4MSWB

Y78 ester mutant of kcsa in high k+
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Using protein backbone mutagenesis to dissect the link between ion occupancy and C-type inactivation in K+ channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
total genus 54
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2013-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mswB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mswB01
3MRBB 3T1FA 2B1AH 3EOAB 3S6CA 5K59E 2F5BL 3IDNB 3KYKL 4FQ1L 5FUOL 1ZT4A 1YY8B 3QR2A 4YUEH 1IC5H 2FR4B 1UXSA 5JW4M 3BQUA 3H9HB 4YHYC 2I9TB 3IDJB 4HUUA 3S35L 2FX9L 2VLKE 2NTFA 5L2KA 1TZHA 1UWXH 1J1PH 1E28B 1KACB 3RVTC 3LDBB 4U1GC 1BZ9A 5LG1A 1IKNC 4Y89A 3TEUA 4K7FA 2XN9B 4WW2A 5M7QA 3BIKA 4GW1A 5GS2H 1QNZL 2ITDA 4N0YH 2DI7A 5IQ7L 3BUYA 3QI9B 2ZSWA 4NQTA 1T7VA 3K74B 5FAAA 3EHBD 2HFGH 3PABB 5IJKC 4LVHB 5F1OB 2KPNA 3TO4D 5KVEH 3I6KA 1AO7A 1OM3L 1P4IL 5I8EB 4U49A 3F7YA 1UWXK 4HS6A 3MYJB 5D96B 3HC0B 1AGBB 4G6KL 5IK3B 4AQ1B 5F88A 5DVOA 1SYVA 5DJZB 1GAFL 4NOBA 1NGYA 2BY1A 5ENWB 1NBYA 3EDKA 4GMSH 4MLIA 3VXUB 1FC1A 4JPWL 1B88A 1NC4A 2YA1A 3C5JB 3RWGB 3SKOA 5CJXC 3V7MA 4WUUA 1YEDA 5J7CC 4MCZB 1C16A 5SWQB 2VE6B 1KCRH 1DBMH 5EOCH 3W9DA 2IQ9L 5JHDD 2HJFB 2XZCH 1BBDH 3IS0X 4CKVX 3KPOA 4RX4D 3QFJB 2A83B 2FEEI 2J1KA 4JQIH 1UVQB 4NZUH 3UPCA 5CEYB 3CH1A 5F7MC 2DQDL 2JIXB 2VQUA 2IH1B 3AB0C 4PRIB 4I77H 5TFSL 3W0WE 1T5WA 1U8MA 1A5FL 2BC4B 4QGYA 2ARJQ 4N0UB 1NFDA 5KSBB 3FMGL 2JJTC 1WZKA 3NCJH 4W68A 3QH3B 4HWUA 3X14A 3X12B 1T1XA 5E95B 4B5EA 3ARUA 1LD9B 1IAII 2EDQA 2DD8H 3HZVA 1L9NA 2A6KB 4Z77A 1ZVYA 3EJZD 1VFBA 3OAZK 2YEZB 1A0QL 2XA3A 3BGMB 4KROC 2M2DA 3CSGA 3DVNB 4PJFE 4Y4KB 4HKZB 4AEFA 5HYQA 5IMOB 4O51B 3T0BA 4PB0L 3MMEB 3O9WC 4OZIF 1T4KA 5C6WH 2DJSA 4XVSL 1LK3H 3ESUF 4QT5B 2WWMD 2XFXA 3RIFK 5SWZB 2CRIA 5SWSA 35C8H 4CAGA 3G6AB 3ZDZF 2EICA 1A21A 3B6SB 3SHSA 4HK0B 4MNGB 3BZEB 1BF2A 2XTJC 3V0VA 4QXUH 1NCAL 5K9JH 4K94H 2JK5B 4NRXA 3NABL 4U4BA 1H0DB 1NLBL 3D3VA 5D5ME 4FFZL 5DMGC 2YSSB 4H20L 3QJHB 2EO1A 3CU7A 3MRKA 2ATKA 5J9PA 4Y5VB 4AENB 1YMMA 5IW3A 2IBZX 2GEEA 3FB5A 4I48A 4QXGL 4YBQD 2C3GA 1WIUA 5D2LF 2Y23A 5EZIL 4PJGF 1CN4A 3BP4A 2P24A 4X5XB 3ZO0A 3O11A 1ZHLA 1II4E 3LKPB 3U7WH 4O58H 4LLWB 4J7RA 3UMTA 4MJ5A 4N8CL 5I8KL 1RJCA 1U92A 1HHGB 2NY5L 4WJ5B 1I1CA 4HGMA 43CAA 1NGPL 2IC2A 3HS0A 3TCLA 1R3LB 3N1PC 4QRRB 2LQRA 3WIFB 4QRPE 4XNQA 3O2DH 2CDGB 2FX9H 1DJSA 3MOQA 4P57B 4L5FL 4Y4FD 3BP5A 1VGEL 2FR4A 4XCYB 5FM5M 2APXA 4M7LH 3U2SA 4W70A 4Y7MA 1BF8A 1U95A 3QDMD 2R0ZL 1P7QD 1Y6MR 4TYUA 5DI8A 4JM2C 1V05A 3UTSB 5DD5L 2NR6C 2YD7A 4YHKH 2D4DA 5HHMD 5E00B 4OAWB 1T0MB 2CPCA 5KVEL 3H7BB 3TBYA 1P4IH 3LOWA 5F1KC 4JO4L 2X4NB 3MGTA 1MRFL 1OCWL 2FLBT 5EH1A 4XI5D 4M1CD 4WI5A 5BS0D 1RZ8B 3EKCA 4NQDA 5EU7E 1CLYL 2OJZL 1BOGB 1UQSA 4KAQH 2PW2B 1RI8A 1T6WA 2Q7NA 1KG0A 3DX8B 2Z4QB 4HS6B 3OJMB 3QPQC 1KJ3L 3WEXA 3GB7B 1IGTB 5GS0C 1J8HE 4HAFA 1MIEL 2DQGL 3CDGA 1DBML 5EOCL 3R8BB 1C5DA 4ZFFB 1OP3K 2XZCL 4JG0L 4TRPL 3U7YH 3D5OF 4D0DA 4NZUL 3GSQA 2APTA 4BK4A 3L3GA 4MXVF 3NH7L 4LLWA 1TQBC 2WBWB 2ERJB 3MJ8A 1U8HA 1VEPA 3P11H 5HGHA 3N50A 1AIFA 4AIZA 5E1AA 3NCJL 5DD1L 3SO5A 4X7EC 3I2CL 3PWNB 4EN3D 3PDOB 4FQPA 3V4VL 3MRMA 4ZFGL 4JVUA 3BSZH 1TJHL 2J8UF 3HZMA 4ODWA 1X6LA 1F8TL 3CVHL 5DFTA 5SX5K 3NTCH 5D93C 1D5ZB 2GAZB 4KUCD 3RPIA 1AGFB 1IC4L 1KCKA 1XGQB 3E6HA 2X10A 3UTSA 3QXUA 4D3CL 1OGAD 4LPVA 1DQQA 1WQVT 3TVMD 4M8QA 4GRMB 3QHFH 4DVBB 4YQXL 3RUGA 5I71C 3RVXD 2F19H 5F3BA 2E7LA 1M7IA 5DJXB 2WBJD 1HI6A 4CVWA 1KLUB 1H3TA 3MODH 4FZ8H 3FO0L 4L4VD 5IB4B 4XNMB 5ETUB 3REWB 2YD1A 5K9JL 1F3JB 4XX1G 1KCSH 4KMTH 4IRSB 3V7AE 3AXLA 2VH5L 4YE4H 3FO2A 3LQAL 2R4SH 1WZ1H 3SDDC 5EWIL 5C0BE 2AAVA 2V2WB 3BEWB 3LRGA 3RIAF 2FHBA 3X3GL 5LVEA 4WHCA 4XP6H 1T2QH 4QXGH 4X7CC 1YY9C 2BVQB 3BVNB 4U1SB 3TFKC 3OKYA 4U6HB 4YX2L 1CICC 4JLRA 4X7TB 4D0DB 2DM2A 4NN7C 5EZIH 4HT1L 2C1OB 2P8LA 3V8OA 2VDML 2ADJB 3Q5TA 4DUXA 1J10A 2GTWB 1ZGLA 3QUML 1E4JA 1KLGB 1FZOA 4NO3B 4WFFD 1U8OB 2XZQH 1EXUA 2P4AB 5KSAA 3BI9X 1H8NA 3CUPA 3F7RA 5GSVA 3M8OH 3ZL4L 2VL5A 3FFDB 1NAMH 4O51A 5FYLE 3NFSL 2EKSA 3T3MF 1I9JL 4Z7UB 3VFMA 3MLVL 4AZ8A 4P4KC 5C7XL 1EFXD 4L5FH 4LQFL 5KVGH 2VDKL 1SJHB 3MGAA 2XTJB 3QJFA 1I7RA 3DTXA 3D39B 3WDJA 1JNHA 4JFHE 4QTHB 3O2DA 1OSPL 1FFNB 3KXFA 5DD5H 3PGFL 1E0OB 4WTWA 2PCPB 2D7NA 4MMZC 3DROA 5D1XD 3TIEA 1FNSH 3JWDC 5CJ5A 1QRKA 2MPAL 1N0XH 4N5EC 5DUML 3C08L 3TA3D 3DBXA 4HJGA 1H15B 2NYYD 4H26B 4WWID 3NPZB 3GSOB 1T20B 4AEHL 5K59F 3OF6D 4IBLT 4XPAL 1JFQL 1G0YR 5D6DA 2FX7L 4ETQB 1QR1B 4L4VE 3NAAH 3T8XA 3KR3H 1KTLA 1JNNL 1UM4L 1KJ3H 3MNWB 4LAQL 4N0CC 4KK5D 5FB8A 1JUFA 4MJID 2FX8H 2Y4SA 3HI5L 4TRPH 5JZ7D 5EC1B 3RX7A 1MCSA 4IJ3B 3VFOA 1YMHB 5D2LB 1HHKA 5ECJE 1YEJL 5MENE 5HD8C 2NY2D 4F3FA 4JFOA 1I3GL 1S9XB 1S7VA 4G8EA 3IF1B 2ZG2A 1IGYB 1QBBA 4GO6B 1SEBB 1Q8MA 1IAKA 1U9KA 1XF3A 4GSDH 3G6JB 3U46B 4KTEH 4POZD 3ALPA 5I66A 5KN5A 3D87B 2D7OA 4L9LA 2M8XA 4HJJL 4QRRD 1R5WB 5F9OH 4WDIA 5FYJD 5B3JE 5KG9A 4XVUD 3MLRH 3AS3A 4UOW1 5CEXA 3JWNC 1G7JB 2LAAA 5MEPB 3P0GB 1KPVA 1BZQK 1DANU 1WGOA 