4LLYA

Crystal structure of pertuzumab clambda fab with variable and constant domain redesigns (vrd2 and crd2) at 1.6a
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
220
structure length
220
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFTDYTMDWVRKAPGKGLEWVADVNPNSGGSIYNQEFKGRFTLSVDRSKNTLYLQMNSLRAEDTAVYYCARNLGPSFYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVATGPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords mutated Pertuzumab Fab heavy chain
publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 220
sequence length 220
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llyA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llyA01
4YFDB 3U1SH 1IKNC 1D5IL 4K3EH 3QJHB 3KYMA 3H0TA 3O45A 4JG1H 5JOFA 3MBEB 3T8XB 1IQWL 4GSDH 3ZKXC 2ICWI 3BKCL 3IU3A 5ALBH 1ADQH 1P7QD 3KPRA 4QHNB 3SDDD 2ZCKH 2R0KH 3LCYA 4KUZH 3FQWB 4LFHG 3RQ3A 3NCYS 5C09D 1KENL 3RDTD 3OXRB 5HVHC 3IF1B 1Q8MA 1WIUA 4MCYA 1AFVL 3V2AR 4F8QA 1YPZF 4B7IA 4OI9A 4I4WA 1GXEA 5IUSA 3P4OB 5D7JA 1OWRM 3S3JA 5DVLA 4HK3N 1S9VB 4QEGA 3KLSA 3BVNA 3TBVB 3BN9C 4WFEE 5DEZA 3CDCA 5D9SB 1N6QL 5L2KB 2CR6A 2QHRL 2XWJA 4G6JL 2DTML 4IMLB 4KUCF 4XVUC 4E5XA 4MVBC 2FEEL 4AENA 4ZAKA 3IDUA 4IOIB 4H1LA 3HC4H 3LIZH 3CFJA 2BOCB 3BQUB 3OAUH 1JPGA 4OZGB 3VGHA 1HKLL 2UVEA 4HEME 3E0GA 1G0DA 5E6IC 1UWEH 1KELL 3K1DA 5IMKA 4S2SA 3T3PE 4PP1D 1G7HB 4OBRA 4S1DC 4I3RH 3CFKA 3C60D 3KPSB 5CEYA 1JNJA 1CICD 5L2KE 2ESVA 4H5SB 2AV7A 2VZVA 3ELAT 3QQ3A 2G2RB 4F7EB 4NZDA 4FA8A 1LP9F 5GZNC 3T04D 2GTWB 5CZKA 2H3NA 4FZ8L 1EPFA 3FQRA 2D0HA 4U6VL 5CKAA 4GRLA 5FM4A 3QPXL 3EYUH 4KPHH 2HT4C 4GS7B 3V7MA 4HW6A 4RISL 2ARJA 4K3DL 4U6HA 1HH6A 2FJFA 3NGBB 2CK0L 1PZUB 3BP4A 5HYEA 1I4FA 3H9HA 1ZT1A 3O3BB 3AM8A 5FCUL 1S7UB 3C09C 1WZ1H 3EYSL 5D1QA 3VRLF 2YD6A 4MNQD 1FVDA 5JLZA 4LRNH 1QRNB 3TYFB 1A4JB 3C6LA 5EZJA 4JB9H 3OBAA 5CMAA 3QHFL 1A6UH 1DL7L 1T5XB 2W9DL 3AB0C 5HGAB 5C0JA 2E6PA 4XNZB 4APQC 4YBHA 4OD2B 1CGSH 1NBQA 4L4VA 2FBOJ 4HDIA 1DQLH 5JDSA 1K4CB 3T1WA 2X89D 1YYLH 4CMHB 4YHML 3ZHLA 5D1XD 2AW2A 2AV1A 3D39E 1FNEA 1G1CA 3VXMB 4CBPA 5EIIB 4ZXBC 2EXYD 5C1MB 1ORQB 1X5GA 4XTRC 1MHCA 4H0GA 4CVWA 4YDVA 4NNPH 5FO9A 3ZE0E 1EGJH 5TFSH 5ID0A 1HEZA 2UWEE 4ZFGL 2GJJA 1HZHL 4WFGE 5IEHA 1A4KA 2Q86A 3PWLA 1A14L 4XC3H 1S3KL 43CAB 5JR1L 3MOBH 4ZSOA 3MSPA 4WFFD 1AKJA 4R2GD 3I6LE 3QDMA 1R3LB 2VLKE 3SBWC 4GOSA 1NBYB 2FX7L 4HIIB 5SWSA 5D6DA 4GG8A 3RU8H 3ZL4L 3EOTH 1C1EH 3HNSL 4LGPB 3LS5L 4PLOB 3BT2H 2D9QB 2BVPB 5CGTA 1I8IB 1FZMA 2HT3C 4Y4KD 5EO1A 3HCVA 1GSMA 2E5EA 4HS6B 4PRPA 3B5GA 3IVKB 3D6GA 1IEHA 2M1KA 1AR2A 5C0CA 1VFBB 1F4HA 1ZVSA 4MWFB 4RGOL 4X4MA 1Z5LB 1PZ5A 2BSRB 1U3HA 1A3RL 4UT9H 4LF3A 4KROC 1MREL 5KS9B 4JLRA 3TJEH 2CH8A 3HB3C 3VI3F 3IJYA 5T33H 1DVFB 3TBYB 3HC3H 5FYJD 3STBA 2FLBT 1D6EA 2J88H 2VZSA 1MFBH 2HP4A 3U0PB 2R0LH 3E6FB 4OZ4A 1LK2A 3O3EB 4X7TB 1NSNH 5DQDL 1CFNB 1W72L 4M4PA 2BSTB 3KDMA 1NC2A 4KJQC 