4MSWB

Y78 ester mutant of kcsa in high k+
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
publication title Using protein backbone mutagenesis to dissect the link between ion occupancy and C-type inactivation in K+ channels.
pubmed doi rcsb
source organism Mus musculus
total genus 54
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2013-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mswB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mswB01
3C8HA 5KVGH 4F3FA 5C7XL 3OR6A 3O8XD 4L8DB 2HRLA 4HS6A 5DVOA 4F9PC 3U9PH 4LFHG 1CLYL 4JGJA 4OI7A 5D70L 1DQLL 1T3FB 4Z77B 4KRLB 3MRGA 4F7TA 4MQ7B 3MTRA 4U6HA 3S34H 1J1XH 4H0IA 4KJPC 5I8EB 3VXME 3BH9A 3PQYA 3A0OA 3S96A 4LSRH 3L3GA 2V2WA 1G1CA 4HKBA 1WT5A 4G43A 1HYSC 4O2CA 3WFDH 3LHPL 4W6XB 5C0GB 2APVA 4PJ9C 3HMXH 1PEWA 4NO2A 2CLZA 3KR3L 1B4JH 3I6LE 1B0RA 2XNAA 4OLVL 2FBOJ 2CK0L 3MRRA 5D7SH 3FKUS 3NCJL 4X4MA 2YEZA 3I3DA 2OP4H 3NVQA 2FYYA 2X9WA 2Q86A 5C09D 5SWSA 4DTGL 4JN2A 3EOTH 2FX8L 1CDUA 3BEWA 1QHOA 1CD1B 4RFNC 4I2XE 3P0VH 2AK4E 4OCRH 3UPRA 1Q72L 4R97C 2PR4L 5CZXC 1GJIA 3LEXB 4UINL 4DWHA 1T1ZA 2M2DA 4HGKC 4ONGH 5IFHL 2CUMA 1JNNL 3CMOL 2OJZH 3QQ3B 3MV7E 5IW3A 1MJ7H 2IPTL 2X4PB 2B20A 4LLVA 2Z0BA 4V1DA 3VFRA 1BD2E 5E5MA 3O9WA 3E2HB 3I75B 3T3MF 3ARFA 4HJGB 1QKZL 4P23B 2I26N 1CE1L 2VRAA 2YUVA 4YXKH 2H6PA 3IU4L 3VI4F 4XVJH 4J4PC 4QXTB 4YPJA 3QA3B 1MJ8L 3CPLB 3PWUB 2CGRH 3RVUD 1I1RA 1QLRB 3SDCC 1XIWA 4ZQKB 5ERWB 2HJFA 4OZFH 5BMFL 1OLZA 4GFTB 4PREA 1MHCA 1GRWA 4IOIB 3S37H 3BGMB 3PQYE 3ZTJG 3P4LA 3AROA 2YMXL 4CMMA 2VH5H 5B4MD 3CVHH 5D7IA 1C08A 2VQ1A 2OSLA 3UYOD 4DAGL 2R23A 3F6LA 4NHUB 4C83A 4LLUB 1JNJA 3MA7A 1ERNA 1YQ2A 3VH8G 1GHFH 5C0DB 4L4TA 3QWRD 2COQA 3AFLA 4IRZL 3GM0A 3GRWL 4ODUA 4X4ME 4NKDA 4UBDC 1Q9LA 2EDRA 4HBQA 5SWSE 3RZCA 2YK1L 4PLOB 3CFJA 4Y4FD 4M4PA 4PBWD 5FYKU 2OI9B 3DLQR 5C6TL 3RHWK 1MQ8A 2EYTA 3GJFB 5DJXB 5FYJL 5I76B 3MRHB 1AGEA 1JUFA 2BSTA 4DGVH 2X5PA 3HZYA 2HT3D 4Z7VA 4E9LA 3FQRB 5J4MA 2B5IB 4XCNA 1RJYB 1I8IB 4AG4L 1V3MA 5KOVC 1A6WL 1YEHH 4V1DE 4RGND 5JOFB 2O26U 3LKRB 3F7VA 3NFSL 3OWEA 1L6XA 4G3YL 5D7KD 3CVIL 1ETZA 3I02B 1X5LA 3JTSA 2X4RA 4CADA 2BC4B 1FLRL 1OGAA 1QEWB 1T7ZA 3SDAD 5TQ0H 4XGZA 5M95B 5TDNB 1R3JB 3OKOB 4EI5A 3RWHB 4K71B 5JW3L 3Q48A 3WFEL 1NUDA 4DCQA 4IRJB 4KMLB 1AO7A 3WFZA 1S7XA 4WO4A 1PKQA 4HFUH 1QLFB 2CKNA 4RZCA 5C6WH 5E4EC 4G6ML 3ARGC 3V6ZA 3RWCB 3CXDL 1ONQB 2BFVL 2DD8H 1X5IA 2I25N 4M6OL 5D7IE 4FXKA 3LQAL 4XBPB 1DBBH 3V4UH 5ESQA 3KYMA 1RU9H 3NGBC 4L1HA 1D5XA 1PW3A 3VFNA 2X1WL 3KPSB 4GXUM 1P6AB 4L4TE 3CK0H 3BRFA 2EDQA 1U93A 3BP7B 2VABB 3LRGA 1EHNA 3C6SB 1GCFA 3BO8B 1UA6H 2IAMD 3NIGF 2AQ3A 5CZVH 4F7CB 2OR7A 1DBKH 5D1XC 3VWKA 4M00A 3CDFA 4CUCA 5ACLA 2BSSA 5D2NB 5EZJB 4RWYL 3AM8A 5HHOA 1I3RB 4P0DA 2W9LA 5E8EB 3CFKB 5C07A 1J0JA 3QEQE 3ARDA 4Z7VE 1JYXA 2E3VA 4LOUC 2A6KB 4XPTH 3RZWA 1CFBA 4OQTA 5KG9B 4G9DA 4LEXL 2UVFA 5FAAA 2X1PA 5ITFB 3SN6N 2EDDA 3U82B 4YDLB 3D69A 5HYJB 4YHZH 5F7UA 4MJ5A 4OTXH 1SYVA 4YHKL 3TJEH 2CMRL 3OAYK 4Y5VB 4IMKA 4K23L 5C08B 3QJFA 1UM6H 1IC1A 1E6OL 5L8LB 1KOAA 1YC7A 4UZGA 3V5KB 4HUNB 1D3CA 1CICA 4OFYD 2IQ9H 2O5YH 2SEBA 1XF2B 5JA8B 2XZQL 1AO7E 1FL6A 1T2QL 1WFUA 1A6ZA 1BEYH 2MFNA 2XTJD 4P3DA 4NSKB 1TZIB 3LKNB 5BVJA 3AUVA 4Q2ZA 5A43C 1EZVX 1L7TL 2AI0H 5GGSB 4APQA 2IF7A 4R4FL 1U3HA 1A1MB 1RZGA 1UYWL 3QIUC 3V0WH 1W2KT 4J3OC 4ZG1A 4Y2DB 4YBQC 1ZV5A 1CGWA 1F45A 5DRZA 4J2XA 4O2FB 2EEAA 4ZMAT 2LV4A 4G8FA 4AZ8A 3P77B 3VMPA 4QHUB 5E2VL 3PP3H 5HHOE 5DMIH 3FQXA 1MFCH 5C07E 4Z8FL 1BREA 4UT7H 4Z0XB 1Z5LA 1TQCC 4BQCA 4RRPG 2IPUG 4JAMB 3H0TA 2Y06H 1NANI 1SJEB 3MLXH 5IVOA 2DQFB 2AEQH 5I16A 3QDGB 3DV6A 1G9NL 5E6IA 1AGCB 1Z6JT 3ZL4H 5AUMB 2WINB 2EKSB 3MBEB 4Y8DC 2HN7B 1S7TB 1J5OH 3MUGA 5GS1B 1U8NA 1QQDB 4YNYB 4Z7QF 3DVNB 1U3YA 2ZPKL 3PABB 3S4SG 5CSZB 1Z9OA 5HHNA 5D7LE 1IAII 2H8PB 4PB0L 1L9NA 1TCMA 1CTNA 3NFNB 3TF7C 2EDOA 1VCAA 5C0JB 4JFFD 3U36A 2GSIA 3TV3L 1Q0YH 1G0YR 1D6EA 4MA1B 5GS0C 5ID0B 4R2GD 5E2TH 4PB9H 1QSFA 2FZ3B 3LEYH 2EEBA 3WUWG 4PY7B 1LO2L 4QY8A 4M7LT 4X6DB 1F02I 3NTCL 5DJ8B 1UB6A 5F7DB 3OHXB 2BRQA 3KPQA 2Q8AL 2OR9L 3QR2A 4JKMA 2Z31C 4LCYA 5IW1B 1M7DA 3HNSL 2DM2A 2DF3A 2ZCKH 1KTRL 3MJ9L 1NBYB 3P30L 3IJSA 1HI6A 2APBA 2HTLD 3M1BA 1WBYA 5MI0C 5DRNB 1WQVT 4JQXC 3ZSSA 4NZTL 1CLZL 4XPBL 4GXVH 2BY1A 1AGBA 3L3KB 1DTUA 5DD5H 4DVBB 1WJ3A 1OSZA 3ZO0A 5D2LB 4DVRH 5T3ZE 3OR7A 4WFGD 3VWJC 4WFFD 5C8JA 3PHOB 3VXRA 2Q20A 5FB8A 1WIUA 3GK8L 2XG4A 4JPIB 2RBLA 2N7BA 3HI6L 5HGAB 3BQUA 3O3EA 4KPHL 3C60A 4JPVL 3EO1B 1HKLH 1KENL 4H26A 3ZTNH 5BOZG 4IRSD 2YWZA 1XGTA 4BSWA 4W4OC 1NJ9A 4GG8B 2DAVA 3GSXA 4OZIF 1RZ8B 2WBJA 5CGMA 4X5XA 3T0DA 1T0MB 2ADGB 3RNQA 1P4LB 1QSFE 4TQEH 1KJ3H 4MD0B 4LVEA 2YRZA 4OLXL 3S3PA 5KS9A 3AS2A 2VYRE 1I1AA 4AM0B 1INQB 2DB8A 2HH0L 5D7JA 4Y0GA 2R0LL 5KZCD 5MP6L 2R29H 2W38A 1CK0L 3FTGA 4M7ZC 1RZFL 3B8SA 3P2TA 2VLMD 1RQ5A 4XCYA 1S8DB 5BS0B 4OF6A 5L9DH 1BX2A 3Q6FA 3O6LL 1JZ3A 1MCLA 3QI9B 4OCMC 4OGYH 4MCZA 5DHVA 3KJ4B 3HE6C 3NBNA 3E1F1 3EDEA 4NQCE 5E5RB 5FM5O 3QUKA 3GSRB 4BM7A 4LLDA 5IHBA 3O45B 3RU8H 2IFFH 1I9RH 1A4JA 2W0FA 1U3JA 1EHLH 