2LU3A

Solution nmr structure of the apo-form of the beta2 carbohydrate module of amp-activated protein kinase
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
105
structure length
105
Chain Sequence
GAMGIRNSDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords 5'-AMP-activated protein kinase subunit beta-2
publication title Structure and carbohydrate binding of the beta2-subunit of AMP-activated protein kinase
rcsb
source organism Rattus norvegicus
total genus 8
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2012-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16561 AMPK1_CBM Glycogen recognition site of AMP-activated protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2lu3A00
4NQSA 4ONGH 4U3HA 3G08A 1AQKH 2EDHA 4KTEL 2B1AH 5EORH 1YMHB 4NQED 3VFRB 4DZ8B 3GKWL 1HQ4B 1RI8A 5E9DE 3OG6B 5IQ9A 2A77H 1TZGH 1C1EH 5DO2C 5HDQH 4WI5A 4F7CA 3FB8B 2YD4A 4Z76A 1YEGL 1CFQA 2GCYB 4M1DL 3HB3D 4U05A 4QRUB 1I1AC 2HLFD 2DYPD 4KKAD 3HRPA 3F7RA 4N0YL 1QHPA 1NAML 1QP1A 1EFXA 1I1AD 1XH3A 5E08L 4WFGE 5GGRA 4FQJL 1T80A 4OZGB 1T89A 1WZ1H 3CMOH 1KB5H 4IOFD 4UINH 1CLYH 2VLJB 3SOBL 4CJ0A 2XRAH 3LIZH 4RISL 1ZGLB 2HKFH 2ZSVA 4HK0B 2AXGB 4LP4A 3DECA 5CEYB 1XGUA 1JIBA 2BSTA 2E8YA 4HX1B 3QO1A 3O8XD 4PUBL 3GSOA 1F2XK 2R1XB 4XPAH 1HXYA 3T08A 3C5JA 3OKNA 3CH1B 5DURD 3RGVC 4KPHH 1JVKA 2DQFB 2X9YA 3ARED 3FB6A 1NGWB 1YNTB 5HGBB 2YD5A 3OF6A 4QGYA 4HKXA 5C8JA 4JO4L 3TWCL 3HPJA 2XKNA 1A6ZB 1DFBH 1V3KA 4QY8B 4Q74A 1KTLB 3WDHA 3C5ZA 5ICXA 4F57H 1WFTA 3FO1A 3S34H 1G7PB 4YHKL 2D4FA 2YUVA 4ELKB 4XBGA 1RVFH 3JTSB 4EEEA 1P2CA 1WCBA 1RIHL 3QUXD 1FBIH 5F1IB 4L8CB 3OR6A 3BEWB 3QWRD 5FYKU 2XN9A 4HGMA 4FRWA 3CZJA 1AO7A 1CLOL 5L8LB 1F02I 4R3SB 1SJVA 4N5EC 3CPLB 5DZOA 4M6OH 1ZTXL 4JAMB 3RKDD 2DIJA 3LCYA 3IDJB 4TNVF 4XNQB 4NQXB 2HFTA 2B4CL 3SGEH 2APFA 4DKEL 1DUYB 1CXEA 2IPKB 1I3RA 3OKEB 2CDGA 2WMPA 5A2LH 3BFOA 3AY4A 4TOYH 3WMSA 1J05A 2JIXD 3SN6N 3N0PB 4UBDD 4Y2DA 1VFBB 4OIBA 3PABA 4OB5L 1BHGA 4Y89A 5EU7E 4O2CB 4TRPH 1ZXQA 3OKOB 1S7VB 4NFCA 1PKQE 3NBNA 2B2XH 1V7NL 1NBYA 2J5LB 3ME0A 1I7TB 1IAII 5D8JL 4DTGH 2NYYD 2R23B 3T77A 2JTDA 5DC9B 5FK9A 5E70A 1NL0L 1VACA 4NM8L 4E5XB 2H8PB 1LO2H 1AXSA 3S37L 1INQA 4IMKA 3VJ6A 4YHIA 1XF2A 1UQSB 1IGIH 1HN1A 5SWSE 1HHIB 1FLRH 4YFDB 4OFIA 5FYJL 5T3ZD 4JE4B 4UZGA 1JFQL 4X6CE 2PCPB 2A6IA 5F89B 5ITFB 1K4CA 2JJSC 2JJUA 3BT2L 4D0DB 2OL3A 4MWFA 1BQLH 2P5WB 3I6GA 4JPKL 4LBEB 3FRPA 3VWJA 3ARRA 2JLLA 4ZYKB 5TJWK 3PP4H 4NNPL 1JNHA 2OXGA 4GRMB 1MCCA 2GITB 2J1KA 4ZUVB 2DS4A 4GH7B 4Z95L 5GZOD 4L8BA 2IAMB 4N0UA 1WT5A 2VZTA 3NPSB 3KYNB 3QDGB 5HDLA 5T3ZE 1JF1A 4HQQL 5DHVA 4J4PC 4GW4A 5CBEB 5F1OB 5HGAB 3ZE0E 2GTWB 4B5EA 3ECBA 3NIFE 1NANH 3H3BC 4QHKI 3OKDB 2APVA 2ATPB 4NFDA 4XBEH 1I7RB 1OP3K 2NW3A 4N90D 2A6KA 2IQ9L 1TZHA 4OT1L 4HWEL 2X4UA 1KCRL 1GGCL 4NHCH 1F90H 3Q5OA 5FM5O 2CLZB 1XR8B 1RZ7L 1R3KB 4YX2L 3I85A 3FQXA 3O2WH 2YD9A 2NY3B 2XFXB 4Z7VF 2VITB 2A9ML 4KHTL 5BS0E 3MLTB 4OLWH 2VLMD 1IAIL 3VWKA 5DZNA 4XGZB 4H1LG 1LHZA 1CBVH 1DN2A 4HWZB 5DK3A 1VA9A 4PJGF 1ERNA 2J5LC 3HI6H 1B6UA 4N90E 4I0KA 1H3PH 4ZAKB 5IVXA 2D3VA 4OCWH 4K8RD 1PX3A 5JXED 3RL1A 1NCTA 1OTUC 4X4XA 1ZLWH 3MLRL 4U0RC 3BESR 5GGTL 5TE4L 4LSPL 1L0QA 4UT7H 3ZTNL 4MA8H 1MJUH 2YD8A 3UYPA 5EU3B 1YMMA 1OTUD 2G5BA 3VMPA 4NP4H 4NUJA 4XMPH 2VLKA 1JE6A 4BFEA 4KZDL 3WKMH 4OLUH 3S96B 4X5XA 4G6JH 3MCG1 3R0NA 4P4RB 3FN9A 2EDWA 5LJYH 3TH4T 3ARUA 1Z2KA 4KJYB 4P4KA 4Y5YB 2VH5H 4JFYB 4KI5D 3VXSB 2DKMA 2V2XA 1EHAA 4KXZH 5TGBA 3BRFA 4U2ZA 3O6KL 4U1KB 2LABA 3GSUB 4E42B 4LLMA 5KSBA 1I9EA 3HR5A 4ZFFA 1CZ8L 5DMYA 1S8DB 3JWDL 1BZ7A 1QSFD 1QG3A 3QCVH 2EDDA 2P5WD 4G5ZH 2Y06L 5EOTB 4LDLB 1NSNH 5EB9A 1YQVH 5DUML 4MDIA 4GFTB 5F96H 4D2NA 1I1CA 1ORSB 2XPGA 1PVHA 5GGSY 1J0IA 2IAMD 4KI5E 1IL1B 1ZGLM 4RAHA 1I3UA 4KK6C 5LGHH 4I3SL 2HFGH 1NGQL 2BNQA 5GS0D 3P0YH 4CKVX 1ED3B 2UVFA 4ORGB 4TSCH 5I1CL 2C1PB 3P4NB 3ZYIA 1QSFE 1CICA 1X5GA 3WFCH 3PXJA 4X99B 4KK6D 1V3JA 3INUH 5DS8A 3VDBA 1J9CT 2NY3C 4KAQL 1LK3L 3B9EA 5AZ2H 5IEKA 4YO0B 1YEGH 4EOWL 1CF8H 1OL0A 2V5TA 1RUAH 1Q9WB 1VFMA 1L7IL 2C1OA 1N3NA 4PJFF 3IJYA 5FB8B 1RFDL 3UTTD 3TZVD 4FQJH 4ZAKC 3P9WB 3O2DA 1MAKA 3ZE1E 5BJTB 5TH2B 1MRCL 4ZTPH 4DAGL 3QWOA 3SQOH 2Y23A 4F80A 1XGTA 3SCMA 3VXNA 2Q8AL 3ZKMC 3J8F7 1JMZA 3H9SB 1A1NB 3KYKL 4EI6A 3T4YA 3D5OF 5E9DA 1UWXK 5DC4B 3UPCA 1F4WH 3ESVF 2ZOLA 4YEFA 1A2YA 4RBPH 2W60B 1MCOH 3BN9C 3AAZB 5C71A 3T09A 4QTHA 4R0LB 4Y5YC 4WRLA 1BQHB 4ONHA 1NDMB 1ZANH 3W9EB 4HJ0C 1X5IA 3UTTE 3WSQL 1WEJL 2VISB 5L2JB 4RMSA 1EO7A 4JO4H 5A1AA 4WFGD 4HV8B 4F9PA 3VXSD 2HG5A 4UOW1 3EJZD 4TULL 4YHML 2EDRA 3QPQC 1ORQB 1EGJA 4HXAL 4YHKH 1QLRA 4NQEA 5TDPB 2F19H 3S3JA 3RBSA 4GQ9L 1EEZB 1MY5A 1Q38A 1WC7A 4ODUA 3FN3A 1RIHH 1AD9A 3EYQD 5CJXC 1NC4B 3V52H 4WU5B 3GSQB 1N0LA 2NTFA 3S36L 2DYPA 1IAKA 3EYUL 3U1SH 2PR4H 1T1YA 1TVDA 1ZTXH 5KSUB 1T0NB 1I1AA 4P59L 3VXSE 5ICYB 2B4CH 3OGCB 5HJ3B 3RWGB 3VFPB 3QDJB 3IXTB 3KJ4B 2VN7A 1YNLL 5EC1B 4OCYL 1HCVA 1OHQA 3QCUL 4LHUG 5ALBH 2VERN 1C12A 1IGJA 4PJ7A 1AHWB 1YEHL 2LFGA 3O8XA 3PWJA 1OGTA 1CXHA 3ZYJA 4BH7B 1W0YT 4IMLB 3S6CA 3BKML 2X05A 4Z78A 1RJYB 4P5TB 