4OB5H

Ontogeny of recognition specificity and functionality for the broadly neutralizing anti-hiv antibody 4e10
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
125
structure length
122
Chain Sequence
VQLVQSGAEVKKPGSSVKVSCKASTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCAREGTTGGWLGKPIGAFQHWGQGTLVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ontogeny of Recognition Specificity and Functionality for the Broadly Neutralizing Anti-HIV Antibody 4E10.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords 4E10 antibody germline precursor 7 heavy chain Fv
total genus 22
structure length 122
sequence length 125
ec nomenclature
pdb deposition date 2014-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ob5H00
1JFQH 4Z95H 5IGXH 4JDZB 3OB0K 5F7DA 1OP5K 4WV1B 1FL5A 4ZS6C 5GPRA 1DQQA 2E9IA 2YN5A 3EYOA 1Z5LA 4NNPL 4K8RC 3SGEH 5DD3L 3LKOB 3QUZD 5K9KA 3U0WL 1BFOB 2V2WB 2FLRT 2P45B 2NY0B 2EIEA 1A6AB 3MZTA 4PLOB 4QTHB 2YD8A 4UQ3A 2W0FA 3QO0A 5DF0A 2ZG2A 3P9LA 5EU7C 3V5DB 4UNVA 4FQXB 3FFCD 4F9PC 5F9JB 3QUZC 3IRPX 1GGUA 3VWJC 4PJBE 4OI9A 4K07A 2NXYB 1QQDB 3BXNA 4LSDA 5C09B 5F7HA 2Y23A 3MLSL 1A9EB 2AGJH 1R24A 1T0MB 1MFDL 1A7QH 2QHRL 3RKPA 4CU8A 1GGCH 4U1SB 2D0GA 3GSWB 4RFOL 2VIRA 5FUOH 3HPJA 3JV0A 2Q7NA 3PWLB 1KGCD 5A2JH 2VQUA 3EJYD 4LCCC 2Q7YB 1N8ZB 3QIBC 4K2UL 3V8CA 2D7MA 5A2IH 4LHUD 4UZGA 1GAFH 3TCLB 2R1YB 5C0CD 2PW1A 5D72L 2JJSA 1H5BB 3LKRA 1S78C 1NBZB 5IB3B 1OP5H 4PYHA 4U7MA 4X8XA 2WSKA 2JK5B 3MA7B 2FZ3B 4OZIA 4L8DA 4NP4H 1FDLL 2X44D 1WGOA 2QADB 4UIKH 1OTUD 5F89A 3RHWK 1LEIB 1PG7L 3EOYG 1AIFB 1FFOA 4X7SL 4WHTA 3WFHA 1U8LA 4L29A 5DEZA 4MA3A 3I6LE 5JW3L 5A2FA 1UEYA 2V2TB 5D7LB 3MBEC 1T0MA 3PGFH 4HIEA 3H3PH 3NH7H 4JFEE 1NUFA 3QXDA 2VQ1A 5T3XH 4FQQA 3T8XA 4HWEH 3GK8L 4MCYB 1BBDL 4BH7B 3QQNA 5HBBA 4WHDA 4NZTL 3DWTA 3QFDA 4LSVL 3ALWA 2FB4H 3BGAA 1MRCL 5FB8A 2OMBA 4FQXA 2XZAH 4L5FL 3QI9B 1RK1B 5BO1L 1KT2A 3MGTB 3OZ9H 2AJUL 3IDGB 1SJEA 2QADD 5A2KH 4BJLA 3CFKA 2GUOB 1OAYL 1DLFH 2BSSA 5FK9A 1HNFA 3MLSH 4NGHL 5IQ7H 3BFOA 3S37L 4WCYL 4JKLA 1ETZB 3L95B 2DLTA 2CDEB 4FG6D 4XWOC 4YDLC 3FB6A 1I9JL 3HTLX 5I1LA 2AXFB 4XAKE 1EUTA 1TJHL 5KANI 1JZ3A 1RMFL 1QG3A 5IUSA 1UEMA 2EO1A 4DCQB 4LL9A 5GGSY 2PXYB 1O5DT 4JFPA 5BVPL 3ZTJH 2E6PA 3CD4A 2FJFB 3F58L 4APQC 4LAJH 2YRPA 2YKLH 4IJ3B 1BQUA 5CINL 4D0CA 1RQ5A 5T1DL 3SGDI 1VPOH 4RMUA 4JO3L 2XRAH 4PJEE 5KVGL 2AS5M 4OI8A 4LLYA 3D85B 2PUQT 1OSZA 4DKFH 4AG4H 1C12A 4HX1B 4OD1L 5D70L 2AXGB 1Y0LB 4F3FA 2HTKD 1JZ7A 3CVHA 4FABH 3LV3A 5CGYD 4MMXC 1HHJA 1N5AB 5KVGH 5I15L 4UTBH 1R5VB 1B0RA 1VPOL 4OJFH 1AC6A 1HINL 3NIDF 4Y4FD 4K8RL 3HI6H 4HCRL 4IBLT 3OAZH 4UV7L 2JK5A 4E41E 3VGFA 3P77B 5C0EA 2VLJD 1RHHB 3H42L 4F15C 5CEXA 3EOAA 4IMLA 35C8H 4MX7A 5TDPB 3L9RB 1KXVC 2NR6D 3TBTB 2O61B 2DKMA 1OTSD 3V6BR 2VMFA 2V9QA 1Q0XH 1Y6NR 4ZNEA 5FYKD 2DLFL 1IGML 2GT9B 2R0KL 3HB3C 1MCDA 5F9WC 1J0ZA 3AREA 1U3HA 4EDXB 3O4LE 3A6OA 5T3XD 4ZFGH 1MOEA 1P2CA 4XCCL 1S8DA 5H94A 4MXQD 3MJ7B 3MLXH 2AJUH 1OPGH 4MVBC 5EU6B 1ITCA 4UBDD 5CGTA 1MREH 3O81A 3PP3H 5GS1C 3TC9A 3ULUD 1FG9C 1B4JH 4YEFA 4APQA 1I85A 5HDLA 3QI9D 4HWEL 2YD5A 1QSVA 3KPSA 1ZLVH 3P0YH 5E95B 2UZIL 2NX5E 3D3VD 1SJHB 5DR5L 5CCKL 1BWWA 5HPOA 3P73B 4LLDB 1DSFH 3QQ4A 5BRZE 1V3LA 2BNRA 4LPTA 2GITB 2ILLA 5GZOD 1OF2B 2CLZA 4M02A 2D0FA 4OZGB 4PJGF 4WHYG 4KAQH 1HILB 1Z3GL 4JM4L 1NMCB 4MJ2A 5IVNA 2A83A 3MFFB 4P5MB 3E0GA 3T2OA 1JF6A 5GS0D 1U8NB 3O8XA 2FX9H 2C3GA 4L1HA 2CKBA 4KUCD 3VXSD 5IT2H 1U8IB 4JFFE 4YDIL 3C09B 2CRYA 1QSFD 1NGZA 1KCUH 3I6GB 3I2CL 1R3IL 1MHEB 2NY6C 1YNTB 4ONHB 1QSEE 4EXKA 3B8YA 4I0CC 1XGUB 2ZCKL 4QHNA 1HEZA 3MRRA 1DQLH 1UACH 1DANT 1N3NA 4N5UA 3UC0H 2FD6H 3VI3E 1EV2E 3N0PB 2E9BA 3KYMA 4R4BB 4FP8H 4RGNE 1AGFA 4GXVL 2V17H 1F4YH 3EFFA 4ELKA 3NTCH 4N0CD 3OXSB 1YMMD 2NY3D 3RY4A 3TP4A 2P5WB 2ZWLT 2Y06H 3QCUH 4MXWL 4OD3H 3FQUB 1EIBA 3MV8E 4V1DE 4NUGL 2UV3A 1B6DA 5GRVL 4HZAA 4NCDA 4JM2F 4YHZL 3KJ6H 2DQFB 1LNUB 1RK1A 5I1IH 3BKYL 3PV7A 4Z7OE 1Q1JL 5I75B 4M7JH 5F71A 3ZTNH 4Y4HA 2QV2A 4YFLI 4U49A 3QUXD 3V6OE 3D2UB 4M1CD 4XP1H 5FYJE 1AFVH 5D7SL 3U7AA 4NNPH 4U1HB 4YHNA 4QRPD 3IDYC 5IWLC 2R1WB 4O02H 4OFYA 1FPTL 4LGPB 4ZO8A 4AQOA 2FJFA 1O7VA 1INEH 4HZLA 4G8GB 3ESUF 3L3DA 2DMBA 4I3RH 5DO2D 1UM4L 4OCXH 3S37X 3U9PH 1MH5A 4HUVB 1A22B 1P6AB 5L8LB 4N8PA 4NRXA 5I19H 5HHNB 2OJEA 4Z7OF 4HUUA 4ZDHB 3TZVB 7CGTA 4ESKA 4UT9H 2FECL 4ZFOL 1LVEA 1FGVL 1UB6B 3AUVA 4Y19A 3VDCA 4GAYA 4YHKL 3ILQC 1F4XL 5DEFA 3QH3B 3T4YA 1RZGA 2O26U 5E24E 1LD9B 2LV4A 4JFQA 3BN3B 1TXKA 5EH1A 2OTUA 1JGDB 4G8GD 3RFZC 4U6YB 3QUZB 4NQDA 5K93A 5EU6E 5KS9E 4JHAL 4K3EH 2F53A 1LO3L 4PP1C 3QCTH 2DLIA 5FGCE 3LZFH 4FN0A 1D9KA 1MNUH 1P4BH 2HKFH 2NY0C 5L6YL 1JHTB 1IC4L 1KG0A 2IG2L 5A3ID 5JOPD 5IVXE 3HCVB 5KANG 4XAWH 3X12A 3BUYB 4QF1A 1OB1A 1S9WB 4PYGA 1PAMA 4D9QD 3SE9H 1IC5H 1YEKH 1N0LA 1AGBA 3L5IA 2ZSVA 3L5WA 4PP2B 3WNPA 3AFLA 1YEDB 4NKOB 2EH8H 4JANA 4Y2DB 2MQ0A 3UZVB 5LGJB 4OV5A 4YHIA 43C9B 3B2VH 2G75A 2RFXB 1LP9F 4A2MA 5F7FA 1OD7A 2ICES 3PWVB 4YNYA 5EN2A 2RCSH 5FM5O 1TCRA 1E4XL 1LWRA 3SKJL 1AI1L 2X09A 3DO7A 5EOCL 3VWJA 5FECB 5DD0L 4XXDA 3NFSL 1FORL 1G7LA 