1VFUA 5ADPL 4PV8B 3K80A 1EJ6A 4R26H 2BNQD 2IBGA 2A6KA 4IMLB 1FCCA 1OW0C 1RIHH 5DK3A 4GS7B 3QHFL 1MLBB 4NKOB 2BVUA 1A6AB 1T83A 5D4QA 2B4CC 4JANB 1GOGA 1NJ9A 1VADA 3EDDA 3UTPE 3BZFB 3MV7B 5HGDB 2CH8A 1WCQA 1X5YA 4P49A 5DWUL 3T4AA 3P4LA 3O3BA 3KPSE 4XCCH 4O02L 1FYHB 3C5ZA 1CD0A 1F45A 1NL0L 1WAAE 3LRSA 1JF5A 4QHNA 4KROB 2PXYD 1HZHH 4NO2A 1BJMA 3MCG1 3T65A 4XCNB 4NQVA 3LB6C 2R4SL 4I18C 3WLWD 1QBLH 5E8NA 3EBAA 2YD5A 5JLZB 5E8OB 4Q58C 1MI5E 4ZOEA 1I9RL 2H32A 3K46A 4POUB 4XB8A 3BH9A 4JN2A 5DZLA 1FBIL 1RIVH 2WM0A 1IEBB 3G5YA 2MWCA 3UAJC 4M6ML 5HY9A 4P46B 2P49B 5BVJB 1TIUA 3B5GA 5D71H 2QBWA 5FKPB 1L4IA 4OLXL 5DDHB 1SEBA 3D18B 1GHFL 2EDWA 3D3VE 3TPUB 5JXAH 5GXBB 4XP1H 3GRWL 4G42B 4OFDA 4RMVA 4EXPX 1RUKH 1LMKA 5C7XH 4PJ7E 3FB8B 4XBGB 1SJEB 5GSRB 2O61A 5KVGL 5HSFA 1RMFH 3WKML 2FYYB 4NQDD 2FB4H 1RZIB 4KI5E 4RGNC 1MWAL 1OP3H 5IVZB 1EMTL 2VDOH 2C3VA 4YIQB 1CFBA 1JZ5A 3SDYH 4JKKA 4LRNH 2DIJA 3PGFH 4PJBB 4LPUA 1I9IH 4MJ4A 4NNPH 5CP7B 3ZDYF 3ARDA 1C08B 1HIMH 1MCPL 1TZHB 1MF2H 5DUMH 3D0LA 4UU9B 3TH2T 2QSCL 4PR5A 1FO0L 3P30L 3S36H 4S1SL 5IM7B 1JFQH 4LDLB 2FL5B 1TJIH 1P6AB 5BXFB 4MCZA 3OSKA 3L95B 3I50L 4WO4A 3H7BA 3TBYB 4JM2B 1TZIB 1R24B 2EDDA 5EU6D 2NY0B 4MA7L 3LN5A 1KEMH 3TGXA 4LLYA 1RK0B 5HHNA 1J0HA 1MPAH 2A73A 4QY8A 1IM9A 4DEPC 1T5XA 4OV5A 5L2JB 2CQVA 5MEQA 1MRCL 3HE6C 2APFA 5D7JA 2HVJB 1IAMA 3FB7B 5B38G 4BH7B 1BQSA 3L3HB 5INCB 4R4BA 4GMTL 1FSKB 3ARDC 4R8WH 1CFQA 3V6BR 5BVJA 1V3LA 2Y5EA 1ORQB 1OAUL 1I3GH 1R6VA 3A6CL 1BQHG 3OAUH 2RCSH 4F8TA 2DBLH 3SGEH 1WC7B 2FJFB 3ZHLA 1VKXA 5E8DH 2XA8L 1BEYL 3TJEH 3PNWB 3CVHA 4GSDL 1TVHB 2AI0L 2EDTA 3NFNA 3ZKND 5F8RC 5DVLA 3IJSB 5E56A 4KQ4L 1A6WH 1H15A 4NGHH 3EO1B 4FABH 3RVWD 4X7FC 1FQ9C 5HVHC 5ANMB 2W07A 2ENYA 3QCUH 1YN6B 3TV3H 4Z8FH 2VRAA 3O3DB 3NIFE 4HIEB 2AEQL 2IFFH 3K2UL 1NGQL 4LSVH 4HIJA 1RZFL 4K3JL 2O5YH 2H2SD 4PJ7A 4PRHB 4I3GA 5C9JB 3BD3A 1XGPA 3KPSD 3BKJH 4W4NA 3SDAA 1NMAH 4K7PH 4PV8A 3U48A 3OXSB 5C92A 5CLWA 3UO1L 4U6YB 3KPQB 4LAJH 4ZPTA 5DWUH 1MWAB 5L2KE 2WIIB 4QTIL 4WW1B 4PFEA 6FABL 1PLGH 3AREB 3SO3C 3D69B 5IFAL 1JN6B 3MFFA 2ITDB 1Q0YL 4P5KB 5DEFA 2AEIT 3CIQA 4P0DA 2XV6B 3ARED 4BA8A 4K8RD 5D7KD 3I3BA 1QBLL 1XF3B 3V7AG 1CT8B 1EO8L 1NGWB 1ZHLB 3BZ4B 3LRSB 2UWEF 1CL7H 2MCPL 1GVIA 4NN5C 4LIQL 4M6MH 3ARBA 3LD8C 4LOUC 4N8VB 3FFCB 4XCEA 4OIIH 1Z5LA 4LF3A 2I60H 3MRKB 1B0WA 4XH2B 1PQZB 5I1JL 2EEBA 4CVZB 4JAMA 5JA8B 5I9QC 4KKLD 1EEUA 3MV01 1EHNA 5HGAA 3EOTH 5HY9B 2Z31B 3MTRA 3SGEI 4XP1L 2QADD 4FFYH 2P5EB 1ZWIB 4YDIH 5IVXF 4XC1L 1DR9A 3T04D 2CO7B 4GKSA 3LMJL 3VWKB 2M1KA 4L1HA 5E8EB 2VYRE 4KTDH 2JJWA 1MCCA 4PRIA 1CIDA 3F5WA 4FG6D 2B1AL 4MD4A 4HHAA 1TLKA 4OQTA 4MDIB 5DRXA 5C1MB 3GMLA 3WNPA 3FHQA 4TQEH 5FUOH 3X13B 4G8GD 4D9RD 5BW7C 5JOPD 4BFGA 2AEPH 1R3LA 5E24E 1CICD 4X98A 2CK0H 1MNUH 3QRGL 4NBXB 3W9EA 4ONGH 1CI5A 1I9IL 2AGJL 3MREB 3H9SB 5AZEL 4M7JL 1LQSR 2AQ3A 3U1SL 4MSWB 5LGJB 2ICEA 1J1PL 3ZT6A 1HHJA 2PCPA 3H3PL 1NGZB 1CVRA 5FYJU 3W82A 1DUYA 1NEUA 2IMNA 2GFBA 4WGVB 2DDQH 5MENA 1NLDL 4P4KD 3UTOA 1CICB 3V4UH 4MA7H 1WFTA 3G04B 1K5NB 3QEQD 3R1GL 3W0WB 4PGBA 1BM3H 1YPZB 5DJ0B 1BMGA 1CD9B 1OGTB 1MCQA 3DRTB 3RY6A 1G9EA 1ZTXL 3W11C 3L95A 5HJ3B 4X6BA 4B41A 1P6FA 4BFBD 4LSTH 2IAMC 2HYMA 3VDBA 2R56L 1TETL 5KSVA 2IF7A 3NA9L 1G9MC 1SY6L 1J9CT 4KZDH 2BSSA 2DQEH 2J12B 3AROA 4DEPB 4UINH 2YMXL 3MCLH 1JRHH 2D0HA 3A6CH 4XMLH 2X7LA 2HVJA 3BEVA 2FJGB 5FYJE 1FFRA 3UZQA 3RFZC 4TSCL 2GI7A 4OLUL 5JW5A 4DAGL 3FONB 5TF1L 2LABA 1TFHA 4J6RL 1IM3A 1BBDL 1X4XA 4UT6H 3L3JA 3IF1A 4YGVB 4HIHB 5HPOA 4JQIL 3BP4B 3TZVC 3Q6FA 2EZ0D 1OTSD 4Q0XH 3SDXE 4XPBL 1H8OA 1IL1A 5D7LD 5B8CC 3R06B 1KB9K 1Q9LA 1YYLL 5KW9H 3MUZ1 4FQHA 1YJDH 3UJIL 4PG2A 3GM8A 4KY1H 1NC2D 3RGVB 4M1GL 4P3CH 3KPRD 1B6UA 3DX6A 2Q6WB 5EUOE 5B21A 3BKJL 5BQ7B 3AS1A 3QIBA 2J88H 3VXQA 5GRVL 3UO1H 5F89A 1M7DA 2YPLA 3KLHC 2AXFB 1Q9KB 5GGVY 4FQLH 5EU5B 2YKLH 1N59B 1S7UA 3REVB 2EDBA 3EGSB 5I8OL 1BQLH 4PJFB 1HYRC 5EZOH 1CFTA 1AHWA 5D7IF 4OGZA 1M7IB 2VKXA 4M61A 4XVTH 5HYSB 3G08A 4BZ2H 4X6CF 3QDJD 4ONFL 35C8L 2CIIB 3C6SA 5EIIB 4JY5L 4N5UA 3I6KB 4OFVA 5A2JH 5E9DE 3PWPD 4H1LB 3MJ9L 2PYED 1DFBL 1LK2A 3Q1SH 1FP5A 4TULH 1NCAH 4LFHG 3OGCB 4OIIL 3DARA 2E8ZA 2PYFB 3WNNA 4PJ9D 1DEDA 1UGNA 2ZJSH 3GEWB 1SVZA 2DRUA 1AR2A 1HYSC 2BVQA 1W0WB 2HAZA 3VFPA 4FTVB 5LBSL 2IANA 4JLRB 2QHRL 5C09A 3C60B 1IC7L 1MJ8H 3BH8B 3AFLA 3WE6B 2FEEL 1C16B 5SWQA 3OXSA 3LMJH 4MQTB 1WWCA 4I0PD 3O6FC 4D9LL 2F9BT 3GJFK 4M4PA 2ZOLA 4LCWD 4TVPH 5GS1A 4Y4KA 5E1AB 1JV5B 1OB1A 2W9DH 1E6OL 1BQUA 5KVDH 3O2WH 3D85D 3ZKNC 4QRRE 2R0KH 2BVPB 3UTTA 2BY0A 4RIRB 4IMKA 1B4JL 3X13A 1KENH 1AC6A 5A3ID 2VITB 4GG8A 1KYOJ 2IH3A 1CGYA 1U8JA 5T3XD 1FFPB 5HHME 2VUYA 1MAKA 2Z0BA 4KHXL 1NLDH 3RWJA 2FCBA 3Q48A 1KNOA 5EBLA 4NUJA 3IFNH 3IJYB 3L6FB 3R1GH 1DVFC 4GRMA 2P5ED 4PRPE 1HHIA 3HPLB 3MRDB 4DN3H 4NZDA 1GZPA 1IILE 4H1LH 4RMQA 4Y2DD 1I4FB 5FHAL 4G8GE 1OCWH 3IDGB 4PRHD 3CFBB 3SJVB 2LAGB 4YHOH 3EYOB 4YDJB 5FM8A 3LQAC 3GSWB 1U3HB 3FT4B 3NA9H 4GW4A 3B8YA 4DKAA 1SY6H 1TPXB 3U46A 2CO6B 4LKCB 4I9WE 4UINL 5C0GA 5FUZL 3B2VH 2QL1A 3RZCA 4BFIA 2CDEB 5E6ID 3HUJF 