5DRZA 1R6VA 3CPLA 3V5DA 1GL4B 2W9EH 4PY7A 5GS1C 1UXSB 3LQMA 2ICWB 5HD8C 4HSQA 3MJ8B 1JTOA 4LMQI 1P1ZB 3IFNL 2X7LB 4RFOH 4KZEL 3DV6B 2CDFB 1A3QA 4LLWA 4QOKD 4P2RA 3I6GA 2FH6A 4RDQF 3Q3GA 1G9MC 1HHJA 2AGJH 3U30B 1HSBB 5E8OA 2WBJC 5ALCH 5B22A 1N7MH 1HQ4A 1CG9A 5E2UH 4RNRA 5SX4I 5F7DA 4P57B 1CDYA 1U92B 1R3JA 5F8RC 2YHGA 5FKAA 3JWDL 5KVEH 3IU4H 3UZVB 3TO4C 3MLUL 4YK4C 4Y2OA 1P69B 3MJ6A 3VFMA 2OZ4A 4IRJC 1ZXQA 1X5YA 3FRPA 3ARDB 3WFBH 4U0RC 4RMVA 4YE4L 5D5ME 1QSFE 3MROB 2BC4B 3FO0H 1ACYL 4NQDD 4U31A 4D9LL 5D4QA 2EIZA 1CLOL 4OFVA 2VLMD 3REVB 1FHGA 2J4WH 3E8UH 2FH8A 1FLRH 4H88H 4JM4L 1AO7E 1I7UA 1H3XA 3KHQA 1MFDL 4ODVL 1JZ2A 4K55A 4GKZB 3RY6A 1K3IA 1BJMA 3V0AC 5JW3H 3G08B 4NUGL 4FQCL 1MIML 1VHPA 4Y19B 3I2CL 3T8XA 4JRYE 3DUSB 3M17B 1UM6H 1DLFH 1I3RB 3QWOA 1S7SB 4Q97A 2FO4A 4K94L 4MQSB 3UTTE 4QRSA 1NKRA 3FQWA 4XGZA 1M6OA 3ULSB 1QD0A 4L8SA 1DFBH 4YZFE 2I25N 4KKLC 2R1WB 3W0WD 2ZSWA 1KEMH 4YHLL 3L3HB 5DHVH 4L8BA 4PRDA 4V1DE 4N9GB 1JNHA 3BPLB 2DJ4A 4PJ5D 4IJ3C 3NFNA 3P4MB 2GW5A 2ITDA 4HC1H 3TNMB 2K3TA 1S9VA 1HWHB 1S78C 4TUJA 4FQLH 5J11B 3LPFA 4OZHE 4WTWA 1KF9B 1NBZA 3VXNA 1JNNH 1KJ2L 5K9QG 1W0VB 3S37H 4EQ3A 5B38G 1QBLH 4IMLA 3PWVA 4PGEB 1YY9D 4UTBH 1NEUA 4OAWB 4UNUA 5FUZH 1Y6NR 4Y16C 5D7IA 2XKSA 1DQMH 3FHQA 4IOIA 1SVCP 1FLTX 1GC1L 5JPMB 5DURD 5KBNC 4PRHA 3SE3A 4JPIA 4QCIA 3LKPB 5D8JL 4PJEB 1G6RL 3BYTA 1J1OL 1A9EB 4Y7MA 3KPSA 1Q0XH 1RUKH 4OUUB 4U1GC 1MJUH 1G6VK 3O2DL 4H5SA 2G2RA 1MHPL 4YX2H 4P2OC 4R9HA 2UVFA 1KJVB 2GTWA 3BN3B 1R3KB 3EO9L 4DN3L 5J12B 5HI5D 4HWZB 3WFCH 2FJGB 2XQYG 5TE6H 1NCCH 2EYSA 1FFPB 2SEBB 1FZKB 3ZTJH 2ZSVB 2PNDA 1S7UA 1OPGL 3LKQB 4YQXL 3BRGC 3NCYP 3RVUD 4HIXH 1YEEL 4HUUA 4BQ6A 3H7BA 5IB4B 1KFAL 3G5VB 4M7ZC 4XPGL 4RWYL 1QRNA 3TYFA 1A4JA 4LCWE 2BOBA 3OB0H 3BZ4B 1P5UA 4JFEA 2VC2L 1HH9B 3QDJD 3IETA 3NN8B 4YDIL 5HGAA 1PKQA 3DVNB 1EXUB 3DVGB 4XNUH 5FGSA 1UQSB 1FBIH 3PP4H 3IYLW 5I1IL 4FMFA 1P84K 5ISZD 3VXMA 5KSAA 5FUCC 5DMYA 3VRJA 1HSAA 5EIIA 4JG1L 1T3FA 4OZIB 4GSDL 5ALBL 1ADQL 5C0GB 3EOBA 2R0KL 4DGVL 1T0NB 4OGYH 5EN2B 1RJCA 4PRIE 5F3BB 2CIKB 1AQDA 4KFZC 4ZTPH 2EYRB 4TRPL 4N8CL 43CAA 4L4TD 1YQVL 3P0YH 4PD4K 4WI7A 4PR5B 5JPNB 1QKZL 2V5SA 1J86A 4XP1H 1LHZA 3OJDB 2IQ9H 4NO5A 1UFUA 5M95B 4HPOL 4NJAL 2F8XC 4XC1H 2BVPA 3LVEA 4OCRL 4QRRD 1BEYH 3ARWA 5FYJU 4HS8H 3MLRH 3KPOB 5M94B 4YHYC 2ORBH 4M5ZH 4PB9H 3BPOB 1MAML 3CK0H 3IVKA 3WJLA 3RVWD 3DVIA 5JHDB 2APWA 4WI6A 3UAJC 5AWNL 5CBEB 5HDBF 1VFBA 4HULB 1YMMB 3QPQC 4H8WC 1AIFA 5GJTH 3B3IB 4K07A 5JW4M 1Z5LA 3OGCB 2BSRA 2VR4A 3OAUL 3GI9H 2DI9A 2IBZX 4FQIL 5SWQA 4MDIA 5KVMC 4EN3D 4X6FA 1DR9A 1IQDA 2V9TA 1CR9L 4I3RL 2V6HA 5FDYA 1TNMA 2Q8AH 3EJYD 1KCVL 1X7QB 3VG9B 2ADGB 2ZUUA 3RL1B 2I5YL 1XEDA 3E6FA 2V2WB 2ITCB 3FB6A 5H2BB 5I9QC 1QSEE 3MV7B 3ESVF 1FH5H 2WWKO 4LIQL 4U2ZA 2AJVH 1I1AB 2C4FT 1KCSL 2NQCA 1WZ1L 1R0AL 3VXUE 1VCAA 3BD4A 5T5FH 4EUPA 4NKOB 3MJ8A 1B2WH 5F9AC 1HI6A 2X7LA 4Y2DC 3NCEB 3MGAA 