1U8KB 3RGVB 3UTQA 2OJEB 1ZA3B 3OAYH 3OMZA 2ICWJ 4X9GA 4PBXA 2NY1C 4QRPB 4G5ZL 3GRWA 2FO4B 3MRDB 3SKNA 2ICWI 2H1PH 4YH6A 2F15A 4LHUA 4WI4A 1NCBL 3VG0L 4PJCA 1M7DA 2X4PB 3L3JA 2BXYA 5KOMC 4XNZC 3GMNB 4Y2DD 4IOIA 3H0TA 5E2UH 1NJ9B 1ZHKA 4WUKH 5TH2A 3NOIA 4FFVD 4GKSA 2W0LA 3HI5L 1G0YR 4M8VA 5I1AB 4YR6A 1PFCA 4P2RE 3REVA 4NQDB 1PVHA 3AROA 3QH3A 3T4YB 4ONFH 3U1SH 1IT9L 4XCEB 1K8DA 3JWDL 3X13B 2CJUH 3WLBB 4YNYB 3A0OA 4HIHA 4OZFH 4CNIA 2A77H 4I2XB 5HGDA 3V4UL 4OZIE 4OF0A 4U0QB 4X9IA 2Y36L 1BVKA 2DS4A 3JV6B 5TDNB 4QOKA 2MNUA 4GBXD 2P8PA 1UYWH 4X6EB 3V0VB 2ZSVB 5SX4H 3CFBB 5IOPA 1RJLA 4BZ1H 2NYYC 2XWJB 4NRYA 4ZFFA 5C0FB 4YHYC 1ZSDA 3VD5A 2F74B 4Y16C 4YHNB 1P53A 3LKSA 1FIGH 3JVGC 3E6HA 4JRXD 4PREA 1TCMA 2MMXA 5HHQA 4Z7VA 5IKCB 1NQBA 4YFLF 5GGSA 4PTUB 4PRNB 2ZUYA 4NQED 5HYSB 3C5ZB 4NQVB 3TVMB 4MJ5B 3C60A 1E27A 3EJZD 4Y5XC 4OGAC 1RZJC 1N2RA 3D69A 4ALAL 1G6RA 4LPYA 3EOAB 1C16B 3AVEA 4GAGH 3SY0A 1A1MA 4WFED 5CIPH 5FYLD 2X10A 2ZCHL 2FX8L 3RX8A 3C2SA 3MRBA 5DVKA 5CUSH 2A6IA 2NTFA 3KPRE 3QHFH 1OGAE 2CMRH 2HT3D 3MV9A 4OM0L 5JQ6L 3UMTA 4YR6B 5I73C 4U7SA 4TVSa 3UPRB 2IADB 3GSQA 3S98A 1IAIH 3LKQB 4MJ6A 1CDJA 4B50A 1FGNL 2EZ0C 4JDVA 5MEPA 2H26A 5M7QA 4LKCB 3MV7D 4LSQL 4G42B 4G6JH 4CVZA 3O6KH 1T83A 3FB6B 4HXAH 1R3JB 3D39A 2HRPL 1OOAA 3HLAA 2E7LA 5SWSA 4IRJA 4LGRB 4IRJD 3LKPB 4PJFB 3UTZB 1UXSA 3F8UB 3LQAH 4XHQA 4JY4A 4XP5L 1NGPL 4G9FE 4NO0A 4D3CH 3N1MC 1YNLL 2COQA 2GITA 1IAIM 3E3QC 1U8QB 4G3YL 1NEZA 5HYQA 1I85C 1ND0B 3W2DL 2DRUA 4QNPE 3WEXB 2LU4A 4N0CC 2BVTA 3O6FD 4HH8A 5CZXC 3TBWA 4LU5H 2IH1A 1P7KB 5JIKA 1KENH 4G8IA 1T1XB 4KKAD 5LGJA 2YD4A 3M07A 4OLXL 4H88H 2IANE 4P2OA 5D1QB 5B3JF 2EE3A 3VFMB 5BJTA 3LZFL 1MCLA 4J12A 3BAEH 5C0RL 1YECL 5JHDB 1FNFA 4PGEA 4IJ3C 4PJHE 4QKXB 4BH7A 3LHPL 1FZKB 2X1WL 4OFDA 3VFVB 4Z77B 3HUJA 4YPGB 1WFNA 4JHAH 1X5LA 4K3EL 4ZUWA 2H9GB 1JCKA 3GGWB 4HGKC 5DGRA 4J3OC 1QUNA 5HI5C 4O58H 1Z6JT 4RA0C 1A6UH 4XPHL 2X4PA 3BDYL 4IIQC 3DYPA 2FIKB 5CP7A 3MCKA 2DF3A 3SKNB 4KWUA 5DJXB 1LO4H 1JTTA 1WV7T 3O8XD 1Y18B 2NX5A 5DHYB 4GH7B 4YHKH 4M3KB 3L95A 1V3JA 2VKXA 4ZPVB 5FYLH 1YMHA 4G9FA 4RSVA 4KROD 1FGVH 2XWTB 4X80H 4TSAL 4M9PA 4LNVA 3HNTH 4JDTL 4UT9L 1TVHA 2QQQA 3CUPB 3PL6B 4PGZA 1FVCA 1NEZG 3EYUL 5FYLE 5HD8C 5I19L 3MA9L 3PQYA 3PJSB 1RVFH 1FFNB 3H9SE 5TE4L 1KT2B 4ONGH 3V79C 4LP4A 1RPQA 4I3RL 4OV6F 4TVPD 4HIXH 4D9QE 3FJTA 2OL3L 1A14L 1M4KA 2IANA 3D3VB 1HKFA 1FPTH 5HHME 1VACB 3TWCH 2QHLA 2ZSWB 4M62L 3ZYOA 3GI9H 5HGBB 2VLKE 1Y0LA 4F3FB 2LTQC 4K3JL 4YE4H 3QUMB 3DETD 4M6MH 3HPLA 2E7HA 4M7JL 4LLMA 2HVKA 2X4RA 2DL2A 4Y2OA 2IC2A 3IT8D 1T2JA 4M9OA 1D5ZA 3KLSA 4LARL 1GSMA 3EDJA 1CR9H 5HHOB 2HJLB 3TH4T 1URLA 3MOQA 5C0FA 2WUCL 2EYRA 1LE5A 3BAEL 2C1OB 4NNXB 2Q87A 5FO8B 5IVOA 1UH4A 1EX0A 5E9DB 3D9AH 2BJMH 1BBJB 1A3RH 1KENL 1UZ6E 4JPKL 2GW5A 1WC7B 1MCJA 4OZ4A 3U36A 2HH0H 3I6LD 3O3EA 4PJIE 4OLYH 5DS8A 4OUUA 4MAYD 2O93L 2LAGB 1UENA 1UWEH 4NC1E 1XMWA 1EHLL 4KI5E 3ULVD 4P3DA 4QYOB 1SQ2N 4G8FB 2IALA 4U4BA 3LSOA 4JFDE 4HJ0D 3G6AB 5J13C 4MQXC 1R3IH 2J7LA 3SE4C 4BFIA 3LEXB 5INDB 5IB4A 2DB8A 3PWNB 3WUWA 3MX0A 3QXVA 3S97C 5F3BA 2J1KA 2HLAA 4O00A 3SOBH 2FYYA 1KLGB 1QO3A 2EDQA 3EIFA 3ALPA 3GBLA 5DMJB 5IM7B 4X4MA 2ATKA 4FXGB 3KYNA 3T0AA 5C2BH 5JDJA 5I9QC 3T1WA 1XF2A 4U2YA 1U58A 5FYLL 1CT8B 2CMRL 2CXKA 4YHPA 1CWVA 4OT1H 5T1LA 3U6RB 3KXFE 3Q6FA 1LO4L 2YZ8A 3BQUA 4S1QL 3VXSE 5DMKA 1L6ZA 3MGOB 1G7QB 1JNHB 2VL5A 4GUPB 3JBG7 4JHZA 2Z8WC 5MI0C 1IAII 3FHAA 3HE7B 5A16A 2JCCE 4P5TC 1NBYB 2FJGA 1OY3B 3HG1B 3V5HA 4QXGH 3KLHD 1QLRB 1YDPA 3D18B 4UNTA 3IAPA 2E6JA 1L9MA 2A0LC 4X6CE 3MJ9A 4J1UA 4XGZB 5D93B 3SO5A 3S88H 3LQZB 4RCAA 2AJ3B 5D2NC 3WFCH 3RGHA 3DXAE 5H8DA 5E8EA 2BSRA 4JGMA 4K7PH 3BRGC 1XF4A 1BJ1J 4G3YH 5JZ7C 1XH3A 3LH2H 4ZOAA 2WQ8A 4DGYH 1YNLH 4X4ME 4ZUWB 2GTWB 5IEKB 3PHOB 4KTDL 1LMKA 3X13A 4R2GB 1E4KA 1CBVL 4NIKB 5EOTA 3FT2A 5IR1A 4KRPD 4YXKH 5IW1A 4ZPVA 4JM2B 4N9GB 4LASH 2P4AB 4J6RL 3ZL4L 1QKZL 1CU4L 4V1DA 4MD4B 5T5FH 5SWZD 1L7IH 4I1NB 4PJ7E 3CUPA 4J3UA 1WBZB 1PEWA 4ONFL 2EKSA 4G9FB 1J10A 3G5VA 4NQEB 5CINH 4GJTB 3G5ZA 3KPSD 3ROOA 4UV4L 5IBTL 5F8QC 4XMPH 1BD2D 4JKMA 4ODBD 2DQGL 2P7TB 3OKYA 5CUSL 1JRHH 5LVEA 4PRDA 1I8IA 1E4JA 1ZMYA 4OQTL 5I1LB 1J05A 2AEIT 3N85H 2AQ1A 2D7OA 3NA4A 4OKDA 2O5YH 1MY7A 2WMPA 4QOKD 4CBPA 1WIOA 1AO7D 4G5ZH 2AVGA 4PG9A 1YEIL 4GRLC 1VERA 5FYKH 4AM0B 1JE6A 4CKVX 1LE9B 1FZKA 1RJYB 2AJYH 3MGOA 2BSTA 4QHLA 3RVTC 4JY5H 2L0DA 4AEIL 2M1KA 4HK0A 2Z8VC 3DX9A 4WO4D 1T7ZA 5I1CL 3QDHA 2MJWA 4KKLD 1KIUA 4G9FD 4HIIA 3C5ZD 2D7TL 2A83B 1I7ZA 3MFFA 4ODHH 3C9NB 4TULL 5JO5B 4JRXA 3QPXH 4LLWA 1E0OB 4OM1H 5HGGS 3G5XB 2C1OA 4NNXA 1YYLH 3EYOB 4LQFH 2A6KA 1WT5A 2W9DH 3QIBA 3B5GA 2VDMH 5T3XL 5F7EH 3OAUL 3MGTA 1IQWL 2JJWA 1ED3A 5B3JE 3QFJA 5ACZA 3UYPA 5K59F 3U0TB 4L3EB 2J8UF 4HWBH 5DFWH 1IC5L 4HS8H 2RHEA 3ULVH 3QG6A 1TDQA 1OSZB 1RK0B 4I4WB 4UQ2A 1K4CB 2WBKA 3U7WL 5JW4R 5E2TH 5F3HB 2XACC 5C0IA 1OQXA 3QUZA 4CVZB 5L6YH 5IVXA 5GZNC 5D2LA 3DUUA 4PJ5B 5K9QG 3BP6A 4J23A 3F7VB 2EXWC 3VWKB 3KG5A 4C54A 3O6LH 4XNUH 3VFPA 1S7UB 3MV9D 3VGEA 2DQIL 2Z93A 3NN8B 4Q9QL 3QNXB 2OJZL 5AYQA 2EKJA 1WIPA 1CZ8H 4J8RA 5AUMB 3P11H 