4MSWB

Y78 ester mutant of kcsa in high k+
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
publication title Using protein backbone mutagenesis to dissect the link between ion occupancy and C-type inactivation in K+ channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 54
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2013-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mswB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mswB01
1A3LL 1G6RA 4FTVD 25C8L 1R3IL 4K71B 1UEMA 3AREA 3QUKA 5BV7H 1EHAA 5E2JA 3MCG1 2X1PA 2Z31D 1HILB 4AIOA 2L7UA 3VFWA 2CD0A 5IMOA 2FEDC 2X05A 5L6YH 3HG1D 3IJSB 2WUBH 4DWHA 2W9DH 3CSYB 4NBXB 2BSTA 3C9NA 5L2KD 3SKMB 4X9IA 1UENA 1RIUL 1ZVSA 4GKOA 5TH2A 1QFWH 3SPVB 5D7LE 5HGHA 3B2VL 4ZOBA 3GMMA 4MXQC 2FHBA 2C1PB 5C0AB 3MRHB 3VXMB 3QEGH 1JPGB 5I15H 1KTDB 1QNZH 1DBBH 1TDQA 4FZ8L 4PV8A 5EU6B 2AI0L 2QBWA 3QUYB 5D7JB 3BO8A 3PWPD 3PV6B 4YPJA 1IVLA 3DUHA 4Y4FA 3L5IA 1IAMA 1RZ8A 2BVYA 3EYFA 3NBNA 3MFGB 4LPVA 3MLYH 3H42H 3W2DL 4PY7B 3OSKA 3H9SE 4P48A 3FTGB 2YEZA 5DEZA 2P44B 3LN9A 5E94A 1A7PH 3ZE2F 2WBWB 1JTTA 3S5LA 1M7IA 1DJSA 3ECBA 1KJ3L 1A4JB 3QSKB 1SEQH 5IFJA 3MRNA 3VWKD 1YEFH 1E27B 3HE6A 4KJYA 3SE4C 5F8QC 3V4VL 1AXSA 3SE8H 4JM4L 2NY5H 3D39B 4ZD3H 3JV6B 1CFQB 5DK0B 3V6FB 4X4MA 2GIYA 1ZGLP 5DD5H 2EYTB 1J87A 4UDUB 2IH1B 1FNGB 2H1PL 3VXUA 3TF7C 5F3HA 1EGJH 3NFSL 4JE4B 4TSCL 5L8LB 2CKNA 3MGAA 1ADQH 3EO0B 5EFIB 1KLFA 3IAGC 3FFCE 4IRJA 5JNYB 2VLJB 1VEOA 3OXRA 1WIOA 3R0NA 4KK6D 3O9WC 4DCQA 3QUMH 5DHVA 2XWJB 4XWGH 4O58H 4HJGB 5T5NF 4KZDL 3FN9A 2DOCA 3H0TA 4P3DA 2NCMA 2RB8A 1DQJA 1H8NA 4Z78A 3S37X 2ZUXA 4HKBB 5IVXF 1PKQE 1YMMA 3EGSA 1UWXK 2IH3B 1ZA6B 2BSSB 3B9AA 5E5RB 4GG8A 2R0WL 3I50H 43C9A 1VPOL 3LQZA 2W60B 1QO3B 4E5XB 3QUZC 5C0BD 1OAXH 2GT9B 2FGWH 5FK9A 1Q9OA 2CRYA 1FJ1A 4R7DA 2QSQA 5L7XH 4QHUA 4YHPB 3TIDB 1JHTB 1JPTH 2K3TA 4HIHB 5EZOL 3STZB 1JYNA 1T04A 2LAGB 4LOUC 1G6RL 1JZ3A 4P5TA 5KS9F 5IBUG 1DBKL 4XC1H 1Z0NA 3C6SB 4TSBL 2ADGB 3MRGA 1MCCA 4G6MH 5FGBA 3VFSB 4LVOC 4Y4HD 3CIQA 3QB7C 2A6DB 4HWUA 3HR5A 1MCPL 3B2UD 5DFWH 5EOTB 1HXYA 4TTGA 4D8PA 4JGUA 4U1JB 3C2SA 3IDMA 4UILH 3OX8B 4UTAH 2DLFL 1XGTB 1PZ5B 5D7IB 1BZ9B 5T3ZL 2AK1H 3U36A 3T4AA 5EZJB 3O8XD 1U8LB 3FFCD 3GB7B 2W0LA 5CGMA 1Q9LA 4AQ1B 4Z7UE 2X4SA 1ZXQA 4XPAH 1SJEA 2ADJB 5E24E 4M9PA 4OZ4A 2Z8SA 1WZLA 2OX5A 3QUMB 3FO9B 4GAYB 2V9QA 2OR9H 4RFEA 2IQ9L 1ZA3A 4R7NA 3O11A 3TV3H 4R4NC 3DYOA 2RCSH 5DEGB 4KK5D 2UZYB 2YC1B 3FRUB 4KK9C 5JIIA 3QIUA 3VFOB 4I9WD 2YS4A 1RZGB 2E7LC 1G7QA 4F33A 2F5BL 5JHDA 2PYEB 5C0IA 3BUYA 3ELAT 3GI9H 4XHJC 4IOFC 3W0WB 4MXWH 3U9UB 4HUVB 5J3HC 4NNYA 5T1KA 1S7SA 2P5EB 4HJJL 3VMNA 4MQSB 3TT1H 5DZLA 4EDXB 4RMUA 5LXGH 3FN0H 4PJCB 1RMFH 3MUY1 1UGNA 2DJ4A 5CIPH 5J11B 1QFWI 1RVFH 4OLEA 2QQLH 5KAQF 2NY3B 4M7LT 1RFDL 4ETQB 4U1LA 4U31A 1CDCA 2G60H 5ESQA 2MQ3A 5IW6B 5C2UB 4R90L 4NZTH 3RVXD 2A1WH 5D9SB 3VA6A 4F2MA 1A5FL 1FNEB 4PJFE 4KHXH 2OK0H 4MD0B 1HOCB 1H5BC 3NIFF 2ICWB 2HTLD 5I18L 2R1WA 4CN1A 4F58H 1W8NA 5ALBH 3F7QA 1INDH 4MA8H 1MCRA 4RISH 2GFBA 1KIQA 3AROA 4ZUVA 1IM3B 4O5LH 4U1HA 1N7ML 5GGSB 1LE5A 2OXHA 1HH6B 1AKJB 5JW3H 4LSSL 5EBWA 1IEBB 4TULL 3WHE1 1FZOA 3QI9A 4X8JB 4HD9A 4ISVB 4EI5C 3QNXB 3LS5H 5F1SA 2OJZH 3DX9A 1UM6H 5EUOF 2A9NL 2F9BT 1YEHH 4OJFH 2YK1L 5CHNB 4X7FC 4GT7A 1HH9A 1IGFL 3BH9B 3M07A 4YHKL 5DMYA 5DT1H 5IMMA 5F7NC 4GRWH 3K7UA 2BNQE 4R8WL 3HZYA 1E28B 3NCBB 4L5FH 1AC6A 2LVEA 2D0FA 5FXCH 4L8BA 4YE4H 1ES0B 4LSPH 4PBVC 1J1XL 5FYKU 5CIPB 4QRQA 4DKAA 4P2RE 1FNAA 1VGEH 4ERSL 1YY8B 4DZ8B 5J13C 4K7PL 1JZ5A 5ID1A 1FRGL 2VIRB 5EU5B 1EFXB 4XCNB 3BX7C 5DQJA 4KJQC 3CJJA 3BW9A 5FIEA 3AREC 1NMAL 5FYKD 3QHZH 3TBWA 4KDTA 2JB6A 1FP5A 2JJWA 4TNWF 3GGWB 4NKIL 1A3LH 4PJXE 1UH2A 3B8SA 5EWIH 4JKKA 5DMGC 3S35L 3NCJH 4UOW1 1R3IH 1NBVH 1PKOA 1BVKA 1PY9A 2G75B 1KPRB 1KC5L 5I66B 1Q0YL 2VWEC 4UINL 4XT1C 4JCMA 1PJ9A 5DI8A 3C5ZD 2M1KA 1HHHA 2C9AA 1ZWIA 5KOVC 4Z7WE 5I8EA 12E8L 3L3JA 1JGLL 1NL0L 2AKRB 5JQHC 2CIIA 1S9VA 3HS0A 3KPSE 4QRSA 3HAEA 1LK3L 2XI9A 5DA0B 1PAMA 4GRWB 5F7WC 5JW4Q 3MRCA 4ZFZA 5TGBB 4ONOA 3S36L 3VXOA 3FJTA 2Z8RA 4Y4FC 2AI0H 1QZ1A 3MJ6A 3QUZB 5IESL 4PTUB 4U33A 1U58A 4QOKB 1WTLA 4HIJA 1FLTX 1VACA 5HD8D 1IKFH 3QXDA 4AL8L 2VH5H 1CZ8L 1X5GA 5EOCH 2H6PA 4NKOB 1ZLWK 1QFUL 4LVOB 4XI5C 2HLFC 1J8HA 1BPVA 1KCRL 4NRYA 1ZHKB 1TFHA 3LKPB 4X4ZA 5DJYA 2ADIB 4GRLC 5IB4B 1KJ3H 5BVPL 2UWEE 3MJ7A 2W38A 1ODAA 3V4VH 1IAOB 4P5MB 5E2VL 4IRJC 1AQDA 4F9LA 4PR5A 4OD2A 4EUPG 1CR9L 5F8RC 3RL1B 4FHBD 5IROA 3T0EE 2JJVA 4TN9A 3EYQD 5IHZB 4WI3A 4XRCA 3RVWD 4OFPA 4RAVB 2PYFB 3L3OA 5EOQL 2CSPA 3QWQB 4D2NA 4N5EC 1U8QB 5C08B 4FQQA 4LCIH 4OKVA 3HRZB 4KZDH 2DMCA 1XF5A 3U2SB 1WWAX 4QXGL 2NW2A 1SM3L 4Q9QL 3V6OC 3DV6A 1ZANL 3DMMD 4WHYG 1A02N 1IAKA 1PG7W 2EZ0D 2R2EB 3UTTD 5CZVL 4NYLB 3B5TA 4YHNB 4P3WA 3UPCA 1E0OB 3D5OF 2XFXB 1F90L 3SDCA 2D4FA 1BFOB 2R0WH 3HE7A 1LO0L 5GGVY 4DVRH 1NEUA 2V5MA 4NQCE 4QRPB 4U6XB 3U4AA 1VPOH 4ONHB 5B4MD 4P5TC 4L4JA 1KBGL 3MOQA 4U6VL 3VFVA 5FGBC 1EFQA 4D9LL 1VA9A 5C09A 2YOCA 3SJVA 1G6RH 1UCBL 4LHUA 4TUOB 3KHQA 3VWJA 5I71C 1DBKH 5D72H 5GJSH 