4EXPX 3U83A 2VLLA 2FHFA 3VXRD 4HWUA 2B8OT 4QXTB 1IGCL 5F6HI 2CRYA 2DJUA 2FEDD 1YYLL 2FB4L 3EO0B 3O6KL 3SCMC 2GUOB 5IMOA 2DM4A 1PG7L 5IF0B 1MI5E 1AE6H 3VD3A 5SWZB 3OL2A 4QXUH 4NFBA 1IMHC 4ETQA 2Y5EA 1SJEA 3HPLA 5A2JH 3I84A 1KG0B 2EKJA 4O9HL 1BOGB 5EWIL 4X4XA 2F54B 4MMZC 4ZD3L 3C5ZB 3D3VA 4GW1B 3ZDXE 3MZTA 1YYML 3UTZB 3QWRD 1KUMA 4Y4HD 2F5BL 3QO1A 3GRWA 2HLFC 3WIFA 1HYSC 1QPXA 4F15C 1SEBA 2NY6C 2NY4D 5D6CB 3BWAB 5C07E 4K8RD 3BEVB 1QQDA 1TVDA 1U8IA 2OS7A 3HLAB 1TVBB 4Y19A 5EOCL 3IS1X 5DJXA 5FUOL 4GKOA 3DUSA 3M17A 3W9DA 1MIEH 4HPYH 4PGDA 1S7SA 2JCCA 1SBBA 2DKUA 4WGWB 4C54A 3SBWA 2G60L 5EDXA 3ULSA 2GI7A 1ZVYA 3GSQB 3SDAD 4M00A 4JY4B 2PYED 1OTSC 3OAYH 2Y07H 4N9GA 5T33L 4X0KA 2V5MA 2IPKB 4UTAH 1W0YT 2J88L 2HJFB 3RWEA 1MFBL 1FSKB 2DYPA 3QI9B 5IV2B 4J12A 4Z0XB 1U3ZA 3RFZC 1UM5L 4OF5A 4GT7A 2VQ1B 3MRLB 4DTGL 3SE9H 1MH5B 1HOCB 3PWNB 4U6YA 4JPVL 1W0VA 1NSNL 2XZAL 5F7WC 3MV9A 4ONGH 1B0GA 1S9WA 3F62A 3U46B 4H26A 2CGRL 4U6TA 2W9EL 1MCKA 5JPMA 4A6YH 2X70A 1CCZA 5IVXE 1IC4L 4RFOL 5IROC 1KJ3H 2VLJE 4UQ2B 4FFWC 4PJEA 5ICXB 3N1PC 1BAFH 4JO3L 4XNYL 4NQTA 1WAAF 5ICYA 3B2UC 2Z31B 3MRJA 5TJWK 4LVHB 2QQKH 2HFFA 1FORH 4LLMA 4FTVE 1T22B 1U93B 5E8DH 1GOHA 2LV4A 3NIGF 2R23A 2RIKA 3BP6B 5E00B 4DGYL 3EZ8A 1P9MA 5GS1A 3QDGE 2GY5A 1YPZB 3PGCB 5GGTA 2C7UB 1G7LB 3DURB 3PL6B 1YNKH 4YHIA 3UPRB 5D71L 5C0AD 2J6EA 5DRXB 2ZSVA 3H9YA 3OKYA 3NPSC 3WIIH 3GBNL 2P45B 2ED7A 5LQBL 2VABA 2WBJA 3S5LA 2HKHH 5EZOH 3IT8D 3QFJD 3G5VA 4GRMB 3LDBC 2J4WL 2WINB 3E8UL 4OZFH 4Y1AA 3JUYA 2X4OB 1FLRL 1NH6A 1PG7W 1HHHA 2VNCA 4H88L 3DNKA 3FQUB 2ZJSL 4OLXH 3QIWB 4RAUB 1XIWB 1EXUA 5E6ZA 3TO4A 4PB0H 3TA3D 1CDJA 2XFXB 1MJ8H 2YD2A 5LJYH 1TTUA 4IRJA 5IVNA 1CXKA 1J10A 3OKOB 1Z0MA 1GYAA 3V6FB 2R39A 3LOWA 1CDHA 2OM5A 1AC6A 3RHWF 4OZIA 1UM6L 2XG4A 3RNKB 1BBDH 4BYHA 5D93B 1KB5L 3TN0C 1C12B 1LP9B 3RBSA 5F3BA 4BH8B 5DK2B 3V6OE 1I3VA 2CIKA 3GSOA 3F7YB 5L7XH 5DMIH 5HGDA 5HYJE 4G5ZH 4P23C 1P84J 5FXCH 4UDUB 3RPIA 4XB7A 1TTFA 3CXDL 1EZVY 3DYOA 3SY0B 3ZE2F 4ZUWB 3B2VH 5JPNA 3MTRA 4O51B 3Q1SH 1B9ZA 4KGLA 1YQ2A 5BVJA 1U8KA 5AAWA 1HINH 4N8PA 4UOW0 5CEZE 1Q9LB 4X9HA 2XPGB 5HI4C 5FB8A 2AEPH 5CFHA 4N0CD 3BGFC 4PD4J 4PJXF 4PYHA 3RUGA 3RWGA 2PKDA 4UTBL 2OYPA 4YNYA 2H32H 3SDCD 3DO7A 1UB5B 1ZOXA 3UYRL 4WUUD 1ORSB 3HG1E 1DQML 4PJFA 2OL3H 4O2EB 3DECA 4Z7VA 1CDUA 4U1IA 5I2IA 3WHE0 1F4XH 1N0LA 5FYJL 3RIFF 4B5EA 5B39G 2VSDA 3INUL 3E1F1 2KKQA 1X7QA 2YUZA 1CD8A 1JPST 3RL1A 3TBTA 4Y16A 3VCLA 3WFCL 4JPWH 1RURH 2ZZUT 5DT1H 3LD8C 2F53E 2DQGH 1OAQH 4K23L 4NCC2 5GQBA 3FRUA 3MGOB 2VXSL 4KQ3H 2IAMB 1I1AA 1NMBH 5EFIB 3JWOL 1WBZB 2PXYD 2A9ML 2NY1C 4HIXL 1F6FB 4PJ7A 1OCWL 1WTGT 4KKAD 2W1NA 3ZT7A 5ILTH 1QR4A 1D6VH 3EFFA 4YHPB 4GFTB 4P2OA 3VW3H 1J05B 3V95A 3DGGB 4M1GL 4XI5D 4XPBH 3V6BR 4PJGF 3IDGA 4FQPA 2KDGA 3BUYA 1FBIL 4UT6L 1I75A 5ACMA 3ARBD 4GRWH 1RIHL 1FV1A 4ELKA 3EO0A 1E4JA 3SE8L 3PP3H 3L3GB 1T66D 1T5WA 2FR4A 5EU6D 4PJHF 1SBSH 