4OB5H

Ontogeny of recognition specificity and functionality for the broadly neutralizing anti-hiv antibody 4e10
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
125
structure length
122
Chain Sequence
b'VQLVQSGAEVKKPGSSVKVSCKASTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCAREGTTGGWLGKPIGAFQHWGQGTLVTVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4E10 antibody germline precursor 7 heavy chain Fv
publication title Ontogeny of Recognition Specificity and Functionality for the Broadly Neutralizing Anti-HIV Antibody 4E10.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 22
structure length 122
sequence length 125
ec nomenclature
pdb deposition date 2014-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ob5H00
6FABH 4R2GB 1U8JA 5SWZB 3D39A 4WEMB 1A6UH 4HCRL 5EPMB 5BS0E 2BERA 3QWOA 2YPLD 3L7EB 2X4TB 1CXIA 5E8NB 4HPOH 5C3TA 3UTOA 1ZS8A 5CGYC 2V2WB 1E4KA 1QRKA 3E2HC 2EDWA 2BJML 2DTMH 4YGAB 1AHWC 2R8SL 1P4BH 5JW4R 3HMXA 1JGUH 5T33L 2NXYB 1J18A 1U9KA 1JZ3A 3C60C 1GGTA 1MHHB 1TLKA 1ZK9A 1CLZH 3O0RL 1C08B 2AJVH 1QG3A 2C1OA 1FFOB 3N1GC 2ID5A 3T3PF 2PETA 1AO7E 1AXTH 3T0VA 4GAJL 5JW4Q 4ELKA 1RULH 5IHUL 2XXMB 4G43A 5HYQA 1S9YB 2PUQT 4FMFA 3VFTA 5L2KE 4LSUL 1HE7A 5BMFH 4HFWA 1PFCA 2IALA 3OGCA 4Z7NF 1DEDA 4I2XE 5E6ID 2APXA 2DJ4A 4K55A 5LCVL 1E4JA 1SYSA 2ZCHH 3EHBD 4LCCA 4HC1H 1TTGA 4F7PA 4BSVB 5FM5M 3TN0A 3BD5A 1EEZA 4XZUA 5HHMB 4ZD3L 5JO5A 4KY1L 4PJ5D 3OHXA 4XBEL 1KELL 3KPSE 4JDTL 4RFNB 4IS6B 1IEHA 1DVFD 1ZLUK 3H2WA 4O2EB 4JRYB 5JPMA 2PYFA 2ITCB 1G1CA 5LJYH 2HVKA 5KOVC 4HIXL 4I3RL 4H8WC 2R1XA 5I8CA 2Z31A 3ARGB 2NXYC 4B7IA 1A0QL 5I1LA 1G7PB 3MFFB 3IXAB 4HKZA 1M71B 2YPKA 1Q1JH 3DO3A 1KN2L 3EFDH 4KK5D 1K8DA 4PJAF 3L6FB 1UM5L 3D5OF 5DJ2A 4OZIF 5IW1A 2FGZA 3M1BB 4L29A 4PB9L 2GTZB 3U30C 5JIHA 1KSRA 4H26B 4LF3B 1DUYB 3OAYK 5F7KC 4HIEB 1CQKA 4R7DB 3ES6B 5DK3A 2FLRT 2EXWC 3MA7A 1IL1B 3GDBA 3W82A 3WS6A 3NABL 5JR1L 4YXLL 1BD2B 5DQJB 1CR9H 4WFED 4YDIH 5DEGA 5HDBF 2OZ4A 4DW2H 1IT9L 4PREB 3BAEL 3B5TA 3O11B 5EU6A 4Z7QF 2BC4A 4FS0A 4GKZB 4BQ8A 4PTTB 1BGXH 4XXDB 4HWBL 3GBNH 5E6ZA 2QQKL 5F6IC 3V4VL 1VGKA 1YY9D 4WGVB 4UT7L 2FJFB 12E8H 4H1LB 4MD4A 25C8H 1JF5A 4Z7UB 4MMXC 3RWFB 1CBVH 3MV7A 3PGDB 3QRGH 5FYKU 1FL6A 2HKHH 3H9SA 3O9WD 2Y36L 4KGLA 2VIRA 4X6DF 3WYRA 1HI6B 1S7TA 2NY7H 4NZTL 4WCYL 4DN4L 1WBZA 2AJXL 5J57B 4KFZC 4O9HH 2H1PH 4RAHA 5EOQH 4IMLB 1KIPA 3HLAA 1A3RH 3TLRA 4LSDA 3HCVB 3LD8B 3SGDH 3CXHK 3MRKA 1OAZL 5F7UA 5EC1A 2ADJA 1U8KB 4RGNE 2G2RB 1VPOL 4LQ1A 4ZOBA 1ERNA 4U1HB 3C9NB 2MHAA 1I8LC 1K4DB 2ICWB 2QSCL 2PXYD 1EUTA 1T89C 3QG7L 2EDXA 2FIRT 5BOZG 3MA9L 3FJTA 3LIZL 4YX2L 1KCSL 5JW4N 2P5WA 4KXZH 4JY4B 3X3FH 2HT4D 5H37H 1WBYB 5B39A 1QNZL 5IVXF 2YPLB 2IAMC 1MVFA 3W0WD 1UB5B 1CN4A 4RGMC 2QTEA 4V1DA 3Q48A 1BFVL 5FOBB 1NGQH 1QLRB 1LE5A 5LAXA 4MXQD 3GSNA 4O4YH 1RZKL 4UOW0 2AK1H 4X6EB 3U36A 3I6KB 3B3IB 1D9KC 3QDGA 4LCYA 2VTFA 5F7HA 2OYPA 3TH3T 5T1DL 3WUWG 4AQOA 5BVPH 4LLMA 1HXMA 2XV6B 5C09A 4QRRD 3VA6A 2CLZA 1BBDL 2C9AA 4OKDA 5HGDB 5FEBA 3WNMA 1WF5A 4HUNB 5FDWA 2V2TA 2ZOLA 4CJ0A 4I0PA 4PJCB 4W81A 5EZIL 1LD9A 4P4RA 2DN7A 5GSRB 3RL1A 1ES0B 3MLRL 4N9OB 2VLME 2EE9A 1MUJB 5I18H 4K7PY 4NCC2 5BS0A 2O93L 5D9SB 1KNOA 1T83C 3OKKB 2P42B 4MXWH 1W2KT 1KB5L 3HZMB 5DA0B 3AS0A 3ZSSA 4J12A 3HG1E 4ZDHA 4PJ5B 4NKOA 3K4AA 3F58L 4ODXB 3IJHA 4KJQC 3RHWF 1DVFB 4MWFA 5DMKB 2XTJE 1M7DB 1MJ8H 3EDDA 4NQEE 4JN1L 3VFSA 1FORH 4RX4D 2F53D 4GRLA 5JUEL 3MXVH 3B9EA 4Y1AE 1MJJA 4Y7MA 2HJFA 1NKOA 3DTXB 1AO7A 2OR7A 3HI5H 4D0CA 1QR4A 5EU5A 5MI0B 1FC2D 3S96A 3VFUB 5DQDL 5CSZA 4U6YA 4LPXA 5BJTA 3ZKMD 1I1CA 5E0QA 2P1YA 3LEXB 4LHUA 1A1MB 1NFIA 4WO4C 4NOBA 1JYWA 4I2XA 4R4NC 3C5ZA 3NOIA 1UFUA 4LKCA 4QHUB 4H8WH 4XPGH 4Y4HA 4TRPH 4U0RC 1ORQA 3DVNB 2B1HL 5E2UH 3VFMA 1BAFH 4R8WL 2XN9D 1LEIB 3FB7B 3VXQB 4PRAA 3D9AH 3KPSA 5FOJA 5CBEB 2H2SC 4M4RA 4XRCA 2DQCL 1NEZA 4HV8B 2UZXB 3DUSB 4MDJB 2ZUUA 1LP9E 4LPUA 1DBAH 1IM3B 3BOVA 4HK3J 4LCWD 1H8SA 4OZGB 4Q2ZB 1KJVB 1R5WB 3DXAE 4Y16C 3WFDL 1H15A 3EKCA 5KOMC 3VFVB 2C3HA 5GS1A 3VWJD 4JO4L 4X7DC 1CDYA 4PY7B 3BN9C 3VI3E 1KG0A 3CFIC 4YDJB 1B90A 4FQ2H 1LK2A 1OSPH 3HMWL 2IQAB 5C0IB 5CINL 4I77L 5HYJE 3WXWH 1W0WA 1HNFA 5BV7L 1PQZB 5MI0C 1KJ2A 5HY9A 1MFCL 4GW1A 3TVMD 4LASH 5FO7B 1KTRL 1A5FH 3VFOA 1VGEL 1HHKB 4DVBA 3IXTB 2ARJQ 4Q97A 3ARDD 1HHJA 5F88B 2XXCB 1J05A 3E6FB 4P2OB 5I8KH 2FLBT 4YHML 2FX7H 4OAWB 4XHJC 3EO0B 4XPBH 1NC2A 4XCCH 2PXYB 3QAZB 3ZT5A 4TPRL 5J6HA 2CDFA 5DK2B 3RWCB 4DGYH 5T3ZL 2OJEB 2QADD 4RISH 4FFWD 5F1SA 1U8IB 1MWAB 4RCAA 3V9FA 4LNVA 2CJUH 4PP2B 4P23C 2V5SA 4K3DH 3F5WB 3MCLH 2UY6A 3PWVA 3SEPA 4BFEA 4IRJD 3NZHL 1F4HA 1KIUA 1JWUB 1PLGH 4K8RH 4M5ZH 5C0DB 2CK0L 1D6EB 2EIZB 4DGIH 3RAJL 1TVHB 1IJ9A 1I1AA 3S4SA 1TQBC 4NQCD 4JO3H 5E95B 3J7HA 2PTVA 3ARXA 3BD4A 1TZGH 1JTTA 4Y5YB 5CHNB 2ZSWA 4M93B 1YQVL 1F4YL 3K81A 2C7UB 3MROA 4DAGH 2VL4A 5E9DD 5HHPA 3B2UD 5IJVA 3MOAL 4P2OC 2A6DA 2MJWA 1XGQA 4KUCF 3MQIA 4Z78A 5I8EB 3P0VL 3OKDB 1GGIH 3OB0K 3RWDB 2MCPH 5F96H 1WIOA 4NNXA 3NA4A 1UA6L 1HH6B 2X4RB 4ACPA 1JN6B 4WHTB 3ETBF 1NSNH 5D93C 1NLBH 5JQ6L 4F9LC 5HI4D 3EYSH 1IC4L 3SDCD 4FQHA 