4OB5H

Ontogeny of recognition specificity and functionality for the broadly neutralizing anti-hiv antibody 4e10
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
125
structure length
122
Chain Sequence
VQLVQSGAEVKKPGSSVKVSCKASTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCAREGTTGGWLGKPIGAFQHWGQGTLVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 4E10 antibody germline precursor 7 heavy chain Fv
publication title Ontogeny of Recognition Specificity and Functionality for the Broadly Neutralizing Anti-HIV Antibody 4E10.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 122
sequence length 125
ec nomenclature
pdb deposition date 2014-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ob5H00
4OM0L 5CJQH 2MWCA 4YFDB 1JI1A 4XMLH 1CTNA 3WIIH 1MCLA 2R0ZH 3LS5H 1WZMA 1TETL 3KPRD 3GEWB 5FKAA 3MRLA 1BQUA 1OP5K 2LAGB 2DI9A 2D3VA 1KLUB 4MD0B 1TLKA 1GGCL 5D96B 3ZKMD 3T65A 4D8PA 3EOBB 1AGCA 4HUWA 1RJLB 3IDJA 4Q9BA 2Q87A 4PJ5A 1JGDB 4XMKH 4HG4K 3CK0H 4NQEB 1HSBA 5IWLC 2HLAA 3DJ9A 3EYUH 5BRZA 1FFPA 1RZKL 2OZ4H 1JGVL 5MEQA 3BP6B 3MRHB 5F1NA 4Q9CA 1KCSL 4FQHB 4ZUUA 3JVGA 1IL1B 1C5BH 2XTJD 2VDNL 4S1QL 5DUPH 4P57B 2GW5A 2QJDA 4GAGL 2R1YA 4WFGD 3F7QA 5ILTH 1EEZB 1OTTC 3QT2A 1AKJD 5T3ZD 2Z91B 3JV4A 5JPNB 3DX7A 1K8DA 1SYSB 1I3UA 1FNFA 3U4AA 2VXQL 2MKLC 3MLXL 3QUXB 3DBXB 2DBJA 3I3BA 4Z9KB 4XXDA 1FNEA 4WUKH 1UH4A 2VXUH 3GSNB 4K3GA 4B5EA 4UAOC 2CUMA 3NMEA 3BPOC 5I19L 1UWXH 3L6FB 4LQ1A 1CU4H 2V7HB 1INEL 2V17H 4JFZL 2C1OA 4L4VB 1UYWL 1QLRB 4F8QA 5IQ9A 4FFWC 3S8WA 4FZ8H 4AENA 2FX9H 1OGAD 4ZFOL 4JRXE 2ZCKH 4EI6A 4ODUA 2Q7YB 5DDHB 1E4XL 4TRPL 2W0FB 1CGUA 3S98A 2YEZA 4X98B 4EOWL 5D71L 4PLJD 1G7JB 5JPMB 1QSZA 2VISB 4NWUL 2QKIB 5INDA 2CDEB 3TNMB 2YWYA 1A02N 3T0EE 3VFRB 3CFCL 5C71A 4MA1B 4XZUA 4Z7NF 4UOW0 4HDIA 4OQ1A 5K9JH 5FGBA 3T09A 1E4KC 3LEXA 2HJFA 2DQUL 1HILB 5SWSA 4P46C 1NBZB 3ARGA 1GGUA 5TH2A 2L7JA 1JGUH 1LEGA 2NY4D 2W9EL 2E9JA 3LS4L 5IBUG 1UZ8B 2X4NB 2IADA 1NEUA 2VO5A 5D72L 2LAAA 2WMPA 2VZ1A 3QIBA 3TESA 3HZKB 1I1CA 4ZUSB 3G9AB 4PGCB 3EOAB 3F7PC 1NDGA 4DKDC 1DBMH 2R1XB 4JY4A 5IMLB 5DS8B 2NX5B 4PJ7B 3OKOB 1IEBA 3TJHD 4E41D 3F7RA 1KJ2B 3EJYD 5DR5H 3MGTA 3MR9A 3OR7A 4QRSB 1G6RA 4XVTH 2OJZL 4L9LA 4N0YL 5E7BA 4PJGA 2AV7B 3EO0A 4KUZL 3FAXA 1SJXA 3SO3C 3P9WB 4P2YA 2DQGL 4XNQB 4GKOA 4DKFH 5C09B 1FAIL 3VD9A 3T0VA 4LCCC 3MNVB 3RY6A 3T4YA 5IESH 4LCIH 1PBYA 3MRRB 3VD3A 2DWDB 5K9OB 2WBJC 1LO3L 1URLA 4R4ND 3UTTB 1P4LA 5DD6A 4P2OD 2XFXB 4WIQA 1NCNA 3HC0A 3NCEB 1DVFC 1K5NB 4OLWH 3AAZA 4KWUA 3U0TB 3IJSA 2VDLL 1Z0NA 1F2XK 4X7SH 4YAQA 2BDNL 1ZOXA 2NXYC 3V5DB 1P4BH 4Y19A 2K1MA 5IHLB 1H8SA 1LMKA 4FHBD 2XRAH 3PP4L 3C08H 1U36A 4H1LB 4KK6D 3BGMA 4MHHI 5F70A 1JZ5A 2O61A 3AS1A 4XBGA 5CGTA 1CR9H 5EN2A 3QUZC 3BKCH 3O6FB 4S2SB 1GL4B 2JF1A 1I9JL 2J2ZA 1A6WL 1N4XL 1TJHH 7FABL 1KIRB 2NXZB 3ELAT 1QLFB 2W9DH 5CD5C 1J1PL 3U7AA 3T77A 3RWEA 5AYUL 1R5WB 5BW7A 4M6OH 2IBBA 3OKMA 5JHDB 3HE7B 1IAOB 2VNCA 4OZFA 1E4XI 1OPGH 5KBNC 1QO3B 1NCBL 1G7QB 1SY6A 2P8MA 3V52H 1JP5A 1RIHL 3BESR 4JO3H 4LSPH 4L8DB 5FYKD 5IVXA 1T7VA 3N1FC 1W0WB 4HUNB 5IF0B 3ARED 1KGCD 3QB7C 4DN3H 1DLFH 4OFYA 5FHAH 2IAND 1XR9A 4HKXB 3FQXA 4UZGA 4PS4H 3UDWC 5IV2B 2Z0BA 1MIML 2OL3H 5HBBA 3QH3B 1A4KB 5TGBB 4HS8L 5D4QA 3RVXC 4DGVH 1Z3GL 2BJMH 3NFNA 1KIPA 2KKQA 3UPRB 5GGVY 4GT7A 3TIEA 2FBJH 2JIXD 3C8KB 4NBXB 3RWDB 1OB1A 1J1XH 4HIXL 3OL2A 4FQIL 1LE5B 2NTSP 4YHOL 3QNYB 4FOMA 3MA7A 3FQRA 3DUSA 3SBWC 3HNVL 4N5UA 1NCAL 1I1AB 3EYSH 1FZJB 1I3GL 1A64A 1YMHB 2EH8L 2CKBB 2WSKA 32C2A 4Q9QH 1S7XB 1EHLL 2ADGA 3C5JB 2LQRA 2X1OA 3CVHB 3MODL 3ULSA 2BHYA 2AI0L 1Q1JL 4K7FA 3HB3D 1YPZA 2BNUB 3V0AC 1P9MA 1FQ9C 1NLDL 4M93B 4NQCB 1BIHA 1W8NA 3B9VA 4YFLI 3UTSD 1VA9A 4JPIB 2AK4B 1A9EB 4KPHH 1JNNL 4X7FC 3WO4B 3HR5A 4UIKH 5EWIH 1JIBA 5CBEA 3VCLA 1TQBC 4PJIA 4RMTA 2YRLA 4YHPA 4P4KD 4GLRH 5J06A 1IKNA 2P5EA 3NZ8A 1FNGA 1R3HB 1VGEH 4FQXC 5F6HJ 2AJSH 4IHOA 4YWGH 5DJAA 4X6CF 1TQCB 3HMXA 2X4SA 1FIEA 2IQAA 1UB6B 3K4AA 4NO2A 5IJKA 5A2KH 3F5WA 3C6SB 3QCTL 2N7BA 5IHUH 4G8GD 3QI9B 3FO0H 1T4KA 5BS0A 2VLME 3CNKA 4S1DD 5D1XB 5ADPH 1CLYL 4KKLC 3GSWA 1FLRL 3NOIA 5ESQB 3PDGA 4CW1A 3C5ZC 3HNTH 3WLWD 3B3IB 5AD0B 4NDMB 1IAIL 2E27L 5ITBL 3VXUA 2NNAA 1F4AA 4XVSH 4PYGA 1WEJH 5JQ6L 2FGZA 5E5MA 4PP1D 1FYHB 4Q2ZA 5JIKA 1KT2B 1ZKAA 4WUUA 1A7BA 3RUGA 1OF2B 2H32H 4HHAB 4RA0C 1J1OH 3FB7B 4OGXL 5HD8C 1Z6JT 5D2LA 5JXED 3VFVA 3LH2L 4HCRL 2CDGB 4TUOA 5EZIH 4UT7L 4Z78B 1HHHA 4P2QD 1ZTXH 4IRSA 4PV8B 1TVDA 3D39E 4J2XA 2ZUSA 3V95A 4NQDE 3PL6A 2FRGP 4UNUA 4MJ4A 3CSBA 5ETUA 1U3HD 5EOQH 3VRLE 1H3WM 3MRPB 5HHOE 4J23A 1AGFA 1F4XL 1G7IB 1K4CB 4IRJC 4TOYH 2I9TB 1TPXB 3CFKB 5CJ8A 1RMFL 1I9RH 1NFDA 1WVZA 4I0PA 1X5ZA 4GMTH 4P5TC 1YY8B 5KOVC 4HMEA 1KCUH 3O3EA 4JO2L 3WIFB 4G6FD 4L4JA 4AK1A 4AY0A 1HI6A 4ZXBA 1SEBB 3IRPX 4HGMA 4ZUTB 2FIRT 4N0RA 3MLUL 3TV3H 4H0GA 1KC5L 1CK0H 4JRXB 5FOBA 1IT9H 5IIEB 2VIRA 4N0CD 4MZ2A 5DD1L 4YE4H 1C5DB 3MRKA 2APVA 1MFAH 1FNHA 4OKDA 2O5ZL 2YA2A 4HUKB 4JFHE 4LOUC 4FG6C 1D5BB 1T89A 3HR6A 3T0EB 3QFJD 5LGJB 2A1WL 1KLGB 5CWSB 1PKOA 2VN4A 3RDTA 1A1NB 5FO8B 1DBAH 3PQYA 1MRFL 4ODXA 4XHJC 3O9WB 