5K59F 4YGVA 4Q9RL 1NDMA 4Y5YC 4BSVB 5SWZA 1AR1D 3K8MA 2B1AH 3RVVD 3UPCA 1W72B 1T4KB 2O5ZH 1EUUA 1IGYA 1BD2B 4OGYL 5MEOA 4FNLL 4WEUD 4YAQB 1CS6A 1REIA 2A0LD 2K7QA 5ETUB 2YPLD 1BOGA 1S5IH 4FP8L 4YBQD 4ZTPL 5FYLH 3IFLH 2VLRE 5EO9A 2F54A 3C5ZA 2D7NA 3VJ6B 2I9LA 3QEGL 4JG0L 4PJCE 3JBG7 2J8UF 3SO3B 4PBXA 1Y18A 3GMNA 3AS3A 3C5SB 3K2UL 3P77B 4KJPD 4OKDA 1JN6A 2EDJA 3T08A 3L7EB 2PETA 1IL1B 4FZEH 3MODH 5D6CA 3AY4C 3GHBH 2O5XL 5E70A 4HS8L 2HMIC 3FL7A 4S1QH 5GJSH 1U8QB 3HLAA 4GQ9H 1XR9B 2AJZB 2YA2A 4PREA 1HHGA 3IJSB 3B4NA 3N1FC 5D96C 1GIGL 4P46C 3DSFL 4MJ5B 5IQ7H 2R0ZL 2COQA 2H8PB 2ADFH 5JOPE 1QEWB 5FYLE 5GJTL 3PDGA 4ZS6D 1A7RL 3TT1H 1IBGH 5C6TL 3DI3B 4WW2C 4UOW1 1J0HA 1MVUA 2NR6C 5GGUB 2WMPA 1T0PB 4URTB 3MLTA 2IPKA 4UIKL 2Q8AL 1BJ1H 3DO3A 2HJFA 1N26A 2NYYD 2R8SH 3R1GH 3WHXB 3QI9A 5IV2A 4Q9BA 3J7HA 1T1YB 1ZLWH 4Z0XA 3T0EE 2FNBA 5FGBC 1RY7B 3IXTB 3T2QA 2APBA 1MH5A 3O6FB 1FVCA 1TJGL 2XACC 4U4BA 3Q6GL 3WHE1 3JV0A 1UJ3B 1FYTB 4XPHH 2GT9A 2AJVL 3V4UH 2YC1A 5IIEB 4FQJL 4QWWD 3RAJL 4NRYB 1JBJA 1IEBB 1LO2H 1BX2B 4JFQA 4PJ8B 1T1ZB 2EDEA 4YHZH 3WUWG 5HDLA 5HGGS 2D4FA 4JY5H 1XMWA 1ZLSH 2EC8A 3LZFH 2N1KA 1NMAH 3PIQA 4XMLL 1D5ZA 4F7MB 2BJMH 4P5MB 5FA3B 2YMXH 1W8NA 5DZNA 1PBYA 3ABZA 4R97C 5JA8B 3AMLA 4DCQB 3GZKA 3DTXB 1UM4L 4KGJA 4C4KT 1FYTE 4L8DA 4MZ2A 2VB5A 4GKNB 4LASL 1MCOH 4XCYB 1KJ2B 1YPZA 4Y5XB 4FQ1H 3KYOA 1MOEA 1G7LA 2G5BA 1MWAA 3UPRA 2YD4A 5DRXA 5A3IC 1IGMH 2WWMD 1H9VA 5F70A 3VH8G 2BNQB 5DRWB 3X14B 1UWGL 3JXAA 2XTJD 3PV7A 3UBXG 3GB7B 3L3JB 2A6DA 3TM6A 1AGDB 4GRMA 5L2JA 1N5YH 3IDYC 1NAMA 2WINA 3TPUA 1G6RB 1AXSB 43C9A 1JWMB 1SM3L 2DL9A 1KIPA 2GJ6E 3B9KC 1KXVC 3VXSD 5I73B 3SCMA 1XF2A 1JWUA 1XIWA 3H9SD 3T2NL 3D2UB 3WD5L 3PXHA 3T65A 4JM2C 4PJDF 1YC7A 2CD0A 1KCKA 1A64A 1G7JA 3U6RB 2R9HD 4TPRH 4Z7WA 3U0TB 5BXFA 1IAIL 4LKCA 1I9EA 4NCC1 1MIEL 3RNKA 1RUPH 4NRXA 1P4BH 1GH7A 4ZYKA 2GFBB 2YKLH 3O6ML 4HCRA 4P2CG 3VRIA 3S98A 4D9QE 4DKEL 4LAQH 2CRMA 1S7QA 1JI2A 4LU5H 3HMXH 4CJ0A 1DQDH 3OSKA 4OTXH 1CL7L 5EUOF 2QHLA 4KKCC 4WHTB 1HNFA 1E6JL 5IBTH 5T3XE 1IAMA 3WFZA 4HF5L 4HD9A 2IFFH 1XGYH 1MCPH 3MXVL 1NFDA 1X4ZA 1U8OA 1C5DA 1QR1A 5T1KA 3D69A 1JNLL 1M71B 1BZ7A 4ODTL 3CFDB 4DQOH 4NQCE 1AP2B 2XRAH 5DS8B 5DTFB 2I9TB 1RIUL 1ES0B 2IH3B 1KJ3L 4OCYH 2O5YH 2ICEA 3RTQC 2DQHH 5AG9A 1BAFL 4MNHB 4PLJC 5DMGC 3RVXC 5CJXC 5BZDB 4LHQB 1P5VA 1LILA 1Z9LA 2QQKL 5DUML 3OJMB 3PQYD 5EIVA 4L3CB 4OIBA 4EOWH 3V5KB 3MFFB 2EDTA 4AIZB 5GISL 1DUYB 4H1LG 2QTEA 4HGKC 1MCJA 1KIUA 2LAGB 4BFIA 2PTTB 2DOCA 5GRXG 3K2MC 1YNKL 4L1HA 1E28B 3MGOA 4RGNB 2H2PC 4NO3B 5IROA 3U4AA 2IAMA 3QEQB 5BRZB 4QRQB 4JR9H 5EFIA 1MCNA 2ADIB 4ELME 4HJGB 1MAJA 4MXVF 4Z7UF 2FATH 2VQTA 5EZOL 4MNGB 1SVZA 5I8KL 3CZJA 3KLAB 4FQXC 2I60H 4CU8A 4LRIC 4NQSA 1J05A 2YD5A 3DGGA 1H3VA 4BZ1H 3W39B 5BS0D 3HS0B 1NC4D 4LVNB 4YPJA 4PB0L 5KANG 1OWWA 3OKDB 5MERB 3QUZD 4KKBC 4LSQL 3HAEH 3L3GA 5I19H 1DBJL 1I1YB 4P0DA 2CLRB 1MRCH 4XCCL 1WBXB 