1DQLH 5CSGA 4ZS6D 3QA3A 4WENB 3FO0H 4OM1H 2VLKE 4HIHB 1Q0XL 4N1HB 4EZMA 3VGEA 5DRXA 4MQ7A 4OI7A 2F53B 4MD5B 4XT1C 3BKML 4YHPB 5D5MF 1IQDB 2H32B 5KAQF 4Z7WB 2DQGH 1EXUA 4A2LA 1DDHA 3WUZA 2WMPA 5FECA 2CLVA 3RX5A 2VOTA 3VI4E 4PR5B 3KLHD 1YEFL 2I07B 2BDNH 4M7ZC 4HWEL 3HRZA 4KVNL 1N5YL 4LCUB 3U1SL 1I9RH 2AERT 1RFDH 4OCYL 5I75B 1OGAA 5J12B 2W9LA 1RMFL 1QLFA 2VSDA 5F7DA 5IMOA 3K1KC 1IRAY 5GGVL 3I02A 3KS0J 4OGZA 2BNUB 2CLRA 3MNVA 2M2DA 2V5RA 3GSUB 2B39A 2HFGH 2ZNWA 2GSIB 5E8OA 1RU9H 1FNHA 4DGVH 2YRPA 5GSVB 2X2YA 2I9LA 2Y4SA 2XN9B 3HG1A 3FFDA 5CIPA 5EORH 3G6JF 1XR8B 1ND0B 3O2VH 1WFNA 4LVHB 1HEZA 1UM4L 1NANH 4X6BB 4DZBB 1A8JH 3W9EB 3BI9X 3KLSA 5CWSB 1K85A 35C8H 3BGAA 4LCWB 1T0NB 5IGXH 5BOPA 3VMPA 1PDKA 15C8L 1KLGA 3VWJB 1U0QA 3U9PH 4WY7H 2F58H 1BZ9B 4PGCA 3BPLC 4O00A 4AZ8A 1AI1H 1C7SA 5JIIA 4X8JA 1BWWA 1KCLA 4UINL 4K7PH 2A6KA 2KQNA 1FZJA 4C59B 3QCVL 4I13B 2ZPKH 3TVMB 3S34H 4MYWB 3SKOB 4XPHH 3R1GH 1CG9A 3ULVD 4U1KB 5J12C 4V2CB 2C1PB 2W0FB 3ARDB 5J0BA 4NWUH 5I1EL 4BH7B 1CLCA 1JF6A 5ALCL 2BRRL 3FONA 4KI5F 4CVZA 5L2JB 3U79A 4J4PA 4KMTH 2XA8H 1HDMA 2JJSC 4TSCH 4U3XA 3U7WH 2VO5A 3L5IA 1GRWA 2ORBL 4DKDC 2Q76B 4JDZA 5DJZB 4HJGA 2QADB 5D4QA 1LMKA 3K1DA 5DVMA 1LP9A 4QOKE 4UBDD 3CCHA 5IEKB 1SEBB 1ZHBA 1KJ3H 3DXAA 5K9JL 5J6GA 3LZFH 1CE6B 4Z7VF 5EU4A 4M9PA 5HYSB 2C4XA 3BYTA 3VFPB 4IRJB 2VC2H 3UJJH 3JTTA 4RA0C 3S98A 2PTUA 3CU1A 5C08B 4KVCH 1KCVH 4JM2A 1HHGB 4IHOB 2P8LB 5HYJA 2QSQA 4O02H 3QUMA 4YC2C 2A73A 2HFEB 5I2IB 1LE9A 3TH2T 1G9NC 1LNUB 5DZOA 4XVUD 5J13C 4CUCA 5C07E 3AS3A 1BJ1H 2W9DL 3PGFL 1YC7A 3QUZD 1ITBB 1DQMH 4D9QE 2F74A 1IM9A 3GMMB 3F7RA 5E9DB 1BBJB 2ZWLT 5F9OL 2BVEA 1AGCB 2W38A 2WQ8A 4OCXL 2HRPL 5DR5L 1BQHG 3RVVD 2UWEF 2V7NB 3AAZA 5D7IA 3EOBA 4UUJB 4I3SL 4X0KB 1SQ2N 1DTUA 3KDMA 3UC0L 4UAOB 4EVNA 3SDCB 4F58H 2X70A 2BJMH 3ULUD 2H45A 3TIDA 5K9OA 3BGFB 4NO2B 1DSFL 5SV3A 1QBLL 1XH3A 3BDXA 2Y06L 1QSEE 2X4PB 3EJJX 3PL6A 5EOTB 4HS3B 3BKCH 1MCWM 3NCEB 4F37F 4HJ0D 4B0MM 3EYFA 5F7YC 4YAQA 1NBZB 4WIQA 1L7IH 2W92A 4GS7B 2GUOB 1J10A 1SEQH 2YK1H 2V5TA 3R06A 1JJUA 1WIUA 1KFAH 3NFPA 5KSAC 2XY2A 2FL5B 1NGXA 1AQDA 2Q7YA 3W2DL 3OSKA 4I48A 3QZWB 1MCIA 4UV4L 3CX5K 4NJAH 1NCBH 1CK0H 4NO5B 4UT9L 5GGSA 1U92B 5K9KA 2H8PB 4QHMB 4XP4L 5AAMA 3JWOL 4K07A 1BECA 4CMHC 2GAZA 1CGXA 4JY6A 1EVUA 3BEVB 2XZAL 4KY1H 3SGJC 5C0FB 3D48R 3JWDC 3ME0A 3F7VB 4ZFFA 4UAOC 2OQJA 1JWSB 1KTDA 2VLKA 1BZQK 1KTLB 5B8CB 2BVOB 1RUMH 3SKNB 4PJFF 4PLJC 3BGFC 4I3RH 4XI5D 1EEQA 1EFXD 1AC6A 3GKZA 3QUXB 5HVGB 1Z6JT 3GO1H 3OAYH 5GJTH 3SE3A 5ABDE 4PRHD 2GEEA 2GKIA 4JB9L 4NKDA 2QV2A 5E7BA 1YECL 4KRMB 4NWTL 4NZUL 2D7TH 4MNGE 3MRDB 3WS3B 1ZLSL 3O2DL 1UM5H 3ARFC 3C5JB 3QIWD 2XPGA 4KKAD 5C6WH 1ORSA 1A9EA 1CGWA 3ZO0A 1FH5H 2X4OB 5EO9B 4OFKA 5GRJL 3T2OA 1WBXB 4D0BB 5TH2A 4B5EA 4P3WA 1P5UA 4CADA 2Y07L 3WNOA 3MRPA 2A9NH 3FT2A 4G42B 1U8LA 4Q6IC 3AS2A 1T4KB 1MCKA 4QEGA 2BX5A 5DMIL 5HD8C 4PJHF 1I3GH 4H0GA 4PG2C 3GSRB 3L1OL 3UTSE 5L88H 1IT9H 4WTZG 3UXFA 4WHCA 1I3RB 1Y0LB 3SDDD 2X40A 4QXUH 3Q6FB 4JFPA 2LE9A 2VDOL 4XMLL 5IB4B 4P2QE 1I7TB 3QEQD 4LPVA 3JV4A 3MLVH 5ESQB 3RVTD 3UPRA 5GISL 1QYGL 2ATKB 4HBCH 2V17L 2GFBB 1GSMA 4Y4FB 4JFXA 4MJ6B 5ADPH 5IB1B 1BVLA 2Y36H 3QUXC 5C3LD 3B9AA 1KCUL 1FL3A 2R0LH 4BZYA 4KZDL 4NOFA 2P7TA 1FAIL 3JUZA 5F7LB 1NCTA 4QHLA 2W60A 1F8TL 3SDYL 3MV01 1ADQA 3QXWA 2DYPD 3GHEH 2EIDA 3RKPA 3B5GA 4D9LL 5LBSL 4KKLC 1TPXB 2BRQA 1PY4A 4GO6B 4XBPA 2W0KA 3SDXF 5BRZA 4DZ8B 3GIZH 3SCMB 4JR9H 1DLFL 2VL5A 1XGRA 4R0LA 1RIHH 3CDGB 1VPOH 2D7PA 5IOPB 1VEPA 3QUZB 1MCPL 2M1KA 2ZJSL 3VXNB 5KVMC 5DUBB 3MGOA 1P9MC 2EDJA 5DFVC 4I9WE 1I1FA 4JJ5B 3RTQC 2HH0H 4OQTH 5E94B 2H3NA 2BZDA 1XGYL 2XT1B 3OTTA 2VDNH 2J8UF 4O5LL 4FABL 5J11B 3WO3B 1QSFA 5F1OB 3GSOA 3VRLF 1G84A 4URTB 1FDLL 3I6GA 1PJ9A 1G9NH 4QOKA 5GGVY 2VZTA 4KI5C 1MCDA 4GKNA 2DMKA 4NHCL 1AIFA 4D0DA 1F58L 2X4UA 1PY9A 5ACZB 1P84K 4Y4FC 4GMTL 1NDGA 4U1NA 5E5MA 3IDGA 5TQ0H 1NCAL 1V05A 1QFWM 3KYOA 4Q0XH 1WITA 1A9BA 1FNAA 5FYKL 2GI7A 2A6IA 2FO4A 1I7RB 1F4AA 3ZZ1A 2IFFL 4ODUA 7CGTA 4JKPH 5E2JA 1A6ZA 4IRSD 4NM4L 3MRMA 4OBSA 4GMSH 3RU8L 1RZ7H 1GHFL 3V6OC 2JLLA 4PG9B 3QIUC 1ACZA 3WUWA 2ZSVA 3MLRH 4L4JA 5C0BD 1HZHL 2Q86B 3REVB 3FO9A 1KN4H 4RIRA 3SJVD 3OKEB 1WTGT 5HPMA 2CKBB 1XCQB 3H7BB 5DURD 4PJBE 3HZYA 4QRUB 4MVBD 5GJSL 3ZE0E 4GAYB 2D4DA 1IE5A 2VISB 2QR0B 5AUMA 3IAPA 2YBRB 1OAXL 1JFQH 3MRBA 4MNHA 4AENB 4JLRB 3S36X 3JBG7 1QSEA 1JMZA 5CZVL 1L6ZA 5DJ8A 3RIAK 1B0GB 3BJ91 1QOKA 1EFXB 5IP4A 1M7IB 2BCKB 3FOLA 4JFHE 1TJGL 1RIUL 1CDBA 5EA0H 5F6HI 4Z7OE 4PRHB 3FMGL 1F90H 5EZJA 1I1YB 1KPUB 3O45A 2ADGA 4EKXA 3LRSA 4FP8L 4N0UE 4S2SA 1MCHA 4WUKH 3QIWB 4DOHB 2KL6A 3L3IB 5D6CA 1UM6H 3EYQD 3JWDH 1M1SA 5FF6B 4FQXD 3SN6N 3W9DB 3VDCA 3TZVA 5ELIA 4N9GA 3L7FB 3VD5A 2HJLA 5JOEA 4ZTOH 4HC1A 4KJPC 1HHHA 1GC1C 1W72B 4JG1L 4XBGB 4ONHB 1J1PL 2X4SB 3U6RA 3BSZH 3BKYL 3FOMB 4FQQB 2B1HH 1G7LB 5EBLA 1QFWL 4LSQL 2Z8RA 1D6VH 2PR4H 2WK2A 2W0PA 3PXHA 3TA3A 4NIKB 2XQYK 4QRSB 5B38B 5ANMB 5F7EL 1X5HA 3SDDB 1JHTB 4JFYB 2Q6WB 3EOAB 3EDEA 1A2YA 5HHOE 5I1DB 5F3HB 4OFPA 3PHOA 3IFPB 3QEQB 4QTHB 1YMME 5SV4A 5D6DA 4JVUA 4NHUB 3DNKA 3LV3B 5AYQA 1JIBA 