2JJTC 3AREA 4FTVB 1A6TA 1DJSA 2GUOB 5D7KE 1A7PH 1VFAA 2CRYA 1CLZH 4X6DF 2ICWA 3S37H 2Z35A 5DRZB 5DYOA 5EFIB 4HH8A 1BX2B 1NGYA 4UQ2B 1C08B 3RFZC 1BVLA 4HD9A 5L88H 2W9LA 2ED9A 5HHXL 5IMOB 2I5YL 3H9SD 2DI9A 1JFQH 2AJSH 3L5WA 3PDGA 4KV5E 4R0LC 5HYSB 3QUXA 3X11A 3MFFA 1PKQA 3QWRA 1D5MB 1D6VH 1KB9J 2DD8L 3VFUB 4RNRB 2JCCE 4S1QL 1MHCA 2HFEA 4RX4D 5IJKA 1QLFA 1FGNL 3ILQC 3C09C 4Z95H 2HN7A 1U91B 1AGBA 4NO3A 1T5XB 5CJ8A 3ZT7A 2A38A 1FL5A 1ZSDA 1JGDB 3X12A 4F3FA 2B0SH 1IQWH 4YBLC 1J8KA 4G9FD 3UJJH 2JIXA 4NOFA 3VFRA 1Z0NA 3MREB 3H0TA 5HDOA 3GUTB 2VLRD 5AZEL 4EBQH 1QRNB 3R1GL 4P9HC 1NC4D 1LEKB 2R9HC 2GCYA 2IQ9H 4YBQD 4LMQE 4OT1H 1VKXB 4JEGB 4QRUA 3TVMB 1GGCH 4D9LL 5F7DA 4W4OC 2ZUUA 4ZUSB 4ZD3H 4HT1H 2R1WB 1CGSL 4YNYA 4FP8L 1YEJL 5ETUB 4YX2H 3KGRA 2CK2A 1JK8B 4N0CC 1KN2L 3KJ4C 5KJRL 4JRWA 1CE1H 5FXCH 3GBNH 5MHSD 3LH2H 3GJFB 5CKGA 4KHTH 1D6EB 4OZGA 4UOW0 2A6JB 4PLKC 1IAIH 4N0CD 3QDJD 1CGUA 4JO3L 1A4JA 4G9FE 1JGUL 1S7UB 2F5BL 1LP9F 2JB5L 3HC3L 4LKXB 1EO8L 1MF2L 4MJ6B 3A6CL 2VLRE 4CVZA 5CEYA 4GUPA 3WJJA 1IKNC 4HX1A 5ID1A 1ZT1B 1BMGA 3KPOB 1AP2B 4LAQH 3RVTC 1NGZB 4XX1G 4ZO6A 2R1XA 5I1HH 2OL3L 3VU2A 1N5AB 2JJSA 4EQ2A 3MLRH 4KU1A 4P5TD 3UJTL 2DQFA 5GGTH 3NTCH 1OAZL 3RVTD 3PHOB 1NGWA 1YNTA 5MHSE 5D5MB 5DLML 4DOHB 3FO9B 2G75A 4JFXB 1UWGL 4JQVC 5IMMA 2YPVL 2EEAA 2BVQB 1I3GH 3O6KH 3PWNB 4MNHA 4ELKA 3U46B 1CK0H 4L5FL 1QEWB 4OBSA 1S7SA 1JWSB 3JTSA 3VFMB 1JPTH 3H9ZA 1I9IH 1RU9L 1XGQB 3HA0A 4R8WH 3Q48A 3BP6A 5F1IA 3BEWA 4ODBD 1WWBX 4NWUH 2ZUVA 3CNKA 2OX5A 1M7IB 1MCIA 3QRFM 4P2OD 3CPLA 4LOUD 4CNIA 4LLDB 3EOBB 5DFVD 5MERA 4JAMA 4QT5A 2XWJA 2JF1A 3IDJA 3ZT6A 4XNQA 3JV5A 4NYLA 1WIPA 2CKBB 4TPRH 4K2UH 1DUYA 2WUBL 1MCKA 3OKEA 1MRDL 3DX7B 5JNYA 4HK3J 3SE4C 1FVEB 4AEFA 4C59B 4YBHA 1NGQH 1BP3B 5JZ7D 3RDTA 1VFBA 3JV4A 2MJWA 3KPTA 1S7VA 1F45A 1QRND 5JXEA 1F4XH 3FZUC 5I1EH 2H32H 1LK3H 3CDGB 1RULL 1WIUA 3E8UH 3TVMD 2GIYA 4NPYB 3OAUH 2R23A 3GMLB 4DUVA 4EOWH 1YUHB 3GMRA 4GG8A 5EBLB 4YDKL 5J4MA 4E5XA 3TH3T 1L7IH 1KLFA 5IWLA 2WANA 2OP4L 3RI5K 5CD3A 2FBOJ 4H8WC 1UZ8B 1JGEB 4I1NB 4EUPB 2ZG3A 2GI7A 1II4E 1KXTB 1X5JA 3H7BA 4LPVA 5ACZB 3BHBA 4DAGH 3WNLA 3S3PA 2PCPA 3KPPB 1QSFA 1JZ3A 1JPGA 3PWLA 5ERWB 2P5WA 3WIFB 5JOFB 4UILL 5EWIL 4U1NB 1NPUA 5CZXD 2X7LB 3LPFA 4ZYKA 4BYHA 4PJDE 2VN4A 4LP5A 5I1LB 5L6YH 5C0GB 3ARPA 1PD6A 5HY9B 5C2UB 3NA9L 1FYTB 1SJEA 4M5YL 1DUZB 2IAMA 4QRPB 2DQJL 1J7VR 4BKLA 4YR6A 3KYNA 15C8L 2ZUQC 4OLYH 1FNLA 1G7QB 1YY9C 5CBEA 2B7DT 4LSVL 2GTWA 4TULH 4IRZH 2W65B 3L1OH 4QRSA 4HXAH 4K9EH 3QUYB 2WWMC 4MGXA 3T0XA 2ARJQ 1CG9B 1IC4H 3TA3C 1OAQH 2EDQA 4NRYB 5KAQG 5I1GH 3QCTH 5I30L 2FWOB 3GMOB 3CVHH 3VI4F 3WUWB 4MQ7B 3VD3A 5E8NB 2CO6B 2XFXA 4FXGB 2FATL 2PTUA 5CP7A 5GGSB 3QFDB 3MLTA 1R0AL 1WICA 1UH4A 2VDPL 4XGZA 5FYLD 3UTTA 3TZVA 2D0HA 1MLBA 1KSRA 2F54B 2ZSWB 3BPCB 5DD3L 4HWZA 1I9RL 3CX2A 1YNLH 1U8LB 3BDXA 1KUMA 2VABB 5IVNA 3MJ8A 3LDBB 4J3UA 5BV7H 1G7MB 5GGVY 4GKZA 5JDJA 5EU3A 4FFZH 1NLDL 1F8TL 5EOCJ 2MQ3A 3S96A 3ZYOA 5FYLE 1F58H 2ICWI 4QEGA 1LVEA 4P4RA 1U8OA 4Q0XL 5HHQB 5I8KH 3NCYS 4KJYA 4U1LB 1JPFB 5EU6D 2I9LB 5FHBL 3SJVB 1H8OA 1EJOL 3VXSA 2DJ4A 2VUOA 1CIUA 2WINA 4Y19B 3FRPG 4L1HA 5MEND 2VSCA 5EU4A 2OTUB 5GRWA 1S7QB 4NGHH 1E28B 4WFFD 1EGJL 1KFAH 3DMMB 1D5IH 4O4YH 5EOTA 5CLTA 5HI3D 4XZUB 4F2MB 4AT6A 2PYEB 2XA3A 1ZHKA 4AEHH 2DD8H 4ODXB 4S1QH 3W5MA 4B0MM 1ORSA 3B2VH 5EU6E 4QRPD 4LLYB 1BJMA 1EH9A 3IF1A 5DQDL 1IL1A 3O41A 3MODL 1OAXL 4LKCB 5DRNB 5LXGH 3QUYC 4ORGA 1R24A 1AE6L 1UVQB 3QDHA 3V0WH 4F37K 5JUEH 1TCMA 4ODSL 5MENE 1QZ1A 3EJJX 4X99A 4WFFE 4HJGB 3K3QA 2MCPL 4U1HB 4K23L 1OLZA 5SX4I 2D31B 3CXDH 3WS6C 2R56H 3R1GH 2N56A 1JGLH 4KROC 2FX8L 4BSJA 4YO0A 5HHMB 3U36B 4CDGC 1UFUA 1R3LB 4LEOB 5HSFA 4G8FB 2ATKB 2YBRB 2PYFA 1Q9WA 1E6OL 3STLA 4KQ4L 4I18B 2IPTH 5K59F 2JCCA 1KN2H 3RY5A 3B2UD 3HE6B 2X4OB 3EFDH 3CCHA 3LN5A 2F54D 1FL3B 1U0QA 4GAJL 5TH2A 3L7FA 1BBJB 1JGUH 1TETL 3MV7E 3KWWB 2JB5H 4LEXH 5TF0A 3V8CA 3BXNA 1MF2H 3H9SA 4IOSD 1A1NA 5C70A 4P2RD 3BW9A 1Q72H 4G43A 4PJBE 3O9WC 1KT2B 4C4KO 2C7UB 4KK9C 3LKRB 4Z8FL 3MV11 3FT2B 3AAZA 3CSYB 3HC0A 5FGBC 3MCKB 3WS3A 1L7TL 2D7QA 4UUJA 3W9EA 1OAZH 4KJQC 1M05A 4RX4A 5EBWB 1FPTL 4HIIA 3BWAB 4UI2A 3OAZH 3V6FA 5L2JA 2XYCA 3FFCB 3SJVD 1UWGH 3V6OA 1N8ZA 4M9OA 1QTYT 3VXPB 4Y19D 5L2KD 3L3OB 4Z0XB 4MXQC 4JFDB 2YSSB 1ORQA 3DMMC 4X8JB 4OJFL 4G9FA 4LCCC 5E8OA 5F9JA 3GIZH 5JDSB 4P2RE 3LRGA 4L5FH 4F58L 3QFJD 4UT9H 2VLRA 3I75A 3O4OB 3OHXB 1Q9KB 1I8LC 1NC4A 2HH0H 3QG7L 3GSQA 2NX5D 2QJDA 3HMWH 2AQ2A 5BOPA 5F7HA 5F3BA 3H42L 1PG7X 4WY7L 4PJEB 2P48B 2E7LA 5KSUA 2AEQL 3CDYA 2ID5A 1T0NA 3PF2A 3OGCA 5HJ3A 2LU4A 2FX7L 4Y19E 1FL6B 5L2KE 3VFPA 3MLXL 3QDJA 2VWEC 1NUDA 1MRDH 1OTSC 5I1IH 5C2BL 3ALPA 3STZB 3FT4A 5EC1A 3K74B 3FQUA 3QFJE 4MAYB 3IAGC 2J4WL 2PW2B 5T3ZL 1AHWA 2NX5E 1MAML 4EN3B 4MQXD 3KHQA 1WZMA 4NJ9H 4IMLA 5HHMD 3UZVB 3QQ9C 1FZJB 1YJDC 1X6NA 3P4OA 5JR1L 4MA3A 4U6XB 1XT5A 2VXTH 2DBLL 4P5TA 5DVMA 5K9JH 2P8MB 1P4LB 4MCYB 1OSPH 2GUOA 2HVJB 3CXHJ 1F4AA 1KJ2B 4P46D 3HE6D 1NCUA 4M93B 4J8RA 5FA4B 4CMHB 2OP4H 4OFYD 1I85C 1WWAX 1BX2A 5KS9A 1F6AA 4Q6YA 5I6XB 5GRZA 4JQVA 1DBKL 1ZHLA 1WWWX 3QBTB 