1H5BB 3IXTB 1BF2A 4R6UA 1BF8A 1ZLSL 3SKOB 4HWZB 2XWBB 3TFKD 1DBAL 3RWHA 4ZO7A 3WNOA 4GG6E 1X5JA 3FMGH 3T0ED 5TFSH 2VKWA 4K3EH 4HKZB 4WGVB 2IBGA 2AJYH 3QEQB 4ZUUB 1KXTB 4NRXA 1MUJB 1BOGA 2R0KL 3SDAD 1SYVB 4P2QE 1JRHI 1QFWM 2HJLA 2VUOA 2KKQA 4EI5B 1T03L 2NMSA 4HZLA 2DQJH 4Z0XB 3WEXB 5MEOB 4LFHG 2AEPL 1TVBA 3VG9C 1N5AB 1Z6JT 3NFNB 5ENWB 3QIUC 4B7LA 2QHLA 4S0TD 4F7TB 4U1IA 5HYSA 1EEZB 2R2BB 2YD3A 2NY2D 1PLGL 4N0YH 4NQDA 2EDYA 4PJIE 2QL1A 1A1MB 1NCTA 1KNOB 2YUWA 4OM1L 3TBTA 3V4PL 3BRGC 2YD5A 4U6TA 2DLGA 1IZKA 3KPNA 3BPOC 2MKWA 3QCTL 4IRSD 4NQCD 4JFDD 2RBLA 4H0HB 4JO3L 4S0SD 4MQXD 2DLEA 1AP2B 3RWCB 2F5BH 4Z76A 5LCVL 3BT2H 3S34L 3QQ9C 1T5WB 1NBZA 4Z5RA 5J13B 2XTLA 1ZT7A 3GIZH 4JDVA 4J23A 1A47A 4DGYL 1HHGA 2J7LA 1G6RB 1WJ3A 3MV8E 1ZLVH 5IOPA 3TT3L 3AREB 4IBLT 3QUKB 1RFDH 3MRFA 5HDQL 3VFWB 4PYGA 1CTNA 5IMOB 1QQDA 1A5FH 3QDAA 2X4NA 4OBRA 5EN2A 3U7AA 5IHLB 2GW5A 4NQXA 2A6KA 2VABA 5EUKA 3O3AA 1IMHC 2BSTB 3C9NB 5I18H 2NXYC 5D7IF 1PSKL 4JFPA 1TIUA 1ZVSB 1A7BA 4P2QD 3K74B 4HUKB 3IDGA 5TH2B 4WHDA 5HGHB 3OWEA 3GMMB 4M00A 2R0ZL 3GKZA 3SE9L 5IK3A 5D8JH 5D1XD 4PGZA 3KLDA 4PV8B 2Y9RT 1J1PL 4JQVA 1X44A 4X80H 3GSWA 3P11H 3BO8B 1YJDL 4R4BA 2B0SL 2EIEA 4JKPL 1JVKA 1UH3A 5D7SL 4Y4FB 1IGFH 4YHKH 5IEKA 5SWZA 1RZ8B 3EYFB 5ESAA 5HHNA 1ZTXL 3DSFL 1U8MA 4R8WH 2WIIA 1KENL 2YEZB 1MVUB 3JV0A 5EORH 3RWDA 2BCKB 2R1XA 1INEL 5E94B 3HN3A 3S5LB 3RHWF 4LQFH 4F7CA 5DHXB 1M7IB 1NMBH 1T1XA 2JIXD 3ECBB 1ND0A 1LE9A 3MV8D 5IFJB 4PJCF 2OS7A 1T7XA 3MRNB 3ZTJH 1M7DA 3HE6B 4KJYB 2X9WA 1AXSB 5CJXA 1GC1H 2D7OA 4CNIA 3O6FD 4HIXL 2H2PC 2AABH 3DYMA 4PJAF 1CDIA 3GMPA 5CCKL 2PETA 3VXUB 5F3HB 1LEKA 4NKMA 2HVKA 1T7VA 3Q0HA 4IRJB 5HHVL 3OXRB 1FL3A 2DAVA 1KB9K 4JFZL 4ODVL 4DCQB 1A4KA 1J18A 5DHVB 4R0LC 1QFHA 3WDIA 2IGFL 3IT8D 2E8YA 3H0TB 4MGXA 4P3DB 1DQJB 4UQ2A 3BQUD 4Z78B 4UINH 1CDYA 1UH4A 4OFYD 2P24A 2CJUL 1YMMB 5FAAA 3EGSB 4TPRH 2ZOKA 4J1UA 5D7KD 3T3MF 3BKML 4GG8B 3ARFD 1NL0H 5AZEL 2A0LD 43C9B 2VKXA 2HT4D 1D9KA 3LQZB 4M6AA 4ZDHA 5DD1H 2P5WE 4Q6YA 3F8UB 1LK3H 4B7IA 5FK9B 1JWMA 1Q9OB 2ADFL 2VNCA 1FJ1B 4NFDA 4R7DB 1OWRM 4QHUB 4G6KL 3BZDA 3WKMH 1T04B 3S36H 4U1GC 4AEIH 4P5TB 3DI2B 1B2WH 3PQYE 3DHMA 3LN4A 2FDBP 3MRGB 5IESH 1E4XH 4PLJD 4YHLH 4XPFL 3GMQA 2EDKA 1AGEA 3HR5B 5T1LD 1CZ8H 5F97E 2VRAA 1HXYB 4XP6L 4D8PB 5I71B 3AY4A 3RTQC 3IDMB 2ZKHH 1ZV5A 2Q7YB 1IGCH 1QFUH 4JLRA 3U36B 3T4AB 4P46D 2M2DA 4L3EA 5FKAA 1Q9LB 5FYLD 4F9LC 2HT3D 2X4SB 1PDKA 1SJEB 5IROC 2F19L 1C8PA 3O3DB 3RGHA 2V17L 4RFEB 1J9CT 1NCCL 5E2VH 1ZA3B 3QAZC 2VZ3A 3P9WB 3O11B 4M7ZC 3IRZA 4R7NB 4V1DA 5SX4I 1FFOA 4HH8A 2VOTA 3UO1H 5F9JA 2PXYD 4PJHA 4O00A 2V5TA 3QIUB 3X3GL 5DFVC 2HTKC 5EOQH 2P5WD 4NC1C 1G7QB 4F33B 3EYUL 3RDTD 2WINA 5C0IB 5JHDB 1OAKH 3BUYB 4WUUE 1QRND 3H2WA 4XNMA 4XX1G 4W81A 5T1KB 1S7SB 3SDXA 3BPOB 2X1XR 3SDCC 1GRWA 4F7MA 3HE7C 4QXGH 1SM3H 1YJDC 4OKDA 4GRWF 1ZEAH 4JPKL 3P0VH 5TE7H 5FB8A 3PQYD 2QQKL 2GHWB 5DMKA 5HHME 2VSCA 3UJIL 1F90H 3MLTA 4U1LB 5ESQB 4LU5H 1NGPH 1BECA 2J8UA 3GJFH 3MYJA 4GKZA 5HVWA 4F2MB 1II4E 1FNLA 3WBDA 5DJZA 1BFVL 1N4XL 3SDDA 3VWJC 1LEIA 4ODUA 3BEVA 3LRSA 2GTWB 4HLJA 3U6RA 4D9LH 4HAGA 2DQUH 4GW4A 3MV9E 3QIBD 5EU7E 1PG7L 1VERA 2GFBB 5GJTL 5K93A 1KIQB 3THMH 2HG5A 4ZUVB 3MLZH 4U1HB 2IPTL 3NPSC 1NCUA 2NXYB 1EZVX 4U7MA 1LE5B 1DBAH 1I9RH 2CRMA 5EZIL 4WW1A 4P2CG 4K94L 5EBWB 1FZOB 3QI9B 1KTLA 2KH2B 4G8GA 5BXFA 5L0QC 2YPLA 1MAMH 3DX9B 1P84K 2R0KH 2UZXB 1J5OL 1CDHA 1HH9B 3FQWA 3HAEH 1QACA 1JN6A 5DA4A 5IMMB 1Z9SA 4DUWA 1T03H 5T5FH 3L3IA 4WUUD 5F71A 4MJ2A 4MAUL 3KYAA 2AAVA 3HZYB 1UYWH 1H3PH 3VXRE 3OKOA 4PJ9D 3C09C 4XPBL 4MNQE 3WSQL 3I6GA 3UEZA 3G6DL 5DQ9A 4PBWD 3ULVL 4HMDA 4ZYKA 2D0HA 5AWNL 2E7CA 1G7IA 3MQIA 2KQNA 3V4PH 2UZIL 1FZKA 3AAZA 1GJIA 2APWA 5ID1B 4Y2OA 5DQJB 1FH5L 4XWOD 1YN6A 3BW9B 3TBWB 4JN2A 1A9EA 3RIAK 2IADA 4K23L 2JB6B 4QXWA 4JY5H 3MV9D 4X6DE 1GOGA 3WIHA 2IFGA 1UJTA 5I6XC 4LP4A 1XIWD 3N9GH 3TJEL 5I1EL 1BVKB 3TT3H 2F54A 3I3DA 5HDQH 5CUSH 1DSFL 4NKQB 4JO1L 4UU9A 1S3KL 2NZ9C 1NFKA 1JBJA 2VDML 4JQIL 5DI8B 4UDTA 1HHHB 4R0LB 1ZWIB 4X6CA 3B5HA 1E4XI 1LILA 1TXKA 3L3JB 3MGOA 5I8EB 3WNNA 1RURH 1MCQA 2CIIB 4FQ2L 1S9VB 2DD8L 3HS0B 4QRSB 1MIMH 4ZODA 4JQVC 3HAEB 5JORA 1B3JA 2OR7A 3AXLA 3MRCB 3SE9H 4ZFZB 3VXOB 5I8OL 2DB8A 1I1AD 1LO2H 1J1PH 3K2UL 1CXIA 2XZCL 4JRYA 1LD9A 1U58B 1KPUA 3OB0H 4HIJB 3UJTH 1FZMA 1VACB 2IEPA 3QXDB 4A6YH 4U1GB 5D7SH 3PE9A 5DJDA 2H6PB 1F4YL 1ZTXH 1WF5A 3PP4H 2GITA 3Q2CA 4M3KB 1EEUA 5CKAA 1KENH 5E9DD 1J8HB 3K4DA 1MCIA 4NRYB 5CJXC 4YDIL 1LP9E 5DJYB 5HHOE 3RVTD 2AJXL 1DN0A 1VKXA 2V2WA 4WFHE 4YPGA 2AXGA 1IZJA 3MJ7B 1MCOH 3LN5A 3FRPA 1T1WA 3RQ3A 5IG7A 1AQDB 4DTGL 2A83A 4PR5B 5D4QA 4HIXH 1DEEA 1IC4L 1MFDL 1NMCC 4G8EA 4OD2B 5CCKH 4M1DL 4OZHF 3MLSL 2D3VA 2F5AH 5HI3C 4XRCB 1X5KA 3OJVC 4Q9RL 4WCYL 3VI3F 3QAZB 4M7ZB 2LQRA 5IUSA 3L3OB 4P2OD 4ODVH 2ZP0T 5GGUA 3HZMA 4FQQB 4F80A 4K94C 2IGFH 4OKVB 1FZJA 1KYOK 4YXHH 4JFYA 1XF5B 3VXSE 2NW2B 1A8JH 1MCEA 3DV6B 1D9KC 1IAKB 2CJUH 5K9QG 5F96L 1XF2A 2IAMA 3SDCB 5E03A 3HE7B 2X7LA 5I1KH 5AZEH 3KR3L 4OZGE 1VFOA 1GYAA 1CL7I 4PJDE 5JHLL 1I85A 3QRGL 1T66C 5BRZE 