2LU3A

Solution nmr structure of the apo-form of the beta2 carbohydrate module of amp-activated protein kinase
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
105
structure length
105
Chain Sequence
GAMGIRNSDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-AMP-activated protein kinase subunit beta-2
publication title Structure and carbohydrate binding of the beta2-subunit of AMP-activated protein kinase
rcsb
source organism Rattus norvegicus
molecule tags Sugar binding protein
total genus 8
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2012-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16561 AMPK1_CBM Glycogen recognition site of AMP-activated protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2lu3A00
4KUCD 3VFNA 3I6GA 1JZ8A 4NCC1 1FFNA 3QDJA 3ZKXB 2YA1A 3IS1X 1KXTB 5J11C 3T2NH 4HXAL 1G0XA 6FABL 4LHJB 4BH8B 2W9EH 3FB7A 5CZXD 2A77L 5TF0A 1PX4A 3P40A 1PZ5B 5A3IC 4AEFA 5F9JB 1TJHH 4S1QH 3D39B 4NWTL 4YHPA 5SWSA 1KCVH 4UINL 3T8XA 5KW9H 1LILA 1D5IL 3MRMB 1A7BA 4PJHB 5TDNA 4MXQC 2BJMH 2IALB 3S36X 3IF1A 4IOFC 4R4ND 4G8GD 5JOPD 5C0JA 4OJFL 1T0MA 4DN3H 4NN7C 1F4XL 4TNVK 3CFCH 2BHUA 2BHZA 1VEOA 3OXSA 3IFLH 3MRDA 2D3VA 1HHKA 4AEHL 3SHSA 4X4MA 3V6FA 1U8KB 1QR1A 5C07E 3RWDB 4HHAB 1HHIA 1HHIB 3QJFB 4JFHD 1YYML 1WZ1L 2XWTB 4UNTA 2QSVA 2RIKA 4TVPH 4ODTH 1PDKA 1NMCB 1G7IA 1JPGB 4OFKA 1N2RB 2VDPL 4LLDB 1F90L 3QDGA 4QXGL 1HYSD 4DVBB 5ISZE 1IGIH 1T1ZB 5EZJA 4AIZB 3QULB 5D71H 4L8SC 3K8MA 4N0RA 4NM8H 2IQAB 3V8CA 3QHZH 4WUUD 4NRXA 1MI5D 1G9NC 2O5ZL 3VFTA 2HLFD 3N50A 4EXKA 2VUOA 5E2WH 3EO9H 3IJYA 1SQ2N 4EI5B 1NCDH 4G6KH 4KK8D 5TQ2L 3ALPA 3T2PA 3VXSA 1NDGB 4JFFA 1FE8L 3X3GH 1U6AH 2NX5A 3HCVB 3MV7B 3C6SA 1CLCA 4RFEB 1MFAH 4LU5H 5JDSB 2NXYB 3ARBC 43C9A 1IM9A 1BFOB 4UZGA 5D7KD 5CZVH 5I8OL 3HZVA 5BV7H 5TDPB 3PABA 4KZEL 5D6DC 1HHJB 5SWQB 5EORH 3KPPA 4Y2DB 2P1YA 3S88L 1J1OL 5CZXC 5TFSL 4ELKA 2G75B 5JOFA 5B3JE 4QHKI 1JZ4A 1JWMB 1ZVYA 2QQNH 5GJTH 4U1HB 1FDLL 3DTXB 5DT1L 3T1FA 4ZO7A 4NOBA 4OFVA 2VMFA 5HJ3A 3OL2A 4PRBB 4R4NC 4HF5L 2GJZB 3RWCA 1JNNL 3EHBD 3PWUA 2F15A 1VGEL 4WTZA 5BMFH 1PLGL 2OXGA 1EHNA 3CZJA 4MAYA 5DWUL 2MJWA 1MLCB 4M43H 2P48B 5J06A 3L5JA 4TVPE 3DNKA 4XGZB 3O3DA 4DKAA 3IFOB 3MV8B 3MV9E 4DCQB 5C0CA 1I3UA 3ZE1F 1U8NA 4RA3A 1AC0A 4HK0B 5D2LF 2FR4A 5E03A 4D0DA 1OTUD 2IBGA 4JDZB 2ZUQB 4M5ZH 4PJXB 4OZ4A 3O8XA 1NBQA 4W6WB 3T0DA 3PIQA 5LXGL 2CDFB 3ZDXF 4QRRE 5BRZE 1UB5A 1NAMB 5F6HI 2R1WB 2KDGA 2EEDA 4TUOA 2HLFC 5IWLA 2X89A 3HE7B 1YEEL 4XCYA 1Y18B 3H3PL 5AEAA 3O41B 1AQDB 5E0QA 4NT6B 1P84J 4KK8C 2ZZUT 2EKJA 1QQDA 5I19H 4LIQH 5GS1C 3CU1A 1L7IL 2JJUA 1FYTD 4N8PA 4N8VA 4N8VB 5DK0A 4AENA 5E6YA 1P4IH 4NHUA 3KDMB 1FGVH 4FQQB 4QHNB 3TJEL 3IFNH 1IFHH 1U9KA 1IC7L 1ZHNA 1BLNA 1ZE3C 4HEME 3QDHA 4MAUL 4OCWL 1I9JH 2FLBT 3E6FB 3RVVD 3TIEB 4KUCF 5GRUL 1A14L 4TNWK 4KTYA 5E00A 5C2UB 4YFLI 2NY5L 3K80A 4QRUA 1RK0B 4TSBL 5CGTA 3ALXA 4IJ3C 2CKNA 2NY2B 3FO2B 1IT9H 1A9EA 3VDAA 5E8EB 4AIXA 1BVKB 4NKDA 4Q0XL 1RAMA 5HGHA 1RJYB 4GLRI 3BP5A 4FQ2H 4UT6L 4HT1L 3IDYC 4X0KB 3EYVB 1FVEB 4U7SA 3MX0A 4L4TE 1KJ2H 2QL1A 4PGDA 3UBXG 1GGTA 2JELH 5DHXB 4KROB 4NJ9L 4ACPA 1LGVA 4WCYH 2HLAB 3OJVC 4YE4L 3N9GH 2M1KA 3FO0L 1CFVH 3NMEA 3MO1A 3ZYJA 5EUOF 3MROB 1Q72H 3HS0A 1AGBB 1PYWA 2VAAA 5IVZA 3S5LA 3DX8B 4S1DD 1GSMA 1DANU 4M4PA 3BQUD 1JV5B 5IV2B 5JLZB 4NZUH 3IDGA 1MWAL 4XNYH 3A6OA 3T0XA 5FA4A 5DXWA 2AI0H 3QEGH 3RVTC 4X4XA 1F45A 5IHZA 3C08H 4HEPG 1IGFH 4P2OD 1KB5B 1UACH 4LQ1A 5J1AB 1KLGA 3V0VB 3AREB 4CW1A 1KIQB 2H1PH 3EYSL 3JWNC 4L8DA 3REWA 3JV4A 4MAYC 4PJDB 4HGMA 2DLIA 1S7WA 4F3FB 4OF5A 1MHPL 5IFAL 3SY0A 2QSTA 5FUCE 3QQ9D 1EAJA 3T09A 2Q8BH 4H1LH 4HQQL 1A3QA 5C0GA 3OKKB 1HHGB 1KEGH 1VPOL 3NABH 5FYKD 4YR6B 3DOSA 1ZA6B 4OB5H 1FV1B 4U1IA 3L3IA 2BNRD 1NBVL 4WHCA 3SBWA 3O8XC 2AJSL 4GQ9H 4C4KT 3DSFL 5T1LD 1R3KA 4PJFA 1CGSL 3TVMB 5EIIB 4OFPA 5EIIA 3RVVC 5DMJB 4JO2L 4FQCL 2NW3A 4QXTB 1FPTL 5GGVY 5IB3B 1T21A 5F71A 1J87A 2ED7A 1IL1B 4PG2C 1NANI 2OS7A 3BZEB 3PGDA 2BOBB 1BP3B 2WWMC 4M3KB 3M07A 3GI8H 4ZFFA 2F8XC 2UZXB 3AB0B 1A5FH 3DV6A 3LIZL 1DQMH 4G7YH 3VI4F 4CAGA 4DQOH 3CMOL 3QIWD 3CFDA 4X80L 1QOKA 5T1DL 3V6BR 4MNGE 5CD5D 1ZT7A 1TCMA 1ZANH 4GO6B 1S7VB 4LLYB 3SDXB 3CH8A 4DGYL 4HUVB 2C1PA 3O45B 4Y16D 1FN4A 1GH7A 5E9DB 3N1FC 3TO2B 1FVCB 4JY6A 3OKDB 5CILH 2EH7H 3PE9A 5DJ6B 4DVRH 2HJLA 4JKMA 3CIQA 1MFBH 1XF3A 1UB6A 3N1GC 4FQXD 1CTNA 1MNUL 4N68A 2RFXA 1NEUA 4YX2L 4CVXB 4YBQD 4DKFH 3VXTA 3C60D 5D96C 1WICA 2J1KA 5GGVL 3FRUA 3FRUB 2R1XA 2GHWB 1MAML 3MRPA 4GW5B 5FDYA 3GSXA 5I8CA 3BIKB 3BQUC 4UT7L 1U92A 4YUEL 5FKAA 1DFBH 3RVWC 4LLUA 4I3RH 2VWEC 5ICXB 1JMXA 5ERWA 1CICA 1G6RH 1HH9A 3RX8A 4H88H 4MD5B 5LCVH 4XMKL 4F7MB 1D9KD 5FYKL 2FEEL 2D4FA 4P2OC 2X4NB 1EERB 1ZT1A 3NVQA 1K4DB 1JRHI 4OFYA 4U6XA 3T4AA 4BKLA 4PGZA 1FORH 3QUMB 3QUZB 2A6KA 5KSAB 1D5MA 1OAYH 5KVFH 1IGMH 1ZV5A 2XNAB 1FIGH 1S9YB 3G08A 5HY9A 3QCTH 5DQJB 3QQNA 5E24E 3BSZH 4C59B 3DYOA 5KTEH 3QIUA 5GISH 3CXHK 4WFGE 1NC2A 1RUQH 5DJZA 2VABA 5JA9A 4OZGB 3C5JB 3BW9B 1M7IA 4ISVB 1BEYH 1JL8A 5HHOB 4BFBD 4V2CB 1URLA 3N1PC 2BVTA 3QEQA 5IBTH 5T1KB 3UPAA 1J5OH 4U1GC 3H9SB 