5HYSA 5E5RB 4RA0C 3BDYL 4TSAL 1T3FA 5J12B 1J0HA 3NMEA 5KOMC 5F9OH 1H3XA 4WGVB 1C7TA 5HD8D 4UILH 2K9UA 3PWVA 4D3CH 1AIFB 1D5MA 4Q9RL 5E94B 2H1PL 1P4BL 1XF3B 3U82B 4P2OA 4RNRA 4OV6F 1YY8A 5HVGB 1HI6A 3UPAA 3ALXA 43C9B 3MV9D 1BGXL 1AXTL 3MRKA 3B9AA 2FRGP 3FFCD 3ZHDA 2NZ9D 2PN5A 5LWYL 1T5XA 2IWGA 4M5YH 4AQOA 4Y4HD 2DDQL 3DARA 3BSZL 15C8H 5D1QC 4DZBB 4WTWA 3O4OC 3C87A 3IRZA 3VFGH 4WFED 1NBVH 4TUKH 3ROLB 5D2LF 2EO9A 1HXMB 1MNUL 3TO4B 2X1QA 4YJZL 3MBEB 1QRNA 5IT2H 2A0LD 4MD5B 3D1MC 1LEKA 1QA9B 1VKXA 2OSLB 5C09D 3TVMA 3BOVA 5IQ7L 4K8RL 4Z7WF 1F97A 4ZS7L 3FN0L 3MV9E 5ETUA 4JVPA 3GMMB 1HKLH 1JK8A 2BSSB 4PJDA 4Z5RB 3FFCE 3NCYP 2FATH 4Z7QE 4CAGA 2VUYA 3GJFA 5F7WC 1ACYH 4NHUA 3GMPA 4Y8AA 2A6JA 4JN1H 3K4AA 3DYMA 1Z0MA 2IFFH 1DEEB 2P24B 4CVXA 5C0AE 4LKXA 4EN3C 4NRZA 5DD3H 1I9RH 1CU4L 4RIRB 4MAYD 3RP1A 5D96B 3O2DH 4JKPL 4KK8C 1QNZL 2MHAA 4F33B 5J06A 3KPOA 1Q1JL 1ROWA 2NY4C 3RVWD 5C09E 1NGZA 4KUZL 1N5AA 3ABZA 5CMAB 1L6ZA 3MJ9A 4FQIL 4M93C 3HR6A 1K8DA 2VZSA 3PHOA 3QG6B 5MEQB 4WDIA 3K7UA 4GAGH 1ADQH 2IGFL 4PJIF 3FO9A 5DMKB 1OAUL 2GJZA 1HH9A 4QXTB 5D1ZD 5DD6B 4PRAB 3VXTB 2G5RA 5ENWA 2H3NB 3CU1A 4PV8B 3BJLA 5F3HA 4ZTOH 4Q0XH 1PY4A 2CGRL 5J12C 2Q1EA 3PWNA 4P2QB 1JHLL 3PL6B 4U1JB 4DW2H 3MRFB 1QEWA 1JWSA 1DQQA 2YWZA 3VFMA 5GS0L 5DJZA 1XGQA 2A9NL 3KR3H 1G6RH 1YYMH 1IC5L 5FUCC 4EZMA 1A14L 1M7IA 5C0FB 3RA7L 5EU7C 1A7QL 2LU3A 3EOBA 1JP5A 3RRQA 3RWFB 1HSBB 2GY5A 4UTBH 4F7PA 3HAEB 3M1BB 4NQDE 2W9EH 4YDVB 4RDQG 4E41D 1I8MB 3DX7A 5MP6L 1NCNA 4RMUA 1KIUA 5DQDH 1U8PB 1FVEA 1TNMA 1H3UA 5CIPB 4U3XA 3MBEC 4FABH 1UADC 5C7XH 4UB0L 5IOPA 1IGFH 1P4IL 1AE6H 1B0WA 2X4QB 3TO4D 4OF7A 2GSIB 3DGGA 2HTLC 2EE2A 4JFEB 1MQ8A 4NZTL 3UTPE 2MCPH 3OKLA 4K23H 4XPTH 3RTQD 4LCIL 4QXWA 4Z7UB 3REVA 4NPYA 4PRPB 3GMLA 3N50A 2NY7H 4UV7L 1T4KB 4HWUA 5TDOB 2QLVB 5EBLA 3CK0H 1QKZL 4Y1AE 5IW1B 3SGJC 2N7AA 3TPKA 4CN4A 1E6OH 1OWRM 3ET9F 4E41E 4M8VA 4AIXA 5AG9A 1UZ8A 1JGEA 4X7TB 5EU6A 1EV2E 3TYFB 5FO7B 4BZ1H 4XWOD 2RJMA 5F6HJ 4JJHA 5MENA 3UO1H 3BX7C 3ROOA 3N1GC 3R8BB 4YDIL 2WBKA 5DJCB 3NH7H 4W6YB 1AI1H 3NABL 4PRHB 1D9KC 4Z8FH 1AR2A 1EJ6A 2D03L 4TYUA 4POYA 2ZOKA 4HPYL 4M7LT 1IEBA 3AMKA 5I1LA 1P5VA 2Q20A 5C0GA 3G5ZA 2FZ3A 2NY5L 3LQMA 3PHSA 1NQBA 2CRIA 3P11L 4K3HA 1NFDE 2VYRE 3MRIB 3WFBL 1SEQL 1DUZA 1FPTH 4QRPA 1EEUA 4WHCA 5GRJL 4NO0D 5J6GB 4GSDH 2MMXA 5FCUL 5B4MC 3F7YB 3TNNB 4QRRD 1EERB 1Q8MA 3O3BB 3PL6D 5INDB 2DKSA 3DO3A 1EHLL 3PV6B 4MJID 3O3UN 3CLEH 4FFWC 2DMBA 4ZOCA 5GRVK 5I18L 2F9BT 3ZDYE 2FWOA 3GMOA 4L9LA 4PJBA 3WUWA 3QG7H 4MQ7A 1A5FL 3ZE2E 5E8NA 3ETBF 4AL8L 2PTTB 3QR2A 2CDEB 5DK0B 1BEYL 2UUDH 2QQNL 4FZEL 5SX4H 2DWDB 3RIAF 1BOGB 4N8PA 3MOBL 1RZIB 3BIAX 2I27N 4B7LA 3JTTB 3B9DA 4QRRE 2F54A 1P6FA 4H25A 2J6EA 3MLXH 5GGUB 1DQLH 4WEMB 1U8LA 1UM6L 4MJIE 2R4RL 5IGXL 3GJEB 3T0ED 1UB6A 4P2RA 3Q1SH 4K7FA 5AYQA 3WDJA 3TGXA 2I26N 2EDEA 2VQTA 5D1XD 1NBZA 3C2AL 3MNVA 5L9DH 4YHZL 3SJVA 4U1LA 1JPFA 1T22B 5IP4A 4Y19A 5L2KA 3DRQA 4ODHL 3BIKB 4KHXL 5IB4B 3T0EE 3ULUC 4WTXA 5HI4D 1QSEE 3IJHA 1DBKH 2OTUA 4DEPB 3AC0A 3QFJA 3ZKNC 4XH2A 4TSAH 1HHKB 3BDYH 3C8KB 3JV6B 4PRHD 4DGVL 4F37F 2F8VA 2NX5A 5D7LE 4XZUA 1E4XI 5CEZD 1XIWB 1N6QL 2FGWL 4GW1A 1RJZB 2FGZA 3CMGA 3OKYA 4Q9RH 3BP4B 2H1PH 4LCYB 1EDQA 4ZUTA 3LRHA 4LLQA 4ODXA 5E8PB 3LEXB 1AXTH 1TJGL 2XT1B 3QIUB 4MXVF 4XCFL 4G6AC 4PR5A 4LLYA 25C8L 3TT3H 4HZLA 1IMHC 4LKCA 1T2QH 2UWEB 2E5EA 2CLRA 3RZCB 1MELA 1S9WB 3MCLH 3BSZH 4Q2ZB 5FV2A 2OCFD 2Y7QB 4HGWB 3WXWH 1T7YA 4MX7B 1FHGA 4QWWC 5K33A 3OSKA 1PW3A 4PRHE 4RGOH 2OLDA 2D31A 1G6VK 5KSVA 1NBQA 3BQUC 3U2SB 2MQCA 3JWNC 1MHEA 1TCRA 2J8HA 5CEZE 1NFKA 1EAPA 1MCQA 2VDRL 4Y4KC 5IQ7H 1HKFA 2GAZB 4LEOA 4G8FA 2WIMA 2ATKA 3L7EA 1OARL 1YEIH 2NW2B 2YBRA 4IRJB 4I18A 2HAZA 3IU4L 5AUMB 2M2DA 4P46A 3CFEB 3HE6A 4Q9BA 1RMFL 1AC0A 3V4VH 4OFYA 5JA8B 4NSKA 3TF7C 5DVLA 2NLJA 2OJZH 1WBYA 1BQUA 5B3JE 3KWWA 4XNUH 3H9HB 1UA6L 1UXWB 3GBLA 3MA7B 4JPIB 4IBLT 2IH3A 4U3CA 3I50L 1IC1A 5CSGA 1LK2A 1JUFB 1JYWA 4NM4L 4PBWD 4ZSOE 1F3DH 3SE3A 1QNZH 2C7UA 1U58B 2XY2A 5CBAB 1Q1JH 2BY2A 4HWBH 1W72A 1AGDB 3FT2A 3QO0B 3CSYA 3C6LD 5DRWB 1FSKB 5FM4A 5D70H 4PG9B 4Q58C 4FQIH 3MV9A 1RUKL 5EBWA 1F3RB 3BWAA 5LGKA 3BKCL 4B41A 3FFCA 4UMGA 1E4XL 1OAUH 5EZOL 3EJYC 5DQJB 4N8VB 1NGPL 2VDOH 4Y4HA 4LPWA 3NN8B 4DEPC 3EHBC 4JM4H 1A0QH 2H26B 4KJWD 2D7MA 3L3OA 2P7TB 2V5MA 4WCYH 4Z0XA 4X8JA 2PXYB 3U9PH 4Y8DC 4MSWB 4V1DD 5JDSA 3ARGB 2AJXL 1XIWC 2ED7A 2YA2A 4M61B 2PNDA 4M02A 3OHXA 1FFPA 1Q9OA 5EIQA 3UTZA 4TUJA 1ZAGA 2HJFB 3QIUC 4HULB 4JN2A 5C09A 4XNYL 3KXFD 4JLRA 1IKFL 4XCYB 5EU5B 1A14H 5IM7A 3D6GA 2IH1B 5CZVL 3RA7H 2CXGA 3DURB 1FH5L 3RZCC 3D69A 4JCMA 4HC1A 4HBCL 1FL6A 1GIGL 1B4JL 1ONQB 1SJHB 4KVNL 5D7IF 3PP3H 4O5LH 4V1DE 5TPWL 4EI5D 4LSQH 3S4SA 2X4RB 1G9ML 1DE4B 4MAYA 4O00A 1P4IH 1DN0B 3QDAA 2PW2A 2X1XR 5C0CE 1YEFL 1CGXA 2G60L 4NZTH 4XPHL 4WHTB 4IRJC 3KXFE 4JKMA 4LCIH 4XNXL 1NMAH 4XC3L 4OI9A 5T3XH 1TZIA 1QFWL 3NA4A 1L4IA 2VC2L 4I3RH 4IRJD 3G6JB 3MJ9L 3VA2C 1KJ2A 5BXFB 3DHMA 5D1ZA 2MFNA 4RAUB 4I5BB 2EDLA 1QFUH 1CT8A 5ISZB 4JFPB 1E27A 1JNNH 1HQRB 3UTSD 1B6DA 1MCWM 4YZFF 4PLNC 3FL7A 4F7EB 3V0VA 2V7HB 2HYMA 4WIQA 