5CLWA 4ZS6C 3JBG7 1A1OA 3TLRA 4BQ6A 4J8RA 5A40E 3ULVC 4G6KH 3DLQR 1DQTA 1HHJA 3B43A 2FRGP 3K1DA 1OGAA 2IPUG 4YDJA 5C09B 3WIHL 3SJVB 4FS0A 1KCLA 4LHUB 3BKYH 4KJPD 3VWJB 1A14L 1MAJA 3AY4C 4FQXA 4CKVX 4C83A 4WI9A 4WFHD 3IDYC 3KGRA 4JRXD 4M9OA 2A6JA 2HJKA 2Y5EA 3TN0A 4RDQG 4WWKA 1M05A 1NGWA 3ILQD 4G9DA 1I7TA 3HNTL 3RWHB 4JRWA 4XP6H 1AR2A 1V3MA 1WFOA 4LPXA 3KNBA 5MEPA 3QQ3A 3NPSB 3RKDC 4NRXB 5H37G 1BOGB 3SQBA 4C58B 3MOAH 5J9PA 4KH2A 4YBQD 4PRNA 2HJLB 1I9IL 3NCCB 5DRNA 5L0QB 4HZLB 4ALAL 4HWEH 1TVBB 2XZQH 3LEVH 5IV2A 2V17H 1NLDH 1NUGA 1MJJB 1V7MH 2PTTA 1F2XK 5EO0A 5HVFB 4U1IB 5HYSB 5DVKA 4ONGH 4NQDB 3TBTB 1C5BH 3CAFA 3TO4D 3KPNB 3K8MA 1V05A 3X3GH 1X5LA 3C09B 3V52L 1XZ0A 2CGRH 5I1HL 1AGFA 4PB9L 1XFPA 3G6AA 4MJ4A 2B5IC 3OAZK 5BRZD 4Z76B 1B4JL 5DRZA 1MJ7L 2WBJA 1O0VA 2VXUL 3MXWL 5DS8A 4UTBH 1NBZB 3MJ8A 1ZT7B 3G9VA 4JDVB 4JPKH 2COQA 1HHGB 4N1EA 3SDDC 2YA0A 1MRDH 5FGCE 5IOPB 2B1AL 3CMOL 3MRFB 3VXNA 4MLIA 3MRBA 3IKKA 3OKEA 2H45A 4POZC 3D3VD 1QQDB 2X4NB 5I6XB 1CICA 1HSBA 5EN2B 2JE8A 2FD6L 1N3NA 4NQXB 2A6KB 2VABB 5EUKB 3FQTA 3O3AB 4QTIL 4OGAD 4K8RD 1U91A 4JFPB 3X17A 1DCLA 1IGJA 3QDMD 3IDGB 3QEHA 4FTVA 3QXTA 1EA9C 5GJTH 3DX8A 3ZKSD 1NCWH 2Z31A 4FFWC 1BGXL 4DKFL 1MY7A 4LK4A 2DQTL 4H25A 5IK3B 1MJ8L 5CEZL 4XMLL 1PY4A 2VSDA 4K3JH 4UNTA 4K94H 4PRPE 3GSWB 1CU4L 1P69B 1CGUA 4GAGH 5JZ7C 3NGBC 4R4BB 3HUJE 4C4KO 2FB4H 2C1OA 2NYYD 2X4QA 5GGVL 5IEKB 2WUCL 4LAQL 5SWZB 5ESAB 2GTZA 2LU3A 4LCWD 3GSUA 5HHNB 4I2XE 1U8MB 2IAND 4XB7A 1CD9B 1H3UA 2WIIB 4KQ4H 4JGMA 3RWDB 3D9AL 2R1XB 1H3VA 3ESVF 4ZQKA 4F7CB 1T1XB 4XPBH 3WSQH 4KI5C 2VMFA 4X8XA 1ND0B 3ULVH 1LE9B 3PWPA 3QFJA 5A1AA 1M7DB 3PXJA 1V3KA 2UZIH 2BNRA 3L7EA 5I30L 5KSBA 4BA8A 4CNIB 2EDWA 1MY5A 1Z5LA 3GMPB 3B4NA 1FH5H 2ARJQ 4HCRA 4HH9A 3WDHA 1LEKB 4NKMB 1HCVA 1RZ7L 4H20H 2HVKB 3QA3A 1EHNA 4K7FB 1FL3B 1R3LA 1NMCB 3ARQA 5I19H 1OAYL 1WAAE 1A4KB 5I1EH 3VWKA 4JG0L 1P4LA 3QH3A 1G6VK 4MAYA 4UQ2B 5E99H 2VDMH 2P24B 4NZRL 4BSJA 1YECL 2AJUL 4IRZH 5KW9L 5AAMA 2ZOKB 1SHMA 4J1UB 4E0RA 4UAOC 4HUMB 5DVMA 4L9DA 1Q9WA 2P43B 5T1DH 1DVFD 1D9KB 4RBPH 2OQJA 5EIIA 1VSCA 4ZDHB 4N8VA 5T3XE 1KB5H 4OLVH 1YA5A 4XP5H 5F7HA 1JWMB 2X4PA 3FQXA 3OG4B 1T20A 3ZMRA 5I1JL 7FABL 1GOFA 4R9HA 3K2UH 5GZND 2R8SL 3LN4B 2XZCH 4CUCA 2HRPH 1QSFE 3CVHH 4LLYA 5SX5H 4NBYB 1P7QA 1T21A 3GMQB 4NWUH 1AGEB 4NNXA 2Q6WA 1G7PA 2C4XA 3PHQA 5E1HB 1F4YH 2PTVA 1WGOA 2NY4C 3C6LD 4G7YL 3BOVA 5C0BA 3ULSA 4HX1A 4HEME 3IDYB 4KRPD 1QTYT 4JLRB 4JFFD 1BZ7A 4KTDL 3EJZD 4M93C 4L3EB 5FKAB 3IFOA 5BZDA 4QRRA 3KPQA 3UBXA 4KUZL 4I3RH 1MCBA 3BE1H 4NO0D 4FA8A 4O4YH 1IE5A 2EICA 5IKCA 4OLZL 2DMKA 5GRYA 4UNVA 3VD4A 3KYMA 5DDHA 4DTGH 3CUPA 4V1DB 1OT2A 1F5WA 1FFOB 1EJOH 2I60L 1QLFA 3AFLA 1OTUC 3R06A 4M1DH 4PP1C 1HZHH 1NBQA 3MLSH 4U4BA 2BX5A 5F9JB 4PJHB 4OZIA 3O8XA 4P9ML 4Q9RH 3MRKA 2JELH 2F8XC 2IJ0C 5T3XD 1RUPL 2WINB 4M1CD 4GW1A 4XNMB 1CF8H 2DQCL 1U8JA 3SDXB 1WFNA 2IAMC 3WIIL 4RGNC 5DJ0A 4K3DL 2DTML 3O6KL 3CZFA 4F7MB 3ARXA 2ZSVA 2YR3A 1I85C 3ARZA 5FB8B 1MHCA 3FQNA 1WK0A 4N8PA 5DMKB 3QWRD 4RQQA 4MA1C 4U49A 1QSFD 2Y4SA 5C0RH 3MXVL 3MLTB 3PG2A 3PGDA 3CXHK 5CZKA 2UYLA 2KL6A 5GGQL 1G9NL 3KR3H 1W2KT 5MEQA 2F58L 2F53E 4M6ML 4GKZB 1F45A 4JPVH 2YBRA 4C56A 4HCRL 1TJIL 5DJZB 1GGTA 1LEIB 3SDDB 4FQXC 4ODUB 4XP9L 4LASL 3BEVB 4KJWC 3KXFD 3LRSB 4CJ0A 3U6RB 1X9QA 3GBNH 2KBGA 4P3CH 4WWKC 4GW4B 5F1IA 3ZHKA 1A14H 1WISA 3NA9L 2ORBH 5EBMA 2HG5B 4G9FB 1RPQA 4M6OH 1DDHA 4ODTH 4M43L 2Y7QA 3ARGD 1E6OH 5FHAL 3HNTH 4PD4K 1S5HA 4WW1B 1J7VR 1FVCA 4XCCL 3AMKA 4S1DC 4YDKL 1QLEL 1KTLB 4G8GB 4BZ2H 5BXFB 3TYFA 2YPLB 3UC0L 1RIVL 2YMXH 3ZYZA 1XGRA 4N90D 3L5XH 3FQWB 3MUGA 4TTDC 4QHMA 3FKUS 4Z7UA 3RX5A 1JN6B 4N0CC 2LFGA 3PIQA 3L3IB 3NGBB 3HC3L 3WNPA 5KTEH 3R8BB 2P8MA 1JZ2A 3REVA 3OKOB 3ZHLA 1B4RA 1DQQA 3I6GB 1KCVL 2Z9TA 1P2CA 1UFUA 3O2VH 5DQ9B 2UV3A 2XQYG 4GS7C 1A7OL 4ZYKB 4ODSH 2W07A 1HI6A 3MA9L 1G7IB 2WBJC 4WJ5A 3RUGE 3ARBA 5C07E 1FZKB 1OM3L 3AAZB 1NAMA 4LCUA 1BD2D 2F53D 3V52H 4ZPTA 4Z7NF 4PB9H 3QDJE 5KZCD 1B4JH 1K6QL 1YN6B 4ELKA 2VXUH 2G5RA 2DQGH 4MD4A 5ICXA 5EA0L 4JN2B 1A9EB 2IADB 1KV3A 4IM8A 1UM5L 5ANMA 4KVNH 2DYPD 1CICC 4JKLA 1KG0A 4XNYH 4QCIA 1IGIL 1MIEL 2F54B 5F44A 5CJ5A 3ZYIA 3IETA 4F7PA 2BHUA 5K9QI 4UU9B 4UDTB 3EDDA 3TYGH 1S7XA 3O2WL 3BMWA 4BQ8A 4U6HA 3DXAE 3DWTA 4W4OA 4X6CB 3ZE1E 3MGOB 3WFDL 1LO3L 3VRLE 2Z31C 4PRIB 2AJVL 4HWNA 3MUJA 1SQ2N 1G9EA 4DEPC 4UAOB 4YXKH 2A74A 3AXLB 4DKFH 5ELIA 2DQTH 2CO7B 2FEEI 4U1KA 4XMLH 4K9EL 3C5ZA 1CU4H 4ZNEA 4LARH 5HDBE 4JRYB 1LD9B 5TQ0H 2GK2A 1KPUB 3U7YL 3VH8G 1FZMB 5C07D 4W6YB 3GI8L 4M5YH 4X9GA 2DMBA 4Y16D 1TTUA 5GGVH 5J57B 1TQCC 4LAQH 2XXCB 3QDJD 2EECA 2NTFA 4PLKD 3T4YA 3ZDYE 3BWUC 3WUZA 2GITB 5HGBB 4LNRA 5DYOA 3T3PF 3NCYS 5F72S 5J0BA 1G7JA 2E9IA 1BBDH 1DN0B 1G9NC 1SMOA 1VKXB 2V2WB 4YPGB 2AXGB 2MQCA 2FR4A 5AYQA 4HJ0D 1WV7T 3LN5B 4M93B 1T1WB 5I30H 2I9LA 1KFAL 1GIGL 4NQED 3MRDA 3ETBF 5IG7B 2DM7A 2A83B 1I1CA 2M8XA 1DEEB 4G8EB 2I9TA 1RHHA 2YUZA 2CQVA 2IFFH 3DXAD 3AGVA 2BMKA 3FAXA 3VFUA 2YD7A 3VWKC 1RZ7H 4WV1C 3HHRB 2YA1A 5DSCA 4JJ5A 4MAYC 3AB0C 5ITBH 3G6JE 1JIBA 4PJXA 5CZXD 3ZSTA 