G42B 5KSBF 1U8JB 4LNRA 4O02L 4KTEH 1XF4B 4OLVH 4NO0B 2EE3A 2XTJB 2AI0H 3MC0A 1P7QB 2W59A 3TN0C 1AE6H 5EO0B 4F58L 5L9DH 3OJ2C 2WQ8A 3MRQB 3O2WH 3OJDB 2YS4A 5TDNA 4ORGB 1H0DB 4U1GC 1ITBB 3CSBA 4POUB 4LDOB 3FQUB 4MNGE 3RGVB 3AY4C 3VD3A 4EDXA 3BP5A 1PQZA 4Z0XB 3GJEB 1C7SA 2FX7H 5F97E 4GSDH 3BYYA 4QRSA 1DBJH 2Y7QB 1DTUA 1D7FA 1T3FB 1X7QA 4JFYA 4D9LL 3QQ9C 1PZ5A 4GW4B 1D6EB 1BBDH 3IT8D 3OAUL 4JFZL 4DK3A 3IJHB 1OF2A 3E3QE 1QYGL 5EN2A 1KEMH 1WBZA 3OKNA 5BS0B 5KS9F 4UTBL 1UGNA 5I8CB 4JM4L 3MR9B 4OGXH 5I1AB 2HWZH 4DUWA 5BVJB 4PYGA 1CD0A 1IGML 4KHXL 1Y6NR 5LCVH 3HAEA 5GRUL 3F12A 3TESA 2P5WA 4X83A 1HHHA 4RDQG 4ODTH 2MKLC 4YAQB 1G9ML 5GGRY 4HQQH 4HUMB 1VFAB 1QRNA 4XCNA 3DVIA 1E4KA 1T0MB 3BPNC 2J4WL 5DJ8A 2HG5B 3MJ9H 2HT4D 4Z7WA 3ILPA 3ARBD 1FL5B 4LHQB 4S1DC 4TSBL 5F89A 3PWLA 1P84K 4U0QB 4YQXH 2Y06L 4YH6A 5IR1A 1CDBA 1A1OA 3UROR 4OTXH 3QCVL 4WU7A 3LMJL 3VWKD 5IVXF 3EFDH 3LY6A 1TXKA 3MMEB 3ZDZE 3L1OL 5BRZA 5DLML 1S9YB 4MA8H 3NGBC 1EMTH 5HY9B 5D2NB 1KN4L 1T1XB 4OCRL 2EDXA 1WZKA 2ATKA 4G80B 4PJIB 2VL5B 3R8BB 1KIRA 4YHLH 3SO3B 2VC2L 1KJ2L 1QO3A 3O2DH 4OZIE 4P46A 2UY7A 1RU9L 4WIQA 1FJ1A 4Z95H 1P4LB 2WV3A 1GC1H 5DJZA 1FFPB 5ESAB 4FQHA 2JELL 4LU5L 3G9AB 4KMTH 4XMKH 1FNLA 3CK0L 1QBBA 5SWQB 3CLFH 4G6AD 1LO2L 2EZ0C 2AXJA 1CICD 3BXNA 1HCVA 2NZ9D 2RFXA 4X6DA 4PY7A 4EVNB 4NO0D 3WLWC 5EU4A 2ZOLB 4JO3H 1EIBA 1KPRB 1JFQH 2BSED 4JDTL 3RTQA 5I76A 3D3VA 4IHOB 2QQLL 4MB3A 5DJ2B 2ZNWA 3RAJH 1NANH 4KMLB 3TJEL 3W0WA 4JFFE 1WGOA 4F7PB 1RJYB 1MAJA 2VL4A 4YZFE 2E27L 1F4XH 1N6UA 2Y4SA 4OZHB 1AHWB 1OSZB 4AENA 2XKSA 2FR4A 2E9WA 5DQDH 2XTJE 3L7FA 2CLZB 2C5DC 2MTPA 4HS3A 3DI2B 2LU4A 1UEYA 2XG4A 3H9HA 2DQGH 1UCTA 3CSYA 5JA8B 5HHMB 1RUAL 1QEWA 3O2WL 5BS0D 1KJMB 4PRIE 1F3DJ 4L1HA 4PLKD 1MIMH 2OTUA 3FQXB 3VMPA 3SCMD 3O45B 5D1XB 4K3JH 1EVTC 3GM8A 1OP3K 3UX9B 3GBNH 