4M43L 5FHBL 4GRWB 2VXSH 1RURH 2J6EL 5T1LA 1JPTL 3KYKL 1JE6A 3LQZA 4GSDL 1QO3A 3ZDZF 4MNGA 5DLML 1SY6H 3I3BA 2CIKA 2IAND 3VXPB 1JL8A 3BPNC 5LGJA 1VA9A 4ZPTB 4XAWH 4OZFH 2DYPB 1IQWL 4QHKJ 5ID1B 1B4JH 1MHPH 1JGVL 4X4ME 2APBA 4NN6C 2YZ1A 1FV1B 4YHZH 2HT3C 1U8OB 3U46A 1YEHH 4YXHH 1VHPA 1G7MB 2CQVA 3VFNB 4J3UA 4X5WB 1LDPL 2N4IA 3FQRB 5I17B 1FNSH 4AEHH 4FXKA 1U6AH 3BQUA 5FYLD 4OSUH 4GKOA 4WU5A 5GRYA 5EBGA 2FR4B 4P2QA 4EDWL 3I6LE 5JMRA 2YUWA 3RDTD 4HUWA 4HKJA 4RMQA 4L4VD 3T1FB 3ZL4L 3CH1A 3GMLA 5IROA 3O3AB 3E8UH 4G80B 1ETZA 3IU3A 3MLTB 1F4XH 4JPWH 3L5WA 1J9CT 1FVDB 3MOBL 3SY0B 1ZHKB 1DQJB 4RRPG 2LTQB 5DFWH 3WKNA 3BXNB 2ED8A 1N5AA 1AE6H 4MDIA 3EBAA 5J8OA 3GSWB 5TPWH 4A6YA 3MBXL 2L7UA 4I18B 4O51B 1F3DJ 4U6VH 4F33B 1Q9OB 4WI8A 2JELL 1U36A 2YA2A 2BY3A 4IRSB 4EDXB 2Y25A 4Y89A 1TZHB 1F4YH 3QFJD 5CMAB 5ENWA 1YYMH 4UIMA 5EFIA 3OKMA 2VLRE 3RVWC 1NAMB 2RAMA 5KSBE 3GJFH 3PJSB 1Y18A 4MB3A 3VD9A 2YMXL 4TVPH 2YD7A 2PCPB 1S5IH 4LGSB 5C0BB 3QNXA 4C83B 3O3BA 1OAQH 1BP3B 1TZIA 2RCSL 4DUWA 1FLRH 4HH8A 4AM0B 3VRJB 3HC4L 1KJMA 1QEWA 4LBEA 4P0DA 5DURB 2UVFA 3L5XL 4PGDA 4PJCF 1Q0XH 1TIUA 3CMOH 4OCSH 3GSVA 1CFNB 5IHBA 1N4XH 3OR6B 2AJUH 2AJZA 4LMQI 3PWUA 3GBMH 1JHLH 3BKMH 4M7LH 4P5TA 3P4OA 3O8XA 2NY2C 3T3MF 3SHSA 4ISVB 4KK8C 1MWAL 1NGZA 4LVOB 1T0MB 1MFEL 2G5RA 5KVGL 1TJIH 1U3HD 1FCGA 1YEFH 4Z6AT 2A38A 4U49A 2ZG3A 2DQJL 1CI5A 4KHXH 3MYJB 1RSFA 1AHWA 4S11A 5DI8A 3GM0A 4X6CB 5IG7A 4FQXB 4C58B 4OIAA 2P8MA 4Y2OA 3V0VA 5F7WC 3C08H 4XCFH 2AKRA 1GIGH 3O6KH 4G6JL 3HR5A 2BOBB 1ONQB 1Z0NA 5T1MB 1OM3H 2R23B 3VH8B 5E2TL 3EYOB 8FABB 3DX9B 1CVRA 1D5IL 3DV6A 4XXCC 1NFDB 5FYJE 3QXDB 2ZCKL 1KF9B 1V7ML 3QO0B 1XEDA 1IMHC 4LPYA 2WUCL 2YWZA 1NJ9B 1A64A 5J06A 1UQSA 1RZJC 2E5EA 2DL9A 1RK1A 1GC1H 15C8H 1CIUA 4U6HA 3MRNB 2XZQL 1A7OL 2ZKHH 1QR1A 2IPUK 3QIBD 4XP9H 3KXFA 2IANB 5IFJA 4UINH 3AU1A 5HHQB 3EGSA 4J3VA 2AXGA 5KVEL 3ZKXB 5DD0L 1AGDB 2FIKB 1OSZB 2F54D 4EI5D 1FZKB 3VCLB 3WJJC 1BIIA 1EEYB 2B1AL 4QRTA 5IUSA 1LO5A 3QI9D 5JHDE 4DKEL 4H20H 1WCBB 4PY8I 5SX5K 4ONGL 5IMMB 4F3FB 3ABZA 4M7KH 3AXLB 4X6FA 3SKMB 1ZSDA 5EO1B 2GJZB 4FZEL 3TPKA 4N5UA 1HOCB 5HHOA 2DOCA 3CFBA 5DWUH 1E28B 4TSBL 1N7MH 1YMMA 3RDTB 2ZUQB 1EV2E 2HLFC 4OZFG 1IGYB 4MCZB 2BOCB 5E1AB 3SGEH 3UBXB 5MHSD 3KR3L 1X4XA 5KSVB 4ZXBD 3HE6C 5DJAB 4XCYB 2LVCA 4HGKC 1U91B 4R96A 3TBYB 3LKRA 1OGTA 3G04A 2DJUA 1X7QB 4QRPA 1ZGLP 2EKJA 4AG4L 5I6XC 4P2RD 1LEGA 4RAVB 1EHNA 2CMRH 4MA8H 2W9DH 1YA5A 3BMVA 4M1DH 1IKFL 3QFJB 4OUOA 5HDBE 3VXUA 4EXPX 3L95A 3DHJA 2EYRA 3RZWA 3LN5B 4LP4A 4XVJL 3KLDA 1EMTL 3IDXH 2JB5H 3KPRB 1J1XL 5HJ3B 1JGDB 5JLZB 2VQ1B 4LEOA 3LQAL 3MJ8B 2NCMA 4OBRA 3QISA 3MRCA 1AP2A 1QA9A 5JZ7C 4FQIH 3CUPB 1P6AB 3QQ9D 4M1CC 1UJ3B 2K7QA 2DD8L 3AGVA 3NN8B 1CTNA 1CICB 1BQHA 4X5XB 3H42L 2X42A 5MEND 1I8LA 1QBLH 1RJYA 3M07A 1XR9A 2PTTB 5IEHB 4Z95H 1HHIB 1T89A 4OD2A 1BX2B 5L8JB 4DN3L 4G3YH 1DEEA 1T03H 5BQ7B 2ZZUT 5FFLA 3MRFA 4OCRH 1IGTB 3BT2H 2XTLA 2IAMA 4MNQE 4F7TB 3QDME 1U3HB 1J0YA 5DHVA 4HUVB 3V4PH 1JYNA 5ID0B 4APQD 5TQ2H 1QVOB 3PP3H 1ZLWK 4NZRL 5HHVH 3WLWD 4UV4H 2VDMH 1TJHL 4MLIA 2HAZA 5DUPH 1YPZF 1DBML 3QHTC 1EZVX 4Z7WF 5ISZE 4OJFH 4YHLH 3G6AA 4QTIL 1I7ZB 3TNMB 3UPCA 4CN6A 1S7QB 5IK3A 2Q8BH 3FAXA 5CFHA 5DS8A 3N1QC 3NCFB 4HWUA 4JVPA 2A83A 1R24B 2VZUA 4YZFE 4GKSA 2ZCLL 2CKNA 2H9GA 1CICC 1X4ZA 5I1JH 5C7XH 3O6FC 3P77A 1C12A 5E8PA 4TNWK 3PE9A 1J5OL 5B3JE 3W11D 2NY0D 4L8SA 4I4WA 1MCEA 1S7WA 3U2SB 3HPJA 1A7RL 4FFZL 1SVCP 3GHBL 4L3CA 1Z5LB 5AYUL 4GRMA 2FYYA 4NQUA 3QIBB 4J23A 2UYLA 3O2DH 3TBTA 3HC3H 3ROOA 1A1OA 1YEEL 5DJ0B 1OCWH 3WE6B 1R0AL 3SE4A 3P9MA 4HK0A 4WJ5A 4P46B 2F54B 1MJUH 1XZ0B 4G5ZH 1ZA3B 4EI5B 2Y07H 2FO1A 3TCLB 1ZTXL 1SYVA 2FD6H 1INEH 2DQTH 4OZ4B 4XWOC 1F4WL 4LKXB 4ORZC 2HN7A 1RZJH 3LPWA 3QI9B 4JFDD 4PJGE 4PJEE 3FQTA 3N9GL 1X3DA 4RMUA 5ERWA 1CLOL 4ODHL 1PKQE 2NY5L 3IKCA 5IFAL 2VLLB 2CH8A 2MQCA 5ACMA 3GMPB 1IGML 3NCJH 1KEMH 3H3PL 4JANB 3VFGL 1OD9A 4WO4A 3UAJD 3NH7H 4OV5A 3X14B 3LAFA 1KLUB 4NJ9H 3WIIH 2IH3B 4L8CA 5DJXA 4WTZA 1K8IB 4YR6A 3OF6D 4R97C 1CGVA 4PTUA 5DYOB 5FK9A 3RGHA 4KZDH 1RD6A 1N2RA 3HB3D 4KAQH 1FAIH 3MV9A 1AD0A 1IAII 3IDIA 1Z9MA 4HKBB 5FUZL 2EICA 5GS0C 5LBSH 3S36L 1FRGL 4P2RB 4NT6A 1GOGA 3C8DA 3BE1L 3DYPA 2E6PA 3G5ZB 3RIFF 4P4KA 4IM8A 4Y16A 5TE7H 2VABA 1HXYA 2XIDA 4HX1B 1S9WB 4PLKD 7FABH 1CL7I 5DD1H 3DUHA 2B5IB 3OKNA 1YEGL 1IGFL 5GRVK 4OKVA 3MRGA 1JV5A 4UT6H 1P2CA 3TJEL 1XGYH 3C6SB 1KXVC 1Z3GL 4O5LH 3FZUC 5ADOL 2C3GA 5EU6D 3IFOB 3TYGL 4BH8B 5DO2D 5C0CD 3QEHB 4XVTL 1FVEB 5BO1H 2ZG2A 3ULVL 2DWDA 1E4XI 3QWRA 1OQXA 2HTLD 1EHLH 3EJYC 5K33A 3ZYIA 2JCCB 4QWWD 3MLZL 3NCBB 4J3TA 3OQ3B 4S1RL 3SGKA 5L6YH 4JPIB 1IGCL 5T1KA 2G75B 1VADA 4ZFOB 1GYAA 3B9DA 4X7TB 2LABA 2EO1A 4R7NA 1RZGB 3KLAB 3CH8A 4L9LB 4NM4H 2OL3H 4XP6L 1OLLA 4K3GA 3RU8H 1S7XB 3L3KA 3Q3GA 4FXLA 5ICXB 5KN5B 4APQB 1AQKL 3CZFA 4PLOB 4U1MA 1F42A 1U8MA 4E42A 2FHFA 5EU7C 5ITBH 1INQB 2HG5A 1LVEA 4E41E 4FQLL 2B5IC 3NIDF 1JYVA 1U8JB 3D39B 3RBGA 1JZ8A 1OD7A 1UKTA 3QWOB 5FUCC 4IDJL 2H2PC 3UTTD 1EO8H 2V9QA 2CIIA 1OF2A 4EUPG 2DBLL 5M7QA 3EJZC 1ZT4A 1JRHH 3TO4A 4OCMC 3JXAA 4OGXL 4Y5XC 1MFAL 3IJSA 2ICWJ 2P45B 2FH6A 