3HI5L 4LLVB 1DL7H 1J05B 3O6LL 3U79A 4MCZB 3VH8G 3U9PL 1D6VH 1UM4H 2NY4B 5EOTB 4Y89A 2RB8A 3QXDB 1UKQA 1JGVH 4KI5E 4QHUB 2LU7A 4Y16C 1JWUA 4IIQA 1SEQL 5IBLC 2P8MA 3ORJA 5AD0B 3SBWC 4KHXL 1NCTA 2AW2A 4XC3H 1JGLH 4FQXC 4ZUVB 1A7NL 1MCCA 5KG9B 4YBQC 1QVOA 4WW2F 4C55A 2F19L 2IAND 3QPXL 4CU7A 3QISA 5DS8A 1DN0A 4EQ3A 1BZ9A 2AJXL 2CUMA 2LFGA 2ZCHH 1S3KL 5CIPA 5J6HB 3KPSB 3KPNA 4H8WL 4Y88A 4NZTH 1NDMA 1RMFH 5F1KC 2DI8A 1QRNB 4YLQT 3DECA 3D3VA 1JUFB 3IXTA 5ILTH 1CD1A 4ODVH 4JPWH 4NUJB 3D6GA 4NZDA 3GMQB 3U0TA 1D9KC 4D9RD 3GIVA 4P9ML 4QT5A 1M71B 3SJVE 5HYJD 1C16B 1VGKA 1VGKB 2GI7A 4YIQB 3MRHB 1YDPA 3K1DA 4OLYH 5KS9A 3GM8A 5D7IE 2H32B 4FFZL 2EXWD 1OPGL 1TTFA 4BZ2L 1LMKA 3WFHB 3E8UL 1NEZA 4GMTL 4KY1L 3KLAB 3MODL 4MNHB 1Z0MA 5AAMA 4HWBH 4HKJB 4YHOH 1CLOL 2Z91A 1P7QD 1X5YA 5IBUG 4P3CH 1E4XL 1OLLA 4J3TA 5FDWB 3ZE0E 4NGHH 5DJYA 2C5DC 1LO3H 1ZA3B 2OBGA 3NCYP 2A6DB 2FX7L 5D1ZD 1DUYB 1TETH 4N0UA 2WQ8A 1EEZA 4XP1H 1CGYA 1Z3GH 2ED8A 3WDIA 1BJ1J 3E1F1 1J8HD 5D1QA 4EDWH 4P59L 2V2XB 3S8WA 5I18L 3O9WD 5IEHB 2UUDH 3LMJL 1MCPL 1JN6B 4Y1AB 3CGTA 4XB8A 3U4BH 3UPRA 3LKNA 1MCKA 3DVGA 2D7PA 3WBDA 5HYIA 4LSRL 4X6CE 4OCRH 3QUXA 4TTDC 3O3AA 3RPKA 3VG0L 1KIRA 2ZUTA 3LN9A 2BRRL 2NY0D 1XZ0A 1MQKH 3L3DB 1Z6JT 3IETB 2D9QB 3MRBB 3QNYA 1HSBB 4K8RD 2YZ1A 3VXUA 2OXHA 4ZYKB 3K3QA 2CKBH 1QSEE 1WISA 2CK2A 1ZTXH 1UH4A 4JFXA 3CSYA 3GSRA 4JM2B 3OBAA 4OFDA 1G1YA 2VLRE 3DLQR 2X4UA 1L6ZA 5HI4C 15C8L 2F8VA 1C5BH 5I1EL 3QUYB 4MXWL 3T3PF 4CN6A 1QBMH 5IIEA 4WI8A 1AH1A 3AY4A 3WN5A 3ZTNL 1H3PH 3T0EE 2BNQE 2AQ2A 5B38B 4JB9H 5HGDA 5INCB 1YNTB 3FFCA 1E6OL 4PJCB 4V1DA 3OKOA 3LEXB 4L8BB 4NFCA 4F7TB 3QO1A 1UVQB 3JTTA 1F3DH 2FECI 4JHWH 1KUMA 2CLRA 2HTLD 3ARDB 2HJKA 5CJOL 3KWWA 4X6FA 3RY4A 4JFQB 4PTUB 3LKRB 1CGWA 3D18B 1AD9B 2BSSA 3EO1B 4MHHI 4CL7A 1Q9KA 4HAFA 3BD3A 2FD6H 4ENEC 4PJEA 5JW3L 4RAVA 3SO3C 3BEVA 2YD7A 4NC2B 2E9IA 3VW3L 4N0YL 4KHTL 3CVHL 5L7XH 5F7LB 5DMGC 5E8PB 5I1IH 5HYQB 2NXZD 3OV6A 1SVCP 5DD1H 4P2RE 4AL8L 5JHLL 1ULVA 1AI1H 1V05A 2HT4D 3RTQA 4LCIL 1EXUB 2Z35B 2A6JA 4UDUB 4XVUC 2Z4QA 5KSBE 2PW2A 2YD9A 1MCFA 3TH2T 2CGRL 2Y7QB 4K8RL 3O9WC 4LK4A 2DJUA 2GTZA 4X8XA 3O6MH 3Q48A 4FTVD 1JK8A 3PWPA 4NN5C 5TF1H 5D7SL 4NQXA 1YQVH 3GHBH 3OJ2C 2OK0L 3HAEH 4XX1G 3I3DA 3HNVH 4OGYL 3ULUD 4HS3B 5ADPH 4K3EH 1J8KA 2DQHL 4QXGH 1TZHB 4KWUA 2AJ3A 4GUPA 3WV0A 2XN9D 3L6FB 4I5BA 4W81A 4JHAH 1VDGA 4IMKA 5F72S 2R56H 2AERT 4Y5YB 1WCBB 3D1MC 5C0BD 2YPVL 4ZOCA 5T5FL 5I73B 1CK0L 4LEXH 5JZ7C 1A2YB 5KVMC 1SBSH 5FXCH 2Q7YB 3QEHA 1EFXB 3KS0J 1JNLH 5IGXH 1I1FA 2DBLH 5MEOA 1NFDF 4PRPD 4PRIB 4OUOA 1N3NB 5L8KB 1SYVB 3J8F7 4X5LA 2BSTA 4WHTB 4ZODA 1N8ZB 1ZK9A 1CXFA 2ICEB 2IBZY 3UMTA 3MNZA 2I07B 4B53A 4E41A 2GCYB 2WP3O 3PV7A 3NCFB 25C8L 1J1OH 1HCVA 1IQDB 3KAAA 1U8HB 1UWEH 3SKOA 3GBLA 4YDLC 4G9FD 3B5GA 5CSGA 3NZ8B 3W39A 4OGAD 5GHWL 4JRYB 5BO1L 4YEFA 1MCRA 2YPLD 1FNFA 1J18A 3OJDB 3OF6A 4FFWD 5SX4H 3JVGA 1V5JA 4J6RL 3WIHA 1MRCH 3AY4C 4YHKH 4M6OL 4JRXD 4OLVL 3ULUL 1B2WL 2V5YA 3FRPG 3GJFB 1SM3H 5ACLA 5F9WB 3LRGA 2B0SL 3JWOC 4HIIA 1QFPA 4AH2A 2R4RL 3HNTL 1JWSA 5LBSH 3I6KA 2L0DA 2YD3A 3NGBC 4HIJA 4X6DA 5EBWA 1A0QH 2ZOKB 5DHYA 1RV6X 5ID1B 4HC1L 3M45A 5FUZL 3QZWA 5KS9F 3T0VA 1JPTL 4XNQA 1EK3A 3QFDA 5MHSE 1I1AA 5CEZH 5IB1A 1Q9LA 4Z7VB 3BP7B 5DGQA 2YUZA 3TT1L 2DD8L 4MNQB 2P5WE 4MJ6A 3QB7C 4KGLA 1U58B 43CAB 4JFDB 3BDXA 1M05A 2A74A 4AYFA 3FQRB 4FRWA 4RISH 2FJHB 3LDBB 3RTQC 3B6SB 3UO1L 1WZLA 2MHAB 4MJ5B 1YEEH 4ZNEE 3AVEA 3PGFL 5I66B 1MAKA 5DJXB 2X4RB 4Y4FB 1MPAL 4DOHB 1RZJL 4MD4B 3QXAB 5LQBH 3KYKH 2G5BA 4QOKE 5CMAB 2VDMH 1L7IH 3SCMD 1A7OL 2B8OT 2V7HB 3MRJB 1EAPA 2WUBL 4GG8A 2EIZB 1FO0B 5E2TL 2OCFD 3B9KD 3MRCA 4LOUC 1KTLA 3D9AH 3MA7B 1D6EA 4X7EC 2X1OA 1J1XH 4I9WD 5C09D 3IDXL 1QFWL 4NP4L 4XVJH 5DURD 3VFWA 3MACH 5FM8A 1DQLH 4BK4A 4IHOB 3K4AA 4X9FA 4XBGB 2WWKO 5FK9B 1BPVA 3K74B 1B0WA 5I1AA 1KULA 4F7PB 1TQBC 5FO7A 1R5IB 1HDMB 4I0PA 4CMHC 1T5XB 3U36B 2PTVA 3QYCA 2NZIA 4X6BA 4R8WH 4HD9A 4X99B 4F57H 3BZFB 3JXAA 2VR4A 2CUHA 3DV4A 5C07A 1DBKL 2ZCLH 4XCCL 2QKIB 3F6IA 3IRZA 3GZKA 5BVJB 2PN5A 3GKWL 4CJ1A 4M7KH 3STLB 2P49B 2D31A 2GT9A 1E28A 1RIVL 3AMLA 3GSUB 4QY8B 3W0WE 4YE4H 4JPVH 4P0DA 1KPUB 4POZD 5ISZA 5GXBB 4LVNB 2AV7A 3WLBB 3TBTA 4X5WA 5CEZE 12E8H 4NRYA 3BEWB 3IAPA 5HHVL 3FQXB 3O4LD 3KJ6H 3Q0HA 1LDPH 2OJEA 5E1AA 4NC1E 4ZAKD 5GGSB 3WO4B 1QP1A 2HAZA 1KIPB 1OAZH 2FL5B 5K93A 4EOWL 4OLXH 2EDEA 3JVGC 1RULL 4KVNL 2DM3A 4ERSL 3ULUF 4YAQB 3L95A 1CZ8H 1IKFH 2FSEB 3GO1L 4MVBC 2G9HA 2X9WA 3T0BA 1RU9L 3P0GB 4AG4L 1DVFB 4WTWA 5AYUH 5GS3A 4WY7L 3QFJD 2FEDD 2P24A 3S9DB 2Z31A 3LVEA 4OZFH 1OP3H 4NQDE 1YN7B 1KF9B 3SCMC 3BT2H 5JO5B 3GNML 1I1AC 4GW1A 3O0RH 1QSFE 2LTQB 3OG4B 1CT8B 1U8JA 4Y5XA 1FL3B 2V5RA 3QWOA 5I71B 4NQTA 3L3JB 5GS2D 4KMQA 2Y25A 4A2MA 1MRFH 2YBRA 5GGRB 4NNXA 3EUUA 3HLAB 4YGAB 5JHDE 4ZUUB 5IHLB 1XR8A 2R4SL 4ZTPL 1QLFB 1CQYA 2VXUH 1QNZL 4CN1A 2W65B 1FLRH 3VI3E 2BCKB 4H20H 4OM0L 4BSVA 1DDHB 4GBXD 1QPPA 2GEEA 1FJ1B 3FO9A 5DQDH 3BE1L 1VKXA 4L3CA 1LWRA 3SKNA 3LKOB 4LLQA 4JR9L 4MZ2A 3D87B 2ZUVA 3MV9A 3D85A 4MMXC 3HR5A 5C9KA 1X5LA 4DAGH 4BQCA 1VSCA 35C8H 3B9DA 1DBBL 4RMWA 1IGTA 4ZD3L 