3FTGB 3V4PH 5IK3A 2PTTB 3GSXB 1WBZA 1FYTD 3MRFB 4L4VE 4U3XA 3BIKA 2OZ4H 2OK0H 1YUHA 3MYJB 4ORZC 4PGCB 2PW1B 1D5MB 5HYSA 1U58B 5DT1L 5LGHL 12E8L 1HHJB 2ADGB 4BYHA 3ZYIA 1MCPH 2I25N 3MV01 5A1AA 4Y5VA 4IHOA 3RJDA 1U8OB 3T1FA 4AM0A 3IGAA 3C6LA 1BLNB 2JLLA 4L8CB 1BJ1H 1UM4H 3ARYA 5I2IB 5IG7B 4PG2C 1NLBH 1Q9LB 4BSWA 3H9SD 3CSGA 4KHTH 4I3SH 3H6JA 2FR4B 1QLRA 3FQRA 5EBLB 2R2BA 5C09A 4NYLB 3JV6A 5TDNA 5FO9B 5E1AB 3ARGA 1GOHA 4GQ9L 1BF8A 5EB9A 4ODVL 2Z35A 1C8PA 4LPVA 5IOPB 1DR9A 3QULA 3V4VH 4PJFF 5I1IL 4TYUA 1MHHA 5GS3A 2BSSB 5J1SC 5CEZD 4LIQE 2BVQA 3MUHL 1FH5L 4L8SB 3BH8A 3SGKC 3VFGH 3U82B 1ZA6B 5IMLA 3FT3A 2E7BA 3N06B 4JB9H 5IW1B 1U6AL 1DBJH 1NUDA 2H32H 4GMTL 3VGBA 1EHAA 4QT5A 5EUOA 1MNUL 2HFGH 1IVLA 2KKQA 4OGAD 3T2QA 4IS6B 4FP8L 3VRJA 2C3WA 4TNVF 2CPCA 2Z92B 4BKLA 1IKNA 1FVDB 3D1MC 4R4ND 5KTEH 1JK8A 3EOBB 4ONHA 2PXYD 5I1GL 5KAQF 2J6EA 2AW2A 4E5XA 5ESQB 3OKKB 2ADJB 4JQIL 1ZT4A 1EJOH 3RX7A 1NBQA 4U05A 4KJYA 3HPLB 4DUVA 4NPYA 4D8PB 1IM9D 4NQCA 3O3AB 4GRWF 1FFRA 1XIWA 3DOSA 4NKDA 4I18A 1KTDB 4HPYH 3S5LB 3GJEB 4Q9RL 4HKXB 1KCUL 3NIGF 2JKXA 1JGLL 2VXTL 1CLCA 4FFYH 4O51A 2LVEA 1BVLB 1EEZB 4U7KA 1HHGB 2IQAB 2VR9A 5D2NE 4OLUL 3UYOD 4WWKC 4H25A 3QEGH 5EO1B 1M1SA 1WBXB 4PLKD 4PJ9D 4QTHA 5ALBL 3K2UH 5IMOB 2ITDA 1ZGLM 3IJHA 4AQ1B 4R7NA 2CR6A 4E41A 1BD2E 1CLOH 1EHNA 1YN6B 2CK2A 4E41D 4NM8H 4U1GB 3FQWB 2IAMD 4OB5H 3TM6A 4PJEF 3IVKA 2GFBB 4MQSB 2HWZH 4EI5D 4NNYB 2QKIA 2VXSL 2W38A 1YEGL 2ADFH 5HI4D 3QQ9D 2R2EB 4LCUA 3G6DH 5E2VL 5F7KC 1NCTA 1J11A 4LHJB 2XIDA 4XP1L 3HS0B 4U1SA 4XMLL 4Y5YC 3M1BB 2J5LC 5HHPA 5DHVA 5ALBH 1EZVX 1LO5A 4MB3A 3IFNH 2DQDL 3MACH 5A40E 5IQ9B 4Y4KC 4PJGA 3L3HB 4PJ9B 1GIGL 5KSAD 3RP1A 5DRWA 1T1WB 3LMJH 2X70A 4Y4HB 4NUGH 4HMEA 3K1KC 3SDAD 1JGLH 3EO9L 4F8QA 4M1DL 3SCMD 2ZSWA 4OCSL 4HPYL 3VXUA 5DC4B 2B4CL 3AC0A 3LD8C 4M5ZL 5HGBA 4YBQC 3WEXA 2DLFH 4CJ1A 2ATPB 2D03L 4GRWH 2J12B 4PJDE 1EJOL 3VXNB 1CF8L 2DICA 3QAZC 5LCVH 2OTUB 4RMVA 3VH8G 4F7TA 4GW5A 5I1GH 1KLFA 3R1GH 2PTTA 3C60B 3GJFH 4OAWA 5KG9B 2LE9A 5AWNH 2C4FU 4K8RH 2YA2A 2OCFD 3SDXA 4LSUH 3ZDZF 1DBJL 2MWCA 3DGCR 1RJYA 4LMQI 3NGBC 1MH5B 4F8TA 2W9EL 5FOJA 4GAYB 2YPVL 1RZ8A 1P6FA 5JMRA 1IL1B 1DEEA 4AEFA 1FE8L 1IBGH 2BERA 2R4SL 5HHQB 1QFOA 5FYJD 4HS3B 4M5YH 5CEZE 3K8MA 4PJGE 1N3NB 1ZA3A 4O5LL 3UJIH 2QR0B 3MUJA 2Y25A 1S7VB 3OKDB 1PW3A 4PRPA 1DSFL 2YPKB 3C5SA 3QG6B 2RAMA 4P46C 4U1MB 2DDQL 3OGCB 3BIBX 1A1MB 5C0BB 3Q5OA 4LDLB 5INCA 4N9GA 3ZT6A 1HH6B 4GKNB 4OFIA 4P2YA 3PGCB 3TEUA 3QWQB 1DLFL 1CFQA 1OAYH 1QFUL 3U2SA 3P4MB 1A1NA 2CLRB 1I1AB 5DJYA 4P9ML 4UT7H 5BO1H 2VUOA 5MERB 1H8NA 1MRCH 1OCWH 5KAQG 3UTOA 5J12C 4NZTH 1JHKL 4P5TB 4K7FB 2H26B 3VXOA 4F2MB 1J05B 3S6CA 1T89A 4UTAL 2R0KH 2BRRH 3VDAA 3OKKA 2EIZB 4XNQB 3MRKB 2EIDA 4YHOL 5DD1H 5GGVH 4KPHL 3NABL 4TSCL 5SWSB 3UDWA 2Y6SD 3N1GC 4IS6A 3IU3A 5KW9H 2YD2A 3NCFB 3O6LL 3CZFB 4WI7A 1PY9A 2JCCB 1TCRB 1KEGH 2SEBB 3SDXB 1CGWA 1FL6B 1KIQA 2E27H 4WI2A 5I16B 3GFUA 4KI5D 5FKAB 4F80A 5T5NF 1WK0A 2MFNA 1L0QA 4P23D 5GSRA 5E2TL 2CLVB 5C7XL 3WS3B 4N0UE 3NCJL 5HI3C 1ADQL 1KEMH 4GRWB 3IS0X 2VISB 1FNEA 3I50H 4NC2B 1WFOA 4LVHB 3GMPB 5HPMA 3EJYC 5TE6H 3P4MA 4MXVE 1Z9MA 4OSUL 1IQWH 4Y0GA 5E1AA 4KRMB 4N1CA 2I24N 3QUYC 4OLWH 5L2JA 1WF5A 4JO3H 3JWDC 1E28A 4XPAH 2X42A 1I3VA 3H3BC 3PL6C 3FO2A 4IOFC 5DJDA 5C07D 3VFTA 3EO0B 4GLRH 2AXJA 4TPRL 5E7FA 5TH2B 4CL7A 2I07A 1AE6H 3EFDL 2V2TA 5CZVH 4TULH 3F7YB 3C8HA 3ZHLA 5GIRA 1TJIH 2AABH 4NHUA 4P99A 2AK1L 2CIIA 1BFTA 4ZUVA 4ENEC 5IB1B 3MLUH 4IOFD 4HG4J 1AE6L 3BEWA 3NPZB 4FQ2H 1YEJH 4WW1A 4HXBL 5BOPA 5IQ7L 2OYPA 1OAZH 4AK1A 1A4KB 2C4XA 3KPLB 5D8JH 4AZ8A 3MOAH 4FQ2L 1MLBA 3O9WC 4ZAKD 5DHXB 1T0NA 1VADA 3OZ9L 2APVA 3MRFA 1YJDL 5A3IC 3CFIC 1NDMA 4LCIH 2VDLL 2WWKT 3JTSB 2Q7YA 4HUXA 2WUBL 4F9PA 3QDGA 5F1NB 4UNUA 1CD8A 2DI9A 5E0QA 4GW1A 5DRZB 4PJHF 5D1XC 4QTIL 4RWHA 4P4KD 1FG2B 3FQTA 1JZ5A 1RIUH 2EDFA 5LKNA 4OZFB 2OS7A 5CBEB 3MRRB 3HAEG 4J6RH 1UFUA 3IJHB 2GSIA 4BQ8A 2UYLB 2VABB 3I9GH 4UDTA 5FHBH 4F7EB 2ICWA 1JHKH 4ZS7L 5DUBB 5IJVA 4L29B 1NJ9A 1OCWL 2DM4A 2YPLE 1QLFA 3NIGE 3IKKA 5FHAL 3RY6A 1RZ7H 4G7VH 4LCUB 1O7SA 3DX8B 4POYA 3H2WA 3ECBA 5J6GB 4NWTH 1BFOA 2V2WA 2NLJB 5J1AA 5GGVL 1GAFL 4P2RA 1QFUH 1QNZL 3BHBB 3P2TA 4K9EL 2VXUH 2VLJB 3MBEA 5BZWA 2FH6A 2FJHB 3ARFA 2BVYA 5KVDL 2P8MB 3FT3B 4S11A 2UWEF 3CAFA 2FHCA 3I6KB 4PRHB 4LLVB 4DOHE 1HH9B 2M8XA 1N0XH 3QXWA 3TN0B 3BE1H 3C60C 1OAXL 4JM2C 3QPQD 4X99B 2IBGA 5DC0A 2E8YA 4CUCA 5BXFA 2AGJL 5I8CB 3CFCH 5I30L 3P9MB 3RI5K 3FFDB 1EMTH 2A2QT 3GSVB 2MPAH 2Z31D 4MYWB 4EKXA 2NR6C 1F4WL 4WW1B 5D96B 4M6OH 4KKAC 3WFDH 1H0DA 1JNNH 4NC1C 1ZT1B 3RWJB 3ILPA 1NLDH 3L3KA 3OG4B 2JB5H 1J1XL 4JFFA 1X5ZA 4P57A 2D3VA 4L9LC 2D9CA 2Z91B 3UJIL 3WJJC 5TF0A 4MVBD 3KPRD 1N59B 4YC2C 4EI5B 3O3UN 4FTVB 5I9QB 1NANH 4JFQB 2GHWB 1IBGL 1R5IA 2UY6A 1MPAH 4YIQA 4XBEL 4ZPTB 5LCVL 2GSIB 5JMOC 4WV1C 4H0GA 3WIFA 4LCYB 3B43A 3CDFA 1IGIH 2E9JA 3NPSC 4PJCF 5CBEA 4Q2ZB 4U6HA 4R2GC 1S5HA 5K9OB 4A6YA 2B4CH 4C56D 2KPNA 2VLJE 1GRWA 4LSUL 3KXFA 3SN6N 1AJ7L 3TIEB 5IFHH 5JPNB 5DLMH 1LK2B 2G60H 3OHXA 3HA0A 3TBVA 1WITA 1S7UA 3WE6B 4JJ5B 1YMHB 2RB8A 5D2LB 2GI7A 5IQ9A 2IAND 5ANMB 