2X9XA 1A21A 4M6ML 4YUEL 1UXSA 3QDGD 1MIEH 4ZFZA 1TJGH 2NTFA 2NY0B 2DQEL 3O4OB 3OXSA 4EI6A 1RUQL 3GKWL 1KPRA 4JFOA 2BHUA 3GUTB 5D1XC 5F97E 4F9LA 4ELKB 4FP8H 3QDMA 3HNTH 3ULUL 1VFBA 5C0JA 1N6QH 4XH2A 4LVNB 4JKLA 4YDLB 4I0PD 2X4QA 4UV7H 1MAKA 2IQ9L 4HIJB 1R3JB 4HFWB 3PQYE 3OGCB 4GBXA 3VXTB 3QUYA 2Z35A 1VESA 4F7MA 1PBYA 5IVXA 1SYSB 1LO3L 5ISZA 1HYRC 2I5YH 4JFDB 5D7KD 5T5NG 4F7PB 3OJVC 5DD5H 2FGWL 3KHQA 3TO2A 5FA3B 4BUHA 3GGWA 1RUAH 4XZUB 1QBAA 1HINL 3BFOA 1UWGH 5EUOB 3JV6A 3OHXB 2R0WL 3LEYL 2V7HA 4LQFL 2DQUL 4RFOL 5D5ME 5INCB 1OY3B 3FCTA 4NSKB 4Z0XA 3ZKND 2PYFB 3ULVF 2HVKB 2J5LB 4GG8A 5FHBH 3T0XA 5I8CB 2Z31B 2BHYA 2CKBL 4PRDB 3V0WL 2ZUVA 5I1LB 4ZS7H 4HKZB 1AO7D 2YPKB 3V95A 2Y23A 1JCKA 2XWBA 3QT2A 1JK8B 1K8DB 4XCEB 5IW1B 4L5FH 4L29B 1PGRB 2WLZA 5H35A 4QLRA 5L2KD 3G9VA 4JREB 2KKQA 1SJEA 3DIFA 4ETYA 4EXKA 4PPTA 5GGQH 3C5ZD 4EQ2A 1OLZA 3MA7B 3T8XA 4LSSL 2ED9A 4IJ3B 4PJGA 4PJEA 5EIVA 3QNZA 3SKUD 3G6JE 4XMPL 4XX1G 1BM3L 4G8GA 5E2VL 4LCCC 3G08A 2DM4A 5DEGB 3MUGA 4OUUB 3MLPA 3TN0C 5HSFA 2BK8A 4RWHA 1AC0A 3KPSD 5EU6B 3RWJA 5ACLA 2BC4B 2DLFH 1UEYA 2WWKO 1LO2H 3FQWA 3T08A 4EDWH 5C0CB 5GS0H 2VWEE 5I8OL 3MXWH 1W72L 4J1UA 1KCRL 1A6TA 5D7JA 3MRJA 4XC3H 1QLEL 2VZSA 4S1QL 4WI5A 4KJWC 1CXKA 1PKOA 4XVSL 3P30L 3S35X 3MOBH 1FL6B 4BZ2H 1HSAA 4K9EL 4IIQA 5IB3B 2Z31C 2R0KH 4IBLT 4AEIH 5L8LB 1S7TB 4PGEA 2VR4A 1CDUA 2JJSA 3MLWL 4PJDB 2BFVH 3MBXH 2LU7A 1KIPB 1NBQA 1HQ4A 1MQKL 4NQDE 3HNSH 3ET9F 3J8F7 4JREC 4FQ1H 4DEPB 5I16B 5EC1B 4RRPA 1YZZA 2ADJB 3QO1A 4KI5E 2QL1A 3S7GA 3ULUF 3UYRL 1X5IA 4EEEA 4ZUVB 4TVPE 1I3UA 4KQ4H 4OQTA 3WS6C 1TQCC 1UB6B 2EDBA 2BSSA 2DIBA 4JKWA 3NIGF 1UGNA 1ZAGA 2EC9U 1XF2A 3QHFL 3AMKA 5B39B 3UTTB 5MERB 3PG2A 1G6RH 2DLTA 2E8YA 3IRPX 4H1LG 1JPGA 4OT1H 2P8PA 2VERN 4U2YA 3V6OE 3ZE2E 5D7LE 5HGBA 4V1DB 3SDAC 1DCLA 2APWA 5J9PB 4FTVE 5LAXB 1IEBB 1OW0A 1QBML 2AW2A 4JFFA 1VERA 4ETQB 1J8HE 3QDGB 4LCYB 5D1ZD 4YIQB 2F5AH 2NNAA 3RY5A 5JXAH 4KRNA 1MFEH 4MJ5B 4NQTA 4KRPD 5KVGH 4QXTA 3SKJH 3K0WA 4LLMB 1MLCA 1HXMB 4LLQB 1CFSA 4POZC 3RI5F 2WIMA 3DVGB 4U7KA 3WIHH 3UTZA 4K7FB 1U8PB 3VGGA 5FDWB 2V2TB 2ZOLB 4MHHG 4I0PB 3MLXL 3OG6B 4RA3A 3MJ9L 1LD9B 3CK0L 4DK6A 1MHEA 3QFDA 3RL1B 4E41A 3L3DA 1MFBL 2YXFA 2YD8A 2FH8A 1BREA 1UT9A 4NRZB 1KB5A 3QHZH 1CQYA 1A7NL 3RA7L 3ORJA 3FQXA 1KV3A 5BVJA 3MRLA 1KNOB 2WBJC 4WFHE 2FX9H 5E2TH 4YLQT 4GFTB 5F8RC 1UC6A 1GZPA 1NAML 3MACL 1FO0H 1T2XA 4ZDHB 2CPCA 3L3OA 1ZOXA 5KSUA 4TNVK 1FE8L 1ODAA 3VFSB 2YC1A 2YSSA 3AY4C 3CLFL 3SQOH 1NGWA 4MD0A 2VDRL 5I1IL 3WEXB 5L9DL 5E1HB 1BOGA 3BZFA 3IKKA 5JA9A 1MVUA 2HJFB 1T7ZA 4G6KL 5JDSA 2OJZL 2Y5TA 3OKOA 4LPTA 1AO7B 4G8FB 3FN3A 4D0CB 3SGJA 4K71C 1J0JA 2FB4H 4L4TE 5SX5H 3RRQA 4I8DA 4PRNA 1E6JL 4UB0H 4R4BB 5L2KB 1MELA 2GJJA 2OTWA 5ETUB 3QXAA 3D25B 3PQYA 4J3XA 2DQIL 4M4PA 5E4EB 4QNPF 4LSPL 1I4FB 2VLMD 4I2XB 4DKEH 3C5ZB 2R69L 2VH5L 1JPST 1QPPA 4LKCB 1TTFA 2XNAA 1QKZL 2VZVA 3MRQA 5DJCB 1NMAH 4F15B 3VFMB 3WIFA 5K59E 1TCRB 3KPLA 3GI8H 3DX7A 5D2LF 5F9AC 3ARFA 2WBKA 4JG0L 4FZEH 1D5BB 2OI9C 3D3VD 3KPSB 5DSCA 3FTGB 3Q6GH 4EOWH 1WEJL 5D5MA 2ARWA 3D0VB 2DQFA 3KYNA 1NEZB 1OP3H 1YC8A 5BXFB 5CD3A 4NQED 3H6JA 3TPUA 1N64H 1R3KB 4Y1AD 3IFNH 1H15B 5FHAL 5GS1B 4GRLC 1AJ7H 4PG2A 2M26A 2FX8H 1M05A 1KG0B 2CRYA 4ODVH 4KKBC 1S7UA 5KG9A 3RPIA 5J3HD 1MFDH 1LK2B 4OZFA 3V5HA 1R5VA 4PJIE 1AXIB 1W0WB 5T5FL 4GW4A 1KJ2B 4HFUH 5HY9B 2B20A 3DLQR 2DKUA 1I7UB 1Q9LB 2ILLA 4LAQL 1VB9A 3RGVA 4PJHE 1A4KA 4DVBB 1T3FA 3LEVL 3V8CA 2LAAA 3BWUC 4XHQA 5FKPA 4M61B 3L3JA 1HHJB 3U7AA 1J05B 5GXBB 5DEFA 3IDNA 3THML 1JBJA 3G6JA 4F80A 1EMTH 1IBGL 4JM4L 5E8EA 3T4AA 5KW9H 3A6CL 4WDIB 4J4PD 4PJ7E 4PUBH 2VXUL 5A16A 4Y4HC 3EUUA 4JAMB 2NY4D 1JI2A 2YUZA 4F15C 5FB8B 1HYSC 1RZ8A 5J6HB 1YDPA 2CDFB 3HAEA 5CILL 1LWRA 1T7XA 3EZJB 2GJ6E 3LS5H 3GBLA 1MLBA 3RVXC 3B4NA 3IETA 1ZEAL 2W9EL 2DIAA 3DXAD 3I2CL 1F6FB 1S3KL 3PWVB 1BFSA 4XPAH 1Q94A 1T5WA 3TJHD 4RGOL 1ZVSA 5F1KC 2IGFL 3RTQA 5C9JB 5FYLL 5HPOA 5DUML 2OK0H 4E9LA 3SDXE 2AXFA 1UVQA 2JIXA 1I1AB 2PO6A 2N56A 5D1ZB 5C0AE 5EG6C 3S4SB 2AK4E 2NY6B 1K4CA 4WUUA 5TF1H 2V6HA 2OZ4H 3B9KA 4NQDA 4KRPB 4BFGA 1WFTA 2VDLL 4JN2A 1L6XA 3WN5C 3K3QA 4XNYL 3H3KA 4ONFL 2ZSWB 3GJFA 2HMIC 3T2PA 4NZRH 1UXWB 3BEWA 3MROB 3S5LG 2NZ9D 1AKJD 1E27B 5HHPB 1UG9A 3L3HA 5IJVB 2A6DB 1D5XB 5IQ7L 3QPQC 3VRLE 4Z78B 1LQSR 4MAYA 2VDQH 1ZXQA 4NNXB 2X44D 3RWGA 3H9HA 3X11B 1OHQA 1JP5A 5DGQA 3P0YH 4UDUB 1BEYL 3BIBX 4JKKA 1F00I 1TMCB 1NBYB 4FQHB 1NLDH 1QSZA 3V6OA 2DQHH 4YJZL 4X6CF 3BDBA 4FTVA 5H8DA 2RBLA 2PW2A 3NPZB 3DROA 4HAFA 4XP1H 5DRXB 2VR5A 2VXTL 5EZLA 3DBXB 5IVZA 3ZMRA 1J8HA 1A7RH 1HSBA 5DEZA 1FQ9C 4S10A 4PJ8D 5IF0A 1I1AC 3PWLB 4PP1D 3GEWB 1IGJA 43CAA 5FECB 2CLVB 2J4WH 2NY6C 5EULV 4FZ8L 3FT4A 3RWEA 3RY6C 3I3DA 1OAUH 1NFDF 5D72H 3STZA 3V6ZA 4F2MA 5I1KL 3U9UA 4KRLB 1AXSA 4RGNC 2XKNB 4N5ED 2YKLH 3A67L 2HKFH 3WCYA 3QCTH 1QLFB 1NBVL 4XWGH 1OT1A 5I30H 1IAMA 2ERJC 2B2XH 5HVHB 2JTDA 1RVFH 2CLRB 1FN4A 2YD6A 3MNVB 1FYTE 1T5XB 3GSNH 1G0DA 2DMBA 2O26U 5FGRA 3G6DH 4GXUN 3CVHB 4JHWL 4XNQA 5HYEA 1UZ6F 1CFVL 1P7HL 1BLNA 3HPLA 4QT5A 3HG1B 4OGAC 5KS9E 3FFDB 2K3TA 5CIPB 1FG2A 5GPRA 1SVZA 3D3VB 2O5ZH 