1NAKH 2R4SL 1FFOA 4OGYL 5DQJA 5C9JA 3HUJF 1GZQA 1NGZA 3WHXA 2IFFH 4HW6A 5FO7A 3VH8A 2C3WA 5CHNA 4JZJA 1MCIA 5GGRA 1IGCH 1KXVC 4P23A 2K7QA 2A77H 3TVMA 4F3FB 1G6VK 5GGQL 4CUCA 1RZ8B 4LAQH 1XEDA 2IQ9H 2KZWA 4DZ8A 3IAGC 1IBGH 5BV7L 5DSCB 4M03A 4IOFC 4ZOEA 5GISL 3RL1B 5F7NC 4X6FA 2ZCHL 5I8KL 4NKMB 3AU1B 4JDTL 1IMHC 1QUNA 4I77L 5J1AB 1ACYH 4KVCH 3BUYB 2MJWA 3GSVB 4K55A 5K9KA 1QR1A 4FNLL 4KQ3H 3VFTB 5CP3A 1BECA 4M61B 2NY6B 4R97B 2FB4H 3LSOB 4NT6B 4S1RL 3V4UL 1QVOA 3SE9H 1K4DB 3EJZD 3DRTA 2PO6D 1A2YA 3OBAA 4BZYA 5I75C 1DSFL 5ISZD 1PG7W 1IAII 1KG0A 1C16B 5BO1H 1CGWA 3EHBC 5DQ9B 3R8QA 3SGKC 4U1HA 1N64H 3FN0H 3CFEA 4TTGA 2ZPKL 2OSLB 3MV7A 1QTYT 4E5XB 5C3LD 1N5AA 4ODSL 1XCQB 3QIWB 4QWWC 3SKMA 1ZT1A 5DJYB 1GC1L 3RVWD 4Z7OF 2R9HC 4NFBA 3NA9H 1UM4L 1WICA 3GRWA 3LN5B 3U7WL 3QHFH 4R3SA 4U7SA 5F21B 3TEUA 4ORGB 3IGAB 1U91B 3QQ3A 3NFPA 2VR4A 2Y07L 2QSVA 1GPOL 4X6DA 1LO2H 3DSFL 4HPOL 2F74B 4H5SB 4KQ4H 1HQRB 3HC3H 3WKNA 1J5OL 4J6RL 3D85A 4XPGH 3RY4A 4D0CB 4ZQKA 5E03A 2RFXA 5FUZL 1F11A 1ZVHA 1G7PA 4PY7B 3LHPL 5D7IA 3O2WH 4QHKJ 5L88H 1C8PA 1F6AB 3KPSD 4Y8DC 5CCKL 1LD9B 5EUOA 5EDXA 3AS0A 1DE4B 3EDEA 1KYOK 4XPHL 3SY0B 5CAYB 2GUOB 4B7LA 2V9QA 3UTOA 5I9QC 4YZFE 1VDGA 3KGRA 4CMHB 1UM6H 3GSUA 3OV6A 3FQUA 4G9DB 4WU5A 1X5XA 3F7VA 4HC1L 1R3KB 1JMZA 4M3JA 1JHKL 5GS1A 4IRZL 3U2SA 3H9HA 4NM8L 3DX8B 4X99B 4YXHL 1MCFA 4LVNC 4LSDA 3BPNB 1BFTA 3UCRA 1S9XA 4JY6B 3RVTD 2Z9TA 5MP6L 1U95A 4U1SB 1PKQA 3EDKA 3FJTA 3PWPE 4OF5A 4YJZL 1HHIA 4HFUH 5HYJD 3IKKA 4I2XA 4OZGF 1CT8A 4UV4H 3SDCD 1AQDB 1QSFA 2XKUA 3C9NB 4UIMA 1RURL 2K7PA 1FFRA 1CLCA 3P4NA 3GMPB 4WNQB 2OM5A 3T3ME 4WW1B 4NNXA 4AG4H 2HP4A 1NAMA 4PRPE 3BWAA 4A2LA 4L29B 2IGFH 2A74B 4XPAH 2R29L 1OAXL 4JFDE 5FECA 1G1YA 4MX7B 2GJ6B 1DQQB 4IBLT 4P59L 4DGIH 3GK8L 1HZHL 3FN3A 3ARDB 3VFNA 3I02A 2PTTB 5IMOB 3JBG7 1I75A 1LDSA 3ARTA 1FNLA 3C60B 3VGAC 2APFA 2XT1B 4PB9H 4WI7A 2XZCH 3Q6GL 4NO5A 3W5NA 1FGVL 2I07A 3HMWH 1RJZB 4KK8C 1JHLH 3VXOB 1MHEA 3CDGB 4IMKA 4ZSOE 2DQJL 2FEDC 4CADB 12E8L 1WSST 5DRWB 4OCWL 4EIGB 3QQ9D 3MLWL 1V3JA 4OIAA 5TQ0H 2JK5A 4M1CC 5CGYD 5E6ID 5C07E 1AGBB 3BJLA 4LMQI 3EOTL 2MCPH 4Z76A 5E2VH 3ME0A 1EMTH 1L0QA 4FQ2L 1OTUD 5FHBH 3H9ZA 3W2DH 2BFVH 5EU6B 3MO1A 1EJOH 1P1ZB 5TQ2H 2BSTB 4OM1L 3S4SG 1CLOH 3N1PC 1NCDH 4HWEL 4XPFH 5ABDE 4MNQA 4R4FH 1I3RA 3BDBA 1NC4B 1OSPL 3DLQR 2C4XA 3O0RH 1PG7L 4J3UA 3MLSL 5JW3H 2R0KL 4GSDL 1MCQA 1NUNB 3RU8L 35C8L 3G08B 3QDJE 1AE6H 4PLJC 4U6HB 4U3HA 2NTFA 4TNVK 5GGTH 2YD5A 3PHOB 1F90H 4PTUB 4CVWA 1P7QB 1EGJL 5GZNC 4HH9B 1A14L 5HGBA 2XN9A 4YR6B 4MCYA 4Y4HA 5CIPA 4NQDB 2UUDK 2VDML 4V1DA 4FXGA 4JKPH 2CD0A 4JKWA 3ARVA 4KK5C 4WVRA 3MLTA 1MHPH 2BOBA 2FECL 2GAZB 2RBLA 1BEYL 2GQHA 2NY3D 2AKRA 3L3IA 2BHUA 1PY4A 1Q94A 3KPOB 4C4KO 2FJFB 3T8XB 5IMKA 1H8NA 4I3RL 3UBXA 2J8OA 5C70A 3VD5A 5HHNA 2B5IC 1K3IA 3SE3A 2WUBL 4HKZB 2VQ1B 4PRIE 1IE5A 1ZANL 5KSUB 4DTGL 4PUBL 3QPXH 2G5BB 2HT2D 3SGJC 1VFBB 3FQWA 1A21A 3QEQE 1VACA 4BUHA 3FT3B 1NUGA 3T08A 4XC3H 4XCNB 3EJYC 5FK9B 1BMGA 1A0QL 4X4YA 3VA2C 4E42B 4ZFZA 2PYEA 4MB5A 4FN0A 3VGFA 1BVKB 5IFJB 3FT2B 4GS7B 4JFEA 1HN1A 2BNRE 2F5AH 2JCCE 4LBEA 2XY1A 4X4MA 2NY0B 5FYLE 3H42L 3OKNB 4MQ7A 1RZIA 4Z77A 4JPVL 3QUMH 1GZPB 2ICWA 3IDIB 3MCG1 2ITDB 3B2VL 2FH8A 3EYOB 2XNAB 4LLUB 1FORL 1JL8A 2IH3B 4JFXB 3BW9A 4BA8A 1CFVH 1J7VR 2HA1A 5DZOA 1JRHH 2BCKB 4AL8H 1JYNA 1DVFB 1KV3A 3PHQB 3HE6D 2Y7QA 4R4NC 1TCRA 5HVFB 3X12B 3A6BH 3QIUB 2C1PB 4MAYC 4X5LA 3ZYJA 1QSED 2ZZUT 2JELH 1F4YH 4WFHE 2NXYB 3VWJB 4BKLA 1ZSDB 5GS0D 2O5YL 2YPVH 4GW5B 4NHCH 4Z7WF 4ZAKC 5C08B 3CAFA 4UTAL 4G3YL 2QR0B 2O93L 1BD2E 1R3JA 5EBWB 1S9WB 4PRNA 4KHXL 3QUZB 1BIIB 3KNBB 3G6JA 5C0ND 1XF2B 4KK6C 3M45A 3OKKB 4AEHL 1MWAH 1G7HB 1BQSA 2F9BT 4PJDF 4EXPX 1DN0A 3P30H 4GKSB 5E8OB 1X44A 4BK5A 4LKXB 5HGAB 2N4IA 1WBYA 4TULH 3BISA 3O6ML 3KVQA 3MLYL 1JF5A 1VKXB 1JK8B 5FO9B 4QT5B 3F7YB 2VLRB 1DP0A 4D3CL 1J8HB 1I7ZB 3QJHA 3VA6A 5FGCB 3GBNL 1LK2B 3HI5H 1MVUB 1U8PA 3AREC 3RWGA 5FUCC 4JO1H 3WS6C 5GRZA 3NCYP 2VERN 1D6VH 2RCSL 1FL5B 4OB5H 1EHNA 1C7TA 2F15A 1FBIH 2PR4L 4Y5YC 3CIQA 3MRCB 1CTOA 2W0PA 4QRPE 2FECI 2P24A 5SV3A 4XPBL 3P4LA 4GFTB 5J9PA 4YC2C 2X1QA 1KTLA 1XGPB 2YMXH 2PNDA 4QHLA 4G7VH 1P7KA 3KPRE 4UUJB 1IGMH 3DIFB 5T5NG 4KZDH 4PGDA 2X42A 2J8UA 3QULB 3QA3A 3O4LD 1AC6A 1VGKB 4KKCC 2UY7A 4KVNL 3FO9A 2Q3AA 1K6QL 5FYKH 5E8DH 3G5YB 2Z31A 4OAWB 1JYXA 5EPMB 4XP4H 1VERA 3TN0D 1CE1L 1JNHA 3KYNA 1BZQK 3D18A 3O8XD 1UACH 5AWNL 2Y6SC 5E00A 4EUPA 1XGTB 1FGNH 2EZ0D 4YHMH 3S96A 5JHLH 1TQBB 1ZV5A 1BX2A 3PXHA 3W9EB 1NCWL 2COQA 1RVFH 2BVOB 4NC1C 4P4RA 4JM2A 1EFXB 1T22A 2HJKA 3U4BL 4WFGE 4ZUVB 3PWPB 4Z7NE 4FTVA 8FABA 2EIDA 5CEZH 3HFMH 3OJDB 4OQTL 4P4KC 5T3ZE 1QRKA 2WIIA 4JZNB 5JORA 2A6KB 5CMAA 2UZYB 1XIWA 2OYPA 4I48A 1GGIL 3VXQA 2HTLD 3G5VB 5C0DA 1QPXA 4NO3B 2PW2B 1AQKH 5J13B 3TNNB 3WXVL 1V7ML 4UINL 4XMPH 4ZUWA 1YNTB 2F54D 4NC2B 1CN4A 1FPTH 4S1DC 3JV6A 3GJFA 2DD8L 5T1DL 3QUYA 4HGWA 4JFDB 1RZJC 1UWGL 2E7HA 4L3CB 4ZTPL 4M5ZL 4TPRL 2YPKA 5HJ3A 1AR2A 2HG5B 3EO1A 1OGAE 3T1WA 4JHAH 5DK0A 3CXDL 4ODTL 1IAKA 1Q9WB 1AI1L 1MHCB 5KSAD 4S1SH 1U9KA 2FGWH 4N8VA 3PWJB 3BPCA 1KPRA 5FB8A 