2EEAA 5GGUB 5JDJA 4PJ7A 3WFCL 3KLHC 1CL7L 3HZMB 1J12A 1X5XA 1DBMH 3PJSA 3AMLA 1FZJB 3BRDA 3CFKA 4JFYB 3UYPA 3PNWA 3RX8A 2VYRE 1PVHA 2EH7L 3OMZA 1W72A 4NZRH 1YECH 4KK6C 3PUCA 3TWCH 1L7IH 4Z7WA 1XF2B 5DD3L 1NAML 1FDLH 2IAMB 4RGNB 2X7LB 5JW4M 3G08A 1R6VA 1PEZA 2BXYA 1IAIH 3L3HA 5J1SC 4Y19A 1J1OL 2JJUA 3KPTA 4MA1B 4Y2DD 1A1OB 4HS8L 2JCCA 3IGAA 4UUJA 2Y06H 3IB4A 1HHJB 1GHFL 1OGAB 4YDJB 2ZJSH 3DMMA 5C6TH 5FUOH 7FABH 2R23A 3UTTA 3BWAA 2DIJA 4UV7H 4WFGE 4FQXB 4C83B 4KHTH 4XXDA 3WE6A 3IU3A 2DLHA 3QG7H 4Y89A 2A6JB 2HJKB 3TN0B 1D7FA 4WWKB 1M05B 1NGWB 3SY0A 4G9DB 1I7TB 5IFHL 3HC4L 3ZTNL 3BFOA 5MEPB 3KNBB 4G7YH 1T0MA 1R24A 3G9AB 5FYKL 3RL2A 4JZOA 3QQ3B 1C16A 5GRUL 4ZFOA 3V7AE 2GY7B 3HFMH 3MUHL 5H2BA 5J9PB 3ABZA 4MX7A 4PRNB 4YHOL 5IGXH 1SYSA 1U95A 5DRNB 1KELH 4P0DA 2UWEA 4BSWA 1FORL 1VFAA 4G6JH 4XAKE 1S7WA 5A2KH 3MUZ1 5IV2B 5IT2L 3O8XC 4OLZH 1S78D 4PB0L 2PTTB 1T1ZA 5EO0B 3A6BL 1U3HA 3T0EA 1JFQL 1H0DA 3S6CA 5IM7A 4D3CL 3JWDL 4KRMB 1V8HA 2Q8AL 2Q86A 3RPIA 3W9DA 1XZ0B 4TNVK 1AGFB 3G6AB 1RZKH 4GS7B 5FO7A 2JTDA 3H3PL 2QHRL 1U3YA 5IB1A 4K9EC 4LDOB 5DRZB 1CDUA 3O3UN 5E7FA 3NIGE 2WBJB 4KK5C 5DS8B 3BP5A 3WIIH 1NUNB 1V3JA 3MJ8B 4JFQB 5C0ND 4K3DH 2DTMH 3O6KH 5IIEA 1G0DA 5CJ8A 4WFGD 4K07A 4RAHA 3MJ9A 2XY1A 3VXNB 1I8KA 5GGQH 4IRSA 3MRBB 4NQCA 4JFDA 3OKEB 2F58H 3LHPL 1F2QA 5LG1A 3ULVF 4L8CA 4CRPA 1CICB 1HSBB 2X40A 3SGEH 5FYJU 5IVXE 1MI5D 5GS0D 1N3NB 4XP9H 4LASH 3FQTB 3CNKA 2WMPA 1F8TH 2OJEA 3MODH 1U91B 3RVXC 2RGSA 5D5MA 5E2TH 1IGJB 1NEZG 2CXGA 3QEHB 4FTVB 5DC4B 3LH2L 3NA9H 5C6WH 3LMJL 5FYJD 4WWID 4XAKD 3DX8B 1JNNL 2Z31B 4HG4K 3UTOA 4H25B 1W72L 4PJ5E 1QD0A 4XAWH 4XCCH 5KS9E 4L4TE 4DEPB 1ORSA 5BMFL 3W9EA 1OB1A 3GSRA 2C1OB 4GW5A 4S1RH 1IQWL 1XF3A 1RUKL 4PJHF 4IJ3C 4HSQA 1DFBH 3HPJA 2GTZB 1OCWL 1U41A 3GSUB 4KFZC 1FNSH 2HFGL 3IKCA 3BYYA 4HQQH 5F21B 2OP4L 3ARBC 3D2UD 5D1XA 3WS3A 1TQCB 2MOVA 4ZQKB 4LEOA 3SDXF 1YPZE 1CGSL 1K4DA 4MVBD 1ZGLA 3ILPA 3PWPB 4MCZA 4EVNA 3QFJB 1UACH 2DICA 2XZZA 1IJ9A 2BNRB 3L7EB 5KSBB 2VDLL 5IW3A 2DBJA 3V0WL 1Z5LB 3HI5L 2Z35A 4YX2L 2J8UF 4YXLH 3MZGB 4ZFOL 2J5LC 1ZSDA 4HH9B 4KXZH 2EIBA 2W0PA 3GMNA 5I75C 3MBEA 5EA0H 5GGRY 3QA3B 3MRIA 5D2NE 2VN4A 2JIXA 1R3LB 5IBLD 5IMLA 3KS0H 2CRIA 5DTFA 4KAQH 1KPVA 3MLUH 3Q5OA 4XMKL 4W4OC 1MIEH 3VWKB 1GGBH 1P4LB 3QH3B 3SKNA 2DM2A 4MAYB 3AB0B 2FO1A 3O6FA 5IJVA 1F11A 5KN5A 1RZFL 1A1NA 4RDQF 4HHAA 4I77L 2G9HA 4HGKC 1F4XH 1GH7A 4E0RB 2I26N 4H88L 2ATKB 1LO3H 3WFDH 5HGAA 1CDGA 3GIVA 4KMTH 4PJBE 1A6ZA 4LLUA 3QDGD 3QZWG 3TP4A 1Q9WB 2AJVH 3T65A 1I4FA 3MRMA 2OQJB 5EIIB 3V5HA 4KK8D 4N8VB 5FOBA 3C5ZC 4ODHH 2KQMA 5CINL 1HXMA 2FX8H 2X4PB 4OM0L 1P4BH 1T2QH 2EXYD 3BQUA 3FQXB 4OFYA 1T20B 4NCDA 3N0PB 3JWDC 3MA7A 1HQ4A 4EBQL 4GKSA 3MJ9L 1OQXA 3ARTA 3PL6D 4LLYB 4Y1AE 1P7QB 3U7YH 1T21B 2RHEA 3ARFA 4KQ3L 4NNXB 1DTUA 3GSOA 3GI8H 2Q6WB 5DMIL 2ZG1A 1G7PB 3PHQB 1KGCE 4PJEA 5I1AA 2X1OA 5C0BB 3ULSB 4HX1B 1KCUH 1Z9LA 4PRDA 1BZ7B 3AU1A 3PP3H 1RQ5A 3PWJA 4EDWL 5EUOE 3UTQA 5ISZD 5BZDB 3IFOB 4QRRB 3KPQB 3UBXB 4ONFL 1X4XA 2A2QT 1KT2A 1MREL 4D0CA 1QYGL 3N50A 3I9GH 2YRZA 5IKCB 3C5SA 4J3WA 5T1LA 1MFNA 3KYMB 5DDHB 3CUPB 5E08L 4ZXBD 1QLFB 3R06B 1WEJL 5KJRL 4OZIB 3CK0L 3O8XB 4FP8H 3QPXL 4URTB 5E1AA 2OLDA 3MRKB 3P4OA 1X4ZA 2ZCLL 2NY6D 4GW1B 3N85L 4YDLC 3SGEI 3EYQC 1U8JB 1Z0MA 5DJ0B 5IB3A 3H9ZA 3CZFB 5DQDH 2EH7H 4LVEA 3RVWC 2ZSVB 4HFUL 4CDHA 2AV7A 2QTEA 4R97C 4EQ3A 2F15A 1MHCB 3FQNB 3IDNA 4F8TA 1Q38A 4XTRD 2PXYA 4RQQB 4CADA 5DD3H 2XY2A 5L8KB 2IMNA 3PGDB 2UYLB 2K7QA 2VO5A 3OAYK 4ZUTA 4JDTL 5MEQB 2DM4A 2XG4A 3DMMC 2P5WA 2YBRB 3UZVB 3RDTA 3L3KA 2EZ0C 1QRNA 1J1OH 4QYOA 4X4XA 2X10A 3L7FA 4HS8H 1ZT1A 4J3UA 5JMOC 1GHFH 3RU8H 2MCPL 1W0VA 2HVJA 2XIDA 4ZOEA 5F1IB 3NCEB 4H26A 5B4MC 4NDMA 1QKZL 5EBMB 3RNQB 3ZT6A 1RUAL 4WU5A 5MHSD 1C1EL 5DVLA 1DDHB 1YYML 4C59B 2Y7QB 3L5HA 1U8NA 2YD2A 5HDLA 2UVFA 3HC4H 1S5HB 4MMXC 4NPYA 1FVCB 1K2DA 3I3BA 2VQ1A 1WZ1H 3E3QC 4CVUA 5FYKH 4YQXL 3JTTA 3TYFB 5IF0A 4HXBL 1EO5A 3G04A 3SCMA 2EEDA 1XGRB 1C5CL 3NOIA 4LLMA 3TFKC 3QIBA 3MUGB 4Z7UB 4QHMB 4YO0A 1LGVA 2DI7A 4YHOH 1R0AH 1P7HL 3PIQB 3S88H 1RJZA 1U3HC 3T0EC 3DARA 3M1BA 1FORH 2EDBA 1FBIH 2P8MB 5IT2H 4OLUH 2QSVA 1OARH 4PB0H 2JB5H 3REVB 3KPMA 4UIKL 4IJ3B 5DJ2A 1QP1A 5DLMH 1DQQB 3A6BH 1P2CB 3CFCL 1JFQH 4NN6C 2PW2A 3WXWL 4OF6A 1HI6B 5DGRA 1E4WL 1UC6A 1I8MA 1AY1L 3SOBL 3I6KA 2LE9A 3JWDH 4WJ5B 3ARBB 3PHSA 4GLRH 4YC2C 4QY8A 1NAMB 4LCUB 4DOHB 4ZPTB 5D70H 4G43A 3J8F7 2BRQA 2NY2C 2QHRH 1QBML 3EZJB 3G5XA 4L8DA 3O0RL 4ELKB 5FGRA 4IIQC 4MD4B 5ICXB 1ITBB 4PJ9A 4IRSC 3BYTA 5C1MB 1VHPA 1KTKE 5ITFA 2VDRH 5ANMB 3ROLA 1A22B 4NUJA 3V7AG 1KG0B 2J5LB 4QCIB 8FABA 5I75B 1PGRB 3IETB 3MO1A 3QHFH 4F7PB 1JF6A 2DQEL 2FH6A 2YD1A 1U0QA 3LHPH 3MOBH 4X6DF 1S7XB 4F57L 4Z7QF 3AM8A 2FEEL 4U6HB 3ARDD 3VXME 1YMHB 1X6NA 2IQAA 5F9OL 5M94B 5LGHH 2O5YL 4YZFE 5EU6E 5FYLL 2I5YL 1OHQA 4ELMF 3MV9A 3TJHD 1XIWA 3LH2H 4DQOL 3BH8A 3FFDA 3QISA 2A74B 4TRPL 1F3DJ 4OIAA 4L4VE 1JGVH 5LVEA 4LQ1A 1W72H 4JVWA 4U1KB 3V79C 3C5ZB 35C8H 3EFDH 4QEGA 1FCCA 1YNTA 3MRLA 4YHZL 3GMOB 4GQPH 5D1XC 4XB8A 2VAJA 1QSED 3PV7A 1T5XA 1L0YA 2NTFB 