2VLKD 2CRZA 4JPVL 4HXAL 4MAUL 2XTJB 3QCUL 4BK4A 4XX1E 3DETC 4Q9CA 4NQEB 1J0IA 3B6SA 5KVFL 1YYLL 4NQVA 3V79C 4HBQA 1U2CA 2UZIL 3R0MA 4RWYH 4D8PA 1LO4L 1OT2A 3C09B 4Y1AB 1YEJL 4UU9A 5DJ6A 1U58A 1KLGB 3OZ9H 5DTFA 1ZA6B 4QHKI 2IG2L 4LIQL 1NUFA 2AEPH 4PGCB 4L4TA 4PRIE 4L1DA 3CLEL 4X8JB 4W4OA 2EYTA 1XT5A 1FZJB 4J8RA 4TSAL 4M5YL 1UWEL 4HUMB 4P57A 2ED7A 2HTKC 2NZIA 3TNNB 1QSVA 2YD9A 3FL7A 5GGRB 5ILTL 2DS4A 3BPOB 1RUPL 5CS7A 1BZ7B 1ZT1A 4OM0L 2RJMA 3RIAF 1Q9KB 4N0YL 4QYOA 5FAAA 3BVNA 3OKYA 5DRWB 4CBPA 1T20A 4YDKH 5IIEB 1HDMB 1WWBX 3VE0B 1VACB 2FATL 3FFCA 2CSPA 1A14L 1C5CL 2XG5A 3EOTL 4JFZL 4LNRA 3FQNB 1ACYL 4HJGB 4MXVF 4HS8L 4I3GA 1LP9B 2X89A 4MSWA 1DBBH 4KMLB 5AWNL 1YEDA 1QRND 5CZXC 3DXAB 5J6GB 4HQQL 5EU4B 1YNKL 1OAYL 1P1ZA 2H26B 2OR9L 4GXUM 2AAVA 5C6TL 2Q8AL 1ZGLB 3FRPG 4Z0BL 1GAFL 1FFQA 4MQSB 3RWHB 2E3VA 4JZOA 3LB6C 1UEMA 3WBDA 3BP6A 5FGBC 2G5BA 5IHZA 4PBWD 3CDCA 3QUMB 5CP7B 2A73B 3BO8A 3HC0A 2Y7QB 2A74B 3DGGA 2DDQL 1N26A 4MJIE 5FV1L 1LE9B 1WIPA 4XP6H 4PJHA 4AT6A 1JNNL 2AV1A 2OSLA 4G8EA 4G7VH 2DM3A 5SWSE 4RFEA 1AQKH 4RZCB 3BPOC 4R90L 3VXSE 1IM9B 2R4SL 3LN9A 3RX8A 5T3XH 2O61A 1QFPA 1AKJB 1ZWIB 1CDIA 2R2BA 1GXEA 1CE1L 4HF5L 2YA1A 3CSPA 5IJKA 5M95B 3DURA 3LCYA 3MV11 3VXRE 4PJ9D 43C9B 2RHEA 4HS6A 4N0FA 3V52L 2GJ6A 3Q5TA 4NRXA 4PJXE 4C54A 4JRWA 4LLAA 4CNIB 3DVIA 3K8KA 2DBLH 1BJMA 5I19H 2AJYH 2JJWA 5A2KH 4WEUD 5SWQA 2HLAA 4OGXH 3T77A 4GG6E 1MFAH 2EZ0D 2BP3A 3PV6A 1XH3B 3PL6B 3SDXA 4EUPA 2EEAA 5L7XL 5C0AA 3ARBD 2J1KA 3VGHA 4JM2C 4YAQB 3QJHA 1EZVY 1MI5E 3ARZA 4EBQH 4PJ8B 3S35L 5C07D 2E9IA 3KPNA 1NGYB 4NN7C 2VXVL 2ATPA 4YH6A 3NFPB 4D9QD 3MLUL 4CMMB 3UTQA 2J8UA 1NGXB 1AQDB 4ZFOL 4JHAL 1OL0A 4KC3B 1DBKH 5K9KB 4G9FE 1FFNB 3PDDA 4JY6B 1IAOB 1CIDA 4RDQG 4N8CH 4NN5C 1WAAE 4XNXL 5TE4H 5SWZA 2ITDB 1NC4D 2OQJB 3ROLA 2BVQB 2VLKB 3TBSB 3QQ3A 4WW2B 4M1GH 1WQVT 3IDMA 4MA7L 3V0WH 3PL6C 4PJ5E 1FSKB 5GIRB 1WJ3A 3DMMD 4WHYH 1EGJL 2WWMD 3O2DA 1NUDA 5JORB 5A2JH 1UACH 4LOUD 2OTUB 4L3EE 1NMCB 4BQ6A 4OD3H 2XPGB 4XGZA 2KH2B 1ORSB 3HMXL 2XZCH 1DANT 5I15H 1MNUH 5IR1A 2CR6A 5FUOH 3TZVD 2YHGA 1N59A 5DQ9A 2WBWB 1FFOA 2IADB 1BF2A 3QZWG 4YFLF 1FZOA 2E9BA 5A2IH 4DCQA 4D3CH 4CADB 5CJ8A 3FT2B 1CFTB 1YNTB 1U8LB 1JZ6A 5GHWH 1S9YA 1BM3H 1KC5L 4PS4H 3HZKB 4WI3A 1KEGL 4WFFE 3QXUA 5B4MD 3NFSL 4H0HB 5LVEA 3TA3D 3QNYB 5KS9A 1M7XA 4Q74A 4YHOL 1N8ZA 4JFPB 4LPWA 2Y72A 1X4YA 4BSVA 1KCRH 4O2FB 3JV4B 5EWIL 2AP2A 4XPFL 3UPRB 1TTUA 2GY7B 4JPKH 5M94B 3U0TB 4JFXB 3PF2A 4Z8FL 3SGDI 3O41A 4IS6A 5T1LD 5EOCH 4AIXA 2D0FA 5MP6L 1VCAA 1OOAA 5E99H 3SE3C 3ARED 2P7TB 1NDMA 1U2HA 1EJOL 1S7VB 4X80L 4PRIA 1MCJA 4QHLB 4YFDB 2AEQH 2AQ2A 5CCKL 1HN1A 4PGBA 1G7PA 3HR6A 2LAGB 4OF8A 4XBPB 1J87A 5DMGD 3HNVH 2CDEB 2JCCF 1NMBL 4KXZI 3GI9H 2GTZA 3IDYC 3VWKD 1K3ZA 3HE6A 1Q72L 4H26A 5D8JH 1DUYA 3UTSD 1YEKL 3WKMH 3MODH 5C0RL 5TE6L 1PZUB 2H3NB 3MUJA 4F57H 2C5DC 3NIFE 4LCIH 4KU1A 4KTEH 5IM7B 5LWYH 2J88H 1OTUD 2NY3D 1BD2A 2DAVA 3INUH 3OB8A 3ALPA 2ZUWA 4Y5VC 4QOKB 3P2TA 1JMXA 1GPOH 1L9NA 4U7SA 4FFVC 4PREA 5I66A 4GKNB 5E24E 4HXBL 4D0DB 4M6AA 1LHZA 3O3EA 2X4UB 2G60H 3FN0L 1S78C 3MOQA 4XXDA 3I84A 2PYEE 3IDGB 1MPAH 3I3EA 3WDHA 1HKLH 1ED3A 2FJFA 4H1LA 2I24N 3W0WE 4QKXB 2ESVE 1K2DA 3RWFA 3PGDA 4MJIA 2A6IB 5FUCE 3VFRB 1JHKH 2FO4B 4ODUB 4Q9BA 5CD5D 1A6ZB 5C07B 1HI6A 3AB0C 3SO3C 3MRMB 5SWSA 5LKNA 4NNPL 1SM3H 5IV2A 1PX4A 3PWPD 3JV5A 4R0LC 1CFBA 3VXSA 5JXED 4I9WD 4IMLA 3D0LB 5C0GB 2ZSVB 1KENH 4QRRE 5JPNB 2YZ8A 3I50H 3ZSTA 3FO9B 4F7CB 4RIRB 2G2RA 3D2UA 4ZAKC 3VXRA 5TFSL 3V4UL 2XQBL 3T09A 5C2BH 4FHBD 4U1HA 4PJXA 2ICWA 3HFMH 3HZYB 2HFFA 4ZUUB 3A6BH 1UYWL 2X41A 4K94L 1UJTA 1QACA 3K2UH 5AUMB 3CX2A 3UO1L 3MRBB 1CYGA 5INDA 4QO1A 2F19L 4JY4A 4KDWA 5IFHH 2YRLA 4FQJH 2YPLA 5DJ8B 2VDRH 5I1IH 1UB5A 1CL7L 2GITA 4U0QB 4YFEA 3MLYH 3HUJB 2FBJH 2VRAA 5FOBA 3DMMB 1MI5A 2GSGB 5EZJB 2AI0H 1CLYL 5IESH 3O45B 2ADGB 3LRSB 5EUOF 1A7PL 4OLYH 5CGYD 5IB2B 5JHLL 1QQDB 2EKSB 3QQ4B 4YQXL 2B0SL 4KQ3L 1YPZE 5SX4I 3BHBA 4Z7WE 3TWCH 2DQIH 5IVNA 3MMEA 4HUUB 3TZVB 4N9GB 2EDEA 4XPTL 4G6ML 1YN6B 3C60D 5HGDA 1HHHB 2VXQL 4JO1H 3U6RB 2MPAL 2K9UA 2FWOB 2VQUA 5D7SH 1HIML 4PJCA 5HI3C 4LRNL 3OAUL 4K3EH 1X5FA 5EBLB 4LRIA 1AY1H 5DA4A 5TDPA 2A9ML 5A3IC 1LO0L 3TA3B 4ZMAT 2WWKT 1NUGA 1T66C 5E6IA 1MUJA 1WEJH 1W8NA 1BPVA 2UV3A 2Z93B 4OIIL 1A2YB 3ZTNL 3PHOB 1YMHA 4DKFH 2Y9RT 1UCBH 3B2VL 2XN9E 4GT7A 5CUSH 4PJ5A 1L7TH 3CJJA 4ODXA 3BRFA 5T1LB 1IKNC 3WHXB 5FCUL 1DVFA 3LQZB 3ZKSD 2I60H 1QO3B 1R3LB 2P5EE 3Q0HA 4MNGB 3ZYOA 2EH8H 2DLHA 4L3EA 3H3BC 2YD4A 3GIVA 1CGSH 3RKDC 3S3PA 4JHBA 1CU4H 1T7YA 4OI9A 1BMGA 1DQQA 1BFTA 2Q3AA 5D70H 4UTBL 1V3LA 4YGVA 2D3VA 1RUKH 2NXYD 1AGBB 4JO2H 1P84J 4JM4H 4WV1B 2PNDA 3VWKB 3LEXA 3QDJE 3WFBH 3UTSB 2XWJB 4PJDF 4FXKB 2XOTA 4GW5A 5B38G 4X8XA 1FP5A 1DANU 4ZPVB 4QHUA 4UTAH 5JNYA 3WFCL 5F6HJ 4GXVL 1XF5B 1KOAA 4P5KA 2NY3B 5ECJE 1A4JB 4HKJB 2EXWD 5ESAA 3GB7B 3VW3H 3VXQA 3CH1B 3GMLB 4MJ2A 3MTRA 3PHQA 5D6DC 1ETZB 3IU3B 1P4LA 5GZOC 3L5WB 4RGOH 5F7MC 5I74C 3MRRA 3BMWA 3BDYL 4HV8A 3QPXL 3DUSA 3NGBC 3M8OL 4MDJA 4JQVC 4KZEH 4P3DA 4YHIB 5LQBH 1WZKA 1QD0A 1N5AB 4UILH 4MDIB 1R5WA 4FNLL 4QRQA 4BSWB 2CRMA 