2AV1A 1P4LB 1KJ2H 2K3TA 5F1IA 4OZHF 5FA4A 4O4YH 4LKCA 1LP9A 1CDGA 4HHAB 2BJML 5IHUH 3QIUD 3MO1A 4Z7UB 4GRMB 3S36H 3MJ7A 4WFHD 3P4OA 1PEZA 1RUKL 1PY4A 1LO2L 5JPMB 2APTA 4Z76B 1CDCA 5J7CC 4NHUB 2Q6WB 3VXMB 1NCUA 5ICYA 5DD5L 2BY0A 2E7MA 1JIBA 2AQ2A 4QHMA 3DSFH 3LS5H 4M6ML 1CFVH 1DBAL 4K71B 3FOLB 2B39A 5GHWH 5FDWA 3TT1H 5E2VH 3HAEB 4JLRA 1GC1C 4LLDA 2YD7A 4U1KA 1YYML 5EA0H 3QNXA 4QHLB 1GHFL 1VFAA 1IM3B 1U41A 3V6FB 1OARH 1QEWA 2EDLA 1U8QA 5IWLA 3SDYH 1Z5LB 3U46A 1A6PA 3EFFB 4MAYC 4UT6L 2P5WA 2CLVA 1ZVHA 1CK0H 1KCVL 2N1KA 1DDHB 3FMGH 4KUZH 4NZJA 5ECJE 3UTSB 2GAZA 5ISZB 4JDTH 1CLOL 2B1HL 4D9LH 3S3PA 1RAMA 4GKSB 4NZUH 3MRMA 3U30C 3ULUF 2D4DA 1FIEA 3MRPA 3DI2B 1CTOA 5IB2B 4LCWE 1W8OA 2FEDC 3S9DB 2GJJA 4MA1B 2EXYC 3PP4L 1RHFA 4L3EA 3NPSB 4C56E 5EFIB 1BGXL 3FFCB 2AQ3A 4F15B 4QRUA 5AZ2L 2J8OA 4P59H 2WANA 3BPNB 1K4CA 5EWIH 2CDFA 3SDCD 2P5EB 4KFZC 4OD2A 1DN0A 5FUCE 4CN4A 2R69L 3D2UD 2ICWB 2W60A 4IDJH 3ARXA 5D9SB 1NSNL 3DO3A 4DKDC 1AKJB 1DUYB 3GMQB 3TZVC 1JPTH 1TZGL 2ENYA 3C87A 5GGUA 4DOHB 3DURA 4NO5B 4JLRB 3Q5YA 4R3SA 4X9HA 3IFLH 4GT7A 3L3IA 1IM3A 1X5FA 1Q38A 2I27N 2K9UA 4H88L 3O45A 2FRGP 4PJ9C 3W11C 43C9A 4RGOL 3GSNH 5EU3B 3K7UA 2E7CA 2BOCA 4OBRA 1NLBL 2GKIA 3STLA 3KHQA 3L7FB 3WFDL 3NZHL 5IMKB 2ZJSL 2BNQD 3AS2A 3CH1A 1DVFA 5CIPA 2AXHA 2PO6A 3QDME 5JR1L 4CW1A 3TBSA 1XH3B 3TN0C 5H2BA 3OKMA 3ILPB 2B2XH 3MREA 4H5SA 3EW3B 4R96A 1KJ2A 3HG1A 2WM0A 1YDPB 5MEOB 4HXAL 1JWSB 1N0XL 5IG7A 1IL1A 3LCYA 3BYYA 1M05B 3BX7C 3IDYB 1DDHA 2V7HA 3BIKB 3IDMB 4BQ6A 2ESVB 1KCRH 3SEPA 1MRFH 2BC4A 2VLRE 5DHYA 1L0YA 5GGQH 4O9HL 1MCPL 5JNYB 3NGBB 5LGHH 3DARA 4Y2DA 1RZ7L 3I75A 4G7VL 3QNYB 4JFDA 25C8L 5E5MA 3HNVL 4NN5C 4JQVA 3GHBH 1R24B 1GGBL 4I3GA 5DXWA 2P5EA 4ZS7H 5DRWB 3PHQB 4XBGA 5HTSA 1C5BL 1IEBB 3U7WH 4RZCB 1KIPB 5H35A 3T0ED 3BZFB 3I3BA 3BPLB 3CC5A 4PJBA 4RQQB 3N1FC 2GJZA 4YX2H 5D7IB 3GZKA 4KMQA 1JGEB 4RGMB 3OAUH 3KAAA 4L9LB 3DX7A 3RHWF 5HGHB 1ZSDB 2FYYB 4BM7A 4ZO7A 2GSGA 2JTDA 4ZD3H 3INUL 1CFNA 1G9NH 1HYRC 1YYLL 3OJ2C 1TZIA 2Q8BL 3QT2A 5JXAH 4HC1H 4MDJB 1NEZB 2XNAB 1RD6A 4JRXB 3QEHA 4ELMB 1D5IL 2DQHH 2D7TH 1CS6A 1GL4B 1EAPB 4G8EA 4J3SA 3VXPA 4GW1B 3MLYH 5D7KD 3DV4A 1YN7A 3T65B 5F1NA 2VZTA 3OJMB 1PZ5A 3NZ8B 3MROA 5E9DA 5TQ0H 3T3PF 4N0RA 5D8JL 3RIFF 3HR5B 3SDXE 1KN4H 1WEJH 3D25A 4ZPTA 1S5IH 3PXHA 1FJ1B 2A73B 4P4KB 1G0DA 5B38A 1XIWB 3U79A 3ARBD 3MLZL 1I7TA 1A2YB 2VN4A 4M61B 5E99H 3EFDH 3QFDB 1BZ7A 1TQBB 5FYKL 3WHXB 4XXCA 1EEZA 1A7BA 4TSBH 1ACYL 2C1PA 4MCYA 3GMLB 4XH2A 2J5LB 5EIVA 4JO2H 1OVZA 4Y16B 4H1LA 3MLVL 3SJVA 1S7TB 2ZUXA 3RL2B 3AREC 4FQIH 3LPGA 1CG9B 3RAJL 5TE6L 1SVCP 2R0LL 4ZS6D 3ZL4H 4MCZA 1FFNA 4KKCD 5KJRL 1MCCA 4HS3A 4HUKB 1J0HA 1SM3H 1DZBA 4QGYA 1WWWX 5GJSH 2CDEA 1WWCA 4QRRE 4JG0H 3IKCA 5T3XE 3IXTA 4Y1AA 3RWCA 3A6BH 3OXSA 1I8LC 1ONQB 1SYSA 1FO0A 4PJ7A 3CGTA 4DGYL 4X8JB 4NBYB 5EIIB 3RU8L 5B21A 1KELL 2VDKL 4PRHE 1EEQA 4LSRL 3IFPA 1VFUA 2X1QA 4KHXL 1KCKA 3ZSSA 4UOJA 4WNQA 1MELA 2OL3B 5KBNC 4YXKL 2NZIA 4YFEA 1J8HD 2XNAA 1F00I 4FXKA 2Q86B 3B2VL 3KPOA 3P30L 1LE5B 1QYGH 5HHOA 4NO0D 4PJDF 4Y5VC 1DQJA 4NDMB 1VA9A 1EBPA 4M1GL 1BVZA 1JPGA 1G7MB 4Z77A 5AG9A 1XEDA 3DIFB 4G6MH 4H1LB 1MAMH 4IHOB 3BOVA 4D0BA 2ED9A 3STLB 3KYOB 4UQ3B 2H45A 2IF7A 5ISZA 3WXVL 2AJ3A 5FYKE 1DVFB 1MCWW 2VLLB 2WK2A 4Y5VB 4NHCL 4EI6B 3M45A 3T1FB 1OTTD 1ZVSA 5D93C 5B38B 3P40A 3FO1B 3QCTL 5DJDB 1CI5A 4P4RA 4QXGL 2DBLL 1V3KA 5E00A 1T1XA 2NY4D 2WNGA 3VFNB 3BZEB 3EJJX 4TNVK 1C08B 3HRPA 4IRJB 5C92A 5HVWA 3G9AB 4GG8B 1OP9A 1MHCA 3LKPA 3EYQC 1TTFA 3HI1A 1J5OH 1KLGA 4P3WA 4BSVB 2BK8A 1MLBB 4DN4L 3P4OB 3IDIB 4S1RL 5F88A 5KN5A 1XF2B 1DVFD 3DUSA 3UPRA 5EU5B 3KPNA 1NGYB 3GHEL 4BELD 2IGFL 3CC5B 4LEXH 5ACMA 4Z7WE 3QIWB 1JRHI 5DQJB 1AY1H 4DKEL 2GTZA 3U9PL 1SHMA 1PSKH 4PLJC 1I8IB 1EHLH 1VENA 1WIUA 4XHJC 3L7FA 3QFJD 4J4PC 1OLZA 3PWPB 4RQQA 2WINA 4ZTOH 3WSQL 1U3YA 3MTRA 4UDUA 1R3LA 2VDNL 5DWUH 2FGZA 5C71A 1S7SB 4IRZH 5JHLL 2R4RH 5J3HC 5D1XB 4LCCA 3FL7A 1T2QL 3RIAF 5ADOL 1ZLVK 4XPGL 4KK8C 3BKYH 3CU1A 3IDXL 4MS8D 1P84K 3A67H 2FDBP 1TVBA 2YPLD 3GMRB 5L0QB 3R8QA 2AI0L 4PB0H 3ARDA 4X6BB 2PN5A 3ARPA 4NQDE 4XTRD 2F5AL 4MNGA 4MXWH 3RY5A 5ALCH 3LKNA 2PW2B 4YE4L 4NQXB 4I48B 4E42B 4XVJH 4HUNB 4HT1L 4UAOC 1V3MA 1HI6B 3RY6C 3CZFA 4GXVH 1K3ZA 1QRKA 4OGYH 1HQ4A 5HYIA 2HG5A 4ZTOL 4WWID 4LARH 2C3VB 1RZ8B 4OCNC 1I9RL 3H9HA 3BKJL 1UACL 3OF6D 1MCHA 3BPCB 2I60L 3C5JA 1MI5A 1P4LA 1QPPA 4J3TA 4ODTH 1MVUB 3I2CH 1F6FB 4TVPH 2VITB 4ZTPH 2IPKA 4X80L 1HXYA 1CICB 3KPTA 1YY8B 5D7IF 4K8RD 1WBYA 5HY9A 1L4IA 2V7NB 1EEUA 1OTSC 5SV3A 2VLKD 3QRGH 4FS0A 1YPZF 5CD3A 1MEXL 3L3IB 4XC3L 5TQ2L 1F6AA 1G0XA 1XGRA 1QBML 1ZTXL 3HZYA 4LHQB 3GEWB 3CDGA 4ZSOE 4UB0H 1TLKA 2KQNA 4FOMA 8CGTA 4OFPA 1F45A 1CGVA 1PQZB 4G8GA 4YK4C 2UVFA 5F7YC 2Z91A 4EBQL 2YXMA 3HPJB 3MRHB 4XAKD 1S7QB 1G84A 3BKJH 5TGBB 2XN9D 2R1WA 4CDGC 5FIEA 2CRMA 3MRNA 5I1EH 1DQMH 3G08B 4N68A 1QBLL 2R0ZH 4XWGL 4JN1L 1KCSH 4EN3A 2FO4A 3DI3B 3MRDA 3QUML 4LHUB 3SE8L 4K7FA 4HG4K 2D0HA 4QWWC 2QL1A 3LSOB 3VGGA 1RZJH 5FM8A 3F6IA 1VESA 2XN9E 3QIUC 1I7TB 1NC2A 3TA3D 4YXHL 1HHIA 4MD5A 3PWNA 4YUEL 4HKZB 3WUWB 4CN6A 1NBZA 5IB3A 3WDJA 4L4VB 