1NGYA 1YJDC 2A9MH 5DC9B 1R3LB 1VHPA 3UC0L 5C9KA 4OZIB 2ZKHH 4HBQA 3OR6B 3FB6B 4ZS6C 3FT4B 4HIEA 4KAQL 3MBEA 1MFNA 1ZLSL 3L1OL 1ADQA 5FA4B 3HPLB 2X70A 1C08B 5FYJL 2EE3A 3SDDD 3EYVB 2FX7L 4ZSOB 3SQBA 4F33A 3ILQD 4LRNL 3TLRA 3SHSA 1U8NB 4CNIA 2CH8A 1GCFA 3CLEL 3OAUH 3DURB 2ZG2A 1OAUH 3D3VA 4P5TB 1S78D 4PP2B 4D9LL 3MOAL 1H5BC 4TUKH 1W72L 1D6EA 5HVHC 1RZJH 1P84K 1HIML 4LNRA 3MFFA 2P42B 4JDZB 3V7AG 1ITCA 3JTSB 3KPQB 4RFEA 5KJRL 3S3JA 3P0VH 2PXYB 1OSZA 1JGLH 4M7LT 3DSNA 5E94B 1YJDH 3BDYH 3KXFA 4E41E 3STZB 2R2HA 5T1LA 1AIFB 4JFOA 1NBYA 1TNNA 4U1KA 4N0CC 5FM4A 4BZ2L 4HSQA 3K8KA 4GRWF 1GIGH 3TCXA 3IDYC 4KJQC 2D31B 3MRDA 4WI9A 1XF5B 2IJ0C 3MRNB 5LG1A 3QWOA 4Y5XC 5TE6L 5BRZD 2BP3A 3G5XB 4ODWB 1A6ZB 3KYOA 4M8VA 4BFIB 1I9IL 3P77A 4F7TB 1AGEA 3EO9H 3VFGL 3VRIB 5FGSA 3RTQA 2DQTL 1A8JH 4HS3A 5FXCH 3G9VA 3WS3A 2W60A 2DICA 3V6OC 2X4QB 4XH2B 5C7XH 4UMGA 2GJZB 4I3GA 3TT1H 4OLYH 5IB4B 3E1F1 3R4DA 5JUEL 1PDKA 4PRIB 3OKEA 3RA7H 2P7TB 1IC4L 3ZE1E 1RJYB 1I8LC 3UBXG 2I24N 5A2JH 3QEQB 1X5IA 2F19H 2P43B 5I1GL 4JJ5B 4B7IA 1HYSC 1RZGB 4V2BA 3ZTJH 4HX1B 4H1LG 3X17A 1X5YA 3I6KA 3LD8B 1T1XB 2VH5H 1XMWA 2AJZA 3F58L 2BNRB 5KTEH 3NGBC 2JCCB 5DA4A 5I75B 1A7PL 2SEBB 4CVZB 3L5HA 3VJ6B 1DFBL 2FWOB 1BZ7B 3W0WE 4MNHB 1RU9L 3D2UA 4YBLC 2CXKA 3ULVL 1MCEA 1QFOA 3OG4B 1CFNB 5ELIA 4O4YL 1S9KC 1HSAA 3K74B 5GIRB 3QXAB 1RY7B 5FYKE 1G9NL 2R56L 5SWSD 1KGCE 3ARGD 3B9KB 4O00A 4XNYH 5FUCE 3X13B 2IANE 3MCLL 1DQDL 3RVWC 2H6PA 4QRUA 4D9RE 2CIKA 4N9GB 4DOHE 4L4TE 4UB0H 1TXKA 1S9VA 2EDNA 5DJ8A 3QIBD 3E8UL 2YN3A 3DTXB 5EU5A 1BD2B 1WFOA 5F96H 1WCQA 1DQML 4X4XA 5JNYA 3MNZB 2NZIA 2HFEB 1HHJB 4M7KH 5DJCB 1I7RB 1DUYB 4OLVL 3PWLA 3JZ7A 4LASH 4X6CE 3OZ9L 2DBLH 3LPWA 2ILLA 3VXNB 4X6EB 2ZCLL 5EU4B 3ESVF 5IR1B 1BFVH 4O2EA 4YQXH 4RNRA 3FO1B 4CGTA 4AEIH 3LV3A 4GMSL 1KXTB 1FFNB 4UV7H 2OR9H 3KPNA 4KRPC 1NMCC 3PJSA 1I1YA 5L8LB 2B4CH 3G04A 3QG6A 5C0GB 4LIQL 3TIDB 3UTSE 2XWJA 1TMCB 3QWQB 3DVGB 2HVJB 2QSTA 1LO5A 2YN5A 3B6SA 2KDGA 3VFOA 5J6HB 2Q8BH 3S9DB 4NC1E 2GI7A 4BH8A 2YHGA 4EDXA 2EYTA 3RL2A 1H3GA 3JWOC 4ZYKB 1TJIL 5EC1B 1X5AA 3VDCA 3WFHB 3RVTC 2AJYH 2VC2H 2DLFL 5IHZB 3S36H 1Y0LA 1P69B 2AEIT 3ILPB 1KJMA 4U1GB 5E1HB 4UBDD 1KJVA 3SDCC 5F6IB 3QEUA 5KW9L 3OX8B 5T3XL 4Y19D 2N1KA 4GG6B 3ORJA 4RBPH 3REWA 4GAYB 4RZCA 3VXPA 3CX5J 3SE8L 4NQXA 4BQCA 2X1WL 1ZLUK 3KPPA 4GXVL 1EHXA 5DHVH 4WFED 4RIRA 5HHQB 3RGVA 3H9SA 3V4VH 1A6VL 2X4OB 3P0GB 4R26H 2XZQL 4LCWA 4LKCB 1K85A 3M07A 1MCPH 2O26U 1E4KA 1D5ZB 3D39A 3SGEI 3JWOH 3WFBH 1HQ4B 4P46A 1YECL 4I18C 3HI6L 1ZS8A 2XTJB 4AIXA 3MLZL 1BF2A 4P2QE 4R6UA 4PV9B 5DVLA 3BSZL 5HHOA 3THMH 1KN2H 2X2YA 3SKNA 3T4AB 4OFYD 1AKJB 3Q5YA 3WFEL 5JLZB 2VXTL 1VFOA 3LCYA 1MAKA 2V7NA 3P4OA 5FAAA 3ZE0E 3QJFB 4AT6B 4PD4J 3CSYA 2H1PL 3HUJE 3D0VA 3QQ9C 1XF4B 5CGYC 2QQQA 4Q58C 5E6IC 3RWJB 2IWGA 2J4WH 1QEWB 3RAJL 3L5WB 2GT9A 4QXUL 2IALB 1C5CL 3EFFA 4BK4A 4LF3B 4LK4A 3ROOA 5I1KL 4JE4B 5ID1B 4HF5H 1OGAB 4MJ5B 2IEPA 4X7CC 2BRQA 5LAXB 1OW0C 5GGUB 3ZYZA 1T21B 3RNKB 5LXGL 2CIIA 3N1QC 2EDJA 3NTCL 3VXSA 2KQNA 4JQXC 5DVMA 3HRZA 4YHZH 2IBZY 5DD5L 4ZDHA 4R96A 5KSVB 1L6XA 5DVNA 4X9IA 3GSNL 4Y0GA 3IXAB 4LCCA 3QFJE 5T5FH 4I3SH 2DLTA 2FJHB 2AGJL 1QFUH 1NAML 3GMLB 2WBWB 4GOSA 3BWUC 3HRPA 3QRGH 4QKXB 4P9MH 3H3BC 1CGTA 2V2TB 2NY4B 4XPTH 4ODHL 3K4DA 3BIKB 4BM7A 5J1TC 1YN7A 3L3JB 1GVIA 4P3WA 2NY3C 1YEGL 2P5ED 4JPWH 1FH5L 5BQ7B 1XH3B 1S7QA 2EC8A 2GSGA 3NABH 5C0AA 4M48H 5F1SA 5F7KC 5DA0B 1FZKB 3PP3K 2VLLB 4JHWH 1IILE 3PXJA 2I60H 2DYPA 2OL3A 4F7CA 3VI3F 4Z7OE 4E41B 3U0WL 4XCFL 2MCG1 5FM8A 5HPMB 5BS0D 1U8KA 5DQDH 4TNWK 2DM4A 4BQ6A 3ZDYF 1MCOH 3BD3A 3T0XA 5J3HD 2R4RH 3KJ4C 1AJ7L 3VXUD 5AAMA 3MRFB 3SGDI 2UZXB 1JUFB 4MJ2A 4AQ1B 2CJUH 4WUUD 3NCJH 2P46B 2FO4B 4JN2B 5ISZE 1LNUA 1N3NB 3GJFK 1AR1D 1X7QB 2EDYA 3BAEL 3I75B 3L3GB 4H8WL 2ADFL 5MHSE 2W91A 4IRSD 1DL7L 4HXBH 5H2BA 4P2OB 3MZGB 3Q2CA 4DWHA 3PL6D 1B3JA 4Q74A 3FKUS 1DQJA 3HE6C 1T2QL 1ZEAH 5DUMH 1NGWB 1ZHNA 3DVIA 3QXDB 4I0PD 2EYSB 3NFSL 5TDNA 5DHYB 5KN5A 1A1OB 3FHQA 4M5YL 2QADD 3OXRA 4TVPD 1T5XA 3GKWH 5KVFL 1MCSA 3U6RA 2DMKA 4ZXBD 5CLWA 4YK4B 3LOWA 2YBRA 3SBWA 4RFOL 1ZGLP 1SJEA 2JJTC 3MV01 3DVNA 3U30C 1AD0A 2A9NL 4OZGE 3P9LB 3EZJB 2AXGA 5C0NC 5I1HH 5LQBH 2HT4D 2BRRL 4MDIB 3DV4A 4ONFH 4HEME 2VZOA 3DV6A 4P9HC 1SBBA 1MHHA 3UJTL 3DO7B 1SJHB 4LLDA 4FFYH 1CVRA 3TBVB 3RDTD 2QQNH 1I7UA 3PQYD 1NFIB 4CMMB 3KPSE 4F58H 1I8IB 4Z95H 1S7TA 5KVGH 3QPQC 2ARWA 5I17B 1J0JA 2QSQA 2IANB 1VCAA 2CLZA 4FQXA 2BOCB 3RWHA 2G75A 4P23D 1HH6B 1QKZL 2JIXB 3WEXB 3DETC 5HYJE 4NN7B 2AQ2A 4P9HH 3AMLA 3C5ZA 4PRPA 1CCZA 1FO0B 2DTML 2WP3O 5B39B 5J6GB 1YN6A 4ZD3L 3B9DA 1MLBA 1AD9A 5GGVH 4D9QD 1IGIL 5IQ7L 4HXAH 1OAKH 4LLYA 4GH7B 1BVLA 2HRLA 2EKJA 3GIZH 4D94A 5GRJH 3GIVB 3LQAL 2IH1B 1JZ8A 4NKOA 5HYEA 2ATPB 2I5YL 4IDJH 4KTDH 1MFEL 3SDYH 5CUSH 3L5XL 5DO2D 2AVGA 4L5FH 1MCKA 1ZA3B 4Z0XB 4P3DA 1VADA 3C6LA 2HFGL 4OFKA 3GB7B 3UTSB 4JLRA 4QRTA 5E5RB 1MJ8L 2JJVA 5C0FA 4X8JB 1T1YA 2B7DT 4YDKL 3O8XC 1R0AH 5F7DA 1OTSD 2XWTB 3O3AA 1KEGH 2YSSB 3H3PH 4IRJA 3MV7D 3FQTB 1QBML 1F8TL 1MRCL 2CKBL 4P4KB 2A73A 3LMJH 5DJZA 1L0XA 3CVHL 1CG9A 4GG8B 1XGUA 5C07A 5F7EH 