2LU3A

Solution nmr structure of the apo-form of the beta2 carbohydrate module of amp-activated protein kinase
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
105
structure length
105
Chain Sequence
GAMGIRNSDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-AMP-activated protein kinase subunit beta-2
publication title Structure and carbohydrate binding of the beta2-subunit of AMP-activated protein kinase
rcsb
source organism Rattus norvegicus
molecule tags Sugar binding protein
total genus 8
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2012-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16561 AMPK1_CBM Glycogen recognition site of AMP-activated protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2lu3A00
4PGEA 5J57B 5HHQA 4K7FB 3QJFA 5JZ7D 5D1XC 3DXAA 2Y6SC 3J8F7 4PJ9A 1T2QL 4WWKA 5IW1B 4XCYA 3MSPA 2XN9D 3KDMA 2FZ3A 3LRGA 3IDXH 4QHKI 3NCMA 2XIDA 3EYOB 3QFJD 1RJLB 1RZIA 4UV7L 3OMZA 4WFFE 5T5NG 1XEDA 5CMAA 3DVNB 4F15C 2DQFA 2C3VB 3LOWA 2ATKA 1S7WB 1PY4A 3V7AE 3ME0A 2Y4SA 1T5WB 3RX8A 4U6TA 4PTUA 3QEQB 3TNNA 4JAMB 3D9AL 4L1HA 1F3DJ 2GSGB 5FIEA 1NH6A 3A6CL 2YWYA 1ROWA 1U8HB 4G6ML 4YC2C 4LSSL 4RFEA 5KSBF 4OCWL 1QVOB 1PZUB 1JNLH 2I07B 3RZCA 1WAAF 3V5DA 1I7RB 4PREB 4UIKH 2E5EA 3BPNC 1T3FB 1K9TA 2E8ZA 4M1DL 4RGMB 1NBVH 5C09D 5FGCB 1NLDL 2NPLX 4JVPA 2BNRE 4PJGE 1NFDA 2W65B 2BOBA 4ODBD 4PGZA 3ZDYE 4K7PX 1QP1A 5ALBH 5T3XE 1T89A 3F7VA 3I75A 4QHLA 5F9JA 3X3FL 1A7QL 3MACL 2V5TA 3IRPX 4HAFA 4NJ9H 2Q87A 1QUNA 4ZS6D 5SWZE 4PGJA 5FUCE 5LWYL 3CMOH 4GRLC 1YPZA 4PREA 3LKPA 2AJ3B 1YNKL 3DRQA 3QG7L 3T3PE 1JNNL 5E5MB 4CGTA 1ERNA 5I1GL 4XMPL 2O5YH 3CGTA 3GRWL 4AG4H 4IMKA 1FYTB 1YECH 3G6JA 3CU7A 4RAVA 3SGEI 5F1OB 1NANI 3BDBA 3C6LB 2NW3A 1F11B 1B0WA 4QTIH 2DQEL 1JYVA 4BYHA 4OLYH 4HDIA 4OLZL 2LV4A 2P43B 3T0BA 5J8OA 2X40A 4GW1A 4HULB 5HGGS 3L3JA 1V7NL 2XOTA 2IF7A 3DMMC 4UI2A 1V3LA 4WO4D 3ROOA 4FXGA 3ZKSD 4O2FB 4HWBL 5BRZB 4N9GB 1SM3H 4FFYH 5I8KH 3EOTH 1G9NL 1S9VB 4GG6F 2XN9E 2NY1B 1F11A 3FT2A 1RK1B 3GHBH 4ZTOL 5M95B 1I7TA 3PXHA 4DKEL 2D0GA 1AC0A 1MQ8A 1X5JA 1XGQA 1HHJB 1URLA 4FZEH 4UOW1 4MAUL 5IBUG 3MJ7A 4FMKA 5IKCB 3S4SG 2JTDA 4L29A 4N9GA 5BRZA 4CKVX 4Z7NE 3FZUC 3GKWH 2D7TH 3KJ4B 1JHTB 2BXYA 2EH7L 1X5LA 3CNKA 3EYQD 2R8SL 5EU5B 2V2WA 1PEZA 3BPCA 3V79C 1NMBH 3W81A 4D0DA 1RK1A 1YMMB 1JWSA 2VLLA 3C09B 2YEZA 4OLWH 1IKNA 1BP3B 4U1KB 1DFBL 1EHLL 2VKXA 1A6AA 1IGYA 1I3RB 1WBXA 1I1AA 3VG0L 1QLRB 1GC1C 3CFKA 4HEPG 1QZ1A 3TWCL 2LU3A 2B5IB 4Y8DC 5IEKA 1BIHA 4PP1D 1P4BL 3LKRB 3DV6A 3WNPA 3VGGA 2DKUA 3K7UA 3PHQA 3NTCL 3QCTL 3MLXH 1HNFA 8FABA 1NKRA 4XAWL 2FJGA 1M05A 3DARA 1A3RH 2VN4A 4NNPL 3O2WL 3NAAL 4Y1AB 1Z0MA 2HKHH 5JHLH 4OLVH 2DAVA 5DD3L 4RWYH 2CUMA 4FQQA 1T1XB 2DLIA 4UNTA 1NCTA 1T1WA 4JKLA 4OKVA 2R1XB 1ND0A 3ULUD 2YPKB 4JPKL 2ZUQC 5F7NC 4U7KA 2HFFB 3QXVA 2ICEB 3VFUB 3W2DH 2FL5B 4PGBB 3L5WA 2J6EA 1OM3L 1YEKH 1G0DA 1Z9SA 1EPFA 2PW2A 4Z0BL 3A6BL 4PJCB 3QULA 3QWRD 5I71C 4NOFA 4YUEL 1MFDH 3H3PL 4XP5H 2C3HA 3EYUL 2R1XA 5DVOA 5D6DC 1K4DA 1UM4H 3P0GB 2H1PL 3BGMB 4WEBL 1F3RB 2KQMA 4JZNB 4Z78B 1BM3L 5DXWA 1R3HA 3H3BC 4TSAL 3WYRA 3HMXA 3Q5OA 5B22A 5L8LB 1P6FA 4G6FD 1LK3L 2Z93A 3PV7A 4NFDA 4TUJB 4MJIA 1HH9A 1SJEB 1CK0L 5C6TH 1MHEB 3DUUB 4XX1G 2A9NL 1LO4H 3V0WH 2O5XH 3SKOA 2R0KL 3ZE2F 4F9PC 1NMCC 4YR6B 5FKAB 3LPGA 4PB0H 4QHMA 3H42H 2ZKHL 4BH7B 2P5ED 1G7PB 4WHYH 5E4IA 4Z7QF 4OLXL 2VISA 4XPFH 3TN0B 4Z7VF 1WK0A 3EFDL 5IB4B 1T03H 4HFWB 3U9PL 4QXTA 3ZE0E 4QRTB 4LCWA 1NBYA 3C2AH 3C9NA 2FWOB 2XY2A 3OGCA 3W39B 4L5FL 5C3TA 2AW2A 3JVGC 5GRVK 4C59B 1A7PH 1MHEA 2XWJB 4I18C 4OI7A 1CD0A 4Y5VA 5T1DL 1EFXA 5JOFB 1YYML 2P45B 2DM7A 4NKDB 1PG7H 2GITA 3RDTC 3WIHL 2X4SA 5TDOB 4GMSH 3K0WA 1C5BH 4F33A 4CVXB 1U8MB 1FFOA 4Y5YA 4K3JL 4V2BA 3BGFC 5ACMA 1OAYH 1INQB 5D5MA 3MGTA 4LF3B 3RVTD 5DC4B 3QEHA 3MBXL 4NHCH 3GHEH 2Z4QB 3BKCL 1FAKT 3JUYA 3RNQA 4Z7OE 1O7SA 1B4JL 1KC5L 3STBA 4F2MB 3ULUE 4U6VL 1PVHA 5MHSE 1MELA 5KTEH 3BWAA 4JVUA 5E8OB 4C4KO 4EXKA 3FB7B 1FJ1B 1KJVA 2VE6B 3O6FC 5F7EL 4NKDA 1QSFA 4NKMB 4RNRA 4S0SD 1KIQB 4G6JL 1DR9A 1FGNL 3VXME 1MRCL 1W72H 2NY4D 4H88H 4F8TA 2XYCA 3N50A 4W6WB 5JXAH 4X99A 1MRFH 2YD1A 3ARUA 2APWA 2UYLB 4HGWB 5C0CA 4P5TC 2DL2A 5JQ6H 2BJMH 3CSPA 2AXHA 1W0VB 2HT3D 5DLML 3EOBA 3KPRD 4PRBB 4DKDC 1QSED 3REWA 2BNUB 4YGAB 4IIQA 1R3JA 4LBEB 1J05A 4KZEL 1WV7T 2AXFB 1ZEAH 1ZA6B 4HS3B 1IC5L 1CT8A 5E1AB 3VH8G 3U36B 3L3HB 4KVNH 2BY1A 1D6EB 3VDAA 4GBXB 2DWEB 3L5XH 1QOKA 5E8PB 3IDYC 4JDVB 1LE9B 3HZYB 1Q8MA 4L4JA 1IEBA 1U9KA 5JNYB 1MIEL 1NFKA 1NFIB 4J4PD 1H8OA 4R2GC 3GI8H 4KRPB 1MCWW 4ZAKA 3WUZA 1Z2KA 3HC4H 1Q72H 3JUZA 4AEHL 4PB9L 2W60B 3RHWF 3LRHA 1EO8H 3V6OE 2CSPA 3MCKB 5E6YA 3KR3H 1UVQB 4N8CL 1S9XA 3DX7A 1FRGL 2P5EE 1X7QB 3O4OB 5SV4A 2YSSA 1KXQE 1H3XA 2P8MB 4POZD 2WLYA 4JDVA 4LAJH 3HZYA 1T20B 3QHZH 1RJZB 3ZTNH 3I9GL 3T0WA 1JGUH 5A2IH 4JLRB 3RWIA 4UOW0 3DTXB 4XRCB 3VFMA 1J1PL 2EDRA 2VSCA 1KIPA 3C60B 4XWGL 2JJTC 3QDMB 2X4OB 2DLFL 1JGEA 4GRWE 3MCKA 1OARL 3MODH 4P5MB 3TH3T 4J1UA 4KK5D 5J3HD 5B3JE 5C0FA 3GSNA 4N0CC 1A6ZA 5HDBE 4P2CG 2APTA 3ARDC 2BX5A 2AXGB 3ARBD 1OB1A 3HKFA 4MAYC 3ALPA 3I84A 