1G9ML 4MAYB 4JRXA 5DFVC 4L8BA 3CCHA 3VXRE 1FZJB 1IQWL 1NCNA 2IH1B 1ZTXL 3FOLB 4KU1A 1UG9A 1AD0A 1DVFA 1MWAL 3T0XA 1C16A 1NANH 1A7RH 5JXAL 2R39A 4Y16B 4KAQH 4H1LB 5GRVK 1M71B 3QRGL 3WS3A 3D18B 1G1YA 3UYPA 3OAUL 5IR1A 4LASL 1FV1A 4K7FA 4C56B 4TSBH 1BLNA 2CIIB 4OM1L 4OZFG 4MMXC 1HSAA 4NBZB 2NY7H 1UZ8B 5GSRB 5I1IH 5KJRL 1I1YA 4TPRL 4O9HL 3O3BA 4PJDA 3TN0B 1U91B 2FDBP 4WWKA 4KROB 5KS9E 5I17B 1DBMH 1U8KB 4GBXA 4U1SB 1A14L 2X41A 3QIWD 5IIEA 4JRWA 2PCPA 4ZOBA 3GMMB 3AU1B 1ZA3B 3ZHKA 4LRIA 1NMBH 4ONFL 5DI8B 2FJHA 4HUMB 1VHPA 3VFOA 4OFIA 5CGYD 1XF5B 4OJFH 3GSNA 4D9LL 4OD2A 1X3DA 1MRDH 2QADC 3RUGF 1XGYL 3AY4C 2PF6A 3MGTB 5IESH 2PYEB 5KN5B 3IU3A 4DJMA 4QF1B 4OT1H 3LMJL 4OQTH 3GGWB 2R0WH 4QWWD 3F5WB 2OR8A 5JIPA 1OCWL 4YDKH 3WIIH 2JB6B 2YZ1A 3KPLB 3FB5B 2R1XA 3QEGH 1A5FH 3P0YH 5JW4N 3AREA 3TYGL 3G6JA 1JF1B 5FA4A 8CGTA 5CMAA 5HVHC 3O6ML 2I07B 2VLRD 2X9XA 3EOAA 1G6RB 3LOWA 4HS3B 3LVEA 3I6KB 5EBWA 4BUGA 1M7IB 4OLWL 4P4KB 5DC0A 1RJCA 4P4RB 5I74C 4PJ7F 4XCCL 5HDBE 4AYFA 2VZUA 2QQLH 4R96A 1MWAB 5JHLH 1BQLL 1BFTA 2D7PA 5E00B 4UDTB 4N5ED 1WISA 5I1CH 5FDWA 5LGJA 4TTDD 3G5YB 2UYLA 4YGVB 5I71C 3QHFL 1KTLA 1E0OB 2OTUA 3U7WH 4ZNEA 4KHXL 4KVNL 4YHNB 3P4MA 4HMDA 1JPFA 1J11A 5DR5H 1LDPH 4PV8B 4JRYB 4L9DA 4I3RL 1Q0XL 1R5VB 4Q6IA 3AAZB 4PJDE 4XC3L 2NLJA 1LO4H 4YXHL 4X8JB 2DYPB 4OD3H 2NY0C 1XGUA 1GGTA 1VPOL 2D2OA 2LFGA 5C0ND 3RGVB 2QSQA 5CJOL 2HWZH 4DW2L 4NO5A 4NNXA 1LD9A 3GSWA 1P4BL 3F12B 3MRFA 1A4KA 3DI2B 2OTWB 4RMVA 4GRLD 4Z7WA 4FZ8H 5IEKB 5EUKA 4IIQA 1GZPA 5C0CA 3SGKA 1Y6NR 2EIDA 3MUY1 2EDJA 3NH7H 1JWMA 5DJAB 3VFUB 4G42A 4WV1C 4G6FB 3ULVC 1NPUA 4NT6B 4HUUB 3MRMA 1EFXB 2GTZA 1U8QB 4NRZB 3VG9B 3G6JE 4Y8AA 3OG4B 3SDAA 1DSFL 4FXGA 3QZWG 4PGBB 1UWGH 5T3ZH 1NH6A 2EXYD 4YHYC 3IFPB 3S36L 1D9KA 1P5UA 5T3XD 1CI5A 1KPRB 3O3AA 2F19H 1P53A 5I1GH 2LVEA 1JFQL 3RBSA 4FA8A 4JM2C 4EDXB 4TSAH 3MBXH 2VR5A 3QUML 1NBVH 3HLAA 4WENB 4EN3C 4X7SH 2VXUH 4RAUB 1Q9KA 4FN0A 5IJVB 4ZNEE 5IKCA 1JWSA 3FO0H 3OZ9L 2X44D 3TVMD 1XAUA 2VDPH 4NC1E 2D9QB 5JW4R 1T03H 4PJIB 1BJ1H 1CLOL 4ZFGL 1Y6KR 3WIHH 1MNUH 5HHME 4KK6D 4L8CA 1LP9E 4IOSD 3TT1L 1UJ3A 2FSEB 4K8RH 4F80A 1NCBH 4WTZA 5HYQB 4PJCA 1UCTA 1P4IH 1MCWW 3UTZB 1UKQA 4U7SA 1QP1A 1I9IH 4JANA 5JXEA 3MV9A 2DL2A 5L2JA 5MERA 3BW9A 3TPUB 2IANB 1CD8A 2FLRT 1MQKH 3TNMA 4Z7WE 4YXLL 1MLBA 5EZIL 5HD8C 5C3LD 5C0CE 3CLEH 1ZS8A 5J13C 5E08H 4RGNE 1IAOB 3HC0B 4HIXL 4LKCB 4PJXF 3D0VB 5KSUB 3L6FA 2OMBA 3K3QA 5D7KE 4KJWC 2XQBH 4PD4K 3ZE2F 3JV6B 3U4BH 4LVOC 2VR4A 4GW5B 5I15H 1HHKA 3S7GA 1KYOJ 5D6DC 3MLTA 4R8WL 3GMNA 4RGMB 3ZHDA 1R24A 2PYFB 3IXTA 4ZXBC 3WD5H 3RPIB 4PJGA 1AKJD 3QT2A 2NY1B 3CLFH 5IB4A 1RFDH 2VXTL 5E5UB 3WXWL 2Z91B 3L5XL 2ERJC 1T80A 2FBJL 4XAKE 1S9VA 3DVIA 4OGAD 3GHEH 5L2KA 1HQ4B 2WWMD 1CGTA 1I75A 5J1TC 4EI6A 3TCLA 2APWA 1XEDA 1NGXA 1U58A 2R2BB 1IJ9A 3HZKB 4JO2L 4JY6A 4K7PY 4P2RD 5GHWH 5L8JB 4WUKL 4FABL 3BP5A 4J12A 2VLJD 5I1KH 5DD6B 2ICES 3B9KD 1NAKH 3CSBA 3L3IA 5FYLE 4LARH 3CIQA 1HHIB 3P0GB 5CP7A 1X7QB 1EO8H 2IBZX 2ZCLH 5IK3A 4M8QA 1ZHNA 3ZE1F 5K9JH 3BE1L 3KNBA 3BDBA 4YO0A 3DMMB 2J6EA 2QSVA 5KSAD 5KSBE 4D0DA 1IEHA 3BISA 1QFUH 4PJ8A 4U1IA 3JXAA 4NQXA 5K9QI 2NW3A 4I0PB 4POYA 3NCEB 3TH4T 1AHWC 4YHOL 5IB1B 5DHVH 4TUJB 2D4DA 1UACH 1MELA 3MRJB 1Q94B 4PRIB 4U0RB 5D5MF 1I9EA 2Z35B 2FX7H 1UXSA 4L9LB 4I0CC 4PUBL 5ALCL 3DO7B 3DURA 2VL5B 4DKEL 4M7JH 1JHKH 3CXHK 5D1QC 1E6JH 3QUXB 4WTXA 3U0TB 3Q3GA 2A83A 2DLFH 4U1LB 2P47B 3UPAA 1YEFL 3X14B 5DQDH 4PJGE 1FNSL 2XTJE 1JI2A 3FT3A 5DJCA 4OZHB 3H9SD 1T89A 4HKJB 4IJ3C 4KKCC 4P5MB 1IGTA 4JFFA 5DEFB 5J6HB 3N1PC 5K33A 1G7QA 1KGCE 2Z92B 4LU5L 4HAFA 2NTSP 4L3EA 3MJ8A 5L2KE 5FCSH 3LS5H 1J05B 4TSCL 4RDQG 1O7SA 5IG7A 3AMKA 2Y7QA 5BZWB 3TBTB 3IDXH 5E94B 3UYRH 3OJ2C 1D5IL 1S9YA 3KLSA 3HC4L 3GIZH 4FZEL 4MNQD 1VACB 5HYSB 3JWNC 4X9IA 2OXHA 3MRPA 5DYOB 3N1MC 2XQYK 4TOYH 1PQZB 2YR3A 2HMID 3D2UA 2G2RA 1WGOA 4MDJB 2W9DL 4XX1E 2BVQA 4ODHH 5C0IB 2D7NA 4JY5H 1FRGL 3GSNH 3GIVB 1Q9OA 1FHGA 3TIEB 4YHPA 2VB5A 1FP5A 4KK9D 4JKKA 1UCBL 5DJDB 4X80L 3UBXA 1K6QH 2P8MA 4G5ZH 3BD5A 5EFIA 5IHZB 1T20B 3WEXB 1INDL 3EO0B 3KPMB 3N1GC 3T4YA 1BECA 5EOCH 5IWLA 2FX9L 3P40A 3HI1A 3QRFM 3GSUB 5J1SC 1VDGA 4IS6B 3C5JA 3M45A 1KCUH 2ZP0T 1TDQA 5EU5B 3DV4A 1UB5A 3BUYA 4XMLL 5F88B 4DGIL 2IALB 1JI1A 3ZDZF 3U4EA 1A3RH 4JFFE 1JPTH 4BSVB 1PSKH 4YHMH 3WUZA 4L3EE 3KPOA 4QRSA 3KG5A 2J5LC 4F7EA 1HSBB 3EYQD 3QCVH 3KAAA 4KKAD 4LGSB 3U9PL 1NC2B 1YEDA 2RQ8A 2Q7YA 3SDDB 3HG1A 2P7TA 4UU9B 2GI7A 4YR6B 2JKXA 1WLHA 5AYQA 2EDNA 4M1CC 4LGRB 4PRPD 1VADB 2UUDK 4X6BA 4PBVC 2ZUTA 4BA8A 5J1AB 3RTQC 3UMTA 3K7UA 4LSRL 4XWGL 5C0BD 1FL5B 1NCUA 5B22A 2ZSWA 4ACPA 5L88L 3MRCB 3WFDL 4PR5A 5DMGD 2C3XA 2ESVD 3HMXL 1B4JL 4BZ1L 1DUYB 3O6KH 4PRDB 5FKAB 1P84K 4GOSA 1TITA 4GG6F 4NZJA 5IT2L 1OAZL 2FR4B 3TO4A 5BO1L 2FH8A 3I3EA 4HK0A 4WEBH 3MRIB 3QBTB 5T1LA 5D7IF 3FRUB 1UT9A 4QHKJ 4WFFE 2VLKB 1FLTX 4Y19A 3OTTA 1GGYA 3K74B 4ZAKC 3VFPA 3S36X 2HTKD 3GB7A 4ONGL 4MHHI 3Q6GH 3VRIA 4J3VA 2IEPA 2XN9D 4JFEA 2NYYC 3MLUH 3DRTA 3OF6D 2AEPL 3KDMA 1N0XL 1KFAH 1I3UA 4QT5A 3F7RA 5I1HL 1RZJH 1J86A 3MYJB 1OQOA 1V7MH 