2R2BB 1CFQB 5JA8B 1FRGL 1TZHB 5DZLA 1WUNT 1MOEA 3BEVA 4EI5C 4QNPE 5TDPB 1UVQB 4U1MB 5EFIB 5IEKA 5C0BA 4G8GB 2F8OA 3N06B 1AO7A 5C0IB 1NLBH 1TDQA 1N5YL 4Z7UF 4KY1H 2ITCB 4OKVB 5DEFA 3D85D 1TCMA 1VEMA 2AS5M 5CSZB 1M05B 3FQNB 4RMUA 3QDJA 5EZOH 3QDGA 1EBAA 4ODVH 1YEIH 5DK2A 1MIEL 2OQJB 4OT1H 5FCUL 5KSAC 4QHMA 1U8HA 1A9BA 3RPIB 4WHCA 3V2AR 5EC2B 2FSEB 3CCHB 3FRPA 4P2QB 4JAMA 5D2NC 3WNMA 3A67L 3UBXI 2FZ3A 4Z7QF 4BFGA 1UWXK 4RQQB 3KR3H 1NDMA 1F3DJ 3O45B 1FDLH 1GGBH 4YHIB 4MXQD 2FR4A 1U3HB 5EZLB 3L9RB 3TBTA 4N1HB 4RFNB 5D7KD 5BVPH 3KPLB 4KJPC 4ZFOB 5HVHB 4JQVC 5DD3H 1YNLL 4R7NB 5HYSA 1S78C 3MOQA 4YFLF 3VWKC 1MNUH 4X6DF 3GMNB 3NACL 4G6FB 3R06A 2Q86A 1QSFD 4ZPTB 1CXIA 3GMRB 5E4EB 5E8EB 3S5LB 4NQSB 4IJ3C 3V5KA 1CQYA 2EKSB 1IAMA 1BOGB 5F89B 2QSCH 4BH7B 3BQUA 2GEEA 1DQTA 2B0SH 2IPKA 4XVUC 4KROD 4N5ED 1IC7H 2X4TA 3GHEH 1X3DA 1WBXB 3RKPA 5M94B 5I2IA 2EH7H 3OGOE 1JPST 4GRWH 4Z7WE 4NN5C 3QFJB 3L3OB 3WNPA 1OD7A 5JOFA 3NAAL 4Y5XB 4P99A 3MJ9L 1RIVL 2AEPL 3SGKA 4NRZB 1BHGA 2EO9A 2A6DB 3SE4A 1JE6A 3IFOA 4PR5A 1F42A 3H8NA 1NMBL 3V5HA 4OZ4B 1BLNB 4J12A 4PJDE 1I8MA 5INCB 1OP3H 2J6EL 1X5GA 4LSRL 1D5IL 3BIAX 3JVGC 4XAKD 4QTIH 3BGFC 4WY7L 5IFHL 2KH2B 1J88A 1A5FL 1BOYA 2YA1A 3OGCA 2XG4A 1UB5B 2XWBB 4WI2A 2VXVH 5K9QG 3MCKA 3ULUD 1QSEE 1LWRA 2BSSB 4U6XA 4Z0BH 3MXWH 3P4MB 4PLOB 3QXVA 4RWYH 1I4FB 4UOJA 2G2RA 4P5KB 2RHEA 4OJFL 1AXSA 3V0VB 1SBSL 1PYWB 5C2BL 4HJGA 5GXBB 2AXFA 1A47A 3DMMA 4U1LB 1SM3L 1X5JA 5IT2H 5D6CA 4HGKC 2VABA 1EZVY 1DBJL 3UTPD 3INUL 3UJIH 1QFWH 2CO7B 3NGBB 1PD6A 1YEFH 4MNQD 2DDQL 2WLZA 3GMMB 5J8OA 4TSCH 3P9MB 3MROA 2PO6B 3LEYH 4MJ6B 1N0LA 5GS3A 5EIIB 5C6TH 5J7CC 5KAQF 4M7JH 5ISZB 4Q0XL 1BBJA 5IKCB 1JNLH 3QNXA 4G6MH 4LLQA 3MRQA 4G42B 2X4PB 1ZT4B 5H37G 2XN9D 4GUPB 4LVHC 4NKIL 4Z7VF 4Y4HD 3VFRA 3EOYG 3GSXA 4V1DD 4NWTH 1MEXL 1MFBL 3RNQA 5FGBC 2FD6H 5ESVB 1UWEL 1YDPB 2NY1D 3ZKXC 2EDOA 2EDTA 3I50H 2A6IA 3MA9L 5CINL 2PETA 5C0EB 3JV0A 3N9GH 2M2DA 1CFTB 4QRPA 1FVEA 3U0PA 3P73A 1B0GB 2DQCL 1WC7B 5JR1H 4H88L 1J86A 1T20A 1C1EH 3KPRA 1D5MB 1RHHB 3U36A 4ZS7H 3GI9L 1FJ1A 3BP4A 5MI0C 3NCMA 3TPUA 3I9GL 3X3GH 2VDKH 2VUYA 4QYOA 1BQLL 4XXCA 1NJ9B 4M02A 3O4LE 4QXTA 4WGVB 5DJDB 2PYED 4HG4J 1L4IA 4L9LC 3KPSB 4KU1A 4IS6B 3BX7C 1NMCB 1ZGLA 2AV7A 2HVKB 4JFED 3WUWB 5IMMB 2D7TH 2KUTA 2HFFA 1YEJH 1CLZL 5HY9A 2IBZX 3K46A 3G5ZA 4OF0A 5GGTA 2ZSWB 5I76A 3WIIL 4C83B 4C56D 3KLAB 3BIBX 1RD6A 5JOEA 4G8EB 3ARUA 4KZEL 4YDJA 3BP5B 2C3VB 3OXSB 2GK0B 4ZTOL 4NRXB 3CVIH 2YD6A 3BKML 3WIHH 5HYJB 1XZ0B 1CDCA 1GAFH 3MREB 1RZFH 5I6XB 4PJXF 3WFDH 3CH1B 3GGWB 4TSAH 1ED3B 5GRXG 3CK0L 3QZWA 3KJ6H 4UBDC 3EYUL 1G6RH 3AUVA 4TUJB 2CLRA 2OZ4L 3BEWB 1KN4H 2DAVA 2F54E 1FNAA 4HKJA 2X89A 1JWSB 3M8OH 3QUKA 5GS2H 3W5MA 3VI4F 4MSWB 2ADJB 3QG7H 1PEZA 1CD0A 2FDBP 4JRYB 2BY2A 1MREL 5ILTL 2FX8L 2ESVA 5CZKA 5D7SH 3BFOA 4YXKL 2XA8H 4GRMA 3LEVL 1AC0A 4I18B 5F1OB 3DYPA 5TDOA 4PLNC 2FJGB 1N8ZB 3QHTC 4PY8J 4DCQB 1Z5LB 5F9OH 4JG1L 5BW7C 3DO3A 5ALCH 5EO1B 1KPVA 2W0KA 5JHDA 2IC2A 3PG2A 1EERB 4HUUB 1DEDA 5E99L 4RDQF 2VE6A 3IJYB 1KB5B 5FEBA 3M17B 1VFAB 5DMKA 2YC1A 1CGYA 5F97E 3NZHH 3BRDA 1DUZA 3LKQA 3FRUA 1IEHA 4RAVA 2YD7A 1OAQL 4NZUH 5CKGA 1IM9A 2E9BA 1RZ7H 2A83B 5KVMC 5HI3C 5HHXL 5HGHA 2AK1H 2W65B 2CO6B 2FIKB 4NNYA 1TZGL 2H26B 1U58B 3D25A 4YIQA 3HAEH 2FBOJ 5CP7B 3RWIB 1LEIB 4X5XA 1L7IH 3V6FA 3ARZA 3S7GA 3O81A 2HT3D 1LP9A 1JGUL 4ZOBA 1U8LA 5I1DB 1BQHA 3U9UA 1W0VA 3H9YA 1YY9D 1Q0XH 5IVZB 1CL7L 1YMHA 3LKOB 1MWAA 4HKBA 2Z31D 1S7XA 3MJGX 1Q9KA 3L95B 3RIAK 1CFSB 1F58H 1XF3A 5BRZE 4XGZB 4LU5H 4CL7A 2WWMC 3MLPA 2FNBA 5SWZE 3U9PH 4K3DL 4QHUB 3IS1X 3KYKL 4M9OA 4MAYA 5EIVA 2NY3B 5EIQA 5L9DH 4HQQL 2VDRH 4OLEA 3GBMH 4JM2D 1V3MA 3MRGA 4XVTL 1A7RH 1KTDB 2YUXA 4FTVD 5J89A 3JWDL 5C6PB 4XCCH 5CJOH 4ZAKA 5CJ5A 1XIWD 1KPUA 1T1WB 1R3IL 1U8JA 4WTZA 5CZXD 4MAUL 4PJ9C 1AHWA 4R4BA 4NCC2 1FZMA 4TTDD 3IKCA 3L3HA 3Q6FB 3H0TB 4F37K 1GH7A 2A38A 2EIZB 3MUGA 4DEPB 3TO2B 3DX6A 3Q3GB 3BZFA 3ES6B 3KJ4B 3P0YH 3PDDA 1CI5A 5B4MC 1CS6A 1UJ3B 1A6AB 3QUYD 4FFZH 4N8CH 5J3HC 5IB5B 1CDGA 5ICYA 4XP9H 4PJCB 4NP4H 3W0WA 1KFAH 4K8RC 1I8KB 1ZMYA 2R69L 5I16B 4ISVA 4F7MA 5GGRY 1REIA 4OLWL 3UMTA 2DJUA 1OT1A 4H20H 4LL9A 4NC0B 1UQSB 1MUJB 3HNSH 1MCWM 1S7SA 4PJDB 4EXKA 2XXMB 4X7SL 1P5VA 1VSCA 3MBED 3VFUB 2PTVA 4JM2F 4MA7H 1YYLL 1UXSA 4LCUA 5IOPB 4G80B 4Y1AE 5ERWA 3TWCH 1G0DA 4LSQH 4Z78A 4APQA 4A6YH 3C08L 3TO4D 5SWSE 4L4TA 4MYWB 3PIQB 4AIZB 3BXNA 4GQ9H 3PL6C 1E6JL 5F72S 1QSEB 1D9KA 4GKNA 4Y5YA 5B38A 3D3VD 3BKCL 2DQFB 5F9JB 3HZMA 2PF6A 1FVDB 1NUFA 2V2WA 1CF8H 4I0PC 3WYRA 2FCBA 2W9DL 2NYYC 3FFCA 1YEKH 2VRAA 5F3HA 4X6CA 4O9HL 4J8RB 4M6OL 4K8RH 4LLAA 4X7TA 1MFCH 4ZXBC 4PRDB 1EUTA 4HK0B 4JO3L 3D9AH 1HEZA 3KXFD 5IBTH 4HS6B 5T1LD 3PNWA 1TJGL 3DROB 5T1MB 2HT4C 3BZ4A 3RWFA 3LKPB 3QNZB 3RPKA 2NW2A 1T83C 3QEHB 4PS4L 2CLVA 1T89C 3UPCA 2EICA 2OL3L 1INQA 2L4OA 4DGVL 4JANB 4OM0H 2BJML 3RDTC 5ITFA 4C4KT 1KTKE 2X4RB 3O3DA 1C7SA 4PJHB 3BO8B 1TETH 5DZNA 2PW1A 1U2CA 2HKFL 3ZSTA 4XBPA 1CL7I 3RTQD 1G7LB 3OAZH 1BWMA 1GGCH 5DMGD 4G6KH 5CEYA 2DWEB 4XI5D 2VZTA 5JW5B 3ECBB 2XA3A 4M1DH 4P23C 4TVPH 2YD1A 2R23A 4LPYA 3RZCB 