3GRWH 4PY7A 4JFEE 3O9WA 3CPLA 5D96B 4R26L 3ELAT 4OLXH 4HULB 5ENWB 3LHPL 2F8XC 4UIMB 5C0IA 2VN4A 3KHOA 1PQZA 3MV7E 3FB6A 2VUOA 5A43C 4NQCE 2CUIA 4TUKL 3H9SE 3U4BL 1HHKA 5K93A 1KJ2L 5DT1L 4CW1A 3IXTA 3O3BB 3EO9H 5F88A 4ELME 1T6WA 3E6FA 2FJHA 3MUHL 4HWZA 3BQUC 3S5LA 1C16B 4OAWA 1FIGH 2ENYA 1KJMB 1QEWB 3L9RB 4LBEB 1ADQH 2XI9A 4OGYL 4YK4C 2IEPA 4ZO9A 2PXYA 3OJ2C 4NKIL 4PGDB 3WD5H 2VLJE 3RWCA 5IROC 2W07A 1EPFA 4HH9B 4NQSA 3TBWB 1U8IA 1MWAA 3P4OB 3RZCC 5C0NC 1N3NB 1RZIA 3O8XB 3W0WA 1IFHH 2RGSA 1G6VK 4PP2A 2ESVA 1AGFA 3FHQA 3NTCL 4X4YA 4LFHG 1NGZB 4KJYA 2IAMD 2P5WE 1JWUA 4QGTA 1DZBA 5C0DA 1ZHNB 1D6EA 2EIZA 3E2HB 5D96C 3S37H 5MEQB 1FL5B 2VLRD 2VDKH 2IPTH 5EC2A 1AHWB 4KV5E 3T04D 1D9KD 4QRRA 5CZKA 3GK8H 5FM4A 4Y5YA 1CDCA 3TT1H 3UJTL 2D2OA 2C7UA 3HR5B 5DHYA 3HI6L 1FO0A 4M6OH 4PJBB 2Z4QA 2C3VA 2CGRH 4FQCL 3FO1B 5I8EA 4J6RL 5C09E 3VGAC 4PB0L 2DKSA 3OKDA 4JPVH 4EN3C 1U42A 4MAUH 3T2NL 2X4RA 1OTSC 1XGPA 4WHTA 4RMWA 2FHCA 4ZOAA 2ARJB 1PZ5A 1RK1B 1EUUA 4P5TC 4HJJL 3O8XC 1QR1B 3OPZL 4U7MA 5J56B 5K9QI 1XGTA 2NTSP 3ILQC 5DJYA 1VSCA 2IBBA 3CLEH 5HDQL 1IGIH 4N0UB 2F53A 5IFJB 1Q8MA 4LSTL 1YPZA 4YHPA 3EGSB 4NZJA 1IQDA 3OX8B 4KJQD 4Z7WA 4ALAL 1DLHA 4P3CH 4DK3A 2X4NA 3RY4A 1BIIB 1RK0A 3VG0H 4JFQB 3LMJL 2VKXA 4WRLA 1MAJA 4GAFB 4X98B 4M7JL 1LO5B 4PR5A 4M48L 2I07A 4HT1H 1FJ1B 4YE4H 5DD3L 1UADC 5EU3B 4N0YH 1DQDL 2WNGA 3C6LC 4NM8H 1YY8B 1CZ8H 2FATH 4L1HA 4AL8L 1A14H 2BMKB 4YHKL 3U30B 3ILPB 3GSUA 4WO4D 4E0RA 1ACYH 1ZGLM 1WLHA 4Q9RH 2GSIA 2BNRD 1K5NA 1OP5K 5I73C 4M62H 2Z8WC 1YMMB 4R4ND 2WW8A 1WVZA 5GSVA 3CVHL 3AM8A 2XN9A 4MX7B 4PFEA 3VXOB 1NAKH 1M6OA 3O4LE 4XNUL 1GAFH 3VD7A 3BZEA 4X99B 4DZBA 3IAQA 2EIEA 2P5EA 1FGVL 5E03A 3ZT7A 1AR2A 4R96B 1OGTB 1G7QA 2H2SD 1R3IH 3G04B 4LCWA 3CFCL 1T0NA 3EW3B 2QHRL 3U7YH 5MEOA 3FRPA 5F6IB 1HQRA 4ODWB 2BHZA 5CJQL 4Y16D 5JHDD 1JNHB 1V7NL 5T3XE 5GRUL 5CBAB 3DUUA 3L95B 3BN9D 2EYRB 2SEBB 3QDJA 1CF8L 2DI8A 5KVDH 3TVMA 3TT3L 4N0CC 5EUKA 1YNLH 2Z92B 3SKOA 1H9VA 3VG9C 2UVEA 4U1KA 4LEOB 2C1PA 5I1GH 3ARDA 3V52H 4U4BA 1MHCA 2KBGA 3QUKB 2C4FT 3TFKC 4NPYA 4RMRA 4OD1H 1QA9B 4S1SL 3GSXA 1W0VA 3AROA 1YN7A 1C8PA 4K23L 1G7IB 5JOFB 4QXGH 4HLJA 4BM7A 4KDVA 1BQHB 2PW1A 3CFKA 1E6OH 3H9YA 1MSPA 5KJRL 4XHJD 3SE8L 1A6VH 5DJZA 3I9GH 1S7SA 3C2AL 1EA9C 1IC7L 5GZNC 1FBIH 4OD2B 1JPSL 5IEKA 1DEEB 1Z9LA 2LQRA 3S88L 3MRFB 5ICZA 1CFQB 3VFPA 2KZ1B 4JFEA 4PY8J 2WIIA 4IRJA 2YD1A 2IAMB 1B88A 1LILA 1FZMB 4P23D 4RGMB 3GZKA 2P8LA 4IHOA 1HK6A 1AD9A 3BKJH 4MQXC 2VLRB 3SDAA 2HFEA 4NNYB 5KSBB 5I2IA 3IS1X 4NQCA 1YJDL 1D9KB 3DV4A 4G7YL 3PNWB 5CJXA 4LU5L 4OI8A 2R29H 4ELMA 1ZKAA 4G8IB 1Z2KA 3G6AB 1B2WL 4ZFGH 3BW9A 4GQ9H 3V5DA 1BBJA 3SBWA 3X13B 1NCCH 5DS8B 4XNXH 4A6YH 1AGCA 5CJ5A 2GTWB 1TENA 3O3UN 2VLJA 4P9ML 1OTTC 5E2WL 4PRPE 4P2OD 1B0WA 1I9JL 4LSVH 4GKSB 5GRZA 5JW5B 1U93A 2H9GB 1FLTX 3VGDA 4AMKL 4P9HL 4K8RC 3P77B 1C12B 3BIAX 4W6XB 5E8PB 2D03L 2J12B 1CGUA 1S7WB 3HPJB 5I1HH 5FDYA 3RBSA 4L3CB 4YO0A 3BZ4B 2WBJA 3D87B 4GRMB 2FYYB 1DBJL 4MNQD 4PV8B 2UYLB 4QY8B 3TBTB 5ALBL 2ADFH 1A1OB 2YPVH 5EOTA 4HS3A 4C55A 4KKCC 1MAMH 3BIKA 2R56L 4RMTA 4U1LA 2BNQD 1D5MB 2RIKA 5HGAB 3UJIL 3AY4A 2GUOA 1H3PL 1J86A 1SYVB 4OZHE 4U1GC 3RNQA 1V8HA 4WI9A 2HN7B 5HHXL 1JPFA 4OLZL 5ISZD 2E7CA 2NQCA 3T65A 5ERWB 2D0GA 1R6VA 1BQLH 4LEXL 2NY1B 4Q9QL 3U0WH 3QZWA 1RI8A 2X1OA 4WWKC 2P48B 1T6VN 4NO5A 3B9VA 3LKOB 4POYA 2XKSA 4F9PA 2H8PA 4QHMA 2UZYB 4WO4B 3VJ6A 1N0XH 1LDSA 5EWIH 2BNRB 4LLUA 5IBTH 3BEVA 3A0OA 4OV5B 1MRCH 4WU7A 4IRZL 4MCYA 1OGAE 3HE7C 4YR6B 4ZTPL 1Z9OA 5C0FA 4PTUB 3H7LA 5LGHH 4L8SC 5FK9B 1JWSA 4U0RB 2XRAH 3H0TB 5B8CA 2BVOA 2VDPL 3LOWA 2BY1A 4DTGL 1AD0B 1JNLL 2H6PB 4PD4J 3SOBL 2AABH 1KBGL 4K2UL 3EOYG 2GT9B 1TETL 3VGBA 4NT6B 1SJXA 2B4CC 3MYZA 3SE4C 2E7LA 3IU4H 4ODSH 1B0RB 3VDAA 4OF0A 3WS3A 1P4IH 1NCDH 4P4KB 5JHDB 4Y16B 3C5JA 5D2LE 4X7EC 4R3SA 1HXYB 3GMRA 4TNVF 4KMQA 3VI3F 2QQNL 4UDTB 3OKNB 5I71B 1A3LH 1WBXA 4OKVB 5DRNA 3BH9A 5EIIB 1P2CB 5JW4M 2NY1C 4JQIL 3F7YB 3U83A 4DQOL 3ZHDA 3NACL 4BQBA 1T4KA 1FPTL 3OXRA 1T2QL 3Q1SL 2DWDB 5EH1A 1HCVA 3GSRA 1T04A 2EDFA 1I3RA 2YEZA 2YN3A 2QBWA 1QUNA 3O4LA 2O5XL 1EJ6A 1OARH 5IB4A 3R8BB 3NBNA 4S0TD 1I7TA 2YWYA 3CDFA 5T1KB 1VKXB 5CSBA 2ATKA 2GFBA 3DGCR 1H3GA 4R7NB 1FAKT 2O5YL 1X5JA 1PG7H 5DC0A 4HEPG 2I26N 3E3QC 1GGBH 1MRFH 3KAAA 3IAGC 2Q3ZA 2YXMA 3L3KB 3Q3GB 4P23B 1Q0YH 2YRZA 3CZFB 4P4KC 2XYCA 4E42B 2HG5B 1A1NB 5DF0A 1NCWL 2P24B 5I71C 1JGLH 3KGRA 3CDGA 4HGWA 3SE9H 3LRGA 1TQBB 1IAIH 3QUZA 4NGHH 3VXNA 4WNQB 4HWNA 3BUTA 1S9VA 2D0HA 3DSFL 3WN5A 3IDJA 1I9IL 4K94H 4YWGL 3DX6A 1SMOA 2CR3A 5GGUA 1ZT4B 4OB5L 3SJVE 2CUMA 5ICYA 4KKNA 2ZG1A 3GMQA 1MRDH 2P46B 4X4XA 2NX5E 4FXGB 3O6ML 1MIMH 3OJMB 1EHAA 3SGKC 3OXSB 2AEWA 2VZ3A 2C4FU 5EN2B 4OLUL 2VKWA 1G9MC 1L0YA 5D7IE 5D93B 4MNQB 2F5BL 5ESVA 1VFBB 1E4XH 4NO0A 1KTKE 4WW2F 3O3DA 2BNQB 3GMOB 3QUYB 4E41D 3X12A 2Z35B 5E7FA 5CEZH 4F7MB 1M4KA 3LS4H 5C08D 2DI7A 5ISZB 4HD9A 4LRNH 4TOYH 3TO2B 3QWQB 2E27L 4PG9A 4RAUB 1KIQB 1SJVA 3CXDH 3RY6A 5KSAD 1WISA 3REVA 4N0RA 4M7ZB 5CJOL 4JCMA 2V7HB 6FABL 3OKEA 5TJWK 1RPQA 2ICEB 2C26A 4PRPA 3FCTB 1DUZA 1A6UL 5DHVH 4M8QA 4Z0XB 4LDLB 2CKBA 