4OTXL 4L4TB 3OX8B 3B9KD 4PTUA 1F4YL 2VJXA 1KLUB 3UJIL 4YDIH 9CGTA 5C86A 2E27H 1IM3B 5E94A 2Y07L 4K3DL 4HPYH 1MCPL 43C9A 2V5RA 5BZWB 4Z9KB 4OM1L 5I1JH 5DMJB 4I4WB 4Y4FB 2PXYC 2QQLH 3UTSE 1A8JH 2X1WL 1HHGB 1SEQH 2HLAB 1ULVA 5HHOB 4E41A 5GZND 3ARGC 4JHAL 5GRJH 3IFNL 2BVPA 5EO0B 2R0KL 5FCUH 2PXYD 4LSRH 4OCXL 5FYLL 3UAJC 1A7NH 1F11B 3NCBB 2VR9A 4NKQB 1T7XA 3PQYB 2FJGB 4OI8A 3TO4A 4LVOC 4JPVL 4WW2B 2YN3A 5IB2B 3UAJD 2O26U 4LU5L 4MD5A 1GC1L 3E3QC 3EZ8A 3RTQA 1QA9A 2W59A 2YWYA 4HIJA 4XI5D 2OSLA 2VDNH 1QLEL 3O2VH 1TTUA 4KZEH 5DJ8A 2WP3O 5D6CA 3QXDB 2J12B 3OJMB 5FKPB 4NCC1 3O3AB 1YEKL 3GMMA 4JG1H 4QRQB 3RUGE 1W0VA 1F6FB 4PGBB 1GXEA 5JPNB 3ISWA 4WI2A 4CVUA 1BEYH 5C9JB 5JHDB 3QJFB 3TBWB 5ADOL 1XEDA 4FZEH 1JBJA 5DJ6A 3SKNB 1NFDA 3O4LE 4YHLL 4Q9QH 3MOBH 4DQOL 1HYSC 4QNPE 4I0PC 3TESA 1DEEA 5IMKA 4YFEA 1P84K 4EJ1C 2AI0H 3VFNB 1UB5A 4RIRA 3KJ6L 4ZOBA 4XXDA 1XGYH 5D5MF 3U4EB 2IAND 1D5ZA 5H94A 5IGXH 4F33A 3PWPB 2W1NA 4WO4B 5FF6B 5IESH 3KLHD 1H15B 1J8HE 1KACB 3F65A 2BK8A 4HCRA 3SGDI 3Q6FA 3QUKA 2ADFL 4M43L 4HAFA 4M5ZH 4JZJB 4JY4B 2VR4A 4YPGB 5DD6A 4L29B 3VXTA 5ISZD 3MOAH 3S37X 4YHZH 3IFOB 4WEUD 3DX9B 4NO0A 4N5UA 4AM0B 5HYSG 1I8IA 1MI5B 3DETD 5D2NE 3QNZA 5IHUH 3D0LB 3GB7B 1UGNA 4QRRA 4APQB 2J8UB 3PL6A 2IANE 4ODHH 3V5HB 3MRFA 5EO1A 1B90A 1J1XL 1X4ZA 4MJIA 1LD9B 1UCBL 4M9PA 1AC6A 1ZA3B 1KIRB 4YFLI 4S0TD 4Y4FC 5C0IB 5C0FA 3SDCC 2V7NA 4HEPG 5K9KB 4I77H 2FGWH 4Y2OA 3RWFA 1HSBA 5IW6A 4OQ1A 3W11C 1G7JB 4G8IB 1R3IL 5JO5B 1M4KA 1TJGH 3HAEA 3M1BA 4YDVA 3I3BA 1F3JA 4P9HH 5F8RC 4NNXA 1U8PA 25C8H 5LCVH 1KJMA 2BNRE 2MOVA 4X0KB 4N8CL 2X4QA 3KPRD 4HH9B 2AK1L 3FB5B 3T0EA 3OR7B 2AW2A 5AD0A 4Z7UA 4TVPD 4BQCA 5E5MA 3D2UD 2WUCL 2NCMA 5IV2B 3ZKSD 3L9RB 3TBTB 5D1XA 5JHDD 4GRWF 2ESVE 4X80H 4X9FA 3VFSB 1CDUA 2AQ3A 4PRNB 4OCRL 4RWYL 4TNWK 5FO7A 3N1FC 1RMFH 1QO3B 3LV3B 2VE6A 3KPRE 4MVBD 2CDFB 4WO4C 3NZHL 1WAAE 3FO0L 1UA6H 1JZ7A 1KJ3L 3X13A 3DV6B 5H8DA 2GYSA 2AAVA 1S3KL 3OMZA 4X4MA 4OD1H 2Q87A 3CFBB 3U0TA 1LEIB 4PJ9B 3HUJE 1NJ9B 4NM4H 4PRHA 4EDXB 1H9VA 1QFOA 1V3LA 5IBLD 1V05A 1NAKL 1NCWL 2IF7A 5JHDE 2ADGA 4XVJH 3HNTL 2EKSB 4Z7NE 5MEPB 4PP1C 4APQC 2ZCHL 4GMTH 2CK0H 1E4XH 4YUEL 3V5KA 1MI5D 1SMOA 3FONB 4PP1D 4PGEA 1UXSA 2FHCA 5INDA 1K2DA 1XCTB 5FECA 3PV6A 4I8DA 3NIGE 2VZ3A 1QPXA 3LSOB 3IJSB 5CCKH 3MUHL 2AJXH 1KPVA 2DTMH 3FAWA 1JF6A 5K93A 4ZSOA 5LQBH 2W92A 4F9LA 3HCVB 2PTTA 3JVGC 2CDEA 2B5IC 4QF1B 1DSFL 4ZFGH 2X4PB 4UNUA 3R0MA 2I07A 4TTDC 4U2YA 2DWDA 4A6YA 3KDMA 1KN4H 2EH8H 3D85B 1FH5H 4FQCL 5IIEA 1KPUB 1RZIA 2DM3A 4WI4A 1TVBA 3P0GB 3JTTA 3VXMB 3GJFH 2DQTL 3HI5L 4KVNH 4PIRF 1MJJB 4JCLA 4KQ3L 3GJEA 1G9MH 1OB1B 4LPTA 1NCBL 4FOMA 5C3TA 5ICZB 4UU9B 2YEZA 4ESKA 1YEFH 4H8WH 2QV2A 1K4DA 1NUFA 2AEPH 3RY4A 4JGUA 3OAYH 1G1CA 3C6LA 2A73A 3VD7A 5JW4N 5LGJB 3F7QA 3VRJB 4QHKJ 5J0BA 1W72L 1RY7B 3QQ3B 2WBWB 1K3IA 4H0GA 1J5OH 2EDNA 3TNMB 4BQ9A 2Y36L 3MJ9H 3MO1B 5CJBA 2YUWA 3K1DA 1UYWL 3LB6D 4XBPB 3FQRA 3KNBB 1HNGA 3BIKA 4PJAE 5KVFL 5C1MB 1T1ZA 4V1DA 4OTXH 3L95B 5GHWL 3M07A 2DLFL 3D3VB 3LS4L 5L7XL 1JZ5A 2VZ1A 1HHKA 2CD0A 4PJ9D 1OM3L 3VXQA 3I6KB 3UJIH 5C0CA 3K2UL 5F9WB 2ARJA 1IM9D 3KXFA 3MA9H 4ZO9A 5FYJU 2R2EB 4LCYA 2L7JA 2Y07H 3C9NB 3KHOA 2YPKB 2FHFA 1N4XL 4K3DH 5A16A 5E8PA 4BH8A 1MCPH 3G6DH 2HT2D 3X14B 1MH5B 1WCQA 4YPJA 1WFOA 4FQXB 5BO1L 4JO1L 2KL6A 3QAZC 4RZCB 4XC1H 1YPZE 2UWEA 2DB8A 4W70A 4HC1L 1KEGH 2CKBH 5ILTL 3EYSL 5H37G 3RWIB 1B2WL 2Y7QA 4EI5A 1ZEAL 1MCJA 4W4NA 4MX7A 3RY6A 4OCMC 5FM8A 3WUWG 1UZ6F 2YOCA 4PJHB 3D25B 4L9DA 4Y16D 4LLWB 4JPVH 2DQCH 2OR9L 3W2DH 2EEDA 2P49B 1I9JL 2AJZB 1NDGA 2CMRH 3U2SA 4Z7VB 1GC1H 2GFBA 2D2OA 1LO3H 1T6WA 3S36X 1I1FB 3EKCA 3IFLH 5GRUL 4NZUL 1EUTA 1RZGA 2NW2A 1FIGL 4IRJA 3RJDA 5EA0L 2K7QA 5FA3B 1NLBL 5KN5B 1CR9H 2HFFA 5ADOH 1C5DB 3MV8B 4PJGB 3UTSA 1KJ2L 4R2GB 5I73B 1S5IL 3VXMD 4DQOH 1HOCB 4ZUWB 2F8OA 5SX5H 3KPMB 3ZSTA 1D5XB 4GXVH 1J1OL 2B1HL 2VLLB 4H20H 1DP0A 1LO5A 3EGSB 4OZHF 4EUPH 5CP3A 2VDLL 3C6SA 3B9KA 1WZKA 3KJ6H 4LRIA 5HGGS 1JUFA 3U6RB 1KPRA 4S1DC 3LD8B 1CXIA 1TQBB 2NNAB 3DI2B 1PZUB 3KLAB 5LBSL 2ITCA 4LSUL 4PG9A 4DN3H 2JE8A 1IARB 3AS0A 4S1DD 5BCAA 4LQFL 3MRJB 3RUGA 3ARFB 1CI5A 4X5WB 4LVNB 1VB9A 1B4RA 4OGYL 1H0DB 4B7IA 5LAXB 3U7WL 1A6UL 1XF5B 3NN8A 4D0BA 5ALCL 4LF3B 5J56B 1CYGA 2H26A 2P7TA 4G6KH 3DUUB 2PXYA 4MS8C 4NO5B 1A3RH 2F53D 4ODVL 4MSWA 3DTXB 3QIWC 4PJEF 1BLNB 3D3VD 2Q86B 5F9WC 5JW3L 1SMAA 2EDXA 3O81A 1J1XH 3A67L 4PY8I 1E4WH 3MC0A 3MRNB 4EVNA 2QR0B 5AAMA 2WLYA 1GZQA 3IDXH 4XCYA 4PP2B 3IAQA 4R90H 2IH1A 3MLYL 4OCSH 4XTRC 4RFOL 1D5BB 5BRZB 5D7SL 2JJWA 4FQXD 2DTSA 2APWA 1R3IH 1ZMYA 1ONQA 4XTRD 1ETZB 1SJHA 2F53E 3DI3B 2IALA 4PJ8B 2YD3A 5SV3A 1RIUL 3D3VE 2X4RA 5D2NA 2NXZB 2XWBB 4G7VL 1DN0A 3O3DB 1RJLB 2J6EH 4N8CH 2IANA 5ACMA 4WI6A 4FQPA 3MACH 1C16B 4WHTA 3OKKB 4KDWA 4WUUD 1CD1A 4GAYB 1T5WA 1G0YR 1E4JA 3QISA 1UCTA 5KZCB 5HGHB 2OI9C 5ID0B 1F5WA 4PJFB 3HG1E 3G6JA 1TFHA 2ZKHL 4HCRL 4I5BA 1QPPA 5ISZA 4JFPA 1HQRA 4OCRH 2X40A 4R2GD 4HKBA 4JFOB 5DEFB 3OBAA 2V7HA 2AQ1A 2FIKB 5I8CB 4KMQA 2UZIL 3LD8C 1HINL 1TQBC 3OX8A 4AMKL 1A7OL 1QVOB 3FO0H 1MLCA 2XZAL 1UH2A 1AKJD 5CILL 3THML 4JANB 1WVZA 