1KPRB 1UZ6F 4NN7B 1N5YH 3DSFL 2VITA 1UWXK 5C2UB 1ZT4B 4WHDA 3E6HB 2YKLH 4E41D 4DOHE 2CLRB 4P5MA 2JKXA 3DBXB 3V52L 3BZDA 5JIIA 5CSBA 4LHUB 5JR1H 3CAFA 4NWUL 5E24E 2ORBH 4OZIE 5JXEC 5E8NA 2A38A 4JPVL 4I77H 1R5IA 3UP1A 3PHOB 3PL6C 1GGTA 1S7UB 3GSOB 3N85H 5C71A 1I3UA 3LRSA 4PFEA 4PUBH 4TSBH 4U1SA 2R2HB 4LMQI 2XNAB 5ILTL 1IM9D 1G6RL 2XA8L 4M1GL 4L3ED 4HUMB 3QDJD 4NO5B 2HJLA 5CAYB 3U0WH 4RA0C 4ZFZB 3WIFB 1G7HA 1TNMA 2EXYD 1A2YB 4B7IA 5I9QB 2NYYC 5HI4C 5CIPH 2XQBH 1HOCB 1BBJB 4IRJC 1EV2E 3MRHB 1GGIL 5HHOD 3PHOA 4H1LB 2A6DB 3WHE0 2AABL 2NCMA 4UAOB 3GSOA 3QCUH 4JFEA 1FFRA 4MLIA 3MA9H 2J8OA 3MOQA 3HG1D 4GO6B 4L8SA 1IZJA 3B5TA 1NAKL 2JJWA 5FYKD 2YRZA 3Q1SH 4G8IA 4XXCC 2A6KA 3IFLL 2NTFA 3JTSA 5DD1H 3K80A 1F58H 1NGQL 1BBJA 1YEDA 2FBJH 1HCVA 5DTFB 5B3NA 4FQ1L 3LS5L 4JKWA 3C5SB 4P2RE 2WWMD 3S35X 1KJMB 4RMSA 3CU1A 1MJ7L 4JFYA 2X4PB 5FYKH 3X14B 1AC6A 1OSZA 5KW9H 5CSGA 4NRZB 3MRBB 4M93B 3LS4L 3BEVB 4GSDH 4F7MA 5AG9A 2W0LA 2WBJB 5EUOA 4RX4D 4OZGA 4OFVA 5C07D 3RAJH 1D5IH 1S9YB 3O45A 3KYMA 4UUJA 4R8WL 5DUML 2X4TA 1XF3B 4FFWD 3OR6B 4NKOA 4PRHA 3CDYA 1J0JA 2VXVH 4WGVB 5DD5H 4CU6A 1WGOA 2FX7H 4QT5A 4OCYH 4R4NC 2W9DH 1QFWH 3T4YB 5IROA 1RZ7L 3ZYOA 4W6YB 1NUFA 5IM7A 5HYQB 5FUOL 1AHWA 4D9LH 2W0FB 3S36L 4P99A 1XH3B 3MRQB 4WHTA 2E9BA 4R90H 2N7BA 1F4WH 4ZXBD 4R0LC 1F8TL 1QO3A 1XMWA 5T1MA 1BIIB 3JWOC 1TJGL 3GSRA 1D7FA 2CR6A 4EIGB 1LD9A 1DEEA 1P7QD 2F8VA 4AMKL 4M00A 3PWPD 4PRAB 4MA3B 4XMLH 5DRWA 3U1SH 2VTFA 4L3EE 3QDJE 3RWFB 4U1HB 4JM4H 1MWAB 2R39A 1CBVL 3KLHC 5F88B 5LXGL 2VDPH 2EE6A 4YDJB 4B0MM 4MJ2A 5EPMA 4PJ7A 4G43B 3DURA 3O4LA 3CJJA 2BNRB 4PJGB 1QLFA 3OX8B 3TPUB 1AQKH 5EZIH 2QQNH 2FATL 5DEZA 1RUAH 5ISZA 5SWZB 4F57H 2FB4L 3VWKD 1K5NA 2NXYC 1OGAA 5JO5B 1AD0A 5C7XL 1KEMH 1OAXH 3O3AA 3E2HC 1BWWA 4PJ8B 4U2ZA 4WCYL 4TTGA 5F88A 3WN5A 5FA4B 1ORQA 1NL0L 3O3EA 4XCEA 2FD6H 3LSOB 1WTGT 1A1MB 1RD6A 4O51A 3Q0HA 1GGBH 2GW5A 4D8PA 5I66B 1INEL 2XZCH 3OX8A 4UT9H 3RVWC 2OP4L 4NP4L 5JMOC 5LAXA 2FECI 4KMTH 4M43L 5KSUB 2EIDA 4XNQA 3MBEC 2X9XA 1QRNA 5C07E 2VLJD 4PJ8A 5C9KA 1QEWA 3K8MA 5FA4A 4MA1C 4JFOA 4XH2A 4LIQE 3RZWA 1D5BB 1TTUA 1TVDA 3D25A 1VGKB 3GMNA 5KSAB 2XN9B 2MCPH 4YDVB 4ZS7L 3SGDH 2M8XA 4ENEC 1TVHB 3LN4B 4YE4H 1U92A 2ADJB 2Z31C 4FFVD 1UJ3B 1C16B 1VSCA 5DK0B 2EDYA 4W4OA 5BOZG 4KMLB 4YHYB 1N3NB 1G7QA 1MCWM 1B88A 1I8IA 5K9OA 1W0YT 1EERB 3RWGB 1CDCA 3HI6H 1RZFL 1R3KB 3NOIA 5MEQB 5BW7A 1UACH 2CIIA 2VN7A 2P7TA 1WT5A 4LP4A 4QRPE 5E03A 3T3MF 3V0AC 4U33A 4ORGB 4X6EB 4YHZL 3FQTB 4R26L 2A73A 4ONHB 1TVHA 2R2CA 4ONGL 4ZO6A 4RMTA 4JO1H 5EU3A 1C16A 4MSWA 3QFJA 4BFGA 1V05A 1U8KA 1XCQB 2XACC 1JP5A 5D7KE 4JQVA 5EOCL 2X4NA 1SEBA 3ARFD 3TJHD 4ELME 5CEZL 3AAZB 1ZTXH 3NFSH 4HC1H 3EO1A 3I2CH 1YY9D 2AVGA 4F37K 4XWOC 4J8RB 4P46B 3GMOA 1FIGH 2A83A 2QQLL 2GTZA 2P24A 3LEYH 4I3RH 1H8NA 2I60L 3FQTA 4CN4A 1IL1B 1LE5B 1E4WL 4ONHA 4LKCA 2X6MA 4XBEL 2GSIB 3WNMA 2A6JA 1OCWL 3UTQB 3FT3B 1GSMA 1T2QH 4FNLL 4PTTB 2H32H 4E42B 1VFUA 3OAYK 2OI9C 3VI4F 4UIMB 1WF5A 3HC0A 4UV7H 3L3DA 1DL7H 1OGTB 5C09A 4AEIL 4J6RL 4P9HL 1WEJH 1UQSA 4MA7H 3VRLE 3PDOB 2QHLA 3B83A 2D3VA 3LN5A 5F44A 2IBBA 1Y6MR 1NGYB 1JUFA 5IVNA 2F8OA 2DMBA 1EJ6A 4OZFH 3D9AH 2L7UA 2VLJE 3TO4C 2VO5A 3A6CH 2GQHA 3DYOA 4UIMA 1J12A 2YA1A 3MNZB 4LSSH 3MO1A 1JWUB 3HE6C 4OCWH 4F7TB 1N2RA 3HE7C 2Z0BA 3M1BA 3SDDC 2CLZB 4MHHG 2VDLL 4HX1B 4BQBA 4OI8A 5HPMB 1DQMH 4M1DH 5DZNA 2EEAA 1NGYA 1UCBH 2FX8H 3TP4A 4FABH 3W5NA 2IGFL 1NC4B 3V6FA 1RMFL 2WBWB 1K8DB 1QBAA 2J3SA 5EO1B 3WFDH 1XIWC 4I4WB 1C5CL 2Q3AA 1FNSL 5DS8B 4HH8A 3NIGF 4WO4A 3ULVE 2Q7YA 3X3FH 4Y2DD 2IALB 2HTLC 2ERJB 3FFCD 5DHYA 3CK0L 1H3VA 1FV1B 3RIAK 2CLZA 1BZ7B 5BZWA 2IFFL 4GKSB 3QXUA 1YNKH 1NJ9A 2VZVA 3QAZC 1JNNH 3QG7H 3IFNH 3WJJA 2HFEB 1WUNT 1HHGB 2ED8A 1UB5B 4XMPH 4YIQB 3UTSA 3GRWH 5I1GH 1DUZA 5FCSH 4ZPTA 1IMHC 4NCC2 4KK9C 1B6UA 4JRXD 1KTRL 5FYLL 4QHUA 2DQEH 2KZWA 1FC1A 4OLZH 3GIVA 3P11L 3ET9F 1FGVH 4LLQA 3S5LG 1AE6L 1V7NH 3BFOA 3CVIH 2D31A 3T2OA 1T1ZA 2O93L 3OPZL 5A16A 3FQRB 5C0DA 1CICC 4R3SB 1UB5A 2VR4A 5F1SA 2BVQB 1U3JA 1BLNB 2X9WA 2Y36L 1B0RA 1CDUA 5BS0E 1G9NH 4FQXC 1F13A 3BT2L 3TZVA 3HUJE 1UM6L 4CU7A 1KPVA 1YQVL 3B9AA 1JGLL 1NGPH 1FL3A 3GMPA 4NCC1 3G9VA 5I1DB 5HHPA 5I73B 2FLRT 3VXMB 4NO0D 5EU6A 1J10A 3DGGA 5BV7L 1NSNL 2N7AA 4R3SA 3G5VA 3HB3C 3U46B 4PJ5E 4JO3L 2R8SH 2EDDA 3OZ9L 1KTLA 5GXBB 1Q0XL 3S9DB 3U9UB 3S88L 4NC2B 3D0VB 4LEOA 3SDCC 1W2KT 3ZKXC 3S34L 1EHLH 4XCFL 5DJ8B 2F8XC 5L2JA 3VG0H 3O9WD 3BN9C 3TWCH 5J89A 4NDMB 4LLUA 3P40A 1CE6A 4MA8L 5DJ0B 3VE0B 4N5UA 4QO1A 3GJEA 3UBXA 2HP4A 4FQLL 2GK0A 3U46A 3VD3A 5AYQA 3UC0L 4N8VB 4NHUA 4YAQA 5T33L 1XR8B 5TH2B 3NTCH 3QCTH 2FLBT 3QQ3B 4L4VD 3QQ4A 4XAWH 2A9ML 4PJ9C 3CSYB 3DV4B 4NNPH 3O2WH 4WWKC 5F1NA 3NAAH 5F8QC 4A6YL 3FFCE 1WBZA 4NSKA 5EBLA 4HWZB 1QLEL 5DD3H 2JE8A 4YHIB 2IMNA 4UINH 3VD5A 2W0PA 2P5EB 2QEJA 4NT6A 4YK4C 3QHTC 5D7JA 4XC1L 3U4EB 4KI5E 5I8CA 2C3XA 1YUHA 1NC2D 3B9VA 1HIML 5DMGC 5JORB 5DRXB 4EDXB 4HUXB 3SQOL 3QQ3A 2B1AL 1OM3H 4M6OL 2VLMD 5KN5B 3O2DH 4YZFF 2GY5A 1QSZA 3A6BH 1LO3L 1IAKA 3SDAB 5ALCL 4HWZA 4GRWB 3H3PH 4R7DB 5TF1L 2ZSWA 4L8BB 4OZ4B 2BVTA 3EYUH 3TNMA 1HKLH 1DVFD 