3UTTE 4NQCE 1T22A 3E2HC 3V5DB 1BZQK 2NY7H 3Q5TA 2FGZA 2PYED 2YC1A 4POZC 2FNBA 1A22B 5SWZB 5SX5H 3MLRH 1MAMH 1C12B 4NO0D 4P46B 5T3XD 4XC1L 3SDDD 4QRRA 5BRZA 4UT7H 2FX8H 4YUEH 1KPVA 4RAUA 1I7TB 5K9OB 1RUKH 2DM2A 3JV6B 2CRIA 2Z8RA 4LSQL 3OAUL 1T1YA 5C0EB 4P3DA 3FHAA 5TE7H 1N5YH 3A6BL 1GIGH 5H35A 2WIMA 4RFNC 4M6NL 4PRDA 5FM5M 1RUPH 2P5ED 1UFUA 2DYPB 4X98B 1H3VA 3KXFB 1A7QL 2AK1H 4HFWA 3UJJL 1V3MA 2YXMA 1X5KA 4JZJC 2XY2A 2R0KL 2YN5A 1Q9WA 4EEEA 1IRAY 2FEDC 1YMHB 2APXA 3MZTA 4P23A 4F58L 1EGJL 3SE9H 1T89A 5DD0H 2XWBA 4MD0A 1YEFL 3VGDA 3VXOB 3RAJL 3C5SA 1RFDH 1Q0YL 4J8RB 3RL1B 4JDVB 1MCHA 1S8DA 5ITFB 4U1KA 3HUJE 4ZUWA 1YEDB 1IJ9A 4LRIA 3RNQB 2QQKL 3T4YA 3QP3A 1AP2A 4WHDA 2WZPD 1WIPA 1AO7D 1YNKH 1FC2D 4L4TA 4LCWE 4JPIB 2VZTA 3GDBA 3IDNB 2FO1A 1CI5A 2BFVH 1MJ8H 4PJAE 3DRQA 3QG6B 3HE6A 4PV8B 1P4BH 4YNYA 3SDAA 2LAAA 4YZFE 5DJDB 2ARJQ 1G9ML 2Z31C 2EDTA 5T3XL 4R90H 2WBKA 2NYYD 5JW4R 4LCUB 4XPAL 1CYGA 3IDIB 4JREC 4JG1H 4PUBL 1ORQB 1TZGL 1XIWD 4U1JA 3EOTH 4QCIB 1UZ8B 1E6JH 4KDVA 3S3SA 1AHWB 1JYVA 2I24N 4Q2ZB 3D0LA 4KHXH 2XZCL 4S10A 4KPHH 1F8TL 3MLVL 4UNVA 4JFZH 3V7MA 2N1KA 1FZOA 1DUZB 3BPNB 1U8IA 1T0PB 5H37G 2FHFA 4GRLD 4MA7L 4R4BA 5FYJD 2I9LB 3SDDC 5AAWA 5FOJA 5E5MA 3MMEB 2HKFH 3U6RA 3WL9A 2O61A 1OF2A 2V2WB 3ROLA 1RHHB 2CXKA 4DWHA 1X5HA 1LK2A 3CUPA 1U8LA 1A6VL 4JAMB 4M7LL 2AXFB 4PJ9A 4OZIA 3PHSA 5D7LB 5I1HL 2UWEB 4NKMB 5C08A 5CBEA 4M02A 4N0FB 2CDEB 1KJ3L 1DANT 1I75A 1T3FA 3D39D 1KCRL 4HCRH 3QAZB 5H37H 2NTFB 1FGNL 1YEIL 4ZPVA 5EN2B 4LHUA 2ADIB 3QWQB 3MBEA 2I60L 3Q5YA 1QFUH 4OUUA 4I2XB 4I3SH 2AV1B 3VRIA 2H41A 3GK8L 4W70A 1CGTA 5ABDE 4MA1C 3H9ZA 2ZPKL 3FAXA 1K4CB 4WO4A 4BH7B 5L6YL 4N1EA 5E8OB 1IE5A 3WUWG 1RJZB 3MTRA 5KOVC 2XRAL 1NGZA 3I9GL 4RMSA 3ILPB 5BQ7A 3EFDL 3BWAA 4AMKH 1P2CA 3ROOB 1KJ2B 2O5XL 4PRNA 1S5IL 4MNGA 1MIML 2FX7H 1ZWIA 3TLRA 3WD5H 4P5MB 2XIDA 4G80A 4QTHA 5L2KB 1PSKL 1HZHH 3U46B 2HH0L 1LD9A 3MV01 1N59A 5GRJH 2DQEL 2VDLH 3UYOD 3MGAA 4OQ1A 1NSNH 4PJGB 1MCPH 1NC4B 2GJJA 5FYJL 3NAAL 2NYYC 1JFQH 3TBWA 1T89C 4YHMH 5EIVA 1E4WL 3D25A 2X40A 4L3EB 2EE6A 3A6CH 4WWKA 1A6WL 1GC1L 3R1GH 1JTPA 1AGFA 3UBXB 3VGFA 4W4OA 4EI5D 1FAIH 4UILL 2DIAA 3KLHC 3ARFA 1Q1JH 3GMRA 3U7WH 2M8XA 3RY6C 1FLTX 1QA9A 5FB8B 1RZGA 2JJTA 1ZLVK 1F2XK 3U2SB 3RWEA 3MV7D 5J8OA 1F3JB 5FHBH 2EYSA 1K5NB 4I3GA 1MEXL 4OLZL 3RI5F 3U48A 2LABA 2NXYD 1KLFA 4RFOL 2A38A 3HE6C 3NACL 3SDAC 3IJSA 1DR9A 3OKLB 2ADFH 4HFUH 1KTDB 4OV5B 4U7KA 1T66D 3SDYH 5BVPL 5I1EH 4GRWH 1K6QH 1H15A 3X11B 3GI9L 4H1LA 1WT5A 1EO8L 3FKUS 3MJ9H 4Y2DD 2J12B 4L29B 1EUUA 3FT4B 2JCCB 4F37F 5DZNA 5B8CA 5JORA 2HJFB 3DUUA 2R39A 3VXME 1E4KC 4ORGA 4TSCH 4HJGB 2AEIT 4XWGH 3VMNA 3MOQA 1XF5B 3MLXH 4FZ8H 1B0RB 3UTSE 4APQA 3S98A 3PQYB 2ADJA 3FJTA 1RY7B 5KVEH 4JDTH 3G6DH 2XZQH 5EU7C 5CLTA 5DJAB 5E95B 1FZJA 2UY6A 4WRLA 1N64H 2VLJB 3ZT7A 4UOJA 1NGXB 3FOLB 5DJ8A 5FUCC 1OCWH 4EUPH 2DWEA 1KOAA 4OT1L 3O4OC 5HGGS 4HKZB 5FECA 2YRZA 2ZSVA 3MV8D 5JHLH 2YEZA 3CFBB 2VDOL 4HGWA 4FFYL 1NMCC 1U2HA 5EOQL 3H7LA 2F54E 4ODHH 1BZ7A 2Q86A 2YWZA 4UV4H 4PJ7E 2QQLL 3MBEC 4WDIB 3BJLA 2R8SL 1CR9L 5IB2A 1BJ8A 4KU1A 3L7EB 5I1KH 2R29H 4A6YA 3LN5A 4NO5A 4JHBA 1U8MA 2NMSA 5JNYA 4KMTL 3HE7D 2FBJH 5CS7A 1KN2H 1OGAE 4O2CA 4DGVL 1G6RB 4EI5C 1AIFB 3V6OC 1IGJB 3ZMRA 4G5ZL 3QWRD 2JB6B 5ESAB 1OD9A 2E5EA 3X17A 1BQHG 4XZUB 4LSPH 3KVQA 1A7RL 1P84K 2RBLA 3G6JA 4G43B 3SJVA 5CEXA 2XZAL 3V2AR 2OLDA 1AGEB 3JZ7A 2PXYA 4G3YL 1BREA 1J10A 1IEHA 2NXYC 5ITBL 4XCFL 4GRWE 4I1NB 4KMLB 5AZ2L 3QA3A 5D7IA 3L9RA 4LLMB 3ZDYF 3WFBL 1NKOA 3S35X 1PJ9A 4OZHE 2MOVA 3R06B 2R0ZH 5C0DB 4HZLB 4QHKJ 7FABL 4LEOB 4OF7A 4W4OC 2NY2D 4B7LA 2NR6D 3EOBB 5IT2L 3ARFC 4P99A 2G60H 2JJTC 4OIAA 5SX4I 3VXRB 3JWDH 1NBZA 4PJ5B 4XPTL 2EDBA 25C8H 4H26B 4N5ED 5DI8B 5K59E 1MJUH 5JQHC 1XGUA 4PJHF 4KROD 2PR4L 4XXDA 1NCBL 3NFPB 3EGSB 5GHWH 4RGMB 4AM0B 4HBCL 1CVRA 3KJ4C 1WT5C 3H7BB 3VXQB 4ETQA 5TJWK 3BP4A 1LO0L 4QHMB 2VDRL 2JB5H 5HGBA 4XP9H 2DF3A 4PR5B 4YGVA 3UJIH 5B8CC 3BRGC 3P4LA 3O2WL 1M6OA 4OD1L 5IW6A 4X6CA 4Z7WE 3FQUA 2V9RA 2B0SH 3DVNB 4QWWC 2G2RB 1MCQA 4WUKH 3SQOL 3U83A 1PQZA 3UDWC 3CDGA 1WTLA 5CSZB 4APQC 2IC2A 4S1RL 5IVXE 3OAZH 3JTSB 2F5AH 3FT3A 2VTFA 4Z7UE 1QSEA 4FXGB 4D3CL 3ARED 2DD8H 2BVQA 2XTJC 3UTZB 5A2FA 4M03A 2AK4E 3F12B 4Y2OA 4Q97A 1NMAL 2VLRA 2Z8VC 3CCHA 1A6UH 3MYJA 2LAGB 1P7KB 2FB4H 4I48B 3W9DA 3ARUA 5CP3A 3K2UH 1ZEAL 2R0WL 2HFGL 5MENB 2BNQA 3T0EA 1MUJA 1V7NH 4U2YA 5D93B 2YMXH 1RUAH 3FQTA 4PREB 2VZ3A 4JPKL 4GXUM 1JF5A 5DJ2B 3DPBA 3WFEH 5FO9B 1JCKA 1OB1A 4I18A 3TVMD 1RQ5A 1GGCL 2B39A 2GUOA 5FM4A 2GUOB 1KG0A 3BXNA 2VSCA 5EU6B 3VRJA 5E2TH 3G04B 5D6CA 1UC6A 1UM5H 4MCYB 3P0VL 4IRSA 4U1SA 4X7DC 2PW1A 4IRSB 1DEEA 4ELME 2SEBA 4NNYB 1DP0A 5ICYB 4HIEA 5DK2A 3RKPA 1N6VA 1A1MA 4PJBE 2XQBL 1G7PB 3RUGE 3RBSA 3V95A 3P4OA 4IM8A 5F1IB 4P2RA 2IH3B 4JGMA 4GMSL 5E9DD 4LLAA 2DQCH 3P30L 4CNIB 5KSBA 3TZVA 1KJMB 4WU5B 1NUNB 5AUMA 5E99H 5IBUB 2BDNH 5EO1B 2PUQT 3MNWB 5HDQL 4PRHB 3THMH 2ADGB 1XCTB 5TDOA 3MA9H 1IQWL 3H0TB 1RIVH 3R4DA 3OKEB 3CK0L 1FBIL 4UV7L 1KGCE 3I02A 3EOYG 1WC7A 2V7NB 3PP3H 1HXYA 4S11A 4LMQE 5CHNA 3HZYA 4FABH 4K23L 5CUSH 1XGRA 2CKBB 5HHVH 