4U7KA 1RUKH 5AWNL 1FZMA 5DTFA 5DURB 4XH2B 2BNRD 4M9OA 2VXVH 3CFDB 4LNRA 5MENA 5LJYH 1ZT7B 3IVKA 3RUGB 1J0YA 3JZ7A 2A6JB 2H2SC 4AK1A 5FYLH 4L4VB 4LF3B 2O5XH 1CXLA 3AXLA 5F8RC 5I18H 4NWUH 2ZUYA 3HE7B 2VLME 1T2JA 3GMOB 2VXSH 4UV7H 3WHXA 5GS2H 2H32B 3O3DA 5JOPD 1G9EA 1MLCB 3TBVA 4FMFA 3X11B 1PYWB 2A74A 5FHBL 1ZA6A 5CAYB 2ITCA 2VAAA 3L7EA 5HTSA 2FJGA 5AD0B 1MRFL 1NCCL 2G60H 4LCIL 5EU6A 2FGWH 3T0ED 5DQJA 2OBGA 4OZGE 1JNHB 4BFGA 4PJ7B 2BOCB 4XBGA 1CZ8H 2Z8VC 3GMLA 4YHIA 2DWEB 4N5UA 2BMKB 2OX5A 5HI3D 4Y19E 5FYJD 3F7PC 1DEEB 4Y1AA 4TVSa 4I4WB 3V4VH 2CR3A 5IVXA 4PTTA 3B9VA 1BZ9B 4K3EH 4UTAL 2PXYB 2VN7A 2VLLA 4MA3B 4N9GA 4OCSH 4JFEE 3UTTB 2VDMH 1EEYA 1CWVA 2LTQC 1YEHL 3BPCA 3IDMA 4N0YL 1BF8A 2QHLA 4XVTL 1I85A 1CFTB 3TA3D 5C71A 3UO1L 4YFDB 4O4YL 4XTRD 2A6DA 3MV8D 1T7VA 5CHNA 4QRRA 3QG7L 5DZLA 3QEHA 5A2KH 5TQ0L 5DGQA 4ETYA 4O51A 5JW4Q 1T1XA 2PW2A 1HHHA 5MENE 5BRZB 1HH6B 3TH3T 1JRHL 4CVWA 4F9LC 1RZ7H 1OD9A 2IC2A 4HFUL 4XZUA 4JFQA 2B2XH 5FECA 2J8UA 3IXAB 3OXSA 5D96C 5TDOA 2NPLX 2DD8L 4GRLA 3U1SL 1UWEL 4HDIA 3IDYB 1MFBL 2J6EH 5IQ7H 1W0VA 3E6FB 4PGDB 2DWDA 4P5TC 4H8WH 4ERSL 5EU6E 1MAJA 4YQXH 1ZLWK 4DEPC 2CXKA 5CD3B 2FHFA 3W9DA 3WFCL 2V5SA 5JZ7D 3EDDA 2X4TA 1SYSB 2VLRE 4JLRA 3RVVC 5DRXB 3WN5A 4AT6A 1ZWIB 1MHHA 4Y1AE 4PJEA 5L8KB 1ZSDA 2PTVA 2KBGA 12E8L 5TFSH 4Z78A 3GBNL 5ISZD 3WNPA 2F54B 2W07A 5TDPA 5CWSA 2VDRH 4PP2B 2BJML 4QXUH 3D1MC 1C8PA 1IEAB 4OFPA 3SPVA 1VESA 4YHZL 4M6NL 5LCVH 1DFBH 3ARBB 2XWJB 2MWCA 3DIFA 1MSPA 5B8CC 1IGFH 2HT2D 2EDFA 5E9DB 2CLRA 5K59F 3SDXA 1UM6L 1P9MC 4Y89A 1A1NA 2NQCA 1S7VB 4X5WB 1RUMH 5FKPB 3VFWB 4EKXA 2Z4QA 1AXSA 3EUUA 3MNVB 3KLDA 4KUZL 1DCLA 2V2XB 2O5YL 3U7YH 2W0LA 5JHDD 3RL1A 2EC9U 5EIQA 4X99A 2FATH 1KB5B 4M9PA 4Y7MA 3G5ZA 4FQHA 3U30C 5BZDB 4PJXB 1MVFA 1F5WA 2HJLA 2J8UE 1E4WH 5GGVY 2JB5L 3W2DH 4NBYB 1EAJA 4R26H 3VXUA 2FIKA 2JIXD 3K4ZA 5EZLA 1N7MH 3B43A 3BDYH 3FQWA 4OZ4B 4MJ2A 4JKWA 3QYCA 1T1YA 3H3KA 1UADC 4HULB 4GW4A 4LDLB 1CIDA 3H7BA 1JGLH 1FFRA 2CDFB 4TVPH 4LHJB 5DQ9A 5L7XL 5JO5B 2G75B 4ELMF 1A6UH 3ARYA 2VZTA 1MVUA 1T7WA 3DX9B 3O4LB 3EOBB 4OF3A 3HUJB 5EDXA 4NN5C 1A2YA 4GKZB 1A3LL 4GKSA 1JTPA 1MFCL 3AMLA 4C55A 5KSVB 2ZJSH 1E4XI 1YYMH 1QA9A 5INCB 4PJAA 5D9SA 1R5IA 1NLDL 2AABH 1K4DB 4QYOB 3VD7A 3MNWA 5CJXA 4PYHA 4P46C 3QDMD 5IMLB 1J5OL 1EJ6A 4CDHA 3SKNA 1NAMA 3FT2B 3SDXE 4YPGA 4NHCH 4PJ9B 4ORGB 1XH3A 3W0WD 5CZKA 4PJ5A 4Z95L 1G7LA 4XI5C 2DMBA 4HS8H 1EO7A 5JR1L 3ZDYE 4N68A 5DDHB 4RNRA 1YPZB 4AEEA 1WUNT 2WNGA 1H3XA 5J06A 1AR1D 5C0AA 3D39B 2BXYA 1RURH 3HPJB 3CSYA 1D5MA 4PRHB 2D0GA 3EYOB 2W1NA 3RNKB 5D5MB 4PP1D 3OSKA 5B39G 1ZHBB 4EBQH 3C09C 1PZ5B 2AEIT 1HILB 4XWOD 1Q0YL 1NCDH 4TUOB 4FQXD 3VXTB 5I8CB 3STLB 5E2TL 5IM7B 5FOBB 2A9NH 5DJYA 1EUUA 4PJFA 4U3XA 3ZKNC 3LEYL 4GQ9H 3UTPD 5HHXH 5ITBL 1ZGLB 2VDKH 3I6GA 4FQIL 3ORJA 5E2WL 4XCEB 1GVIA 5BS0D 1SJVA 3N1FC 1XR8B 3O6FD 1CXHA 3V5DA 1DP0A 1HCVA 2BCKA 5IHLB 1Z3GH 1KCLA 4MXVE 3EIFA 4HQQH 5E0QA 4Y5YA 5IVZB 3CMGA 4HUKB 4EOWH 1ZE3C 3C5ZD 3SDCB 3SGDI 2NY5C 3HZVA 4PJAE 3R1GH 4AEHH 4PPTA 1WWAX 3GBMH 4L8DA 1J18A 4NM8L 3RAJL 1FNLA 1CF8L 2Y23A 4H20H 4DVRL 1OTSC 1WZ1H 3REWB 4MAYD 5DEGB 1NGYB 1T3FA 3RJDA 4CKVX 2YKLH 4Z77A 2XRAH 4MQ7A 3DARA 5I8EA 2WSKA 3WNOA 3B2UD 1QBML 4LIQL 5C0AE 3S37X 3IJHA 2EIEA 1OM3H 3T4AB 2F5BL 1HKLL 3FB8B 5EORL 5I30H 2ZNWA 3QUYD 5C0GA 2X1XR 3RVTC 4N90E 2YS4A 4KRPC 4EUPB 1KB9K 2NZIA 4P5KB 4PLKC 3HPLB 4WI3A 4PJFE 5CJBA 4B7LA 4TQEL 1C5CH 1CD1A 1T21B 4P2QB 3LEXA 4KK8D 3TIDB 4M93C 3AM8C 3MXVL 1DQTA 1FPTL 1ND0B 2HRPL 4PJDF 1E4KC 4TNWK 5CEZE 1WICA 3QQ3A 2X4PA 1F2QA 1CFQB 4ETQB 5I1EH 4OGYL 3ZKMD 4OCLC 5IBUB 4NYLB 4KI5C 5A2FA 3I75A 1L7IH 1V5JA 5K9QG 5E4EB 1K9TA 3ARGB 4HJGA 4HEME 2L4OA 2EXWC 4P23A 1XZ0B 2AJXL 1MREL 4Y4HD 3RU8L 2IFFL 4B50A 3BX7C 4OCWH 4QXTA 2WV3A 3NGBB 2APTA 4M4RA 3QA3A 3CPLA 3PWUA 1QLRA 4M1GH 4ZQKA 5ERWA 4JHWH 3MNZB 4MAUH 3THML 1E4XH 2CD0A 5F7FA 3VCLB 4IOIA 3BGMA 1JGEB 4TULH 3ZKQD 4AENB 4MNGB 5D1XB 3PV6B 3G6JF 1N3NB 4LFHD 4NHUA 3KS0H 2AK1H 4GG6B 4LLUA 1XMWA 4HXBH 2QR0B 4XMPL 3Q1SH 1TNMA 4WTZG 5DWUH 2NY7L 5C0DA 4TNWF 5I1IL 2CSPA 1JN6B 2HKHL 2FD6L 4E0RB 3FHAA 3QXAB 2DYPD 3LRSB 1OP5H 3V4PH 1DBML 2FGZA 5DUPL 1IAIL 2HP4A 1FGVL 3O4OC 4W6WB 3GJFA 5DJXA 5I76A 1FSKC 4RX4A 5GZNC 1T04B 2WWKO 3MRHA 4KJQC 5BW7C 5IROC 1KG0B 43C9B 1BFVL 2X4UB 4OJFL 3FQRA 4KY1H 4CN6A 1MRDL 1RJYA 3S35H 1FNGB 1FG2B 1I8IA 4U1KB 3S5LB 2QHRH 5JOFA 2EH7L 3LKRA 1A7NH 1IT9L 4UQ3B 3B9AA 4OT1L 3U7AA 3LH2L 5E56A 3EDFA 3I02A 3MUHL 4YDKL 3QEGL 1MAML 1DBJL 2BC4A 4N8VG 1QEWA 3P0YL 3T2OA 2X2YA 1BQUA 2UWEB 3QIUB 3QUZC 5TDNA 1KIPB 1R3JA 3OKOA 1K3IA 4JDVB 3RWHA 5JPMB 3SQOL 2YPKB 5HDLA 3INUL 5JNYB 4IRJA 4CJ0A 4JDTL 1QLFA 1GC1C 5IBLC 3SGDH 4BQBA 2QQLL 3RWCA 1ONQA 2RAMA 1YYLL 4GRWB 3ES6B 4EIGB 4XBPA 2IQAB 4L8SC 2N1KA 5CINL 3U7WL 2APXA 2ZG3A 1IGIH 4O58H 5DR5L 1TQCB 2XWTB 3WNNA 3BP7A 2VABA 2FEEL 3C6SA 3BO8A 3FFCD 1ROWA 1LO4L 4ODXB 1FL3B 4F7CA 4XX1G 2QSCH 2AJVL 3CFEB 2BHZA 4I48B 3RWIB 1GGCH 5D2NA 5EZJA 3MREB 5FUZH 3DX8B 1I3RA 2D3VA 5GRYA 1X5XA 5E8EA 3CFKA 1YJDH 2NR6C 2ATPB 1YY8B 4KHTL 2IAND 2A6KA 5FGCB 5GZOC 