4I13B 3MRFA 3OKNA 5EU4A 3EOYG 4JFHE 3T77B 1CU4H 2DI7A 3B8SA 4WEBH 1LEIA 4MQ7B 3WDIA 2HYMA 3ZDYF 4L8DB 1W72B 1BM3H 5DFVC 4M6NL 5F7LB 1HILA 2D7PA 3GNML 3MRJB 1DBBH 2G75B 4TSAH 1CD1B 3NCYS 5A2KH 4OM1H 3ZO0A 2LAAA 1LK3H 4NNXB 1LDSA 4DOHB 3AS0A 5D1QB 3T3PF 3BRFA 1T89C 4HXAH 2NY4B 2A9NH 1RZKL 3BP4A 2EDJA 4OZIB 2R0KH 3QEUB 4LSDA 1U8PB 4MQSB 2HVKB 5HYJE 4KQ4L 4L8DA 2X41A 1MSPA 1W72A 5AZ2L 2ZKHH 2R2BB 2QADD 4Z0XB 4RGMC 5ERWA 3MV11 2BDNL 1HK6A 4IMKC 5CGYC 2PETA 1CD1A 4NQVA 1DBAL 3U9PH 4AIOA 4G5ZL 2CIKB 5D7SL 2DLEA 2UWEE 4L5FH 5D7IE 5I1KH 1KN4L 4RQQB 3VFVB 1BVLB 2E7HA 1XZ0B 3QFDB 5J9PB 4FQIL 3UPAA 2WINB 3O3BB 1YYMH 2AERT 3BPLB 4U1NA 1U8PA 3WIHH 1U6AH 3QO1A 2SEBB 3WV0A 1ED3B 2IBGA 3RWDB 4K3JH 2R2BA 4Y8AA 3AS2A 3KPRA 4L4VE 3W11C 1QSEA 2R0LH 4R7NB 3OKKB 4GMTL 4F8QA 3MBXH 3BKCH 3REVA 3MMEB 3C6LC 3ELAT 1MJUH 4Z7WA 2LTQB 5IVZB 1B4JH 2OR8A 4Z7NF 1KC5H 4J7RA 3S3PA 2YD7A 4RQQA 4JANA 1EEZB 3MFFB 1KJ2B 4XXDA 1MCCA 3O3BA 5IHUL 3BZEB 3BP7A 4P2RB 3C8DA 3VXRE 5EIIB 5EC1A 4G6JH 2H2PC 5TJWK 3EGSB 4J4PA 3TBSA 1OAQL 2ARJA 5GGUA 2VLME 3HZKB 1CIUA 3T0ED 3RL2B 3MJ9H 4QHKJ 2XFXA 5DLMH 4G42A 4YHKL 5DI8A 1IKNC 1U93B 5IB2B 4KZEH 1DLHA 1BQHB 3QPQD 3AU1B 4WI4A 1KULA 1WZKA 3MOAL 3BZEA 3ARBB 1IC5H 5EIIA 1RVFL 3EGSA 4NKIH 3DX9B 5ENWA 3ZDXE 1NEZB 3V5KB 4MQXC 4RMVA 1JPFB 2DL9A 3G5YA 3P4NA 5C0GA 4FQJL 1MIEH 3MRLB 3GMMA 5AD0B 4DUXA 3NABH 5B8CB 3HCVB 1J18A 3C09C 4AEHH 1F97A 4PB9H 3VWJD 2IFGA 1ZT1B 5DHVB 5EZLB 5MENE 2GI7A 2GCYA 2FO1A 3IKKA 4PP2B 2XZAL 4Q9RL 2QQQA 2PO6A 3O3DB 3UJTL 1FRGH 1MREL 2V2XB 1FZKA 4PY8J 1IM9B 1KT2B 3HC3L 4OCSL 4L3EB 1IGCL 1S5HA 3QDJB 1C5DA 4IJ3B 5IF0B 1HYRC 1B90A 4CDHA 4E41A 3SCMA 4JB9H 1L9NA 1J1PH 5FCUL 5AD0A 1EH9A 1FO0B 2HKFL 2UZXB 5JLZA 4XWGH 3VU2A 2DLFH 5LJYH 2BNQD 1OARH 4DKFH 3S96A 3IB4A 5CIPA 4CDGC 1IM9A 1KT2A 4U05A 4CNIA 4X4XB 5C8JA 1I9JL 5I1AA 2GIYA 2FX9L 3ROLB 5IF0A 1ZWIB 4K9EC 3L3OA 5IBLD 2IAMB 4MX7B 4G8GE 1CLZL 1UWXH 3CFBB 4Y16D 2VSDA 3PJSB 1PYWA 2VDOH 5D6CB 3DSFH 5ELIA 2ARWA 5IFHL 5HHOA 2FYYB 4ODTL 5KVMC 3IDMB 1M7IB 2EXWC 2WIIB 3GGWB 3V52H 3FCTA 4WI7A 5SWSA 4JG1L 3ZSTA 3TH4T 3ZE0F 3O11A 3HG1A 4D3CL 4X6DE 3T0EE 3N1FC 4OLUL 1I3GL 3C87A 2R56L 5C07B 4BZ2H 3EDEA 43CAB 3Q6GL 3QI9B 3UDWA 5I0DA 2BC4B 5ILTH 4BQ8A 1MCFA 5D6CA 1G6RH 3HNVL 3PV6B 4M1GH 4MNHA 1TJIL 4TOYL 5CD5D 3JV4B 5DVNA 2WIIA 1JTOA 4A2LA 5CWSB 3K8LA 3IXTA 2CK0L 2Z9TA 4AH2A 2ITDB 1KIRA 1I1FA 4Z7OF 4DN4L 5CBEB 2Q7NA 1G84A 3SJVD 4X80L 5E6ZA 4OGAD 4YH6A 3ULUF 4Y5YC 1Q1JL 4QXWA 5F7FA 5CILL 1WVZA 2YRLA 3EYVB 1B4RA 2VC2L 4U3HA 4HZAA 1EZVY 1NAKH 3F6LA 3JV4A 3KPSE 4TYUA 5DJZB 5IB5A 2P4AB 2YZ1A 5CWSA 3IFLH 1I9EA 1P7QB 4MD4A 2PCPB 1RZJL 1NGQH 4XNYL 1HQRB 5CBEA 4ELMB 3LS5H 4PRPD 1HYSC 1MJ7H 1U8OB 5EUKB 4PRDB 3OG6B 4CW1B 4BZYA 1ZKAA 5CJOL 4ZXBA 4NRXB 3EJZC 2BNQE 3B4NA 5D70L 1V3MA 3MJ6A 3VFRA 1MIML 1NCNA 3D39D 4R8WH 4XHJD 4WU5A 3IDGB 3PWPA 1EMTL 4MXWL 4JFFD 3VWKB 4MNQA 3X11A 1HQRA 3KXFE 4U1LB 1CQKA 5DMKA 4JM2F 3GB7B 3KPTA 1SY6L 4K2UH 3ZYJA 2Z8RA 3RL1A 1U8OA 4EQ2A 4RGND 1PG7X 3LEVH 1J88A 1S7XA 4WGWB 1T0NA 2Y07H 1RZ7H 3MUJA 3VFTA 2VZSA 1A7NL 5F3HB 3HRZB 3S36H 5IMLB 5E6IA 4ZMAT 1L7TL 4DQOL 5ICXB 3NCFB 1G7MA 1F8TH 1C1EL 1F6AB 1H3PL 3V0VA 1TJGH 1R3LB 2VLJB 4X4ME 3M17A 3VFOB 1BAFL 4GBXC 4AMKH 1CQYA 2NY0B 5J1AB 1JGVL 2DQHL 1Z0NA 1U8NA 4UU9A 4GRWF 5D7LA 3HRPA 5I1LA 2QL1A 1AO7A 3AVEA 1JN6A 5B3JF 4ZOBA 3LHPL 1CBVH 4POYA 2VDKL 2DIAA 5HDBF 2HH0L 4WJ5A 5B39A 1GZQA 2XKSA 2XZZA 4XBGB 1OTUC 4K07A 3SJVE 3MLWL 1F6AA 3O8XD 4UQ2B 1MY7A 5MERB 2G5BB 3IS0X 2QV2A 5IESL 5CBAB 2AJSL 3T1FA 2FB4H 1D5ZB 5FK9B 1ETZB 1BZQK 1XR9A 3OR7B 5FEBA 2HVJA 4ZUTB 4WCYH 4RZCA 1BX2B 1OWRM 4OZIF 3EKCA 2Y23A 1P9MA 3IJSB 4ORZC 5H8DA 1NAML 5I2IB 5GRJL 2MJWA 5GISL 5E94A 3BQUB 1FVEB 1CL7I 5TFSH 1NCUA 2G5BA 4M3KB 4DVBA 1KN2L 2J8HA 3O6LL 4NP4H 1A6UL 2KQNA 4Z7UA 5FK9A 3KYNA 5I19L 4M43H 2P46B 3ARGD 3FB5A 1H15A 3R4DA 4HC1A 4XP6L 2BMKA 4LPTA 2NY3D 1IARB 4N5EC 4NZUL 3RWJB 3BKJL 3D39E 3VGAB 1FE8L 3PABB 4JFFE 4HIXH 5BS0B 5DO2C 3ARFA 3MZTA 5I2IA 2J88L 4WHCA 4ZS7H 5E08H 3HUJB 2A77H 1RIHL 3V2AR 1W0WA 3GZKA 3ZKNC 1BF8A 4H20L 2YWZA 3EW3B 4FQHB 2H3NA 4OZFB 3BXNA 5EU7E 2H32A 5I1JH 2IH1B 3ECBA 1RZFH 1F3DH 1U0QA 2AJZB 2G60H 5HVGB 4KJPD 1GXEA 4L9LA 5TGBB 4L8SC 3L6FB 3OKEB 3A67L 4WW1B 3QUZD 4PJ5B 1ITBB 5CEZD 4YHZH 1N64L 3SE3C 2EIZB 4HPYH 5C86A 1X6NA 5I9QC 5J11B 3HI1A 3DROA 1U2CA 1AKJD 4NWTL 3QG6A 3CH1B 5J0BA 4OZFA 4ZDHA 3WL9A 1CDGA 1HCFX 5CEZH 4TNWF 4H26B 1IZKA 5KOMC 3QNXB 5TGBA 2I9TB 2CR3A 2QQLH 3G6AA 4KROD 3B9KA 2I60H 4NQCA 2EIZA 3MRGB 4X6FB 2O61B 4P2QD 4LSRH 4OF6A 1FSKC 3LVEA 6FABL 3SKNB 2OZ4L 3FFCB 1ZLSL 4I0PD 4FNLH 1U8LA 2APVA 3OXSA 4HJGB 2Q3ZA 3RWHA 1VADB 3NCJL 5IHBA 2J5LB 5D71H 4OQTL 2ED9A 5IP4A 2R23B 3BYYA 4M93C 3CCHB 1S9KC 3CX5J 4BUHA 4AEIH 4J6RH 2I9TA 4P9HH 5IROC 3GMRA 2WBJC 1AXTL 2OSLA 5I1HL 4X6FA 1RI8A 4GOSA 3LEXB 2AJXH 4PG9B 1BGXH 3GRWA 2RHEA 4GS7C 4NN6B 3SKNA 1NCCL 4P2OD 4Y2DA 3WJLC 3KPLA 4YHML 4L4TD 4WI9A 5GZNC 2CUHA 2V5RA 4YPJA 1VADA 3DYPA 1NMAH 4Y4KD 3UBXI 2O26U 4M02A 3ARRA 5BXFA 3ARTA 3KWWB 4WI5A 2G2RB 4HJJL 1SEQL 4LLVA 2VDLH 5B4MC 4JRXA 1KACB 2BVUA 1MCEA 3F12B 1JL8A 4WUUD 