2UWEA 3S96B 5IB5B 1AQKL 4FHBD 4OGAC 5FB8B 4GKZB 2K9UA 1OT1A 3MRLA 1INDL 4K8RC 2XWJA 4DTGL 2DJ4A 1MIEH 4JFQA 1WCBA 3SDAD 1XEDA 2OXHA 3V95A 4NZJA 3IFPB 3KWWB 1I3VA 3TN0A 1T0PB 4JG0H 1U0QA 2ATKB 5J9PB 3U7YL 1KEGL 1VKXB 5IVXB 3GMNA 5IB1B 1NUFA 3MPCA 3UTPD 3RA7H 1K6QL 3T77A 3UYRH 2DYPA 4U1KA 3U9PH 4Z7QE 5E94B 3OKEA 2HT4C 4NO3A 4Q97A 1YYLH 4GAYB 4KQ3H 2UUDK 4ODTL 4I3SH 1INQB 2V7HA 3O11B 2XACC 4GKNA 2VL5B 3FFDA 1A1OA 1BHGA 4KY1L 4LLUB 3FHAA 5DD1H 4R3SA 4M1GH 4P3CL 4NKDB 5IOPB 2YUZA 4OAWA 4FFVD 4D9RE 1CU4L 3S3JA 4ZUSB 3UJTH 4OF6A 2NY3D 1WBXB 1JGDA 4JY6A 1JNJA 4FQLL 4MDJA 3PV7A 2CMRL 2LVCA 5JDSB 5F1IA 3TH4T 4PJFF 3WIHA 3QWRD 1HH6B 1X5ZA 3SDXF 1BQLL 2X1PA 3OG6B 3MV8E 1N7MH 3ZYZA 3TBVB 3MOAL 5KSUA 3U79A 1FH5H 1CLZH 5JIHA 4BZ1H 5IBLD 4U3HA 4NYLA 4AEIH 3HPLA 4W6WB 3JV5A 1QSEB 4WIQA 3SN6N 5EZJA 2B0SH 2EYRA 1NFKA 4PD4J 3MFFB 4U1HB 5F9DC 4OZHF 3ILPA 5JNYB 1GZPB 2F19L 4MAUL 4LU5L 1C5BL 1MJJA 2XWTA 1PEWA 2VDQL 4PGEB 1HYSD 3EOBB 4GKOA 1SY6A 4K3HA 3MODL 4LHJB 5JA9A 4OFYA 3E8UH 5I30L 4XWGL 4JFYA 1RU9H 1OL0A 2Y72A 1RIUL 3AY4C 1YN7A 4WI9A 3VRLE 4NQDB 4HCRH 1PX3A 2ZJSL 1HNFA 2CSPA 1F2XK 4CBPA 1NAMB 2NR6D 1L0XA 5HI4C 3JV0A 4Y19E 4IS6A 5D9SA 2H6PA 3UBXB 4BELD 4ORGB 1WWBX 4P9HC 1MJ8L 2R8SH 4X6FB 3GI9L 1UJ3C 3VFOB 5IVNA 1A6TB 4PRPA 1JYVA 1LO0L 3TH3T 3QSKB 3OAYK 1CLCA 2DMCA 1MCIA 1EAPA 4U6XB 4X99B 3D0LB 3S7GA 3M8OL 4CU6A 1NAML 1BZ9B 1DCLA 4ZXBD 1E6OH 1FL6A 4MA8H 3OR6A 4ZO7A 1P7HL 3ULUE 1BAFH 2L0DA 2VLRB 4HAGA 5CZXD 3ROOB 2X4SA 3UTTE 3QNYA 2OJEA 1B4JH 1R5WA 3W81A 4EQ2A 1XGTA 4S0TD 1HH9B 1RZIA 4PYHA 3KS0J 3C2AL 1F11A 2DM7A 4M3KB 5F6HJ 3T2PA 2PO6C 4ZOBA 5DK0A 4KHXH 1WZLA 3BPNB 5A16A 1OSPH 3VRIB 4LLDA 2FBJL 1AXTH 2X89A 1FL3B 5IQ7H 3S34L 4JFFA 1AGFA 5F88B 2W65A 4Z76B 4P9HL 3H8NA 1D7FA 3WFCH 5GGRY 5JXED 1OM3H 4DCQA 2K7PA 1JCKA 3MYZA 2EXYD 3QCTL 3VG0L 3DRQA 1BFSA 5GZOC 5HJ3A 4OFPA 3VXUE 4V1DD 4L4VB 4PRDA 3L7EA 2IAND 2ZUUA 5C09D 3BPOB 1ZAGA 3KR3L 1N5AA 3VXNB 3IDGA 1QLEL 1SMAA 5KJRH 3DXAD 3RWEB 4P2QD 1NAMA 4JRYE 2FDBP 5DVMA 4Z0BH 1ZHBA 3BO8B 5E6ZA 3TESA 2C4FU 2PW1B 4N0FA 4C83B 2IQ9H 1MHCA 1U8MB 3HTLX 3S96A 3PGDA 5DFWH 2HFFA 5EORH 4OJFH 2F53A 4ISVB 1I9EA 1C7TA 4XNQB 4NZTL 5I1LA 4P48A 4P3WA 1FFPA 4FS0A 5K9QI 3O41B 4I77L 1KIQA 4K23H 5C0DA 2X05A 2G5BA 1A5FH 3TC9A 1KGCE 3EYUH 4U1MB 3TO4C 1ORSA 4EIGB 3R06A 2KBGA 2JB6A 1LWRA 2YPVL 3OZ9H 1U95B 5DJCA 1I1FA 1AD0B 5L7XL 3J7HA 2C4FT 2E9IA 1J88A 3LZFL 1UH4A 1TNMA 3CX5K 1CU4H 1INQA 3RY4A 3F6IA 2F58H 2VXUL 1HSAA 1HH9A 3QDHA 3RWCA 5F7KC 3PWPA 1N3NA 4ZS6D 4QKXB 3MLRL 1CG9A 3QIWD 1F11B 4JHAL 5DJ8B 3RPKA 5DRWA 4KC3B 3VWJA 1FVDA 5EU3A 1A0QH 1CT8A 3HC0A 4HF5H 1HDMA 2YD8A 2OK0L 4L8SB 4PJDE 2XZAH 2BHYA 1N7ML 1XGPB 5AG8A 2AXFA 1A6ZB 2HJLA 3MRJA 2VZTA 5DMIL 1G7LB 4Y1AB 2PW2A 1RIHL 1CLZL 1G7MA 1YQVL 3CFJB 3JVGA 3QUZC 5FYKD 3VRLF 5CKAA 1ITCA 4J4PD 4XPHH 1YECH 3L7FA 3DHJA 2Z4QA 3K1KC 1NC4B 5J89A 1M7XA 3X3FL 2VDQH 5E6IA 3KDMB 5CGMA 2X2YA 5SWSD 2A6IB 1NMCB 3PWLA 1U36A 4KVNL 3NFPA 1HZHL 1NANI 1A3LL 1T4KB 2F54B 4U6TA 3LN5B 5HHVL 2HRPL 3C6SB 3BRFA 3WXVL 2GUOB 5DTFA 4XNZC 4XPFH 1SVCP 4WVRA 1CXIA 1S7RA 1GXEA 1UJTA 5DR5L 1MI5B 1J11A 3A0OA 4D8PA 1RJZB 1I9RH 4JFZL 1E6JL 3EJZC 3GI9H 4NCDA 4M00A 4UDTA 1EGJA 4ZUVA 4CVXB 1LO0H 4GXUM 4ZUUB 1G7IB 5IMKB 4JFDD 1JWUB 2A74B 1ZT1B 5CKGA 1J8HA 1UFUA 3H3KA 3C5SA 3DNKA 4OFKA 2I5YH 4KH2A 4NWTH 5E2UL 3V6OE 2P5EA 1DQDL 5H35B 3PV6A 5D7SH 1BAFL 1RUKL 2A9NL 5CHNA 1KV3A 2DM3A 3T0EA 3Q2CA 3BZFA 2AV1A 4L3ED 1OB1B 5SX4I 2JJUA 4JFEB 1CTOA 1W0YT 3C2AH 4MZ2A 4ODBD 4M7LL 3AMLA 1EMTH 2BMKB 3S3PA 2X4QA 4TVPE 3P77A 5KVMC 3ULVF 3QUYC 3SDYL 1IZKA 3OJDA 3S34H 3S97C 4YHKL 2W60A 5ERWB 5DK2A 3PJSA 2R0LH 3S36X 1NUDA 2BSSB 4FG6C 4RGNB 4UOJA 2BVTA 4L4JA 1JTPA 4V2BA 4HC1H 3O9WB 3TN0D 4JFPA 5DJYA 5DEGB 4XCYA 4ZYKA 2AK4D 3L6FA 4S1QL 1G1CA 2VO5A 3ZTJG 4H0GA 2G2RA 2CLRA 3RP1A 1IEBA 3G5YB 1B3JA 3MLUH 3VG0H 2CJUL 4OKVA 1CLYH 2OJZH 4TN9A 1NDGA 1QUNA 4MD5B 4OCXH 3FQXA 4OLZH 3RZCC 3SKOB 4TSBL 1SYSB 5C8JA 4P99A 2ADJA 3BWUC 2Y7QB 4YPGA 5E6YA 4DZ8B 4P2RD 4X6BB 1S7RB 1IL1B 1ERNA 4NQVB 4CDGC 4QHUA 1NGXB 3RNKB 2DQGH 3VH8B 4U2YA 2HTKC 4NT6B 3EFDH 2CDEA 1JK8B 4OZGB 5HGHB 2BOBB 5CJQL 3LQZB 1BFVH 5GSRA 5FV2A 3UDWC 5IG7A 5I75C 4X4XB 3MRHA 4OJFL 4UT9H 3IFOA 3IXAA 4R8WL 4WHYG 1Z5LB 3U30C 2EDJA 2FRGP 5KSBA 1S8DA 3OAUL 5C0CA 3P11L 1GGCL 5IMMA 2GSIA 3PP4L 1DBJH 3K4ZA 3MLYL 3OQ3B 1BEYH 2NW3A 4OZHB 5GGSY 2F53B 4ISVA 1VEOA 4R7NA 3ROLA 3I2CH 2DICA 5BS0A 5L7XH 3WN5A 4PRNB 5TGBB 2VWEE 2IPUK 4LASL 2NNAA 1ZXQA 4NSKA 2GJ6B 2XWBB 3LZFH 3VXOA 5F6IB 3RWDA 1A6WL 2F58L 5F1NB 3LKQB 3TYFA 4CU7A 3IJHA 2ESVB 5DURD 1NEZA 4D0CA 3RTQC 4HKBA 4FQXB 3NTCL 4N9GA 1B0GB 4HHAB 4JHAH 3O8XA 3GMMB 1OP9A 5SWSE 3HG1A 1FVEB 4Z8FL 5MP6H 2JJSA 4KV5F 3DETD 4R2GC 2D7PA 4JN1L 1BOGA 1UQSB 3HAEB 4YWGH 3WO3B 4MDJB 3VFVB 1H3PL 1MCKA 4PJXB 5F97E 2DQTL 3UPRB 2P7TA 2W92A 3ET9F 3IDMA 2DN7A 4MSWA 5JPMB 1U2CA 4XTRC 4GT7A 4Z5RB 4APQC 5L0QC 4HS8H 1W72H 4F7EA 5HGBB 2BRRL 4O2FB 4YXLH 1RY7B 3NGBB 3V5DA 3PWUA 5EFIA 4FZ8L 3DO7B 2GCYA 1X5LA 1Q0YH 1A3LH 3ARGD 5JQHC 5ALCL 2DKMA 4JHWL 5CUSL 3TNNA 2HRPH 3MRNA 3WXVH 