4R4FH 3NA9L 4KK6C 3TO4C 4QRUA 5CGTA 5I1AA 2WP3O 3EDKA 4MB4A 4GAYA 5GGRY 4HPOL 3W81A 2QR0A 4MMZC 1MH5A 4JHZA 5FCUH 3QJFA 4TULH 2VITB 1GJIA 1YEIH 3VU2A 4NKMB 1O0VA 4AENA 2XWBB 3T4YA 1ZMYA 4K7PX 1JGUL 1QFUH 5F1IB 1FVCA 2K7PA 4Y88A 5AAWA 1M7IA 1CXHA 2BCKA 3GJFK 4PRHA 4XTRC 1SJEB 4NDMA 4PLJD 2AJVL 1I1YA 2F15A 1KPUA 1UZ6E 4OZHA 3PWNA 1AXTL 2ENSA 4YHNA 4GBXC 1RULL 5KBNC 3QUYC 1TFHA 3T8XB 3KYMA 3QIWA 4PJGB 4PJEB 4ZOEA 4NQXA 1C5BH 2HWZH 3L3IA 1PKQB 4HIIA 2OX5A 3BPLB 3ARFD 3G08B 1T2JA 3L7FA 2VR9A 3MUGB 3RWJB 3FQWB 5IBLC 3WFCH 3WXVL 2XWTB 1AFVH 3O2WH 4HC1L 4J1UB 3KS0H 1XIWC 2B4CH 3N85H 3LH2H 2APTA 3VD4A 1OAKH 1X6LA 3A6OA 3MV8E 4QRSA 1A6WH 5B38A 4NUGL 4H5SA 5FYLE 5HD8D 1JHTA 2FSEB 3BDYH 3MNWA 5F3HA 4X7FC 2V5MA 3IFPA 3QEQA 4AK1A 5D71H 3QDAA 1EAJA 4NHUA 3JSSA 4LHJB 4L4VE 3CFEB 1F11A 4FNLH 3BWAA 4R26H 1FNEB 4LLWB 3JTSA 5FO9A 1WICA 5FYJH 1Q1JL 5IW6A 3IVKA 5D2LA 5IBUG 2E8ZA 3EFDL 3QUXD 4X4ZA 32C2A 1DL7H 3GJEA 1WCQA 4TUKH 5AZ2L 5I1CH 4MA3B 5FGBA 3TV3H 1G7JA 4YC2B 1U8OA 4DFHA 2EEBA 4LARH 4M7LT 4KKLD 2R2EB 4KROC 1F45A 3ULSA 3D18B 4OGYH 5J13B 4D9RE 3EIFA 1CR9L 4YDIL 3JWNC 5BRZE 5D7JC 1WT5C 1JPGB 3W5MA 5HGBB 3MJ6A 4J7RA 5DFVD 5E08H 2D7OA 2L4OA 3MZTA 2XA3A 3TF7C 5FKAA 5F89B 1MY5A 1RHHA 1BGXL 5L8KB 1NQBA 4IIQC 5D1QC 3RUGF 4HUXA 4IDLA 1MEXH 1KXQE 2JIXD 4OCWL 12E8L 2NNAB 4G80A 2AGJH 25C8L 4UOJA 3MLTA 3QRGL 4KH2A 1MLCB 1QSFE 2HKHL 1CFSB 1DQJA 2QQLL 4C4KO 3T0EC 1R5IB 5F21B 3WSQH 3UTZB 5FO8A 1ZANL 3MJ9A 3BXNA 1CDHA 2NY7L 2D31A 4TVPD 4WI2A 1LK3H 4Y4FD 3AMLA 2VAAB 2A0LC 3MRIA 4J2XA 4O51A 4O9HL 2H1PL 3BH8B 4IOIB 4ZYKB 1MHEB 1A3RL 3QFDB 4E41B 1H3XA 3L3DB 4IRSA 4EDXA 3HUJF 1TZHA 3X3GH 1ROWA 4JY5H 4Z77B 1BFOB 1GGCH 3S97C 3FQXB 5BVJB 3PJSA 2ZNXA 3QG6B 1C1EH 1G9MH 1GZPB 2PCPA 5HGGS 3SCMD 1MREH 5AZEH 2FNBA 5KSAB 4C83A 5D7LD 2IC2A 1II4E 2BSED 4FTVD 3SJVA 3QIUD 1C7TA 1RZKC 2DTSA 4AM0A 2OCFD 3VRJA 3FO2A 1IVLA 3X3FL 3MPCA 2NX5A 5FCSH 1SBBA 2Y1VA 2A2QT 1OW0C 2HVJA 4P99A 1H8NA 2EECA 1SBSL 4CMHB 1BOGB 3BZFB 4HCRH 1MVUB 4S0SD 2I9TA 2VAJA 3KPTA 2Y5TB 1NGQL 4O4YL 1KIRB 3OR6A 1ZLVH 5TDOA 5BZWB 4ISVA 5LXGL 3QXAB 1F3JB 1T0MA 2R8SH 5BVPL 1KB9J 5T33H 2JK5A 4LMQE 1OP5H 4DJMA 3MRHB 1ITCA 5DD3H 2XNAB 1JI1A 4WFHD 3MRQB 3PDOA 3O0RH 2R9HC 3WIFB 4FQXA 3SGEI 5BZDA 3DX7B 3ARFB 5EO0A 4GAJH 5L0QC 5IHUH 4UIKL 5DSCB 1J88A 4IOSD 3MCKB 4LLDA 1FCCA 3DPBA 3KYNB 3NZ8B 5I18L 5CD3B 3MREB 3CNKA 4LSUH 1H5BA 1ONQA 2CD0A 5TDNB 4KJPD 3VH8A 2R23A 4MXWL 8FABA 5D2NC 2A77L 5LCVH 4Q6IB 4MB5A 1NFDA 3QXDA 3ZHKA 1M05B 1EBPA 5DZLA 2V9TA 4V2BA 1NJ9A 1S7UB 4ZUTA 5KG9B 2DWEB 1T21B 2ICES 5CP3H 4OZFB 4ZD3H 3CFCH 1FORL 4XBEH 3PP3K 1KELH 4JDTH 5IVOA 3MXVL 3MRNA 5MHSE 2CK2A 2N7BA 1A4KB 4FMKA 1J11A 3BP7A 5FKPB 3L3JB 4HIXH 5HHQA 5DEFB 5FM8A 1A0QH 2FIKA 1OSZA 5IQ9A 3VCLA 1D7FA 1L4IA 3C5SA 3G5YB 2YS4A 1MCNA 2CDGA 1KN2H 1I8MA 2R1YA 3QXVA 1RZ8B 1YDPB 4TUJB 4PB9H 2IBZX 3RWIA 1WCBA 4GLRI 4H8WL 1CGYA 1H3TA 5EZOL 1G9EA 2NR6C 4XPGL 1MLBB 2X7LB 4TRPL 4RMVA 3EAKA 5E2UL 2HT3D 1BAFL 3AXLA 2EXYC 2GK0B 3SKMA 3MV8A 2GCYA 5EO1A 1KYOJ 1LEKA 1HOCA 1T5WB 3NABH 5JR1H 4OTXL 4NC1E 3RTQB 4YXLH 1FNGB 4YNYA 3RDTA 3DRTA 1UVQB 4L4VA 1NL0L 1IGYA 4P59L 1DBAL 5BV7C 5I9QC 2JIXB 3GRWA 3BAEH 4QCIA 1JTPA 2E7MA 2G9HA 4NQDB 3B9KB 3TM6A 5MENE 4Y5VA 5DJAA 4HWBH 2Y6SC 4TTGA 2QQKH 3V4VH 3RGVC 3TBYA 3GJFB 4UT7H 4FQ2L 3GNML 1OSPL 1X7QA 4FFYL 3WXWL 4PJ9C 3CGTA 4Y2DC 1F6AA 4LASL 4P2YA 3CSYA 1A5FL 3QH3A 1QP1A 4NZTH 1MF2L 4WCYH 4DN4H 2AJXH 3RWGB 1T22B 2GJ6D 3H9HB 5I8KL 4JQXA 3LN5A 3PDGA 1EEUA 4HSQA 2FX7L 2VWEC 1OAZH 3V6FA 4XPBL 5HJ3A 4XCCL 1JGDA 2WINB 4LL9A 3GSQA 3RVWD 5D7LB 4MA1C 4FTVB 3QIUB 2PW2B 4DGYL 3DROB 3IFLL 4P9HH 3LKQA 1JNJA 1YUHA 3CUPA 5EZLB 1WSST 2QSCH 1UJ3A 4RISL 3ZDXF 1XGUB 2VUYA 1HSBB 4ZAKA 3NN8A 3QG7H 2AK4D 4X5XA 1CGTA 3MR9A 3LIZH 3MA9H 4K3DL 4Y19E 1KCSH 3MCLL 4YX2H 1DBJH 4PJBF 2PO6C 2PTTA 1QNZH 5F3BA 4FA8A 3B9KC 3FT4B 1PLGL 2R56H 3RWEB 2JB6B 4M5ZL 1BX2A 3STZB 3V6ZB 3CSBA 3KPOA 4F2MB 4RNRA 4DGIL 1C5DA 3U9UB 5BQ7A 1UWXK 5MEPA 1BFVH 4YBQC 3FQUB 2F9BT 4JO3L 1RZKH 3VRIA 4F7TA 1TZGL 2NY2D 1U3HA 4HUVA 4Z7OF 3PXJA 4KK8D 4OFYD 4MAYC 4XNQB 3D85D 5HGHA 2AJ3B 2VYRE 5T1DH 2APFA 4DAGL 3KYAA 2BXYA 1BLNB 3JVGA 1BBDH 4QT5B 1V5JA 3KJ4C 1FG2B 4HDIA 3JV0A 5FGCE 5EDXA 1GGIL 4BELD 2MCPL 5F96L 3QULB 1I7ZA 3TNMA 2P43B 1S7QA 5EZIH 3B6SB 2GHWB 4ZTPH 1EX0A 4Y4KC 4PV9B 1NSNL 2X05A 1NLBL 5DDHB 5EUOE 4D8PB 3CC5B 3EYSL 4TUOA 1AGEA 3KPQA 1DQLL 4UU9B 5DJ6B 4AH2A 1R24A 2VDPH 3FO0L 4OM1L 3LPFA 4FG6C 1EDQA 1KB5H 5DK0B 4L4TB 5HI5C 3TIEB 1KBGH 2EYTB 3U2SA 4WFGE 3F58H 1UZ8B 2DQGL 4NC2B 2AEIT 1WZLA 3QIBA 3S8WA 4JN1H 1FYTD 1GOFA 5EBWB 3ARUA 5JUEH 2KPNA 4OLEA 2BDNL 2X9WA 5TF0A 1JF1A 1IKNA 1ZVYA 2F54A 5BW7C 3CU7A 1ZA3A 1I9RL 1RFDL 1T20B 4KDTA 3BPNB 4HKXA 3IGAB 4LKXA 4MS8C 3KXFE 5DQDH 3Q1SH 5DJDA 4KTYA 3VDBA 3RX7A 3RPKA 2HFGL 1RU9L 4NN6B 2JJVA 4MSWB 2VLLA 4YBLC 1YEDB 1ZT7B 4AQ1B 4JANA 4OF7A 4GJTB 4ZUSB 5EORL 4KI1A 3O2VL 3TBVB 4JZOB 4R8WH 4PRID 4XNZC 3QDHA 3X14A 1O7SA 4B41A 3BP6B 3BP5A 2G5BB 5IHZB 35C8L 3JZ7A 4PJIB 1CD8A 3BO8B 3HC0B 1WZ1L 2COQA 3DGGB 3UBXI 4W4OC 5IGXL 2DQCH 1RJZA 4PJHB 2HLFD 4ZXBA 3U9PL 2AV1B 4WY7L 2F58L 