2WQRA 4MVBC 3ISWA 4QRSB 5GRUL 2IGFH 2D03L 1RMFH 4WI8A 5F7KC 5F89A 3T0DA 2H9GA 1I8MB 1Z9MA 1C5CH 3QUKB 4NO0B 4CJ0A 3BSZL 3AC0A 3LKOA 4YBLB 5JA9A 5T1LD 3RIFK 1TCMA 2ZWLT 3JTTA 3LQAC 3CK0H 3ZKMC 1F5WA 2VDML 4XI5D 4KTEH 5CEZE 5HYJB 3BW9A 5DJYB 5FYLD 2ZG3A 3BX7C 2CDFA 2RR3A 3GDBA 1MEXL 5DJCA 4F7EB 1N7ML 4DFIA 5BO1H 3WUWB 2VWEE 4WFHD 3NCYP 3TCLB 4AL8H 3SGJC 5HD8C 4JFQA 5D7IB 3O9WB 3WLWD 1KNOA 4MCYB 5FYLH 3IGAB 4NO0A 1CLCA 2VDNL 2P1YA 5F9AC 3T0AA 3KJ6L 4S1DC 4GAYB 5FUCC 3P11H 1MQKL 4NPYA 4BSWB 4X9IA 3OG4B 4CAGA 3D3VA 3CFJA 4HPOL 3PNWA 3OPZH 4PJ8C 1J1XH 4P2QE 3ZYIA 3TYFB 4I48B 4L4VB 3O0RL 3GJFH 1WBYA 2Y36H 3X3GL 4CMMA 4WENB 3BT2H 3SE8L 5C0IA 5KS9E 2YXFA 5INCB 1UM6H 3TA3B 5CINL 1JGLH 3O6ML 1H3UA 4W4OC 5FHAL 1BVKA 4KK6D 4HIJA 4S1RL 1UEYA 1J0ZA 3MRMB 1NC2B 4FTVD 5CZVH 4R97C 5JZ7C 5BV7H 5AAWA 2F74B 1WWBX 4F7CA 4ELMF 3RVXD 3CC5B 4L4TE 4QOKA 2BSRA 3OZ9H 5IIEB 2EKSB 1Q0XH 3TFKD 1AGFA 4WV1A 3BDYH 3S88H 1DVFB 5CJXC 3O2DA 1K2DA 1HSBA 4JQVC 3ZZ1A 2VLKD 1I7ZB 3GMQB 4X4ZA 2FGZA 4XCFH 2WANA 3FO0H 1Q0YL 2JCCE 2PXYD 3TYGL 1T7XA 5KOVC 4NBYB 1Q9OA 4HT1H 3OSKA 4MA8H 1GPOL 1LMKA 1I8KA 4FQLH 2X89D 2F74A 4PRID 3NCCB 5C2BL 4HK0A 2X9YA 2ZOKA 3GSWA 2DYPA 3G08A 2IH3B 5T33H 3VXPB 2AJUL 3R8QA 1HH6B 1NCWL 2APXA 2OR9L 5IFAL 5DJXB 4A6YH 1YJDC 3VRLF 4LK4A 3LKNB 5MENB 3J7HA 1QLEH 4C56D 1E6OL 4I1NB 3B3IB 4OB5H 4UMGA 3GI9H 4AM0A 4P23B 2QADB 3KHOA 4TRPL 3ESUF 1UG9A 4XC1H 4KKLD 5CP7A 4JY5L 2PTTB 3QUML 2BCKB 2Z35B 4APQB 5ADOL 3EFFB 4PJEE 5C08E 3SQOH 4LNRA 1HHKB 1A0QL 1P53A 2B1AH 4M6OH 4PV9A 4ZSOE 1HH6A 1QKZL 1V3JA 2FO4B 1CXFA 4ZS6C 5FV2A 3T0XA 2X1WL 1LP9E 5DJXA 1FZMB 4JY4B 3TT1L 1ONQA 1LO3H 5IHLB 1YEGL 5D5MF 4LSQH 1KG0B 5K59E 4CVUA 2C7UB 4HH9A 4BA8A 3QIUD 1FFNB 1M4KA 1N0XL 3WFHA 1NGXB 4CN1A 3WIHA 2BCKA 4JN1H 4JREC 4PJAA 3EFFA 4Y19D 3RJQB 3ULVF 2C1OB 4EI5B 4M6NH 1JGDB 1JNHB 2J12B 3GNMH 4NM4H 5HHXH 2EDLA 3R8BB 1OQXA 4Y4FA 2V2TB 4DZBB 4H5SA 5A2FA 3RY4A 1JPGB 2UY7A 3WXVL 4FTVE 3TIDA 4WO4C 4R4FL 3QNZA 5C0BA 3QXAA 2Y5TB 5HHNA 5JW5B 3K74B 2VQ1B 1X4ZA 1FN4B 4X6DB 2F53D 3B8YA 3T0EB 1G7JA 2H6PB 3BEWA 4KQ4H 3WJJC 3NFNA 3VGBA 2BDNH 3Q5YA 2ZCLH 4ISVA 1A64A 5EA0H 5LGHL 2VLKE 5IVOA 2HMID 4EUPB 5GS0D 3V7MA 4G5ZH 4GW4B 3MJ9A 3WO4B 5D7SH 5E9DA 1HHIB 4N0FB 3FB6B 2Y5TA 1KN4H 4PBWD 2VLRE 1RZ8A 4HIHB 2ERJC 4FQIH 3BVNB 4DEPB 4FXLA 4LVNB 3FL7A 4PRIE 3EYQC 3HR5A 3UTPD 5GS0H 3HUJF 5DHXB 1J8HD 5DF0A 4Q6IB 1N8ZB 3VXQA 4NUJA 4NC1E 1U3HB 3DPBA 4HHAB 5CD3A 1PLGH 3VWJB 4OCRL 4GMTH 4D2NA 3CUPB 1ZSDB 1VGEH 4PY7B 4JFDD 1E4XH 3KPSB 2EC8A 4C56E 3OKOB 3QUXB 5DR5L 4PP1C 4HIHA 5TDNB 4N1CA 3V5HB 2EH8L 2BOCB 4NQSA 3IAGC 1J87A 3F8UB 4X5XB 2YD4A 3HPLA 4IOIA 2KL6A 4U1JA 1OAQH 5H35B 2EIBA 4ODUA 5I17A 2DN7A 4HHAA 3VWJA 3EUUA 1JK8A 4IRSB 4FZ8L 2BNQB 3DIFA 3MFGB 5HGBB 2NZ9D 3P30H 3ULUC 4YHKH 2H26A 2AK4E 1U8QB 1VKXB 3NN8A 1AY1L 3DX8B 3LMJL 4JKPL 3KXFB 1AGCB 3D18A 3MOAH 4HUVA 5I73C 4NZTL 3BE1L 4Y19E 2W91A 5GGVL 4MDIA 4C83B 4GW5B 3BRDA 3DVIA 4MXQD 5DJAA 4BKLA 1OL0A 4X7TB 4OM0L 3U2SA 3L1OL 2WQ8A 1U36A 4FQJH 5EBMA 5CJBA 2MTPA 5DJ2B 2VABB 4LL9A 1D5MA 3PDDA 3S98A 2EYTA 4KI5F 3ETBF 3FOMB 32C2A 2EDKA 2F53E 2AV7B 4G7YL 3ARED 4Q9RH 1UGNA 2I5YL 3B5GA 4Y16A 3UJTH 4NGHL 4XHQA 5EBGA 2EYRA 2XQYK 1FFPA 3HC3H 4E5XB 4OCSH 4RFOL 1IGCH 5C0RH 4HG4J 4PYHA 3MQIA 1G9EA 4M8VA 1ZHKA 4HFUL 5DJ2A 2EECA 5FCUH 4PJFA 4PJHE 1G6RA 2AI0L 4MJ5B 4AJ0A 3TO2B 2BP3A 3V6OC 3SJVB 1JPSH 1OD7A 1FDLL 1J8HE 3I6GA 1J11A 5J56B 1MWAL 5L2KE 3L7FB 3CFEA 4UV4L 3C5JA 4FOMA 3T0VA 3PWJA 4JFDE 2FX9H 3UEZA 4ETYA 2E6QA 3MV8E 5F96L 4D94A 5T5FL 1CLZH 4O2CB 5T3XL 1S5IL 3DUSB 2X42A 5DJDA 1T0MB 4W4NA 2KH2B 4DN3H 5IFHH 1FORL 4ODTH 3RTQB 3BUYA 4LCIL 4P4KD 4P49A 2DJUA 4V1DD 3L9RA 4JG1H 1EZVX 3RVTC 5BQ7B 4PJDA 2IAND 2XTJD 1UWGL 3GK8H 2UWEF 4OLUH 5D7IF 1I3GH 3KYOB 2R56H 4EQ3A 3Q6GH 1MJJA 3D39B 3SGDI 3MPCA 4ERSL 1T0MA 4JFFB 1DSFL 1H0DB 3HNVH 1TJIH 3HNSH 4LCUA 4M5YL 4P59L 3QUYD 2ICWA 4PRPA 2NY4C 2YC1B 3DVGB 5F8RC 3P4OA 2HLAB 5JA8B 4ODSL 2PF6A 4PD4K 1A4KA 4G8FB 4F7PA 1JJUA 5ITBL 4X80H 4Q0XL 4XZUA 1QFUL 3H7BB 2HT3C 4PR5B 1A3QA 4X8JB 1Q1JH 4PLOB 3BYTA 4OFIA 1FG2B 5K9JL 5IR1B 3D39A 4IHOA 1A21A 4AENB 1N59B 3OB0K 3QIBD 5F21B 5H2BA 1XGTB 3VXOA 2EO1A 1KELL 1M7DB 4PGDB 1WFUA 3FONB 4JHZA 5I18H 1S7QA 1FZOA 4HXBH 4ZUUB 3S37X 1QA9B 1K4CB 1RZJH 2Q8AL 3WLBB 3BPLC 1YEJL 5EFIA 1IAOA 2WK2A 3U83A 4QRRA 3HR6A 1OF2A 4N0UA 4J4PC 1ZT7B 4X8JA 4XGZA 1Q9LA 4QCIB 1G0XA 3VRIB 5AAMA 1PZ5B 3ZT7A 2XWTB 5GS1B 4I5BA 5CJOH 2ILLA 4CVWA 2A74B 2LTQC 1X5IA 4MWFB 5D70H 4UQ3A 2JF1A 3ZDXF 1MIMH 3CFDB 3T8XB 4MXWH 4POZC 3WFCL 5IB1B 3NCEB 3IDIA 2W9EH 4QRQB 1S7SA 1MHPL 4F9PA 5LBSL 3HLAA 2CDEB 3QT2A 1SY6H 1BVZA 1PEWA 4X8XA 5KSVB 3VFPB 2R0ZH 3SEPA 1FH5L 3RPKA 5GGRB 5L0QC 5D2NA 3INUH 5DD6B 5CGTA 3O8XA 2Z8VC 1A7NH 3BPOB 4KK5C 5J3HC 4UZGA 4NZDA 5HYSA 4H25B 3QIWD 4I18A 1L7TH 2F15A 1TPXB 2BSED 5IB1A 1C12B 2DTML 1KTDB 3ARBC 3RDTA 3P2TA 1OP5K 1H3PH 4LVHB 4Z95L 2XRAL 1HQ4A 3UAJD 3U7AA 1XAUA 4LLYB 3LKQA 4EBQL 4DTGH 2DQHH 4FG6D 1ZXQA 2A2QT 4OQ1A 4PJBA 2PR4L 4K7PL 4YNYB 3LHPH 1IC4L 2MWCA 2VDKH 2ARJQ 1KB9J 3VFSB 2GHWB 4XX1E 2EZ0D 2KDGA 4HLZH 4Q2ZB 4YPGA 4HS8L 1OAUL 3ARGA 