1IKNA 5C0AE 4ELMA 4E0RB 3ARFA 1PKQA 2CXKA 4XPFL 3BAEL 3U4EA 2R2CA 5DR5H 1EO8H 1KLGA 4AJ0A 1T2QL 1DBAL 2J8OA 4X7SL 1E6JH 1H3UA 4YX2H 5IHLB 4RFEB 3QWQB 1T0NB 2AKRA 5L8LB 3JV6A 3IDYB 4LLQB 3VD9A 5D2NB 1KIPA 3DMMA 1J86A 4MJ6A 1IGJB 3QUMH 1BLNB 2LV4A 2V2XB 2BVPA 1DQLH 4HKXA 3H9HA 4EUPG 1T2JA 4WNQB 3IXTA 2C3HA 3KPRE 3QXWA 4NWTL 5B39G 3NFSH 3MUGA 4ZFZA 1DQDH 2OR7A 1FZJB 2EDRA 3VGAC 3MLVH 3VE0A 4OCWH 1MFAH 1J8HB 4WW2F 2DWDA 2UY6A 4WI3A 3B9KB 4V1DE 5ISZD 3MSPA 4C54A 3GIZH 4NKOA 5H35A 1J5OL 1NUGA 3HG1B 4Y5XA 5ICYA 5CHNB 2MQ3A 4E5XB 2AEPL 1IQDA 1MNUL 3QRGH 4P2QA 2VR5A 4ONGL 2AGJH 1L7TL 2X9WA 3SKJH 4GW5A 5M94B 3MXVL 2X4UA 3QO0B 1FDLL 4ETQA 2MPAH 3U1SH 2H32H 4LDEB 4JDVA 4YZFE 1FAKT 2LU4A 1XIWC 3H3PH 1IGCH 4LRIC 5F7YC 4MJIA 3MLUL 4UDTB 5EFIB 1XCQA 3IGAB 4PTUA 1NBQA 4I4WB 4OLZL 5DUBA 3DVGB 1CE6B 1LDPL 2DLIA 2CUHA 1C12A 1RZKH 2AV7A 3ULUD 3WL9A 4M4RA 5FA3A 1T22A 1ZTXH 5DXWA 1ZLVH 4DZBB 2OXGA 4X6CE 3T08A 2ZOKB 4FRWA 4HH9A 4UIMB 5EU4A 4GKNB 3PWVA 3CC5B 4KKAD 5E8PA 5AAWA 2MKWA 3QIWA 4KZDL 4Z7OF 2WBKA 1JPGA 2JCCB 1AJ7L 4AMKH 1S7SA 1JRHL 2OTPA 3FOMA 1AXIB 5J6HA 2Y25A 3PF2A 1PY4A 2EXYC 4ZS7H 4M6NH 3G6JE 3T09A 5CEXB 3I02A 2PXYC 4P2CG 4XH2A 2NYYC 3VXRA 3A67L 5TF0A 1YMHA 4LASH 5EUOF 2DI9A 3VXSE 5DFVC 5F1SA 5F9OL 4Q0XL 1GGIL 3IDJA 5C07B 1TTUA 3GSRA 5DJCB 2OZ4A 4OI8A 2ZP0T 5C0EB 1DEEB 1R3JB 4F2MA 4D94A 4C56A 4RA0C 4FP8L 5KW9L 4JVWA 3UJIH 3G5XA 4H0HB 2YUXA 4WEBL 2V2TB 1EZVY 4KKLC 5BXFA 2FATH 5FKAB 2L7UA 3AB0B 4MZ3A 2FGWL 2YS4A 1H3PH 5AUMB 5IQ9A 4HG4K 3N1GC 3SY0A 5IV2B 1O0VA 5DJXA 4JJ5B 4OZGE 3ZT7A 1FVEA 4ODXB 4JFYB 4P5MB 2VLLB 4JDVB 1L6XA 4CMHC 4R96A 1KLUA 2HT4D 3RWHB 8FABB 1W72L 5E0QA 1G7MB 1TQCB 4JO3H 3B3IB 4POZC 3WS3B 2OSLA 1YEHL 4WU7B 4JPKH 4OV6F 1KNOB 4MXVE 2ZWLT 5I1IH 5ALCH 1VFAA 4JHWH 2VB5A 2Y5TA 1C7SA 5HGBA 4OZFG 1W72A 1ADQL 4NM4L 1S3KL 1YYML 4CNIB 5MEOB 1I8KA 1YEFH 1A47A 2YD3A 1LE9B 1S7VB 2ERJC 4G8EB 2GCYB 3UZEA 3WIHL 1ZA6A 4XVTL 3O3BB 1ONQB 1J0IA 4O2EB 3GNML 3VCLB 4X7SH 3MA9L 3G6JA 1YEDB 2ZCKH 3MRNB 2EYTB 5DDHA 2ADIA 1FBIH 2EDFA 4TOYH 3KPLB 4NO2B 1S9VA 3FRUB 4CADB 4QRUA 2VWEC 3ILQD 5I76B 1CFSB 3QUXB 4U6VH 4GRWB 1KJVA 4N8VG 2B8OT 1VB9A 5MEPA 3B9KC 3KPPA 1OD9A 1Y6KR 1GHFH 4J23A 2X7LB 3LN4A 1IE5A 1AGDA 2BC4A 5LBSH 3GRWH 3QZWA 3CPLA 3O8XD 4WRLA 5CIPB 5DK0B 4OCWL 2AJXH 2NX5E 32C2A 3VXQB 1UCTA 2DYPB 1VENA 2AJZB 2UZIH 4XX1E 3GIZL 2V9RA 4NO0A 2D7QA 2P45B 1AH1A 1GZQB 4QHMA 4OI9A 3JTSB 3LDBC 4KV5E 3KXFB 1FFOA 2ZSVA 1MWAH 4GRLA 3KPQA 3KYKH 4FQ1H 1TXKA 2VDOL 3OR6B 4ZPVA 3F58H 5AYQA 3UXFA 3OKMB 3C5ZB 2DTML 1VEMA 3I75B 5IBUB 2W9DL 1WBZA 4XB7A 4XZUB 2ADGA 5I1EH 2OR8A 1HIML 1MCPH 1NCUA 2R0KL 3SJVD 4HUXB 4JM2A 1RHHB 1X5GA 5DS8A 2D4FA 1Z6JT 2VZ3A 5T1KB 4NN7B 1IGCL 5HYJB 3GMPB 5BZWA 4JZOA 5F9WB 5FXCH 1IAOB 4JRWA 5EU5A 3MNWA 4N0YL 5T5NF 2APWA 1ZHKB 1RVFH 1CDJA 3FN0L 3PGDB 5MEOA 1F42A 1OPGH 4J3TA 2H26A 2D9QB 1QSEA 1W0WA 5DSCA 5K9KB 1QFWL 3RVXC 1ACZA 4M1DH 5CJOH 4HKJB 4U0QB 4KRNA 1JF1A 2A38A 1CQYA 2F74B 2ZUVA 4X9BA 3LVEA 5EC2A 4HZAA 1AGEB 1ZMYA 3TO2B 1AJ7H 5EIIA 4J12A 4WWKA 2VR4A 2PN5A 5J3HD 2Y9RT 1PSKH 3V5KB 1INDH 4PJGB 2V7NA 3K4AA 2OMBA 4KROD 2AI0H 2P8MA 1PY9A 1AC0A 1BWWA 2H2PD 3CFIC 4NQSA 3MREA 3RA7L 1PKQE 3V0VB 3QFDA 1HQRB 1GGIH 4U7KA 3PQYE 4FABL 4WV1C 4Y1AA 4HPOL 2HFEB 1BBJB 1H0DA 5ITFB 1KT2A 4FP8H 1RJYB 2YZ8A 4ODTH 4WU5B 3TV3L 4PY8I 1FNFA 1AKJD 3HNTL 2PR4L 3FMGH 4Y88A 2FATL 2O5ZL 5FYKL 1M71B 3V5HB 2VLRA 1TCRB 4YHPA 1HSAB 2XYCA 1A1NA 4K07A 2Q20A 1QACA 4PGBB 1CXHA 4F33B 4URTB 3QT2A 1D9KB 4PJ8C 1H8SA 1BD2E 2H41A 1AO7E 2B2XH 2XQYK 4JO3L 1XAUA 2OTWB 3BMVA 4MJ5B 1K4DB 1J05B 4YC2B 4WJ5A 3TJHD 4PB0H 4MWFB 1FH5L 4WHYH 3VXUA 1S3KH 1YYMH 2NY0D 4RWYL 1CGVA 3RTQD 4OIAA 4KU1A 4Z78A 5ILTL 1FZMA 4OD1L 4UBDC 5GS2D 3MZGB 2FJGA 4JKWA 1XCTB 3SKUD 1BIIA 3GM0A 4MAUH 3KDMA 3HC3H 3AREC 5DJAB 3MA9H 2C7UA 3CFKB 3LKSA 3MLWL 3B9DA 3E0GA 1P9MA 2A83A 3B9EA 1T20A 5HVWA 5J1AA 1TTFA 2BJMH 1NLBH 4FFZH 3U36A 2JIXA 4H20H 5GS0D 3P9LA 1JHTB 5L8KB 2NY2B 3V6FB 5IMLB 3K4DA 3RX8A 1T5WB 1S7XA 1HXYB 3EOTL 4PGDA 3UC0L 1V7NL 4FFYL 5I19H 3R0NA 5C0FA 1WBYA 1K4CB 3OWEA 5I18L 4Y19D 5B3JF 4RMRA 3HZYA 4L9DA 4DVRH 2UZIL 3MLZL 1LD9A 2VKWA 3I85A 3HUJB 1OWWA 5CSGA 4K3DH 1FHGA 4R9HA 4M1CC 1GGTA 3HZMB 3MFGB 4TQEL 5B39B 2NY5H 2NY7L 4H5SB 1GRWA 1HOCA 4LNVA 2X9YA 2DTMH 4HWBA 4L4TE 1NGPH 5AZEH 1AD0A 1XF1A 1Y0LA 1S9WB 1I7UA 5F9WC 3WMSA 3O2DL 2OS7A 4MNQD 4O2CB 2Z8WC 3N06B 3TWCH 2LE9A 3DPBA 5DFVD 1VGEH 1DLFL 3I75A 1HILB 5I0ZA 2OTWA 4OFIA 5TH2A 1N0LA 5DRNB 3O4OC 5SWZD 2CK2A 3CFDB 3U0TA 1M05B 3VRJB 1ES0B 2R0ZH 3GSUA 4DGYL 4PGCA 1YDPA 4KFZC 1RVFL 2C1PB 3BQUC 2X4PA 1HH6A 3T0EE 5DJYB 2FIKA 3P0VH 3VXSD 2XZZA 1QFWH 4ELKB 3MR9B 1ZT4B 4X9IA 5CWSA 3OAYH 1QYGH 2IQAA 3E6FA 1G9NH 4LSTL 4B7LA 3QCTH 4DJMA 2R56H 1CICA 1TETH 5DQ9B 5ITBH 2BHUA 3S3SA 3T0DA 2VSCA 5B4MC 2DQEL 3G6DH 1XFPA 3IRPX 2BOCA 1AFVH 2DBJA 5KJRL 4YDLC 4QOKB 4Z0BL 4NWUH 5D6DC 1A2YB 1Y18B 3PXJA 3WUWG 1HN1A 4FQXA 4KI1A 4N9GB 4XZUA 4J6RH 3QPQD 3CH1B 4RFOH 5KVFL 3K2MC 1NCTA 3W5MA 2QADB 3HZYB 2NY4B 4ZUVB 4CVXA 1JHKH 3OJ2C 1WFUA 4NZTH 1G7HA 1FNAA 4J8RB 3BN3B 4OZHA 