3TWCH 5KG9A 2DI7A 2X40A 2NCMA 4FZ8L 2YPVH 5ITFA 1KN2H 5HYJA 1JZ6A 1PFCA 2X89A 5FM8A 3BKJL 4PJCF 5EZOH 1P7QD 2BXZA 1WBZB 3LKOB 1A1OB 1OGTB 2JJSA 4Y5VA 5C08A 1YN7B 3MYZA 1NGPH 2VDNL 3UJJL 1UZ6E 4HZLB 1OAKH 5CCKL 5CKAA 1X5KA 3EZJB 4JZOB 4MQTB 3V5KA 4P9MH 3BKYL 1NAMH 3WSQL 4OIAA 1XF2A 3T04D 1PLGL 3DUUB 5E99L 5F7NC 1MH5B 4P99A 4P9HH 5ICZB 4NSKA 1TZIA 1XF1A 2GW5A 2FJFB 3LKNA 2F19L 5I1GL 1LK2B 5GGSA 5HJ3B 4TSAL 3MBXL 1A1MA 5JOPE 2GJZB 3KLHC 4X7SL 4NKQB 2R1WB 2Z31B 5E7FA 1QUNA 3PL6D 1W0YT 5AZEH 5LWYL 4Y2DA 3TT3L 4UILH 2P8PB 1T03L 5JW5B 3SE4A 3KPRD 5DSCB 5CS7A 5FO8B 5A3IC 3WIHL 4UOJA 4O2FA 5MI0B 1I1AC 3T0EE 2E9WA 5EU7E 1ORSB 1DQML 4F37K 5DMKB 1NCBL 1YA5A 3T77B 3P77A 3BIKB 3JSSA 4QHUA 5D2NE 5E24E 3SO5A 1RSFA 5ESAB 5FYJE 1JZ4A 4Z0XA 3FQTA 1KT2B 1QD0A 3UBXG 2PO6D 3VWJB 4DGYH 4OGXH 3M8OH 4JAMA 5E1HB 3QP3A 5K9OB 3TBYB 1SJEA 5CEZH 3ULUC 2DQFA 1AH1A 1YEEL 3QDGA 2VNCA 5E08L 1AGCA 5AUMA 1U3ZA 2WINA 2EKSA 2ADFL 3MBEA 4LHUD 2HN7A 5FHAH 2DBLH 1S7TA 4NKOB 5C08E 3O8XC 5GS1A 4MYWB 4NM4H 2XQBL 3MV8E 1QQDA 5J6GB 1IGCH 1K2DB 2ICEB 4YNYA 1W8OA 3QUXD 3DVNA 5ADPH 3RVWD 5I15L 4PJBF 3PABA 3BP4B 4WIQA 5CSZA 5KVEL 1WSST 2H8PA 2HFTA 4RFOH 3WL9B 3NFNA 1HNGA 3CLFL 5C0JA 1KC5H 3UJTH 1OAUH 1DQDL 4M7ZB 3GHEL 4RBPK 5C9KA 4OLZH 4R0LC 5ID0A 1GGBH 4YFEA 3PE9A 4JKPL 1CN4A 1SBSL 4ELMB 4DKFH 1BFSA 3MFFB 4UIKL 4MMZC 2FZ3A 3IFLH 5D8JL 2VUYA 4PY7A 3HE6B 1A6VH 5F97E 4X6DA 5DJ8A 2AV1B 5F7DA 3OHXA 5I1LB 4G7VH 4LARL 3GI8H 1J1PH 4AMKH 1FYTB 1EO8L 1MI5B 2ZCLL 4S1QH 4ESKA 5IW1A 3DX7B 1H8OA 3D0LB 4UI2A 2YUZA 3NABH 1QSED 1NBYA 5EWIH 4P2OD 3PWLB 4QTHB 2EZ0D 5DRNA 4PRAB 3MOQA 3QDGE 3WKML 3OB0H 3IDNB 4QGYA 4MD5B 2X9YA 2DI8A 3L3KA 4DVBA 1Q38A 3RJQB 5D2LA 2FX7L 2Q3AA 3BVNB 5C7XH 5JQHC 3PHOA 5DA4A 4M7JL 5EC2B 1JHKL 1FCGA 2V5RA 5C0FB 1HYRC 3HZMB 5BJTB 5GGTL 3RVUC 1KCSL 4JPIA 4JDZB 3TO2B 5HGAA 1DQLH 3LN5B 1K4CB 3EO1A 1IILE 2Y6SD 2WAHA 5HGHB 5B4MC 3HFMH 2F8OA 1VGEL 4GG8A 5EC1B 1RZ8A 15C8L 5ICXB 1T0MA 2QADB 2ADGA 4NC1C 1P4LA 3LHPH 4Q6IC 4MD0A 5A2LH 5TF0A 3UYRL 4AM0A 1INQA 4OLVH 4X6DE 3NCJH 4IDJL 2VOTA 5HHQB 4Y4FC 5BVPH 3O11B 1N64H 2V9TA 1AP2B 4DTGH 2FX8H 1S8DA 5BS0A 1IC4L 5HVHB 3GJFH 3NCYS 3BEVB 2CRIA 2HT3C 1S7QB 2PR4H 3QI9A 4ODHL 1MJUL 5ANMB 2VQUA 5IFHH 1ZT1B 3GSNL 5I74B 3SGKC 3CMOH 3UTQB 3GSRA 1RMFH 3JWOC 4CRPA 3RWGB 1C5BL 4G80B 2P46B 3O45A 4LCCB 1GOHA 5EOCL 5D2LE 5I71B 2YD5A 5E2UL 3RIFK 5J9PB 3IAGC 4MAYA 3SJVB 1QKZH 4YAQB 1FZJA 2EYSB 2IH1A 3FOLA 3IU4H 4POZD 3WHE1 4HD9A 4F15C 1EVUA 3IFOB 4ZS6D 5DK2B 4Y16A 1NGWB 1DN2A 2NY0B 5LGKA 5T5NG 4H1LA 5EU3B 1M71A 2D4FA 3IGAB 1BQSA 4O02L 3D18A 3KYAA 3VI3F 1T66D 4C56A 3BZEB 3MOBH 2CIIA 4MJIB 1JPTL 2YMXH 4F2MB 4FQLL 2QLVB 1UZ8A 5GSRA 4K94C 1PSKL 4YHML 3TN0A 4DAGH 4LCWB 1U91A 3O2WL 2E7HA 1FZOB 4NZRH 3WNLA 3QCVL 4X9HA 3VFTB 3WDJA 3QFJB 5I17A 1U8KA 3VFVA 4U1SA 2B39A 5IV2B 1AC0A 5KVDH 2IAMC 4IRZH 1ZLVH 3GMMA 2NX5D 3AU1A 1ZA3A 4WV1B 4LDEB 4L4VD 3IRZA 5DI8A 1XF5A 5CJQH 4IM8A 3PNWB 5BS0E 3NPZB 5C6TH 2VDLL 4MJ4A 5F9OL 1CDIA 3MGTA 5F7EH 3HMWH 3AVEA 2PYEA 1NFIB 1I7UB 2VIRB 5KN5A 4YHYB 1FNHA 4QF1A 3GGWA 2RIKA 3F5WA 3O6KL 2JB6A 3KPLA 3FB5A 1A6WH 1LEGB 1VKXB 4JM2B 4G9FD 3HI5L 4Y88A 1JF1A 3NFSH 4KZDL 1T6VN 4EN3B 2I07A 4G3YH 1RD6A 3CVIH 5DZNA 1T2XA 4WEBL 1JTOA 1G6RA 5CSGA 4HS3A 1JGUH 4V2BA 3I6KA 4FQ2L 1LO3L 1M7IA 4X7TB 1FLRH 4P4KA 2O61B 4P4RA 5A2IH 5F7MC 1ZHLB 1N6VA 1MWAA 3KHOA 5JW3H 5E00A 3WFEH 4WNQB 3DHMA 3HC3H 4AH2B 3G5YA 4YGVA 1NKRA 5DK0B 1R3KB 4MD4B 2GAZB 3UC0L 1DZBA 1H3UA 5E8NB 4G6MH 4YHNA 5M7QA 3CXDH 2BFVH 4JRYA 4PV8A 4M6OH 1R5VA 3LQAH 4Y4KD 1FIGL 3AAZA 3D85B 3QULB 5IVXF 1IC7L 4X8JA 4X0KB 2DYPA 3ECBB 4HWUA 5BRZD 5J13B 4KDTC 3SKOB 3GMQB 3MRKB 3TP4A 3RGVA 2W0KA 5FYLL 3F12A 3ARPA 3MCG1 2O5XL 4X98B 4S1RH 3UEZA 4ZNCD 5KOMC 4LVOB 4NWUL 4PG9B 2LU3A 2OTWA 2J2ZA 1TVDA 1IC5H 4R3SB 5IEKA 4ODWB 1WZLA 1NGQH 5T33H 2PYEE 3LZFH 1ZVSB 4ZXBB 5DJAA 3VFUA 4BFBD 4NT6A 4HUUA 1EFXA 1U8QA 3Q5OA 3CUPB 4OCXL 5IF0B 4ONHB 2FHCA 5KW9H 4HT1L 1X5FA 4NRZA 1W72L 2ERJB 1FVDB 4PG2C 4YHKH 2CMRH 2J8UF 3SBWA 3UP1A 1AI1H 1FG9C 2HVJB 2XYCA 3T0BA 5HGGS 4PGBA 2X7LB 3UXFA 4XP9L 4PD4J 3IFPA 5DC4B 5F1SA 3R8QA 3ZHLA 1KXTB 5C1MB 5TGBB 3FQNB 2ICWB 1KPRA 3V4VL 5GGVL 2EC8A 1MCEA 1OTUD 3CC5B 4EDXA 4K3EL 4UOW1 2K3TA 3C2SA 4KFZC 2MNUA 1T89C 3M17B 3QDJB 4BKLB 4RAUA 4EVNB 5IJVA 4DN4H 4NQDD 1CXEA 5DS8B 4JRYE 4Y2OA 5E9DD 4PJIA 5HYFA 4GW1A 1I8LC 4PJEF 5IGXL 1QHPA 4UT6H 1ORQB 2EC9T 2D0FA 2FSEA 1AHWB 5HYQA 5F71A 4KTYA 4OLUL 4CGTA 1AJ7H 4EZMA 3UTZA 3IJYB 5JPNB 1SM3L 1ZLSH 2MHAB 1RZ7L 4XP4L 4ZTOL 2WW8A 3HRPA 4NQED 3TPUA 2IANA 2B2XL 1KLUB 4I3GA 1EEZB 5D1QB 1SY6A 4BK5A 2C1OB 2EKJA 1RAMA 5SWZB 4LSUH 5DVKA 4Z8FH 1IAOA 2J6EL 3HC0A 1RIHL 2HTLC 4LKCA 3LN4B 3SGJC 5KSUA 1GPOH 2HLFD 4NO0B 4OI8A 4H8WL 5E8DL 3QPXH 4YEEA 4MSWB 4YQXL 3EJJX 3B9EA 5IWLC 3JV6A 4JO3L 4IJ3B 1G9NH 4UQ2B 1W72B 4GW5A 3MCLH 2X4SB 4QRPD 2JELL 4HIHB 4G6AD 4RIRB 2MJWA 4P3CL 2PYFA 4YX2L 3T08A 1G7PB 3CXHJ 2P5WD 1VA9A 3RPIA 2Q76B 3IFNL 1JF6A 2W92A 2Z91A 5TFSL 1T83C 2R56H 2WP3T 1QG3A 1ACZA 1RIUL 4PB0H 5F9WC 1HQ4A 1YMMB 3ZT7A 4LHQB 3TZVD 4IRSC 4WUUB 5LCVL 1SMAA 