1KLUB 2IF7A 4UTAL 4PJXF 1TFHA 1NUDA 3B5TA 3NCBB 4H5SA 4MS8D 4QO1A 3GBML 4XPHH 1QLRA 2QR0A 1G7LA 5HHMB 4PLKC 3AREC 4RRPA 2FZ3A 1OGTB 4ODBD 4M7ZB 4X7TA 3D2UB 1HEZA 1P9MC 3QUZD 5I1GH 5KSAD 3TWCH 1RULH 4U1NA 5ETUB 2CIKA 1ACYL 1KT2A 3MXWH 1CE6A 4ONGL 3WHXA 1LEGB 3C6LA 3VFSA 1EH9A 3F5WB 3UC0H 4Z77A 2J3SA 3QRGL 5B39G 1QFHA 3OHXB 4YHIA 4L4VE 3EYQC 2BMKB 5I30L 4LGPB 1UH2A 2H45A 3G5XA 1U3YA 4RQQA 2OZ4H 3I6LE 1CDGA 4TTGA 1FFOB 4JQIH 3T3ME 4JO1H 1WSST 3L1OH 3GGWA 1BVLB 5HHOD 5K33A 3VCLB 5HD8C 1CN4A 3RVUD 3NCEB 3VU2A 5T1KD 3H9SD 4FG6C 5E5UB 1YMME 2A9NH 1CGUA 1IC5H 4PJIE 3KPRB 4Y5VA 2MQ0A 4OLWH 3AB0C 4GRMB 5A43C 2DTML 2NY4D 5FUOH 4EBQH 4RZCA 3DI3B 3F7YB 5IMKA 1HN1A 4M9PA 5DQ9A 4EVNA 2L7JA 3ZKNC 3G6JF 3KG5A 1X5XA 1OARL 3DXAE 4KTDL 1FNEB 3FQWA 1JNHA 1XT5A 3RIAK 5E08H 4KRPB 1EVTC 3U4AA 1S9WA 2A9MH 3BN9D 5EBLA 3MXVH 4HKXA 3HAEB 3EDDA 1Z5LA 1ZLSH 4LGSB 3QUML 3KPSD 1LO2H 4Z8FH 3BKYL 3QH3A 1OSZA 2FDBP 1QRND 3BX7C 5GSVB 2P5WB 1T20A 3FHQA 1C1EH 3KYNB 1FRGL 1FYHB 5D2NB 3U9UB 3CDFA 3RDTB 4JKPH 3PL6A 3TNMB 4XC1H 4LKXB 2BY0A 3TZVC 4ZNEA 2F53E 5TE6L 3DGGA 3QQ3A 5GJSH 4WI2A 5LWYL 4EN3B 5IF0A 3QUZC 4NFBA 5HHPA 1ZHBA 4QXWA 2WV3A 3VWJB 4QOKB 5C0AE 3QIBA 4HK3J 2R2EB 1LE5B 4PJDF 2QBWA 4YDVA 2E6PA 5EFIB 4F7CB 1MY5A 3RGVB 3U0WH 5F3BB 3MCG1 3NFSL 4QRQA 4NDMB 4TUJA 5T3ZD 3BKMH 4MLSA 4ONFH 4TYUA 4ZUSB 1IM3A 4PYHA 1PVHA 4NO3B 4BZ1L 4JN1L 3O2DL 1GGYA 3IU4H 3S34H 1ZMYA 3RVUC 3CH1A 4ZS7L 2EKSA 5IEKB 4HS8H 1OTTD 5DUBA 4GAFB 1AQKH 3L5XL 2Y07H 4IMLB 4FHBD 4Y1AD 4JZOA 1N6QH 1MFCH 2OTPA 5DMKA 2QTEA 3GRWH 4GS7C 2DQUL 5J57B 5GS0L 3O3EA 2HKHL 5CEYA 2HG5B 3P77B 1I85A 1S9VA 1R3IH 3W0WA 2CR6A 1MVFA 4H25B 4NOFA 1HQ4B 3SDXF 4ZXBA 4C4KO 1GYAA 3LOWA 5J4MA 1T4KB 4O4YH 1NCWH 2B7DT 3U0PB 1RVFH 5T33L 2E9JA 3BD4A 3BN9C 4NQEB 3Q3GA 1S7XB 2DQIH 2AJYH 1MLBB 4N8CL 4JM2D 3MUGB 4HUKB 3RZCA 4Y5VC 1XGYL 4OIBA 5EZIH 4Z5RA 4ZOBA 4HK3N 1E27B 5E7BA 1R5VB 3PWNB 4OD3H 3QUYD 2C9AA 4K7PY 1CL7I 4X5XA 4MA7H 4JZNB 5EZOH 2DIJA 1T0NA 3NFNB 4ZOEA 2ICWI 2X70A 4IBLT 3I3BA 5DRZB 4XH2A 2DRUA 3KPMA 3REVB 3AFLA 1MF2H 4A2LA 3ARDD 4XHJC 1G9NH 3EYOB 3ULSB 5D9SA 3GMNB 1RJCA 1BAFL 4NQDA 2ESVB 4PY7A 3MPCA 3PNWB 4TVSa 3OGCB 1QSFA 1VESA 5EG6C 5BXFB 5DHVH 3TNNA 3P11H 1DE4B 3AS2A 1XF2B 1QO3A 1I9IL 4K7PL 3GK8H 3VXNB 3SOBH 1DLHB 4GFTB 4BK5A 4MDJB 1N4XH 4Q9QL 2ZPKH 5EU4A 5JHDB 3CFJB 3PL6C 2HMIC 4QF1A 1EEYA 1KN4H 3ULVD 5GGUA 3SPVB 3H6JA 3U1SH 4OZGF 5F96L 5FM5O 1B4JL 4M61B 1BD2B 1MH5B 1ORSB 4YXKH 1OTTC 5CJQL 1A3RL 3VFMA 3QIBC 4LF3B 4IS6A 4R26L 3VDBA 4QRPB 2X1XR 1GRWA 4ZFOB 4XNXL 4F15B 3QEUB 2Q76A 4KJYB 6CGTA 2IFFL 3OB0K 4NYLA 1AXSA 3AXLB 1YECL 3HPLA 4LFHD 4NQCA 3UTTB 1ND0A 3GSNH 1ADQL 2D7TL 3C5ZA 5EOCJ 3ZE1E 2FIRT 1J0JA 1F4WH 3GJEB 1A6TB 1LDSA 4XNUL 4JM2C 1AGCA 4CUCA 3SGJA 3SE4A 4OGXL 2OL3A 5I0DA 3HFMH 3MLZH 4XMPL 3FT2B 3BHBA 4HKBB 1EFXD 1EHLL 1DBAH 2XPGB 3TIDB 2J6EA 1VFBA 3ZDXE 1T7WA 2FJFB 1LE9A 3TH4T 4JJ5A 4LASH 4PRID 5KJRH 2GK0B 1K8IA 2D03L 4EZMA 1I85C 3BO8B 3NACH 1RJLB 4DW2L 3EO0B 4OZFA 4POYA 4ZXBC 4JY5H 3UTPE 5E70A 3ARDC 1XCQB 5ESVB 2ARWA 4WV1B 4O5LL 3UYRH 1EO8H 1JHTB 5JDJA 1OLZA 5CD3B 2ATKB 2JTDA 3QHFL 3B2UD 3VGGA 3UTQA 5EH1A 4NC1C 1UCBL 3RZCC 3FZUC 4AEEA 5HYSA 3BH9A 4JRYD 1A4KB 3V5KB 4MB4A 3HUJA 2ICES 2JIXB 1CDCA 2MMXA 1NJ9A 1REIA 3QXVA 1QFOA 3HZKB 4PTTA 3BUYA 2Z92B 4HS6B 1WBZB 1HOCA 1HI6B 4LCWA 5E6IB 3ULVC 4JO4L 4Q6IB 5EUKA 4MJIB 4PJAA 1KPRA 1N26A 1MAJA 1MSPA 1TNMA 5C0IA 1TPXB 1H3UA 1IEAB 4NPYB 2C4FU 3QG7H 4HWNA 1HXMA 3K4ZA 2HWZL 3SE8L 1FNSH 5CWSB 4OCYL 4GKSA 3FFDA 3WSQL 3IDMB 2V6HA 5KN5B 5FO8A 2X7LA 3RPIA 3BRDA 4Z0XB 1SY6A 2K1MA 3CSBA 4GKZA 2PTTB 4QXUL 4G8GE 5JOPE 4MNQD 1H5BB 2I26N 4U1MB 3VFUB 1I7RB 5ENWB 1U93A 5F89A 2R8SH 2AGJH 4JFDD 5EUOE 4B7IA 1JRHL 2AEPH 2VSDA 3I84A 4D8PB 3LEVH 4Y5YC 4F37K 4QYOA 2R2HB 4R3SA 5I15H 4TN9A 4YK4C 2WIIB 5I73C 3X12B 3TFKD 1NMBL 4P9HC 3SGKA 2H6PB 2K7QA 1N7MH 5IG7B 1TVHA 2H26B 4WTZG 5T5NF 4Y4FD 3BKCH 3MOBH 4HWZB 4RA0C 3BAEL 2AABL 2BVOA 4JM2F 3IXAB 5DVLA 2C4XA 4FQIL 1Y0LB 1OAQH 3AM8A 3VMPA 2P42B 1G0YR 2B5IB 1CLZL 1W2KT 1T2QL 4HLZH 2X44D 3L3KA 1X5FA 4KJWD 4WUUE 2CIIA 5JW4N 1MI5E 3MCKA 4LNVA 2Z93B 1W8NA 5JPNA 1OD7A 4XP5H 4X4ME 2ORBH 5ALCH 4PJCF 3BWUC 1MHHB 3C5ZC 3IGAA 5MEQA 2B1AH 4ZSOB 5IROA 1I8LA 1KC5L 4YHNA 4PGEB 4QRSB 3WNOA 3B2UC 2XKNB 5CBAA 4XPFL 4NZRH 4MX7A 4JFPB 4NKOA 2JE8A 5D1XA 1WFTA 4NQVA 3SGEH 4NQVB 1W72H 1KENH 3U7YL 4XTRC 5TPWH 3LRSB 2JJSA 3MRNB 3QDGE 2X4SA 5SV3A 4YBLB 3NCCB 1UXSB 4K94L 5F44A 1GVIA 2VE6B 4LAQH 4K3JH 1DEDA 2LVEA 4N8VG 4YH6A 2OTUA 5F9WC 1JJUA 3P4NA 4O2EB 2EDOA 3ULVF 1FP5A 2VDRH 2IADB 4Y4HB 4LMQI 3CAFA 4JFFE 4OLEA 4TSAH 1MCWM 1W0VA 4U6HB 3OGOE 4UIKL 4PBWD 3ARGA 1KCUL 4OD1H 5E5RB 1BQUA 2NX5E 1YNLL 5IFHH 4FN0A 2VIRA 32C2A 1LP9B 4RIRB 5JQ6H 2W0FB 1LEKB 3B2VH 3IAQA 3ZDZF 2DQGL 2BSRA 2HT2D 1FO0L 4UT9L 3PV6A 2ITDB 4S1RH 4GOSA 5F9AC 1D5BB 1MFEH 2GAZB 3MLUL 3TO4A 3WS3B 2FO4A 3LDBC 4OD2A 3M1BA 4K9EC 4P5KA 4PRAB 4YXHH 1DVFD 4OKVB 4XMLL 1XGPB 3P0YL 4OIIH 1Z2KA 2QSCL 2YK1L 3C2AL 1JHLH 4WW1A 5D5MB 1CGVA 4G9DA 4JHZA 3BGMB 2WAHA 3P9WB 5GGQL 3EJJX 1ZT4B 3BJ91 1ZSDB 2ICWA 4HCRA 5GGSY 5CLWA 4G6ML 5JIPA 3DROB 2D0HA 