1DQJB 1YPZE 2A6DA 3K81A 2IH3B 5EA0L 2PR4H 3ROLB 3EYUL 3OB0H 5GGSB 1JI2A 1JNHB 4LMQE 1ZVSB 1YEIL 1N8ZA 3V4VH 5DA4A 1RJYA 4WU5A 2BCKA 3CZJA 3PHOA 5C3TA 4O2CA 1JPTL 1Q9LB 4WFFE 3EZ8A 5DD3H 1F8TH 3CVHH 2B2XL 4M02A 4RAVB 3PL6C 1WSST 4HF5L 2OK0H 3MLSL 4U1LB 4UDUB 1I1YA 4G8FA 5KAQG 7FABL 4Z6AT 4OZIA 4L4TD 2VQTA 4X5WA 3OR7B 3QXAA 5CD5D 4OCLC 1YECL 4OD3L 4ORZC 5JMOC 4OF3A 4HUKB 2ESVD 1NBVH 1A6VL 1KCVH 3RTQA 3MCKB 3AU1A 3HC3L 4ONFH 1RZJC 2PO6A 4NRXB 3MLTB 3QFDB 4NHUB 1DFBH 3Q1SL 2MQCA 3O9WD 3TN0B 3MROA 5IJVA 4LP5A 2XIDA 4I0PA 2CIKB 4GBXC 1KT2B 3CX5J 2W0FA 2VISA 3MGOB 1CYGA 4U1KB 2DWDB 1F4YH 3I3EA 3ISWA 4QOKA 5DLMH 3X3GH 5FYKE 1BX2A 1ZK9A 4UNTA 4XP6L 4DQOH 2ZKHL 4HLZH 1NMBL 4APQD 1NCDH 3QNXA 2QHRH 2ZOLB 5BRZE 4R3SB 4Y4HC 4X6DB 4LLVB 4LCUA 3HNVH 3FO1A 2VC2H 2VDMH 2F5AL 3E3QC 4D9LH 3BKMH 1VDGA 2OX5A 2WSKA 3QDAA 2AJYL 5L9DL 1EEZB 2DLTA 3CXDL 1QD0A 2BRQA 3ZL4H 5J06A 4UI2A 5CCKL 1AQDB 4UV4H 2XOTA 3FOLB 1GZQA 5D7SL 5KVDL 1FG2A 1QA9B 3ELAT 3QG7L 2HKHH 3AY4A 1GGYA 4IRZL 1KENL 4XVUC 3H0TA 4IOSD 4LQFH 1X7QB 4G8IA 4HKZA 1CTNA 5HYQB 5H94A 3MO1A 4KUCF 4G6JH 4NKIL 1KN4H 1GH7A 1EGJL 2NY4D 4G6AD 4WWKD 4OT1H 3HAEH 3SGJC 1JHLL 5SWZA 1CFVL 4H8WC 2NY2C 3ZKSD 1I7ZA 4JCLA 1VGKB 3F7YB 4NHCH 4W4OA 2FH6A 1N0XL 4ZUTB 5BRZA 3B2UC 3C08H 4TTDC 5FOJA 4YHZH 4BSVA 1QYGL 1WT5A 1T03L 2W1NA 2UWEB 1AY1L 4S1QH 1QO3A 4XNZB 5FA4B 4R0LC 2D03L 3R0MA 4S10A 2C4XA 1RUML 3MRFA 2XY2A 4XRCA 5ID0B 2VNCA 4OCXL 5FUZH 3NAAL 2DYPD 3B2VL 3OX8B 1FC2D 1R0AL 4XAKE 3E6FB 4GQPH 3VGEA 2YN3A 1EDQA 1WAAF 1N5YL 4Y5VC 3QUZD 4WFGE 3KPRA 4QF1A 3RWFA 3OKEB 4UUJB 2AP2A 1LO3L 2KZWA 4G6FB 5D70L 1QHOA 3EFDL 3OF6A 4PJXE 4GG6B 4RFOL 4ZSOE 5KVFH 5C0CE 3RDTA 1KEGH 2E27L 3SE4C 3UYRL 4N9OB 1YEJH 2ED7A 5LAXA 3ARFC 3D85A 3GRWA 3VWKD 4I3SL 1GGCH 4Z7WE 3S8WA 4N0UE 1DBJL 3PP4H 4F7PA 2VMFA 5EA0H 3I6GA 3DGGA 1JPST 2XN9E 1WBXA 3D39A 3BOVA 4IHOB 2GK0A 1MJ7H 3SBWC 1YEIH 2Q7YB 3QG6A 5C0JA 1A1MB 1BOYA 2I9LB 2NXZD 1ZANH 2CKBB 4QRPD 4HJJH 5CBEB 3MRPA 3UJTL 1IVLA 4NQEA 1QFHA 4LVOB 1ITBB 4MAYC 5IKCB 3CFBA 4PG9B 5IW1B 5ADPH 3BESR 4PJIA 4I2XE 3NZ8A 4WV1B 3ZKXC 4S0SD 5IQ9B 4PJCF 1Z9MA 4MB5A 4MXQC 5D5MF 2X4UB 2ICWB 4HLZG 3BDXA 5EU7C 3U7AA 5TQ2H 2DQTH 3F7VA 1CFSA 5IB5A 4G43A 1DVFB 2B39A 2YD6A 3B3IA 4EBQL 4EOWL 3AMKA 3MV7E 4YXLL 2X1WL 3D2UB 4WI2A 4WO4C 4DGIL 1JYWA 3KG5A 4XCCL 5JHDB 3AXLB 4FQJH 1HHJB 1NL0H 3UEZA 2HVKB 4PJAA 3E8UL 5I30H 3MV9D 1A14L 1RU9L 3UTZB 5CD3B 4JO1L 3SE8H 4KK6D 3VI4E 3CFKA 4NNYA 3EHBC 5HHOD 1F4YL 3P3YA 3WL9B 4JFXA 1C08A 4JQXA 3GSQB 5GGTL 1X5IA 1KPRB 5C0DB 2V7HB 2ZKHH 3PWJB 5IJVB 3U30B 3CMOL 1NCDL 4RISL 4GG6A 2PF6A 5KSBE 4P2YA 2NY5C 1FN4A 2VISB 3MGOA 5I75B 1FJ1B 5L6YL 2WV3A 3QB7C 4BQBA 2EXWD 1HXYA 2QV2A 5D1ZA 1V7MH 3GIVA 4M93C 5L9DH 5GSVB 4LCCB 3BGFC 3CXDH 1U8QA 3QNYB 4EI5B 1OF2B 2X44D 2AABH 5SV4A 1BZ7A 3D25B 5F21B 4UV4L 3QIUC 2AEWA 4F7MA 3EJJX 4F7CA 1VACB 4BUHA 5C0JB 3FQNB 3N0PB 4JFED 1CZ8L 4JGMA 5CJBA 4WW2C 3FONA 4PJ7B 4PRHA 4R4BB 3RNQA 5GS0H 4LLMB 5JXEA 1RMFL 3L3JB 3SDAB 4L4TA 3W39A 2HTKD 5C0EA 4MQ7B 5DYOA 5KAQF 3QDJB 1EGJH 1ROWA 4ZPVB 3AAZB 1KELL 1YMMD 2Q8AL 3VWKC 5E6IB 4OM1L 3G5XB 4HS3B 2FBJH 4HXAL 1S5IH 1AXSA 1BJ1J 1CD1B 1I1AB 3BHBB 4PJBE 1L7TH 1QBAA 2PO6D 4NNPL 3SKJL 1D5BA 1RK1B 2KH2B 1XGTB 2CKBL 4NHCL 4RA3A 3DXAA 5DHYB 1H5BA 3HAEG 3RWHA 5DA0B 4N90E 3S36L 4LEOB 1P7KA 2JJVA 1FPTH 3RWEA 1IGFL 1T0NA 3T8XB 1IT9H 5IFJA 2VSDA 4F7EB 4PJCA 3GB7A 3RUGE 3TVMC 2IGFH 1R0AH 2O5XL 5B38B 4LMQI 1CVSC 3DV4B 4JDZB 3QIWC 1QLEH 2AXHA 2JTDA 4Y2OA 3CH8A 3BPNC 2J7LA 4Y8DC 1N5YH 4MD0B 3WHXB 4G9FA 4M5ZH 5ACMA 4WUUB 5JMRA 4J2XA 4MHHG 3QEQB 3Q6FB 5IB3B 4O2EA 3RU8L 4MA1B 5GRZA 4YHIB 4AL8L 4XXDB 2E27H 3EDFA 4LOUD 3GUTA 4GMTH 3MJ8B 4QRPB 1S5HA 3RDTD 3SKNB 1UKQA 2VLMD 3V5KA 3T0AA 1KJ2L 4M03A 1A1OB 5KTEH 1MCDA 1XMWA 5FECA 2RCSL 3JTTA 1LEKB 5F9JB 3RDTB 5E9DA 4ZS7L 4C57C 3GMLB 3NA4A 1QR1A 3OZ9L 1DQTA 4K8RL 4PJHF 2YBRB 3EDJA 4L1DA 1DQJA 4RRPA 5CP7A 4DK3A 1RSFA 4OZ4A 2G9HA 2V9QA 2BNUB 1F2QA 3MRJB 4KDTA 5FO9B 2Z91B 3B5TA 5MERA 3QCUL 3A6OA 5CSZA 4RCAA 5EC1A 4DOHE 4JAMB 4LSVL 2XZAL 4OZFH 7CGTA 3ARRA 3HMXH 1XIWB 3WJJC 2GFBB 5ICYB 4Y1AE 1XR8A 4RAVA 2FGWH 4LPYA 1SQ2N 5K93A 4LLYB 5A3IC 1CDHA 1NMAL 3G04A 4YFLF 2WBJB 3NFPB 4PJDA 4NC2B 3RHWF 4NQCD 3QQ3A 2ED8A 4YLQT 1GC1L 4JREB 4J4PC 1L6ZA 2EIEA 1X6NA 4MDIA 5C0BD 3ARZA 4F57H 2JLLA 3SE3C 4FQJL 1XH3B 1YEHH 4L9LB 3PQYD 4KVNH 4JPKL 5LAXB 1K4CA 1UENA 1XCQB 3IGAA 1CFQB 4KWUA 2BERA 2EXWC 5I15L 1EHXA 2IANB 4OB5L 5C09B 5D2NC 3C8KB 2IWGA 2IPKB 2H32B 1KF9B 3WIHH 1J12A 4BK5A 2KQNA 1UM6L 4KJYB 4JFZH 1ZT1A 1TVHA 2H9GB 1BJ8A 3DX7A 1UG9A 2AVGA 4GAGH 5J56B 5DJDB 4M48L 5INDB 5T1LD 1U58B 2NNAB 3EYQC 2J8UE 3PWJA 4NQEB 5HDBF 1JV5A 4QO1A 5GZND 3LPWA 4ZTOL 1Q0XL 5IBLC 2Z31D 5MI0B 1T0MA 3P4MA 5E2UH 2Z9TA 5I1KH 1J8HD 2EC9U 3MBEB 5IFHL 1JZ4A 2P8MB 5F7DA 4Z7UE 5AUMA 4UQ3B 4NDMB 4XC1H 2A9NH 5KANG 1A9EB 2EZ0C 3FQWB 2GT9A 1G7LA 3C09C 5IWLC 3S5LA 3BKYH 2AK4E 1Z3GH 3HUJA 3LEYH 5FO8A 3TA3A 1Q9OB 2E5EA 3M17A 1B90A 1YEGL 5T5FL 1JIBA 4HFUL 3F58L 1TMCB 3QI9C 3V52H 5JQ6H 4RNRB 4TSAH 4W6YB 5LXGH 2CLRB 4RGND 4RDQF 3OXRA 4KTYA 1U3JA 