1AY1L 3NIGE 2R2BA 3CH8A 2DQTH 3HZKA 1IEBB 2HLAB 3LIZL 4PJIE 3TV3H 2DJ4A 5EBMB 1KJMB 2DLIA 4MXVF 1XCTB 5DD6A 3SE3A 3A6BL 2HA1A 1HHIA 2XACC 1N4XH 4JJ5B 2A6IB 1H0DB 1X7QA 3X3GL 1EMTL 1T4KB 3C6LB 1LO2H 3LQMA 3LSOB 3DMMA 4PRHD 2IANE 4HUWB 1V8HA 4B41A 4N0UB 4I0PA 1BWMA 3W2DL 3HNSH 4Z0BH 5IB1A 4R26L 4TUJA 1N7ML 1T22B 2WBKA 3CFCH 3P30H 3MRJA 1Q94A 4PRIA 3V6OC 3QWOB 1I3GL 2Z35A 4PJBB 4PGEB 2I27N 4L9LA 3I6LD 3DO7A 1JGLL 2VL5A 4TVPL 4CMHC 2JJVA 1IFHL 1ULVA 3MLZH 3QUXA 3U0TA 2FCBA 2J5LB 3NCCB 1ES0B 4O00A 3PWNB 4U1LA 2AK4D 3MACL 3T65B 5DJ0B 4XVUD 4URTB 2GQHA 3CSGA 3X14A 2XZZA 1TCRB 1QBLL 3JUYA 3EYFB 8FABB 4OZHA 1F8TL 4X6FB 2Q87A 4HKJA 4P5MA 4PLJD 2R0ZL 5DEFA 1RPQA 3REVB 5J6HA 2CR6A 1TVBB 3HI6H 1N5YH 2Z92A 1BQHG 4KPHH 3OKYA 4JPVH 4H1LH 5CFHA 5IQ9B 4UV4H 1R0AH 4KMTL 1FAIH 1J05A 1KENH 3RTQB 2AVGA 3FAXA 5BZWA 3TBTA 2H2PD 2VC2L 3A6CH 2XPGB 5E94A 4HPYH 1J9CT 1QRNB 2B8OT 4ZPTB 2AXJA 1UM5L 4NHCL 5DMJB 1VACA 5HYSA 4LSVH 1CFVL 3QIWC 1S7SB 5E95B 5DYOA 2VZ3A 4OLXH 5DHYB 1PQZA 3PDGA 2HH0H 3AS1A 5A16B 4HH9B 4MDJA 5CGYC 2R0LH 5CGTA 4HK3J 3UTSB 5C0IA 1JZ8A 1CK0H 2X09A 3GIVA 5J7CC 1RZFH 3PQYD 3VXSB 5JA9A 1KLGB 5IMKB 3O6LH 5DJDA 1P5VA 5IHZA 1T20A 4QWWC 4Z7QE 3WEXA 3EO0A 4WHTB 3KPMA 1IAKB 1NC4B 2JK5B 4MB3A 1P84J 2B1HL 3GSUA 1DBAL 2DIJA 3OKKB 4IS6A 3MRDB 4P59L 4CVXB 2VDKL 5SWSD 1FJ1B 1BF2A 2QEJA 4QRUA 1G6RH 1TPXC 2EE2A 4KI1A 5EU5A 4YHLL 1G0DA 1IQWH 1Z3GL 5F88A 2IALA 4OZHE 1ZTXH 4ZOAA 4N5EC 1MWAH 4Q9BA 4TTDC 1GGIL 4JG1L 4BSVA 1CE6B 5JXAH 3T3PF 5FF6B 3R1GL 4G7YH 4DQOH 4U1JB 4RQQB 3K2UL 1YEGH 1CL7L 3QRGH 1FGNH 4V1DD 1HSBA 4ZO9A 3RY6C 4CBPA 3OAUH 4LASH 5JOEA 3O9WD 4RISH 4OM1H 1UKSA 1NC2A 4JFXB 1OAYL 3ARFD 1WZ1L 4HWZB 4TPRH 3MGAA 3SDDA 4UU9A 4YR6A 5DJZB 5AG8A 2IJ0C 3MJGX 1VADA 2ID5A 5C0NC 3WFBL 1A14H 4OV6F 5J1AA 3N85L 1QFWL 2YA0A 3EDKA 2B0SH 1XIWD 5T1DH 4ONFH 1JYWA 4NUGL 2FL5B 1FL5A 3Q5TA 2GUOB 4HJ0D 4MCYB 4JFHD 3BI9X 2R2HB 5F89B 3MRCA 3B6SB 4PS4H 1WEJH 1XGYH 1DUYA 4PRDA 3MMEB 3GI9L 5FKAA 3IDIB 3QZWB 3EKCA 3LMJH 2FR4A 4XNUH 2E6JA 1C5CL 2LTQB 4G8GB 3MRIA 4UNTA 4L4TD 4NZUL 3K46A 3FRUA 2FNBA 2HKFL 4KZEL 2VLKA 3TYGH 4ZO6A 1RZIB 4WJ5B 5CIPB 3RZCD 4K2UL 2EXYC 3O6MH 3DXAB 2J88L 5EH1A 4R4BB 3B4NA 4MJ6B 4OZIE 3L3HB 4OLWH 4QRQB 3TC9A 2YD2A 3PG2A 4OAWB 4D9QE 4MXWL 3VXMB 2BVPB 2FO4B 2IMNA 2YA2A 1L7IL 4UUJB 4E42B 3MYJA 4XVSL 3TVMC 5D96B 2ZUUA 4XH2A 2PUQT 3EW3B 1FFQA 3CFDA 4LPXA 4I3RH 1Q0XH 4KK6C 4U3HA 1ZT7A 3ZZ1A 3BKCL 4QOKB 3RUGA 3WBDA 1MFEH 1KTDB 2A6JA 1OGAD 1T7YA 2YPLB 4KWUA 4P5TB 4YXHH 1UWXK 4L4VA 3EYVB 5C2UB 1SEQH 1E4XL 4DEPB 3HE7A 3QXDB 4EI5D 1CCZA 4KV5F 3GMOA 2ARJB 2Z8SA 4I2XB 3SKMB 4Z7OF 2H32A 5CJOH 1AO7D 1MLCA 3X11A 1PYWA 4WU7B 4WO4D 2O93L 4JHAH 2AK1L 4KTDH 2DQIL 3WCYA 3ZE0E 1SY6H 3Q1SL 5AD0A 5AEAA 2MQCA 1X5HA 1I4FB 3IDGB 3QO1B 1JNHA 1LEIB 3V4PL 3P9LB 3RIAF 4PJ7A 2BOCA 2DWEA 2BMKA 1A3QA 2VLKE 4IBLT 1DEEA 5B8CB 3ULUF 2K1MA 4I4WA 1DSFH 4JM4H 4QGTA 3VWKD 4KMQA 1BZ9A 2PXYA 5BQ7B 4KY1L 1PX4A 3BN3B 4MA3A 4GS7C 5HHOD 3UTTA 5C07D 3DUHA 2QHRL 4G8EB 1SBBA 3ARDD 7FABL 3DVFA 1CFTA 3QCUH 4OGAC 5DT1L 1H3PH 3JV4B 2WWMC 4U1NB 1B9ZA 5C2BL 5FDYA 4EIZC 3VFMB 3OZ9H 2C3GA 1YY9D 5BRZA 1HH6A 3BSZH 3OAYH 1QPPA 3B9KC 4ZFGH 1EO5A 2BX5A 3RUGE 5FYJU 4ZUTB 2BSRB 4L4VE 3ARTA 3TT1H 3SKJL 1U36A 5I6XC 5JQ6L 3PGCB 1CICD 3IXAA 3B3IB 3JVGC 2ZKHL 5KSAC 4OCNC 1YNLL 3G08B 4ZYKB 4NN5B 1WF5A 3E6FA 4PGDA 2A73B 3RKDD 4ZUVA 1IGIL 4HCRA 4YXLH 4O58L 4APQD 2BZDA 1U3HD 1U8PB 3WJJC 2WBWB 5F7WC 2NY5L 4HIIB 5CD3A 5CBAB 1ZANH 2ICCA 1S9WB 4ALAL 3JTTB 3BP6B 4PJ7E 1DQJB 5MEPB 5HI5D 1SYSA 1TETL 2ED9A 4I1NB 1YNTB 4P46B 1CVSC 4I18C 5DRXA 4AJ0A 1ZWIA 1A9BB 1I7TB 5DVMA 2O5ZH 3VD3A 1OOAA 4R8WH 2WLZA 2F54A 1TZHB 1FAKT 4I9WE 5AAWA 1W8NA 4PP2A 3UTTE 2YPVL 1IEAA 1KN2L 4UT9L 4JZJC 3ARBA 4OD1L 5EZOL 4GXUN 2XWJA 1JCKA 2VXTH 3WXWH 1SEBB 3L5XH 1RZKH 3ZYIA 2FBJH 3UDWA 5E9DA 2A0LD 4PRNB 2AS5M 5ECJE 5D72L 3C09B 1OY3B 5E6ID 3G6DL 4HKZB 5TPWL 1S7VA 4LPVA 4X5WA 4CJ1A 4MX7B 5FKPA 3VFWA 5BRZE 3V7MA 3MNVA 5I73C 4JO2H 2JTDA 4FABH 5T3ZD 3FOMB 1NAML 2V2XA 1L0YA 4WTWA 5J12C 1KB5A 3FT4B 2YD1A 3BJ91 4XXCA 1TIUA 5BZDA 4PJXA 3L3JB 4C4KO 2HMIC 1B90A 3VJ6B 1I9JH 4M48L 1Z9SA 4FQ1L 1XR9B 2BNQB 1FFOB 3QEQB 1WVZA 4KK9C 4KUCD 4OZ4A 1WIOA 3IF1B 4BELD 2CDFA 5JO5A 2G75A 2PTUA 5C0EB 3O2VH 4K8RD 4XAWL 2W91A 3F58H 3DX9A 1GAFL 3X3FH 3VXNB 1F11B 3O4LA 3EOBA 4F9PA 3HUJA 4GKZA 3LDBC 4LPWA 2AW2A 1EFQA 2ZOLB 5EUOF 3PUCA 3WDHA 5KSVA 4OGXL 2F54E 3L95B 3CZJA 1H3VA 5INCA 4WI4A 4HXAL 1EIBA 4FQJL 1K4DA 5CEZL 1YEFH 1J8HB 4QYOA 1FNSH 4NNYB 4I5BB 1LVEA 3CDYA 2VKXA 2GT9B 5IMLA 5FHAL 4OM0L 2MQ0A 1IGML 4PFEA 5E9DE 1U2CA 3EYQC 3FT2A 4L3AA 4LU5H 4NM4L 32C2B 4KKAC 4PJ9A 4ORGA 4TSCH 4OFKA 4H1LG 4LL9A 5BOPA 2F53D 4M61B 3T1FB 4KRPB 5ADPL 3V8OA 4N9OB 5DDHA 1IKNC 5FFLA 1YPZA 2JJWA 4FZEH 1EUTA 3D39A 3HPJA 3VXRD 1U8IB 4PRHA 2AXFB 4W70A 4PJXE 5D2LF 1A9EB 3EYOA 4K3DL 1KC5L 5D5MA 3RNKA 1ZHBA 1OAUL 1II4E 1PZ5A 1HILA 3BQUD 3NN8B 4M93B 3C60D 4TUOA 3H3BC 4JB9L 3VXTA 5I8CA 3CFBB 3STLA 5DMGC 3ZE2E 5IM7A 5FOBA 3B5GA 2ATKB 3B8YA 1MIML 3H8NA 5GRUH 3IFLL 1HINH 1UCBH 3OAZK 2WBJD 4X80H 1KB9J 2HG5B 