1KJ3H 5IFJB 4WUUE 3DOSA 5HHPB 3NACH 1S3KH 2FD6H 1U3ZA 5DXWA 4YXLL 4M7KL 2XQBH 1S9VB 3MGTB 4LVNC 4HXBH 1KELH 1NAKH 1NCWH 4HMCA 3BYTA 3ARFD 1UG9A 1JN6B 5I66B 4FFYL 2DMKA 1HHGA 3MLZL 3QZWA 2Y9RT 3KPQB 4U1SB 5H35B 1YECL 5EDXA 3QEQB 2QKIB 1FRGL 2FJGA 3KPRA 4WW2A 5CJQL 1LWRA 1WAAA 4ZG1A 4JY5L 5GS1A 5DJDB 4QTIH 1LNUB 4X6CF 2A1WH 4E9LA 1VESA 1BIIB 2RR3A 3MRMA 2DM7A 2I9TA 4XAKD 3QXDA 3HUJA 3MROA 3D2UA 2P45B 3GBML 5FKPA 3O3AA 3NCMA 4NCDA 5HHVL 3GK8L 4MJ4A 5E4IA 5GIRA 5C9JA 5JHDA 3TBWA 3HC4L 4PJ8C 5E6IC 3L5JA 1DTUA 5DMIH 3S4SG 4LHUD 1LE9A 1HNFA 2NXZC 2EDOA 1V7ML 5DD0H 4AG4H 1QFPA 3BP5A 3CUPA 4NT6B 1TDQA 3HI5H 1BBDH 1N64L 1WZLA 4KQ3H 4HS8L 4QHLB 3U4EA 4BSWB 1KTKE 4RMRA 4O58L 3NIFF 5CD5D 1NCBH 4ELME 3DHJA 4G9DB 1OP5K 5FF6A 2P5ED 1FN4A 3GJFK 5KZCD 4HGKC 3MRCB 3NZ8B 3VFOA 2NR6C 4K7PL 5JXAL 4QHMB 3SKUD 4X6DB 5FGCB 2X70B 4JZJA 3NFSH 1Y0LB 3ARBB 4JY4A 5CEZL 4YPGA 8FABB 5C0RL 1GCFA 2PKDA 4H26B 4L3EB 1XGPB 3L3JA 1W2KT 4YDJB 1ZLVK 1DL7H 1MI5A 3QUMB 3D0LA 2HA1A 2L7UA 3F7VA 2Z93A 5E8EB 4BELD 4X7DC 2DWEA 2VKWA 5F21B 2RFXB 3RVVD 2Q7YA 1DBMH 1ZS8B 2P5EE 2DLFH 4X7EC 3LS4H 2Z0BA 1K85A 4WU7A 1J10A 1G9NC 4GKSB 1ZA3A 1E0OB 1KIRA 1BWMA 1OM3H 1A7RL 4ODTH 2PUQT 3VRLF 4Z6AT 2VDKH 1VFUA 3WYRA 5ECJE 4XMKH 1N4XH 3ARTA 1G7JA 4G8IA 5C0EB 4OZ4B 3BPLB 2UY6A 4MJ2A 4A6YL 5BO1H 3UZEA 3QEQD 2MTPA 1JGVH 4HPOH 3MJ7B 3CLFL 1OGAE 2H6PB 3EYSH 2HP4A 4ZMAT 3CDCA 3FB5A 4R7NB 1JHTA 5FHAL 5B38A 4C56B 3OR7A 1CL7H 1OW0A 4GBXD 4OLZH 2Q7NA 1U3HB 1S9YB 3TN0C 2ZCLL 3QUZB 1IGCL 3TBSA 4GLRI 5IV2A 4LASH 3TBTA 2CJUL 4PRIB 5DMGC 3K80A 1F6LL 1M1SA 1KNOB 2C4XA 2R0LL 3RWHB 1FIGH 1JRHI 3VFSA 4U6TA 1RZKC 3VFVA 3K8KA 1LP9B 1GGBH 4D9QD 4HF5L 5GJSL 3JWOL 4Q6IB 3IU3A 5HPMB 3MYJB 3ULUF 2ITDB 3LV3A 1HDMA 3DVNB 1KJ2H 5DWUH 1PG7W 1IVLA 2O5ZH 5TQ2L 1J1OH 3SDXE 3EYOB 1H5BA 1G7LB 3DV6A 3FHAA 3CFBA 4XCCH 2BVOA 3EDKA 4PJ9A 1RUMH 4EDXA 4S1RL 1GJIA 3ARBC 5J1AB 4U1IB 1EBPA 4MZ2A 1IM9A 3AU1B 4OZIE 3BAEH 2VZUA 5IB1A 4EXPX 3IDNB 1DLFL 5IROC 3RHWF 1LDPL 3WFEH 1XR9B 4D9QE 5AG8A 4L8DB 1P1ZB 2RCSL 4OGYH 1QBML 3U7WH 3B4NA 2AK4B 4W6WB 5FO8B 5ALCH 2IJ0C 1MIEH 3L5XH 1PX4A 4JGJA 4C55A 3SKMB 4BQ8A 1XCTA 4ODVH 4ETQB 1IJ9A 1S7XA 3ZE1F 3QEHB 3IJSA 4Y16A 4WW1B 5JW3H 5KBNC 4U33A 2V5YA 5IMLA 3BZFB 4NWTL 5CWSA 3IXAB 3MRPA 2OTWB 4GAFB 2MQ0A 3LQAL 5I8EB 1S9XB 2QHRH 2E7HA 3HAEG 1NFIB 1SVZA 3BPLC 4YHYC 3HCVA 5KG9B 4FQQB 5DRXB 4XP5H 1N0XH 4QF1A 2WAHA 2X4PA 5I1KL 1P7KB 1QOKA 5DI8B 3AM8A 4RFOH 1KPUA 3DYOA 2AXFA 5D7SH 3DX8A 1OQXA 3F6IA 4XXCC 4D0CB 2Z91A 5E56A 1AR1D 4HEME 2ICEA 4G6ML 3VXMA 1JRHL 1MJJA 3MLSH 4YHPB 3TC9A 1RIUH 3NAAL 4JM2C 3A0OA 4RQQB 2D9QB 5ICZA 4UU9A 4PFEA 2AEWA 1U3HD 1CGTA 4RFEB 5D72L 1JHKH 1RZJL 1SYVB 1CDGA 2NY1D 4D8PB 3QUZD 3RZWA 4I3GA 2PW1B 2HJLB 4L3CB 5EBMB 2Y5EA 4GG6B 2FEDC 3NFNA 2JJVA 3CFIC 4JPWL 1UKTA 4N9GB 2G9HA 3HZVB 2BNUB 4X4YB 3TNMA 2FCBA 5I76A 1WWCA 5HTSA 2ZKHH 3AS2A 3PDOB 5ESVA 2NY6B 3MO1A 4XP9H 1LO0H 3O6FD 5AEAA 4KDVA 1X5ZA 3RWJB 4KVCH 1HZHL 3KNBA 3WFDL 2YPLB 3LAFA 4Z0BH 3TCXA 1UENA 2A74B 2F53A 4POUB 5T33L 2QADD 4IRSC 3T2NH 2R0WL 3L95A 4BK5A 1CDBA 1S78C 1ZT7B 2VQUA 2EDJA 4LGRB 3D3VA 4ONGL 2NZIA 4AMKH 4ZFZB 1WISA 1A7OH 2VMFA 4R4NC 5CILH 3THMH 3BP7A 1AQKL 2BY0A 3SDDC 2B1AL 3I6KA 4JZOB 3QI9B 5EORL 5JPMB 3F6LA 1I7UB 1FG2B 4OKDA 5CINL 2A77L 1TZGL 1C1EL 2BX5A 5HDQL 4P2YA 4HFUH 3C9NA 4OD3L 2YPKA 4LLUB 3TBYA 1PAMA 4P5KB 1ZV5A 3T0WA 1KIPA 1IE5A 3H8NA 3X14A 1JF5A 2EIBA 4R4BB 3HPLB 4NFBA 1F42A 3PWUB 4FQXA 4YXHH 3REWA 4OKVB 2K3TA 5F70A 3GI8H 2AK4D 3G6AB 5E24E 1T6VN 4XCNB 2W0KA 4OLEA 1EEYB 1YECH 2OQJB 3HAEH 3QDMD 4N1EA 3UTQA 2ICWJ 1WZ1L 3CMOL 1WK0A 4UINL 5BW7C 5CIPH 4LLWA 1CLYL 4KDTA 2V6HA 5GXBB 5AYUL 2D9CA 1EEQA 1P9MC 2XRAL 4JY5H 4Z7VA 3MRRB 1UJ3A 3QNXB 4Y0GA 4WUUA 2Y6SD 5IBTH 1I1FA 2V2WA 1JWUB 1MFDH 2GEEA 2XN9E 4XPAL 3AXLA 5HHVH 2VXVL 5EPMA 3F7PC 5H2BA 4I48A 5KN5A 3HC4H 4KPHL 3EDJA 2AK4E 1C5DA 4PJGA 3LN4B 4AY0A 4ZNCD 5EUKB 5EN2B 5J6HB 1WSST 3QDME 2IC2A 1HOCA 5FDWA 1U8HB 3T3PF 1D5XA 3HFMH 2VLLA 4K3EH 4P3DB 3TJHD 2OXHA 4ZPTA 1AKJA 1GGUA 4F57L 3S34L 4KY1H 3BMVA 3FT3A 2DLIA 4FQHB 1BWWA 1IC7H 1WF5A 5JW5A 1CXLA 2FDBP 1RVFL 2NNAA 2EH7H 5I74B 3KLAA 4LLVB 1EHNA 2NY6C 3WNKA 4NJAH 5C6TL 3RPKA 3GIVB 1P84J 1FBIL 2DIAA 4M6ML 3ULUH 2X4NB 3UX9B 3ARFA 4K7PH 5EZJB 1M7DB 3RNQA 2NY2D 1H0DA 3VFWA 5FYKH 5LAXA 1XF5A 4M6OL 4LHQB 1W8NA 4LF3A 1QACA 3DXAD 1IT9H 1KF9B 2HT3C 4DWHA 4GMSH 1RK0B 3QI9C 1DQJA 3DTXA 1L9NA 1WIOA 2IQAB 5GSRA 1BJ1H 3KPSB 4TOYL 3HI1B 2YZ8A 3MRNA 1MOEA 5JORB 1FORH 5DTFB 4XCEB 3RWEB 4FQLH 4IOIB 4WV1A 1SJXA 2QQKH 3C5SB 3HLAA 4PP2A 5CFHA 1EX0A 5E2UL 1TTGA 3T0VA 2B2XL 3EDFA 3VGEA 1D5BA 1C8PA 3WL9A 3LZFH 4GRLB 4X6EB 4DTGL 2Z4QB 4LPYA 4LHUA 3VCLA 3DXAE 4XNMB 3BUTA 5DJ0A 1SHMA 3G04B 3KPLB 4N0UE 2IADA 6FABH 2XWBA 3T1FB 3CLFH 1RJLA 3E6HA 4WUKH 1FJ1A 4PTTA 4XNZB 4ZPVA 5T5NG 4H0HB 5TE6H 3MUGA 1JWMA 5KSAB 2P5EA 5GSVB 1DBAL 4MAUH 1KGCD 4PJFA 5KVDL 3MRHB 4OF0A 5E8DL 1OP9A 2XZCH 4JO2L 4HAGA 5DHYB 2HJKB 3PP4L 4ENEC 2VL4A 3CH8A 4G42A 1GZPB 1KCSL 2F15A 3RWDB 4J3VA 5JIIA 2X1OA 3VMOA 4HF5H 5IG7B 4JFOA 3HRZB 5DEFA 1G0XA 4HMEA 2ZUTA 2FIKA 1SBSL 1MQKL 1JPSL 5I8CA 2GKIA 