4G8EB 1HNGA 1UH2A 3WLBA 1AI1L 6CGTA 4KK9C 3WFDH 2VE6A 3LSOA 2O61B 2N1KA 3HE6D 5I76B 4K7PL 1D3CA 4JO4H 4P2RA 4JZJC 4PJ7B 1ZE3C 4P49A 2ZPKL 2R2BB 1AR1C 1CT8B 2RQ8A 4JDVB 4JQVA 1JRHI 4OF5A 3RNKB 5GQBA 1KPVB 3S34L 1ZHLA 1GZQB 3R1GL 4XPHL 3HMWH 5CINH 4I77H 5LG1A 1UH3A 5BV7H 1S9WA 4N0FB 4NWUL 4DUXA 1MFCH 4QRPE 2GJ6B 4NRXB 3ALXA 5E56A 4Z76A 1GVIA 1VGEH 4YWGH 1CXFA 4KMTL 2XA8L 5KSBF 4Z7UF 5SWQB 4TSCL 4N68A 4YHMH 3VXUE 3ZLQC 2Z0BA 3HI1B 3PV6B 5BCAA 3TYFB 4YDVA 3SDXB 2XG4A 2CO7B 4CAGA 5JOPE 3PABA 5C0AB 4TPRH 3BGMB 2AK4B 1KJ3L 3LZFL 5JZ7D 5T3ZH 4O2CA 3OR7B 3STBA 5MENA 4M1CD 5CKAA 3KPNB 2VC2L 2BVUA 3HAEH 1KT2A 5DVNA 3RFZC 3UJJL 5SWSD 2ATPB 3STLA 3MBEC 4KVCL 2AV7A 3VXSD 4B53A 5H2BA 4O02L 1I1RA 5H94B 5CEZE 3C8KA 3NZHH 3RZCA 4ONOA 3MNZA 2NY2B 3D2UD 3K4DA 1S7XA 1F3DH 2CK0H 2AXHA 3VXRD 3RAJH 4NBXB 5KN5A 4APQA 5CEXB 1DQML 2K1MA 3VD3A 5IJKC 4EIGB 2FJGB 3D85B 4HHAB 5C8JA 3EDJA 3WL9A 3WFHA 3ESVF 1YQVH 3ROLB 1MY7A 3P3YA 3QQ3B 5D7KE 3NA9H 3MOAH 3F12A 3NFNA 4L8BA 1EGJA 3IDMB 4L3AA 2JKXA 3P0VH 3KPRD 1WGOA 4Y19A 5HDLA 1MI5D 4NCC1 4F58L 1UA6H 4CVWA 1KGCE 3LN4B 5JQ6H 4CVXA 1IC4H 4XGZB 3BKCL 1K3IA 4EN3A 2WUBL 5JQHC 4I0CC 5ITFA 5IR1B 1CICD 2NXZC 5DQ9B 1N59B 3O6FD 4BFIA 1FZOB 3GUTA 1L7IL 4DCQB 5FXCH 2FEDC 3VFWA 4G9FD 1SEQL 2YK1L 1FYTB 1KFAL 3JWOC 3E6HA 2X9YA 1PG7W 4HIJA 1R3JA 2PKDA 3VXTA 1JZ2A 5KS9B 4NJAL 1NCBL 1CK0L 4XAKE 2W65A 1N8ZB 3WXVH 1SJHA 1X5ZA 5J1AB 5JIPA 4JFDA 2P49B 4HWEH 4K3HA 5IB5A 4TTDC 1S9XA 4R2GC 4JRXD 5FA3A 4KVNH 1N5YH 4LHQB 3U1SH 5B3NA 4OCYH 3P4NB 4XWOD 1RMFH 4AYFA 3BYYA 4NUGH 5EUOA 4Q6YA 5E4IA 5GGVH 3QRFM 1WC7B 1HILA 2DLIA 3IT8D 3O41B 1VDGA 5INCA 3C6LA 4NSKA 1URLA 1NDMB 4L3ED 3I75B 1WK0A 4H0IA 1RUML 3UTPE 4PRIB 1QZ1A 4YFLI 1HWGB 1MOEA 3OF6A 4LGPB 3GO1L 4PRDA 1BHGA 3FB8A 3P73A 4PGBB 5GJTL 4TVSa 1OWWA 1UM4H 4M02A 1JUFA 4P2CG 1JK8A 3CFDB 2D7TL 4XCEA 3T3PE 3P40A 3OMZA 3HE6B 4WFFD 5AZ2H 1FH5L 3RVUC 3TCXA 2Z91A 4IOFC 3MV9E 4PGJA 5GS0D 2YOCA 3WJLA 4NKQB 4Z7NE 2A9NL 5I6XB 3ECBA 1T1YA 2XACC 3E3QE 4ENEC 4P46D 3QCVH 1I3GL 3LVEA 5GRXG 1EVTC 3C87A 4OUUA 2EDHA 5L88L 5B22A 5I66B 4OZGF 3O3EB 4QXUL 5I1EH 5C0CA 3P9LA 1GOHA 2ZP0T 3OJDA 5KAQG 3FT3B 5ALCH 4RFNC 2BRRH 3FZUD 3MLVL 1ED3B 5F1NA 4OCWH 1NUNB 4HBCL 1K2DB 1IZJA 5ADPL 4MJIB 2OL3B 2QQLH 2ORBH 1RHFA 3KNBA 4JE4B 5IB3A 5F9JB 3ARGC 2R0LL 1ZANH 3EJYD 5SWSB 4PJDA 5IV2B 3DRQB 3DJ9A 2XY1A 3VXSB 5K9JH 4CU7A 1HCFX 3CZJA 1A7QL 3GHEL 4PJAE 4OZIE 5I16A 4PBXA 3GIZL 4JR9L 1P6FA 3D2UB 1RIHL 3VXRB 4G6AC 1OP3K 1KUMA 4ZUVA 2EE2A 4PJXB 4CU8A 1UB6A 2HFFB 2HH0L 4OQTL 4FRWA 3PGFH 3SPVA 2VDNL 4GG6B 3HAEG 3WHE0 5INDB 2PYED 4Z7QE 3UTTA 2WP3T 5MERA 5F9OH 4G9DB 1G9NL 1U8QA 1SBSH 4OCXH 4J3WA 1QFOA 2ESVD 2GITB 2HRPH 5DR5H 2D7QA 4NYLB 1NEUA 2H2PD 3R0NA 1UENA 5J9PA 1MI5B 1IEBA 4I3SH 3UC0H 3EJZD 2IH1B 4ETQA 3N50A 5TQ0L 2GY5A 4YZFF 3BHBB 4X6DE 4YIQA 3M17B 4Q0XL 5LXGH 4MJ5A 3MMEB 3BP4B 4GAGL 4U6XA 2EDYA 3O6FB 3PGCA 4LLQA 5B3JF 1DSFH 2EDQA 2WAHA 3DVGA 3KWWB 4UQ2A 3REWA 1P7QD 4GOSA 2Y06H 4JKPL 4K7FA 1U8PA 3ZKQD 4G9FB 3LD8C 3U4EA 2B7DT 4GMSL 3WFEL 1RZ7L 5D1XD 4EUPH 5TDPB 3W39A 1N6UA 2XICA 4WWID 4UIKH 5C0EA 1J0ZA 5E6IB 3O81A 4OF3A 4N8VG 4NRZA 1KN4L 4LAJH 2VQTA 1YMHB 4JRXB 3W2DH 2A77H 4PJGF 4UT9H 4PJEF 1BIHA 2W1NA 1S7RA 3RIFK 3D3VE 5IVXE 3D39D 4XP4H 3JWOH 4JZNB 1JFQL 4WWKA 4L3EB 2XZAH 1V3KA 4N90E 1U8NB 3GIVB 1F5WA 3CAFA 5HHNB 3WEXA 1DQQB 1U8HA 2D7NA 5EA0L 4WVRA 2NYYD 2F8VA 4YGVB 1F90L 4G8FA 3HE7A 4R97B 2ZOKB 4LLVB 4WUKL 4DWHA 4JB9H 4R4BA 5L2KA 1UM6L 3JWDL 4QXWA 3D25A 5ETUA 1YECH 1G7HA 2AJSL 1I4FA 4NWTH 4NZUH 4GW5B 3G5VB 4LRIC 1ZLSH 3MO1A 4ZTOL 1T1WA 4TN9A 5JNYB 3BSZL 5EZOH 5E6IC 5GRJH 5DJCA 4P5KB 5SX4H 2NLJB 1TCRA 2AVGA 2IBGA 3GMNA 3LKPB 3EHBC 5ESAB 4C56E 4M00A 3NCYP 1D6VL 3PHQB 2PR4L 1D5BA 4LP5A 1P4LB 3FTGA 4AIZA 4OTXH 4L9DA 3D0VA 5DMIH 3MRRB 2P5ED 1VFAA 3K8LA 5BXFA 5IKCA 4Q7DA 3TN0D 3L1OH 1NL0H 4G8GE 4P59H 1DVFC 1JGEB 3UPAA 2CUHA 4P3DB 3DO7B 1HH9B 4QF1A 3ARPA 1PW3A 1R3KA 2VDOH 4QRQB 2FZ3A 4XMLH 4C4KT 2IPKB 3RQ3A 1XF4B 2VXSL 1SMAA 3U0PB 1RURL 3DARA 3O9WB 3CPLB 4ZODA 4KJWD 3EO1A 1XCTA 3GNMH 4X9BA 1QYGH 1SY6L 5GISH 2V17H 2HJKA 4FFYH 2V2XA 3C2SA 2Z31D 3QDJD 1I7UA 4KK5C 4XAWL 1KCUH 1Q9LA 3FB6B 3FB5B 1B4JL 4CW1B 1MF2H 1TVBB 4PRBB 1MHPL 4M61A 4YHZL 1F8TH 3SDYH 2OMBA 3HZVB 4DVRL 4OLVL 1IAKA 2YD3A 1RJLA 2FJHB 4HWZB 1YEHL 4BQ9A 3S5LB 4D9LH 4YXHL 1G6RB 3IJYB 3T0EE 4WDIA 2EC9T 1DLFH 4JAMA 1EERB 5FB8A 1FNSL 4AEHL 1U6AL 4U1JA 3EDFA 4OSUL 1MCPH 5IWLC 3IFLH 2ZJSH 2OP4L 2KDGA 3VXME 2PYEB 4NQSB 4HMEA 1B9ZA 1UWXH 4NRYA 1RZIB 2RFXB 3W0WB 4FABH 3P4MB 3T0WA 2ESVB 1A6AA 1AGFB 1J12A 4YEFA 3E8UL 1YY9C 4X4YB 5IT2L 4JFED 2ZUTA 1F4XL 4JPWL 4KJYB 4A2MA 5C9JA 1FDLH 1WFUA 3O9WC 2BVPA 1FGNL 3HS0A 3ARTA 3SDAD 5D1ZA 4NHCH 5EC2B 4GUPB 1AE6L 1F58H 3MV7D 4Y5XB 1BVKB 4PJAA 5TPWL 3U4AA 3H9SD 4OZIA 4GMTH 4U6VL 4QRRB 3S3SA 1P7QB 5DRZB 1NCAH 4BUGA 5H37G 1W8OA 4JFFE 4ZQKA 1KLFA 4NFCA 1YYML 2DL2A 4POZD 1UXWA 5FYKH 4NO3A 5DHYB 1WV7T 1BJ8A 3UZEA 1E27A 1FFPA 2EDKA 5D1XB 1FO0B 4H1LH 1D5XA 2Z4QB 2IFFH 2C3VB 4TVPL 4W70A 1S5IL 3PHSA 2VLJD 4WI6A 1OAQL 3LKSB 2PXYC 3QAZC 1GHFH 1RV6X 4XNMA 1XGPB 5TGBA 3X11A 1EHXA 1FLRL