3TJEH 4AMKL 1S5HA 1RQ5A 4LGSB 1LDPL 4WI5A 4HT1H 1DBBL 1RZKH 5I8EA 1JGVH 1UA6L 1ZLVH 2IPUG 4XCYB 1WCBA 5IEHA 1KCSH 3E6FB 1S7VA 4M1GL 2WM0A 4HIHB 4Y19E 4DGYH 1QBLL 4S1QH 4Y4KC 3TBYA 2VZSA 3O4LB 4X5WA 3FOMB 4FQ1L 3AXLA 2VXQH 4NZTL 2KQMA 1B4JL 4Q9RL 3V7MA 4MMZC 1VGEL 5E95B 3TN0B 2UY6A 4JFYB 3ZKQD 3T1FB 5IJVB 1ACZA 3E2HC 1VESA 3D2UD 4KH2A 3O8XB 3S6CA 5I19H 1QQDB 4O5LL 3DRQA 4MA3A 1INEH 4XP1H 1T03L 1UYWH 3O3BA 4PJEB 5FDWA 5FV1L 1OTSC 1I1RA 3HUJA 2EDQA 2W07A 4O58L 3HNTL 1S7WA 2LVCA 4UILH 4QTHA 2ZSVB 3BP7A 4CN4A 4ELMF 1E4XH 4OV5A 4TRPH 1DEEB 4EOWH 3CX2A 5D71H 4XVSL 1SMOA 3HS0A 4D2NA 3AS2A 1WEJL 3U48A 5I8CB 4NWUH 1ZT7A 5EO9B 3TZVC 3F6IA 5CGMA 4J3WA 2F54B 1AP2A 1JFQL 3QZWG 4JFPA 2QHRL 4GRLD 7CGTA 3TBSA 2DQUH 4F2MB 1ZTXL 3O3UN 1U93A 1F3DH 2W9EH 1MCDA 4O2FB 5K59F 3LS4H 2IPUK 5KSAB 3VI3E 3V6ZA 5DLML 2PYFB 5DUBB 4ONOA 3ESUF 5D72H 4TOYL 4MJIA 1EZVX 1V7NL 5SWQA 3UTZB 1U92A 3P2TA 1P6FA 5GSVA 4YNYB 1KIUA 2CMRH 4RRPA 3NN8A 4ZNEA 3SDDB 3V6OA 1DE4A 1JWUA 2ED8A 3VXTB 4K7PY 1P2CB 5IHBA 1K8IA 2HRPL 4JR9H 2DQIL 5M7QA 4CVXB 1OTTD 1EFQA 4MXQC 4GBXC 4LSVL 3PF2A 3QO1A 3LPFA 5GS1C 1CDBA 1IT9L 1CICC 4N0YH 1PVHA 4GW4B 3LZFL 1MI5A 2C4FU 3ROLB 4PJIE 4KUZH 3WL9A 4H25A 1P53A 4CU8A 2P5EE 2DQGH 2HWZH 5D93C 2XG5A 4IJ3B 4BQBA 4U1SA 5D5MF 1FAIH 1KJ3L 2X41A 4I9WD 4CDGC 4MVBC 5FKAB 4FFWD 3MRLB 3JV5A 5BS0E 5I18L 4KROC 4WW1A 1GOHA 3FL7A 4NN5B 2ENYA 5B8CC 1LO3H 3T65B 4D8PB 1X4YA 1RV6X 1AGCB 3L3DA 3GO1H 4HUWB 3IDJB 4PJ5B 4UI2A 3U82B 4XP6L 3EJJX 2H9GA 3U7YH 3RGVD 1UM5L 3H9SD 3VXRD 1HSBB 3MNWA 2HLAB 3SOBH 5BRZB 2FL5A 1FFPB 2IQ9L 5EOCJ 2DLEA 1BPVA 5MEQB 2BDNH 2DOCA 3IU4H 4LCWD 4WUUE 3DVFA 4X6BA 4LAJH 5FOJA 3RUGE 3MMEA 1OWRM 1CE6A 3D39D 3UX9B 3CC5A 1T1ZA 4ZUUB 4P46D 1WZ1H 4YO0A 1U3JA 4A2MA 1E4WL 3PP4H 4GLRI 4U49A 4MXVF 4CDHA 5CD3A 2R1YB 3UZQA 1GXEA 1KOAA 3VDBA 4YGAB 4HMCA 1II4E 3JV4B 2OMBA 3DX7B 1K8DB 1A6WH 3GSQA 1B4RA 1MJUL 1N4XH 7FABH 5IB2A 3LN4A 4DW2H 1J1PH 4LP4A 4XXDB 3X3FL 1FNEB 1ORSA 1MJJA 3SE9L 3ULUC 5AYUH 4OUUA 4MD5A 5ADOL 3QBTB 4UQ3A 5BO1L 4OZGA 4TVPE 2C1OB 4YX2H 3VU2A 3HZYA 3BVNA 5IQ9B 1OT2A 4XWGL 3J7HA 5I1AA 3SJVE 4EI6B 1SMAA 4ODUB 4D0BA 5E5UB 3VGGA 1TVHA 4EZMA 3BN9C 1F6LL 2YEZB 1MIMH 3IXTA 3VXSD 1JPSH 1O7SA 1KCKA 4HS8H 3LIZL 1Z3GH 4PTTA 2VDOL 5INDB 5DHVA 3NA9L 1NFKA 2ZG1A 1N6UA 4LVHB 4ETQA 3G08A 3QHFL 4XZUB 1HYRC 4HIXH 3PQYE 3LRGA 4FQQA 4HDIB 4UT6L 5MENA 3C2SA 3LEXB 4YHOH 2HJFB 4Y4HC 5SWSB 4M6NL 3ARGB 2EE2A 5TH2B 1LO2L 4YPGA 5EG6C 1NEZA 1OP5H 4OF7A 4HH8A 1LEGB 2AEWA 3A6CL 2NY1C 4ENED 2QL1A 3I84A 5FYLL 1NCAH 1FG2A 2IADB 1I3GH 2EH8H 1YC7A 5LCVL 1AXTL 3VFWA 5B38G 2PCPA 3QIBB 3O2WL 4QOKA 5L88L 5C0AD 1HHKA 2AI0H 1NDGB 1Q1JH 4XVJL 3P11L 1TZIA 5MI0B 3SE3C 4JY4B 2DYPD 1IEBB 4GXUM 3IFPA 4XP5L 5B39G 1KTRL 3MGTB 2ZUYA 3MR9B 4D0DA 4K94C 3OR7B 1UM6L 1JNNH 1G6RB 4OFVA 2CDFA 4L9LB 2ORBH 3V9FA 4U33A 4P2RA 4MWFA 4PJGB 3EO0B 5E6YA 1JN6A 5I1IL 1XF1A 4PBWD 5IW6A 5D7LA 2GSIA 3T4YB 3QCTH 4DUVA 1EO5A 1T7YA 3S34L 1CLYH 5DJ2A 2WINA 5C86A 1CXFA 2HYMA 2ITDA 3R0MA 4U2YA 1A7QL 3MV7E 1IAIH 1P4LB 5DD6B 1TITA 1LO4L 4MQXD 2PN5A 5JMRA 3HC0B 3RVXD 3EW3B 3AAZB 4PJBF 3IJSB 5JQ6H 4Y2DA 4YUEL 4K94H 1HKLL 4X4ZA 4YAQB 2BK8A 3QIUA 4CU6A 5DMIL 2GY7B 5KVEL 4OGXH 4Y19B 1JNJA 4PBXA 4MQSB 3LH2H 2MQCA 4HCRH 3GMQA 3QQNA 3BGMB 2O61B 5E2JA 4X6DE 1JJUA 4XBGB 1LK3L 2C3XA 5EN2B 3M1BB 3OAYK 1JHLL 4QRRA 1B88A 1F4XH 1FL3A 2FYYA 1RMFH 4LVOC 5D7IE 3T77B 3RWEB 1IM3A 5TQ0L 3OKMB 2FHBA 4OZFB 5IM7A 4JO2H 4JZOA 1PLGL 3STBA 2P8MB 5D1ZD 2WK2A 3LRSA 5E2VL 1EMTL 3TH4T 5IVXB 3MLUH 5FO9A 4MNGE 2Y23A 4H26A 3W2DL 2BFVL 2VLRA 4Q6IC 3LAFA 4LSUL 1EJOL 1XR9B 5BV7C 1X4XA 4FQXD 5D7KE 3FQXB 4M43H 4R4FL 2X05A 2O5XH 5HYFA 1T04A 2ARJA 2ZOLA 5FGRA 3MGOA 4XX1E 5IK3A 3NFNB 5CEXA 4WI3A 1KIPB 4J4PA 2DQHH 1CDYA 1MLCB 5L6YL 2YUVA 2R0WL 1S7RA 1XGQA 3TIEB 1YEHL 1OB1B 2R4SH 2XYCA 3KYMA 4I2XE 4OGYH 1YNKL 4KV5F 1QSFE 1MJ7H 3C5ZD 4PRPD 3S5LG 5GGSA 3MA7B 3FQRB 5T3ZL 3FN9A 4Z7WA 1WWAX 3C8DA 3T0WA 1BWWA 4LLMA 5GGQH 2FLBT 2HT3C 1MHPL 32C2B 4L3ED 2ADGB 3ULSB 1YY9C 4K7FB 5BV7H 1YPZB 1QRNE 3BHBA 2Z31C 4LEOA 5GISH 3C6LD 2ZCHH 1WLHA 3KPTA 3X14A 3EGSB 5I8KH 1RUML 3EFDH 3W11C 3QPXL 4I77H 3HE6A 5E6ZA 3HR5B 1UH2A 4FNLH 4IRJD 5AZ2L 5CBEB 4XAKE 2AABH 4PJIB 3VCLB 1WWCA 3DHMA 4YHPB 2X9YA 3T3PF 4DQOH 2VLKA 2P5EB 3K7UA 3NZ8B 1FNGB 4Y5VA 3CFJA 4JM2C 4Z7VE 2WLYA 5TFSL 5DJAB 1T0NA 2VQUA 3ZT5A 1D7FA 1FCCA 3A6OA 4R9HA 3TYGL 2X4SB 3PGFH 1GOGA 2IQAB 3FB8A 1DSFH 4NO2B 3ULUE 3WD5L 4JG0L 1FVCA 3F5WB 5DRNA 5CZXC 5C0BD 4OZHF 1ZXQA 2GY5A 1T4KB 1J05A 25C8L 2GFBA 4K3EL 4ZOAA 5BS0B 2YUZA 1AO7D 2EDHA 3QUML 4CW1B 2ZPKH 3B8YA 4JFQA 4ODSH 5ESAA 1NL0H 2OTWA 3VXUB 2NNAB 4FG6D 4MQTB 2J88H 2ZUVA 3QDJD 5E5MB 3QDGD 4Q2ZB 1N6VA 3K4ZA 4WUUB 3OHXA 2IG2L 3RUGB 3A6BL 2JELL 3V6BR 5D2LB 3VFVB 2VSCA 2YPVL 4NFCA 4TUOB 1HHHB 4IRSB 2Y07H 3MBEC 1GPOH 2XN9E 3DSFH 4G5ZL 3O11A 4HPOH 5AG9A 1J5OH 5JO5A 4G43A 4J6RH 4V1DE 3PL6B 5ETUB 2UWEA 4HUXA 4MLSA 5FUZH 3TO4C 3MJ8B 1OARH 3LHPH 1NFDB 2XICA 4I0PB 3UTQA 3WFCL 1KCRL 5IGXL 1DBKL 2QADB 1RPQA 4K3JL 5CCKH 2PTUA 1V05A 3O3EB 2YXFA 4X80L 1HI6B 2YZ8A 1N59A 3D6GA 4ZXBB 3I6GA 4QLRA 3HI1A 4HIIA 5TE7H 4OCYL 