5CEXA 1BFSA 3PDDA 1ITCA 1QVOA 5I74C 5C08B 4MNQB 1CFTB 5IFJA 1H3WM 1JI2A 3K81A 4P2CG 5I16B 4JRXD 2VXUL 3MGAA 5ESQB 5IVXE 3ILPB 2ZUYA 4DVBB 5CAYB 3VG9B 2GJJA 1YN6B 1QR1B 2GSGA 1RHHB 2CR3A 3MOQA 4JY6B 1DCLA 3VD9A 1JN6A 1F90L 3IDIA 3JBG7 5I66A 1JZ4A 1YMME 3G5XB 3DIFB 3O2WL 1VGEH 2DLGA 2VLKE 3KPQA 2LAGB 4U1SA 1KTDB 4R6UA 3BH9B 2FX9L 2RCSH 3TCLB 3D0VB 3QEQA 1NC2D 4Y5XA 4GW5B 1MHHB 1U93A 2BC4A 1CBVL 3U4AA 2FR4B 2XTJE 4GBXA 4JRXE 5KSBE 3O6LL 3SDXA 1LNUA 1Q0XL 1CWVA 4H0IA 1FNEB 3NCFB 4YIQA 3HI6L 4GRLC 2H32A 1H3PL 1OVZA 2WSKA 2VQ1B 5F7NC 4OCWL 2DLHA 4PGDB 4IIQA 5B3NA 1RK1B 4K07A 4GRLD 1F2QA 1T20B 3W0WB 4I2XB 5BMFH 4MA8L 4NP4L 4XMPL 4GLRH 3IS1X 4XVUC 1T03H 2W91A 3IYLW 4OF5A 4XNZC 2GJ6B 3VH8A 3GM0A 3LRSB 1U2CA 4NT6A 2J2ZA 5KSAC 1JRHH 4C83B 2VH5L 2QSCH 2BNQE 3M8OH 2IEPA 3WJLC 3BPOB 3TP4A 5J8OA 4HUKB 5ANMB 3IFPA 1E4KA 4YGAB 4KTDL 4N1HB 3I02B 2X4SA 1RZJH 4ZFOB 4JB9H 3C60D 4M1CC 3WN5A 2J8UF 3L3GB 4QHMA 4X6DA 1Y0LA 1OT1A 8FABA 1NSNL 3DUSB 3LHPH 1YQVL 3BO8A 5F96L 1FNHA 3UTOA 2F74B 2SEBA 3BIBX 3RIFK 4NDMB 1J12A 5C0BD 2RFXA 5DF0A 4UNVA 1T66C 2ENYA 2R0WH 3VG9C 2HFGL 1QRKA 1A1MB 3EOTL 3P0YL 4TSCL 4YWGH 4GKSA 5SWZB 1T1XB 3HZKB 5K59E 1ZLUH 3I9GH 3WFCL 1FCGA 3DVGB 32C2B 3MQIA 3INUL 1U95B 2R69L 3QZWG 3CVHA 5CINH 4OD3H 5AZ2L 3BUYB 3TIDA 4OZ4A 1R6VA 2EYTA 1CF8L 1MWAB 4PBVC 3SY0B 5I2IB 5DO2D 3FOLA 1RUAL 2A6DA 3MRLB 3NIDF 5D2LB 1ZA6B 1Q0YL 1SYSA 3FCTA 5C0BE 1ND0B 4OF3A 1XCQB 1N5YH 2H6PA 3L3KB 1PYWB 3SKOB 5BQ7B 3W9DB 3P4MA 1N7ML 5KVGL 2DF3A 3MXVH 1RD6A 1PFCA 4Z7WB 5IHLB 4ZTPL 3SQOL 1U3HA 1S9YA 4NQEE 3P9MB 1DDHB 4LAJH 5AYUH 4YE4L 3QHZH 3UXFA 3QUZA 4YAQB 2CXKA 1U36A 5IHZA 3PHQB 5I19H 3B83A 3HZMB 1F4WL 1KNOA 2GK0A 3RWHA 3W0WD 1B0GB 1ZVSB 1MCOL 4OGZA 1A64A 2FECI 4L1DA 2VXVH 5EG6C 1LP9A 1MVUA 3HS0B 1HIML 2AJVL 4NQVB 4Q6IA 1ZANL 3O6FA 3MYJA 2ITDA 3BPOC 5GGQH 4HS3A 1I4FB 3UC0L 3RGVD 3EYOA 1G7LA 3SDAC 3VXRB 3QNYB 1RHFA 4M48H 4NBZB 3EOAA 4PJIB 2F19L 2FHBA 3V6ZB 4PJ7E 4ZUUB 3E6FA 3MRQB 4Y5VC 3IDNA 3U7AA 2ADJB 1MEXH 5C6TH 3V52L 3VFTB 4M6MH 1XR9A 4L8DA 4JR9H 3QA3A 3U1SL 3V95A 2PR4L 3WIHA 3KAAA 4LSSH 1YC8A 1IZJA 2AK4A 5IKCB 5D71H 2O61A 3VGDA 3QDMA 2VZOA 1WBXA 2BOCB 1G7HB 2BXZA 4N5ED 3TBVB 4U6VH 3VXUB 1TJHH 3V4PL 4M3JA 4R96A 4B50A 5SWZD 3HMXA 5JW4M 3IXAA 5ALBL 2YXMA 3CXHK 4UNTA 1KG0B 5DRXA 4PJBF 4K94C 3W82A 2DI8A 4GS7B 3FMGH 4HLZH 5E2UH 4ISVA 4TVPH 1OAKL 1P7KA 1U2HA 3V7MA 5DI8A 3DV4B 5DGRA 5GGRY 4D0CA 3JUZA 1VEOA 2X44D 2P44B 5B38G 1QR4A 3AS1A 2E7MA 4LSDA 1A7PL 1I7ZB 3CFDB 4H1LB 2R2HB 1CLZL 4OFPA 4U0RB 5IJVA 4NZJA 2X4TA 3F12A 4LCWB 4J3OC 1NAMB 2VLJD 3SBWA 3S35L 4BZ2H 5L88L 3WE6B 5TE7H 1SYVA 4ORZC 1TLKA 3SPVB 4C57C 5B8CA 2HJLA 2AJSL 2E7BA 2GQHA 3QULB 1DBAH 2BP3A 4N9GA 5KVDH 2H9GB 5E8DH 1D6VL 4M6NL 4JO2H 2G2RB 4AJ0A 3DO7B 2ORBH 5EOQH 4HUWB 5C6PB 2BDNH 1KCSH 3DXAA 3FKUS 2WBJB 3ZHKA 2A74A 4OZGE 4YH6A 3T3MF 1SBSH 1MQKH 1JPSH 1ZT7A 2VLJE 5HPOA 4ZFZA 3VXRD 2VXSH 2B0SL 1IQWL 1OF2B 4NC1E 3ULVC 3UJJL 4JZOA 3ZO0A 1PZ5A 3MRGB 1I7UA 2VXUH 2EDTA 5DUPL 4EBQL 3DX6B 4J4PD 3TIEB 4WENB 4KUCF 4XP6H 3C8HA 5I1DB 5INCB 4R4BA 2AERT 4PJHF 5GPRA 4ZD3L 4HT1L 2BFVL 4HW6A 4MNGB 1Y6NR 2ZPKL 4OKVA 4Q97A 3BKYH 2RIKA 1CE1L 2QHLA 2FO4B 3OXSB 3GBNL 3LH2L 1HK6A 1EEYA 2OQJA 4GT7A 2FX9H 1A9BB 1YDPB 4OD2A 4UDUA 3MMEB 4MZ3A 4QYOB 3FTGB 3VXUD 2WWKT 4GS7C 3GKZA 3O6LH 1Q0XH 4CDHA 3S97C 5ADPL 1HILA 1JWUA 5I17A 4JDTH 4H88L 3U79A 4LAQL 4G6FB 4UTAH 5I1HL 4DCQB 4O51B 2F58H 3EYVB 5DD1H 3WHE0 2D7TH 1A1OA 3LN4A 3NTCL 5EN2A 3MR9B 5J6HA 1U8HA 5DDHB 2VLME 3GSNB 1RZFL 2ZUSA 2Y72A 4JFQB 1KJVA 4ZODA 1YNKH 3VXUE 3BH8B 1C5BL 4P3DA 4HHAB 4LCWD 2BSRB 4JFZH 4JFFB 4JQXC 3NFPB 1FVDB 5IK3B 4JVWA 4S11A 3U4BL 1I3GL 4FQHA 3O45A 1OAYH 3QEUA 4PRDB 1CK0L 4JRXA 4KTDH 4LLVA 1E6JH 1JPTL 1I9IL 3DLQR 3FHQA 5MEOA 4R8WL 2PO6B 3MNZB 3V8OA 4NWUL 2WBJC 1M7DA 3UDWC 2YC1A 4NCC2 4P49A 3ARDB 3DROA 1R5IB 5E2VH 2WBJD 4OIIH 5GISH 1NC2A 4TPRL 4K2UL 4HIEB 2GTZB 1IQDA 1CQYA 2IQAA 4PLJC 3EW3B 3IB4A 3TPUB 5FOBB 3QDGD 3RL2B 2UYLB 3HI1A 2E9BA 3LKOA 3EOTH 3QIBC 5IB3A 5JORA 3M17A 5DTFA 1X9QA 3RWEA 4YHNB 1EZVX 2OBGA 4IOIA 3VD5A 4UIKH 2P5WE 3QXAA 3QHFH 1F4XL 2R69H 5I1EL 1KCVH 1I8KB 3E8UL 3O3EA 4GRLA 1T83C 2LAAA 3KLDA 3OAUL 2Z4QA 5A40E 2CIIA 2AV7B 4U6HB 4U6YB 3AROA 2NY3D 2R2BB 3ZL4H 1RURH 3PUCA 3G04A 5IFAH 3KPLA 1KBGL 4DKDC 1Q0YH 3I84A 5HHNA 2B4CC 3QDGE 4XAWL 3SGKC 1VGKA 4AIZB 4ERSH 1N7MH 5KVGH 4ZDHA 4PGCA 4BFIA 3T2QA 4RMTA 4JHZA 5GSVA 4IS6A 1MREH 1HCFX 2AKRB 4YE4H 5A2IH 2V9QA 5FV1L 1F13A 4ZAKD 4DK3A 1MCLA 1AQDB 1Z9LA 2BVYA 3C60A 4PJCB 4ZO8A 1REIA 4FHBD 5T3XD 4JKKA 1S7WB 3TJEH 2XZQH 3D48R 5DHYA 1ADQA 3EFFA 4RAVB 2HJKA 2O5YH 3ZKMD 1MJ7H 5L6YL 3LPGA 5CSZB 5IVZB 1CVSC 1AGEB 5D6DC 2NMSA 3MX0A 5IG7A 5T1LB 1HIMH 2AJVH 4QHUA 2EDFA 1WBZA 3BZ4B 3FB7A 4KRPB 3BJ91 4PBXA 2ADIA 3BN9D 1J1PH 1BFOA 5C0BA 3UC0H 4OLYL 4UOJA 3N1MC 1CFTA 3PGDB 3CVIH 4HJ0D 4IRZL 2PO6C 3L1OL 5I16A 3C09B 5EC2A 5ESQA 5DK2B 1G6RA 3W39B 3ILPA 2ERJC 4DVBA 5CHNB 5T3XE 4K9EL 1YN6A 4WWKB 3Q6GL 1QR1A 3FQWB 4PB0L 1N59B 4UT6L 3ARDC 1IC4L 1OAQL 2HVKA 3QPQD 4JY6A 4YBLB 3LY6A 5I1GL 2YS4A 3QCTL 3IVKB 3CVHL 3VE0B 1BOYA 1XGRA 4LPCA 5HGDB 3DSNA 