5T5NG 3T4YB 2X89D 4LIQL 2Z91A 3JUYA 4LNRB 3D39E 1LK2A 1OAUH 5DYOB 5FF6A 1I1AA 1G7JB 5TQ2L 4UT7H 1CGSH 3A6OA 5F7KC 2PKDA 2VLJE 2FR4B 4ZOAA 2D2OA 3WFBL 3W5NA 3ZHDA 2YSSA 1IEHA 2I9LB 3MBEC 3EO9H 3FO2A 3MRDB 4UB0L 1W0YT 1VADA 1LP9F 4K7PX 4WFEE 3V0WH 2WNGA 4TUKL 3TO2A 2I9TB 1RHHB 4HPOL 4YX2H 2ZOLA 1D6VH 2BMKB 4AM0A 5E9DA 3VFUB 5C7XL 3GHEL 4N8CL 4MYWB 3BEWA 1E4JA 3IU4L 4P59H 4JJ5B 5D7JD 5DSCB 2V2TB 3O6FC 4PJXB 4PJ7B 1M71A 3S35X 3EO1A 4XNUL 3V0VA 4WW2A 3PJSB 3CFKB 4L4VD 3PNWB 4P2YA 2YN5A 5FA3A 4LNVA 1W72B 4IMKA 4OCRL 2H32A 4I77H 4QHLA 4YDLB 3HR6A 4Z7WB 3VFGH 5T1MA 5KVEH 3BQUC 4P2OA 3G08B 4R97B 3TA3D 2R29L 2N4IA 2WM0A 1JCKA 4GJTB 5CINH 2K7PA 3C60D 3L3HB 1O7VA 4Y19B 4M6NH 2IALA 2E27H 2JCCB 3IGAB 4P9HL 1RULL 4UUJB 1UJ3C 4OZGF 3U1SL 3ARFC 3B83A 1RJCA 2A0LC 4PJDF 1SVCP 3DMMB 4MNGA 5D7IE 2HT4C 3S36X 4FMFA 15C8L 2R23B 3UTTB 3BWAB 2CK2A 3P9MA 2Q7NA 4XXDB 3WE6B 2QSCL 1F3RB 3HC0A 3R4DA 4FQCH 3IU3B 4X0KA 1WIUA 4KPHL 3MROA 4RMWA 4NM4H 3BD3A 4BFIA 2KPNA 1LEGA 4I8DA 5CEYA 4H1LG 3SY0B 3P9LA 4WFED 3DROA 4ZAKD 3STLA 4JFHD 2NTSP 1T0MB 1R24B 5TE4H 3RL2B 4JZOB 4U2ZA 3EDJA 1C16B 1FL6A 3NCMA 4IS6A 4ZFOB 5EIQA 2C1PA 4BFBD 3EYVB 4OLXH 5H2BB 3D6GA 4TSAL 4MX7B 4ONFH 5FA4A 4KKLD 5KAQG 5DZNA 1SYSB 1U95B 2UWEB 4G3YH 1VFAB 4BSWB 5KVGL 2BJML 1S7WB 5J6GA 2RJMA 3TH2T 4JRXA 4ZTOH 1FYTA 1I8LA 2PYEE 1T1ZB 3W0WE 3QXVA 2HT3C 1U3HB 3T0EB 1WCQA 3H3BC 4NSKA 1H0DB 4TOYL 2AQ3A 1WEJH 4OB5L 5IM7B 3CK0H 4PJCE 1I1YA 4BQCA 5A2LH 3C2AL 3QPXH 1N26A 2DKMA 1FE8H 2Q86B 3RPIB 3W9DB 4UQ3A 1NGQL 2ZCLH 4NN6B 4TQEL 3NTCH 3LS4L 5FO7B 4PJAE 1CQKA 1A4JA 5IB1B 3N85H 2DKUA 2PXYC 3BZFA 5I2IA 4YC2B 4ZSOA 3BP5B 4S10A 2J1KA 5IIEB 3SGJA 2VLKD 4HFUH 1VB9A 2NY2B 1MFBL 5DEFB 3WD5L 1ZVHA 3RDTC 5DC0A 2IH1A 4IIQB 5E7BA 5CGTA 3TO4A 4BQBA 2APBA 2VDPL 5AZ2H 5K9OA 1I8KB 4IRSB 4NQCB 4JFDB 2AXJA 4JDTH 4TNWK 3ESUF 4L8CB 4XVJL 3BP6B 4HAFA 1EERB 5BRZA 4NQUA 4W70A 5MEND 1OLLA 4RCAA 1S9YA 1YEEH 1CLOH 4OCSL 3T3ME 1CGVA 3WO4C 3HA0A 2OJEB 3D25B 4GXVH 1OOAA 1G0YR 3KPRE 1MFEL 3P3YA 1HKLL 3TC9A 1JHLL 1ZVYA 1CK0H 1RUAH 3KS0J 2VDOL 1C1EH 2CPCA 3QJHA 5GGTH 2VTFA 4X6BA 3SCMC 3D3VA 4OCYL 4O02L 3FZUD 3W0WD 3QIBC 3FOLA 4NN5C 1ORSB 3WXVL 3MX0A 4POUB 4YQXH 1YNKL 5E8DL 5ICZA 1OB1B 3GSRB 1CFTA 4HXBH 4P99A 5L8JB 1I3GH 4S2SA 4GW5B 4BSVA 2FJGA 1U6AH 4HIHA 3STZA 1XF3B 5IHUH 3HPJB 3P30L 3QDMA 3U7WL 3FQRA 4P57A 2Z4QA 4AMKL 4PREA 3U79A 3HUJF 5DRWA 3IKCB 1OW0A 2VDKH 4S1SL 1A3QA 5GISL 1EMTH 5D1XB 4QNPE 3WS3B 2A6DA 4I1NB 1CXFA 1T1YA 3F7PC 1K4DB 4JKWA 3CFCH 1ZGLB 1OF2A 3CDYA 3ILPB 4MCZB 4DW2L 4EVNB 5DD6A 2FEDD 1E4WH 3JUZA 3CDGA 4GQ9L 1AY1H 3SOBH 5CBAA 2WV3A 4FXKA 4CU6A 1YC8A 4P9HC 4PJ9C 2IBZY 3UTSD 1I8IA 5F3BA 3CVIL 4RMQA 4LCWA 3FAWA 2Z35B 4BUHA 2PO6D 1HHIA 5F7UA 1QBMH 2IANA 5CEXA 5EBGA 4WY7L 1ZSDB 3GMNB 1AKJD 3FO9A 3MBEB 4J12A 3MBXH 3MRIB 5JLZA 2JIXB 3VH8A 1AR1D 3KPRD 5IMLB 5DTFB 1KPVB 1BIHA 5GGRA 3AM8C 3IS1X 4TVSa 1MQKL 4XWOC 1LO5A 4P23D 1IT9L 4PJGF 4X9FA 3SKNB 3KYKL 4NQVA 3O6FB 5IJVB 1F11B 1WAAF 1QBAA 4GRWE 5D96C 1A1NB 5KN5B 4HHAB 4F57H 2G9HB 4M7JH 1XIWC 4D9RE 4O2EA 3O4LE 5HGAB 3GIVB 1MPAL 1A6ZB 4LLUB 2I5YH 5FYLH 3T65B 3O81A 1I4FB 3MRMB 4LEXH 3V5HB 5FOBB 3FL7A 4QOKE 1HXMB 5HY9A 3UROR 2FX9L 3KPPA 4DQOH 5IVOA 4TRPH 1S7RA 4PV9A 3X12A 1NC2D 2CUHA 2X5PA 2QQNL 3BQUB 2D7TL 1BP3B 3MLRH 3MA7B 1T6VN 1HQ4B 2MTPA 5I0DA 4GKSB 1BOYA 3B6SA 4TYUA 4XNXL 1UJ3B 2WLYA 3ARFB 4S11A 3ZKMD 3GSOB 2C5DC 3U46A 1DVFA 2ERJC 1MCDA 3PF2A 2CLRA 3MV11 1I1AC 4OLWH 1J05A 2MNUA 4PJEB 5I1AB 5JXAH 4MSWA 4OCWH 4LRNH 3PDDA 4PRDB 3AU1B 1TENA 3PWJB 1INQA 1BAFL 3UTQB 5TQ2H 1N0LA 4GMTL 1KT2B 2QADD 4D0CB 1WT5A 3QRFM 4PYHA 4YHML 4HLZH 3W11D 1AHWA 3C5SB 3L6FB 4ZO6A 3OF6D 5T1LB 4UB0H 1NJ9A 4O9HH 5KVDL 5C08E 4TUKH 3GSNA 3RVTC 4LKXA 2EDLA 5ID0A 4K8RL 5E2WH 4JFFA 2E9JA 4WW2C 3O4LD 1GVIA 5SWQA 4RRPG 5E1AB 3IU4H 2P48B 3JVGA 3P4OB 3LSOA 3PXHA 4JN1L 3MV7E 1ACYH 4NO0A 3UYRH 2EC9U 3DIFA 5DUPL 5SWSD 4QRPE 3I6LE 1AXTL 4FQJH 3KPOA 5IB3B 4DZ8A 1VCAA 5I1CH 1TETL 2AV7B 4P2OC 1JTOA 3IDNB 2PXYB 3OV6A 4CADB 1D3CA 3SGDI 4K3GA 3ZDXF 4YIQA 4ZUTB 4NT6A 2P5WB 3X3FL 3RDTB 1QBLH 1QRNB 3J7HA 2W92A 5EIVA 4QYOB 4R26H 4X4XB 3VRJA 3L7FB 2A9ML 1GZPA 1ZT1B 4Q0XH 3F58H 1W0VB 1YEJL 2HVJB 3RJDA 1KEML 4JB9H 1NDGA 3QEQE 3O9WA 4H26B 4NDMB 3QWRA 1ZS8A 3DSNA 3LKNA 1QSFA 2QSCH 4I18A 4WU5B 4KPHH 3WO4B 3MLWH 6CGTA 1U8NB 4NPYB 1A6TA 1K2DB 2VQ1B 4KJPC 1U8IA 4WHCA 3NFPA 3JTTB 2JF1A 5C0JA 3KXFA 3UPRA 5IF0B 3WV0A 3G04B 3HMXH 4ODBD 4XP1H 3SCMB 4IOSD 4OCXL 3U4BL 4LLMB 2HRLA 4JHZA 3ILQC 4UV4L 3QIBB 4YO0B 4NN5B 1CFVL 3MV7D 4DAGH 5JIPA 1UWEH 1RJZB 2QSTA 2Z8VC 3M1BB 1EHLL 3I6LD 4Y5YA 2ARJA 3O6ML 3T08A 4HDIA 4PJ7F 4PRBA 4YEFA 3O2DH 3KPMB 1J0HA 4YBLC 3OZ9H 2UVEA 1Y0LA 4YBQC 5DJ2B 3H9YA 5JO5A 5JUEL 2PW2B 2XA8L 3ZKND 1I8MB 5HYIA 2WK2A 4OF3A 3I6KB 1TNMA 3C2AH 1FG2A 3GHBL 3T2NL 3RHWK 4CVWA 1UWGL 4QY8B 4KZEH 3SGJC 1NGQH 3MLVH 1P53A 4G43B 4WHTA 4ESKA 3ZL4H 2P8PA 3G5XB 4L8DB 3H7BA 4OF5A 5DK3A 5JR1L 3ZLQC 3TO4C 2FX7H 4AG4L 4PJ9B 4JHBA 2XKUA 2D0GA 3VI3E 2JCCF 5ITFB 1AE6L 3ROLB 4Z0BL 1YY9D 5BOPA 3QEQD 3SO5A 4NUJB 3QR2A 2FHCA 2VWEE 4YGAB 