3SCMC 5H8DA 4ESKA 2VJXA 3BQUD 4HC1H 5FOBB 1JHKH 4PJXE 5HHVL 2VIRB 3SKJL 4ERSL 1MRDH 4NM8H 1UKQA 3MRKB 4YXHH 2X4UA 5I74B 4RAUA 4KDVA 1ADQH 1ZHBA 4OLUL 3RDTB 3PQYB 1WTGT 4ODXB 5DMJB 2R8SH 2BVTA 2OBGA 1FFOB 1RURH 3WUWG 5DQJB 4X4ME 5C9JB 3BKYH 1GZQB 1NGZB 3WHXB 5FO7B 3VH8B 4QWWD 5CHNB 4JJHA 4JZJB 5GGRB 4C56E 1NGQL 4P23B 3RTQC 5HI5C 3OB8A 5DMGC 3TVMB 2R29H 4XI5C 1OAXH 1NEZG 3I2CL 4EI5A 4XH2A 4WHTA 3GK8H 4K7PX 2EDKA 1HZHH 4DZ8B 1M7DA 2G5RA 5FYKL 2EC9U 3EDJA 5I66A 1MH5A 2UYLA 1I7TA 4X6FB 2NY5C 4WI6A 5T5NF 3BKJL 5LWYL 2EDFA 3ARFC 3DMMD 4NN6C 1H3PL 4CRPA 1FIGH 1UACL 1R24A 2VKWA 5K9KB 1QR1B 4PG9A 2HH0L 1AH1A 5JHLL 5KSBA 2BNQE 1JF1A 2VZVA 3G6JE 2DQJH 3REVA 4OD2A 3VD4A 12E8H 3MYJA 1QVOB 2C3GA 3DRTB 3MLWH 3NBNA 3D0LA 3E2HB 5D2NA 1H3UA 1KG0B 1WAAF 3MX0A 4PGEA 3EOTH 4LCYA 4N68A 2YUWA 3TBWA 4FQ2H 5JZ7C 2NCMA 3NPSB 4U1HB 3CFEB 2D7QA 1OWWA 2Z35A 3MV7B 4RBPK 1N5AB 4XMPL 2AQ3A 1OQXA 4HWEH 3I3DA 3SKMB 1ZT1B 1G1CA 2P4AB 3R8BB 3Q1SL 1ZA6A 3VWKA 2D9CA 4FQLL 5E2TL 4JHBA 5E24E 4HPYH 5GRVK 1JZ6A 1PG7H 1T66C 3MLSH 3HC4H 3PHSA 2DQEH 1JPFA 2R0KH 1A6UH 3NCFB 4GSDH 4JHAL 4YHKH 3RU8H 35C8H 1P84J 4DK6A 4EN3C 4R3SB 4FA8A 4F15B 4QRPD 3VGHA 2L0DA 4RMSA 1T7XA 2MMXA 1NCCL 2HFTA 3HG1A 4IEFB 3QQ3B 1EGJH 3NFPB 4E9LA 2A9ML 3BN3B 4X6DB 2D7NA 5I1EH 2D7OA 3MLRL 3D85B 4JEGB 4GRLC 4HUVA 4ZQKB 3TYFA 2Z93A 4M9PA 4ZNCD 3IF1A 2CUIA 1F11B 1G7PB 5H35A 2J8UE 1BEYH 1IZJA 4OUOA 5D7IB 5LGHL 5MEPA 1OAUL 5DVOA 4I3RH 2YPLA 1KULA 4P2CG 2YRPA 4TUKL 5EUOB 4MB4A 1UT9A 1RZJL 4U7MA 2WUBH 3H2WA 1NBVL 5SWZA 5BOZG 1ZANH 4DTGH 4PUBH 1QBBA 1YQVL 1TTGA 3GSUB 4KK8D 3FQUB 4WU5B 3F7VB 3AGVA 5GS1B 3U2SB 3H9HB 1EUUA 2FEDD 4OFDA 5E1AA 4DAGL 4M7ZC 3L7EA 3H7LA 4HWBL 3VRJA 3E3QC 4I1NB 1R5VA 1S9XB 4M1CD 5D93B 4HWUA 2CQVA 4FZEL 1U95B 3MOBL 1PKQB 4MDJA 2XY2A 4FTVE 1HHIB 3UTTD 2ZUQB 4I2XB 1CT8B 4M6ML 1QSFB 1ODAA 4KC3B 1WTLA 4UIMB 3BH9A 3P4NB 4PJ7F 3H42H 3QEGL 4JPVH 5EOCH 1NKOA 4KROB 3B2VH 5CBAA 3LKRA 1FORH 4NNXB 2X10A 1NAMB 3EO9L 3MJ7A 1TTFA 1MY5A 2X89D 4WV1C 3VFSA 2RAMA 5FECB 1E28A 1ZVSA 5DC0A 1KEML 3QCUH 3VFNB 3RGVC 1X9QA 3I02B 4OLYL 2ESVD 5GZND 2JLLA 2O5YH 2AERT 4O2CA 2NLJA 5GJTL 1WGOA 2NXZD 4Y1AA 4NNPH 4NO5B 4UTAH 4EBQH 1AY1L 2I07B 5EBMA 3RJQB 5L7XL 5ACZA 4FP8H 1GOFA 4KK5D 5HYQA 5ICXB 5JHDD 4KHXH 5JW4Q 1FYTE 4UDTA 4RMRA 4LRIA 1MHEB 2WIMA 3MV9E 2E7LA 4PV9A 1JHTA 1CYGA 5E8NB 3C87A 4KKAC 3FZUD 4OF6A 2JK5B 3D3VE 4BSVA 3IFNL 3WE6A 3OKYA 4BZ1L 1YEEL 4FMFA 4Z76B 3O6MH 3GSOA 3WIHA 2GTZA 1IM9D 2UVFA 4QF1A 5EUKA 1UEYA 4KFZC 1DLHA 3MO1B 1G7MA 4OV6F 4UNTA 4R8WL 2NY2C 5T33L 4U3CA 1XFPA 4MNQB 1I3RB 2R2EA 5GQBA 3KXFE 3DYOA 1IGYA 1T5WA 4FQJH 5IB1A 2ZOKA 3BH8A 2FATL 5FCSH 4RMQA 2ZNXA 2RCSH 5IROC 5GZOD 1X6NA 2M8XA 2DI8A 1E27A 3D87B 3HLAA 3NIFF 2NTFB 2PR4H 5KSVA 4PB0L 3OG6B 3W82A 1CWVA 3PGCA 5HGBB 2XN9B 4MCYB 2XQYK 4XPBH 4Y4HB 5CIPB 3HKFA 4ONGH 4V1DB 1V3LA 1R5IA 4FXGB 3WLBA 5F96L 1CGVA 5EA0H 2JE8A 2NY1B 3WNLA 4K71B 1KXQE 1J18A 2DB8A 3MLTB 2BOBB 1IQWL 4MAYD 1CIUA 4ENEC 2AKRB 1Q9LA 3L3IB 1K6QH 1Q94B 1XGYL 1BGXL 5IMKB 3UBXB 1BFVL 2OXGA 5HHNB 3QDMA 4ZAKD 3T0AA 4L3AA 3IFLL 3WV0A 5BQ7A 4Y4FA 5EH1A 3UZVB 2BY1A 2Z4QA 3CFIC 4TYUA 2OR9L 4ELME 3FQWB 1VACB 1LP9F 2ZWLT 3P40A 2AJUH 1Q9OA 4F9PA 4CVUA 3I3EA 4AQOA 4X4YB 4ZFZB 1NCWH 1RUKL 2PYEB 2V6HA 3U4BH 3FOLA 3LVEA 3V8CA 2Q8BL 4U6YA 3HAEA 4OQTH 1S9YA 1IQDA 3W0WD 4JFEB 3V4PL 3DYMA 1NCUA 5F7UA 4LBEB 3BRFA 1O0VA 1YEDA 1LVEA 1MPAL 3UZEA 2AJYL 1J12A 3VG9C 5IVNA 4MQ7B 1RZIB 4Z77B 2ICWB 5K59E 4QCIA 3WXVH 1V7MH 1JWMA 4UINH 3OKDA 1TTUA 2NY7H 1MAML 3BW9B 5T1DH 2DD8H 1A7OH 4M5ZH 4AH2A 4APQD 4D9RD 2Y7QB 1M7IA 5DD0L 1TCRB 2Y5TA 4L4TD 4WO4C 4ODTH 3KWWB 4MQXC 1D9KD 5GRVL 3O2DA 2DIJA 4KMQA 4BKLB 4BQ9A 1HH9A 3V4VL 2ZUWA 2D7PA 3UC0H 1BAFL 3MC0A 5CEZD 3FFCD 5DHYA 1ZLSH 1QYGL 2NW3A 3L1OH 3JWOL 4PBVC 1R3JB 1JPGA 5FYJH 4PRNB 1QG3A 4XNUL 2UUDH 2FX7H 3G6JB 3GNML 4KKCD 5E9DA 4LRNH 3THML 2HTKC 3CLEH 5DFVC 4LVOB 1KN2L 1RUAL 3KAAA 5L0QB 3O6LH 3MOAH 4W6WB 1DN0B 1LEKA 4KJYA 2DJSA 1W72H 4UT9H 1H0DA 1WBYB 1A7NH 1HIMH 1MFDL 3HA0A 2Y6SD 5KJRH 3QJHB 2J4WL 5D1ZC 2BSRA 1U8PB 1OAYL 3RWGB 2VZUA 4PGZA 1QACA 5EO0A 3E3QE 4BZ2H 3B5HA 3MXVL 2LU3A 1CBVH 4A6YA 4PJ9A 4X9BA 3J8F7 2EEBA 3NIGF 5AEAA 2NQCA 2P24B 1T80A 4RX4A 5J9PB 4I3SL 4I9WE 5B22A 1KTLB 3VFGH 1KB5L 4QHLB 4JM4H 4CBPA 1P7KB 2DQTH 3O2VL 1RULL 4WENB 5HTSA 3CPLA 4PGDB 2J8UB 4N9OB 2BMKA 3QA3B 1NGXA 1PSKL 4C59B 5CZVH 4DN4L 2BVPA 3FO9B 4PRAB 3OKLA 1S5IL 5L2KA 1QFHA 2DMBA 2XPGA 1N2RA 5JDSA 2GKIA 4I4WA 4YHYC 5BZDA 1I1FA 3VFPA 2Z31B 4ZS6D 3TA3C 3GIVA 1DDHA 5JUEH 1MF2H 3H9SE 3HCVA 2XZZA 3VXRE 1IC4H 1G9NC 3H6JA 1JNHB 3KYNB 2ED7A 4LCWE 1I9EA 3D18B 5AYQA 2WANA 5E00B 3C6LC 5I1GH 4EUPB 1IC5H 4FXLA 2FO1A 1U3YA 1BX2B 1MAJA 3ARRA 1ONQA 2XWTA 4KTYA 4WWKA 1T22B 2HJKB 4OLZH 4OSUL 3SGEH 5E2UL 4DFHA 1MCOL 3F58H 4FTVB 8FABB 4QRQA 2R4RL 2FHFA 4HJJL 5JORB 1A7PH 5CMAB 5KG9A 3WSQL 1XIWB 2EIBA 4I48B 1DFBH 2OJEB 3VXQB 5C0DB 1RU9H 5F7FA 3IJHA 3ARBC 4YXLL 2VDPH 4X9GA 4NBZB 3NCJL 4ZUWB 5F44A 4DJMA 3SJVA 4W70A 4QY8B 1ETZA 4AM0A 3JV6B 3GJFB 4U1NB 2C26A 3QUYB 4HGWB 4KKBC 1HDMA 1G9NH 4N8PA 1QR4A 1EVTC 2YPKB 1M4KA 3OF6A 3EO1B 2ITCA 1T83A 