5HPMB 1G7QB 1L4IA 2V5MA 3GBNL 1F13A 3HMWL 3VXMA 2YUWA 4HUWB 4E9LA 4JPKH 3M17A 4Y0GA 3BPCB 3I75A 5IQ7L 4U1LB 1KEMH 2KQNA 3S37L 3VWKA 4DN4L 2CRYA 3UTSA 4HUXA 4IOIA 3AS1A 3MJGX 3EJYC 4Z9KB 4GXVH 4ZQKB 3LCYA 1S7RB 5KSUB 2IGFL 2VQUA 4KQ4L 5GRVL 2YD5A 1FYTE 1F2QA 2DN7A 4TUKL 1HILA 2UZYB 5HGAA 3DARA 1I3GL 3IB4A 3FB5A 4NJAH 3MBXL 5EU5A 3RVXD 5D4QA 1GZQB 3VE0A 4PJ8B 4XP6H 1I8IB 3AM8C 4ODUB 3UROR 2XWJA 3PWJA 3GMOA 3CLEL 2YZ8A 2AAVA 2F54A 4Y4KB 1LNUA 4AEIL 3PDOA 4PJ7A 1ITCA 1KJVB 3VGBA 5HHNA 5GGRY 1B90A 3M8OL 3KNBA 5EOCL 5IMMA 1K85A 1ES0B 5HHXH 4LVNC 5D70L 4XP4H 5SWZD 1MHEA 3LKQB 2R69H 3V4PH 1CIUA 4ZS6D 2GTWA 2W0KA 5IROC 3SKUD 5J13B 2WLYA 4P46D 3KLDA 1P1ZA 3DRTA 2NY6C 2W9EL 3WO4C 4UB0H 4WWID 1FFPB 1OGAA 5IFJB 1OGAB 2HVJA 5LGJB 4K2UH 2A0LD 2R9HD 3UAJD 1SMAA 2WBJB 1TJHL 4Z7VF 4S1QL 5GIRA 4KTEH 2HT2C 4J4PA 1KCVL 4J1UB 5F6IC 5KW9L 4L9LB 2KBGA 1RZIA 2FECL 5C70A 2DMCA 1WVZA 1QEWB 1LEIA 2BJML 3DYMA 2DYPD 1FSKB 2R23A 2DL2A 3KXFD 5BZDA 3RKDD 2BY1A 1XMWA 3DUSB 2X4OA 2W38A 4DN3L 5M95B 5DO2D 2Y5TA 4GRWB 3CFCL 3AU1A 5J9PB 2YSSA 4QEGA 3MJ9A 1Z9LA 3IFLL 4C56B 2NY3B 2GSIB 2X10A 2VWEE 4OZHA 5E56A 3VG9B 3KYMA 2EDJA 4IRJA 3ARZA 1UJ3B 3RWGA 2HVKA 1R0AH 3PG2A 4TVPL 2MCPH 4ODTL 1BHGA 4R96B 3OB8A 1G0DA 4ODSH 1EJOH 2P8LA 1C5CH 4FXKB 1DTUA 4XCEA 1JYXA 1ZS8A 2FGWH 1IGIL 2CXGA 1U2CA 4P2QA 1I3RB 5D71L 4NM8L 5DSCA 4YFEA 3QHZL 1Q9OA 1BVZA 2HFEA 2J5LC 5EPMB 4EUPA 4N9OB 5FYKE 4HH9B 5E2WL 1IAII 3UEZA 3EO9L 2YRPA 2WNGA 1BGXH 1NCDL 4G6KL 4Y8DC 1SEBB 2BNRE 5D72H 1ZHLB 3FONA 1X4ZA 4OAWA 1EO7A 5F1NB 3X3GL 1U6AL 2I9TA 4Z7WB 3ARQA 3L5IA 5IESH 2DLTA 3X13A 2C3VA 2X9XA 1MFAL 4LU5L 2MKWA 1UG9A 3TBSA 3OKMB 2Q6WA 3VWKC 1GAFH 1X4XA 1SVZA 4F7EB 5CZVL 2FIKA 4BQ9A 4ZPTB 5IVXA 5BV7L 1DQQA 2DM7A 2W07A 3QDMB 4P46C 4O51A 4Z7UA 5MP6H 4RCAA 3BKYH 5EORL 3NCYS 5DFVD 2R2BA 2GSGB 1IAOB 2AK4A 3PGCB 2WW8A 2A0LC 5GRXG 5EOCH 1I1RA 3E6HA 5D7LD 2QQNL 5GJTL 4K3GA 2IMMA 1W0WA 4PJFE 3WNMA 1RZ7H 1RZ8A 3TBYA 5I2IB 4CVUA 2AQ3A 3MLTA 4XI5C 5I1JH 4JGUA 2ZOLA 5ACZB 4R2GB 2X4QB 2YWYA 3DBXB 2IJ0C 2MNUA 5TQ0H 3VFOB 4JVUA 3STZB 1KNOA 4U05A 3T3PE 4FZEH 8FABA 5BMFL 2XG5A 1HWGB 3V5HA 1OQXA 3ES6B 3DMMB 3HG1B 3MFFA 3BOVA 3WYRA 1A4JB 3L3HA 3V0WH 5F3HA 4ELMA 4U7MA 4PJBA 3LPGA 1S7QB 3RUGB 4M5ZL 3IKCB 3Q6FB 5L2KD 1S9XB 4OI7A 2A83A 4M6AA 2BOCB 5BZWB 3OR6A 2OX5A 1HH6A 3HI1B 5F7EH 1RURH 2KKQA 4DK6A 3P73B 2JK5A 1NC4D 5F70A 1AXIB 1YEGH 4O00A 4IRJC 3PXJA 4L3ED 1NEZG 2OR7A 4JVPA 5I19L 4LIQL 5C0RL 5K9KB 2OTWA 5H94A 1AHWC 5AZEH 4F8TA 1GL4B 4HDIA 3TT3L 1B3JA 4MYWB 2VXQH 2FBOJ 3WIFB 4WEUD 3DGCR 1P4IL 2YPKA 5D7JA 1FGVL 3KPQA 1Q0XH 1XR9B 3RNKB 3IFNL 1IFHL 5JA8B 2VLKB 3BVNB 2EIBA 5J7CC 2EIEA 1I9JL 3VRLF 3MRIA 4JFEB 1T04A 4Z0BH 5IHBA 1CQKA 3F7QA 5DFVC 3L7FA 3O3BA 5EO0A 2AXGA 3QUKB 1IT9L 3V7AG 3GSOA 4HUUB 1MJJB 4Y19A 4NBXB 3VXPB 2E6JA 4FQLH 4BFIA 4F2MA 3SDCA 3GUTB 3DX6B 4JY4B 4FQ2L 2R1YA 2VL5B 4JQVA 4MGXA 2IANE 3LHPH 4LBEA 2JELL 4L4VB 1I7UA 4PY8I 3LKPA 4NO2A 4DZ8A 1WBXA 3L5WB 4F33B 3S7GA 4O02H 3C8DA 1NFDE 3PQYD 1GPOH 3N9GL 1CFVL 4GLRH 3LKSA 2ARJA 5T5NG 5DTFA 3FB8A 1JZ6A 4M4RA 3WJJC 3ARRA 1G7JA 5EO9B 5IM7A 1YMMA 2VLLB 1WWBX 2VLJD 4NZUL 4PJIA 1UWXK 4XNYL 3CXDH 3W9EA 4Q9QH 2ZP0T 5IR1A 5HI3D 1TJIH 2P43B 2P8PB 2FCBA 5BS0B 2AI0L 3QEGL 4R7DA 3TN0A 2CSPA 4KI5D 4QLRA 3C08L 2Q3ZA 5B38G 2I27N 4P57B 1IGFL 4PGCB 1WBYB 1XGQB 4HJJH 1UACL 5DRWB 5I9QC 2DLGA 2YKLH 4UDTA 4P5TA 3DXAB 4PG9B 5DJ0B 2H1PL 1HINH 2ITCA 3HR6A 1N0XH 5FYLD 1JTOA 3L3GA 5J89A 1YPZB 4R0LB 2EC8A 1D5ZB 1CFQB 5MERB 3MGOA 5HI5D 1ZOXA 3VFVB 3MQIA 3SE3A 3HPJA 1OP9A 1M7DA 3NIFE 1HHHA 2FYYA 2HTKD 1KEGL 3NABL 1GZPB 4LPUA 3TF7C 1RZFH 4P4RB 4OB5L 2BSED 3NCJH 5KS9E 4Q74A 2IMNA 2FH6A 1J8HE 2BNUB 4GQ9L 5DMYA 1I4FB 3JWOH 2UYLB 1HQRB 1A6ZB 1F3DJ 4XNUH 4RGNB 3QI9A 4CMMB 1PAMA 3FQNB 2WUCH 4LRNH 2VZVA 5GSRB 2F53B 4QTIH 1I1YA 1UXWB 1WIOA 5IB5B 1YUHB 1EHLH 1H3GA 2IAMA 2APWA 1ZHKB 4FQJL 3G6AB 5C0AA 3C9NA 4OQTA 3GI8L 5EU3B 1QHPA 2D03H 1DQML 4G7YL 4ODXB 4RDQF 1N5AA 2DDQH 1ZANL 2UWEF 4JJHA 3F65A 1XH3B 1FZKB 2OZ4A 4LCCA 5D7JC 3VXRD 5CILL 1NANH 1SJEA 2EH7L 4K7FA 4PJ5D 1CXHA 2B4CC 4IRZL 4LFHG 1U3HA 3K46A 1S5HA 5ADOH 3Q6GH 2BX5A 1F6AA 4R7NB 2F58H 3VH8A 4DFHA 1VHPA 4M9OA 4BJLA 4DKFL 4WFED 4N9GA 1I9EA 2DB8A 5HBBA 2FJGB 1DFBL 1RZKC 1PY4A 2GFBA 3NPZB 3TA3A 4I3RL 2J8UB 4XCNB 1G6RL 4LSVL 4H88L 1LO4L 5LCVL 2O5YH 3NIDF 3RWJA 1BF8A 1FG2B 3VXUE 1BX2B 5C8JB 5FHAH 4KH2A 3PDGA 5TH2A 3LRHA 4DZBA 5J12B 5IUSA 2XA8L 1FORL 2PO6B 4PJGF 1OAYL 3HZMB 5KVFL 1IGML 2AVGA 5DYOA 3X14A 2HN7B 5HI5C 4DUWA 1FIGL 5IW1B 4JFYA 5IB4A 5IMLB 3PF2A 5MEPB 3QCTL 3NZHH 4U6YA 4J23A 1S7TA 2H8PB 4WJ5A 3BSZL 1JRHH 4MA3A 4YDIH 5KTEL 5GISL 5HHQA 3HI6H 5MEND 1RUQL 3NH7L 4FFVD 4FTVE 1OL0A 5L2JB 1NMBH 3O6FB 3OPZL 1LO5B 1BEYL 4PGBA 5IBTL 1J5OL 4P4KA 1DL7L 5EU6D 2VN7A 4FXLA 4M1GL 1K8DA 4CBPA 3QZWG 1YY8B 1J9CT 2XN9E 4IRSD 2NLJA 3BP6B 2DI9A 3SE3C 1D6VL 4D0BA 3WIHH 1VACB 1JGVL 4U31A 2JCCF 5C0BE 1TJGH 4YEEA 1I8MA 5F7DB 1ONQB 4DKEH 5DZLA 4E0RA 1F4HA 1NCAH 2HFFA 1T1WA 1JGLL 4X8JB 4XC3L 5J11B 1GHFL 1GOHA 3QI9C 5A16B 1CXKA 3T08A 3HRZA 1AY1H 3MRFB 4PRPE 2ZCHL 2IAMC 4PRHD 4HUNB 3NPSC 2XQYG 4MWFA 