4MNGE 5DD6B 3GHEL 4U1LA 4LPCA 1WIPA 1ONQB 2OTWB 4YAQA 4JZOA 5GGSB 1H0DA 1QYGH 5L7XL 5DMIL 4RAVB 4G5ZL 5HDBE 4WHDA 4F57H 3KPRD 2XA8H 5TH2A 2NY0D 2QL1A 1KPRB 4JREB 3VJ6A 3NCJL 4RMWA 5BMFH 2IH1A 3JV6A 3QHZH 4P3WA 1RZIA 1HDMB 5AZEL 3P77A 1A6AA 4K8RL 4MA8H 3QXDA 5L6YH 1T03H 5HHQB 4LIQE 1EVUA 4R4BB 3BH9A 6FABH 4PUBH 4X9GA 1TXKA 2XXCB 1S7VA 2AJZA 4OCMC 3IJSA 4NC1E 4OLWL 5D2NE 4PGJA 5I15H 5I1EL 3ZHDA 3QQNA 3UJTL 1JVKA 4P23A 5IFJA 2JLLA 4PLKC 5I74C 1QEWA 2OL3L 1BOYA 1J7VR 2OCFD 4TVPH 1T04B 2X9WA 1K6QH 1CGVA 2BNRA 3J8F7 3S88L 4ZAKD 3ARGC 4HUVA 5IR1B 1BQHB 4KVCH 4O2FA 3CGTA 4BJLA 3MCLL 1BFSA 1N64L 5J89A 5ESVB 3CZFB 3R0NA 3EYQC 1BGXH 3O41A 2X9YA 1YJDH 3HUJF 4ENEC 5I30H 3WHXA 1QHOA 2MKWA 2PF6A 3EHBD 5GRVL 3IXTA 4HWBL 2ESVD 1Q94A 4IIQC 4Q0XL 1RURL 3O6FA 5DT1L 3FB5B 1DANT 2GSIB 2DRUA 4X7SH 4TVPE 1QFWL 3TT3L 5I8OL 1UJ3A 4X83A 5I8EB 4GRLD 1P7QB 3MJ7B 4PGCA 3SDDB 5E5UB 1HN1A 4PRNB 5EBGA 1IEBA 3P2TA 5DJZA 3U0WH 1Q38A 4P9HL 5C09B 2OP4H 3RDTB 5ILTL 3WS3A 1D6VL 2FGWH 1YEHH 1CWVA 1VGKB 3CU7A 2XN9A 5J9PB 1OGAA 5D1QD 2V5YA 2IALA 1A1NB 4ORZC 2HJLA 4NBXB 2Y25A 4WI9A 1WC7B 3C6LD 2EDNA 4BQ9A 4JFPB 3DTXA 3LY6A 1X4YA 4GKNA 3RJDA 1EUTA 2JELL 1SBSL 4L4VD 4NZRH 2WW8A 1MFCL 4JDVA 1DEEB 1KSRA 4PS4H 5F1NB 5E0QA 4QRPE 5GS0D 5DRWA 3X14A 3GJEB 1HHIA 3GUTA 1ZHBA 1S5IL 4F3FB 4WWKB 2IANA 4YXKL 4XNXL 2C4FU 2MCPH 4G8EA 4BFGA 3GB7A 3L3JA 2WBWB 1AGDA 4ZDHA 4HFUH 4JHWL 4X6CF 5KVFH 2IQAB 2W91A 3TYGL 1JWMA 4O02H 3C60B 5K9KA 2B5IB 3QB7C 1MQKH 2FWOB 4JKPL 4LEXH 1AKJD 4BA8A 3D2UA 3QDMD 1X5AA 5LKNA 3LRSB 1OOAA 4Y5YA 4TNWF 4BQCA 3MODL 3C5JB 1VADB 3FRPG 2YXMA 3VFRA 2A1WH 3BEWA 4K71C 3OKMB 4JFZL 1K5NA 3U0TA 4KC3B 2LU3A 2VN7A 3GSNL 3RNQB 2ADFL 1FCGA 1NCTA 1K8IA 2H9GA 5KVGL 2GFBA 3OTTA 1BIHA 4PRPD 2B2XH 4DUVA 2NW3B 3VE0B 3VXQB 1MAKA 4ISVA 3QAZC 2EDLA 5C0CD 5HGBB 5EU5A 2EH8L 4MXWL 4HUNB 1RV6X 4FG6D 3B5TA 1U3HD 4O00A 5HGHA 5E2VH 1N4XL 3AY4A 1EEUA 5DA0B 2ZWLT 5IB1B 4WHTA 4BQ8A 1HWGB 1M7IB 4IEFB 4J4PC 1WAAE 3P30L 1U8JB 2QBWA 1YA5A 5IW6B 3KAAA 5D1XB 1U8MB 1BFOA 4M8QA 1H8OA 3IRZA 3VFOA 3NIGE 5C2BH 3EO1B 4MQ7A 3AREC 5F9OH 4WW2A 5CD5C 4MNQE 5FDWB 3QG7H 1ZANL 1V05A 1F8TL 4UB0L 3CFDA 2MNUA 1KB5B 1AP2A 5DTFA 2A74B 4MQXC 4YHZL 1J0JA 1NC2D 1ZLSL 1NMAL 2WBKA 4HIJB 1G9NH 4G43A 4G8GB 2Z92B 4R2GB 4MNHA 5KSUB 5E6YA 3M8OH 2BP3A 2NLJA 4EXKA 5FGBA 4LLQA 3WS6C 3MJ9A 1BLNB 4N1HB 3IKKA 4ONOA 1AH1A 3NBNA 4X9BA 1UENA 5GRUH 4FFZH 3CFIC 3REWB 4MA7L 4RX4A 2LTQC 5TE7H 4Y4KB 4KJYB 1QFPA 2EO9A 4P2QE 1E28A 2VDKL 5FGCB 4NO3A 4J3SA 3QEQA 2CO6B 4QRQA 5BRZA 2Y7QA 1NQBA 4PY8J 3AS1A 1T1XA 4ZUSB 3TZVD 4NO2A 3VFTA 1KPUB 1RJZB 1AD9B 3L95B 4P2YA 3ROOA 4PJXB 3L5IA 3IJHB 4J1UA 5C0IB 1Q72L 3A67L 3W39A 4J23A 4K9EC 4A2MA 3CUPB 4Z76B 3HS0A 5DJCA 4OSUL 5JW5B 2NNAB 3ZE2E 1NGZB 4KK6C 1SHMA 4HWEH 1FNFA 3SQOL 3OKDA 1T6VN 1Z3GL 5T3ZD 1I8KB 4MXQD 2ICWJ 1IAII 4OCXL 2P5EE 3LKSB 4S1RH 3GMPB 1XZ0A 5CP7A 5L0QC 3R8QA 3DXAE 4PJXE 1ONQA 1RFDL 