2WUCH 4KJQD 2JJUA 5DK0B 1H3TA 1IAKB 4LHUA 15C8H 3MCLH 4F7PA 4N8VB 3CDCA 3BPCB 1KPRB 5FB8B 4U1JA 2BZDA 1NGYB 1ZEAL 5CILL 3VXSE 4MJID 2PUQT 1UZ6F 4HIEB 3MBEB 3E8UH 3MV8A 1DQMH 1L0YA 3WFZA 5E8PA 2X70B 3CFBA 4G9FE 4OLVH 4NUJA 4F33B 2J7LA 3MRJA 4IMLA 4CNIB 2OK0L 4F57L 1INDL 3OZ9H 1DQLL 5EULV 1XGRA 2Q8AL 5SV4A 4CN6A 2ZCLH 4MCZA 5I73C 2EDRA 2AXJA 1MI5D 4OI7A 1D6EB 2WW8A 5HYIA 3VE0A 1T2XA 5ENWA 4LNRB 1F97A 3MFFB 4WTWA 4Z18A 4RFEB 5C0AE 4Y4KA 1HYSD 2QQNL 1OSZB 5F1KC 2OR8A 1M1SA 4PRHA 4NQVA 4F58L 4UQ2A 2VWEC 4LIQH 3KXFB 2R2HB 5T1LB 4JFOB 3K2UH 5KVGL 3BQUC 4U1KB 5C3TA 4LP5A 1CXEA 1N0XH 4M62L 4Z7UA 5DEZA 1ZE3C 2VN7A 5GS0L 4AEEA 3NVQA 1P4IL 1TJIH 2RJMA 3MRDB 4ONHA 4Y2OA 4JCLA 2VLJA 5FYJE 2DLFH 3QWOB 3LKNB 3IETA 5C0CE 2EECA 1IVLA 2HLFD 3KYOB 3FB5A 3V0WL 5KW9H 3P77B 5MHSD 5T3XH 1AGEB 1X5FA 3SE4C 4YDVA 3IDXL 3RTQB 3SGDH 4P9HL 4Y16A 2FLRT 4HS3B 4L8CA 5HDLA 3WS3B 2W60B 5E56A 3BOVA 4GXVH 3T2OA 4HLZH 1NUDA 3GJEA 3IDNA 1OAKL 1FZOA 1BFSA 4WEBH 5HVGB 5DTFB 5BJTA 2C7UA 3TZVA 1X5HA 1T2JA 3CZFA 4M4PA 3OKEB 4KHTL 4I13B 1MCCA 4IDJL 1PZ5A 4KTDL 1KIQA 2MSPA 3KYAA 5CUSL 5I1JL 4NN6B 4C55A 1YECH 2VAAB 1CZ8H 1DN2A 3K0WA 3PDOA 4J3TA 2R15A 3MLZH 2NR6D 1BJ1J 3DMMC 2ENSA 3W9DA 5DXWA 1U6AL 4POYA 3I6KB 3BT2L 3WFEH 3RHWK 3C5SA 2MHAA 2VXTH 3H3PL 2AJZB 3CX5K 4RGND 2AJVL 5I71C 1GJIA 1YYML 4KRPD 4BSJA 2JJSA 3N1MC 4U6VL 3D2UB 2KBGA 4FABL 4MNGA 3RAJH 4OCSH 1MQKL 1HSAB 4OZFG 4QXUH 4X0KA 1C5CH 4GBXA 2KL6A 2YD3A 1OQOA 5MEND 2EDEA 2VYRE 1CICA 1BFOA 4MA1C 1IGTA 1NLBL 4KY1L 5HDQL 3VW3H 1D3CA 5FF6A 5E08L 4PJAA 5HDOA 2H6PB 3NTCH 1UKTA 4QRUB 2CIKB 1NSNL 1QHOA 3GSNH 1S9VB 5ICZA 4HV8A 4LQFL 5DJ8B 1N7MH 3FHAA 4ELKA 4QOKD 2CRIA 1J0ZA 4OT1L 5EU5B 3ZL4H 1JBJA 4X4XB 5JNYB 5IP4A 3T3PE 4NKQB 2AV1A 3PWLB 1JPTL 5B8CA 3RX5A 2R39A 2YK1H 1RHHA 3DUHA 4ODHH 1GGBL 1D5XA 1QA9A 1F3JB 1RUQL 1EH9A 1XR8B 1WV7T 4P2RD 4O2EB 4XXCC 4OZHE 1QRNA 4RNRB 1YEGH 5DFTA 1FH5H 4H8WC 3LV3B 1UXWB 4L3EE 2GJJA 4QXWA 3W39A 3KPNB 2BC4A 2D2OA 1I1YB 3S35H 5D7LD 3RRQA 4K23L 3I85A 3G04B 3ZZ1A 3QG6B 3QQ4A 3U0WH 1PZUB 1Z9LA 4KRNA 2XACC 2XWJB 3JTTA 4M7ZB 1LO5B 3B6SB 3DNKA 3VFOB 3EDDA 4NJAH 4Z7VA 2Q76A 4BH8B 4EDXB 2EYTB 3RL2B 4N0FA 4NOBA 2W1NA 5ANME 2VITA 4UAOB 4JB9H 3UJJH 2IMNA 3BPOB 1IKFL 4Y2DD 4FRWA 1Y0LB 4HFWA 2Y25A 1KJMB 1KJVB 3QIUD 2D7MA 3QEUB 4GO6B 3W81A 1KJ2H 3REWB 4H8WH 5C0BE 4PREA 4YHNA 2ADFH 4RZCB 3VXPB 4NQXB 1CVSC 2DIBA 1AO7E 3KPPB 2XI9A 1K9TA 5JXAH 3WJLC 4RIRB 3SPVA 2FHCA 3GBLA 3RGVB 1T2QH 2D4FA 4QRRD 3H9SB 2JB6A 3NCYS 3NIDF 5KOMC 1SEQL 3QDGE 4LIQE 1IRAY 3NFSH 4LCWB 3O6FC 1ES0B 2VXVL 1HHGA 5F7YC 3D39B 2E9IA 4P46B 3MXWL 1ZS8B 2X1XR 2NXZC 5KVFH 1WFNA 5HHOB 4K2UL 4R2GD 4RFOH 2ADIA 2Z92A 3K8MA 2A9NH 2VLRD 4NUGH 3SKNB 1KNOA 1J8HD 1S7UA 2Y72A 4OCXL 1HXYA 4M7LL 4GJTB 2V7NB 3P4OB 5AG8A 2VL5A 3CXHJ 3CSYB 5FFLA 3M17A 3D0VB 4RCAA 3FZUC 3LEYL 4J4PD 4M7JL 4WU7A 1CD8A 1BBDH 2X40A 2GT9B 1FL6A 4H1LH 4G6ML 4PJXA 4LSTL 3EFFB 2LTQC 3ROOB 1UFUA 2VWEE 1O5DT 4F80A 3MZTA 3ABZA 2Y5EA 2W65A 5J12C 3C2AH 4HCRA 2FD6L 3SO3B 2CIIB 1QKZH 5EBLA 3VXSB 3HRZB 3I50L 4ZDHB 1ZLWH 4R96B 3TC9A 5A1AA 4G8FA 2GCYA 3O41A 3T04D 5GZOC 2QQLL 1WZKA 4PGBA 4LCCB 5HVWA 3N9GL 3OQ3B 4NKDA 3U4EA 4DVRH 1I1AC 2WBJB 2XZAL 3LKOA 4LSSL 4C56A 5F88A 2DTMH 4NQEE 4G8IA 4ZD3H 3D69A 1JGEA 4R7DA 3U46A 3VH8G 5C0RL 1IGIH 5F9WC 4M93C 1C12A 1WAAE 1YN7B 3MUJA 5T1KB 5DJXA 2VDKL 3LQAH 2VLKD 1S7QB 3WO4C 1MFEH 4ZO7A 2GSGB 5F93C 5C0AB 1EFXD 1CXKA 2ERJC 1J87A 2DYPB 2OL3B 4F7CB 4P3CL 1MJ8H 3VGEA 5IG7A 1AHWC 1TQCC 4YDKH 2BNQA 1U8KB 4YBHA 1XCTA 1A6TA 1QBMH 1F8TH 1MRCH 2CKBH 3QI9C 2ARJQ 3MRIA 5D1XC 5IB3A 3CVHH 2R2CA 4L4VE 3MACL 1KACB 3DX9A 3VG9B 2Y4SA 4YZFF 1ND0A 4PJCA 2ATKA 1FRGH 3WIHL 2HJLA 2CRMA 1GAFL 3WFDL 1GGTA 4HZLA 5D8JL 3SDXA 3QPQD 4Q6IA 1ULVA 1P5UA 2APXA 3KJ6L 1G6RL 4ZFGL 4YHLL 5H2BB 3GI8L 5BVJA 2YR3A 1DQJB 3M8OL 3S88L 1FV1A 4APQC 5KZCD 1A4JA 1DANU 1U8IA 2P5WA 3K2MC 1ZHNB 3DETD 1MIEH 5FCUH 5AZEL 1D9KC 5TDNB 4KMTH 5D9SA 5KN5B 4R0LA 3VFMA 1A1MA 3MLVH 5D7SL 1TPXC 2HN7A 2XA8L 5F3BA 3OXRB 1T5XB 1Y18A 1EVUA 1RAMA 4NJ9L 2Y36L 3A67H 3U6RB 4PJFA 5TE4L 3RIAF 3UROR 5F9OL 2YBRB 1SJEB 5ALCL 3QR2A 1QHPA 3DVNB 1AD0B 1SVCP 4H0IA 4FXKA 3RWCA 3UO1L 1WBZA 3L7FA 2ICES 4PJ7E 3DV4B 3DV6B 5BMFL 2W0LA 5TPWL 1MHHB 4R90L 4LLDB 5EOTA 5EZJA 4OZIF 2C4FT 3LKPA 3NZHL 5FYJU 1SQ2N 1EEYA 2AEQH 1I7UB 2YZ1A 3FTGA 3NACH 2UWEF 1L6ZA 5FM5O 1WITA 4JY5L 1S7TB 1K2DA 2H32B 1G9EA 4LHQB 4F37F 1M71A 2EXYC 4PJHA 2CLZB 2AK1L 4BSWA 3O9WC 4JQIL 4FQXB 2YXMA 3RWHB 2G75B 1YZZA 5BOPA 1T7WA 1JV5A 3KDMA 4DKEH 2IPTH 3BJ91 4EI5D 4XX1G 3ECBA 1Y6NR 1NQBA 3B2UC 5TJWK 1SY6L 3UTTE 1XAUA 4JN1L 3F8UB 3C5ZB 4PRPB 1YN6B 1F58L 1MLBB 4LU5L 1AD9B 2J6EH 2YD9A 4JGJA 1D5IH 1ZHLA 2WZPD 4BQ8A 4LLYB 4HIHA 1BVLB 2A6JA 3DOSA 1EIBA 5IFHH 1H15A 3BMVA 4E0RA 2J8HA 1A5FH 2EYRA 4LPVA 2R0LH 4HC1A 4NKOB 4KI5D 1TIUA 3QFDA 3GBML 1CD1A 2E6JA 2ESVE 4P3DB 1VADB 3C6LB 4XCCL 5CJOL 4OJFH 4JLRB 4QRTB 1SBSH 5C2BH 5C0FB 1FYTA 1T1YB 3KS0J 4DZBA 3MV9A 5F7DB 5KAQG 4QEGA 3O3AB 2EE9A 3TO4A 4IRJB 4JKMA 1DBJH 3NH7L 1T7ZA 3NIFE 4M6AA 5JHDE 1OAZH 5EB9A 4NGHL 4KJPD 2A73B 3P0YL 3EIFA 2BVQA 5AUMB 5DJZB 1CG9B 1XGUB 