3BH9A 5CGYC 1FV1B 5DHXB 3CSPA 3AB0B 4KJPC 4NKMB 1EVTC 1WTLA 3WEXA 1Z3GL 3RNKA 5HDBE 2GHWB 2FR4A 1DEDA 4J1UA 1JYXA 4AENA 4BFBD 4X6FA 2DQUH 3V4PH 1BJ8A 1BZQK 4NO2A 3MTRA 2ZP0T 4WI7A 4BSVB 3L3IB 2KBGA 4P23C 4PGDA 4LCUB 2BRRL 3LKPA 4XHJC 3HE7B 3DRTB 5EUOB 2HKHH 4NBXB 5BV7L 1T20A 3W0WA 4I2XA 5JW4R 2EEBA 5JHLH 4GOSA 4JREC 1OAKH 2FJFA 5D7IB 5JIHA 1EK3A 1U8IA 4RFNC 2R29L 4XHJD 4FFZL 4OGAC 5IB5B 4XPGL 1TPXB 2MPAH 4PY7A 4X83A 3IKCB 5JLZA 3LRSA 3GSVA 1F58L 5C3LD 1BM3L 3NCEB 4IJ3B 2IMMA 5I8KL 1U8NB 4OGAD 3RGVA 3CZFA 4L8SC 2EXYC 5J11B 1IGYA 5ANMA 3S35H 3FQNB 1IAOA 4LVHC 2YUZA 4ZFOA 2EXYD 4NGHL 3FOMB 2BMKA 1KFAL 1B88A 2VR5A 1D5IL 4O4YL 4HIXH 4IHOB 4TVSa 4XPFL 4ZS6C 1K5NB 4KRPC 4M6NH 2OTPA 3VGBA 1KC5H 4AEHL 2EYRB 1JMXA 5J9PB 3NCCB 4KRPD 3B2VL 3B3IB 2C9AA 5DR5H 4UQ3A 3WIHL 1U8KB 5LXGL 1A1MA 4WWKC 1S7TA 5CJOH 5JUEL 3V0WL 3E0GA 2ZG1A 3ILQD 1T1XA 3MLWL 5SWZA 4AK1A 1NMCB 3H9SE 4NQCB 1YMHA 4DZ8A 1HQ4A 1U95A 1C7SA 4WWKD 3HMXL 3O11B 3JWDC 5DUPH 3CXDL 4NBYB 5F8QC 3FB8A 2R56L 5M95B 1JGLL 3BUYA 2K7PA 3AB0C 3G9AB 1PQZB 3QH3B 5KS9B 4PREB 4OV5B 1X6LA 2BFVH 5D2LA 2ZPKH 4HIHB 5J1SC 4JM2F 2IPTL 2R9HD 1XCQA 3IETB 3L3KA 1PYWA 4XRCB 3SKOA 3V6OE 1UWEL 3EFDL 4NQUA 1QSVA 2ICCA 4Z7WA 3T2OA 2VLJA 1MUJB 1RIVH 2XY1A 3OJ2C 3HE7C 1DDHA 3PIQB 4LEXL 1ZGLA 1HSAB 1PEZA 4PLKD 4HK0A 5F6IB 2AXGA 3VW3H 4ZXBC 5ADPH 3HZMA 1Q72L 1EFXB 1XH3B 1TPXC 4H88H 5T1MB 3VH8G 3P4LA 1B0GA 3GHBH 1ZVSA 4IJ3C 3CH1A 1VPOH 1XF4B 4NQVA 4FTVD 4HKJB 5HGBA 5J11C 1IEAB 4XVTL 2ZSVB 2OJEB 1I4FA 4NN7C 3ALWA 1RZFH 2BSTB 2LVCA 1MCEA 3QDJE 4LFHD 1A6ZA 5DD5H 2YR3A 4QY8A 1ZLWK 1C5BH 1LO4H 3VXRA 1KTLA 4LLAA 4TUOB 1VCAA 3U4BH 1G7PA 3GIZL 3IDMB 4PJIA 3I2CH 3FB6B 4P3CH 3V6ZA 3U9UB 4ZNEE 3MRQA 4UT9L 3LMJH 2ZUQB 1AXIB 5DFWH 5C8JB 4J4PA 3MBXH 1KCUL 1N26A 2HH0L 3VFTA 4ETYA 1JZ2A 3HMWL 4L8CA 2Q3AA 4RSVA 3U7YH 4FTVE 4Z18A 5ICXB 1J18A 4R3SA 3FO1B 3ZLQC 1J88A 4DN4L 1EFQA 4JZNB 1AH1A 3TA3B 3QPXH 4Y88A 2HRLA 4NQXA 4TSBL 4GKNB 1NMCC 1P2CB 1WCBB 4HZAA 5IEHB 1QUNA 2IPKA 1X5LA 5I1IL 5B3JF 3VXUA 3PJSB 1AO7B 4NQCD 3Q3GB 2XACC 3AFLA 3CGTA 5F88B 5EOCH 4O2CA 2WQRA 3DBXB 4P3WA 3OKOA 2DQGL 1FNGB 4NJ9L 1I3RB 4HUXB 4ONOA 1FNSH 1I7TA 2VXTL 5K9JL 1FYHB 4K3JH 1OSPL 2BHYA 4NN6C 3FZUD 1J05B 4W68A 2R2HA 5F7KC 2CR6A 1KBGH 4KKCC 1U6AH 4QKXB 2H8PA 3FQTB 4GG6F 4YC2C 4TNVK 1MCFA 5F6IC 1MFCL 4LCWA 1UQSA 4XAWH 5FIEA 3VMNA 3P0VH 5JQ6H 2Z8VC 1HHIA 2VSDA 3J7HA 1RZKH 4KKCD 4NIKB 2RHEA 1T89C 4GRWB 4HWBA 5E2JA 5F89A 5ITFA 1QRNE 5FK9B 3QULA 4D0DA 3CIQA 5F9OL 4MD4B 4LBEA 1AXSB 2H9GA 4D3CL 4N0RA 3DO7A 1XF2B 2G2RA 2R4SH 4HKZB 4CUCA 4FNLL 5FUZL 5FUOL 4GRMA 2GITA 1FAIH 3DNKA 4ZUVA 1SEBB 2YMXH 2YUXA 2WBJA 1K4CB 4HFWB 2OL3B 4JRYB 4GKOA 4OSUH 4RBPK 5CGTA 1FQ9C 5K9OB 3QUMH 1UH3A 5E0QA 3QDGA 2NY0B 4WFHD 1ZLSH 3VFGL 1H8NA 5KANI 1NBVL 5HGAA 4TUKL 2P8LB 3MRGA 3WO3B 5I9QB 3OKDA 4NUGH 2A83B 2ATPA 2D0GA 3DX6A 1I7RA 1QQDB 5IT2L 1YY9D 3Q6GH 4PB0H 4UT6H 4I0CC 3EDDA 2CLZA 1XR8A 4MNGA 2COQA 3VI3F 2WWMD 1R3KA 1WGOA 1HKLL 5D5ME 5DHVB 3P9LB 4GW4B 4DOHE 1OLLA 2FO4A 2VITA 3TA3D 3ARWA 1ACYL 4KROB 4FFVC 4PB9H 4R97B 4P99A 4P9MH 1UACH 2BVUA 1A9BA 1CE6B 1AJ7L 3MMEA 4JN1L 2AABH 2A6KB 5JMOC 4QYOA 4WFHE 2IFFL 1Z3GH 4FFVD 1Q94B 3CJJA 2AJUL 3O2DL 3QQNA 4R4FL 2APBA 4CU7A 4ZAKA 3KYOB 5FFLA 2BVTA 2BRRH 3VWKB 4Y2DC 1FVCB 2D7NA 4C58B 5CKAA 2ZCKH 3EYVA 1INEL 4KMTH 4GAGL 1ADQL 2BOBB 2R29H 3F58H 3UBXB 5C92A 3O9WB 5DDHA 4XPGH 3GSNA 5HYJB 2FNBA 1UT9A 4X4ZA 4NZDA 2XXMB 1BM3H 4ZTOL 3PNWB 4Y5YA 2F5AL 4X4XB 4JFYA 5HBBA 3NFPA 1FVDA 4U1KA 3GSUA 4E42A 2L4OA 3W5NA 4DW2L 2G5BB 3MUJA 5FEBA 3RU8L 1S8DA 3KR3L 4RGNB 1G6RL 1YYML 3B5HA 3MNZA 1AD0B 1CDHA 4LCCB 1YN7B 4XPFH 5TGBB 4LLMB 5CJXA 1C5CH 2NY0C 1I1YB 4UTBL 4ZFFB 3F8UB 5JIKA 1FYTD 2EO1A 1CIDA 2W9EL 4JRYD 4QNPF 4FQ2H 2O93L 1DBJH 3WIHH 3QT2A 5CLWA 4CU8A 2QSQA 5I9QC 4QHNB 5FOBA 1MFBL 4YXKH 2UYLA 4FABL 5C7XL 1IGFL 1ED3A 5TQ0L 2YD7A 4FG6C 1WT5C 2C1PA 2DLTA 3MLWH 3P4NA 4YHNA 3TO2B 3L5IA 1JNLH 1PG7H 3V6BR 3QUYD 3FJTA 4E0RB 3HMXH 4XPTL 3RX5A 1RUQH 2HT4C 1SQ2N 4R97C 3QB7C 2AV7A 2NY7L 3CK0L 5I15L 4M7JH 2HT4D 1FYTE 1P6AB 4KROD 4QRPE 4LQ1A 4O2EB 5DS8B 2H2SC 5FB8A 1UWEH 2JJTA 2E6QA 4BZ1L 3I3DA 5IEKB 3P40A 5BJTA 5JA9A 4G7YL 3VWKC 2QSVA 4H5SB 3UO1L 2ZUWA 4LDEB 4S0SD 1AQDA 4HUMB 3RVUC 1U8JB 3U0PB 3NH7L 1AI1L 4ZFOL 3H3KA 3IJYB 4PY8J 4RAVA 3H2WA 1RJCA 4PS4L 1K6QH 2W60A 5TF1H 5CSZA 2IG2H 5T5FL 4R0LA 5A3IC 3NOIA 2RBLA 1BQHA 3O9WD 4OZHB 1NDMA 3QWOB 2EYSB 4KK9D 1R3HB 1XGTB 2HTKC 3WLWC 5HYJD 2CLVB 4XVTH 2VISA 4X7FC 2F54E 3RWCB 5IR1B 4GSDL 5E9DB 4D9RD 4HV8A 4R9HA 2W0PA 2VL5B 4KJQD 2BZDA 1A2YB 2WIIB 4RGNC 4M62H 2XKSA 4QTHB 5DK2A 3O6ML 4P4KC 1MIML 5TDPA 3BRGC 3CLEL 4WWKA 3FQWA 4K7PX 1EEZA 5D1QB 4MXQD 1JI1A 3DMMD 2XTJC 5DSCB 1EMTL 1KCUH 3IVKA 3VDAA 4WU5A 1Y6MR 3MLUH 1ZVHA 2HG5B 3QWQB 2PYED 1CTNA 1SBBA 3V79C 1A3LL 1WFUA 1QLRB 4DN4H 3SJVE 2UV3A 4D9RE 4W4OA 5ICYA 4TSBH 2N1KA 3RWGA 3X3FH 3IXTA 1DQLL 3EYFB 1IAKB 1OTTC 4BSVA 3N06B 2QL1A 1IGMH 1T1YB 4LCUA 1OTSD 3Q1SL 3DRTA 4ZNEA 1UM4L 4BH7A 2DQGH 1CICC 3CSBA 1BF8A 5D7IA 2PYEE 1IKNA 1RJYA 1XF1A 3KYMB 1CD0A 4Z7NF 4GXUN 3IKCA 2NY4B 3WD5H 4FTVA 1TQCB 5L9DL 3WDIA 5F72S 3V5DB 