2Z8SA 3TT1H 3EO1B 3GSVA 2IBZX 3RWFA 3O2VL 1I4FA 5HHXL 3EZ8A 1Q94A 4K3DL 2IGFH 5JNYA 4ZMAT 1J5OH 2NW3B 3CC5A 1VERA 1FFOA 4UUJB 3GFUA 4FQXC 1NKRA 1BPVA 4M43H 2CGRL 4AQOA 4KV5E 4KKCD 4OZ4A 5IGXH 1U58A 3CFKB 3SOBL 3V6OC 5KBNC 1MJUH 1KPVA 5HHNB 1PSKH 2HRLA 2GUOB 2F9BT 4M7LH 5C09A 1GGIL 1SYVB 2DQHL 2JF1A 2QHRL 3RWFB 3U0TB 5FUCE 3CUPB 3D25B 5D5MA 1NCAH 3IAQA 5I15H 3TPUA 2WP3O 3TGXA 3D85B 3O45A 3IDXL 2A9NL 2MHAB 3RX8A 5C08E 4P5TD 4P5MB 4GKSA 2OJZH 5DUML 5IF0A 1I8MB 1MCWM 3TO2A 3N9GH 4TRPH 3SDYH 3BJ91 1XGQA 1HQ4B 3WLBB 4X6CB 3VDBA 2XQBH 1JZ4A 5KW9H 3O4LE 1NGWB 3QJHA 2CLZA 1IGTA 3RX7A 4GRWH 4MD5B 1S7SA 2FR4B 3O3AB 2MPAH 1D5IL 4A2LA 4JFDD 3K4DA 3OHXB 1RJYA 1CXFA 2BNRA 2R4RH 4L8CA 1TVBA 4FZEH 4KI5F 4P9MH 2CRZA 5I1HH 4J3VA 2F19H 3H3PH 3QEQD 2PR4H 3D3VE 2OJEA 5B22A 5MP6H 1J1OH 4ODHH 4J3UA 1M7XA 4PJCE 3QAZC 5FYJD 1URLA 3TN0A 3A6CH 1ES0A 3GIVA 4OGZA 5H37H 4PJHB 2V5RA 1BIIA 2K3TA 4YHYC 1D5BA 1MLCA 4XVJL 3P30L 3EAKA 1EHLL 1IGCH 1LO0L 1KEGL 4JM2B 4YBQC 1JV5A 2X9WA 3MLZH 3SN6N 2X4UA 3O4OB 4LLQA 4HXBL 5IFAH 4RIRA 4WTZA 1JGDA 4BH7A 4NUGH 4GG8B 3QIWA 3QNXA 3MRGA 1U8HA 4IIQB 1FNHA 4OZIA 1LDPL 4L4VB 1Y18B 3ZKMD 1CFQB 2V17L 4KJYB 4Q58C 5MP6L 2I27N 5DJAB 1F97A 1Q72L 1UB5A 1JTPA 4F7MB 3RVVD 4ZNCD 1QSEB 4M62L 1OGAE 5ESQB 4KWUA 3LEYH 2C4XA 4XHJC 1A1OB 3O11B 2EEBA 4YHZH 2GCYB 3MPCA 4PJXF 4DEPB 4HIEB 1S7VA 1ZXQA 4IJ3B 4U6XA 1RHHB 4PJ5A 5AWNH 4TN9A 5DUBB 2ZCLH 4WFEE 1FLRH 3G08B 4Z7WE 2FL5B 3GMQA 4FQLL 4JG0H 2VLJD 1B90A 4KK9D 4S11A 1EJOH 2CRMA 2HN7B 5E2VL 2Y36L 4XCNB 1QRNB 1C5DB 4MX7B 3NA9H 2DQJL 3FO0L 4LSDA 4OD2B 4UB0L 3FZUD 3RWEA 1UKQA 2X9XA 3IFLH 5ALCH 3RP1A 4U1KA 1DN0B 4LKCB 5EU7E 3IKCA 4BSJA 2WWKO 1KEGH 5I17A 5D6DC 3GI9L 4GG6F 1EFXA 1R3HA 4JFHE 3QUKA 1PX4A 2CKNA 4LVEA 4CW1B 4NUJB 3GHBL 4Z78B 1VEPA 4BELD 4GW4A 2DM7A 5FGBC 3ILQD 2ED8A 2VDQH 5EO9B 