1A6VL 1PJ9A 3P9WB 2PNDA 1ZGLA 1INDH 4HFWB 4D94A 2V5YA 3GI8L 4OFDA 1KF9B 4LSTH 4XCEA 2FX9H 4AMKL 3O4LE 5D7JD 1I1FB 1XR8A 3HUJE 5E7BA 4Q9QL 2HTKC 3WNMA 4J4PA 4WFEE 3N50A 5IVZA 1S9XB 3SDCA 3ABZA 4J3XA 2VZOA 3MJ7B 1JRHI 1KACB 3BDXA 3BMVA 1GC1L 5D7LB 1GYAA 4DGIH 5DGRA 2WIIB 5CD5D 2XV6B 4U7MA 3REWA 1O5DT 5KTEH 5DEGA 3SJVD 1NGYA 2HJKB 3ZE1E 1JHTB 5DD0L 3MLYL 4LSPL 4K71C 4HMCA 2Q8BL 1YPZE 3RWFB 1MCRA 4JZNA 4JRXD 3D39E 4X6EB 5IHUL 3T4AA 4PRHE 3FB8A 5AYUL 1LWRA 4Q0XL 1DVFD 4HSQA 3O4OB 4MJID 1FSKB 5D5ME 43CAB 3HFML 2H32H 4LCWD 4EUPA 3FQXB 3QIBC 4P5KA 4XWGH 4WW2C 3HPLA 4NQTA 3JWDL 5L88H 1F58L 4G8IA 2I9TB 1FFPB 1T21A 4KKBD 4M03A 4BZ1H 3T0EC 4M7LH 2OJEB 4P2QA 1LO0L 4WWKD 5IT2H 4QHLB 3EOYG 5BVPL 4KVCL 1OAZH 1N64L 2E27L 3TIDA 5BO1H 4GBXD 3MXWL 5HI3C 1MCOL 1JP5A 1ND0A 1ED3B 1MAKA 2ICWJ 3OKLB 4MLSA 3QUZB 3QPQD 1CFQA 4ETQA 2VERN 3S35X 2W0PA 5JLZB 4M62H 4NYLA 1Y0LB 1IQDB 1NCWL 3D25B 4WI6A 3ARGA 1RMFL 3TA3C 1CR9L 1XZ0A 2AEPH 1N0XH 4XTRC 4F7MB 1G7MB 4L8SB 4HEPG 3GMPB 5I1HH 1IVLA 3ARED 5AWNH 1U95B 1JMXA 3MNZA 5BV7C 1QOKA 3MCKB 3VCLA 1JGEA 1CDJA 4I13B 3NIDE 4MNGA 4AENA 3UROR 5D1XA 3PV6A 4QY8B 3LV3B 5KBNC 1N3NA 4GG6A 1QFHA 3RY4A 2QR0A 4FG6C 3IYLW 4FXLA 2Y9RT 3MOBL 1CGXA 4DUXA 4HV8B 3NACL 3MV01 1JN6A 1MY7A 4E0RA 3QXAA 4OKVB 4NZRL 5FHBH 1NSNH 3LRSA 3ULUL 1PKOA 4HCRH 1MRFH 1NCCH 4NQCB 4LCIH 4P2QE 5DJ2B 5KVDL 2GJ6B 4MZ3A 5HHMD 5JZ7C 1T04A 4RMRA 1KG0A 1OP9A 1AE6H 3ZDZE 43C9A 5CJQL 2X4UA 4NP4H 3RP1A 3LKPB 1U8HB 4E41B 1FNGA 1FG2A 4U1KA 1WBXB 2X4QB 3S5LA 3TNNB 1K8IB 1UENA 2DTMH 3HMWL 5F7EL 4ENED 3ARUA 4UQ3A 5HPMB 5ACZB 2WM0A 4UTAH 2WANA 3G9VA 3RVXD 3CD4A 1DLFH 4D0CB 4JPWH 5C0CD 4KGLA 4RA3A 4N0YH 4XVTH 3DVGB 2HT2C 2UWEA 3BD3A 3UO1H 3OX8B 3QIUA 1KIPA 2OS7A 4JDVA 4O4YH 2YPKA 3P73B 4JQVC 5JNYA 1JGUL 1J0KA 3QG7H 1DQQB 5HDQL 4O5LL 3L1OH 3TJHD 5T1KB 4LQ1A 1JRHH 2YD9A 3EYSL 2A38A 4LIQE 4MNGE 3ES6A 3HC3L 1D9KD 1KB5H 2IQAA 1FVEB 1QR1B 2ZWLT 4GG6E 1FZKB 5E8OB 4JFHE 4U6XB 3GKZA 3U1SH 3KPPB 4XAKD 2XWTA 1UWEH 3RHWF 3RWJB 4U1GC 1MFBH 2M8XA 1JWUB 2X4NB 4ODXA 1FL3A 1MRCH 1EZVY 4I48A 2QQNL 2YD3A 3DHJA 5J3HD 3C5SB 3RWIA 4ERSH 2B4CH 3MREA 3LD8C 3DX8A 3VDCA 3G5VB 4KJYB 3O8XB 5FYLD 2ATPA 2YN3A 1YY8A 3WFCH 1A0QH 4NRXB 3Q5YA 4S1RL 4PJIF 2ZUQC 1IM9B 4LHUG 4DN3H 1IC5L 2E7MA 5GS2D 4I0KA 5JXED 3MV9D 3VXOB 1NGQL 5T33L 3TM6A 3LZFL 1S9KC 12E8H 4JFPB 1WBZA 3LKOA 3GBNH 1J8KA 1G6VK 1A1OA 2EDKA 1OGTA 3PGDB 2D7MA 2BJMH 1U41A 1AGDB 1YN7A 3MUJA 3HNTH 3MZGB 2P43B 5KW9L 4M6NH 4HZLA 1WFTA 1UEYA 1QRKA 1AI1L 1CBVH 4R0LB 3M07A 4OBSA 4U6TA 1MCNA 1I8MB 4LRNL 2QBWA 1X5ZA 3DUUA 1OGAE 1MH5A 4JR9L 1ZEAH 4JPKL 1F00I 3WV0A 4M8VA 5ICZA 2I24N 3ARWA 5C09B 2FJFA 5B39B 3OKDB 1AR1C 2UZIH 3MRLB 3A6OA 4KUZH 1LK2A 4EQ2A 4GRWE 4Z18A 5HJ3A 1B4RA 5F7HA 3MRBB 3WJLC 2GJZA 3P11L 4ZFFB 1PKQE 1MCBA 3I2CH 2R1WA 2P1YA 3L9RB 2Z31A 2W60B 4PP1C 2DMKA 4DZBB 4KGJA 1G7JB 4DN4L 5HYSG 4XWOC 3T2PA 1BZQK 4FQXC 2P8PA 4D3CL 4NKIH 4HUXB 1BFOB 2JB5H 5JW5A 1KGCD 5DSCA 4ZTPL 5FO8A 3ZKSD 5L2KD 3BZDA 2RJMA 2APFA 4QCIB 4UT6L 3K4DA 4HG4K 3H2WA 4JQXA 1ORSA 2C3VB 4LKXB 1C7TA 1N6UA 5DMKA 4QHMB 3HAEB 3T77A 3BIKA 3C6LD 1AJ7L 2KH2B 2C3WA 1DL7L 2DQDL 4NQSA 5INDB 5ESAA 1NGZB 5L7XH 2A2QT 1ZLSL 2F8VA 5EB9A 1KT2A 1NDGB 3VWJA 3O6FC 5FGCE 5FUCE 4FFVD 2AGJL 2AJ3B 5K9OA 3TBYA 3DROB 1A3LH 1JGDB 4LSUL 3C5ZC 3VRLF 3CAFA 1N5AB 2A1WL 3BPNC 3ZT5A 1DN0B 3QO0B 4PJ8D 1GPOL 4XNZC 1OLLA 1YEJL 1WCBB 5FO7B 4NKOA 4XP6H 1NLDH 3QPXL 2LAAA 5J6GA 3IS1X 1K2DA 2ICEA 1J1OL 4W4OA 3IDJB 3P9MB 4BYHA 1FH5L 3MCLL 5GIRB 2PN5A 4HC1A 3BP4A 3RDTB 4FRWA 4CDGC 4Z5RB 4TYUA 2N7AA 3VGBA 1S5IL 3WO4C 3N1QC 1HXYB 1LP9B 3WL9A 3B2UC 3NAAL 4Z95H 1OL0A 1FDLL 5JR1H 3OL2A 1MIEH 4Y4FB 3O2DA 2R56L 4RMWA 1RUQH 1FQ9C 3TBSB 3O81A 3VXQB 4CVUA 3QUYC 5FGRA 1W0WB 4XBEL 1MHEB 3U0WL 1NFDF 4ELMA 3MFFA 2DQTL 5IP4A 3QXTA 4EUPH 1PX3A 4L3ED 3HE6A 1YN6B 3WIHA 4YIQB 3QG6B 4OZHF 3SOBL 3E3QC 3OKMB 2AV1A 1T0PB 4XNYL 5I1LA 5EUOB 1N4XL 2ORBH 1Q9WB 3S98A 3W81A 2DBJA 1FYTA 1SJHB 1MI5A 4JCLA 1QZ1A 2JJTC 1DLHB 5HBBA 4X4YB 4KK8C 2QL1A 3DX7A 3QFDB 3D0LA 4G6JH 4MB4A 3UTSD 5ITBH 4ODSL 4ODVH 2VR9A 1QYGL 4FQIH 2X1QA 1FC1A 3PWLA 5E2WH 4QTHA 5FYKE 1GIGH 1JZ2A 4PRAA 5ACMA 3D2UD 3ZKMC 4Z0BL 4F15B 3IDNA 5K59E 1QNZL 4MD5A 4LAJH 3VMOA 1ZVYA 2NY3D 3V79C 3CFCL 1RJZB 2NZ9D 3BVNA 4GSDL 3ALPA 3DOSA 2YHGA 4Y4HC 4WHCA 1TTGA 5KANI 1MFAH 4TVPD 3VGAC 2P45B 5EC2A 1AFVL 1G9MC 4NM8H 3RAJH 5F1NB 3MLZL 1JWSB 2F53A 1CF8H 1OPGL 1FVCB 5C0FA 3HZMA 1CDBA 5BJTA 4JDZA 4B5EA 2DIAA 3TO2A 1XCQB 3LN5A 5I9QC 1K4CA 2FEEI 1NMAL 5DLMH 1XF3B 5HGHA 2IAMB 2X70B 2IBBA 3R06B 2E7LC 1QBMH 4LIQH 2OXGA 1Z9LA 5EC1A 1N5YL 4I77H 1R0AL 4UV4L 2F5BH 4TUKL 5ICXA 4M7KL 1FAIL 4HK3N 5EORH 4ELME 2WZPD 5KSBB 2RR3A 3AY4A 2P5EB 2XG5A 3A6CL 3DX6B 4HPYL 4I8DA 3VGHA 3BHBB 3SCMC 3DRQB 3WNKA 3RWEB 4P49A 5HHQA 3O11A 4YDJB 4DOHE 2W9EL 4LSVL 1AP2A 1ZAGA 5B38B 1FYTE 1MI5E 3H9HB 3S3SA 2Y25A 3HG1D 4BQ8A 3A67H 3BEVA 1S7QA 3HB3D 3BUTA 5ANMA 3MXVH 1ZT1A 3OKNB 1FPTH 2CQVA 1MCWM 2HRPH 5E1AB 3UTQA 2UUDH 4N8VB 2V7NB 3RWGA 4G80A 4UAOC 3H3PL 4LCCA 1HCFX 5HI4D 1UQSB 1NDMB 5F1OB 3BPOC 3EO9L 2ARWA 4JHZA 4J6RL 