4Z9KB 3QXAB 4YXLL 2DWDA 1J0JA 3OR7A 3E6FA 1Z9SA 4Y1AD 3LN5B 5F44A 2MOVA 2M26A 3NA9L 1NDGB 3QNZA 3BHBA 1TFHA 2HFTA 4MB5A 3VGAC 1T80A 3HG1D 2VLJA 1T7XA 2UUDH 1EUUA 4PLKC 5D4QA 4KHXH 4KZDH 4GKZA 5C0JB 5GRWA 4UINL 4HF5H 2G5RA 35C8L 1SEBA 4HPOH 1RUQH 4KKBD 4OLZH 5E00B 1LO0H 4BUHA 1AO7B 1XF3A 3CMOH 4ZFZB 4QF1B 1LK3L 4NN7C 1J8HA 2WV3A 5IFJB 3MBED 2J4WL 4CGTA 4JRYA 4GSDL 4UTBL 3SDDC 3AY4C 5JQ6H 1UG9A 2ADJA 1E6JH 4QXWA 4DVBA 4U0RB 1LO5B 3SQOL 1LEIA 3C08L 4ZUSB 1AP2A 4Y7MA 1X4ZA 3Q48A 3ZHKA 4G42A 1MSPA 5DK0A 5ANMA 3RAJH 3L3KB 5SWZA 3RIAK 1T5XA 3RWGA 2BSED 4NN6B 1A7RH 5K9JL 1XR9A 3DUSB 4OZHB 1WUNT 4AENA 4LLAA 5MP6L 5HI5D 1MFCH 2AXFA 5IEHA 1CZ8L 5TF1H 3F58H 1MQ8A 3O2WH 2OJZH 3D3VA 1MRDH 1T20A 5E6YA 5FUCC 3W0WE 2BVOB 3RWIB 2DBLH 1HN1A 4PGDA 5DK2B 5DUMH 2BNRD 1EGJL 1VADB 4JHBA 3MNVB 4PJ8D 3DX6A 3QDAA 4X0KB 4JRXE 1L6XA 4KK9D 1A6WH 3ZSTA 4WCYH 2E3VA 5EUOE 3RDTB 3KPRA 1SYVB 8FABA 4NGHH 3ULUL 1LEKB 2SEBA 3LOWA 3WDHA 3BJ91 1SY6H 4HFWB 1INQA 1U8JA 3B6SB 3ES6A 3BUTA 1I8KB 1IKFH 4HWBL 3IRZA 2XZAL 4FQQB 3QZWB 2OZ4A 1SBSL 2VXVL 3HC4L 1BQHA 1QSEB 3MYZA 1NGWB 4C56A 4FQPA 5CJXA 1QR4A 4L4TA 1J9CT 1EXUB 2Y36H 5E8PA 3UEZA 1RUAH 1F3JA 3HFMH 4NWUH 4HIHB 4QY8A 5MHSD 3DETC 3O45B 5MEQA 3QDMD 3E1F1 3Q2CA 1K8IB 2CJUL 5CJOL 3O4OC 1RZKH 1U8PB 2YR3A 3OX8A 4M93C 1YY8A 1YEIH 3KHOA 3OHXB 3RVTD 4NO0B 1B0GB 4MNQB 4I2XA 5HGDB 3GHBL 3T77B 2HLFC 2ZPKL 2FJHA 3ARFB 3ARBB 1MQKL 3C5ZC 1DE4B 2VLMD 3U4EB 2H6PB 4ORGA 3RWGB 1CDBA 1DL7H 4I0PC 5T3ZE 1XCTB 2J8UE 1PKOA 3QEQB 5D72H 4QLRA 4DVBB 7FABH 5EZIH 3FO9A 4K2UH 1ACYH 2NQCA 4N0FB 5F97E 3MCG1 5C0CE 1M71B 5MP6H 2QSTA 3DNKA 1QR1B 3CX2A 5ELIA 1X7QB 3B9KC 3VD3A 5EORH 4PJEA 1LP9E 2A1WL 1XGUA 4QHNB 3G04B 2EEBA 4P2OB 5D7LE 3HG1E 3SQOH 3Q5TA 3OL2A 5KVEL 1TJGH 2ZUQC 2VZ1A 5KSBB 4LASL 4KY1H 5LQBL 3LKNB 3ZKMD 1NCBH 4YQXL 3B9KD 5FO7A 2CLZB 3T3ME 1IJ9A 2CDGA 5GJTH 1I8MB 3CFDB 5E2WH 3VFNA 3BZEA 2UYLA 4WY7L 1G6RB 4HJJH 5HSFA 4RFNC 3CMOL 2ZJSH 1LO0L 5JR1H 4CMHB 1FORH 2IBZX 4U1MA 2R8SL 1S3KL 1JTPA 4YWGH 4G6AC 4OGXH 3GMPA 3H9SA 1D5IH 2O5ZH 3MLWL 4G6FD 5E94A 5ICZA 4FZEL 2IPTL 2AP2A 2YD6A 4KI5F 4ETQB 4KH2A 4ONOA 4FQ1H 5DD3H 1IGTA 3J8F7 5FM4A 1MHEA 1OGAA 3TBYA 3K2MC 5TE7L 4G8EB 5IW6B 4C56B 1YC8A 4XPTH 4CMMA 1JZ4A 5IBUB 4YXHH 1M71A 1MF2L 3HE6D 5HYJD 4ZUUA 4MDJA 5DQJA 1QOKA 3QIWC 4OBSA 5DYOB 4RGMC 5JHDE 3IYLW 3K1DA 3NAAH 3UO1H 4PLNC 1F5WA 5ISZE 5T3ZL 3OG6B 5DSCA 2R2HA 5AZ2H 1CE6A 5DMIH 5DDHA 2J8HA 3TIEA 3TCLA 5KG9A 4YZFF 2VR5A 4DW2L 4PJIB 3VFSB 3X11B 1BFSA 4O9HH 4URTB 1IM9A 1WICA 4NQCD 1REIA 5T1LB 3VDBA 5C6TL 1KCRL 4HFUL 1GZQB 5EBWA 1QFPA 1P9MC 5E9DE 5IV2A 4GS7B 1JI1A 2I5YL 2FSEB 4UB0L 4PJFE 5HVFB 1F4XH 4OCXL 1OD9A 1NMBH 4EI6A 1RU9H 2F54A 3E3QE 2LAAA 4GRMA 1BFVL 5EA0L 3QRGL 1RUML 2MCPL 3UCRA 4PG9B 4H1LH 4O02L 1RURH 5DJ8B 1AFVL 5D7SH 4GS7C 1NAKL 3SBWA 1FC1A 3U4BL 4NRXB 4CN1A 3L3GB 1JWSA 1LDSA 3DSFL 2PCPA 2DJUA 4P4KA 5B8CB 3VCLB 5E7BA 1ZT4B 4V1DD 1A21A 1JYNA 3SJVE 1UB5B 1ZWIB 2WWMC 6CGTA 5JPNA 1LO2H 5JOFB 4X7DC 3JTTB 4M43H 3QDJA 1P4IL 1P69B 4PJAF 3RZCA 3JUYA 5I8KL 3UTTD 4JO4L 2ZCLH 1NCWL 1IC7H 3WFEL 3RWDA 3I3EA 1NEUA 1V05A 3MJ6A 1ETZA 2VH5H 2DQFA 1F13A 1NSNH 1IMHC 1KJMA 5HYFA 2DBJA 2R69H 4MQ7B 3PWPD 2ZCKH 4IIQB 3RTQB 4R3SB 5IEHB 3T0VA 1CXHA 1BMGA 1MUJA 2FNBA 3I02B 3WO4C 3BP7B 3C09C 3HCVA 4ZO9A 4PD4K 3NFNA 3TWCL 3CXHK 5KSVB 4RDQG 5D71H 2AJSH 4OD2B 3CLFL 2KL6A 2VABA 3GMNA 4O2CA 4N1HB 4ONGL 4QXTA 5E9DD 1X5KA 4NSKB 1RVFL 3CMGA 4P5MA 1I3RB 1CGTA 3KPOB 5I1HH 1P7QD 4D9LL 1NCAL 4PJXF 3EYUH 5IJVB 1SEQH 1PKQA 4HFWA 4K71C 1AXTL 2WP3T 2JCCF 4TSAH 3B5HA 4Y5XB 5C3TA 1KIRA 5I1DB 4KKLC 1D5BB 1PZ5B 4HC1A 5I66B 1NDGA 5IT2L 3MXVH 1YYMH 1HKLH 2BZDA 1HQRB 2JELH 4JFFD 5AYUH 2FH8A 4M6OL 4G6KL 4M93B 1FNSL 1LQSR 5JXEC 1U92B 1ZXQA 3FT2B 1HE7A 3P4NA 5DQDH 5DVNA 3MJGX 1WWAX 1VFBA 5GGRB 3FN3A 4JG1H 3PHOA 5MEQB 3KXFB 3LPFA 1NMCC 2FR4A 3GO1L 2FWOA 1QRND 2W0PA 4RDQF 4U1NA 4PJAA 5JUEL 3R8BB 1D9KB 3ZYJA 1G7PA 3P0YL 2A9NL 1MFBH 1KULA 5EBMA 1KV3A 4LBEB 5L2KA 4WEBL 5CJQH 3FAXA 4DKAA 4LU5L 3TNNA 4EQ3A 2VDQL 4NN6C 2DQEH 5FOBA 1J1PH 1ZE3C 1K6QL 4KZEL 5FHAH 3DRQB 4NJAH 1BZQK 1NCDL 1U93B 4EOWL 2G60L 4U1HA 3LKOA 5B38G 2AJXH 2EICA 1AC0A 1S9XA 3F12B 4JFDB 4I77L 3MA7A 5HVHC 4Z7UF 5FHBL 2FGWL 1FAIH 4BFEA 1U92A 3MOBH 4HDIB 3DROA 1SMOA 4OUUB 4MLIA 4R0LA 3RDTA 3PWLA 2GIYA 5D70H 3HC0A 2E9WA 3QCVL 1MCOH 2IMNA 5CSGA 5C09D 1HSBA 3LAFA 1AXSB 4HGWB 3RL1B 3ARGD 4UV7H 2Q20A 4P23A 5GS2D 2NCMA 3WUZA 4JG0L 3BGMA 2YKLL 2ORBH 4L9LA 2DM3A 3V6OA 5K33A 1JUFB 3ET9F 5JW4Q 3RZCC 2VDPL 3K8LA 4JFED 4F7CA 2CR3A 3VFUB 2ZCHH 4N8CH 5KOVC 2VDOL 1IEBA 2X5PA 4OIBA 5FYJU 1I1YA 4XNQA 1BX2A 1T04A 3WHXA 4CMMB 5DJ0B 1X9QA 2PXYA 2PKDA 2PTUA 4PJAB 3QEQE 5CSZB 5F6IC 3RBSA 3H7BA 4XZUA 4KZEH 5T5NG 3HZVB 3VRLE 1CLYH 5C0BA 1I9JH 1GH7A 1T22B 2OP4L 4LSVH 4TN9A 2JIXB 1A1OA 2Q76B 2H3NB 5L7XL 5E5RB 1L0XA 1S7SA 1QRNB 1TNMA 4WW2A 2G75B 4E9LA 2JB6B 4JQXC 2YSSA 5E03A 1NGXA 2O5XL 2Z4QB 4L3AA 1MJ7L 2GY7B 2CUHA 5D2LF 4L5FH 1NGZB 3GO1H 4PRDB 4PPTA 3REWB 2F53E 2FECI 1WSST 1PG7H 4KDTA 4TUJB 5BVJB 4KQ3L 1G9NL 1G6RH 1BBDH 4KKBC 1PX4A 3BT2L 5I0DA 4G6KH 3W39A 3I6GA 3S35H 3H3PL 3NH7L 4BSWB 