5I1EL 2CKBH 1NDGB 3SDDA 4M7JH 4ESKA 4U1NA 3J8F7 3QQ3B 2AW2A 1IBGH 1F97A 1IGFH 1MI5A 4D8PB 4JE4B 1T80A 1J1OL 1GGBL 2BNQE 4CADA 1P2CB 3ORJA 4JKMA 3DXAB 2DDQL 3DLQR 4NUGH 4WFHD 2LU7A 3HMWL 5D1QC 2O5XH 1RUAL 2NX5D 5GHWL 4S1DC 3FN0H 4UT7L 2CR3A 4GOSA 3DMMB 4MJ6B 3WNLA 3IDNA 3O2VL 2NY4C 4G6AC 3ZE0F 1VACA 4NFBA 1SBBA 3QQNA 5HHOE 1LE9A 2DQIL 2ENSA 2VLKD 4LHUG 5CJQH 3A6BL 3JUYA 1BFVL 2YHGA 1ZLUK 4M43L 3FQXB 4TNVF 5D2LE 4C58B 5GGSA 3L3GB 4PJ9C 1BVKB 1DN0A 4WTZA 4F9PA 4WCYL 1Q9WA 2QR0B 3OB8A 1JVKA 1MREH 1U8KB 5E8EA 1MFNA 5IM7A 4KGJA 3C6LD 3MLYH 2E8YA 1Q94B 4TSCH 2VDRH 2AJVL 4OLVL 3OKKB 2HWZH 4FQIL 1FLTX 4DAGH 1MCEA 2BNQA 5IG7B 4UT6L 3RVVC 3QDME 5HHNB 4JQVC 2H6PB 3TLRA 5C2UB 1WWWX 3OKDB 3QZWG 3ZSSA 4X5WB 1A3QA 4KK8C 1EEQA 5IR1B 3BQUB 4PGZA 3MV9A 4P2OA 1NCBH 2I9LA 1QEWB 3BDBA 2V2WA 3BEWA 3HNTH 4UV7H 1NCWL 1XGRB 4AEEA 3HMXL 4PR5B 4JN1H 4WUUE 3QUKB 1N2RB 4RQQB 3QEQE 2O5ZH 1VADB 5CZVL 4Y4HA 5FYKH 3IJHB 3ARFD 4N1CA 3OKMA 3BD4A 1B0GA 2P8LB 1JF1B 2WIIA 4WW1A 4ONHA 2Z8VC 5T3ZH 5F7LB 3FQUA 2W0LA 1GC1H 1HI6B 1FNEA 3F8UB 2UVFA 2BRRH 1IGIH 1QG3A 2FD6L 2FIRT 2Y6SD 4Z7VB 1CXLA 4JFHD 4WHDA 1K8IB 3KYAA 3FB6A 5E5MB 4BFEA 1CDUA 4U31A 4RWYH 2CRZA 3KHQA 5ILTH 3ARGC 12E8H 2H3NA 5TE6L 4YC2C 1UM6H 4BZ2L 4XBEL 4LSRL 2XWJB 5C0CD 4X5LA 4JY5H 1IAIM 3MLWH 2X4RB 4GAGL 4XCEB 5GZOD 4JGUA 5A2KH 5CP3A 3R8QA 1IRAY 1XZ0A 4HX1A 4DOHB 3D18A 5ISZA 5T1LA 4JM2F 3FQTA 4ETYA 1DQLL 4ZTOH 3TYGH 3Q5OA 4JZJC 3S98A 3TO2A 4KRPB 5BMFH 3S35X 4MS8D 4S2SB 3KLDA 3UC0H 3TIDB 3ZDXE 4RFEA 3T0EB 4DGVH 5HTSA 1OF2A 3HAEA 5I18H 4E5XA 1AE6L 2R9HD 4DVRL 3GSNA 3KNBB 2FO4B 3FRPG 5E4EB 2V5RA 2XFXB 4IOFC 3EO0B 3SJVE 2C3VB 2NXYC 1DQMH 1URLA 3GSXA 3HI6L 1MVUB 4TVPL 8FABA 3BRDA 2KDGA 1AP2B 4JY6B 5CIPH 2NXYB 3W0WD 5T5FH 2NY7H 4HFUH 5ERWA 2DIAA 4OBSA 4P5TC 1AGCB 1KB5H 3TA3B 4TSAL 2HTLD 2V5YA 2IADA 4U3CA 3B9KA 2J4WL 3DMMD 5HDLA 2YSSA 3VD5A 3L5XH 1DUYB 4K3EH 3F7PC 2D7MA 1T89C 4Q74A 1IBGL 3FB5B 1ED3A 2WQ8A 3KPMA 4GAYA 1KB9J 4Y4KD 4PY8J 2XNAB 3K8MA 3HPJA 1DN2A 5E4IA 4YHLH 2IALA 3HMWH 3KYOB 1VGKA 3BWAB 5SWSB 5DMJB 5A2FA 1LDPH 4UT7H 5DZOA 4C83A 5IOPA 1OW0A 3P0VL 2SEBB 1U92B 4XT1C 3S88L 5E2VH 2HFFB 3ZDZE 2WMPA 1LP9B 4PBVC 2QQLH 4FTVA 1G7QA 2HJKA 3TCLB 3A6BH 3UYPA 3MLTA 5FO8B 1FE8L 1SJVA 4YDVA 2VLKA 3RWIB 3OG4B 4HFWA 3M17B 4TNVK 4M7LT 4XI5C 1MREL 3FKUS 5C6TH 1GYAA 3CFCL 4QRSA 4M6NL 4PJDF 4BH8B 4FQIH 1EAPB 1MSPA 5DI8B 3SGDH 1YNTA 3TJHC 1S9WA 2EIZA 3N9GL 2ZUQB 2OLDA 4UNVA 1QRND 1ETZA 2WP3O 4WI6A 1EFQA 4LCUB 1T66D 1YUHB 4JZNA 3O45A 5TDPA 4FZEH 1JHKL 4P2QE 1A7NH 3DXAE 2Q1EA 4QHKJ 3IFLL 3U9PL 3DX9A 3RZCD 4X9GA 2VZUA 2WK2A 1A4KA 4KQ3L 3BN9D 3D2UD 4MLSA 5IB4A 3CDYA 1M6OB 5FIEA 4UV7L 2V17H 3TNMA 5DVNA 2A74A 2FECI 1FG2B 2ICWJ 3MA7B 4B50A 4U6YA 5HHOB 2N7BA 1JZ7A 1ZE3C 4K55A 3WEXB 4F9LA 6CGTA 2DB8A 5DD3L 3NVQA 3ZTNH 3UX9B 5GJSH 2ZOKA 2CMRH 2FD6H 1J18A 2XKUA 3NZ8B 2B5IB 2H1PH 1CBVL 2OI9B 3MLSH 3C9NB 4RMSA 3DSNA 1FRGH 4JVPA 3KYOA 4OM0H 5I1GH 7FABH 3W9DB 5LQBH 2BOCB 3G9AB 2IPUG 2X4NA 3MGTB 4NJ9H 3K8KA 3MOAH 5IEHB 3GZKA 2AJSL 3VFSA 5C0GB 4N68A 4BZ1L 2DF3A 5HYSA 1J1XL 5CS7A 4HD9A 2B0SL 1UB5B 3QDMA 2BVOB 1NCCL 1NBVL 5IEKB 3LEVL 1LP9A 5GRYA 3GNMH 4PJHE 4M62L 1A7PH 2PW1A 5FDWB 1EBAA 1BLNA 1KJMB 2PYFA 1BVLA 2H3NB 5IVXA 4XWGH 1E27A 4U6VL 1RIUH 3X12A 3X14B 4O5LH 2BSTA 1N6UA 3W11D 1ZLWK 3QA3B 2MSPA 5JHLL 1D5MA 4X7DC 4LHUB 4H25A 1H9VA 2EIDA 4NO0B 2DJUA 4Y19B 1NMBH 1QSFA 1GOFA 4LEXL 3WO4B 3MJ9A 3JZ7A 8CGTA 4Y5XC 2R8SL 2GHWB 1AE6H 2JB6B 2OL3A 5F72S 4PRHE 2ADFH 1KJVB 5IMOA 2F5AH 5HHXH 3BKML 2ORBL 3CLEL 4F15C 1I3UA 4L4VA 4PRDB 4MVBD 1U91B 1KXVC 4P23B 2YUWA 1RHHA 1G9MH 3I6GB 3OKLB 3RGVC 1KXTB 2ZCLH 1KB5L 4A6YB 3VXTA 1FIGH 4P23D 2A6DB 4TUJA 3ARPA 2J4WH 4CN6A 4IRSD 2HKHL 4RZCA 4JFDE 4RMTA 3HRZA 1EUUA 2CD0A 1W72B 5BO1L 2R2BA 4Z7NF 1AGCA 1KN4L 4TTGA 3MV9E 2B4CH 3BH8A 5EULV 2X70A 5GIRB 4NRZA 3LKSB 1LO4L 3FJTA 5TDOA 2CIKA 3BPLB 4PTTA 4AYFA 4YHLL 4EVNA 4RFNC 1KIUA 1SJXA 3FFCE 5J1SC 4HQQL 1ZEAH 4Q6IA 2B20A 5GS1B 4M1DL 3HPJB 5E2VL 1QSED 3RJQB 5F3HB 1KIRB 4X4XA 4GW4B 1U3HA 3FT4A 1PD6A 1EFXA 1AY1H 4ZSOA 5IK3A 5J11B 1A3RL 1HHGA 1RUMH 1YN6A 3Q6GL 3O3UN 5BOPA 1EEZA 3QDGB 3LPGA 3C60A 4MD0A 3QJFB 3WHXA 4WHTB 3ZKXB 2D7TH 3ZKMC 4FXLA 1IM3B 1KTRL 4H25B 3FZUC 1TCMA 3BP5B 3C2SA 5D7IB 3PIQA 3T4YA 2W0FB 1U3HC 3S9DB 1CK0H 5D70H 3DUUB 3U4BH 1OAXL 4B53A 3FN3A 1FL6B 3H9SE 3O8XB 3GSNH 4WWKB 4HK3N 5EORL 5I73C 5KS9E 5BVPL 3CXHK 3IFLH 4LPTA 4HPOH 5DEFB 2ZNXA 4PLJC 4IJ3C 4KK6C 2PUQT 3HZKB 2Q6WA 2V17L 1ZLVK 5IV2A 4CW1A 1CDGA 2V5SA 3NCCB 5CMAB 1K8DA 3CFDA 3U0TB 2YPVH 4PP1C 1B0RB 1QFWM 5KSAD 3TBSA 4L8CB 1ZANL 3GHBH 5A40E 3X11B 2HFEA 2I07A 2P5EE 1PYWA 4ODHL 3ZDYE 2G75B 3G5VB 5GJSL 5IF0A 3QDJA 3TT1H 4JQVA 2H1PL 4KK9C 2H2PC 3DHMA 1IEAB 4BSWB 5DMYA 2EE6A 2VABB 4KJPC 2OL3L 5DMIH 4P2OC 2FEDD 1WK0A 1YQVH 2APVA 1ZA6B 5TQ2L 3GJEA 4ODVH 1SYSA 2ZUQC 3C9NA 3HRPA 4QT5A 4QXTB 2GIYA 5F3HA 5TJWK 3LEVH 4LEOA 3U9UB 3X3FH 4M62H 5DQDH 3ZZ1A 4DGIH 3UP1A 3NACH 1PG7W 4PGDB 4QRQA 4N8VA 1OGAA 4Y5YA 15C8L 3S5LB 2C5DC 5DK2B 5JORA 1XCTA 3QZWB 1JGVH 4K71C 2JELH 4OGXH 1B9ZA 2F8OA 2Y36L 1S7WA 4HGWB 