2R39A 3QQ9D 3C8DA 2D0FA 5DFTA 1IGJB 3WXVH 5HYEA 3O8XB 5DRZA 2BSED 4JDVB 1JZ6A 1MFCH 5EFIA 4UQ2A 1C08A 5I0DA 5DURB 3FQNA 3GSRB 5FDYA 2VWEE 2DQEH 2BY1A 43CAB 3UPRB 5IMOA 1A6TB 2O5XH 3FOMA 5IFHH 3O0RH 2MKWA 2VDMH 4YLQT 4PD4K 1VFAB 5HHME 1AFVL 3BYYA 3SCMC 1K5NA 3LS5L 5LKNA 4J2XA 1OT2A 4KRLB 2Z35B 2Z8SA 1NGYB 4O2FB 4CGTA 3S3SA 5HVFB 4FNLH 3VFUA 1CD9B 4KKBC 5FUZH 5HYQB 4QOKB 5FUOH 4S2SB 1D3CA 1RPQA 3B3IA 3TT3L 3L5WB 2AGJL 3ZKQD 1U91A 2BHZA 1T2QL 5KANG 5M7QA 3FFDB 3MFFB 3MCLL 1G84A 1JGDA 1PKQB 3MLPA 3U83A 4JFDD 3DJ9A 3WXWL 4NQCA 1DQDH 4AQ1B 3GO1L 5C0NC 4F9PC 3MREA 4XP4H 1MHCB 3V4UH 4RGOL 2XA8H 2HFEB 3SE4A 3O11A 5D1QD 3GUTA 1QLFB 1KENL 3ZKXB 1AGBB 3K8MA 4NO3B 3EUUA 1PQZA 1ZSDB 1O5DT 4OZHE 4O02H 4OV5A 4AH2B 4ZUSA 2R1WA 3X12B 4F3FB 4C54A 1YEIL 4JQIL 4YGVB 5SWSB 4HIHA 5ACLA 2JIXB 1X7QB 1IGTB 1UM5H 3HB3C 3H0TB 3SHSA 3IETA 4XRCA 2HLFC 1D6EA 2W9DH 4KKAC 3GNMH 4X6CB 3V4VL 1AJ7H 1CQKA 4JFDE 1X5FA 4PJAF 4XT1C 4Z77B 4HS6B 1FO0B 1MUJA 2OJZL 4WFEE 1BFVL 4OZFB 1S7UA 4XNUL 5F7DB 3PIQA 4LARH 4YNYB 1HSAA 3KYAA 1K3ZA 4MJ6A 2FYYB 2DQHL 4OBRA 4IOFC 2AJUH 4R4FH 4YHOH 5HYFA 1ZT1A 3LPWA 3VGHA 4EN3D 5T1MA 5JOEA 1AP2A 5E6YA 4HWBL 1TQCC 1N2RB 4X9HA 1UWXH 3BKJL 3LEYH 4PJEE 1A4JB 1XF4A 2KZ1B 5D70L 4KK8D 1CDYA 4HJJH 2NY4D 2YK1L 3O8XC 3ZYZA 1INEH 4HKJA 5D5MA 1IEAA 1T7VA 1NCDH 2OJEA 3IDYB 1D9KB 4CVZB 1YPZF 3R4DA 4GUPB 4JFXA 5IF0B 5ID1B 2M1KA 2VDOL 1VDGA 3ULVF 3AREC 1G1YA 4JM4L 1A0QL 4LK4A 4WCYL 3EBAA 2F5AH 3U9PL 4TUOA 3MGOB 1OY3B 2BVQA 4MYWB 8CGTA 3K0WA 3IDMA 5GS2D 4MA1B 1MCDA 1IBGH 3U46A 3U9UA 2J8OA 3RU8H 2JK5B 2G75B 1IFHH 5IMMB 5BS0B 1J0YA 3SE8H 3FAXA 2CSPA 5FCSH 4QOKD 3QUXC 4LLDA 4JZNA 4MNHB 3TA3A 3VXOB 1S7SB 4GKNA 2CKBA 5HYIA 3G5VB 4CN1A 5IEHA 3W81A 3RKDC 3BP6B 5IJKC 4O5LL 1Q9LB 1MFBH 3PJSA 5F7EH 4LSQL 2E6JA 2Q8BL 3ZKXC 3Q3GA 5F88A 3T2PA 5TQ0H 4CNIB 2VKXA 5MERB 4QT5B 3RI5F 2XWJB 4M4PA 3DBXA 4NYLB 1NH6A 1NKRA 3MBED 1FNGA 4Z7OF 4NC2B 4DGIH 3CDGA 4HUXA 4UBDC 5JNYB 4U0QB 1NMAL 4UV4L 5T3XL 2HTLD 4QOKE 4I3RL 1YUHA 5SWSD 5FUCE 3RDTB 5I15H 1W0WB 3JV4B 2WM0A 1QFUL 3FQTA 1MCBA 2NYYC 1JNNL 4JFHD 1Z9OA 3GSNL 4EUPA 5F1SA 1MCWW 3GRWH 1A7BA 1IAMA 1TXKA 3TM6A 4JVUA 2V17H 5DVNA 5ACZA 3BE1L 4G7YH 3GMRB 4GG8B 2VOTA 2VXQH 3KPPA 5C0DB 4BM7A 1NMBL 4MD4A 1CGYA 5ERWA 3WIFA 5JOFA 5CD3B 3CFCL 4NC1C 4U1NA 1X4XA 2E27L 2X7LA 3IDYC 2OMNA 5E03A 4XP1H 5AWNH 3WJJC 4HK3N 4HKZA 4PS4H 4AEIH 5L0QB 1CDJA 1BECA 3H7BB 4Y7MA 5T5FH 5I1JL 3SEPA 3RAJL 3BHBB 5JOPD 1SEBA 5I0ZA 1QBBA 1D9KD 2QQLL 4HFWA 5HY9A 4JFHE 1FYTA 1QSFB 4JRYA 3PV7A 1JPGB 5D7JB 3D9AL 4MA1C 4S1SH 3PWLB 2E3VA 5K9OA 1EZVY 4Q9CA 1CGWA 4LSRL 1G7QA 3CX5J 4LSTH 1A7NL 2CPCA 5GZOC 4P2QD 2P8LA 2W65A 4L3AA 2I60H 3O6MH 3OAZK 5B4MD 2A83A 1MIMH 1QQDA 3QUYA 1U8MB 5DEGB 1SJEB 1FP5A 1CG9A 2VDNL 5BS0D 3O2VL 5E1HB 4CVWA 4NRYA 4KZEL 4BKLB 4YR6B 4HG4J 1EMTH 5CUSL 2YHGA 4JG1L 2HRPL 3P9LA 5JOPE 1GAFL 4FXGA 4FFWD 3BQUB 3WS6A 5KVEL 4QRSB 5GGSA 1A3LH 3QFDA 1MWAH 4WI8A 4HLJA 1CE6A 4HUNB 4K94H 1GYAA 4Y4KB 4Q9QL 3OZ9H 2DM4A 2ZSWA 3BPCA 4P2QE 2AI0L 3RJQB 1Q94A 3L6FB 5KW9H 1XGYL 4NNYB 5CP7B 4V2CB 4JFED 3KYOA 3RDTC 5IESL 2VABA 1FVCA 4DGYH 1UM4H 3UTTB 3TZVB 1MLBB 2CRZA 4PRPD 1G7MA 3R8QA 4K8RC 1S7RB 3U48A 5JXEC 2BOBA 2ED8A 3UBXA 3RDTD 3O9WA 4M5ZL 4LIQH 2CRMA 5HYJA 3MOAL 5FGBA 7FABH 5HHQA 3PNWA 2I9LA 3VRLE 5IHUL 3MJ8B 5IUSA 4JKLA 5IWLC 1KV3A 4GKZB 1UEYA 1J86A 2HWZH 3QRGL 4JFEE 3LEVH 3E2HB 1BF2A 5BVPH 4KI5C 1S7QA 1E28A 5L0QC 5KTEH 4Z7UE 1MFEH 3DMMA 1AD0A 1U8OB 4NKIH 4PRPE 4LCCA 3SDYH 3ULUD 1AFVH 1YN7A 5L8JB 1GGYA 3LS5H 1BIHA 3RQ3A 2WINB 4I77L 5D7JC 5E4EB 3ULVH 4F2MA 3ZKND 5FYKD 1WLHA 2PYEA 4N9OB 1I8LA 1GGTA 1I1YA 2X89D 1MRFH 1GPOH 3HNSH 3GFUA 5EU4B 5D7JD 4P9HL 4EXKA 2AGJH 5LCVL 4GO6B 4QHNA 4DVRH 5DRNA 2IMNA 2D4DA 1UVQA 4G6AD 2IAMC 1M71B 3TO2A 4AT6B 2V9RA 3NPSC 1ZHKB 4HJGA 4X4ME 3GO1H 3QSKB 4ELMF 4E0RA 4U1HA 5GS0C 3ULUE 7CGTA 3IF1B 1KENH 4BA8A 3O41B 5MI0B 3CU7A 2LU7A 4LNRB 1OPGL 1J0KA 1TITA 3K4DA 5FYKE 4QWWD 3U36A 4TTGA 2DQIH 3ZDZE 5ABDE 1R24B 1R3LA 4JHWL 3VGAB 2BERA 2CUMA 3BQUD 4JQIH 4KTEH 1BQSA 2NTSP 4X80L 3F5WB 2VAAB 4Y4KD 4O2EA 3GKWH 4PJCF 2X4OA 1O7VA 1FL3A 5FOJA 1EAJA 4H1LH 1XFPA 2Z92B 4M1DH 1BBJA 1BFVH 2M8XA 4LGPB 3TZVC 4H5SA 4N0YH 3STLB 1NAMH 2PYFB 1I85A 1U8JA 3U0PA 4OD1L 2DQHH 3B5GA 2JCCB 4MHHI 4OLVL 1CFSB 1KT2A 5E08H 3LKRA 3LN5B 3CCHB 2DICA 1TNNA 3BKJH 3MCKA 2E9IA 4FMFA 4XVJL 3SOBH 3L7FB 3V2AR 4OZHA 3BD5A 2EYSA 1R3HA 4LL9A 2YK1H 2CLVA 5GJTL 4RISH 4RCAA 3BXNB 2ZZUT 4GMTL 2CK0L 2F8XC 3RWCA 5IR1A 3BW9B 4G43B 1O7SA 3TV3L 2VL5A 3E2HC 3VXPA 2WIIA 4PUBH 2XICA 4OUOA 3HC0B 4JFDA 2YSSA 3WS3B 1HHHB 3EJYD 1LILA 5CCKL 3ARYA 4UUJB 3EHBD 1M05B 3SQBA 5E4EC 2DTML 3EJZC 4HIIB 5B22A 5D1QA 3V6FB 3CSGA 1Q9KA 5DSCA 3LKQB 3TWCH 3BVNB 1SY6A 1N8ZB 5LQBL 1XIWD 4LVOB 4PJXF 1INDL 1B3JA 4ZFGL 5EZIL 4PJEA 4G9FB 5E8OB 3EYQC 3LOWA 3WUZA 5F9JB 5IHBA 1KN4L 2EH8L 2NY5C 2DN7A 3QIUD 2DOCA 2C4FU 2CUHA 1X5YA 3BD3A 2VLRB 3I75B 4CW1B 2H2PC 5EUOF 2FB4L 3RZCD 2X42A 1OCWL 2GW5A 3STZA 3EYFA 3EO9L 5F3BB 3SDXF 4FMKA 2H2PD 5MI0C 2Q8BH 1CLOH 4NOBA 1ZKAA 4I0PB 3IDUA 4FS0A 4H8WL 3VGAC 1CXFA 4EN3A 5D7KD 2AEPL 4OZIF 4DKEH 1FZJA 3KYMA