3MLWH 3PIQB 3TBWB 1GZPB 5JIKA 3T04D 2IPUK 4YFLF 4HEME 3RGVB 5IESH 1G7IB 2OL3L 4IJ3C 3FQNB 3QNYA 1CGSL 5LQBL 5C3LD 2EXYC 3OTTA 4JDTL 2AAVA 2FSEB 3UTTE 4WI6A 4YNYA 3FQXB 1MAML 3MLPA 4WNQB 4X6DF 2VXSL 4MD0A 3U7WL 1NAMH 3IFOB 3MCG1 1VPOL 4DK6A 5MEPB 5GRJH 3SDYH 4X6CF 1Y18B 1NDMA 5D93B 1ZHLA 1KN2H 5DC9B 4PJXE 3MRDA 2W59A 2UZIL 4OAWA 1A6UH 1TCRB 4KROB 5I19H 3QUZA 4KKBD 2ZUTA 4DCQA 3H0TB 4U3XA 1EEYB 2DWDB 4XP6H 3ILPA 4P2QB 3FMGH 5DMJB 4GAFB 1AKJA 4NZUH 3BKJH 1AR2A 3GBNL 3ARVA 3EIFA 5C0AD 3U4AA 1YN6B 4I0PB 2WWMC 5ANMA 2NX5D 2NY1D 3CX5K 5IFJB 3FOLA 5KS9B 3Q6FB 5BVJB 1RIHH 1WZLA 3S3SA 4M7LH 4H20H 4DGIL 5EDXA 2GJZB 2YPVH 2IPUG 3BO8A 4HF5L 4LPUA 5KG9A 2JJVA 5ESQA 1EEYA 1IGJA 4U6XB 3GMLA 3CVHB 4LHJB 5ESVB 3QEGL 4IS6B 3G04A 4P2OB 4FFWC 1ZVYA 3A67H 5ICZA 2JJTA 5C92A 2OS7A 4P4RA 1BEYL 4L4TB 2WAHA 1N64H 3QO0B 3MRIA 1YMMD 4Y4KB 2CDGB 4Y5XB 3FQWA 4ONFL 3SO3B 1LGVA 3IS1X 3ORJA 1CXEA 4KJYA 3S5LA 1IQWL 3KPPB 2X1XR 1R5WA 1E4JA 2Q86B 1JMZA 1G9ML 5F1IB 3ARDA 2AQ3A 4M9OA 2JCCB 2BRQA 1RQ5A 3BI9X 4W68A 4HV8A 2X4RA 2YOCA 3SDXA 4MAYA 3DYMA 4OD2B 4WUUB 2FHCA 3DRTA 2X2YA 4IS6A 1EUTA 4TUKL 2W38A 4LPWA 2IQAB 4P2OA 4ZXBC 3K4DA 1S7TB 2JB6A 1RY7B 1JRHH 3TBVA 4L4TA 3D85D 1N5AB 2IPKB 3KPMB 1SBBA 3VXSA 4Y4KA 3FO2B 1R0AL 5IBTL 5HGAB 1UZ6E 4D9QD 1IGTB 2OZ4H 4Y1AD 2ADFL 3SKMA 5T1LB 2OTWA 5JXEA 3BMVA 2DIJA 2FH8A 4LLWB 4ZG1A 2EYSB 1CLOL 2B4CL 3T09A 3KPQB 5ICYA 2ZCHL 3C08L 1BQLL 4WUUA 3UJIL 3U30B 1S7VB 1YC8A 4JY6B 4Z18A 4C57C 1KTKE 3RWEB 1AXTH 2LU7A 2AJVH 2IPKA 3QHFL 4PJEB 5I1HH 5JW4Q 3KLAB 5C08B 3GJFB 1KCUL 2J4WL 4ZSOB 3B6SA 1SJVA 1ZVSB 4EVNB 4Z77A 4IRJA 3VWKC 1LP9B 2JK5A 1IRAY 5T1LA 4DGYL 2WUBH 1OW0A 4YHMH 3C6SB 3VXUA 1RFDL 2WSKA 2IEPA 3FB8A 2MKLC 3UBXG 5C0AE 1WWAX 5F7DA 4HJJH 1SEQH 3MV9D 3QDGD 3RWEA 4TN9A 1VHPA 2C1PA 5FO9A 2NX5E 4TVPH 4FN0A 3EO0B 3MREB 3BD3A 3GJFA 3CXDH 2F54E 4GXVL 4LASH 5GRUH 2D03H 3WXWH 1XF5B 4M8QA 1T22B 4JFXA 3MR9A 4FTVB 4IOFD 1TZHA 3CFIC 5B38A 5KJRL 3BSZH 1DE4A 1F4HA 2CXKA 2C26A 1IBGH 2C5DC 5HHMD 3HS0A 2VDMH 1JHLL 4FFVC 1XGRB 4WHYG 1J0YA 1T21A 3WS3A 3TN0D 1P9MC 1HXYB 1J8KA 1QHOA 2NW2A 1MEXH 5E0QA 3X12A 4U1IB 4JHBA 4PRNB 1N7MH 4YDIL 2VLKB 3ES6A 4HKJA 4UILL 4JHAL 2DMKA 3P4LA 4LAQL 3S36X 5I76A 5E8EB 2HA1A 4WEMB 2VDNH 1MLCB 2VLRB 3OAZK 1EUUA 5F7UA 3KJ6H 5MI0C 4MNGA 1MQKH 3KPNB 2C3WA 4PRIB 5DEGB 3VFGH 4KQ3L 2GTWB 4M4RA 4L8CA 1JCKA 4HPOH 2GJ6E 3MXVL 2ATPB 1D5XB 1R3IH 4LFHD 1VFAA 4P57A 1MRDL 3O0RH 1JTTA 1RUKL 2AQ2A 2D9CA 3FQUA 5F6HJ 1T0PB 3P0VH 3ARFC 4C54A 3TJHC 1PBYA 1IGML 2LFGA 3ARQA 4WU7A 2MMXA 4C56B 3SE8H 2NY7L 2PXYA 1YY9C 3DUHA 5E8EA 4KY1L 3WEXA 4QEGA 5DFTA 1MLBA 1PQZB 2VDRL 3O6MH 1JV5B 3BJ91 4A6YA 1FQ9C 4TULH 5FHAH 2PNDA 3IAPA 3KPNA 3MJ8B 4ZO7A 1GGCL 2PYEA 5INDB 4X7SL 3MA7B 3IU3A 5IEHA 3HMWL 1T04B 2RQ8A 4CADA 2AEPL 1MHCA 2BRRL 3S3JA 4BK5A 3VFWB 1A7BA 2FJHA 1KJ2L 1ZK9A 5C0EB 3QH3A 5TE6H 4HUNB 4MDJB 1KJ3H 5LG1A 3OJVC 5EC2B 3QWOA 5HGHB 4X9GA 3W9DB 4N9OB 3MV9E 3QDGE 1Q0YH 2FECL 3IXAA 3EDDA 2CRYA 4Y19B 2RFXA 4QGYA 5K9QI 2VL5A 3DOSA 5FF6B 2XWBB 1OLZA 5JUEL 1GPOH 3L7EA 3H9HA 3WFZA 5KSBA 2DM4A 3WD5L 3L95B 3AMLA 4NQEA 4HQQL 1WAAA 3H8NA 5J11C 4MDJA 4D0BB 1UENA 4KRPD 2AJUH 5KAQG 1UM5H 3W9DA 1NCWH 3UYPA 2OR9H 3QIUA 2HG5A 5HHME 4N90D 3STLB 3EDKA 4CMHC 4OTXL 2F53B 3HPJA 4MCZA 3VI3E 3IF1B 1E6OH 4GKNB 3LQZA 3ARPA 1SJXA 3RUGE 5FF6A 4TRPH 1QFOA 4KVCL 3NZHL 4JY5H 4F58L 2Y9RT 3O2VH 3QUMH 3L95A 1U95A 5AEAA 1ODAA 5ADOH 4NQXB 4LCYB 4NQTA 4HAGA 3BD5A 2Z31A 4P3DA 1NDGB 3RX7A 1A0QH 4PJHB 5J6HB 1QKZH 3C60D 4Y2DC 5IW3A 1HNGA 4QTHB 3QDMD 4ODWB 1U8IA 3W0WA 4JCMA 3TT1H 3P4MB 1A02N 3NH7L 5IVXE 1T5XA 5JDSA 1J8HB 2J5LC 4M7ZB 5L2KB 5GGTL 1FO0L 3MUGA 4Z7WF 1A5FH 3DVFA 2QKIB 1N0XH 3LV3A 4JFDB 1T66D 3FHAA 3E3QC 1HEZB 1RUPH 2M26A 3MV8B 3X13B 1IQDB 1VFOA 1NDGA 4JZJA 5CSZB 4NN6C 1ZLVH 2K3TA 4WW2B 4WFGD 1MJ8L 1E28A 1G9NC 4OIAA 2PW1A 1I75A 4Z76A 3V95A 1OPGL 2BHZA 3SGKC 4GG6A 3WXVH 3UJJL 1BJ1J 1JYWA 3WMSA 3PWUB 4R4FH 4LHUD 1UYWH 3K46A 2OQJB 3STZB 3FFDA 3WO3B 4ELKB 1EHXA 4IM8A 5GSRA 1WIUA 1EHAA 2F5AL 5T3ZL 1D9KB 1XF2A 1AGEB 3SKJL 1IM3B 2F58H 4WTXA 3BMWA 1TZIA 1CGXA 2VXTL 1T1YA 3LDBC 1ZHNB 4DJMA 3TCXA 1UC6A 2GFBB 4PLJD 3VXTB 2R69L 4FQ2L 2B7DT 5ETUA 5SV3A 1M6OA 1BD2A 3QB7C 1PKQE 3U48A 4OKDA 1HDMA 1I9RL 2NMSA 5IBUB 4LIQL 1U8JA 4M6AA 4P5KA 3S4SB 1P7HL 4RBPK 1QSVA 5J6GA 1U58B 4XCNB 1FNEB 4S2SA 2V7NB 2YZ8A 1CI5A 1YYLH 3SOBL 1A7OL 4OCRH 1TIUA 2D0FA 4KJWD 4U0RB 4CVZA 3PG2A 5BZDB 2DBLL 4H1LH 5GSVB 1C08A 3O9WC 3IJHB 4YWGL 5IK3A 3AREB 3JXAA 5EBWA 4KAQL 2YD9A 4NBXB 3TO4A 5DR5H 5FKPA 1JWMA 3TVMB 5DUBB 5I30L 4K8RL 2EH8H 3HE6A 3MRCA 3EOAB 5D1ZD 5BJTA 1DQJA 2J6EL 4GRMB 3SDDA 1BFOB 4XCNA 5FO8A 3BH8A 3I3BA 2V7NA 4D9RD 3RPIB 1F90L 4IMLA 1FFQA 5E00B 5I1CH 2ICWI 2JCCF 1CFQB 5BZDA 4FZ8H 1DN0B 5ITFA 3F5WB 1ADQL 3IDUA 1RULL 2WP3O 5TE7L 5L6YL 1NANH 4KH2A 3DLQR 4JRYA 1A9BA 1L6ZA 3MLSL 1FC2D 1MHHA 1MI5D 3D5OF 4YDKH 3TBYA 2Q20A 4K9EL 1H9VA 4KJQD 4AT6B 1GGYA 3MNWA 4NZTH 3BE1H 2V9TA 3HMXL 4F3FA 5GGVH 3V4VH 4WFFD 2ITCB 2DQJL 3SY0B 1V7ML 1CFQA 1O0VA 4X4YA 3L1OH 3QRGL 3P0YH 4FXKA 2CLVB 4P4KB 1DVFC 4M62L 5TQ0L 2E7BA 2WUCL 2AKRB 3HN3A 1OP3K 4O58L 