2E6QA 2DWDA 8FABB 2J4WH 3EHBD 3MO1B 3QG6A 1JL8A 1BD2A 3GSNL 2VN7A 2YA2A 4XVJH 3OKYA 3CLFL 3S7GA 1DE4A 5CP7A 3IYLW 3D48R 2IQAB 1NCBL 4GMSH 3RP1A 4OCSH 4NQTA 5EZLA 2E7LA 5D96B 3MV9B 3V2AR 5J8OA 1MFEH 1PG7X 1XIWB 1NLBL 4KRLB 1JHLH 4Z18A 3BH8B 3FFDB 1A3RH 3U48A 1FGNH 3X11B 2VDOH 4N9OB 1G1CA 4XPGH 2YN3A 4K8RC 4HBQA 2H32H 1A2YA 1DQML 4XNZC 2H41A 1JGUH 5E5MA 1YNTB 1BQLH 5HVHC 1YNKH 3MRLB 5E8DH 4RAUA 4HKJA 1OW0C 1D5BA 1SJXA 2VERN 3DECA 4Y8AA 4GFTB 2NY1D 2ZCKL 1DBJL 1NFDA 1T5XB 3BGFC 1UKQA 3HMWL 3P4NA 1DQDH 2AJZB 2Z91B 1UG9A 1I1FA 1HSAA 3WS6A 1LK2B 4X4ME 2ERJB 3MLXL 5FF6B 1XCQA 1I1AB 3VXUE 2YRLA 3K46A 2D31A 3BN9D 4WFFE 1MRFL 2VXSH 4DW2H 3E8UL 4NN7C 2PW1A 2HKHL 4CW1A 5BO1L 1AI1L 1IGYA 3O4OC 4LSRL 3W82A 2E9WA 3LCYA 2YSSB 4WI4A 3FO2B 5C0CD 1VADB 2X2YA 3GEWB 5HXMA 4APQD 3OKNA 3TO2B 3KJ6H 4R2GD 5AUMA 4EI5A 2GKIA 2ZOLB 4WY7H 3KAAA 4AM0B 5E9DB 1EO8L 5D1QD 3ULUH 3WLWD 3BEWB 1YMME 3MR9A 4F7TA 1CD8A 1M71B 3EO1B 3SBWA 3V0VB 4WW2B 5D5MF 3RIFF 1U8PA 3TBVA 3KYKH 4NQEA 3T2PA 2BVPA 4CVXA 4HFWA 5FA3B 5KBNC 2H32B 1GPOH 4FQIL 5ALCL 4QHLB 1T80A 3NIDE 1EVTC 3MNWA 2DQDL 5HHQA 4WUKH 1X5YA 1MPAH 5HVGB 5IQ9A 5T1MB 4DGIL 1WZMA 4P2OB 2VISA 1JPSL 4PRAA 3HE6D 2R56H 4BFGA 3BKJH 4Z8FH 2FX9H 2IALB 1NANH 1JK8A 5EBLA 3RWFA 3RWJA 2D7TH 4MNGB 5C8JA 1DVFC 1XGPA 1N6VA 4Y5XA 4EXPX 3HNSL 1A6WH 1EEQA 3P9MB 4NZUL 2V9RA 2W0KA 3HC0B 2EYSA 4DKEL 4X0KB 1V3LA 3PWVA 5FHBL 3EJYD 3MROB 1R3HA 4BFIB 1LEGB 4BZ1L 5GS2H 5F88A 1A7NL 5CEYB 1QOKA 3P9LB 3DROB 5H35A 3K81A 1E6JL 1LMKA 5D2LA 4PS4L 3STLB 5GZNC 5JW4N 4FFVD 1AO7A 1IRAY 4Y2DA 1WT5C 2Z0BA 4RMSA 5I8CA 1GZQA 3QCVH 3O45A 1FL6B 4IS6B 4IMLA 1AHWC 3SGKA 4O51A 4N5ED 1BAFH 1YMMD 4I3GA 3VXTA 2GSGA 5MERA 1KEGL 1AC0A 2XQBL 5FA4B 5F7FA 1MAKA 3KYOA 2B2XL 3HZKB 1IGMH 4WI6A 5J6GB 4HWBA 4JRXB 1FYTB 2P42B 4KY1L 3EJZC 5JHDE 4EIZC 2O26U 1T7YA 1P4IL 3DOSA 2D03H 3JVGC 5IBTH 4LRIA 4AK1A 4NSKB 2Y23A 1YC7A 1YEKL 1RIHL 3EDEA 4NUGL 5DR5L 3SKUD 4FQ1L 1I1YB 1MVUA 4N1CA 4YBLB 2BCKA 4B50A 4UQ3B 2VZVA 1QUNA 4LSQL 1JI2A 4WU7A 4DUXA 4LL9A 1D5ZA 3EIFA 5DUPH 1IBGH 3BZFB 5I2IB 4ZSOB 2CK0H 2IMMA 2VXTL 3RFZC 4RWHA 4B5EA 2R0LL 3A0OA 1TETH 4GRLA 3MCLL 1PX4A 2WQRA 4M1CC 3NIGF 2J12B 1H9VA 1W8OA 3ARYA 3TO4B 5K9OB 4I3SL 4X6EA 2WWMD 3MNZA 1XGYH 3X3FH 2GJ6A 5BRZB 5D7LD 4XPHL 3L5WA 3H9HA 4LSVL 4CU7A 1S9YB 4I18C 2XTJC 5IVZA 1MCLA 2ESVA 3Q6GH 1YEJH 2HFFA 2YUXA 1KEMH 5F7DA 2H9GA 4OD1L 2NQCA 1TZGH 2GAZA 3QJHB 3WN5A 4JR9L 4YGVA 4A2LA 4X6BB 3V6OA 3FCTA 5CJOH 3D3VB 1HKFA 2YKLH 4JG1L 5LGJA 3FOLB 1MI5A 4JM2F 1TTGA 2O5ZH 5ICZB 3H9SD 1CFTB 1BQHA 3QO0A 4S2SB 4Y5YC 1X4YA 2FJGB 4BSVB 4OCXH 1L7TL 8CGTA 4XNZB 1CYGA 1P9MA 2Q76A 4UV4H 1DANT 2X4UA 3QDMB 3LQAL 1CFVH 3FT3A 1AGCA 3FQRB 4P4KD 4P57B 5HVHB 2Z4QB 4PREB 4UT9H 3UDWC 1EHLH 5DRWB 5E6YA 1GL4B 1RAMA 1FPTL 5KVFL 3S98A 5IMKA 1T1YB 3KJ4C 1RUQH 3BGFB 1OF2B 2XA8H 3LIZL 2Q7YA 4NHCL 5DD6B 1NAKL 4NGHL 3CDGB 3Q6FA 5IQ7L 5CBAB 3T2NH 4FXKB 5KG9B 4OIIL 5JPNA 5B8CA 1YPZF 1I8IB 5GRVK 5F3BB 2VZTA 4LCWB 1HHIB 1FO0A 4NN7B 5CEXB 2IANB 4AT6A 3O4OB 1ITCA 5A16A 5JR1H 4YHIA 1UXSA 3O3DA 4AIXA 2ENSA 4AG4H 5JLZB 3QI9D 5CP3H 5L9DL 3VH8B 4GUPA 1KULA 5GGRB 1PQZA 4HWBL 3KLAA 3MMEA 4EZMA 2Z93A 5BW7A 1LO5B 2VAAA 4JO2H 3MPCA 4HT1L 4NQVB 3GSNH 4LFHD 3CLFH 3T0VA 4TUJA 3ZDZF 2C7UA 5GZOD 4HXAL 5C70A 3B5GA 5GRJL 4TVPL 4MQ7A 3SO3C 4X7SL 1NKOA 4O2EB 2VZOA 1BLNA 5DJ8A 1SY6H 1NH6A 3JWOL 2YPVL 5CJBA 5A3ID 5AYUH 1NLBH 4N0UA 5HY9B 2F8OA 3KPPB 1S7RB 1ROWA 4PJBF 4PV9B 1VGKA 1CGXA 4KKCD 4EIGB 3X12B 5DMJB 1Q0XL 2UY7A 2OZ4H 4HBCH 3HI6H 2WP3T 1J8HE 3T09A 3B6SB 3QQNA 5CAYB 3VG0L 4FXGA 4OBSA 3OL2A 4YUEH 1N6QL 2GTWA 3QDGA 3BI9X 5C0EA 3U46B 3WS6C 1DVFB 2CLRB 3L3DA 2L4OA 4QTHA 1J05B 1G7HA 5DWUL 5IW1A 3HMWH 4MSWB 3N06B 4OSUL 3LY6A 3UAJD 1INQB 2Q3ZA 3WO3B 3BD4A 1T4KA 1ZLVK 1AGDA 5FECA 3W81A 1MRFH 2EKSA 3G5ZA 3PL6A 3E8UH 2HKHH 1OP3H 3MV01 1AHWB 3DHJA 1NJ9B 5GS0L 1PBYA 3GSNB 3G5YA 1JHKH 4JHAL 4LKXB 5ID0B 3SBWC 4JFFB 4HJ0C 2GY5A 1OVZA 4NJAL 5SWQB 4XBEL 5ISZA 1N64L 4B0MM 5JXED 2UUDK 5FYJL 3LSOB 3S5LG 4Z7NE 1MHHA 1TLKA 2LVCA 2DBLL 4H1LA 4NO0B 1OY3B 1SBSL 2IBBA 3DIFB 1WSST 5FEBA 1T6WA 1BWWA 1BHGA 1OAQL 2ICES 3KPOB 1JNJA 4PTTA 1QSVA 4HK3J 4ZXBA 5CZXC 1J8HD 4FQIH 5ALCH 1AJ7L 3BAEL 4L8SA 3QYCA 5CWSA 1P5VA 1XR8A 3LQAC 3SJVE 5CSGA 2NX5A 9CGTA 1XMWA 4MS8D 2Q20A 4YIQB 4NT6B 4DGIH 1FO0L 5GS3A 1L6ZA 4Y5XC 1JPSH 4LGRB 3F12A 25C8H 4NKDA 3VRJB 1HIML 5B3JE 1KJVA 3CLEL 1GZPB 2Q87A 3LEYL 3QBTB 4AIZB 1R3JA 3O6LL 3ROOA 1NDGB 1TJHL 3O9WB 5FM8A 5HI5D 4H8WL 4R0LA 4NZUH 1ZS8B 3LKNB 1QSFB 4Y2DC 4DKEH 1BM3L 4I18B 2XTJB 3BZEA 3OR6A 3NH7L 4RMRA 4BZ1H 2E7MA 3SGKC 3DNKA 1RIUH 2IWGA 1E6JH 1A6TB 3EUUA 4WTZA 1U8IB 3F5WA 3NFPB 3B2VH 1CI5A 5C0JB 2BNQD 3KXFB 3UPRB 2ICWI 3SDYL 3NMEA 3E6HA 4XVUD 5EUOA 1MF2L 4NQDE 4S1QL 4FZ8H 2XQBH 5GRWA 4LRIC 3PGFL 3T0XA 1CXEA 4Y5YB 2ARJB 1GCFA 4P2RD 4HDIB 4PRBB 4NBZB 3GNML 5B38G 1Y0LB 3ZTJG 3T3PE 1P4IH 1TJGL 5JO5B 1CBVL 4LLVA 3JWOC 3W2DH 1YEKH 4FNLL 2ED7A 4NUGH 5DR5H 3RY6A 3S3SA 3ORJA 1FG2B 1S78C 1HQRA 2AGJL 3KJ4B 1EXUA 3RTQA 4ODXA 2OCFD 4YAQA 4WHTB 2P8PB 2C4FT 3CZJA 4WI8A 3H7BB 4JDZA 1J10A 4OAWA 