3VG0L 3WFEH 1MCKA 4MNQB 2IPTL 1KB9J 3LS4L 4NKDB 3MJGX 1QSFE 3WS6A 5KVDH 4Z0XA 1YZZA 3RGVA 3RTQC 1T20B 2D9CA 4MS8D 4Y4FC 4PV8A 2IFGA 1FVEB 3MRQA 5JIIA 4PJBE 1UEMA 3RWGB 3LN5B 5CIPB 4GFTB 2D7MA 3FFDB 4X98A 2A83A 5BVPH 2R8SL 2PW1A 1DN2A 2QQLH 3QQNA 4G6KH 5HDQL 2Z93B 1NQBA 1F3DH 1LO5A 3U4EB 3R06B 3BIAX 1EHAA 1NAMB 2YPLA 4UNTA 3G6AA 1XH3A 3HPJB 4DKFL 1MCLA 1K2DA 3TO4B 1GAFL 4Y88A 1I1AB 3HI6H 5D1QA 5KSAC 5EZJB 2AJ3B 3GSOB 3HR5B 2X4RA 3STZA 1TCMA 4HLJA 4HMDA 3EO9H 3CVHH 2FYYA 4WGWB 1AI1L 5T1DL 4RMUA 2PUQT 1FNFA 1NGXB 4MLIA 4TNWF 5EZLB 3VWJB 5HI4C 4RZCB 3HR6A 1LHZA 3O4OC 4NNXA 3V5DB 4FQIL 5IMMA 4JN1H 4MJIB 5E9DD 2X4QB 3NZ8A 5JHLL 5DC4B 3RKDC 5I1JL 3GI8H 3GBLA 3UJJL 4Y19E 4ZOBA 1D5MB 1P6AB 4Z5RA 3T2NL 5D1ZD 1IAII 3LMJH 4HJGA 4LEOB 5FB8B 2DDQH 4Z0BH 4JPIB 4ZFOB 3S98A 1I3UA 2NY7H 4WEUD 3MRJA 3ULVL 1I9JH 1INQB 4IOFD 4MAYC 4P3CH 2ARJQ 1JI2A 3WFBH 2VLKE 4WHDA 5J1AA 3V4VH 5IK3B 4R7DA 4G6ML 4ALAH 5BV7L 2OL3A 3I75B 3WHE0 4YHNA 1KPUB 4HUWB 1KJ2H 4EI5D 1AC0A 1WFNA 7FABH 4OV5B 1A6UL 3OKMB 4KUZL 1OTTD 2F54D 2NR6C 4HKZB 5LKNA 4CU6A 4PPTA 2FB4H 4P3DA 1AGEB 3KJ6L 3WUWB 4N8PA 1IC4L 5FHAL 3JBG7 3CLFL 3PGDB 3G6JF 2HT2D 3WE6A 4QRRA 2YPKB 1QFWL 1DEEA 1D3CA 3ZO0A 1EUUA 3HE7A 3CFJA 3Q0HA 5HHOA 5TF1H 2EXWD 2AJSH 3DV6A 5T5FL 3I6LE 4X7TA 3SJVB 1K8DA 1JF1A 2DICA 4G8GA 3GMOB 2BOBA 1IEBA 2AK4A 4L8DB 4ODUA 1LVEA 1XR8A 5EOTA 1NCCH 3WD5L 4JREB 2A6JA 2Y6SD 3CFDA 5D1QB 4AEIL 1WBYB 3OB0H 3S3PA 2HAZA 5FOBA 4PJ9A 2NX5D 3ALWA 2WINB 1AY1L 1NAMA 3R06A 2IQAB 2P7TA 5CWSA 2YBRB 5BMFH 2NY6C 1A9BA 4X9FA 2ORBL 3NABL 1HXMB 3DX6B 4TOYL 1I7RA 4I9WE 1H5BA 4DVRH 3WO4C 2AABH 4F9PC 3IVKB 2X41A 3LQMA 5EOCJ 1MIML 4H1LH 3W39A 4AM0A 5AAWA 2NY6D 1J9CT 3MNVA 4PRPE 2DLTA 1MWAH 4D0DA 3U9UA 3MLWH 5HYEA 1A6TB 2I24N 5DD6B 1ITCA 2DM4A 5DVOA 3GMMA 5C9JB 2WBWB 5FXCH 4RMSA 1NMAL 3DOSA 4M6AA