2XTJB 5DK2A 4LPYA 4HKZA 3IKCA 4G7YH 4ZD3H 1OY3B 4HMDA 2UY6A 4HSQA 4ZUSB 1JZ6A 5HGDB 2I5YH 3FO1B 4NGHH 1LP9F 1S7RA 1Z3GL 2ADGB 3UTZB 2I9LA 1FP5A 4RFOH 1JIBA 4O2EB 4XNXH 5IQ7L 5DQ9B 4OSUL 5K59F 4QHNA 1KBGL 1V5JA 5SX5K 2MHAB 1AP2A 4V1DA 3QA3B 3D0LB 1PJ9A 1EGJH 4Z7VA 5HVWA 2IANA 1WZ1H 2Q6WB 4G9FA 4LLDB 4OT1H 1KPUA 4B53A 3U7YL 1TETH 4L3CB 3U0TB 5T3XD 1FDLH 2QADC 1MWAH 3FAXA 5GGSB 4JZOA 4EN3B 4ZFOL 5SWZD 2P8LA 3L5HA 4RISL 2X70B 3C2SA 3QIBB 5F72S 4O2EA 3HAEH 5DQ9A 1FL6B 1S8DA 3QUYA 3UTTB 1A1NA 1Q9KA 1HINL 2XKNA 5F96H 5T5FH 3DO7B 5T3XH 1NGWB 1QBBA 3MZGB 1S5IH 4PBXA 4XP1L 4J3WA 2QSTA 1FCGA 3P9LA 4N0YL 4K94L 1XGUB 1A8JH 3M07A 2VZ3A 4LCIH 4L3CA 2VH5L 2AEQH 3L3KB 5FGBC 3ZHKA 1ZAGA 3IFPA 4PJXB 4ZPVB 3OXRA 1UWGH 3ZE1E 3BP5B 2VL4A 4G7VL 3TIEB 2VAAA 5FM8A 5IW6A 3H9SD 4WI3A 1UWEL 4O02L 1CFTB 5B39G 1DSFH 1MI5E 5EO9A 5GGQL 5KSAD 4X5WB 4QRUB 2H2SD 3JV5A 1MCKA 4P59H 4M5YH 3D69B 1F3JA 3GBLA 2W0KA 3SO5A 4ODSH 3QRFM 4PV8B 3T0EC 2MOVA 4MD5A 1SY6A 4Q0XH 2D4FA 3BH9B 2P5WD 1QFUH 3OB0H 1CXHA 3UTOA 1LK2B 4PLNC 2W9LA 4K7FA 3QIWB 1FL5B 4ZYKB 4LSPL 1IC1A 5IW1A 3QPQC 3WO4C 1KELH 2F5BH 2YK1L 4HWNA 5TQ2L 3EYOA 4HKBB 3VG9B 1RJLA 2K7PA 4MHHI 4GAJL 5CZXD 4DEPC 1JF1B 2HAZA 4LVNC 3F6IA 3VH8B 2Q8AH 3LPWA 4YZFE 1UXWB 3DVNA 1YEJH 2C3VA 1KCSH 2FIKB 2D2OA 4NRYB 1S7WA 2OTUB 4ODHH 1KB9K 3KYKL 1T5WA 2EDHA 5AUMB 4JO2L 4P46D 3QEQA 5EOCJ 3VWJC 1EAPB 3NPSB 3QIWA 4ZYKA 5MEOB 4XTRD 5D2LE 1YJDH 4JAMA 1Q9WB 5T5NF 5EWIL 4YDLB 4S11A 3GSNL 2GSGA 4YHLL 2L0DA 4K71C 2YS4A 3V4PL 4I2XE 3GSVB 4UBDD 3QXTA 1Z5LB 3D2UD 1U8HA 4OFKA 5GJSL 1NAMB 1AIFB 2P42B 3WFCH 3BOVA 1QVOA 2I07A 1MHPH 1I7RA 1T3FA 2OTUA 1I85C 5F9WB 1BBDL 5F3BB 4M61B 1EAPA 2G5RA 3N1PC 3IYLW 3MV7D 1WJ3A 2W65A 4OGYL 1VESA 3LKSB 1Y6NR 5D1XB 3ZTJH 3GSVA 4MQTB 3SE4A 3UYRL 4XNMB 1NAMA 1AIFA 2ZOLB 1OP5H 3IDNB 2ESVD 2BSTB 4OZFG 2DTMH 1CFVL 4M5ZL 4ZODA 5IBLC 1O7VA 2AJ3A 1IEAB 4Y16C 4PJHF 5IV2B 3H9SE 5E5MA 3C8KB 2VQUA 4F15B 1K6QH 4EBQH 2DF3A 1FYTA 5C0AB 4KHXL 1IE5A 4BFIB 2NX5B 3C6LA 1FLTX 2PR4H 4K7PH 4S10A 5F7HA 4NN5B 1CGVA 1A6WL 2F54B 1NC4D 5KVFL 1WCQA 3WS6C 2VXQH 3IDNA 4HS8H 15C8L 5FOJA 1OAUH 2HT2D 4BJLA 2P5WE 2DKMA 4YC2B 4HGMA 4WW2F 4O2FA 5DQJB 1UXSB 3G5XB 3M8OL 1WQVT 5CEXB 1FAIH 2OL3H 5CD5C 5LQBH 1CGSH 3G5ZB 1S9VA 5FB8B 2NX5A 5H37H 1ZE3C 4PJIE 3L5JA 1JNJA 1KFAH 2DLGA 2ZP0T 1VENA 1MAMH 5CCKL 1I1YB 2ZZUT 2X5PA 3U7WH 4G80B 1HHJA 5F6IB 4OGAC 1JFQL 3NACH 4MZ3A 1KEGL 2BHYA 3RI5F 3OKMB 4GH7B 4M4PA 4XAKD 5IKCA 4JN2B 5DQJA 4JGMA 5CEXA 2UZIH 1JHTA 5EU5A 3CLEL 2OJZL 3D85B 3WE6B 4WEUD 1YMMA 12E8L 4ESKA 3PGDB 1EBPA 3GBNH 5GIRB 1P84J 4U1KA 3PWLB 1K3ZA 4NQDD 4YHNB 4X7EC 1I3RA 5I15L 4GKZB 2QR0B 1QLRA 4NCDA 3LAFA 4QYOB 1QR1B 3MNVB 4NZJA 5MHSD 4H0GA 5GGVY 4AEEA 2OZ4A 4JN2A 1LO5B 1TVBB 2ZUVA 4DGIH 2E27H 3CZFB 3LKRA 3ULSB 4KRMB 5IJVB 3MV7E 4CU8A 4HF5H 1MFCL 3VXMD 1A6VL 1IC7H 2YMXL 3ULUH 1CTNA 4XHJC 3QEGH 1X5XA 3BHBB 4GUPB 4Y1AA 1AGBB 2X1PA 1LQSR 1BEYH 2ESVE 2QR0A 4MLSA 5MP6L 1T1XA 4TUOB 1NUGA 1MCNA 2YPKA 4RGNC 4ONFH 4MS8D 3MYJB 4DW2H 5EU7C 1IQWH 5FO7B 1G9MH 1HN1A 1K8IB 1VFBB 2HFFA 2ICEA 3MV9B 3QDGB 3VFUA 5IWLA 2FL5A 4PGBA 2CD0A 3RBGA 4OF0A 4XPBL 3CIQA 4TUKH 4PJCA 1ZA3B 5EOTB 1SJHB 3MLTB 4M9PA 4JM2D 3BKML 4ALAL 2BY2A 4DUWA 4KPHL 1J0IA 1R0AH 5IBTH 2A0LD 4WFEE 2NY6D 2XY1A 1OQOA 2RGSA 5GRZA 3LQAL 5IQ9B 4S1QL 3U4BL 3NIFE 3I3EA 5HHMB 3BGMA 1K8IA 4JZNA 1CLOH 2B4CH 3C5ZD 4Z78A 2HRPL 2ZCHH 4Q9CA 3RUGB 3C08H 1BQLH 3UJIH 5EZJB 5ECJE 5GS1C 2FH6A 5D2NC 1SBSL 1ZA3A 2FEEI 3TF7C 4R6UA 1KLGB 1XF4B 4TUJA 4ZOEA 3O8XC 2VZUA 4OCXH 1SJEA 4DGVL 1CZ8L 3DUUA 4FFZL 4XAKE 2J4WH 2DQGL 1IVLA 3SDAD 4DGYH 3DSNA 3U0PB 4YR6A 5FKAA 5IVXB 2PYFB 2GUOB 4HKXB 4BH7A 5E99L 1G7PA 3GKZA 1LNUB 3TN0A 5IB4A 1P1ZB 2ZUQB 3KPOB 5EO0B 4TNVK 1IKFL 4HFWA 3SBWC 3RU8L 1MY5A 4NQDE 3EDJA 1OAKL 2BZDA 4HK3N 4QRTA 1CG9B 2V7HB 2CRIA 2FWOA 4LU5L 2LAGB 3W39A 4FS0A 4GRWH 3OB8A 5JPMB 5IB3B 2XWJA 5I71B 1YNTB 4GXVH 1TPXC 5JOFA 3RVVD 3P73B 3NGBB 3ARGC 3GEWB 5D1QD 5TDOA 2XICA 4LVHC 4CVXA 1U8MA 1DQQB 2NY3C 4RIRB 2C3GA 4YHPB 1LNUA 1MUJB 5DZOA 1INQA 3BKYH 5FA3B 2F19H 4LF3A 1PDKA 5E2VL 1T83A 5FOBB 4BK4A 2Z4QA 1CG9A 3MRPB 5DGQA 2CK2A 1JHLH 3NFPB 2AEIT 4F2MA 5H94B 1FPTL 1RUML 4LMQE 4PJXF 5E8OA 4X98B 3AXLB 4YDIH 3FB7A 4YXKL 1HHHB 1FJ1A 4UILH 2VE6A 5AG8A 4JHAH 2UV3A 4NKMA 4LAQH 3OAZH 1KIQA 5EG6C 3R06B 2DRUA 1H3WM 1PKQB 4KJPC 1MVFA 3WNKA 5FA3A 4UIKL 4YO0B 4HGWA 3QUZC 2UYLA 2BY3A 1IAII 1F2QA 2OXHA 4YGVB 1W0VA 3MXVH 4LCCB 4PRBA 5HBBA 1E4XI 3L3GB 2BNUA 2Y7QB 4U3CA 3N1MC 2VWEC 4G6AD 4LBEA 5E1HB 4RFNB 1NGZB 3QUMB 2AXFA 1IGMH 1P2CB 4FHBD 1ZA6A 3D87B 3OJ2C 4HS3A 5E1AA 3RBSA 2NY7H 3U36A 3L3HA 3FRUB 5C0ND 1D6EA 1H8SA 4GBXA 2DWEA 5E8PA 3TJEH 2OMBA 1JZ2A 4KROC 1VEMA 2X4UB 1LE9A 1GGCH 4P2RD 4L9DA 4IRZH 2WWKT 4JDZB 5JNYA 1P7KB 4ZNEE 1IFHL 1NFIA 1SVZA 1CE1L 1YECL 3HMWH 4M6ML 3TH2T 3ARSA 3RZCD 2AEPH 1DQDL 2BRRH 4P9HC 1TZGL 4OF3A 4YXHL 2W60A 3A6OA 1BOGB 1KJ2H 2NNAB 4I0PC 3ALWA 3MJGX 3OQ3B 3MGOB 1UVQA 4AQ1B 1CL7L 1X7QA 43C9B 3O6FB 3VFNB 4X9HA 3HZMB 4OV5B 2P8MA 3V6ZB 3QXDB 1NCAH 1T20A 1RJZA 5E56A 1JZ7A 5IMKB 1WITA 4HZLB 1EXUB 4JLRA 1L0XA 1MCJA 2X7LB 1UT9A 3MRNB 4FFYL 1NBZB 