2IADA 4EUPG 2JJTC 5EOQH 4OQ1A 3EOTH 5IB1A 3X14B 4GW4B 3S34H 3MV7B 4X6FA 3NABH 2HT2C 4NN5B 4ZFOB 4WJ5A 3BT2H 1AHWB 2V5TA 4AT6A 4HUMB 3G5XA 3G6JE 5C0BE 4IRSD 3GMOA 4IOSD 4JVUA 4RX4A 3HNVH 2I26N 4KRPC 4EUPH 5E2UL 1A6ZB 4BSJA 1D3CA 1UVQA 3OF6A 3QXAA 2APBA 2VWEC 3RGVC 1MFDH 3TCXA 3KPSB 1TETL 5J06A 5JORB 4N90D 1G7MA 3MRLB 4PRPB 1CGUA 1PYWB 2C3VA 4Z76A 1YEJL 4MDIB 4PRBA 1JPSH 3AMLA 5FGCB 3NN8A 4KJQD 5F9OL 1KTRL 1VEOA 4JFHE 4RFOH 2R2HB 3WV0A 5IMKA 5DRNB 4HUVA 4X6EA 1U2HA 3W39B 3RPIB 5J4MA 1T7WA 5A16B 3EYVA 1NBYA 2FJGB 4JPVH 4S10A 3QUKB 3O3DB 4HZLB 2YN3A 3QEQD 5ID1B 4HV8B 3CFBA 1IC7L 4Q9BA 3BP5B 1CICC 3GM0A 3I3DA 3U46B 2VDOH 1FZJA 4OLWL 2Z31A 4OF8A 1QEWB 1AO7E 4DFHA 1QFWH 3SE3C 3WFZA 4GRLD 2R4SH 3KPRB 3NZ8A 2PETA 3O3EB 1I7ZB 3RUGE 1OAKH 5CWSA 4OZHA 3U30B 1ADQH 4XNMB 1XGPB 2F9BT 1V7NL 4ZG1A 4L3CB 1KPUA 4UDUB 4JZNA 4U6VH 2EECA 5D6DA 2F8XC 3VH8B 4F57H 4R7NB 1K8IA 1DBMH 3TV3H 3FZUD 4IDLA 1XR8A 3ZTJG 3BWAB 3FFCA 1MCOL 4G8GE 4C4KO 4OTXH 3QIWA 4JHWL 3CLEH 4KJPC 3EZJB 1KBGL 3KYAA 4K3HA 2OR8A 3UBXI 3BO8B 3O6MH 1VB9A 2HA1A 4FQHB 3SKOB 5C6PB 2EDBA 4HUWA 1QVOA 2I5YH 2VWEE 3O4LB 3RBGA 4JFOA 4UTAH 4HW6A 4RZCA 4WTZA 2X9XA 1DVFC 4YBHA 1JN6A 1FZOA 3AS0A 1CGYA 3S3JA 1ZT1A 4LPWA 3MV9B 1X5AA 2DTSA 4NQEA 4QYOA 2XXCB 4R8WH 1N7MH 2C3XA 3CXDL 1GIGH 4GG6B 2IFGA 3LN5A 2Q8AL 3K8KA 3ARBA 5DZNA 5D7JA 4TUKH 3PP3K 4L8SA 1A7NL 1ZLSL 1FVCB 3G6JB 2FBJL 3QISA 5TJWK 4DZ8A 2FZ3A 4OZIB 4MHHI 1F4HA 4PUBH 4ODWA 1LEGA 3VXQA 3RUGA 1I1AC 2LFGA 3F62A 4PRHA 2EYTB 4ZYKA 4YDJB 1NMAH 2K1MA 2Z8SA 3MV7E 3TPKA 5JUEH 4UILH 1BEYL 5HHNA 2XZQL 2HWZL 1QFWM 2FHFA 5SX4I 4JFXA 4Y2DC 4HBCL 4L8BB 4HIEB 2CDGB 2ATKB 3ME0A 3TT1L 3IJSA 2WINB 2ZUTA 1BLNA 4PRID 3LS5L 3B83A 3GJFA 1FNSH 3FOMA 4I0PA 3S4SA 5ERWB 1BPVA 5DD5H 1MJUL 4HV8A 3MPCA 1WTGT 3MV8D 3V0AC 5ILTH 4GMSL 1FFPA 1GC1L 4KV5E 3F7PC 4M61A 4Q0XH 1I8KA 5I0ZA 3S8WA 2YPVH 5IP4A 1SY6A 4JJ5A 2P5WD 3HE6C 3QDJE 1RZFL 2W9EH 1FG2A 3VXUD 3X3FH 5FXCH 3I75B 4WHTB 2XZCL 4XBPB 5EC1B 4A2LA 1GGIL 1TVDA 4ODUB 3O2DL 2CO7B 5F89B 4FQXD 3WD5H 4LSTL 5E5MB 5CEYA 4J3VA 4GBXC 2VISA 4TQEL 5HJ3A 1CF8H 1INDH 1D6VL 3UC0L 5DJCB 3C5JB 2ED7A 1VFBB 4WEMB 5GGRA 3WFBL 5E8OA 1GGIH 2V2XB 3RWCB 2VZ3A 2A0LD 4OCSH 5EUKB 4TTDC 1ONQA 1SYSB 1WBYB 3RKDD 5FGRA 4NJ9H 4J8RB 5LAXA 3TH2T 5CMAA 1NC4D 4ENED 5IEKA 5L9DL 5ILTL 3WO4B 2FX9L 5EBMB 4PRIE 1QO3B 4I0PB 3S4SB 3VXUB 1QACA 4RIRB 1JGUL 1V8HA 4Z7WA 3GI8L 2ZPKH 4P2QE 5B22A 1ZHLB 3UBXA 3WLWC 5CKGA 1FFPB 4WW2C 3VJ6A 1D9KD 1U8IA 2BVUA 5EPMB 4DTGH 4M6NH 1Z3GH 5F7WC 1MUJB 2H2SD 2APFA 3KS0H 2W65A 5CFHA 4MWFA 1RZKL 1UWGL 1KPRB 2YC1B 4KXZH 2LABA 1ZHNA 3M8OL 3EGSA 4P48A 2QEJA 3IFOB 5DD6A 3U4AA 5KS9B 1IC1A 4RA3A 2K7QA 4N0UA 4LVOC 1OGTB 4JY6A 2PO6D 1CLZL 2HAZA 1AH1A 5C2UB 3D25B 5F7DB 2KDGA 5HYSG 4JZJA 3WS3A 1EMTL 3S3SA 1XGQB 5DJCA 5F6IB 3FN9A 1HNGA 1B4JL 1DQQB 3ARWA 3RWHA 3DSNA 2ESVA 3STZB 4GAFB 1FZJB 1BBJA 1OSPL 3DURB 4NO5A 5JLZA 5JA8B 5FO8A 4KVCL 2XFXB 3RVUC 3V2AR 3CDCA 2DWDB 4X83A 2QR0A 1KXQE 4MA8L 5FV1L 1WC7A 1SY6L 3HN3A 1ZWIA 4NOFA 4GFTB 4MJ6B 3ULUH 4YDKL 1RK0A 1VCAA 2EIBA 4Z7NF 2D7PA 3FHQA 2NY2D 4HEPG 3QDJB 4NQSA 5IHLB 4GQPH 1A6TA 4EUPB 2AK4E 1QVOB 5BV7B 3RTQA 5B8CC 3QO1A 5T1KB 4JFDD 1UWXK 5D1ZC 4R0LC 3T0DA 4E0RB 2V5MA 4LLQB 5C86A 5JW4N 4AH2A 1QHPA 5D5MB 1HH6A 2H41A 3I9GL 1MAJA 1RIVL 2F5BH 4GRLA 4HEME 2YA0A 3F5WB 1QSFE 3TF7C 1JYWA 4MAYA 4FNLH 3UJTL 2P44B 4RNRB 3IJYB 4Y19B 3TVMD 3VMNA 1CGXA 3I84A 5DVLA 1YEEL 4GSDH 1ZANL 4Q74A 3MRIB 5T1DH 4FQ1L 3BKML 5BV7H 4D0BB 4PB9H 2DD8L 1MI5D 4JVPA 4QXUL 3WIIL 4FZEH 4R2GD 4JPVL 4Z7VB 4HKJB 4X9FA 4G43B 1QA9B 1VHPA 4AEHH 4KHTL 3H8NA 3ULUC 4UINH 1I3GH 3BD4A 1RMFH 5JHDD 2GSGB 4QHUB 2R8SH 3GB7B 5CILH 4AEIH 4JY5L 5DEGA 1C7TA 5HDQH 1AD0B 1FYTB 4HJJL 1FCGA 2FIKA 4J4PA 1LEKA 4WGWB 3MGAA 5C9KA 3MR9B 1W72B 3LRHA 4YAQA 4CVXA 1MHPH 1PKQE 4W6YB 4OCWL 1FN4B 2XA8H 1NAMA 2C9AA 4S2SB 1OW0A 5KVEH 12E8H 1KTKE 2DM7A 4YO0A 3KR3L 1RUPL 1GGTA 1MHCB 3STZA 1FNGA 3OKOB 3EHBC 1F11B 5CZVL 2I07B 4QWWD 3LVEA 5J12B 5GISH 4JKKA 2D7NA 3GDBA 1QHOA 3P11L 3V4PL 1T2XA 4XPAL 5JNYA 7FABL 3QUMH 3L5XH 1A7OL 4JN1H 2R0ZL 4LHUG 1DQML 4PJFA 1CU4H 3V9FA 1JNLL 1BHGA 2HLFD 5HXMA 3VI3F 5CJ5A 3WIHL 4JPIA 4PJAE 4X7SH 3HZVA 1JP5A 1GJIA 1MFNA 2F19L 4Y4FA 4GO6B 4UIKL 5I71C 3PV6B 4G9DB 1J1OL 1H0DB 3GKZA 1KEGL 3ARFC 4U1NB 2EE6A 4D0CB 3GRWH 2O5XH 1E4WL 2X4TA 5E4EC 2NY3C 4LF3A 3SDAA 3BP4A 2P7TA 2VDML 3PWJB 4RAUB 4YHOH 1H15A 1ZHBB 3FQTB 4OIAA 3SCMA 3BQUB 3B9AA 3ARED 3ARFD 5TDOA 3PABA 4D9RE 3S4SG 2IWGA 4OIIL 2VNCA 5I1CH 3HC3H 3SKUD 3QUXC 2VZSA 4OGYL 4U1GC 2N7AA 5I76A 1A7QL 4XCEA 2UWEA 4YIQB 2DYPB 1BX2B 2FX7H 4JFYA 4G6AD 4WJ5B 4PD4J 3V7MA 1A6WL 2F5AH 4H25B 4NKDB 4P2OD 5CSZA 3PL6D 2EXYD 1R5WB 1T0PB 4F58L 1C1EL 4ZUVB 4W81A 1DFBL 3KS0J 1AQDB 3IETA 2PNDA 4L4TE 4ZXBC 2P47B 3LDBC 1XGTA 5FYJH 2HTKC 3VG9B 1MFCL 1QSEA 3T2NH 1X5YA 2Y7QB 4XVTL 1P9MA 4NDMA 2OL3A 2QJDA 2F53B 3TN0D 5F6HJ 2ARJB 1OWRM 2R2EA 4I5BB 4HHAA 4X4YB 5B39A 3MRCB 43CAA 3RZWA 2NX5D 3RI5F 2BMKB 2J6EL 4JZOA 2G2RA 2IJ0C 4BK5A 4P49A 4ODWB 3ZLQC 2R23B 4M3JA 3MOBL 2AJVH 3IXTB 5DRZA 2FGWH 3MBXL 5E08H 2IGFH 4LEXL 3KJ4C 4F33A 1JGVH 2VC2L 1G7IA 2W1NA 