1FN4A 3A67L 3FHAA 4G8FA 4JM4H 1DQLL 5HHXL 2R0LH 5CJQL 3FB6A 3QCUL 2DWDB 1FLRL 2H1PH 3NFSH 4TSCH 3DGCR 4M3JA 3QG6B 3QNZA 2HA1A 4I3SH 1O5DT 1BD2B 4UIMA 4N5UA 3KPSD 1DE4B 3B9VA 1AFVL 4XPHH 5CP7B 2C3XA 2MMXA 3VW3L 4WI7A 3UP1A 5EZLB 3WN5C 3GK8L 4B53A 3SO3B 4OD1H 5GS0C 3ULUF 4HK0A 4BH8A 5IFAL 1LNUA 4YZFF 5SWZE 1UEYA 3LPWA 1A2YB 5DRXA 1P9MC 1KLGB 5L88L 2MPAL 4JG1H 1FAIL 5E5MB 3S8WA 3ARDA 2CR6A 3TESA 3BDXA 2BVOA 1CDBA 4U3XA 1E4KC 3VCLA 4RAUB 4HKJB 1D5BB 3HKFA 4WI2A 5EZOH 3CFBA 2MSPA 4HW6A 1NFDB 4LKCA 3N1QC 1BVZA 1T22A 4TSBH 5HYFA 3P4NB 4U1MA 3TM6A 1PW3A 1I1FB 1ZHNA 5DGQA 5EC2A 1HSAB 1FPTH 1BEYL 1R5WA 1XCQB 1MCPH 4WEBL 5B8CC 2D31B 4AZ8A 3QJFA 4LSTL 3LIZH 1FCGA 1OSPL 3NCYP 2DLFH 4NHCH 2PW1B 5T3ZH 3GJFK 4X7TA 4CW1B 3CXDL 1IGYB 2C3VA 3TH3T 2E7BA 3BRFA 2X70A 4O2CA 5F6HI 5KSAD 1QSEA 3OKNB 32C2A 3ARRA 3F7RA 1T0NA 5AUMB 2X89A 4MVBC 2YUVA 5TDNA 3DBXA 5BW7C 2DIAA 4H8WC 2FLRT 2IQ9H 1MJJA 2XN9A 3MR9B 4CJ1A 5L9DH 2VLME 3RI5K 4MHHG 5MI0C 1UQSA 3TBSA 4DN3L 1U8PB 3TBVB 4NQEB 5DJCA 1P7KA 2BVPB 3MTRA 4CVXB 4HFWB 2XACC 3TBYA 4XP4L 1FL5A 5FM5O 5IBLC 1WTGT 4HXAH 3B8YA 3DXAB 1OLZA 3MNWB 4TVPH 3RGVD 5HHQB 4ZUSA 4Q7DA 1FYHB 4HJJH 5DFTA 5IQ9B 5HYQA 4MJIE 2MJWA 2EEBA 2VISB 3VDAA 5HPOA 1K9TA 4WO4D 3ULVE 1OGTA 4KGLA 4PRAB 4JPWL 2V5SA 4J3TA 4L4VA 1JK8B 2AEQL 5EBLB 1VFBA 3RWFB 3OAYH 3RWJB 4R90H 1N0XL 5C8JB 1XGPB 4Y5XB 4KK8C 2AP2A 4RRPA 1GGIL 1S7QA 4LAJH 1F58L 2EE9A 1NCDL 4L3EE 2EYSB 1HYSC 3PWVB 1R3HB 4X99A 3VDBA 2GI7A 3WJLA 5F88B 4OGXL 2EXYC 3TA3A 5H35B 3FONA 4K2UL 5DHVH 3C60A 5D2LB 1KCKA 1EAPA 4X4YA 1AO7B 4Y2DB 3LDBC 3HAEG 3PL6C 5I8CB 1GZQB 3O45B 1N7MH 4IMLB 2BVUA 1VENA 4OSUH 5EC1A 4O51B 2LABA 4NP4L 1KJ2A 2V5YA 4OZFA 1A6VL 3VXTB 5E8NA 2GSGB 5MERB 4E41A 4CN6A 4PJHE 2VLMD 4LSSH 3KYOB 4TULH 3U4EB 1MCFA 4ORGA 3VRIA 3B9DA 4ZMAT 2HKFL 1F00I 2VL5A 5D71L 2A9NH 4FOMA 2YK1H 2B4CL 3RY5A 1Y6KR 5GS0H 3OR7A 4ZAKA 3SDXE 4JHAH 4R4FL 2BFVL 4P4RA 1X5IA 1B0WA 4NJAH 4ZS6D 1AD9A 1N8ZA 5GIRA 1CE1L 4J3SA 4MJID 3G6JB 4H0IA 4M02A 5K9JL 3ULVD 4WU7B 4ZXBC 2X42A 5E6ID 3L5JA 1D5ZB 4L8SC 2J8UE 4RX4D 5TDPA 5FO8A 1S8DA 1J1XH 3TNMA 4Y5VA 1BJ8A 4ERSH 2KUTA 5JA9A 2R69L 4K7PH 3TCLA 1FRGH 2YPKA 3LOWA 4GRLB 3OB0K 2NY7L 5BJTA 2NY6C 5TE6L 5JW4R 5FM5M 1NMAH 1I7ZA 2N7BA 4X6EB 2ICWJ 4K7FA 3MNZB 2BVEA 2GJ6B 4I0CC 2B1HL 4NKIH 2BVQA 3QPQD 1KOAA 3S35H 2R4RL 3L5WB 3H9HB 4HGMA 4XTRC 3GSXB 1AQKL 2MWCA 4XPTL 3K80A 3LEYH 4JJHA 1KC5H 5IVZB 2VLKA 1Q0YH 2ESVB 1WWBX 3F7YA 2HFFB 4GOSA 2HAZA 5J12C 5F7DB 2J8HA 1TJHH 4JY6A 4PY8I 2H9GB 2HN7A 1X7QA 3O3EA 4WDIA 1BM3H 2GAZB 12E8H 3WN5B 4YGVB 1JGLH 3DI3B 1FSKC 3BKCL 3FCTB 2N56A 4A2MA 5LGJB 4NOFA 1XEDA 3WUWA 1MI5B 1U92A 5MENA 1CVRA 5GXBB 1YEDA 3N1GC 1BQHB 3QO0B 1ZLUH 5HYJA 3P2TA 1C08A 1MF2H 2Q76B 4S1QH 2X4UB 3FT3B 3VA2C 4LHUG 1AGCB 2Y36L 4OCMC 5EB9A 1TCMA 3DVFA 1ETZA 4KI5E 1EJ6A 3RY6C 4AL8H 1KIRA 5IMKB 2GCYA 1RJYA 1ACZA 2QQQA 1CLYL 1J86A 4WTWA 1IC5L 5E95B 4BM7A 3S3PA 3RX7A 3Q6FB 4G6FD 4QNPF 1Q1JL 1KCRH 3VMOA 5HYEA 5JPNB 5B8CB 5BV7L 2F54E 4PJAA 1TCRA 1FO0B 4M62L 4QWWD 4WGWB 5FCUL 4AT6B 5LJYH 5BVPH 5CMAA 3D69A 1I7UA 4NQSA 5A16B 1KJ2L 4YHIB 1UXSB 5L6YL 2WUBL 3A67H 2W9DL 4D0DA 1DQLH 3BESR 2XKSA 4BELD 5GSRA 4GUPB 1UCTA 2G5BA 1CR9H 3QCUH 1PQZB 1YEGL 3KLAB 3MMEB 5D93C 2Z93B 1FLRH 3RNKA 3VG9B 2VAAB 1IM9D 2HMIC 1QFWL 2GJZA 1UVQA 1YQ2A 3UTSA 1CE6A 4TUJB 2C7UB 2PO6A 4DKDC 5MI0B 1AFVH 1EUUA 4MQ7B 3QEGL 1YZZA 5JOEA 2FL5A 3TCXA 1BLNB 1DBBL 5DJ8B 3BP4A 3VW3H 3GBLA 1B6UA 1FC1A 4Q9QH 2D7QA 4JRYE 3KPRA 1ZANH 3ZT7A 1R3KA 5CZVH 2B4CC 4LPYA 4N0UB 3ARDC 3MCKA 1F6AA 4PGJA 2VR5A 4WNQA 4P23A 1L4IA 1VGKB 5IR1B 4C4KT 2FSEA 1LO0H 3OHXA 5BS0E 3S4SG 1W0WA 1LDSA 3VU2A 1QEWA 5F6HJ 3TJHC 3D0LA 4IOIA 4RA3A 1A7PL 1KBGH 4U6VH 4W6WB 4FXGB 1B0GA 3QDGB 1FIEA 5C0EB 5TDOA 1SEQL 1WITA 5I1GL 1UCBH 3L3DB 5F6IC 3NN8A 4RFOL 4QTHB 1G7HB 3SE8L 5IW1B 1JZ6A 3AS3A 4ENED 4J4PD 3VMPA 3WJJA 4G9FA 4MZ3A 5BCAA 1NC2A 1ZLSH 5DD5L 1T4KB 1CVSC 1AGDB 2YD6A 5FECB 1ADQL 2ZNWA 3GJEA 7CGTA 2EKSB 3LDBB 3G5ZB 3PL6B 3EDKA 3CXDH 4FG6D 4HEPG 4XWGL 3G5YB 5ACZA 5FCSH 2BSRA 4L29A 1RSFA 2AEPH 1MRCL 3H6JA 2DTSA 3LKOA 5ISZB 1I1RA 6FABL 3IXAA 1MHHB 1PLGH 3I50L 4H1LB 5HHMD 4G42A 4DN3H 4OM1H 3ZE0E 3CH1A 2JJTA 3OF6A 4OFVA 3QCTH 2H2SD 5BS0D 2FGWL 4PTTB 5D7JC 1QFOA 4JO3H 4XP4H 4ZXBB 2XG5A 2AJSL 1JPTL 4FABL 4L8SB 5LCVH 1OGAE 4Z7VA 5CWSB 5EOCJ 4DJMA 1XR8B 5CLTA 3S34H 3O4LA 2YWZA 3FB5A 2NX5B 1P6FA 3CU7A 4XC1L 3DUSA 4LLQA 4UI2A 4HC1A 4MCYA 4G6ML 4DGYH 2NY6B 3BZ4A 3F12B 4Z7QE 5SWSA 4NKDB 1KJVB 4G80A 1NFDF 4HPYL 2AEQH 3MRQA 4KC3B 4RIRA 3WJLC 1BJMA 1R3JB 3TA3C 4ELME 3ROOB 1GGIH 5DJXA 1F58H 2C4FU 3C60C 5FV2A 4M7KL 4PGBA 5BV7C 4CBPA 5K59F 4QXTA 3BZEB 3OR6B 1F13A 4PRIA 4XPAL 2APTA 4OGXH 1PSKH 3KPLA 1GGYA 3W5MA 5J12B 4XBGA 5GSVA 3F5WB 4QXUL 2OR9L 2V6HA 1S9XA 2R0ZH 3DRTA 4LPWA 3TV3L 1FSKB 3E6HB 2RCSL 1ONQA 5EUOB 5LWYL 2EDFA 3VXRD 1NPUA 1NC4D 4I0PD 1A6VH 1U8HA 4MNQD 3V8OA 3CFJA 4ZAKC 4LHJB 5FO9A 4RWYL 1YJDH 2B0SH 2PF6A 3CH8A 4JKPH 3GUTA 3T8XA 3CX5J 2B4CH 2PN5A 5FDWA 4MXWL 2VR9A 2ICEA 4KKLC 1A7QL 1WFUA 4R4FH 4LLVB 3DSFH 2BFVH 3TT1L 4ETYA 5LXGL 5HGBA 3FN0L 4YBHA 