5J9PA 1LQSR 3SJVA 1YEIL 3DYMA 4YAQA 4G6KH 5L6YL 2AJXH 1MREH 2EYSA 2F53E 3DXAD 3TO4D 3ZE0F 2NNAB 2XY2A 5T1LD 5GGTA 2F74B 3IFOA 1G6RL 5DK2A 1JPSL 3FO1B 1NGWA 5EO0B 5CEXA 4Y19D 2WK2A 5EU3A 25C8L 1OVZA 3IGAA 3MODL 5ESVB 2E7BA 1CDYA 4D9RD 3THMH 1PVHA 3OQ3B 3BZEA 2IWGA 4EDWL 4MJIA 3MRNB 4GRWH 4F2MA 2BHYA 1JNLH 3KS0J 2AKRB 4JFED 4G7YL 4DQOL 4LCWA 4OF8A 1YEGL 4FNLL 1FZOA 1FGNL 1R5WB 3GMRB 5TH2B 3GM8A 4XMPH 3VFTA 3QFJA 4RISL 2XFXB 2OTPA 5IV2A 4KXZI 2XTLA 2HKHH 2FD6H 4WV1A 2YPLD 3ULSB 4FQPA 5MEND 1SMOA 3PNWA 3KWWB 5DUPH 1IAIH 2CO7B 1FGVH 2EO9A 3PXHA 3QWQB 1MUJB 1TQBC 2B0SL 5T1DL 1NFIA 1I7UA 2VIRA 5ANME 4XB8A 1BFVH 3QNXB 1WEJL 4PS4L 2CKBB 1RVFL 2EH7H 1LEGA 3I85A 1VKXA 4JM2A 2ADJB 1IT9H 4ZUSB 3LH2H 4EN3A 4DUVA 3R0NA 3FB7B 4XNUL 5MEQB 5EU6D 3SJVE 3OJVC 4X7TA 1MAMH 1DBJH 1NBZB 2MSPA 2O61A 2HFGH 2LVCA 4AEFA 4Z9KB 3C08H 5EOQH 5GS0H 1ZHLA 4J3WA 3SQOH 4WNQA 3INUH 4JRXE 4AH2A 2BOBB 4NUJB 4AIZB 4JDTH 5HSFA 4Y1AD 2F15A 5DK0A 1R3KA 4MD4A 2GAZA 1D7FA 4S2SB 5E8NA 3ILQD 2UZYB 1F4WH 4MJIE 1YYLH 5FGSA 4WCYL 1N6QH 4R9HA 4LCWE 3D85A 3PL6C 1REIA 3LKQB 3QULA 6FABL 3MLRL 4X0KA 5CINH 3BN9D 3ECBA 3QFJE 1BVZA 4U6YB 3SKOA 3BIAX 3GMQA 3MRKA 3QAZB 4JREC 3ZSTA 1MFEL 4QRRD 2ED7A 2AJVH 2C5DC 4U31A 2E8YA 1SEQL 2R15A 1RIVL 2VWEC 4X98A 4KTEL 4PG9A 4R3SA 1OW0C 2PO6C 4ODWA 3VGGA 2M1KA 3F7YB 1C5DA 4KHTH 3WXVL 1ZVSA 3HCVB 4JHAL 1KNOB 4KTDL 3W5NA 5IFJB 4ZXBA 4RMSA 1SY6L 5FYKH 4XNXH 5F7YC 3SE8L 5DD1L 4IMLA 5EA0H 3CUPA 5IF0A 4ONHA 2HVKB 1F4AA 3BKJH 3RKPA 1FVDA 4K7PH 2HVJA 3CU1A 5F9WB 4MNHB 3ILPB 2X7LA 1EGJL 4IRSB 3QUXC 2EECA 5F6IC 1BIHA 3RVWC 2VDNH 1CTOA 2DQEL 3UJJH 3PIQB 4NNPL 3ROLB 5TGBA 1ZLWH 5CCKH 3FQNA 4HC1H 2ICWA 4XPFL 4JCMA 4JM4L 1U8MB 2BDNL 3BKYH 4LSDA 3CC5A 5FA3B 3BZ4B 3WSQH 1PLGH 2DQUL 4EEEA 5E99H 2VDOL 3M17A 5EOTB 1CFNB 3QDJA 4BKLA 5KZCB 4EVNA 1MCDA 2YC1B 3UAJD 3VW3H 3HHRB 4K9EC 1UJTA 3O2DH 3QCUL 5DS8A 1H3PL 4RCAA 4A2LA 3G5XB 1F4XL 4MA7L 1ORQA 3C9NB 2UY7A 2DDQL 4J3SA 5LAXB 5LWYH 1AHWA 3TT3H 1UKTA 2NXYD 3BSZL 1KPUB 4ZFZB 3IJYA 5JPNA 1H5BC 4NZDA 2MHAA 1WFNA 1DQMH 1FFNB 4OZGB 4FFZL 2K7PA 3MLPA 1KLUA 4CMHB 1EEZA 3FAWA 5D1QA 1KIUA 3WYRA 2P49B 4WDIB 4U0QB 3E0GA 2C1OA 5DJ6B 4P2OC 5SWZA 4WY7H 1HN1A 2BNQD 3EAKA 1EJOH 3LN4A 2EZ0C 1KPVB 5I2IB 4M3JA 3U48A 1TENA 4KXZH 1DR9A 2BK8A 2VN4A 5IOPB 4MSWA 1L0XA 4X9BA 2VMFA 1YEEH 3VXUD 5GRWA 4UQ2A 5ICYB 1W72A 1ZANL 2X4SA 3G04B 4TTGA 2ADFH 4HIHA 1HXMB 3BPLC 4QNPF 4RIRA 2NY2C 4N0CD 1G7PA 1Y18B 2GSGB 3WS6C 1LMKA 4MWFB 3ZTJH 2V17H 2O5ZL 2Q76A 1A6AB 3P3YA 5KVEH 3BRDA 3RA7H 3QIWB 2CRZA 2MCPL 2Y6SC 4HWBA 3LPFA 1J8HD 1YMMA 4MDIB 3QDJE 3UJIL 4WUUA 3DPBA 1BVLB 1WFOA 4KKLD 2AJUH 3HUJF 1ACYL 1IEBA 1RZKL 2HLAA 2AXGB 1DQDH 1F4HA 1K5NB 4U6VH 4M43H 5H37H 4LP5A 1KJMA 5EBMA 3RVTD 2RFXB 1XCTA 1JPGB 2FH6A 4JKPH 1SBSH 1OB1B 2FWOB 4JJ5A 4UIKH 2A6IA 1H0DA 2EDTA 5D6CB 5D8JH 1T4KA 3C6LA 3LSOA 4I3SL 5H35B 5ETUB 4EUPG 1MFNA 4H0GA 4PJ5D 4HUWA 4Z7UF 4HHAB 4WW2F 4PJCE 5LQBH 5HHVL 5TQ2L 4EJ1C 3SHSA 4N0UA 1I9JL 2VLRB 5C0AD 3BOVA 3MV9E 5SWZE 1P69B 1TPXB 2VZSA 5T3XL 2BVUA 2GJJA 2R0KL 5EO9B 1T22A 2ICWI 2AJZB 1TVHB 1ZLUK 1L4IA 5SV3A 3CNKA 2Y07H 1YPZF 3QWOA 2I5YH 4PJBA 5F72S 1EXUB 4PGEA 3C8DA 4N0FB 4N90D 1AR2A 3WKMH 5EN2B 4GMSH 4CVZB 4NN6C 2XQYG 2CK2A 4PJHF 5I1JH 5IJKC 4DKAA 4DFHA 3O2VL 4WGVB 9CGTA 3F58L 4BFIB 2NXZD 4FQQB 3X3FL 1ES0A 2YD7A 3DBXB 5IBUG 3PWNA 1CS6A 5DUML 1E4JA 3T65A 1FN4B 5DJ0A 2D7TH 4POZC 1TCRA 3QXVA 1M1SA 5IMMB 8FABA 3EYFA 4ZS6C 4X6FA 3KPTA 1BMGA 3K8LA 2GYSA 2V9QA 2UY6A 5GGTH 1KCSH 1NFDB 2MPAL 3REVA 1TVBA 2ZUXA 2V7HB 5CEZD 2CPCA 2YD6A 1T66C 1YMME 5IQ9A 1WAAF 4IHOB 1VFOA 3OXRB 4KC3B 4WUUE 3RTQA 2IMMA 4JJHA 3RPKA 2XPGA 5D93C 1QRNA 4M1DH 1VGEH 4ZPTA 15C8H 1BWWA 1ZK9A 1A21A 2WUBL 1S7SA 5ENWB 5DHYA 1ZOXA 5CJ8A 1JK8B 5T5FL 5A16A 5IB5B 1RI8A 3QISA 4HH9A 1JL8A 1RUPL 3ULVH 4L29B 4IDJH 4NDMB 1BBDL 3HTLX 3VXPB 5I19H 3UTSA 1F6FB 2KUTA 2VE6B 1BGXH 3TGXA 5AZ2H 3VXSA 1JHLH 4N0UE 5GZND 1TTUA 1IC4H 4LSSH 5E03A 1KLGA 5IMKA 3KYOB 3KYNB 2DN7A 3GUTB 1MJUH 3NCBB 4RAHA 5C70A 4WHTA 1XGPB 2I9LB 4JO4L 1NC4A 1AIFB 2JK5A 2YBRB 4PJBE 4QRTA 2AJSL 3NIDF 5GRUL 1HINL 2X6MA 3IAPA 1S7UB 1C5BH 1F42A 3OKKA 1KLFA 4LAQH 3S5LG 3S88L 1U8JB 3MRDA 3EBAA 4CVXA 4U33A 1FJ1A 3MPCA 3TVMB 1QVOB 4NOBA 4LSTL 5E2UH 3OGOE 4U2ZA 5D1ZB 5DA0B 1B6UA 5C0RL 4F58H 2EDLA 1I8KB 4DK3A 1LEKB 5CKGA 1CD9B 3J8F7 4NCC1 4QEGA 1CE6A 5FF6A 3PGFL 4U1JA 3FL7A 4RQQA 3U9UB 4O02H 4BH8B 5CLTA 2LE9A 4E5XB 3BT2L 4Y4KC 4ZD3H 2WUCH 1QRNE 4JFXA 4FQLH 4HWZA 5KTEL 3HRZB 3O2WH 5DJZA 1Z0MA 4P23D 5E4IA 5MHSE 2FEDD 3QDAA 5BXFB 1XT5A 1XFPA 4JFZH 2WIMA 5DVNA 1V7NL 5CILH 3LKSB 1A7OH 2PTTB 1JTTA 1PEZA 3RY5A 3UTSE 2FL5A 1DEDA 3VRJB 1ZKAA 2GUOA 4MCYA 5F89A 2R2HA 3BXNB 3IDYC 5H8DA 5E6YA 3VXSE 3B6SA 2VDLH 3SO3C 3RFZC 5F9OH 3MMEA 4N1EA 3VD4A 3PV7A 3IDIA 3RI5K 4GS7B 5GRVL 1AKJB 3QZWA 4WFHE 5DRWB 4G8GA 5FCUH 1BZ7B 3MO1B 4GUPB 3S8WA 4M7LL 4MVBD 4TVPE 5DFTA 3HA0A 2EICA 5C9JB 1RZIA 5B21A 4WJ5A 1A6TB 1CXFA 3HI5H 5CIPA 3HNVL 4KZDH 1GZQB 3DXAA 4E41D 3ARZA 1X6LA 4P2RB 4R4BA 3S6CA 1JJUA 4MJ6A 4FQ2H 1LO3H 3L3HA 4JGMA 1HHJB 1VEPA 4QRQA 4RX4D 2VLJB 3L5WB 