1U36A 4MNQA 4AIZB 3H7BB 4XZUB 1N2RB 3D69B 5DK2A 1NCDH 3DROB 3LD8B 5CLTA 4DN4H 2EDNA 4LLMB 2NY0D 1OL0A 1I1RA 3SDAB 1XGYH 1IM9B 5E4EB 1YC7A 1TZIB 1C5CL 3R06A 4MXVF 1U95A 3FONB 1A3RL 4WEBH 2GYSA 5CJQL 5FOBB 3NACH 5GGSB 1CL7I 3EO9H 4LEOB 1INQB 2NMSA 3M17B 5DVMA 3E8UL 1A9BA 4YXLH 2BSRB 5F1OB 1MFEH 4XCNA 1MCBA 1JPGB 2LU3A 4RAVA 4UUJB 3DHJA 1QQDA 3BXNB 4AMKL 1XR8B 3N9GL 2XTJC 5I74C 2UWEB 2DQDH 2AERT 2R29H 5IVZA 3VWJB 1UADC 5C0JA 5FEBA 3TYFB 3C9NA 4QNPF 1UVQB 4XMLH 5DQDL 3LEYH 4Q9CA 3WKMH 1MCRA 3GIZL 3GI9L 1EO5A 4L9DA 3G6DL 1KYOK 4RFNB 5F9DC 4Y4HC 3EDFA 1JZ2A 5ADPL 2VO5A 4XP4H 4F33B 1AGFB 3HC3L 3MFGB 2R0WL 2VXSH 3U0PB 3FQUA 5JIPA 1BJ8A 4OIIH 5CZKA 4LLUB 1AHWA 4OB5L 5TE4H 4OGZA 2HJKA 4ZNCD 2L7UA 2ID5A 4K23L 1SEQL 4BZ2L 5J1TC 3HUJE 4I5BA 5KSAB 1FYTE 1JYXA 3TO2A 2EIZA 1GPOL 4Q58C 4Z7QE 1H5BC 3DUUB 3VXME 4YHML 5TQ2H 4FQCL 1DBBH 5D71L 1DUZB 3HMXA 3JWNC 3O9WB 3MRLA 2DQJH 1K4DA 5IF0A 2X1OA 2FBOJ 2GK0B 2NXZB 5DJYB 4PJXE 4XPHH 4W4NA 4NPYB 1AGCB 2AEWA 5EO0B 3C60D 1UWEL 1I9RH 4OLVH 2KUTA 3R06B 4OLYL 2VH5L 3MRBB 1PQZA 5FO7B 3V6FA 2QSCL 1FCCA 1FZMA 5E4IA 5IFAH 3PXJA 4JO4H 2XQBH 1Q9WB 1FN4A 1ZV5A 2F54E 4HJGA 3S5LG 5F7NC 4RAVB 4UUJA 2WUCH 1NC2D 4QRTA 1FL6A 4QCIA 1NGWA 2DIAA 3BH9A 4Y4KA 1CQKA 1PLGH 1B0WA 3A67L 3PNWB 4DEPB 5ITBL 3QBTB 2CDFB 4U31A 1Q9LA 1S5IL 5FA4B 3L3GA 1KN4L 1W0VA 2EXWD 1GXEA 4EUPA 4OFVA 4DWHA 1S9KC 1FQ9C 4GQ9H 1I4FB 1UB5A 3MRHA 5DHVH 2A6IB 2NTFB 5EDXA 4NFBA 1FNAA 1A4KA 2WBJC 3TO4C 3VXOB 3WJLA 3ZYZA 5EC2A 3VWJD 4XCYA 3VW3H 4EN3B 5DYOA 1KYOJ 5HI3D 4JFXB 5ITFB 5SWSD 5M95B 4P2RD 4H8WC 2X4OA 1LNUA 4DKEH 4TNWK 3ILQD 1U8HA 1VGEH 4OF3A 2HKHH 3K0WA 2X6MA 3IJYA 5GIRB 4JRYD 2OI9B 4ZD3L 3U2SB 5CP3H 1EVTC 2BMKA 1MWAH 4KK6C 3QUYD 1HYSC 3ELAT 5BV7C 1KFAH 1FO0H 2BY3A 4OM0H 1JV5B 4S1RH 5EU3A 3W0WA 2ZP0T 3QHFL 5C0AD 1N5AA 4EI5A 4G80B 3ARVA 3BSZL 3RTQD 4JE4B 1FV1B 4R26H 5ISZD 5HDBE 4WDIA 4KK6D 2GTZB 3VGHA 3K4AA 4KGLA 1T66D 5EZJB 3SDDA 1U93A 5T3ZH 1A5FH 5DEGB 3H9YA 5C8JB 3IF1A 3F7QA 3BESR 3JSSA 4B0MM 1CYGA 1IGFL 1Q9OA 4R26L 4JFPB 1F58H 1YNTA 3EYVB 5DJXA 5B4MD 4DGIH 3BD3A 2KQMA 4XNUL 3RKDC 3O9WD 1NFDB 2HJFA 4XRCB 5GGQL 4XPTL 1KFAL 4JO1H 1DEEB 5KVFL 2YRLA 3L3JB 3MJ9H 3KYKL 3TT3L 2MHAA 1MIEH 1U9KA 3WXVH 3WLWD 3GMMA 1AKJD 3BYTA 4QGTA 2A6DB 3W2DH 3UPAA 3KNBA 1QPXA 3VXSA 3VW3L 4L3CA 2H2SC 1L7TL 5L2JB 1IAOA 3T2PA 1BQSA 2VB5A 4GBXB 2D31A 2W9DL 3Q6GL 4U33A 1SJHA 1MFAL 1K8DB 2N56A 4WI6A 3DX8A 2NY1D 4QHMB 1KPVB 3O2DA 4OCYL 1I1YB 1YEHH 1AGDA 1S7XB 5EPMA 1FFQA 1BF2A 4LKXA 2HRPH 4EN3C 5IIEB 2HVKB 3GBNH 1UT9A 1Q72L 2EDHA 5I8EA 3RDTC 3RU8H 3M8OH 2KH2B 3B9KB 4D8PA 1AGBB 3W82A 5L2KE 3WFHB 3HKFA 3ECBB 2HFEA 2QTEA 3A6BL 3GSOA 3GSNL 3IDIA 5F88B 4M03A 3CXHJ 2VAAA 2XQBL 1MIML 4GXUM 5C08E 2QSCH 3FKUS 2BFVH 3PE9A 4EVNA 3TJHD 3OPZH 5CMAB 2EDEA 2BP3A 3GI8H 1W72L 4J3WA 1TZHA 1S9YB 2Q86A 4FXKB 1JPTL 5EN2B 1F90L 1XIWC 2VRAA 3IDNB 4DAGH 3MC0A 3FQXA 4HAGA 3LKRB 5IBTH 4XXDB 4NJ9L 2VL5B 5C8JA 5TGBA 4KK8D 4JM2D 5F1SA 1TQCB 3DVGB 2P49B 1WZKA 4FQJL 1ZVSB 3O4OB 4YHYB 5DD6B 1BIIA 4NO3B 2EYRB 32C2A 4PFEA 1AI1H 3GBNL 4X0KA 3ARGB 1EEYB 4ZFOA 5AZEL 3WD5L 2OQJB 2W91A 4P4RB 2Y72A 5IVXB 1CG9A 4G7YH 4LFHG 3TVMC 1R5IB 1WTLA 4KUZL 2A6JB 4WTXA 2QQKL 3SDAC 4F7PA 5TQ0L 5DJ2A 3CSYB 4AH2B 5KSBE 5DJAB 4PRIB 3QI9C 1ORSB 5ENWB 4EJ1C 3SGJC 3ARGC 1M6OB 4K7PL 4JCMA 1IKFL 2YD1A 3D85A 3FO2B 2DLEA 2BOCB 4HLZH 3MRIA 5HYJB 5IB4B 3FO9B 3X17A 1FVDA 4XAWL 3TT3H 3QEQA 5EIIA 4GKZB 3EZ8A 1D6EA 3MYJA 3D2UA 2D31B 2J8UB 2ADGA 1EGJH 2IPUG 4MB4A 1CICD 4FTVD 2JIXA 4UILL 3HMWL 2DYPD 2JIXD 4DGIL 5GS0C 1NMAL 4MQXD 4XP6L 1BIIB 4NO3A 5I71B 1MFEL 1KXTB 4LLQA 3MRGB 3O2WL 1PBYA 2DQTL 4FQLH 2XQYK 3UJJL 3AAZA 3HR5A 2R1YA 5C0ND 1CFTA 2FBJH 3MLPA 1NPUA 1TZHB 1MLCB 1A7NH 2V5RA 2X4QB 3PF2A 4KXZI 2R9HC 1S7RA 2V9RA 2LQRA 5E6ZA 5TDOB 4YDLB 2DMKA 3C08H 3FQRB 1S9VA 3SKMA 4V2BA 3U7YL 3THMH 4FFWD 3VG0H 4JFHD 1R3KA 2J4WH 4X6DA 2P8LA 1UJTA 1DQTA 4CVUA 5TPWL 4ZAKA 3SOBL 3CVIL 1QLEL 4KJYB 5EOCH 2X9YA 1AR2A 1K5NA 2J6EH 4NQCB 4N8VG 4FFWC 4OTXL 1MPAL 1HDMA 2WAHA 2GJ6B 4V1DB 3TV3L 4R4FH 8FABB 3EYSL 4M4PA 3C6SB 2ZOKB 3CCHB 5CSBA 1AGEA 3QHZH 1ZGLA 4DGVH 4IRSB 3NA9H 1NFKA 3T08A 5EUOB 4LP5A 3QDGD 5GRZA 3VXTB 4YBLC 4MZ3A 1T1YA 4LRIC 2RJMA 1CVSC 2F8OA 1OT1A 2BNRE 2XG4A 1KB5A 2CGRH 2YRZA 3UTPE 4YHLL 1IAOB 4PJIA 4YUEH 3ZE2F 1Q9KB 4MJIA 1J1XH 2X4TB 4OF5A 3V7AG 5DJZA 5ETUA 1I1AD 4A6YL 3KNBB 5DDHB 1MCKA 1FHGA 5HJ3B 2PTVA 3HMXL 4XC1L 3WN5B 1DCLA 2P5ED 2YBRB 5CD3B 1QZ1A 2YEZA 4IRSC 4RGOH 3OKEB 3SDDD 5DO2C 5B8CA 1JZ8A 5J6HB 1OM3L 3KPQB 3ZO0A 1M7IA 3O0RL 3LEVH 1P4BL 2HKFL 2OR9H 4K3DH 1T03L 1PDKA 1PYWA 3IU3B 4RX4D 4WEUD 4WUUA 1QBLH 3SDCC 2X4UA 3GSOB 3BE1L 4G43A 2LTQB 4EBQH 5I8EB 1IE5A 2B20A 1BQLH 1I8LA 4U6TA 4KJQC 1WQVT 2BVPB 3TNMB 4C55A 4OZGF 1WJ3A 4K9EH 1VFMA 4P59L 4D0DB 2H6PA 4MAYB 2BC4B 1VKXB 4HMCA 5BRZB 1R5VA 4JZNB 2DL9A 3P3YA 4XCFH 1QFWI 3E6FB 3CVHB 5EBWB 5MENA 5I1KH 5KSUA 2NY4C 5ICXA 2BVQB 2B1HH 3TFKC 2BVEA 2BOBB 4DEPC 1F6LL 5E8EB 2I60H 5CEYB 1FNHA 3L3HA 3H9HB 4WU7B 3WIHH 2VERN 4X5XB 1R3JA 3D39B 3IKCB 4S0TD 5JOEA 1JNLH 2V7HB 1LGVA 1INEL 1GHFH 2P48B 3T0XA 4JDVB 4XB8A 4NYLA 1ZEAH 5EU5A 1W72A 