4NQSB 1KB9J 5ILTL 2V2TB 4ODVL 4RNRA 4XRCB 2V17H 5IJVA 1BMGA 4WNQB 5L8JB 2C7UB 3P9LA 1ZLWK 4JGJA 3EFFA 4NQUA 1U8QA 4LCCC 2MQ3A 4G9FE 3RL2B 1U3HC 4OLYL 2X42A 1UENA 1BQLH 5H2BA 2YPLE 4HJ0D 5D2LA 5HHMD 2IH1A 2IPKB 1IGCH 1K2DB 1S7SA 4JRXE 3EOAA 2ATPB 3D2UD 3MR9B 3SQBA 4HWBL 4YHOL 4JKLA 1KELH 1HSAB 4I4WB 2BK8A 3RWHA 4ZUTB 2GK2A 4K3HA 3PJSB 1MCOH 3S96B 2GY5A 3MGTA 1OT2A 2XFXB 3FTGA 4NGHL 5EBMB 3L3OA 1LO3L 4L8SA 1AKJA 3EZJB 5D93C 4WGVB 3QR2A 4UU9A 1TETL 5FF6A 5I17B 1UH3A 3V4VH 4XP1L 5JXAH 1Z3GL 1R3JA 1HNGA 3OAYK 3NN8A 1FL6A 5JPMA 3BH8B 3PDDA 5E2VH 4RWHA 2GJ6B 3FMGH 5DHVB 3TCLB 1YJDC 5I1LA 2F74A 1JGEB 4QRTA 3IU3A 3KPRD 1WF5A 1U3ZA 4OCRL 1LQSR 3ARBB 1TZIB 1ZVSA 3S37H 4M62H 4WI5A 1AE6H 5DRNA 1MQKL 2EYRB 5D6DA 1EX0A 4GG6B 1CBVH 4PBXA 4ALAH 5F9DC 3OXRB 4U6TA 2CKBL 1HYRC 4UQ3B 1E4JA 1ZTXL 3CFKB 1D5XA 2H9GA 4L1HA 3ECBB 4N0CD 2OI9C 1PKQB 4KRPD 1WFUA 5I16A 5C09E 1ED3B 1B0GB 1NGPH 5LGHH 1RIUH 1AD0A 3CLEH 3W11D 1NGWA 2AJVH 4XVTH 5FGBC 2F9BT 1OP5H 4HMCA 5GS2H 3KPOB 5CP7B 4G8GA 5BJTA 1QBML 2DQDH 2OR9H 2VR9A 1H3PL 2CMRH 3TBVA 3GSNB 1QYGH 4JB9L 2P5WD 3B43A 3GB7B 1IEBA 4L5FH 4P48A 1I8KA 3VFNB 5D70H 3I6GB 4ZO6A 5EUOA 4Z76A 1FFNB 3QDJB 3RDTD 4JHWL 1QBAA 3QPQD 4QHLA 1GGIH 4U2ZA 4HJ0C 3FO1A 1MY7A 3FB7B 1Q38A 5C9JA 2ED9A 3PXHA 4M7ZC 5IKCA 4EN3D 3GMLA 3P9MA 3P9MB 4YHPB 5SWSB 3VWJD 4QOKD 3I2CH 2FD6L 1U41A 3T8XB 3WEXA 2C4FT 5GRWA 5TDNB 3DO3A 3N1MC 3BZ4A 1V8HA 3BZ4B 1JYNA 1QLEL 3IF1B 3MJ8A 1IGYA 5C0JB 5L7XL 5I1IL 3QJHA 3TPKA 2OSLA 3RGVD 5DD1L 1T0MB 4WFFD 4LVEA 1BBDH 1AI1L 2Y36H 4WUUA 5BW7C 1MI5A 3O4LE 3OXSB 3MRDB 1HHKB 2VDKH 5C3TA 2ZCKL 3V6FB 1X5IA 1QR1B 2AQ1A 1R5WA 4MB3A 1CD9B 1MJ7H 4OF0A 1TVBA 3O6ML 5GS1A 5TF1L 3V6ZA 1YQVL 3MNVA 4UQ2A 3GHBL 3MJ7A 3D48R 1NBYA 4OM1H 1G7IB 3GJFK 1VENA 4BSJA 3HNVL 3RWFA 5ADPL 3QDGB 3VD5A 4K3EL 2P44B 3QFJE 5EZJB 3S35H 3IVKA 4JHAL 4NRXB 2R56L 1WUNT 3DETC 3VFTB 4N0CC 3T77A 4LPYA 3WE6A 3IJYB 2VISA 4LEXL 4MB5A 3F62A 4KRPC 4Z6AT 1SBSL 4HLJA 3VXSB 4NQED 4Z7NF 4JFFB 1PBYA 4Y7MA 3W11C 5IGXL 1JNLL 3G5VA 2NX5B 2DBLL 3H42L 1XFPA 3C6SB 3TPUA 5I75C 2E7LA 5FKPA 1VFUA 5DVMA 3LPWA 1M7XA 43C9B 1IM9B 4WFHD 1JHKL 4G7VL 3CZFA 3HZVB 3P4MA 5BCAA 2XQYK 3PABB 1T1XA 2DWDA 1CCZA 3QPQC 4U6VH 3DIFA 3KPPB 5FGCE 5I76A 4MQ7A 5I76B 3B9AA 3N85H 4ELKB 1UWEL 5JOFB 4EN3C 1RIHH 4M8VA 3WXWH 5JOEA 4NSKA 3VWJC 4TULH 2ESVD 1P7HL 1JPST 4KUZH 3T1FB 1Y6KR 1T83C 5ACMA 4Z7QF 5HJ3B 2PYEE 2FHCA 4LNRA 4KVCH 1MRCL 1NLDH 2GKIA 4YHKL 2NW2A 5KVDH 4FQ1H 3RWCB 5T3XE 3PWUB 1EMTH 1A9BA 1FNAA 1MRDH 1SM3L 1FZMA 5IOPA 3FL7A 5JHDD 2E7MA 1OAUH 1RD6A 4ONHA 5LBSL 3ZHDA 4MAYB 2EYTA 1A0QL 5HDBF 4EIGB 2QHRL 3O3DB 1MWAA 2EEAA 1W72A 5C0CB 1BD2D 4HG4J 5CEZL 5DK3A 1FYTA 1U8NB 2FR4B 5GGTH 5DFTA 3V4UH 3BPLC 4D0DB 4O9HH 4W6XB 1P6AB 4OZ4B 4QRPD 5F7NC 4RDQG 3O8XB 1HYSC 3B3IA 1ZGLP 3PHQA 3PIQB 1ZLUH 4DEPC 4XBPA 4PFEA 5GRVK 4RISL 2E3VA 3RU8H 2YUXA 4B50A 1L9MA 3UCRA 4JLRA 1UB5B 4U0QB 1IAKA 3UTTD 4TUOB 4LHUG 4XCYB 4M8QA 4JO3H 4PG2A 2UZIH 3MLYH 3KYOA 2YN3A 3OSKA 4LHQB 5LQBL 2VQTA 1QQDB 3KYKL 3RWIA 2VDML 5C0RH 3BYTA 2VO5A 3TT3H 3WNLA 1AO7E 3ARPA 1CE1L 1OOAA 1IC1A 5DK0B 4AENB 4NHUB 3D9AL 1J1XL 4XVJL 1ZHNB 1BLNB 4WW2A 3MACL 1DQLL 1DQJA 4G6FB 3CFEA 5E00B 1I7ZA 3S4SA 4C83A 4WU7A 4QRUB 3BQUA 1H8NA 1F58H 2W9DH 4G6JH 4B0MM 4PBVC 3STBA 4R8WL 1H3TA 4JANA 4F57L 4LQFH 3BFOA 1A9EB 4NN6B 3IFPA 1MIEL 3KPTA 3C8KA 2ZCLL 1I9RH 1XF4A 4NKDB 3B83A 5HGHB 2PKDA 3BP5B 4GQPH 4M7KL 4EKXA 5FFLA 2E7LC 2QV2A 3EYFA 4PGDB 4P2OA 3ZDYE 2JIXD 3CSPA 5FYJE 3EHBC 5K9JH 4Q7DA 1YEHH 4ZFOL 1UT9A 4R97B 1INDL 3CLFH 1FL5A 2NY5C 2YD1A 4JPVL 5LAXA 3MO1B 1JGUH 3IRPX 4HH8A 5E6ID 3HS0B 4PB9H 1R24A 12E8L 1WZKA 1PYWB 3S5LB 2VAAB 5IVZB 4MJID 4Z78A 4LPVA 4NKIH 4NRZA 2VB5A 1A21A 3KJ6L 5DEGA 4I13B 1LDPL 3D0VA 3D0VB 3IDGB 1BM3H 2XKSA 1OAZL 4JQXA 1OTUC 5TE4H 4OLXL 4OCLC 3RJQB 5FA4B 3X3FH 2BNRA 4H1LG 5FCUH 4GAYA 3DX7A 5L9DH 3HC0A 2XXCB 4X4XB 4F15C 4LKCA 5IHZB 2J6EL 1CZ8L 5L88H 1IKFL 1CDBA 1KLGB 4M00A 1A1OA 1F00I 1T6VN 4CW1B 2VQ1A 2EDFA 4Q9RH 3D69A 5EU7E 2ZKHH 4L8DB 1G1CA 4U1GB 3REWB 3JV4B 1SYSA 5HVHB 2ZSWA 5AYUL 1CFBA 2A6IA 1S7WB 1MELA 4OZIE 3SY0B 2VXVH 4GW4A 3W2DH 3NIGF 5C08E 3QIWA 3BT2L 5C0GB 4L4JA 3O0RL 3ELAT 5LJYH 4Y16A 3HNSH 1AR1D 3INUL 4U1IB 3RIFF 3L3IB 1Z9SA 4MA8H 2X4TA 1MRFL 5FYKU 1ODAA 4FQXA 1R3KB 4PJFB 4O2FA 4YWGH 4HX1A 2XTLA 3C60A 2EDKA 1O5DT 2NW3B 4LDOB 3OX8A 2EZ0D 3QNXA 2VXUL 1T21B 1FLRL 3PGDB 1NAMH 4FQJH 4H20L 4WV1C 3QO0A 4ZFFB 1IAMA 1RUMH 3DV6B 3V6OE 5DQDL 5JR1H 2CRZA 5IQ9A 5HYEA 5DEFA 1CLYH 3CFDB 3LS5L 1D9KA 1BIIA 2FWOA 1BIIB 1ZT7B 3MV7E 2C1PB 2EE9A 1FN4B 3MLWH 4G8FA 4JY6B 4DAGL 4F80A 2HJLB 4IRZH 35C8L 4WW2C 3QRFM 1XF3B 1UB6B 2X41A 2RFXB 2NY7L 3E0GA 1INEH 1F11A 3VXTB 5E8NA 1KCSH 5E6IC 3OR7A 4Q6IC 3MLRL 2R1XB 3PWLA 1J1PL 3MRPB 4S1DC 4AT6A 3GSXB 2Z8SA 4A6YH 5I8CB 2FX8L 1U92B 4PYGA 5FKAB 4LLUB 1RUKL 5EC1A 2QJDA 1KXQE 1OAKH 4Y4HD 2WMPA 5KSVA 4LSVH 1CICB 1HH9B 5ERWB 5F7FA 5TE7L 1LO4H 1N5YL 2CR3A 2DQTH 3Q1SH 4W6YB 1GIGL 4PP2A 4ZDHA 1RUPL 1QFWI 1QKZH 3EW3B 1ZT1B 3PHOA 2AK1L 8CGTA 3WKMH 4U6XB 3T4AB 3VFPA 4N5UA 4BKLB 2XA8H 4KKBD 2A6KB 4XPBH 4EDXA 3CDCA 1D5MB 3QHTC 4KK6D 4R9HA 2WINA 