1OSZA 1YN6B 4MX7A 3OZ9H 5I8CA 1FVEB 3BIKB 2DWEA 5DJ2B 3A6BH 3HZYB 5GGSA 1MRDH 2OQJB 3B9KA 5CSZB 1WLHA 3DROA 1KTLB 3TFKD 3VWJC 4JHBA 1U8PB 4QOKB 1CL7I 3HMXL 2UWEA 2NZ9D 3QXAA 1CE1L 3LS4H 1LMKA 2W0KA 4KK9C 1RJYA 1MCHA 5AUMB 2IPUG 2R0WL 2VLKA 2IFFL 4FMKA 2LVEA 1KGCE 1KPVA 4XPTL 3R8BB 4NO0D 4HH8A 2X4TB 3RP1A 2HVJA 4HJJL 3MA9H 1ZA3A 2BNUA 1I3UA 2R56H 5I71C 1GCFA 2CUMA 4R26L 4TOYL 4QHMA 4GW5B 5IFAH 1ZT7B 4E0RB 4QOKE 4PJGB 5JMRA 3KLHD 2AJUL 1JGEA 4DQOL 2VDRH 3LB6D 1QRKA 3TJHD 1EGJA 3AFLA 3O3DB 2IBGA 1I1RA 4JRXE 4LKXA 4I1NB 4NQDB 5DUPL 2OJZL 3MXWL 3MRDA 5JHLL 1XCTA 4G80B 4F37F 1BQHA 1WFUA 2NXZC 4PJHB 5C9JA 4AZ8A 3R0MA 4PRHD 5ESVA 5HHOA 5IHUH 1B88A 2YUXA 5DC4B 4NQXA 3QULB 1FFOB 3QIBC 4XMPL 1YEFL 3BESR 3KPSD 4K7PX 1P4IH 4UNVA 4WDIA 2JK5B 2P8PB 2HA1A 5JZ7C 3FB5A 3V7AG 2GSIA 2R1YA 4M6AA 1WVZA 3D18B 4PJHE 5K59E 1DUZB 1ZSDB 5F6IB 2P7TA 2EEBA 3L1OL 1FJ1A 4TSCH 1OTUD 3MRPB 1L0YA 1IGJB 3W0WB 5C92A 5J9PA 4PJ5B 2HVKB 4P4KC 3MACH 3DX9B 1G7IA 1WC7A 5KSBF 1QRND 1KIRB 1ZEAH 3MLZL 4CDGC 3I3BA 3MZGB 1LK3L 3BZFA 4JFED 4RIRB 3QNZB 2J8UE 5FO7B 1CTOA 2MTPA 2RBLA 3HZMB 4MLSA 5DFVD 4KJWD 5IJKC 1MRCL 1DEEA 1R5VB 1AGFA 3IDMA 3ILPB 3VXMD 5KSAD 4X7CC 4FQXA 3C8HA 4LRIA 3K8LA 3ME0A 3FO9A 5T5NF 5DURB 3EYOA 4WWKA 3PGFH 2OR9H 2APXA 1EO8H 5D5MA 2M2DA 2APVA 2EC9T 2IQAA 4X7FC 2P42B 2X1QA 4L3ED 4TSAH 1FZOA 4U1NB 3FB8B 1D7FA 1I7RB 4HIEA 3LRSA 4N8VA 3V6OC 1T03L 1AO7A 2ERJB 3QJFA 6FABL 1A0QH 3VWKC 5C2UB 3K80A 3H6JA 5D2LB 2FX9H 2ZOKB 3OJ2C 4Q6IB 3SOBL 5KW9L 2EDRA 4N90D 4I0PC 4MJIA 5I15L 3OR7B 3CDYA 1QLEL 1HXMA 2DBLH 1YMHA 4MDJB 2YK1L 1Z9OA 2ZUTA 1F2QA 4JRYA 2NW3A 3WJJC 5HHPB 3MBXH 1PDKA 3U7YH 4NUJB 1I8LA 4D8PB 5F3HB 3FAXA 4KVCL 2DIJA 1PKOA 2UZIL 4GG6A 5CCKH 1OQXA 1FG2B 3FB7B 4I18C 3OXSB 1OAKL 1PY4A 5I30L 4V1DA 3EGSB 1NBVL 3U9UA 1FG9C 2ZUQB 2DIAA 4CMMA 1U8JA 3ZE1F 3BN9D 4CGTA 3LKNA 5AZ2H 5A1AA 5ISZB 2VDLL 3FO2B 1S8DB 4XVUD 1FFNA 2DS4A 3EO1A 1RHHA 4MVBD 4OZHA 4P5TC 2A83A 1A3LL 3ARGA 1XF5B 4I9WD 2MJWA 4UDTB 4HJ0C 1CFTB 4QXGH 3QDJE 2A9NL 2OP4L 4PJDB 3WDHA 4K7FA 1FPTL 2FGWL 4X6EA 4DKDC 4HIJA 1A2YA 4L4TB 1MFEH 4G8GA 2JB5H 4YO0B 2Z92A 3MRBB 4S1DD 5KSUA 5DHVA 4JKWA 5B38B 4K2UL 3H42L 4LSTH 1ETZA 2PW2A 2XKNA 1JYWA 4HC1A 1AI1L 1U8LB 3CVHL 5MI0C 4L9LB 4QRRB 4PV9A 5K9OA 5C3LD 3IKCA 2MWCA 2HT4D 1GHFH 3HC0A 4I77L 3BZEB 3WLBA 4NZRL 1AXTH 5KVDH 3RPKA 1J0KA 2H45A 4PS4L 5EUOB 3NACL 1NCDL 4IHOB 2VJXA 4OM0L 2F74B 2NY7L 2EEDA 2OJEA 1V3MA 1F90H 1U42A 4G6ML 5KJRH 1RJZA 3L95A 4UINL 1WSST 3GMRB 1JF1B 4EI6B 3HI5L 3HMWH 3WO4B 4EN3B 4QRRE 3TIEB 1A1MA 1RMFL 5I75C 4APQD 3FFCB 4LEXL 3CUPA 4LCUA 3D3VD 3W82A 2B4CC 4KMTH 5EUKB 5J13B 4F9LC 4TUKH 4ZXBD 1CXFA 4I3GA 2AK4D 5C6WH 5DZLA 3LKRB 5INCB 5T1DL 3F12B 1GOGA 3S5LG 5F93C 2EDXA 4Y5VC 3DRTB 1MHEA 1JPTH 4Y19D 4K7PH 5H8DA 1FVEA 4YBLB 3HZYA 2OQJA 1IZJA 4HGWB 4HUWA 4Z7NF 1FCCA 3UTSA 3DV4A 5IFHH 1U8PA 4PRIA 5KG9B 1IJ9A 3GJFB 1ERNA 2EDQA 5E2VL 4E41E 1AGEB 2PO6C 