4YAQB 3TESA 4U1IB 3SE4A 4LRNL 5GISL 3WNKA 3UPCA 1XT5A 2HMID 2B5IB 5DJZB 3I02A 1F3DJ 1G6VK 4XNXH 1RSFA 4AMKH 2UY7A 4LFHD 3OGOE 5EZLA 1UGNA 3RWHB 4LLVA 4PLJD 1KB5B 1U8MA 3EYFA 3K80A 4XPGH 4JVWA 5C0RH 3LRGA 5F21B 5BS0E 4WW2B 5D1QA 5D7JB 3MNWB 1JV5A 5IHUL 3EYQD 5L7XH 3OTTA 5IHZB 1ULVA 4S0SD 5HDQL 2UZXB 3U6RA 3WSQH 1UM6H 4MJ4A 5LBSH 3DTXA 1JWUA 3VA2C 1Y6KR 3S35X 3MLRH 5AUMA 5GS2H 2FD6L 2ZZUT 4AEHL 3QQ4B 2B0SH 1DQLL 2L7JA 3MNZB 1AY1L 5GZND 2XKNA 3HI6L 4HCRH 4GW4A 1A0QH 4QHKJ 2HJFB 4XRCA 2RQ8A 4N8VA 2AJZA 3QUYA 2BSTB 2OR7A 1IFHH 3C6LD 4NT6A 3RDTD 3L5HA 1G9MH 4OSUH 1MCSA 5DGQA 2GCYB 1CN4A 2NY2C 1N5YL 3O6KL 3EDEA 1X5JA 4L4VD 2YHGA 3EKCA 3TPUB 1X5XA 1W0WB 4HH9B 1QRNE 5FGBC 2NY1B 3VG9C 1IAIL 3T2NL 4JPWH 2GK2A 3DBXB 3MROB 3PJSA 1FVEA 1SJEB 3HC0B 3QZWG 5MENB 1PZUB 4QT5B 2N7BA 1HSBB 3MRQB 3RL1A 3FO0L 1OAUH 3GUTA 4P5TD 5EOTB 2FX8H 1CL7H 4MSWA 2EYSB 4PGBB 4MD4A 2MPAL 1FAIL 4F7TB 3S37H 2P5EE 3BUYA 4PY8I 3DRQA 3RPIA 1HSAA 3FAWA 4M7LH 2J8UA 2Y1VA 1N8ZA 2AJXL 3MQIA 2EC9T 3FFCE 2GJZB 4JFEB 2UUDK 1K4DB 3QFJE 1NFDE 4WO4A 1T1WA 1YNKL 1AQKL 3QUMA 5T1KD 2DQUH 4UT7L 1XF5A 3X12B 1DQJB 4W68A 1H3PL 2DQEL 4XMKL 4P23B 2WBWB 4XI5C 4OUOA 1QYGL 2XV6B 4Z7WB 3H3KA 4MD0A 4JQXA 1X7QA 4Q6IC 3LRSA 5BCAA 1F02I 2X4UB 2F58H 1U95B 1JUFA 4RMQA 3RWFA 2KZWA 2XQYG 5SWZE 3TH3T 1NAMH 1T3FA 3AY4A 2DDQH 3GB7A 4IIQA 2Z92A 2VDKH 4Y16D 4U3HA 4KTYA 3T0EB 5JW3H 3H42H 3V5HB 1CDHA 2W92A 3DVGA 2E8ZA 3IFPB 2IMMA 1J1OH 4QCIB 3OR6A 4O5LH 1IEAB 32C2B 2PXYC 1QSZA 2VE6A 4Z7NE 1Q94A 4KC3B 1S5HB 1WBXA 4FABL 5J1AB 1HDMB 1H3WM 1JPFB 1T5WA 4ODSH 3JWDH 4AIXA 1N5YH 4LMQE 5A43C 3ZDXF 5HHVH 1DP0A 2XY2A 4CJ0A 3W9DB 4OLEA 3KYOA 3QWOA 5T33H 3MLTA 1F2QA 4FXGA 2I9LA 2WUBH 1A4JB 1G7JA 4B5EA 1M6OA 1I7UA 4WU5A 2YSSB 2WWMD 1T4KA 2W0FB 3QO0B 3V5DA 3QO1B 3JV4B 2HT3C 1D6VH 1INDL 1FNLA 3CLFH 3MLRL 4NKQB 2H2PC 3KR3H 1ZK9A 4MAUL 4B53A 1TJHH 1KB9J 5LBSL 4F9LC 2NTSP 2D03H 3VXRB 5KZCB 3M1BA 2I9TA 4UIMB 1ZKAA 3KPPA 3O2DH 5J89A 3MOAL 1WAAA 5J6HA 2EZ0D 4XPBL 3BZFA 1DE4A 3MMEB 1DJSA 1AIFA 1FFOB 2EDYA 5C0DB 5DJ6B 1DANU 3SPVB 3VU2A 1JK8B 1U3HD 1C7SA 3MLUL 3K74B 3G6JF 1U8MB 1IEAA 4OV5B 3WL9A 2HJKB 1I3GL 3D85D 1Q94B 2RCSL 3ARUA 3L5WB 1A1OB 4JZOB 4YBLB 4M48L 5F7UA 3OKNA 3AB0B 4WV1A 1JVKA 1VFAB 4TPRH 2Q8BH 5JXAL 2ZCLL 1XFPA 3GM8A 2DQCL 1ZANH 1EERB 1QD0A 3PWJA 5DRNA 3QI9A 2AV7B 1UH2A 3EDKA 3NCBB 3VMPA 3T0EA 2NLJA 4Z95L 3GSNB 3I50L 3BQUD 1IAMA 2PYEE 1YMMB 2NY3B 4Z18A 2ZUUA 4WI3A 3RJQB 4NZRL 3TBVB 3ULVE 4KROC 2JJUA 3MUY1 1KNOA 1GGBH 4EDWL 2E27L 1J8HB 1RV6X 4X6BA 5IIEA 4XP9H 4PRPD 1IRAY 4X7TA 5J3HD 2IBBA 5F1IB 1CD1A 1Z9OA 3QR2A 5J0BA 4LIQL 5DQ9A 5D1QD 5GGUB 1A6AA 3FB7B 3BWUC 4HFUH 5DS8B 1BAFH 1BQLL 5IMLB 1EGJA 4X4YA 3F7RA 5B39B 3VXSB 4HX1A 1KC5H 1N4XL 3QDGB 1EFXB 4LIQH 4ZUTA 1NANI 5ACLA 5E8DL 3CLEL 2Y07H 2Y7QA 4YGVB 2R56L 4Q6YA 2CIKA 4Z78A 3QA3A 1MJ8L 1T03H 3JV5A 4EDWH 4U3CA 3P0VH 3BPCA 3FZUC 1BOGA 2CUMA 2ZKHH 3VGDA 3QQ3A 1TMCB 5F9AC 4JB9L 2WBJB 3TO4B 3BMVA 5C08A 4XC1H 1FAKT 1NH6A 3BPLC 3MUZ1 3ULUE 1MF2H 3V95A 3MNZA 5JXEA 3BVNA 4LCWB 4LPUA 3AB0C 5ESAA 3D18A 5TE7H 1CXLA 3VWKC 3GKWL 1IQDB 3GNMH 2DQCH 2XTJD 4RGND 5FKPA 3VFMA 1ND0A 5BJTB 3SHSA 2P1YA 1NGXB 2Z4QA 1EA9C 2DAVA 4XB7A 1ED3B 5JO5A 2ITDB 3VFTB 2CH8A 2O5ZL 3MLWH 4R4FL 4I0PD 2FEEL 3HRZB 4PJDA 1U91A 4O2FA 5FCUH 3H7LA 4YHZH 5FB8B 2CKNA 4XPFL 1S7WA 1BOYA 4H0HB 2JJVA 4WW2F 4ZNEE 2GTWA 3C6SA 3ORJA 5D9SA 1KGCE 1S7VA 3OKDA 4XPBH 4BUGA 1AKJA 4YQXH 3IDUA 2PF6A 3MUGA 5T1KA 5HHOD 5IW3A 2X7LB 5HHOE 3QQ3B 4TQEH 3U9UA 1Z0MA 5JIHA 4HJ0C 1E4KC 2OZ4L 1VFOA 4Z7UE 1BAFL 3O41B 2D2OA 6FABH 4U0RC 2MQ3A 3S7GA 5EO9B 2DQTH 4FQLL 3LKQA 1HIMH 1NC4A 5GGVY 4R90H 3ROLB 3V0WL 3S34L 2EDRA 1MJJB 2IAMC 3EBAA 4WENB 5C0DA 15C8H 3BW9A 3QDGE 1OWWA 1BJMA 4QRSA 3F12A 1JWUB 4N0UB 3QB7C 3SGDH 2I9TB 5GHWL 3DUHA 5F96L 3T4AB 4XNYH 2IH3A 4KAQL 1WISA 4R0LB 1TIUA 4P46B 4D0DA 4A6YB 1JF1A 1YPZB 3ULVL 2XZQH 3CFDA 1XR9B 2GJ6A 1VEPA 1YEGH 2ADFL 1H9VA 2XKUA 3J7HA 1VKXA 3MV11 2DI8A 1ITBB 4Z7VF 2EDXA 4Y4KD 4L8CA 1NAML 1IQDA 4TTDD 4LEOA 3SDCB 4U6XA 1RUAL 2QQKH 4FTVE 1UC6A 2C1PB 4NKMA 4NM8L 3ZDYE 4G7YL 3BVNB 3RGVD 1X4YA 3SGEI 1CD9B 5LAXB 1R5WA 4ODHL 3HC4H 4M48H 4XMKH 3FB5B 5IFJA 4NRZB 3BRFA 2AK4A 3MRJA 4LNRA 4JZJC 5EUKA 1FC2D 4CVWA 5TFSH 1D9KC 3L1OL 4PY7A 1KB5L 4U1LA 3KPQA 4UU9A 4TRPL 3ULSB 1X5GA 5J13B 4FA8A 1RZIA 2O5YL 1LK2A 3WN5A 4K9EC 1IGMH 4KK9C 1EEYA 3WE6A 3D0VA 4P9HC 4N8CL 4OZFG 3T77A 3DMMD 1BVKB 3HUJF 4L4JA 2VDPH 3IDJB 4JHWH 1CE6B 2X89D 1B2WL 3F7VA 4YGAB 3V6ZB 3MODL 4PP2A 1T20B 1EO8H 1N64L 3EGSB 2HFGL 2CXGA 3T0WA 5TF1L 2YMXL 3CH8A 4XX1E 5T33L 1OGAD 1BVLA 2B7DT 2BY2A 3DMMC 1B9ZA 3X3GH 5CJ8A 2BVPA 1P7HL 3VXRE 1KTDA 4OCRL 5HYJA 4FTVA 1FH5H 4P5TA 2J88H 1E6JL 4YZFE 5DK3A 3NFPB 3QJFA 4OCYH 1P7KA 3V4VL 3GSVA 4DJMA 3SKMB 1F4WH 5C07A 2HFEB 5BXFB 4RISH 1IGYA 1A0QL 1ZS8B 4F37F 1A6TB 3OAZK 4GBXA 3T3MF 1NCCL 2H2PD 1RUQL 2ICEA 4OLZL 2ZUWA 3ZE0E 3NIFF 4NJAL 4Y19D 2X05A 4JFYB 4KZDL 2HMIC 4DQOL 1CFSA 4X4XA 2NY4B 2VSDA 3T3PE 1W0WA 2FATH 4MD5B 1A3LH 3KYKH 3S88L 2QQNL 2ERJC 1NC2B 1TETH 1MFBL 3WMSA 4L1DA 3HNSH 5KVFH 3T65A 3VXTA 3N1PC 4RMRA 2Z35B 3NCEB 3NIDE 4NQDD 2BNQB 3C8KA<