2VXSH 5JTWA 3QQ9C 1J86A 4HSQA 3SE9L 3MV8E 5DD0L 3LZFL 3G08B 5HY9B 3S3JA 3IJHA 5F1SA 4UTBH 4JE4B 1RFDL 4JQXC 3WXVH 1AR1C 3QIUB 2VXTL 4KK9D 1X5AA 4PJXE 1F6FB 1VFOA 1NC2B 1S7UA 5DJZB 2VABB 3NH7H 3GMMA 2B5IC 1M7IB 3OPZH 3DYPA 3NA9H 1EBAA 1KFAH 3RX7A 1YNKL 4QGYA 2IANA 3WUWA 1QSZA 2EZ0C 1KB5H 3QEQB 2BFVL 1MQ8A 2XTJE 1MJ8L 1CWVA 5DMIH 1P4BL 3GMPA 4M1GH 1NFDA 4JM4H 1L6XA 1Q94A 4R90L 1B6UA 5CINH 2DQFA 3QIWC 4JG1L 4JRWA 4S2SA 5CD5C 1FVDA 3EOTL 2CLVA 2D9CA 2BP3A 5HYJA 1E6JL 1JWUB 5DUML 3WFDL 4OCSH 2BC4A 4IIQB 2Q7NA 2P8MB 3TV3H 2VZUA 4CN4A 1BOYA 3UXFA 3CC5A 4KPHL 5TGBA 4PJ8D 5K9QI 1GHFH 4JFZL 5J56B 4HIHA 4OF6A 3VFRA 3VFGH 3C60C 4Y4KD 1QVOB 1KBGH 5I0ZA 1X44A 2PYFA 4BA8A 5DS8B 1DN0B 5FOBA 1BZ9B 3B9VA 3IDJA 2AKRA 5CIPB 1SMOA 5EC2A 3KPNB 1NDMB 2HKFL 3MRQA 2VC2L 1P7QA 2EE2A 3GSQA 3D3VB 3IXTB 4Y4HC 3SO3B 1EZVY 1CD1B 3OKNA 4RSVA 1CIDA 2AXHA 4YZFF 3ARYA 3U0TB 3GIVB 3V0AC 1OGAD 3G6JE 4M5YH 4QT5B 5CP3H 5L0QB 5T1MA 3QNZA 4YPGA 2WBJD 3T04D 1BBJA 5DRXA 5KAQF 1EV2E 4HCRL 1FH5H 1YDPB 5KS9B 4UIMA 4MDIA 1J8HA 2AP2A 3PWVA 1QFUL 4I3SL 3O9WA 2J2ZA 4DFIA 4H8WC 3ZZ1A 1VFAA 2JKXA 4KK6C 1NEZB 5INDA 1R3HA 4BFEA 1OSPH 5B4MD 1MFNA 1NFIA 4NN5B 4N1CA 4JFOA 4YBHA 2Z91B 3CVHA 4C56D 2NY3D 5D8JH 1G7MA 2PCPA 3SN6N 5F7UA 1OAXL 1U95A 4KK9C 4LCYA 5ICZA 5DJYB 4XPGH 4AMKL 3K8LA 1EHXA 3WD5L 1CFTA 1HZHL 1QZ1A 4N0UB 2DAVA 3BDBA 1EEZB 2VJXA 1T5WA 5HDOA 5GRJL 5D1QB 4CADA 2VDLL 4J3WA 1NSNL 4PJDE 1RK1A 1CTOA 1IBGL 5I8EA 4XT1C 2ZUYA 3H2WA 1JFQL 3BISA 4YHML 1JI2A 3UPRB 3IKKA 5JXED 3LKNB 3DVGB 3A6CL 3H8NA 4X6EA 3R1GL 1OQOA 4YHYC 4RRPG 3QUXB 1WIUA 3O3AB 3O6KH 1FAIL 3LQZA 3LQZB 3UP1A 1Q1JL 3GEWB 4HIXH 1KIRB 3U7WL 2XI9A 4CJ0A 5C71A 1XZ0B 3R0NA 3MRRA 3QNYB 4X7CC 4Y4KC 3VXUB 2LE9A 2KH2B 1JGDA 5FHBL 4JFXB 3CSYB 3GSRB 4H0HB 4ORZC 1ETZA 5B22A 5DD5H 2ADFL 4HFUL 3MRKA 2X4UB 3QDMD 3SDYL 3MUHL 1K6QL 3JUYA 4LVOC 1BQHA 1CFSA 1PG7H 3MJ9L 5EZLA 5IIEB 2O26U 1EHAA 4LSTH 3WN5B 5AYQA 2HT3D 4Z95L 3SDXE 1AR2A 5HGDB 2YS4A 2WBJC 3FFCB 4V1DB 3OKOB 3QO1B 4RX4D 3JTTB 4TSCL 3FB6A 3UZEA 2CLRB 1LP9F 4GKNA 4XWGL 4KK5D 2EXWC 3K81A 3NGBB 2HJKB 1DCLA 3KWWB 3MLXL 4FZ8L 4FTVA 4X6FB 4R2GD 4RBPH 2BSSB 5E2UH 5KVEL 2X6MA 4JDTL 3G6DL 1OTSD 4LPWA 2XZQL 1Q9KB 2NY3C 4PJEB 3SKMA 4RAVB 3U82B 3BEVB 3VG9C 3ZL4H 3DMMD 1N64L 3HG1D 2DTSA 1QLEH 2HRPH 3O11A 1OCWL 4G42A 1J12A 2XN9A 3HAEG 4E42A 5KZCB 5D5MF 1CG9A 5DC4B 3TCXA 1A1NA 1KACB 3RTQB 5DLMH 2A6JB 5D1ZC 4L1DA 1BQSA 2Z4QB 4HC1A 4ODHL 5C0BA 2PW2B 2OJZH 1C08A 2ZCKH 4UV4L 2AXJA 5E8DH 4LDEB 2GTZB 1JK8B 5I1KL 1L0QA 2R29L 3LQAL 3PWPB 4NQXB 1Z0NA 5JXEC 1Q8MA 4G8EA 2ERJB 2OQJA 4PRPA 2FBJL 4MXVF 1JPFA 1KN2L 1U8OA 4BFGA 3OWEA 2P4AB 2AJ3B 4GUPB 2NY0C 4D9QD 4OZGE 4I5BB 1CF8H 5T3ZH 2VITA 1A7PH 4LSPL 4K8RC 5HHOE 1YYLH 4G9FA 2VLKD 4D94A 3DURA 3H9YA 3QEHB 1V7MH 2YPLA 4GSDH 1P4LA 4JFED 1I1FB 2R0ZL 3H42H 4L8CA 2LU4A 5MEOB 4W68A 4JRXA 1C5DA 4PLOB 4YHZH 1ZGLA 2E7HA 5IJKC 3FOMA 3DX9A 3VD9A 2BZDA 1JHKH 2BSTB 3BGFB 4G7VH 2L7UA 3TESA 2G60L 2BVPA 2HTLC 3MNZB 4M1CD 1UYWH 4E41B 3JWDL 1TENA 1MJUL 4FP8H 4L4VD 4PS4H 3SKOB 5JW4Q 5I6XB 3KPSE 1OTSC 2C3XA 3W39B 2HYMA 1QRNE 4GAJH 1DBMH 1JI1A 4GRWF 3DMMC 2CK0H 4KZDH 3MLSH 1F4AA 2JB5L 2NXZC 4XP9L 1EZVX 5ESQA 5DD3H 3UJIL 2HT4C 3JWDC 2IPTH 5JW5A 3MCLH 4HIIB 4AH2B 4WUKL 4NM4H 1JWSB 2UUDK 3I6KB 4HIJB 5KOMC 5BS0D 4X6DB 5EBWB 5DHYB 1H0DA 4E5XA 4MQSB 2QHRH 3FCTA 5JUEL 3QZWB 4XNMA 4XNQB 3SCMA 3QFDB 2F5AL 1AXTH 1I1AB 5IB1B 1Q9LB 5F88A 3DXAD 3B9KA 5HTSA 2KZ1B 5KANI 5C09A 1HKFA 2C1OA 2A2QT 4MJ6B 3ULUC 1CFNA 5T3ZE 1A6UL 4ZOAA 1M05B 2A74B 3NOIA 1I1CA 2FB4L 4X4YA 3BMWA 3K2UL 4FQHA 4F9PC 1V7NL 1XGTA 2E9BA 3VD3A 4YO0A 4DGIH 4CVWA 5E94A 3LAFA 4YC2C 1QHOA 1F4YH 2YMXL 3EZ8A 1RUAL 4Z7WF 4C58B 4HV8A 3WFEL 4EI6A 2G5BB 1BFVL 3HKFA 4RGND 5I1DA 5CJXC 4J3SA 1EAPB 1QPXA 2F53D 3GSVA 4GG8B 1GGBL 1CE1H 1UM5L 3MRCB 4KDTC 5B39A 4RWYH 1KTLB 1D6EB 3EYUH 5GPRA 4D0CA 5IK3A 4JN2A 3VFWB 1TIUA 3MUZ1 3JV0A 4F9LC 1INQA 3E2HB 1VADA 2J8HA 1RI8A 4M1CC 3LV3A 3VJ6A 4CVZA 5I1AB 5FO7B 1F02I 1VCAA 4I0PB 1RZJC 4MSWA 1PKOA 1DQDH 2DQCL 3O4LA 1LK3L 4X6BB 1UEMA 5F8RC 4ZAKA 4XBEL 5EA0H 4OGAC 1MIEH 3DV4B 5C07B 5E99L 2BDNL 4P9HH 2XYCA 4PV9A 5MI0C 4IDJH 4FFWC 3THML 2D31B 4OCXH 4HWUA 4BSWA 4RFNB 3MA9L 5GZOD 1EO5A 1E28B 2GT9B 4RAHA 2H2PD 3S36L 5ID0A 1YQ2A 2H3NA 4X7FC 4PJCE 1INDH 3U4EA 1UKSA 4JZJA 1WWCA 2MSPA 5ISZB 3QFJA 2AV7B 4FABL 3TBTB 4X5WB 4NRYB 5CUSL 3RUGF 2EICA 4G8IA 1NLBH 5DC0A 1WAAF 3AAZA 1J0ZA 1T7YA 4GXUN 4XPHL 2OJEB 5E1AB 2ID5A 2Y6SD 3FN3A 1A6PA 4OZFG 1BWWA 4DUVA 3DJ9A 3QQ4A 2ZUXA 2PO6D 1NGYA 5I1GL 3RIAF 2OL3H 3TWCL 5DDHA 3WIIH 3MXWL 2J6EH 3L95B 1X4YA 1T6WA 1X7QA 1JF1A 2G9HB 3UC0L 3ULVE 5HYSG 4EIZC 4U0RC 1EGJA 3T65A 3QSKB 3LH2H 1IZJA 2P24B 4GBXA 3VGAB 2Z31B 4WEBH 2OZ4L 3O6FD 4RGNC 4JQIL 4GW1B 4JO1L 2VOTA 3L1OL 1CVSC 3ZDZE 1V3KA 3DO7A 2JJWA 2EO9A 2P7TA 1SJHA 4Y5XB 1U8JB 1FAKT 3B9KC 3QWOB 3INUH 3LSOA 3F58H 5AWNH 2A9NL 1IC5L 1MCBA 1QTYT 1GCFA 1TITA 5ALBH 2YBRB 3KLSA 4OLWL 1ROWA 4NNXB 3F7VA 5DZOA 4ZFZA 3A67H 2PYEA 4YFDB 1XR8B 5FUOL 5IMOA 4EBQL 5KAQG 2XACC 2QHLA 2X4PA 4NO0A 5J1SC 4UAOC 3SDDA 1KIUA 1CU4L 4K9EH 1DBJH 4BSVB 3H3BC 3TH3T 3KPLA 3FO9B 1VKXB 