4LLAA 3B9KB 1OTUC 4OAWA 3T0AA 3P4NB 2F5AL 4F9LA 4M62L 3VXMA 2BVPA 2FO4A 3RX5A 4BK4A 3WLBB 4R7NB 5I6XB 4UUJA 4CN4A 4E42A 4PLNC 4OV5B 2GY5A 4OB5H 3UC0H 1KELH 1EBAA 5KSAB 4IOFD 3UX9B 4X5LA 4ODTL 2EYRB 1FIEA 2ZCHL 2X10A 1FIGH 3WLWD 5LXGL 4D8PB 4QOKA 3N9GL 5IVNA 1KTDA 3MA9H 2YPLA 4P5TA 1IC7H 5KANG 4MS8D 3EYVA 1S5HB 4Y5XC 4YGAB 3QXDA 4N0RA 5EPMB 4NQVB 2ARJA 1M4KA 3HG1E 4I2XA 3SKMA 1E28B 4IRJD 4WU7A 2UWEF 4HW6A 1KV3A 4I18B 4TRPL 4IEFB 5LGHL 4HPOL 1HWHB 1O7VA 5FGBC 2HLFC 1I4FA 3IDGA 3PP4L 3QO1A 1V3JA 1NSNL 1JYVA 3H9SB 4XCFL 5T1MB 1LEIA 3KPSD 3P9LA 4GRWF 4HCRL 4AL8L 4JZJB 2XKUA 4OCXH 4HT1H 1W72H 3BH8B 1NCTA 5B8CA 4G6AC 3DXAE 4X83A 3VI3E 1AE6L 1ADQL 1IM9D 3CFIC 1P9MA 4JO1L 4NP4L 4XP9H 1AGFB 5BQ7A 2EEDA 5CUSH 5I73B 3DTXB 4MNQB 1AXTH 2DTML 4G8EA 4D9RE 2R1YB 5GGVH 4LEOB 2P48B 5J12B 3JV4A 3VDBA 5E8PB 4U1NA 3TZVC 4HWBH 4S1DD 1DLFL 1KBGL 1CGSL 4JPWL 5HYJD 3IJHB 3QQ4B 2X89D 3VFMA 3LQZB 1J12A 2NY4B 5J11C 1GL4B 5F9DC 4ZOCA 3LPGA 5C08D 3PDOB 3PHQB 4QOKE 3MLSH 3Q2CA 5IGXH 2P24B 3V7AE 2PW1B 4ZUTA 2YPLE 2BSRA 3MLWL 4J8RB 5J8OA 4O2EB 3L1OL 1QACA 3PGCA 3DGGB 4OLUH 2R9HD 3QEUB 4R7DB 1F90L 3B3IA 4PRBB 1SM3H 5HGDB 1TJHL 2BY0A 1KB5L 4XP4H 4ZTOH 3K8MA 5SV4A 3K8KA 3G08A 4ZYKA 3LDBB 1OP3K 3SQBA 5I8KH 3QQ9D 2A73A 1U6AL 3IETB 1U8PA 4HIIA 3WIFB 5LKNA 1QLEH 1RIHH 5CBAA 1S9WA 1HZHL 1MRCL 1YUHB 4Y2DD 2NTFB 3JTTA 3BP6A 5FUOL 1DQJA 5MEPA 4FFWD 2FB4H 1RK1B 1YNTA 5E8DH 2B4CL 2XOTA 4P46A 1CD0A 3SY0B 4JO3H 4JVPA 1PD6A 4YUEH 1KUMA 5JORB 1CL7I 3BGFC 1A9BA 1I7TA 5CEYB 1A0QL 2JELH 1PG7H 1LE5A 2XKNB 1F6AB 1BQHB 4XVUC 1TZHA 4P3CH 4YX2H 4DN3L 1S78D 5GISH 4PLJC 3IFNH 3ALWA 5IVXE 3NZ8B 4PRPB 3K81A 1OARH 1SEBA 2AV7B 3FFDB 4NRYB 4BSJA 3U0PB 1RIUH 1QFWI 3BZFB 4PRNA 3QDGD 3HNTL 5HGBB 3EJYD 2H2PC 1HOCB 2H3NB 3V95A 4HKZA 1HK6A 5C0BB 4WW1B 1AY1H 2Y5TB 3MBED 4MX7A 5IMOB 4NC2B 3RDTD 4YDIH 1CBVL 3LIZH 2ESVB 1UVQB 3FOMA 5IB2B 1E27B 3MR9B 2FIRT 4QRRE 1NLBH 3A6BH 1ZEAL 3FT4A 5H37G 3NZHH 1NBQA 1NFKA 3CZFB 3L3JA 2UZIL 3VJ6A 3X3GH 1EMTH 3P4OB 1XR9A 1KN4H 3I2CL 2BNQA 1FFOA 3EJZD 3GSVB 1WITA 3QEQA 4BZ2H 1H15B 4U05A 4DFIA 4QHNB 4NKIL 1IL1B 2IG2H 3IF1A 1WT5C 2XN9B 1EEQA 3RWDB 3OPZH 3ARSA 5C0EA 2E6QA 4RBPH 2Q6WB 1P1ZB 1I3GH 3D5OF 3D87B 3VXNA 4ZDHB 1F11A 5HY9B 3SE9L 2ZNXA 1IFHH 2ZOLA 5IW6B 4FP8L 1CFSB 2BNRB 1NMCC 3L95A 1C12B 1EH9A 5BV7L 4GQPH 3MACH 3KXFB 3UPCA 1FO0L 4F7PB 1J8HA 2ZG2A 4PJEE 3EFFB 2ILLA 4I5BA 4NNYA 1QBLH 4X4XB 1F8TH 3I9GL 2GT9A 2R0ZH 1EAPB 3E8UL 5GJTL 3FJTA 4XP6L 2MQ3A 1IGJB 4F33B 3O9WC 32C2A 2YUWA 3CDGB 3QB7C 4KMTH 5LBSL 4H5SB 2MCG1 4M61A 3T1FA 3ARFC 2VC2H 3QIBB 4Z7UB 1D6VH 4WW2B 5F7LB 5CBEA 1VERA 1HQRB 3JBG7 1X5AA 1UM5H 1U8IA 4XP1H 3D9AL 3IRPX 1CFVH 2AXFA 3T0EB 2OL3L 2BVOB 1A9EA 1MIEL 1NUNB 4TNVK 3TBWB 1XIWC 4CNIB 5C86A 2JCCF 1RUQL 2CRYA 3NN8A 4HJ0C 3CFBA 4RFNB 2BNQE 4JG0L 1E4KA 2Y5EA 4PJHB 3C87A 2ATKA 1AC6A 1JV5B 1KCVL 2P5ED 4K3JL 2Y36H 1VENA 4R97B 1J0HA 3QH3B 3NA9H 1U0QA 2HG5A 3VXUE 2DOCA 1IARB 1OAQL 1HIML 1T5WB 4HFWA 4J7RA 1TTFA 3OV6A 1LHZA 2ORBL 3TA3B 1I1FA 2B1HH 3RZCC 3MV8B 1DBAH 3L3OB 4JE4B 4YBHA 4G6JL 3N0PB 5CIPH 4P59H 4ODVL 1S9XA 2E5EA 3MJ7A 5BV7B 5D7LA 1GIGL 4WEMB 4YHLH 3OKEA 4A2MA 5IB3B 1J8HE 1FO0B 3S97C 3QI9D 1MPAH 3R8BB 2WIIA 2ED8A 3SDYL 3V9FA 1CU4H 2DKUA 3V8CA 2NY6C 6CGTA 4XNQB 1T0NB 1GGIH 4JG1H 3LRHA 5HYEA 1SVCP 4TNVF 2HJKA 3K2UH 1CL7H 2XIDA 4GRMB 1JHTA 1MFAL 4Z6AT 1ZT4B 4F57H 1R6VA 1T1WB 3W9EB 2LAGB 1LE9B 1OAYH 2J4WH 1A02N 4UTBL 3RWFA 3VE0B 1SQ2N 3FQUB 4X6EA 4YH6A 4PGZA 4XNMB 3VFGL 4EI5C 5DLML 4PJ5E 2OL3B 1DUZB 3WFBH 1IE5A 43CAA 4LPCA 1I7ZB 3N85H 1QFWH 4Y16D 1LNUB 4WO4C 5BW7A 5IROA 1WIPA 4I77L 4NUGH 3BKMH 3FQTB 4M6ML 4C56D 2I9TA 5I1DB 3JUZA 3MJ6A 2GTWB 1FFPA 5ISZB 3CGTA 4XPHH 3GI9H 3TN0D 2OJEA 4KI5E 1KCRL 1CGYA 4QHLA 1N8ZB 1U8LB 2ITDB 5I75C 4KROD 4P2CG 5JDSB 4ELKB 4PV9B 5FK9B 3O0RL 1U8OB 1ED3A 4NZUH 3OKLA 1TXKA 2HKFH 3QUZA 4KZEH 4YZFF 5J0BA 3A67L 2F58H 3VWKC 3B2VL 5FUCC 2QTEA 3KHQA 3CDCA 4K2UH 5JLZA 1KULA 3DO3A 3MLVH 1Y0LA 2J88H 2FECI 4AIOA 1IQDA 4N8PA 5ADOL 1IKFL 3D25A 3ULVF 3ARDC 5JHDB 1ZHKB 1NEZB 5DO2D 2PYED 4FOMA 4XMKH 4M6AA 2VISB 4MXWH 4WVRA 2R4SH 1VFAB 4F7MA 1G7MA 4L8SA 3GMPA 3VA6A 4XVSH 2XICA 1NUGA 1KEML 1YY9C 4ZPVB 2JIXB 4G6KL 1U95A 4IMKC 1KJVB 5SX5K 5DK3A 4U1GB 5I8OL 3MCKA 4ZOEA 5B3JF 5TJWK 1CLCA 2H41A 3BKCH 3K2MC 4JM2F 2IPUK 4P4KD 3LV3A 2IFGA 1CICC 4MQXD 3FO9B 3LD8B 2IBGA 1PGRB 3BIBX 5FEBA 1LK3L 3CSPA 4YDVB 1JNLL 4HV8A 4OSUL 1CT8B 5TF1L 1OF2B 2ZUQB 3RKDC 4OKVA 2VKWA 4APQC 2DQIH 1U3HC 4JRYD 1K85A 2DRUA 2B1AL 4NQCA 2BVYA 5DJ2A 1NCAL 2GJ6A 5DEZA 4OUUB 5EU4B 4RSVA 4LPUA 1YNKL 2Z93B 5HI5C 4P48A 3GKWH 1M05B 1OD7A 1OSPH 3FMGH 3QDMB 5GGRY 1U8HA 2EE3A 3LKPA 4E41A 3OJMB 3IB4A 1G84A 3RGVD 3T3PE 3S3JA 1WBXA 2X4QA 3TNNA 1K8IA 3W0WB 5HPMA 5ACZA 1Z2KA 2D0HA 4D0CA 4GKOA 4AEIH 1N59B 1J7VR 1AD9B 1F13A 2R4RL 3DECA 5IBTH 3GEWB 7FABH 3DVGA 5MEOB 2A0LC 3OX8A 5E2JA 5DT1H 4G6FD 4QXGL 1EFXD 5C2BH 5E6IC 3P73A 5DC9B 3OGCB 4NPYB 4FQXB 1DJSA 2HFGL 3FZUD 1DQQA 1J10A 4HGWB 5EOQL 3C08L 5T1KA 5GS0L 3ZDXF 5ALBL 1H8SA 1FVEA 1QR1A 1F3JB 1G7IB 3SKJH 1A7QH 1FZKA 5E8OA 2EIZB 5JQ6H 2DIBA