2I07A 5INCA 1CGTA 3LPFA 4Y5VC 5AEAA 1INEH 1HQRB 3PWNA 4KVCL 2QQLL 1CE1H 2OYPA 1EXUB 3RTQB 4ODXB 5K9JH 4YAQB 3MV7A 2G60L 1MCJA 1U3JA 4NZTL 3TN0D 4PY8J 2A1WL 4JDZB 4JZJA 2Q3AA 1ZHLA 4XCEA 1U42A 4OAWB 1FN4B 4G8FB 4JFOA 3RKPA 4MHHI 4MWFA 5SX5K 3FB6B 4KRNA 2NY7H 5TE6H 4F58L 3GZKA 1INDL 4MA8L 1UADC 2CDFB 4RISL 3QNZB 2Q8BL 3ME0A 1WBZA 4UIMB 5HHVH 2IPUK 4O5LL 5FUCE 3IDJA 4JFZH 2B1HH 3LV3A 5D93B 5EO9A 3R8QA 3G5VA 3NA4A 1M6OA 3LS5L 1YEIL 2BOBA 2OJZL 2YHGA 1UM6L 2ZWLT 2FIKA 4OJFL 2VE6A 4HK0B 5GRZA 4BH8B 1VESA 1LNUB 1AIFA 3RWIA 3BKMH 5DT1L 1UT9A 2FBJL 5J1TC 2E9BA 3BKCH 5DRXB 3LKRB 4FRWA 1UM4L 3ARDB 1NFIA 2BVOB 4QRUA 3BJ91 3VCLB 2ADFH 4YE4L 5BZWA 4HC1L 2NLJA 3CFBB 5DURB 3QFJE 1F3JA 5HHOD 3OKKA 3FZUC 4LKCB 5J4MA 3MSPA 2M26A 1VGEL 1T22B 1RZJL 2BNRE 5KSBE 4U1MB 1JRHL 1WC7A 1ZHNB 4XPFH 5EC2B 4BK5A 1R5WB 1P6AB 1OT1A 1PX3A 5F6IB 4UNUA 1IC5H 3QJFB 5B39G 4X7TB 5CGYD 2C3VB 1XT5A 1Q1JH 5EWIL 2X70B 4O2CB 2H26A 3NCJL 1NBVL 1QSEB 32C2B 1T0NB 3BXNA 4M62H 4PG2A 5FCUH 1YUHA 4OZHA 1MCKA 2F19H 5TDNB 3DBXB 3UJJL 1NGYA 1KJ2H 4OZFH 3ARUA 1NSNL 2DLIA 1QVOB 4BZYA 3VXSD 1NCCH 2XN9B 2PO6C 1YEGH 4HV8A 3L1OL 1UQSB 3TBSB 5C86A 5DJCB 4YFLI 1P7KB 5C0CA 3VGHA 4APQA 3TBYB 1AR1C 1FL5B 1RZIA 1OTSD 3EYUH 1QG3A 3V5DA 3E0GA 4MJ6A 4ZUSB 1D5IL 5D1QA 3EOTL 4P23C 2RR3A 4JREC 2FIRT 2HT2C 4JFQA 2NXZD 2VDNL 5HYQB 2GK0A 3QFJD 1OGTB 2EDDA 3NIDF 4LPUA 1IKFL 2QQKH 2BNRD 3VGAC 4MDIA 2VH5L 3UJIH 5EOCL 4L4VB 1VFBB 3T77A 4PRHE 4CVZA 1CFNA 4X98A 3GM8A 5F7EL 5C0BE 3GKWL 3B9KD 1S7QB 1BFVH 1N4XH 4QRRE 3WJJC 5DVNA 4X99B 3PABA 1FGVL 5I1IL 3TA3B 5I1GH 2BERA 3FONB 3QO1A 4RFOH 1PG7H 3C60B 1J0JA 1EAPB 3BISA 4X4YB 5BV7B 4MAYD 4LF3A 3X13A 1CD0A 1CDJA 2IPTH 4NO3A 5EC1B 3KLHD 1D5XA 3ZKMC 1KJ2B 4OZFB 4BQ9A 1IKNA 5E8NB 2PCPA 4E41B 1I3RA 5EZIH 3HG1A 4AEHL 3RZWA 4OZIE 1Z9MA 5AAWA 2KZ1B 4ORGB 3VRIB 5CD5D 1MOEA 2C3HA 5FGSA 2VL5B 5L2KA 3GMLA 1J5OH 3O3BA 4LCIL 1SEBA 3OKDA 3OR7B 4ZAKB 5ICYA 2QADC 5C92A 4MAUH 1MCSA 4P4RB 4UMGA 1U8KA 1MRCH 3W11C 2J88L 2OTPA 2JJTC 1EVUA 1AD9B 1N8ZB 5GIRB 6FABH 1D6EA 4Y7MA 3TH4T 3G6DH 1P7QD 4DVRL 1A6AA 2OR8A 5AWNH 4X7DC 5F7LB 4I9WE 5FO8B 5TDPB 4I4WA 1S8DB 1ZMYA 2MHAA 3U0WL 4KROD 4NJ9L 4Y5VB 2AK4E 3TNMB 4PRHD 4C56E 3FRPG 4XGZA 2CMRL 3V5KA 3AUVA 1Z9OA 5GRVL 2X1QA 3JTSA 5HGGS 3TCLB 2YPKB 5GS1A 2J6EA 2AJSH 5BJTB 4FABH 1F6FB 4BK4A 1I3UA 2AJ3A 5B21A 4QRRD 5JOPE 1I7ZB 1RZJC 4PJGE 5D72L 4K23H 1X5HA 2KDGA 2BP3A 5GJSL 1X5ZA 4MB4A 3VGBA 5B38A 3VXQA 3BMVA 4NCC2 3W39A 2BVQB 1IARB 2FECI 3PHOA 1I9EA 4G6AD 2C26A 3TJEH 4OT1L 4WV1A 4HPYH 1U36A 3FMGL 1DSFH 2BNUA 2VLKB 2YD9A 5TFSL 2ZZUT 4ACPA 4K3EL 4JO1H 4LSDA 3F7YB 1S3KH 1O7SA 2AJYL 4JQIH 4JY6B 1FAKT 4PRPD 1RV6X 4M7KH 4EEEA 2HN7B 4MXVE 1X7QB 3O3EB 4WDIB 2ATKA 3TNNA 4G8IA 5JPMA 1JWSA 1JNHA 2DQJL 3HZVA 4LDEB 4FQ2H 2DD8H 3WUWB 4QXUH 5D7LA 1U92B 5MENB 3QEUA 4EUPA 1YEDB 1VDGA 1REIA 3LAFA 3TVMD 4MLSA 5HYJB 3OJDA 4N0YL 5LWYH 1C08B 5I8OH 5E8PA 1BZQK 1ETZB 4WEUD 1OTTD 4RWYH 4DOHE 2ZNXA 3RAJL 1T89A 2AK4D 4DGVL 4C56D 1KIRB 3BT2L 2GCYB 1RJYB 1MNUL 1M7XA 2HYMA 3SKJL 3FO0L 1A7QH 1BBJA 3GIZL 3H9SA 2LU7A 5JOPD 4JZJC 5IJKA 5ANME 5C3TA 4YR6A 3FB7A 4M1GL 4KVCH 4YDIH 4DVBA 3OXSA 1ZE3C 2EO1A 2NW3A 2AJXH 4P4KA 4MDJA 1TCRB 4PJAB 5EULV 2P47B 1YNLL 4JO4L 3ZKNC 4Y4KD 1B6DA 3UZEA 5CMAB 5IB2A 3KDMA 2R9HD 1I7UB 3D69B 4NQSB 2N1KA 4Y4HA 4D0DB 1T0PB 3MREA 1M1SA 5GSRB 5I76A 5FYKE 1IC4H 1MFDH 3UZQA 2G5BB 1G84A 3RNKB 4D94A 1X6LA 3U9PL 4PBXA 2Q8BH 3FFCA 2GJZB 4WCYH 1UVQB 3UTSB 1H3TA 3AS0A 1CE6B 1YY9C 2PO6B 5GHWL 5D8JL 2FL5B 4NFBA 3BP4B 1BQSA 3EHBC 4KUCF 4X80L 3P11L 3MACL 3ZDXE 4ZNEE 2VL4A 2YRPA 3KPRB 5JMRA 3OAUL 1YEIH 2B5IB 2H8PA 1R3KB 1PKQA 3ARBD 1EAJA 4EXKA 4FZEL 3VDCA 3QULA 1EIBA 5F96H 3MCKB 1F6AB 4WNQB 4P23B 4JREB 4Z9KB 3U83A 3HI1A 3LKQB 2FSEB 2FBJH 4HS3A 3OHXB 2J6EL 1A6UL 3T2QA 1W0WB 5JHLH 3QRGH 1B0RA 1QEWB 3P4MA 5EORL 3D0LB 1UM4H 3VGAB 4IOIB 2BK8A 4LQFL 1NMBL 1B0GB 4HIEA 4HC1H 4JHWL 2WBKA 5FDYA 5TDOB 5E4EC 3WIHH 3RJQB 1IC1A 3NN8B 4PLOB 4Y0GA 1RZJH 1EEYA 1Q8MA 3RNQA 2XQYK 1JRHH 2CDEA 2EO9A 1GC1L 2OL3A 3F7VA 2AABL 3QXWA 1NC2B 3GJFA 4Q6IA 3VD7A 4F7EA 2ITDA 2NY0D 2D7NA 4C55A 2NY1C 5AG8A 3GJEB 2JKXA 2W0FA 4YFLF 2PUQT 4PG2C 4PJ7E 3SQOL 1JMXA 3BN9C 1I9IH 4IDJL 5ACZB 2BSRB 1HN1A 4L29B 4U7KA 4OI8A 4ALAH 5LKNA 3UJJH 1B9ZA 5C9JA 1NSNH 2J3SA 3LKOB 4TPRL 4BYHA 3U0PA 3IXAB 4APQC 2QADB 4R2GC 4OD3L 3L1OH 5A2FA 4G42B 2X4TA 1RUML 2R2HA 3CH1B 5DD1L 5D1QC 3VD5A 3UXFA 3WLWC 4XC3L 1FNHA 4Y19E 5I1HH 2ZSWA 3R0MA 2JCCE 2Z92A 2VC2L 4AYFA 2X1WL 1TITA 2QEJA 4LLWA 3WKML 4Z7VB 5HJ3A 1MJ7H 4AEIL 1A21A 3O4LB 5E0QA 1D5IH 3MXWH 3EOTH 2FH8A 3CGTA 4YFDB 3FB5B 3UTTE 1B2WL 3DUSB 3KHOA 4LLQB 2VDNH 5A43C 5JXEA 1E4XL 2OM5A 4LCCA 4MCYB 4YHLL 2SEBA 3N1MC 3BZ4B 3LB6D 3LRHA 4OUOA 3BGAA 4XX1E 1F6LL 5SWSB 4F3FA 4G80B 3D87B 2B1AH 3CMOH 3CFDA 3MRQB 2ZKHL 4RIRB 5F7EH 1IGCL 2Y6SD 3GKWH 4K3HA 4HK3N 5DHYA 5DJXB 3OGOE 3HE6C 4PJFA 5B3JF 5J1AA 2FD6H 4PGBB 1YMHA 4EN3D 4QTIH 4QXTB 3E3QE 2VQTA 3DUUA 5L2JA 1WWCA 1FGVH 5I1IH 3KPLB 1Q9KB 1IKNC 4G7VL 1FV1A 4XBGB 4U3HA 5GSVB 4N8VG 3SEPA 2LAAA 1UWXH 4XH2A 2IF7A 1BJ1H 1S9XB 3DRTB 4Q58C