4AENA 3HR6A 3QO1A 3CMOH 1VFBB 2VZSA 4F3FB 3IKCA 1JF6A 5KSUB 4HUUB 1KFAH 4JDTL 1LVEA 5D7JC 3UCRA 3FO9A 3PL6B 4JB9H 5A1AA 5D8JL 4OZFA 4Z0XB 4GBXA 1N8ZB 3MLZH 2RHEA 2NY3B 4YPJA 4HPYL 2ILLA 4RAHA 2JCCA 1B6DA 1I8LC 2I5YL 3ZYJA 3RUGB 1NSNH 3PGCB 5JW4N 5FFLA 3PWPE 2YD9A 4NN6B 5DJ6B 2PYEA 3ZE2F 1P4LB 4IIQB 4KHTH 4XNYH 3VXMB 1A6ZA 3PABA 4NZRL 3MRGB 3FQRA 3ZE2E 4JPIA 3BPLC 1LEIB 5KSVB 5FF6A 2Q76B 4NJAL 3TWCL 3C8HA 1S78C 3QYCA 1WAAA 1DLFH 2JIXD 4HUVB 4JFEE 4O00A 3LD8B 3DVGA 1S8DB 3OKNB 1TVDA 4HC1A 4RZCB 1KELH 2Q8AH 3GSRB 4HIIB 4O2FA 5MENB 4OM1H 5FA3B 5E2WL 5B8CA 4XXCA 1S5IL 2EDKA 4TVSa 3STZA 1UKTA 1I4FA 3AM8A 5CLTA 1JPFB 5IHUL 1UEYA 4OTXL 3MLXH 3L5HA 4HC1L 2NMSA 3NFNB 3GSWA 2CRYA 4TUOB 2NQCA 1LEGB 1LO5A 2ZZUT 1BX2B 5JIIA 2IFGA 1ZLSH 1PZ5A 4G43B 3BPCB 4PY7A 3NIGF 4OKDA 1QZ1A 3FOMB 2CJUH 3F12B 2GSGB 3E2HB 5LJYH 2DQHL 4Q6IB 4QNPE 2IGFL 4JRXB 2UVEA 1AKJA 4UTAL 1AFVL 5IMKA 4GLRI 3IVKB 5AAMA 2QQKH 5A43C 1ND0B 3WLBA 3KWWA 4M5ZL 5F7UA 2VLKB 2VZ1A 3RL1A 4ZAKC 4R6UA 3KPNA 3G5ZA 4FQXD 5D1QD 5HPMB 4XNXH 5DT1H 4HIHA 4ZFZB 4ZUWA 3GSVA 3HA0A 1JI1A 4C56B 4OZFB 3PWUB 3DO7A 1L7IH 4YHNB 1N2RA 4UT9L 3FFCD 5D5MA 2JB5H 5BVPH 1MUJA 2VTFA 3VMNA 5HVHB 1KJ2H 5CEZD 4U1MA 1WIPA 4JQXC 2HT3C 4PJAE 1QPXA 5D7LB 3CD4A 5M95B 4UMGA 1W8OA 5L88L 4OZHE 3DX9B 1R24A 3NMEA 1EIBA 3G08B 4K8RH 5GRJL 5FCUL 2XG5A 3STLA 3LN9A 3QPXL 4MXWH 1NGWA 5D7JD 5IIEA 1HWGB 1JPTH 3VRIA 3WS3A 1T21B 3JV6B 4ELKA 1DBKH 2CLVA 3LPFA 4MAYB 5F89B 3EJYC 4HWZB 5F70A 4S1RL 2V2XA 3TT1L 3O6LH 4LPCA 4IEFB 4YGAB 3VGHA 5MP6L 1S7UB 3REVA 1I8KB 3GHEH 4NQEE 5HYJD 4GRLB 1T2XA 3SPVB 5ID0A 3G6JF 3ZKQD 1G6RL 4PBWD 3BW9B 4AM0B 4P23C 3DIFA 3T3ME 1MLCA 4OD3H 5HGAB 5HDOA 5IVXE 3WFBL 3BN9C 4L29A 2BY3A 1F6LL 1A6VH 1KCVL 4PRBB 3WV0A 3FRUA 4HS8L 4APQA 4YBHA 5DHYA 2P47B 5DQDL 3VMOA 2AK4B 1IGYA 4S2SA 2ZG1A 2P24B 4X5XA 1QKZL 2G60H 4U0RC 5CUSH 15C8H 1DBBH 1QP1A 2ZCHL 4OB5H 2VXQH 2A6JB 3BAEH 1JGVL 4HV8A 3W9EB 4L8DA 3EO0A 2OR9L 2C26A 5E08L 3MUY1 4PPTA 4AH2B 4FXGB 1DBAH 2QQQA 2X4RA 2AJZA 1KPVB 4ZXBA 1MFEL 1QRNE 1TVBB 1KOAA 3LS5L 3L3DB 4P57A 5GGRB 5I17A 4JB9L 3QEGL 5DVKA 4M48H 2NCMA 3HNVL 3F7QA 2PXYA 3LB6D 3IB4A 5AD0A 2LTQB 4G6ML 4TVPD 1MCLA 4YHML 1ZHNA 1JZ6A 2J8UB 2FBOJ 1XIWD 1WFNA 3NCFB 1CGSH 2R2HB 1N64H 1Q0XH 4D0CB 5ID1B 2CKNA 4NN5B 5SX5H 4DUVA 4LBEA 2R4RL 3VMPA 4UBDD 2X1OA 3AREA 1ED3B 4G8FB 5F9JA 1LEKA 4HH9B 4UIMA 3RL2B 3VXME 1YEEH 4KK5C 4KHTL 3FO1B 4XNYL 5T33L 5DGRA 1RJLA 3OBAA 4NZRH 3WIIL 5DTFB 5ESQA 2W9EL 2P5WD 4QHLB 3LEYL 3GGWA 4A6YA 1UACH 3BZ4A 2YA2A 3F7VB 5SWZE 3NIFF 1RZ7L 3WD5H 1KTKE 3H6JA 3CZFB 4PB9H 1XF2A 2WLZA 4OT1L 1ZGLM 2JCCE 3V4PH 4XAKD 3K3QA 1CGTA 3KJ4B 4KMQA 5LXGL 2GITA 4A2MA 5ABDE 2ARWA 2IPKA 1W2KT 4G8IB 1FDLH 1JTTA 4ELMB 3MLXL 1DSFH 3C5SB 5CSBA 4E0RA 4ZD3H 4LHUD 4ONHB 1EXUB 2A1WL 2DQFB 1K2DA 5EO1B 2D03H 5EU6A 4TPRL 2DI8A 4PJ8A 3MJ6A 4RAUB 1RUQL 1KPUA 5FHBH 4NCC2 3QXTA 4W81A 3N1MC 4FQHB 5D1ZB 1QLRB 3JV4A 2QQKL 5FGRA 3PGCA 4ODUB 5EG6C 3KGRA 2O61B 3LSOA 3EAKA 3MRLB 4E41D 5CFHA 2X4QB 2E6PA 1LO3H 2GJ6D 4X6CB 4UQ3A 4FOMA 4R96B 4O4YL 3WS6C 3QHZH 5EPMB 5JDSA 3ULUL 4MMXC 2DLGA 5D1QA 1JTOA 3BYYA 1Q9KA 1VFAB 1S9YA 3OKNA 4XBPA 1NGZA 2EEAA 3L5WA 5HI3D 2G2RB 5E2TL 4BYHA 3O6KH 2D2OA 3U6RA 5BS0E 1MAML 2HLFD 2VDRL 1OHQA 4DFHA 3DJ9A 4EI6A 3IU3B 5D5MB 2FZ3A 2X4TA 3RL2A 4E9LA 5GRJH 3D6GA 2AQ2A 3RWCB 4P4KB 4PRAA 2ESVA 3ARDD 1VERA 4EUPA 4I13B 1MCBA 1S7TB 1KUMA 1MFDL 2BFVL 3G6AA 3ARXA 4R90L 1H5BB 4JZJA 2QSTA 2VAAB 3N85L 2GSGA 4U2ZA 4ALAL 43C9B 1OTSC 3LQZA 1QO3B 5ETUA 5FA4A 4JRYB 4JRXA 5DEGA 2DQUL 1ZVHA 2W9LA 2ICEB 4WEBH 4HUNB 4JZOB 2CLVB 4MAYA 5HDBE 4IMLA 5GS3A 3PHQA 2P8PA 1MHPH 3AS0A 5DJZA 5F93C 5C0CB 3C60C 2GQHA 2C3XA 4MCYA 3IU4H 3WFBH 1WLHA 4KDWA 4NNYB 5J13B 5HGDA 3IDIB 1JZ8A 4UIKL 3SDDB 3WE6A 2OQJB 4GRLC 5ICZB 4Z7WB 5FUCC 4YHIA 1QSFB 1MCHA 2UY7A 4RAUA 1A14H 2R1XB 2QR0A 4LVHC 5I1IL 2EC8A 3SE8L 5I73B 4Y16D 4APQB 1HINL 3G9VA 4TUKL 3T2NL 3VFTB 5KSAB 1Q94A 2MJWA 4F80A 1YEFL 4JR9L 2NXZC 4QWWC 5E8OA 5MEND 2OR9H 3BMWA 2IH1A 5EUKB 3VWJD 4NIKB 4ZUUA 3STLB 1KJMA 3RGVA 3EW3B 2ZCKL 4LSRH 3BH9B 4JN2B 2GK0B 3LS5H 4R0LA 1JWUA 2O93L 4PLNC 1WISA 2MOVA 3IDMB 4W6XB 3ZE1F 3VFWB 1V7ML 2RR3A 2BXYA 4WNQA 1S7QA 3C5ZC 1CGSL 5DHXB 3ZE1E 3TYGL 3RBGA 4QTHA 1UH3A 4S1DD 4QCIB 5GISH 2R4RH 4BH8A 4CL7A 3HZVB 1FFQA 3EYVB 3TPUA 1R3IL 4CN4A 2CUMA 1YEEL 1X7QA 3GMMA 4PJHA 4YFDB 2B5IC 2AJXL 5ICXB 2DLEA 4PRBA 4Q9RL 1L0QA 4EI5C 2Z93A 5EC2B 4YK4B 2AK4A 1BZ7B 4X4ZA 5E8NB 1CFNA 5A2IH 3HI6H 1LEIA 2QADC 3BGAA 4PJ9A 1G6RB 2X4OB 4HXAH 1N6QL 4HUVA 1KIPB 1NBZA 5I6XB 1OAYH 1INEH 4CDHA 2XN9D 2XXMB 3RZWA 3BRGC 3C8DA 4DFIA 1DSFL 4G9FD 3F6LA 4K3EL 3DURA 1HQRA 1TZGL 2A1WH 5JUEH 3P0YH 5EOTB 4C4KT 2Q86A 2OQJA 1BBJA 3VXRE 4AY0A 1EO5A 1Y6NR 1PKQB 1KIQB 5F7WC 5ALBH 3V9FA 5TQ0L 4Z77B 4WO4B 1RQ5A 1CCZA 5T1LB 1RD6A 5EOQH 2D3VA 4U7SA 4JKPH 4MQXC 1I3RB 4X0KA 3H3BC 4U1LA 1LNUA 1HXMB 4DW2H 4OCMC 4R4FL 1OPGL 1SJEA 4WFGD 4OLEA 1KIRA 1S5HB 5L2JA 4WI4A 3MRBA 5CJOL 3T1FB 5CBAA 4A2LA 2VQ1B 3QHZL 3RAJL 2QQLL 3QQ4B 4YZFF 1Z9OA 4GH7B 5KN5B 4ZDHA 4NN6C 5EU3B 1A02N 1I1RA 1K8DB 1DVFD 32C2B 3BZEA 