3AMKA 2AI0L 5TF1H 5TPWH 4LARH 2HT3D 4Z7UB 1MCRA 1C08B 2Y6SC 4JQXC 4NC2B 2FYYA 4F7CB 5C2BL 2DYPD 1UACH 3BKJH 1QACA 2DLFH 1L7TH 5IG7B 3FT2B 1I1FB 2AXGA 1X5ZA 1T20B 4PJGA 5E8NB 1A1OA 1CGWA 1EAJA 3MV9D 3T0EC 4MMXC 2IJ0C 4FQHB 3VXRE 3O3DA 4M62H 3UROR 4N0RA 5TE4H 4J4PA 3V8OA 4U1HA 1YY8B 4Q2ZA 1MLCA 4KDTC 5HPMB 4Y4HB 4Q58C 5JUEL 1G7QB 3MCG1 1X5IA 5B8CC 5TQ0L 3MV8E 3QULA 1K2DB 2R1XB 1FFOA 2NY4B 5I17A 2WANA 1W2KT 2Q7NA 4JHAL 4JZJB 5DLMH 4D94A 2R15A 3M1BA 1R24B 1GJIA 4L29B 4WU5B 1QFHA 5J1SC 1UZ8B 3OQ3B 4KJQD 5JQ6H 4TULL 1T0MA 1F02I 1RZ7H 2H32B 3KJ4B 3N9GL 3CIQA 3D18A 2BHZA 1U58B 3CDFA 4LPUA 1VKXB 5HD8D 1ZSDA 2F8VA 1QSEA 1UCBL 2OL3B 4OT1L 3JV4B 3WS6A 3WYRA 3I6KB 1SQ2N 1WV7T 5EZLA 3SDAB 3O4OB 5HTSA 3WDIA 1CBVH 1F4WL 3W0WA 2PYEB 1BVKA 2QSCH 4JDZB 4K94C 1UEMA 4EUPH 3NZ8A 4XVTL 4FFVC 4ODSH 2YWYA 2WBJD 1O7VA 2HVKA 4ZO6A 3QNYB 3VG0H 4XT1C 1X4XA 2BSED 1KIRA 4HWEL 4K3JH 4Y1AD 4OD3L 4U2YA 1KXQE 4RIRA 1KTKE 1TIUA 2E6JA 3RL2A 3HZMA 3TO4D 2FJHA 3AU1A 4R3SA 5F72S 4IRJD 1R5VA 1QOKA 1I9RL 4KHTH 4J3UA 3V6ZA 5I16A 2PYEE 1PYWA 4P99A 1MI5A 5GS0L 3HUJB 4KI5E 3U48A 3OZ9L 3A6BL 2AABH 3I3EA 1BBJB 4HHAB 4GAGL 1A7NL 1GVIA 4HMEA 3OHXB 1GC1C 1OSPH 3KWWA 1A6WH 3LS4L 2Y5TA 1MCWM 5F8QC 1TVHA 3FB8A 4X6BA 5HYQB 3P9MA 2XWBA 4ONFL 4NKDB 5DJ6B 3TH2T 1MJ7L 3P73A 4GRWB 3HUJE 4FFYH 1DBKH 2NX5E 5D2LA 2ZOKA 3NIFE 4Q6IA 4LSRL 1T83A 1CZ8L 5C07A 3OR7A 5DSCA 5C0AB 1Y6KR 4WUKL 3CDGB 1RZJH 3TCXA 2VDRL 2FBJH 3MLWH 4POYA 3I50L 4AK1A 4O58H 3Q6FA 4KKLD 1VGEH 2QR0A 3T4AB 3SKOA 1DBMH 1P2CA 3H3PH 4D8PA 1H5BC 3MO1A 3QFJB 1YEKL 3GBML 3N1MC 3BMWA 1UVQA 1DBBL 3QUXB 5E5RB 4OM1L 4YHNB 1T1WB 3HZVA 5IHUL 3EFDL 1DSFL 1RK1B 4IRSC 1S78D 4OV5B 2FHCA 3TA3B 4XPAL 4OB5L 1WF5A 4PJBE 2DWDB 5F1IA 2YS4A 5FV2A 4OBSA 5LWYL 3SJVE 2DQTH 1T2QH 2BY2A 3IDIB 1S7WA 4X6CB 5I1GH 5BV7H 5DUBA 4R90L 5T1MA 4Y16D 3U4BH 4DJMA 3GSNB 3MRKA 3NA4A 2Z8WC 3DLQR 4ZODA 4ZTOH 4AIXA 1CFTA 4PJDA 1T7XA 3SHSA 1X6NA 1I1AD 2GTZB 4M7JH 2CKNA 3W2DL 1CFBA 3EYFB 4YO0A 3MOAL 1KACB 5IVXA 4IOFD 3MPCA 4DKFH 3STZA 5FKPB 1VACB 5F6HJ 2PW1B 2VLJA 4PTUB 1FGVH 2VXTH 4P2OD 5CSBA 1U8LA 3PHQB 1NGPL 3PXJA 4L9LA 2AJSH 4ZO8A 4JFYB 4JO1H 2QJDA 1NGWB 2IMNA 3CD4A 4TUOB 4R6UA 3AC0A 3SDCB 4IHOA 3B9VA 3QDGA 1FL6B 1DANU 3CNKA 4UAOC 3UMTA 3QR2A 3GMOB 5J6GB 2X41A 4J2XA 5SWZD 4JANA 4A6YA 4OGAC 2J6EH 3PGFL 3QG6A 4XP5L 4TNVK 4JKKA 2OR9L 4KTDL 4ZOAA 1F4AA 1HIMH 3BOVA 1NKOA 2F5AL 3OV6A 4QRUB 4UI2A 1HXYB 4EI5B 3SKNB 3FQTA 4J3TA 2F54D 3FFCA 4MA1B 4D0CB 1YDPA 5EORL 4Z95H 5IJKA 4HMCA 4XP4L 3KPQA 1B4RA 5T3ZL 5IWLC 1JF6A 3L3OA 5EUKA 1A6ZB 4NM4L 4WUUE 4U05A 1VPOH 3CFBB 4WENB 3SKMA 2B1HH 1ZK9A 1KTDB 2VSCA 4P9MH 2J3SA 2F19L 3F12A 1RUAL 4DZBB 1ODAA 2W0PA 2QEJA 2VDOH 3HE7C 3U7AA 4QHKJ 3WV0A 5ERWB 5IHLB 1WT5C 3KHOA 4YXLL 4JQVC 2PXYB 2DQEH 4GBXC 1SY6H 3QNXB 4HGWA 1QFUL 3GM0A 4K3HA 4JFFE 1F5WA 5DD0H 1KJMB 3B9DA 5E5MB 5F9JA 4KVNH 4NC1C 3V6OA 5D2NC 4OZFA 3RJQB 2VDPL 5CCKL 4EVNB 4LSPH 