4KUCD 5C07B 3VWKD 1QP1A 1KCVL 4MXWH 3SKUD 5CJBA 3BEVB 1IC1A 5I8OL 5IEKB 1ZWIA 5C0BB 3SCMA 3SQOL 3HG1D 4H20L 2YRZA 5KSBF 5C0JA 4XVUD 1AO7B 4NKIH 5JIIA 1S8DA 4KI5F 4OD3L 1MFBH 4TQEH 1VFUA 4MA7L 2XOTA 5DEFB 2EDLA 2DLIA 3KPMA 4Z5RA 3MA9H 3QDJB 4JDVA 5CINH 4LSQL 1RIUL 3QDGB 5HDBF 2VDQH 2V2XA 3HMXL 1HOCA 5DK2B 4GQ9L 4XWOC 5FIEA 1U8HB 1A9BB 4KK9C 1LP9E 4S0TD 3G6AA 5DI8A 1WIPA 4JKLA 2YPLD 4ETYA 1Y6KR 2D0FA 4JAMB 2F53A 2FZ3B 2BVYA 4KUCF 4M8QA 5SWZD 3Q0HA 1V3KA 4YDIH 1NDMB 2CR3A 3D1MC 4RMVA 4U1IA 2FR4B 3TBTB 5DRXA 3I9GH 1RJCA 5I73B 3QYCA 2H45A 3IRZA 4NHUA 5E7FA 4NQCE 1BQLH 4QHNA 3D9AL 4N0UA 4CMHC 2E9WA 2Y1VA 3GHBL 5HYSB 2Q20A 43C9A 4IOSD 3GSRA 3HPJA 4UDUA 4ELMA 1FHGA 3LQZA 3ARFA 3R06B 4M3KB 1MY7A 2Q86B 2XKNA 1YUHA 3V5KB 3K8LA 3PWUA 1CLZH 3O6KL 1EXUA 3BQUB 2IPKB 1HCFX 4KDWA 3IDGA 1EGJA 5D7JA 2X4TB 4HD9A 1JYWA 5EORL 2VMFA 3ARSA 4NM4L 5I2IB 4KZEH 2V9RA 4AYFA 1V8HA 4ZTOH 4G6KL 5JOFB 1NKRA 3BKMH 2MQ0A 4M1DL 3DUUA 4TVPL 5GPRA 2I9LA 2JB5L 5HI4D 3TJEL 2G9HA 5IW1A 3ISWA 4KXZH 3E6HA 3IFOB 4PR5B 6FABL 4LARL 2HLFC 4HT1L 3V5HB 1X5LA 1CXLA 3ARDC 4P5MA 4Y1AD 4B50A 1YC8A 1IEAA 5JW4R 1I8MB 5JMOC 1JVKA 4DGYL 5ECJE 2P8LA 3C60C 5SX4I 1BJ1H 4XRCA 3GUTA 4EN3A 2BXZA 3OGCB 4ZG1A 2B4CC 5FUOL 1MREH 2FX8H 3MCKB 2YOCA 4U6XB 4YXKH 4XHQA 4RDQG 3LEVH 3MRMA 5EU7C 2OCFD 3ZTNL 2G2RB 1EAPA 4K9EC 1AXSB 1NH6A 4GG6F 4HJGB 2AXFB 4GRLA 4JG1H 3DMMB 3RZWA 4DFIA 3FFCE 3N0PB 3MUZ1 4IIQA 5CEZE 5D6CB 2X7LA 2OP4L 2VABB 4XCEA 5D5MA 3S37H 4AJ0A 2NR6C 5E99H 4XP1L 2IBGA 3NIGE 5I71B 4NO0A 5ID0A 3MROB 1S3KL 1LO0H 4RGNC 4UILL 1BBJB 5GSRA 5GS2D 3F12A 3QNXB 5I9QB 3FONA 1A3RL 4LLQB 1OAQH 1QD0A 3MRQB 3Q5OA 1BZ9A 4PGJA 1N6QH 3AS3A 4L8BA 5HHXH 3IDMB 3GSXB 4PRBA 1CFBA 1TZGH 3RNQB 3JWDC 2VXSL 4LVNB 4W68A 3X11A 4K9EH 2A6IB 3ZE2F 4JFFA 3G6DL 1Q0YL 1TNMA 4QRPB 1FVEB 1HNGA 3U0PB 3GMOA 3P73B 4DVBA 4C57C 1CL7H 2BSED 5FKPA 2OLDA 3QDMD 2R1WA 1E6OH 1T20B 1T0PB 2QQKL 4Y4FD 3KPRB 5H94A 3U36B 4WRLA 4J3XA 3JUYA 2LVEA 1FJ1B 3BP4B 4WV1A 2CMRL 3TPUB 5A16A 3PGDA 3QP3A 4K3DH 1KLFA 4QYOB 3KYKH 4JR9L 4QXTB 4HQQH 3GRWL 2DM3A 1UENA 3VXRA 3PV6A 5F1IA 3JWDH 3T2NL 3VGAB 3CLFH 1ZGLB 3TFKC 3ARWA 4MA8H 1OLZA 4LNVA 5DEGA 2HFFB 1R3IH 2HWZL 2NZ9D 4MAUH 5L2JA 2E5EA 43CAA 5HY9B 2H8PA 3BZDA 3G5ZB 4GS7C 4XBEL 4L1HA 1V5JA 5I76B 4EUPG 2NY0C 1AGDA 4NZRL 5JQHC 3WN5A 3QO0A 5JW4M 4YDJB 1UZ6E 1OM3L 1FG9C 3BZEA 3CD4A 4PJ8A 5FA3B 5BZWB 5GGSY 3GO1L 2R69H 3PABA 4MMXC 5DURD 1ZGLM 5ALBH 3U7YL 2DQDH 4Y2DC 1U8MA 2MPAL 3QZWB 4EDWL 5HI3D 2APTA 3PWNA 3SOBL 2M26A 4FS0A 3QIUC 2CLRB 4HULB 4ZO8A 2WWKO 3IU4L 1YMMA 3VWJC 1YYLH 4WCYH 1SYVA 4NYLA 4HKJB 1WZ1L 4GW1A 1LE9A 2LU7A 3QUKB 5IROA 3QXWA 5E9DD 4OCRH 2AJXL 4NQTA 1PQZA 3BPLC 3RIFF 1E6JH 5ACLA 4UU9A 4KTEL 5D1QA 1UH3A 2ESVB 3M1BA 4N8VG 4GRMB 1M6OA 1OGTA 3VMPA 1ZHKA 2X9WA 3OPZL 5TDOB 4G9FA 2E7CA 4MJIE 4DW2L 3MQIA 4OQTA 2WWMD 4O9HH 3V8OA 1KPVB 4POZC 4NPYA 1GHFL 4OLXL 3RJDA 2B39A 1GRWA 4ZNEE 3V6OE 4R2GC 3QUMB 2VE6B 4YX2L 1FN4A 1A6PA 4KJWD 4HBCL 3BI9X 2D4DA 3FCTB 3VG0L 4EKXA 5DMKB 2F58L 1TJGH 3ZE1F 2YC1B 4WJ5A 2B5IB 3WKMH 1DUZB 1Q38A 3LKQB 3FRUB 5I15L 4RAVB 4UNVA 1MI5E 3DI3B 4PJ9D 1JPSL 4LLWA 3WO3B 4PJBA 1IM9B 4ZO6A 2LTQB 4J4PC 1FSKC 1MLCA 1NGPL 4RX4D 5GHWL 5HGHB 4NNYB 5B4MD 5J12B 4MD4A 1Q72L 2HKFH 3D25B 3STLA 4YIQB 1MCRA 3AFLA 4RGOL 4X5XB 3BD4A 4HWZA 3V6FB 4WHYH 3ULUL 5SX5H 4K8RD 5L8JB 4K7PL 1LP9B 4MZ3A 5JOPD 4OBSA 3IVKB 1U8LB 1BQHB 3U9UB 4WTXA 5L2KD 1W0VB 5H37H 5C0CA 4AMKH 1U8OA 1LDPH 1MWAB 4HKBB 1RHFA 2F5BH 1DBBH 1Q9KB 4S10A 4U0RC 1UA6H 3L3KA 1CGSH 1XF3B 2AW2A 2GJ6E 2EC9T 4EVNA 1W72A 1U8QA 4JRWA 3PWVA 4M1GH 4QXGL 4J1UA 5F9WB 4IOIA 3WCYA 1WWWX 2EE6A 1QBLH 4XAWL 3LB6C 2P8PA 4ALAL 4WO4A 3EGSA 3WHE0 4MAYB 5I1LA 1RUPL 1IGJA 5KS9A 3F62A 3MRGB 4WWKD 1QLEH 4FQ1H 3TPKA 2ORBL 4WDIA 2ERJB 2ZJSL 5MERA 4NZTH 4ZAKB 1B4JH 2NYYD 4Y5VC 4Q9RH 2ICEA 1KPUB 5EU7E 4YLQT 1U8JB 1QZ1A 4OGZA 1AHWB 1AFVH 4R4BB 4LFHD 5C8JB 1FZMB 4FQPA 4WW2A 1T3FA 3IKCB 3L3HB 3OTTA 4O5LH 3MUGB 5GJSL 3U1SH 4YH6A 1XT5A 3TCLA 3DX6B 3SJVD 1IJ9A 3BZFB 1T03H 3MRBA 1IGFH 3S4SA 3WXWL 2WV3A 1F45A 5J13C 1ORQA 4O58H 3QXTA 5LBSL 3OF6D 5EU6E 5GRWA 5B21A 5ICYB 2DTSA 3W0WB 4G7YL 4LHUD 3H3KA 4RGNE 1WFUA 4GKZB 4ISVB 4F7MB 4HIJA 1I85A 5IW3A 1EO8H 4K94L 5D1ZA 1S7SB 5HHPA 1L7TH 2GTWA 3KG5A 3AREB 1JFQH 3MV8D 4ZFFA 1UXSB 2OTUA 4LCUB 2QHRH 3FO2A 1MSPA 3FMGL 5ERWB 4CN1A 5MENE 4RISL 3N85L 4APQB 2J5LC 1TVBA 4DOHB 1KBGL 1RFDL 4L4TB 1I3VA 3SDAA 3IU3A 3BXNB 4LLVA 5DJ0A 3WBDA 2AJ3A 5DRZA 5IFAL 1D9KB 3QCVH 4GKNB 4Y5YB 5GRUL 3SKOA 5B38B 5F71A 3HZMB 5DLMH 3MJ8A 1FE8H 1OCWH 2C3HA 2V2WB 1V7NH 4HAFA 4YC2B 2D03L 4GAJH 2B2XL 3FFCB 1P6AB 2DKMA 5F3HB 4QOKE 2P45B 1CIDA 4JPKH 1HXMA 4X6CB 5CS7A 4BYHA 4X7TB 1T6VN 4Y4KD 4XC1H 5CLTA 1NC2A 5D6DC 4PRHD 1NANI 4L9DA 2HRPH 1HEZB 3IYLW 2DQIH 3BYTA 4OZHA 4LSVH 4O51A 2PXYC 3PNWB 4XNMA 3BZ4B 4L3EA 3RWFB 1HINL 3TA3A 3LZFH 2B1AL 3S37X 2NW2B 4KI1A 3AY4A 4P2RE 4M43L 2CLVB 2O5XL 3FFDA 2EDBA 5CSBA 1INQB 2VLJD 3H7BA 5ITFB 4YGVA 3C8HA 2DQHL 1KJ3H 3O3DB 4CKVX 1KELL 5D7LE 4BFBD 2PW1B 4F7EA 4I5BA 3ZE0F 3NIDE 4XBPB 1MJ7L 4Y16D 5I18H 2GITA 5CEYB 4OIIL 4O02H 5ANMA 4PLKC 1RK0A 3ARQA 5I1CL 1HWGB