4JPVH 1IJ9A 4D9QE 4LSUH 2DQCL 1CGXA 5GGUB 3OJVC 5E2TH 1ZLWH 1PSKL 5BS0B 1D5XA 3B83A 1E28A 4RGMC 3QG6B 3GI8L 4GXUN 3EIFA 3G5VA 4KRPD 4MJIE 3TYFB 1EV2E 2CKBA 2I25N 4FXKB 1MCOH 4XBPB 5EZJB 5D7LA 3BD5A 1UEMA 1UJ3A 3FT3B 4UQ2A 3PWLB 5CGYC 4FZEL 3QCVH 4F37K 5GGVL 4OGAD 4RGNE 4R90H 2AXGB 1JGLL 3GK8L 4M7ZB 1GC1C 5E9DB 3QBTB 5E00A 1OVZA 5GJTL 4U1IB 3LKOB 1QVOB 1B0RA 2EYSA 4LKCA 1W0VA 4HZLA 3O4LA 1ES0A 4MHHI 3GBNL 4N1EA 4X80H 5C0FB 2BNUA 1U93B 1OSZA 3L7FB 4CUCA 3ZHDA 1OGAB 2X4PB 2R1YA 1TTGA 1CDCA 5SV3A 1DLHB 2WWMC 3I02B 4HUMB 2LTQC 1WCBB 4UIKH 1LP9F 5D1ZD 1BQHA 2CGRH 3C09B 5FDYA 5K9QG 2HP4A 4U7MA 4F57L 4EJ1C 1AO7D 5J6GA 1JGUL 3MO1B 4EDWL 3QQ9C 5IB1A 2COQA 3CGTA 4M6AA 5KZCB 4OM0L 5I1GL 5C0BA 1T1YA 1EUTA 3PQYA 4QGTA 2AJSH 5I15H 4X99A 2MNUA 1A7BA 1UWGL 1IEHA 5DMKB 1J1XH 3DWTA 5ICZA 2W38A 1LHZA 4OD1H 2AV1B 1MEXL 2GTZA 1H3XA 1S9VB 3MBED 3T0WA 1EA9C 1ODAA 4UTBL 3IAGC 1A7QH 1SJHA 5D2NE 4I0KA 3TO4A 2HRLA 4RWHA 2YD2A 3PWNA 2E9JA 4L3CA 2BJML 3NIDF 2ESVE 4NO5B 3SDXA 3OKDA 2AJ3A 2P46B 4R0LB 4HFWB 4D0BA 3CK0H 4X8XA 4KDTC 4OBRA 4ZNEA 1OQOA 3KAAA 5I1KL 1YNKL 5IFHH 3H0TB 5BZDB 4NC1C 1V7NH 3PDGA 5I19L 2Y5TB 3EFFA 3MUJA 1Z3GL 5DO2D 4UB0L 3QIBD 2RQ8A 5HHXL 3UROR 1CLOL 1TJGH 4K3DL 1AR1D 2UUDH 2VXTL 2CLZA 1D9KD 3SY0B 5T1DH 2YC1A 1YEGH 3WJLA 1KC5L 2VIRA 3MQIA 2R1XA 3D3VD 4EXKA 1D5BB 1RK1A 5JQ6L 4ZFOB 1FIGL 3QEHB 1OAYL 1YC7A 1C5CH 4NT6A 1RZGA 4OV5B 1IFHL 4OZIB 5GZNC 5D1XB 1VPOH 3X11A 1F3JA 1N26A 3RY5A 3EYQD 3ARBC 2HKFH 5T1MB 5JUEL 3GO1H 1J1OH 1X9QA 3QNZB 1AD9A 2B4CL 1HHKB 4XXCC 1I75A 2A77L 5B3NA 4LCCC 1LO4H 3WHE0 4DGYH 5EOQL 1MCNA 3QIUD 1U2HA 2BP3A 3KPRB 4QF1B 1CF8H 3FRPA 5IT2H 1RUAH 2A2QT 5GHWH 5C8JB 1I8LA 5JW4R 1FZKB 4HQQH 2DAVA 1DQQB 1JBJA 2NY6C 3O2VH 1HEZB 2HN7B 2AJUL 2HG5B 4WW2B 4XPGL 3K0WA 1J0ZA 4RFNB 1G9NL 2DQIH 3CFEA 4YK4C 4W4OC 5ITBL 3OHXB 3FCTB 3Q6GH 2CDFB 5LWYL 1N3NB 4PRIE 3G6DL 1F90L 4WCYH 3REWA 3MRRB 4P2OD 4U1JB 4JJHA 4NWUL 2ZPKH 2VERN 3T3PF 3HG1E 2HWZL 5D1QB 3DO3A 1WT5C 4RX4A 1RHFA 1AP2A 4HULB 2FECL 3MRPB 3RGHA 4F58L 5IESH 1MCOL 4JFFB 4POYA 3Q3GA 5H2BA 1UZ8A 4NUJB 5EN2B 5GGVH 2O26U 3BIKB 3T1WA 4GAFB 2UYLA 3B5HA 2CLZB 2VN7A 3OKKA 4WY7L 1ZGLB 3BISA 4OLWL 2J6EA 1NCWH 2K1MA 4OD2A 2NXZB 1T1WA 5DJ6A 1A4JA 1QFOA 4MB4A 1RZ8A 4KJQC 4F9PC 3GHBL 3L1OL 4IOIA 1EPFA 5JOEA 5T3ZL 2YK1L 4OUUB 3S37X 4ZUTA 5ENWA 3O4LB 5BRZB 4Z7QF 1H3VA 5I74B 2NY1C 5HDQL 2EDOA 4U33A 1OSZB 1Q1JL 1A7OH 3MV7D 4NQSB 1AQDA 5K9OA 2ARJA 4FN0A 1JUFB 3KLAA 3GKZA 4KUZH 3S4SA 4EKXA 3DI2B 3ZHKA 5JW4Q 5DF0A 2G5BB 4HX1B 2IG2L 4TNWK 3MOBH 5TE6H 4RBPK 4P5TD 3LV3B 1YC8A 1DE4B 4MB3A 4P2RB 4XBEH 2J5LB 1S78D 2BY2A 3Q0HA 4UQ2B 1T6VN 4F9LC 5J1AB 3HNSL 2WQRA 3TIDA 1CG9B 4BKLB 3BIAX 3WLBB 5DLML 3B9VA 2JCCF 1HDMB 5BMFL 2FO4A 4M5YH 4YXHL 4DQOL 1UXSB 1C1EH 3FN9A 1XF5B 4DGVL 2D9CA 4I1NB 3RKPA 1KGCD 3RQ3A 2NZ9C 1SMOA 5L2KB 1OTTD 4J3XA 1DLHA 2QQNL 3L9RA 2VC2L 4UB0H 3FQTB 1F6AB 1A1MA 3N1QC 4FFWC 2AJYH 1SHMA 5IWLA 2OCFD 4Q6IC 3KXFE 1DQML 4Y4HD 4EN3C 2C7UB 5T1DL 1TZIA 1V3JA 4AK1A 4CGTA 4G80A 1KC5H 5CCKH 3JUZA 4V2CB 3MRQA 5FYKU 4EN3B 1N6VA 4UDUA 3EOYG 3CDCA 1K8IA 3HE7C 3WJLC 4K2UL 5ESQB 3QG7H 3CX2A 4JO2L 1U8IB 3MJ7B 5CMAA 1SBSL 2WUCH 4PJ8B 5T3ZE 1P4BH 4IRZH 3L5XL 4JEGB 2IAMA 3SQOH 4N5ED 4NJAH 2Z35B 1O7VA 2Q8BL 3QUMB 2ZNWA 4G6JL 4NKIH 4KI5F 5HVFB 1ZHKA 4C56E 3RY6C 1SEQL 2GJZA 5CINL 3TBTB 1JHLH 1CFVH 5FUCE 3VH8G 1BVLB 3C5JA 3VXPB 1IEAA 5IMMB 4HKJA 4I18A 1P5UA 4XGZA 5IHUH 3WHE1 4OTXH 3WFDL 3S88H 4ZOCA 2AJUH 5CBEA 4YHZL 1T89A 1T03H 3B43A 1Z0MA 4JANA 2OM5A 2IALB 2V6HA 4OLYL 1FE8H 1OARL 2YWZA 4Q2ZA 4AG4L 3HB3C 1A9BB 3BP6A 4UTAH 4J3VA 4ODUA 1ETZB 4BFIB 4YEEA 5C6TL 3ES6A 1DUZB 1KLFA 3CFCH 2ZPKL 4OZIE 3FCTA 4NKMB 3GSUB 1ZT7B 2EO9A 5FGCE 2ED9A 1M6OA 4XNXL 5DT1L 1JRHI 1EO7A 3GKWL 1L7IL 3FAXA 1MCFA 2VUOA 2JB5L 2H9GA 2YPLB 3U2SB 2IMMA 3QDGD 4L9LC 1P5VA 3B9KD 3ILQC 1I7UB 3T2OA 1QLFA 2Q3ZA 1QBMH 4HJGB 3ULSA 1DL7L 4EN3A 5L88H 4G5ZH 1MJ7L 4MA3A 3SGDI 3O6ML 1VFOA 4MNQB 5C08E 4M6OL 5GGQH 4MXWL 3MBEA 2WINB 3L1OH 3GBMH 3HCVB 2DL9A 1Y18A 1A9EA 2CIIA 5JPNA 3O4LE 2HT2C 4XP5H 4GKZA 2A73B 4QY8B 3O6LL 2FIKB 1EFXB 1Q1JH 5C0ND 4HG4J 4YO0B 4V1DA 1R3HA 3BPOC 4YDVB 4LL9A 4HKXB 1G7HB 1G7PA 2DWEB 3JWOH 5EB9A 1G6RH 5C71A 5FGBA 5DD6A 2IG2H 5C2BL 5T3ZD 4YFEA 1NCCH 5DJDA 4PJBF 5INDA 5HHQA 5FCSH 4EBQH 4EOWH 1EBPA 3PQYB 1MJJB 2XWTB 4PGEA 1UZ6E 2NTFB 4R7NB 3BFOA 5CJ8A 5IBTL 3FTGA 3O3AB 3VGGA 4Y19A 1EEYA 3KJ6H 2UYLB 5EUOA 4JO1H 4O5LL 1U3YA 4HEPG 5I2IB 1F13A 2ZCHH 4PJCE 2VXQL 2YRZA 4UILL 5BJTB 5J4MA 5GGTH 3TO4B 4MNHA 5FECB 4IDJL 4X6DA 1YY8A 4RISH 1X5AA 2DQJL 4P23A 3VGAB 1MFEH 2BVYA 1G0DA 1AO7B 4ELME 5T1KD 4Y2DC 5L6YH 4IRSA 2K3TA 2BNRB 4LRIA 2ADFL 3FAWA 3O0RH 4G6MH 1F6FB 2NY1B 4YHMH 3VXUD 1NBZB 2X40A 3KYNB 2DL2A 5C70A 5HPMA 4H5SA 1JWSA 3C6LC 5B38A 1D5MB 4LARL 2ZSVB 2AABL 2Z91A 3NN8A 1YEKL 2IADB 5J3HC 5DSCB 5K9KA 2E9BA 2P44B 1QA9A 1NPUA 2ZCLL 3IJYA 5EOCJ 5EOTA 1YPZA 5DJ0A 2FJFA 4HWBH 3BW9A 4U1NB 5KBNC 1GJIA 3SQBA 4F15B 1CZ8H 4C59B 3WIIH 1JPSH 3ABZA 4FTVD 3RHWK 4FQXC 5GS0L 4DWHA 3T65B 5FEBA 1CFNB 3LRHA 2Q8BH 5I1CH 4EDXA 3GJEB 3O4OB 5I1DB 1MQKL 2WBJA