3DTXA 4K7PY 4XRCA 5DYOB 4UT7L 3EOTL 5M94B 2NY2D 5F9DC 7FABL 4P5TB 4P2OC 1YEFL 5JUEH 3C60A 2LABA 2FR4B 1KXTB 5K9QG 3QDMA 2X4OA 3WD5H 4HQQH 5SWQB 4Y4KC 4Y5XC 5HYFA 3OHXB 5LGJB 4RMUA 3SO3C 1YZZA 1IILE 4OZHE 3S6CA 3ZHLA 3PP3H 3V6ZA 4OTXH 5IMMB 5JHDE 2AXGA 1A7RL 3RNKB 4WDIB 2YUWA 2V5SA 5JIHA 3KNBB 3IDYB 4CUCA 1KPRA 3K1DA 4KVCH 5A1AA 2E7LC 1NMBL 1K85A 2FR4A 4F58H 4AIZB 1ZT4A 2D9QB 5DHVH 3RY6A 5FYJU 3E6HA 4Y4HD 2CLRA 2ZPKL 4QF1B 4OLWL 3DBXA 4LHUA 3CPLB 3OHXA 4UTAL 5HY9B 3TLRA 5LGJA 2XPGB 4QXGL 1DUYB 3AGVA 1EA9C 4Q9QH 1OW0C 2GAZB 5GZOD 1NCDL 4XI5C 1S7UA 3NH7H 4JFPB 4Q74A 5HXMA 4K23L 2R2HA 2XNAA 4CJ1A 5GGTH 1FO0H 1EEQA 2EIEA 3IDJB 4R96B 1J5OL 4YHOH 4NO5A 4NNYB 4ZFZA 3WIFA 4AIZA 4NIKB 3OJDB 3SE3A 2IAMD 3WLWC 5E4EB 4KDWA 1A2YA 4HS6B 3MOBH 5JHLL 1HOCA 1CGUA 1MJ8H 4M48L 2YA2A 3MRHA 2QSVA 1HXMB 4H1LA 4UNVA 5T3ZD 2A6DA 2P49B 5D1ZB 1OPGH 2DQDL 3EO9L 4POUB 2XT1B 2EDEA 4Q58C 3B2VL 4OJFL 4RRPA 1T7VA 2JIXB 5BOPA 1I1AD 4U0QB 4XNUL 5HVHB 1GH7A 1FVDB 2WBKA 3B2UD 4KHTL 1AI1L 1N6QL 1LEGB 5F1KC 5BV7C 3D6GA 3KGRA 3SKJH 3F58L 3QI9D 4UB0L 3EHBD 4H8WH 4HWEL 2VXTH 4JHWL 4KK6C 1NFDE 1MI5B 3FAWA 4XP5L 5DTFA 2HWZL 3C5SA 2R69H 4FQ2H 3EYSL 1DBJH 1RJYB 3HZVB 1KJMA 3E6FB 2X4PA 2KBGA 1UJTA 3X14A 4NRZA 3PL6B 4RBPH 3MRBA 2J1KA 3R0MA 1I9RH 4NO2B 3VXNB 1YPZE 4LIQH 3BEVA 3VJ6B 2HJKB 3RVXC 5DRZB 2WBJA 3WSQL 4I0KA 4ZUWB 1R24B 4G9DB 4RDQG 3TFKC 1S9YA 4XCCL 3G6JE 1XF3A 4K8RD 3SOBH 4P0DA 4QRPD 3UCRA 5KBNC 5C9JB 4ODXB 3WJLA 3OR6A 1LDPL 4N1EA 1VACB 3Q3GB 3MGAA 2PXYC 5C70A 3UO1L 3W5MA 4KAQH 2BVOB 4ZFFB 4KDTC 3MRRB 2G9HB 5F71A 4JQXA 5D7KD 5I30H 4HIEB 1LEKB 2VJXA 4K8RH 4LSUL 4PJFF 2FJFB 2E9IA 3T4YA 2ZG1A 4IDJL 1T03L 1FNGB 2LE9A 4NFCA 5HYQA 2W0FA 4NC1C 1XH3A 3MRQA 1F90H 1QACA 1AR1D 5ID0B 3HAEB 1A6TB 3T65B 5I16B 5L88L 1A7PL 5D2LB 1ADQH 1RULH 5L6YH 1BIIA 1CDHA 4I9WE 4I2XB 3QCVH 4PRAA 1EGJA 1RURL 3EZ8A 4KKLC 4MA3A 4RCAA 1C5BL 4MJID 4HIEA 2ZUSA 5FUZL 3RWFA 5HHVH 5BRZE 4U1HA 1MAKA 1P4IH 3FJTA 1DBKH 1MWAA 5KVEL 4YDJA 2R1WB 5DMIL 3O41B 3VI3F 4G43A 1V7MH 3HAEA 5T3ZE 2BNRA 4JJ5B 3JWDL 2I26N 3SGJA 4PJGA 5IOPB 3ARYA 3RUGF 4EJ1C 1OP3H 3TPUA 1KENH 4M62H 2B2XL 2WUCH 4LCWD 3QIUC 2I27N 2DLTA 5SWZA 4O58H 1J7VR 1ZANL 2BSSB 5JO5A 4H88L 4LKXB 4X6BB 2E7MA 1RZKC 1YA5A 3H9SB 1UB6B 2NY0D 3LSOA 1Z3GH 2BJML 5BVPL 5SX5H 1ZS8B 5IVXF 1A1MA 2APBA 5IQ7H 4MMZC 1UH3A 4OSUH 3AROA 3U6RB 4P48A 5I6XC 4N8PA 5I66A 1EO7A 5CKAA 4R0LB 3UPRB 1ZHBB 1OOAA 3PGCB 2HFGL 5KSUA 2R2EB 4ONOA 5DT1H 4D0CB 2VR5A 2DJSA 3L5XL 4X6BA 2P5WB 4LRNL 3U7YH 3ULVD 1KV3A 1ORSB 2HMIC 1D5BA 1FNFA 5IMOB 5GS0C 4DZ8B 1VGKA 5KSAA 2XN9A 1TFHA 4KXZI 4YDVA 3RWCB 3LN4A 4PJIB 1HINH 2ADJA 4JZJC 4QY8B 1UJ3A 3IETB 3P77B 3ULVH 5DK0A 5CJXA 5HYSG 3I50H 4YBHA 1C8PA 3IVKB 1N3NA 1UA6L 4N0YH 1MCQA 4K94H 2R2EA 2YD2A 5I1IH 3BQUD 4JGJA 3BAEL 3RWGA 4LDEB 4KTDH 2VH5H 2E8YA 1R3KA 3LB6D 1ORSA 4IEFB 2NXYB 5MEQA 1JGUL 2Z92B 1MFEL 4PS4L 5DDHB 4DZ8A 3E2HB 4ORGA 4X6EA 4XBPB 4G7VH 3FT4B 3LH2L 3CDFA 3IETA 5ADPL 1VB9A 1UWEH 1D6VL 3D2UB 4O02H 1XCQA 4LHQB 5I0ZA 4MJIE 5BS0D 2NLJB 2NY5L 4RMQA 4ZAKD 4YEFA 3AAZA 2EE3A 3IJYB 4JGUA 1A6PA 2GKIA 4J8RA 4P46A 3TBTB 5I75C 1E27B 3MBEB 2P8PB 2DM2A 1INDL 2VUOA 1REIA 4XB7A 3MV7B 5GRXG 1QHPA 4V2CB 1CVSC 1IL1A 2CO7B 4LPXA 1LE5A 1N5YL 1AH1A 2NZ9C 3OKYA 2XKUA 5GQBA 4CBPA 1G6VK 2GSIA 4HUUB 3D2UA 4LCWE 3UTQA 4U4BA 1BFSA 3GUTB 3FT3A 4PJ5D 4LSPH 1JZ3A 4PTTA 2ESVB 3BIKB 1NBQA 4E42A 2YK1H 5TQ2H 3CVHL 1BWMA 5FYJE 1RZGB 4G6MH 1ACZA 1KB5B 1OGTA 4GAJH 4MXQC 3N85L 2CH8A 3PDOA 1GOFA 4XP4L 5D5ME 1BQUA 5L7XL 3KYKH 1JRHI 1WFTA 4JO2H 2C4FT 1FZJB 3AS1A 2OL3B 4U0RC 3GSUB 2J2ZA 2HJFB 1BJMA 1U42A 1NLDH 4GLRH 2ESVA 4OD3L 3BIKA 3AREC 5EWIH 2XQBL 4UOJA 3V4PH 1A7QH 3MACH 1XGPB 1QSFE 1SHMA 1EK3A 3MNZA 1JWUA 4F7TA 5LWYH 3NZ8B 3MA9L 5CEYB 1XGYL 3ARWA 4HX1A 4U1MB 5JPNB 2XI9A 1BBDH 5DEFB 5HPMA 1DLFL 5C0CE 2FHFA 3VW3L 4KI5D 2OL3A 2Y25A 1NC4A 2P44B 1K8DA 5EO1A 5DD1L 4WVRA 4I4WA 1F58L 4OGYH 5FAAA 5DS8A 1L7IL 3UYRH 2R9HD 4R4BB 2IALA 4B5EA 1UCTA 2D7MA 1FV1A 4FQPA 1CFVH 4M5ZH 1BZ7A 4GKSA 1P84K 3EJJX 4LDLB 4HWBH 1E0OB 2HFEA 1HHGA 4YIQA 5SX4I 1ZGLM 1KYOJ 1YDPB 4JFHD 3MRKB 5FDWB 4JFED 4NQDB 4KHXH 2CRZA 3GJFK 1IGIL 5D4QA 1U91B 4P4KC 3LQMA 2DKSA 4ZTOH 3QZWB 1KSRA 1A6WH 1JPST 1TTFA 1WCBB 4G8EB 4DKEH 2XTJC 5KVFH 1R5VB 5ID1B 2K9UA 2BVPB 15C8H 4Z5RB 4MAUH 3OKDB 5DK3A 3QXWA 3FQRA 1RU9L 1QRKA 4KZDL 1ZLWK 1HI6B 2BVQA 4N0RA 1BLNA 2J7LA 3WDJA 2EH7H 2GYSA 1A9EB 3FTGB 2X4QB 3T2NL 4D9LL 1M71B 5HYJD 3QUYC 4U6HB 4R90L 1KLUB 3MLVL 5CCKH 1WCBA 1DFBH 3SDXF 3ZE1F 2E6PA 3PWVB 1XIWB 1XCTB 4EKXA 3L3IB 1AGDB 1C7TA 2BVPA 5I1DA 1JFQH 4Z5RA 2HFTA 3OKDA 3VXMA 1KEGH 1DDHB 2RAMA 3U1SL 1RZJC 3T4AB 1P4BH 3WHXB 3FO9B 3QIBC 4XVTL 4JM4L 1JI2A 1MCBA 3QWRA 3CLEH 3QAZB 2OJZH 4O00A 3UYOD 1O5DT 4JM2B 3U9UA 4F9LA 1MCOL 3D0VA 1K3IA 2NY6B 5HJ3B 1ACYL 2YUVA 3PWVA 5DJ8A 1XCTA 1CFSB 5C1MB 2H8PB 2J8UF 5CKGA 2QQNL 3C5ZB 1QR4A 4F57L 3TA3D 2R4SL 4NDMA 5B38G 2AGJL 4JPKH 5DJ0A 3VE0A 3RVUD 4RAUB 4C4KT 1GL4B 2MNUA 4HIIB 3VXRD 4N8VA 2IADB 1MFCH 3I02B 4E0RB 1CICB 2FD6L 1A6VH 1XR8A 5TH2A 2YMXH 1KGCE 1N4XL 3WCYA 5HJ3A 1YNLL 3CSYA 3DV4A 1G7LB 4Z0BH 3V6OA 4UT9L 4RMRA 4YUEH 