4L3CB 3LS5H 5E08L 3SKNB 4LLQB 1FNGA 2A9ML 3MXVL 3MV9B 2YD2A 3D85B 2ZJSH 3DHJA 3HR5B 4PRIE 3HC3H 3T3MF 1ZLSL 2P5EA 4PPTA 1DLFH 1LO2L 1SY6H 1UZ6F 4Z8FL 1U8PA 5FA3A 1MHCA 4J7RA 3G5ZA 5KVGH 1C7TA 3RP1A 1IGTB 3V52H 4Q58C 3BD5A 1AGDA 1T22B 4MXQD 1G7HA 3IS0X 3G9AB 1YN6A 1C1EL 2YC1B 4IOFD 4KDWA 3LN4A 1A6AA 4MA1B 4KAQH 3B8YA 1J1PH 4JKPL 5E4EC 3H9HA 2IBZX 1KB9K 4QRRB 3ARWA 5BRZB 1H3WM 4M1DH 1KPVB 4RAUB 2W60A 2YA2A 4C54A 4ZAKC 2DLFH 2Y6SC 3DVIA 3RIFK 1T1YB 5GJSL 4P3DB 2CO6B 4JRYE 3MREA 5J12C 2DQJL 4NWUH 2PO6C 5DJCA 5DF0A 5H35B 4NZJA 4PRDB 5J6GA 1AO7A 1YPZF 4HFWB 5BV7B 3U0WL 4TRPH 1KYOJ 1Q9WB 2YOCA 2OP4H 3ZLQC 3BKML 1JPSH 4ONFL 1GOFA 2MCG1 4P23B 4N90D 3LZFH 3TM6A 4ZFGH 2XWBB 4MD0B 4GAGH 3IU4L 4J3VA 5F9OH 1XIWA 4Z7VE 3S34L 3C5SB 4ODWA 5C0FA 3S97C 1BOGA 4NUGH 4JEGB 1S8DB 2VXTH 4U1KB 1W8OA 4LLWA 4ZUWB 2F5BH 1R3LA 4HS8L 3RY6A 2DL9A 1AQKL 2Y07L 2AJZA 2GJ6D 3G5YA 3T4YB 3T0AA 3MRLA 1N6QL 1MFCL 1AP2B 2C26A 2DMKA 2H2SD 5DD6A 5DD6B 1O0VA 3GSWA 3GRWL 3ET9F 4UUJA 4LARH 2Y23A 4L4TB 4GRLA 5DGRA 4XAWH 5CKGA 3ARBD 4M3JA 3DRQB 1Y6MR 3U7AA 2E7BA 3HE6B 3SDAB 4YNYB 1R3IL 2EDHA 2W9LA 4GBXC 1X5ZA 4V2BA 2VLMD 3BIAX 4DOHE 4O4YL 2NCMA 1NCWL 1RVFL 1YY9D 4BH8A 1MFDH 4U1JB 2P47B 5GGTA 3CMGA 2DQIL 4YQXH 2AJYL 2BY2A 5DUMH 3WFCL 1CS6A 1PZ5A 3WFDH 3VDCA 3HB3D 1IMHC 5F9JA 2F8OA 3D0LB 1E4KA 3D39A 4NBYB 2XT1B 5EZIL 3MRMA 1FZOB 4PJHA 2IALA 2D7QA 4OD3L 1NPUA 1P69B 1U8IB 2J8UF 4D9LH 1G9MC 3QCVH 4R4BB 5DUPH 5EZOL 2IG2H 5E5MB 1TNNA 2IEPA 2VC2H 3QDJD 1L7TH 3U6RB 3IYLW 3WL9B 2O61B 5FYJU 1OF2B 1MF2L 1U8KA 3ROLB 3RWDA 4HHAA 2FRGP 1G9NL 1LK2B 1U8LB 3CUPB 4PJ9B 1WZMA 3QJFA 4OZIB 3O4OB 2XWTA 5C08B 1CL7H 5CBEB 3T0WA 1T3FB 5SWSD 4LVHB 1JPGA 2RCSH 4ZPVB 3P11L 4LHUB 1N2RA 1TTGA 4LLDA 3MBEB 4OUUB 4XXCA 1BFTA 2BRQA 2GW5A 4DVBA 1T1ZA 1OP3K 3VRIB 3SOBL 4AIZA 2VKWA 2JLLA 3QULA 1N4XL 1TXKA 1DSFH 2IQAA 4O58H 4WO4B 1KN4L 4BELD 4WEMB 3U1SL 1NGZB 1OAXH 4EI5A 1T03H 4YXKL 3ETBF 1QSVA 5BQ7B 3BWAB 3V6OA 1NDGA 3BDYH 1P2CB 4PRNB 4MNGB 1P6FA 1ZWIB 2H2SC 4G80B 4QTHB 3HCVA 3MV7A 3AC0A 2UV3A 4RFEA 1LD9B 5JDSA 3SGDI 1N59B 2EC9T 3MRGA 3MRGB 3QDGD 1BFOA 3ZTJG 5CJ8A 1PY9A 1ITBB 2IQ9H 4OBRA 1IBGH 3GSNL 3FN0H 5TDPA 3TP4A 1HHJA 3TBWB 5SWQA 1YY9C 3D25B 4Y2DA 5E1HB 1XIWC 4WWKB 3MJ6A 1AGFB 1F4WL 2G75A 4GH7B 1NGQH 3HB3C 2LU3A 3ARFB 3GMRB 1JWMA 3VXSD 3HFML 3MLZL 5GRZA 1QA9B 4U1HA 1RZGB 4RMVA 4JFFD 5E2JA 3DTXA 4LGRB 3ZTJH 1DBAL 4JCLA 5SX5K 3RWEB 2NX5D 4PRBA 2GJZA 3UTOA 4GRLC 3PP4H 2DOCA 4LASL 5KJRL 2EYSB 2ZG2A 4JG0H 1IM9D 3IJSB 3ZKXC 1TLKA 1GC1C 4JY5L 1H15B 1MLCA 4H1LB 2XZZA 3UYRL 3KJ4B 1UADC 4XGZA 1EEQA 3IFOA 4L9DA 4X9HA 4Z95H 3MV8A 4DCQA 3B9EA 5B8CB 5JORB 4X7SH 3DUUB 4HK0A 4ORGB 3MV11 4HXBH 4KXZI 4JDZA 4EUPG 3ZE2F 2BVUA 4PJXA 3OKYA 3BKJH 3RVTD 4NHCH 3VRLE 3UDWA 4APQB 5SWZE 3LEYH 2CDFA 3Q5OA 2ADJB 3ZT6A 2J4WH 3DWTA 1NAMA 5EWIH 2R1WA 3HE7A 4ZMAT 2XTJB 3E3QE 1Y18A 3U30B 1FZJB 3O41A 4MAYD 1AQDA 4NT6A 2Y1VA 3QG7L 5DJ8B 3B4NA 4KV5F 2DWEB 2Q8AH 1FNSL 5FECB 2ZSVB 3C87A 5C0CD 2YEZB 3QWRA 1MCDA 1NL0H 4HGWB 2M26A 3KXFE 1BZ7B 2Q86B 1CXLA 1YEKL 3KDMA 4FQQA 4QHNA 1HCFX 3O8XD 4XXCC 4HG4K 4YDKH 5IB2B 5F93C 2AGJL 3AROA 3LQAH 3EAKA 4YXLH 3TIEA 2AEPL 3E6FA 5F8QC 4A6YB 3LN5B 4NO5B 4OSUL 2I5YH 1U8MB 4QKXB 5JNYB 3CPLA 3CPLB 3LEVL 2X89D 4ETYA 1IAIM 1RK0A 5I15L 4O2CB 4GG6F 5C6TL 2WWMD 3FO2A 1N7ML 3BKCL 3MOBL 5E8EA 1BVKA 3ESVF 1RJYA 2FX9H 1JE6A 3WO3B 1EVUA 4OF8A 1OAQL 3G6JB 3EYVA 4X0KA 1FVEA 3SJVB 5CEXB 5DR5H 4MLIA 5CJ5A 2PXYB 3JV5A 3WS6A 2KZWA 1EFQA 4QNPF 1WFNA 2HLAA 3QA3B 5D7IB 1RHFA 3L9RB 5DA0B 3O2VL 1T66C 4XP5L 2ORBL 3KR3H 5ALCL 1MREH 4G6FD 3GHEH 3MROA 1AFVL 2B1AL 4Y2DC 1AGBA 3DX8A 2MPAH 1SJVA 1JV5A 2FATH 5IV2A 3RGHA 5JLZA 3RVWD 4NZRL 2HRLA 1W72L 1KENL 3EDKA 4WI9A 1QBLH 5TPWL 3I50L 2VRAA 1VB9A 1NBZB 4KGJA 3N0PB 1QRKA 1XGUB 4KKCD 3RZWA 5DFWH 1KB5A 4P2QE 2MQCA 5AG9A 4XXDB 5J1AA 4LAQL 5EDXA 5CCKH 3V0VA 4XWOD 4K3JL 3AREA 1BFSA 2E7CA 1KIQA 4CDGC 4RGOH 1P9MA 1X6LA 4PJDA 4LIQE 4F3FA 4ETQB 1MCEA 3BP4B 5D7LE 2UWEE 5HGBB 3VA6A 4TSAL 1EPFA 2E27H 4YGVB 3OKKA 2XKUA 1M6OB 1HHGA 5IW6B 4X6CB 1YEJH 3FQUB 4YR6A 3TC9A 5IFHL 1ZA6A 2J88H 1FV1A 2ZUQC 5JQ6L 3B2VL 1PQZB 2XG4A 2LQRA 4I2XE 5JUEH 4BYHA 3CDGB 4GJTB 3ZKSD 3TVMA 5F6HJ 1MFEL 3FT3B 2B4CH 4QXTA 1QSEB 2BVQB 5IWLC 3HE7C 5IB3A 1UA6H 4YXHL 4XVSH 1IL1A 3BZEA 2BOBA 4OIIL 2VLRB 4R6UA 3CCHB 3NIDE 1OM3H 1OHQA 1K3ZA 1JHLL 3MYJB 3W9DB 5DA4A 1KCKA 1RZKH 4WGWB 3CVIH 4S1SH 4LLYA 3T0EB 2BNQB 4HUVA 1S7VA 1MUJB 3SDXA 5L2KE 3O45A 5C2BH 5E9DA 3R8BB 2APBA 5IBLD 3TO2A 4K07A 1FVCA 3OKDA 3FQTB 1QR4A 4HWEL 5DJ6A 2VAJA 4PJGE 3NTCH 1OB1B 4I18B 1BFVH 3OZ9H 1KEML 4CVXA 2C3GA 1KG0B 3BXNB 3VRJB 1HIMH 4XAKD 1GGBH 5D6CB 1TDQA 4L3EE 4GW5A 5FYLH 4U1SB 4GXVL 2PW1B 3BIKA 4Z7OF 1DEEB 4R4FH 2SEBB 2EDQA 2NY2C 4HIEB 2NR6C 1NCUA 1EJ6A 5DK2B 5ICXA 4NN6C 1A1MB 3P2TA 4MD5A 4NJAL 3UPCA 4F7MA 3P4OB 3WNNA 4XP6L 3BESR 4N5EC 4P2RB 2C3WA 4KKCC 4KJQD 2X4NA 4KROC 1LK3H 3WS6C 5KSBB 3TZVB 4CGTA 4XBEH 4XWOC 4R97C 1K4DA 5AUMB 4HULB 1FIEA 5HHXL 3QUMA 3QUZA 4XP4L 4YHLH 5KSAA 5FCSH 3V4PL 2R69L 1SJXA 4HPOH 5TDOB 4M7JL 4YJZL 4M93B 3S36H 4FNLH 2XNAA 2CJUH 2RGSA 3CX5J 2X1WL 3MUY1 1S9YA 2JCCE