4LLMB 1CD9B 4OCNC 5FM4A 2ADIB 2X05A 4YHIA 4BH8B 3O4LD 2P5EA 3P9MB 4KKAD 5GJTL 3U4EA 5DZLA 2H1PH 5D2LF 4RAUA 1YY8B 4JFEE 3BZFB 1AQDB 2CJUL 2YD3A 4YJZL 2V5MA 5JORA 5DRXA 4EDXA 4HUXA 4S0TD 1CFNB 4XPBH 1FVCB 5KN5A 3QIWC 1CCZA 2QQKL 4NO3B 3TEUA 1HSAB 4MB4A 2JELL 3SDAA 1QBLL 1T7ZA 1I3VA 4LDOB 4J2XA 2ADIA 4R7DA 5FGSA 4L8BA 4OZ4A 3SDCB 1CK0H 3BKMH 4ALAH 3UAJC 4OZHB 5K9KB 3U4BH 2BK8A 4FG6C 4OUUB 3T77A 4HMCA 4NKQB 5MEND 4MQ7A 5L9DL 5JHDB 35C8L 4KU1A 1YEEL 4P23D 4NYLB 1I4FB 3MRJA 3K81A 4OLXH 2G75A 3EFDH 1P4LB 5EUOE 2MCG1 5T1KB 5FECB 4OZGE 1F6FB 1SBSH 4K55A 2EZ0C 2HLFD 4PGEB 5HHQB 4JO1L 4HW6A 4NNXA 4APQD 3QJFB 4YDLC 5D1QA 3ZSSA 3QP3A 1RV6X 4MZ2A 4PJ9B 4DGVH 4WWKB 3SE4C 4XCYB 3KDMB 4PRHE 5T1DH 3MLRL 4OZIA 3QEUA 5K9KA 1RJCA 1ZTXL 4M03A 4N1HB 1MFAL 4DUVA 2HVKA 1TDQA 4U49A 3F65A 2Z91B 1FIGL 2IQ9L 5HVFB 3LEYL 5E99H 4Z0XA 4NYLA 3BGAA 2DQFB 3NA4A 5FECA 2ATKB 3RU8H 2MFNA 1OAKH 2CIKA 4PTUB 4LU5H 4JE4B 4AY0A 4G8GD 4EI5D 1WFOA 4OLEA 4U6VH 3VFVA 2CKNA 1BVLA 3TNNB 3UMTA 4KFZC 1XZ0A 3QFDA 5J9PA 3VD4A 2WINA 5F7EH 1Y6KR 4KKBC 3RFZC 1A3LL 4PJIF 1E4KA 1H3GA 2SEBA 1FGNH 1DL7L 4WIQA 4RFEB 1ED3A 3RWDA 2Z91A 1MRCH 1WEJL 3RZCB 4MA7L 4TPRL 3V5DB 4R7NA 5E2VH 2VYRE 3OKKA 1IAIM 2MKWA 3WDHA 3DGCR 3MMEA 2NY1C 5IVZA 1U2HA 4NN5C 1P6AB 2B1HL 2H41A 4PJ7E 1FPTH 1RUMH 4L1DA 3O4LE 1BJ8A 4YXLL 2HT4D 1EEZA 3MFFA 1KJ2A 1NFDB 2B0SL 2BOBB 4YXKH 4QHLB 3F7VB 3I75B 5F9JB 4P2RA 3MX0A 4X5LA 4BM7A 5ISZE 3CSGA 4GFTB 1OGAE 2NY2B 1CDJA 1YPZB 3KJ4C 3LKPB 5KANI 3HZKA 3S8WA 3LZFL 3DRQB 1CS6A 3RL2A 4EUPH 1DQML 3RI5K 1BREA 1C7SA 4PY8I 1UCBL 2FX8L 3DHMA 4FABL 3G6JB 4RAVB 1U3HD 1A1OB 3MLYL 1U93A 3WFDL 5IB2A 3GBML 4QWWD 5FHBL 2NW3B 1OSPL 1BQHA 3AU1A 5F6IC 5KVGL 3KPSD 4M7LT 4HDIB 3ARBA 4N8CH 3QUXD 2B5IC 4GW1B 3DX9A 3L3JB 3ABZA 1NEZA 5CLTA 1MF2L 2QSQA 3V5KA 1QRNE 1JPFA 1MPAL 3ROOB 4FXGB 2BXZA 3I9GH 3IFNL 1BHGA 2FEDD 4Y4HB 4OI9A 2R29L 1IFHH 2V17L 3MRLA 1CE1H 2Q1EA 5B8CA 1SQ2N 3HCVA 4M6MH 1DQDH 1A1OA 1TZGH 4YXHH 5LVEA 4NC0B 1ZT1A 3FT2B 4IRSD 5DHVA 2IPTL 2XZQL 1I7TB 1BOYA 5EZLA 1X5KA 1UEMA 2CO6B 3GSQB 4PP2A 1FGVL 3O3DA 4FRWA 1CL7H 2V2XA 1XGQB 3CVIL 4L3EA 3KXFD 3QDJA 3MJ7B 5IWLC 4L29B 4Y4HA 1SMAA 4UT7H 3BIAX 1BJ1H 5GGTA 1FO0A 3NIFF 7FABH 2V2WB 3BPCB 3HNTL 1YEFH 4KUCF 4D0DB 1MCSA 2UZYB 1JWSB 3UTSD 3QFJE 2VLLB 1NGPL 2YEZB 2Y5EA 3GSQA 2JJSC 4S1SL 1A6AB 1IGYB 1WBXB 1I1AB 1JF6A 4NWUH 3CFKB 4X4XA 1F4AA 25C8L 4JPVH 2NQCA 3ROLA 1ZWIA 5IEKB 1A7RH 2IAMA 4MX7A 4XT1C 5IT2L 4X6CE 1QQDB 3CFBA 4F80A 3DV6B 1WWWX 3PJSA 2XA8H 3PHQB 2VXUL 2FYYA 5CFHA 3IDMA 8FABB 1M7IA 3GGWA 2FJGB 1M05B 3MUHL 2ZPKH 4IOFC 1X6LA 3F62A 4UTAH 2COQA 4OGZA 4QXGH 4FQQB 1LO0L 3TZVD 1GGIH 1T1WB 4OKVB 1NCDH 1ND0B 2AABH 4RX4A 3G6DL 5C07A 4NOBA 5C09E 1FLRL 4K23H 1QQDA 43CAA 3TN0C 4LRIA 2AQ1A 3QI9A 1CDBA 2BC4A 1J5OH 4QRPB 3L5WB 3PV6A 5EU6D 5HPOA 4HJ0D 2AK1L 2KPNA 2PW2B 5I1EL 1KCLA 3QULB 2IWGA 2ITDA 4M48H 4UINL 4KTYA 1F4XL 4FQ1H 3RTQD 1K4DB 1JMXA 2DQDH 3EO9H 5GHWL 4EIZC 2D4DA 3B2VH 4OJFH 2VIRB 3D1MC 3EYVA 3LS4H 1T83C 4XNUH 4QRPA 5LKNA 3H9YA 1R3HB 4ZOCA 4KHTH 1AI1H 5DJZA 1N6QH 3U82B 3O2DL 3L5IA 5EB9A 3F58H 4UB0H 1P7QA 3WHE1 5DUMH 2PCPA 2Z93B 4HWEH 4HUKB 3NGBC 4JHWH 4MJIB 1UKTA 3T2QA 1HH9B 3K4AA 1ADQA 1HKLL 2HWZH 4ELMA 3EYSH 3SKOB 5EOQL 1CU4L 2VIRA 5EUKA 4PRDA 1A22B 4X7FC 4QHMB 4CW1A 2D0HA 4NRXA 2ZNWA 3WSQH 1E6JL 1DBBL 2VISB 5D7JD 3UTSE 5FUOH 5E7BA 4QXTB 4XCCH 3S37L 4OM1L 4LCWB 1NBYB 3C9NB 3IDGA 3CZJA 3OGCB 3VWKA 5HDOA 4HXAL 4U1LA 1LDPH 3GB7A 4I3SL 4Y5VB 1CR9L 1EVTC 3UO1H 1EFXB 3RHWK 3SHSA 5C0JB 4GQ9L 2GITB 2X4SB 3TESA 4F33B 3O6KL 4LSUH 1FFOB 4Y5YB 2RB8A 4IDJH 5D5MB 1EJOL 3MGTB 3VD9A 4LCCC 1H3TA 4KRPC 3QEHB 5F3HA 5GRVL 4ZFOB 3HRZA 5LXGH 2L4OA 3RNQB 5IMLA 4GG8B 3V8CA 4YQXL 3WFEL 4RFNC 2XXMB 3LD8B 3N9GL 1MAJA 5ICXA 5I1KL 5L88H 2QSCL 3SE9L 5HTSA 3BWAB 1R3LA 2VLJA 4DWHA 1KJVB 3O4OC 5C0JA 3VFOA 1QSFB 2FATH 1JI1A 4RNRB 1U6AL 1RURH 5J1AA 1JPTL 5FUZH 1FNLA 5EU6E 5C7XH 2R0LL 1JZ5A 5HDLA 1TQBB 4X99B 5C0CB 4OZHF 4ZFOA 5KVEH 5LGKA 3C60C 1NL0H 4GG8A 1UKSA 3HA0A 5HYEA 5DMIH 1MJUL 4U7MA 4XBGA 3EOBB 5HI5D 3REWB 3JWDH 1W8OA 7CGTA 4IIQB 1R3JB 1INEH 1J05B 4UQ2A 4YX2L 5FYKU 5MERA 2B2XH 1F4YL 2OP4H 5CBAA 2ED7A 1CT8B 1D5ZA 4NJAL 3Q2CA 1ETZA 1ZANH 4H0HB 1T66C 3IAQA 3OR7A 4ZUTA 3EJYD 4NN7C 3T2PA 1BX2A 1IEBB 3MJ9L 3IJSA 4KK8D 2EDBA 5BVPH 3RY6C 1CGWA 4ZAKB 1YC7A 1GOGA 1CIDA 1PD6A 2GY7B 3BQUA 1QG3A 1FVEA 4JKKA 3N0PB 1S9XB 2HFGH 4HLZG 1FNAA 3DX7B 4NKIL 2VDQL 2OXGA 2YSSB 4LRNH 3RA7L 3RGVD 3RWJA 1LWRA 1B9ZA 3PABA 3RWIB 2PN5A 2VR9A 2A1WL 4PLJC 3THML 3VFMB 5BS0A 3WNLA 3F7QA 3NABL 1N0LA 4YBQD 4R26H 1KIPB 3HUJA 4ONGH 1Z9LA 5E2UL 1JGEB 5DSCB 2PUQT 4P9ML 5EOCH 4FQHA 1UA6H 4J1UB 4UAOC 3MXWL 4OF7A 3GSNB 5C0FB 1A6ZB 2IH1A 3BAEH 2AJZA 1V3KA 3WFBL 1NFDF 3L6FA 1X5ZA 1OB1B 4KDVA 3OKEA 1MFEH 2W1NA 4WW1A 4KJWC 4PS4H 4PJ5A 4JB9L 4Y0GA 4BUGA 2BFVL 5E4EC 1E4WH 3LH2H 2VITB 4XBEH 1YPZF 4OBRA 1OCWH 1WWCA 4Y2OA 5ADPH 1D6VH 4W6XB 1QYGL 5DSCA 3CH1A 4DKFL 5D1ZC 3I85A 2NY5H 3G6JF 3EBAA 5E8NB 1B2WL 5TPWL 1R5IB 4H26A 4WUKL 3QNXA 5HVHC 1INDH 3LRSB 2PO6D 5CJ8A 4U1SB 4PLKD 3H6JA 1CFBA 2VDOL 3MRGA 2CUIA 2O61A 3ALXA 2HJLB 2DI8A 1G7HB 3SCMD