3VWKA 3PWUB 5JDJA 2CJUH 2W38A 1OGTB 2E7MA 3OKEB 2C26A 3VMNA 1DLHA 2DMKA 4I0PA 2ZKHH 5GPRA 1S7RB 4RFNC 3CFEB 4OLEA 4XCFL 3ARBB 4X5XB 1UEYA 2EKSA 5D7IF 3WL9B 5D7LB 3W9EB 5C86A 5EU6B 2E3VA 3B43A 1C5CH 1N3NB 3QI9D 3TO2B 4HKZB 2NY5L 1BVLB 1GRWA 4JVPA 5HHMD 3WJJA 5DRNA 3UAJD 2FSEA 3K4DA 4XAWL 3FT2A 3QEHB 2Q6WB 1N5AB 2A2QT 2DLEA 1P53A 5E8NA 4XNQB 3CH8A 4L8CB 2YPKB 2JKXA 3ZDYF 2YPLB 4X7EC 4XCEB 3HG1A 5FHBH 3EDJA 3T09A 1ZA6A 1MFEL 4QTHB 3I02B 5DDHA 4OF3A 1YEJL 2VDMH 5HPMA 3P9LB 3BE1H 1AD0B 1BIIA 5DEGB 1G7QA 4BZ2L 5KSVA 3DJ9A 2W65A 2R1XA 4HZAA 3QBTB 4NRZB 4MAYC 4CNIB 4P5TA 5HYSA 4EDXA 4NHCH 4XH2A 3V0WL 5HHVH 1GHFL 4M43L 5JIIA 1R24A 2D7PA 2L0DA 1YJDC 5J4MA 1JRHH 3V52H 5E8EA 1M4KA 2MPAL 5IB2A 1LO4L 4YC2B 4Y4FC 2H32A 3VA6A 1U58A 2JB6B 1F90L 2X1WL 2OL3A 3HI6H 3TH3T 5E08H 1AGBB 3VDAA 4MS8D 3VGBA 4XMKL 3TBWB 4WO4C 1WZLA 4X80H 2Z35B 3VU2A 4PBVC 3BPNB 1U91A 5IVZB 1DCLA 2HTKC 5JW4Q 2QQLH 1A6TA 3LQZB 4LCYA 4GXVH 3O4LB 1HQRA 1OD7A 4XRCB 3T3MF 3X12A 2HLAA 3SCMD 4M6OH 2Q8BL 3I9GH 1XIWD 5CLTA 3TIDB 3DMMC 3E2HC 4ZG1A 2FX8L 3P40A 2FRGP 1JGLH 4HT1L 1JPTL 4K7PL 4YXHH 3L3IB 1BREA 2VXQH 4HHAA 4J3WA 4MJ4A 4NYLA 5I1HL 5GRWA 2V7HB 4PP2B 4I2XE 3DRQB 1MRFL 5D1ZC 3GEWB 4XCNA 2HLFD 1HYSD 5TGBB 4R4FL 2VLRA 1V7MH 4NNXB 3S3PA 3LQAL 4PP1C 4QRTA 4HMDA 4LEOA 1CFQA 4GUPB 4PTTA 4LARL 1KCUH 2KL6A 4PJCA 1CICC 4FABL 4Y5VA 2AXJA 4P48A 1IE5A 3HAEB 2R2HB 3ET9F 2AJYL 2DLFL 5E9DE 4GXUM 1J1XL 4RQQA 1IM9A 5C0AA 2DQDL 1IM3B 3IXAB 1YN7A 3T0XA 5T1KD 1H15A 3S36X 3T4AA 2XTJB 1FAKT 4M62L 2PO6A 5E1AA 1IAKB 4I48B 1OTSD 4MZ3A 4W70A 5EBMA 1F3JA 3QFJA 3V79C 3QUXA 1F3RB 1FNGA 4F33B 3JWNC 4MA3B 4YHNA 3PWJB 2J7LA 5I1KL 4AEFA 1NCWH 4JQXA 2DKMA 4KRLB 1TLKA 3MLVH 3H9SB 3UJJH 3OPZL 3F7RA 5DLML 3AXLA 2DWDA 5LBSL 5KSBE 3F6LA 5F88B 2XXMB 5DHYA 3MRQB 3MR9B 3IDIA 3T0EA 1MF2H 3MYJA 4YHKH 1JV5A 1NLBL 4OFDA 1LDSA 3H7LA 1ZAGA 4R0LC 2EXYC 3ILQD 2H26B 1U95A 2D2OA 4KDTA 2VL4A 4M1DL 3VXSE 3LV3B 1V8HA 1FAIL 4QNPF 4JPKH 3NTCH 1CBVL 4HH9A 4FFWD 2P47B 2R4SL 1URLA 2ZUWA 5JA9A 2DM2A 3B2UD 1IC7L 4HBCL 5I18L 1EZVX 3JTTB 5FKPA 1RUMH 3UPAA 4E42B 5K9JH 1DBAL 3MRRA 3ALXA 1QNZH 5A16A 4M93B 1G9NC 5I6XC 1F58L 5EA0H 1CF8L 5CGYC 3WUWB 4JAMA 2BRRL 4AMKL 5DJ0B 4LDEB 1MEXH 1NGWA 4WFHD 1YEIH 2LQRA 35C8H 3R4DA 1OQOA 1YNTA 1FL6A 5IW1B 3GMOA 2AERT 5BQ7A 1TJIL 2KQNA 3L3DA 4KTEH 1Q0YH 1GPOL 4ODUA 3O8XC 2B0SH 3ULVE 3PABA 1D5MB 1JMZA 1KC5H 4EI5A 2AQ1A 5TQ2L 1CDIA 1NAMH 1N2RA 1Z2KA 3PQYB 3NAAH 4KHXL 1VA9A 2E7HA 3EAKA 3GRWL 1GGBH 3G6AB 1A6ZA 4G3YL 4HIHA 1JL8A 2JCCF 5IESL 2Q7YA 3KPNB 2X4NA 1XF4B 3ZE1E 2E27L 1N0XL 4X5WB 5E7FA 3MRNA 2EE6A 4CJ1A 1JZ8A 4YPGB 5J1AB 3MLWL 5ERWA 4PGBB 1LE9B 4O58L 4ODHH 32C2B 4P23D 2PCPB 5DJ8B 3WNLA 1DBML 5CIPB 1VFAA 1W0WB 3KG5A 4S0SD 1JI1A 1EMTL 1KJMA 2FIRT 1LVEA 4K3GA 2BNRD 3MNZB 2EDYA 2CKBH 3HR5B 4EVNA 3NA9L 3DUUB 5BS0B 1O5DT 4IDJL 4G7VH 4IOSD 1FFRA 1I7TA 1NC4B 1OGTA 1V7NH 3CFCL 4X8JB 5DJYA 4F7TB 2EC9U 3CMOL 3GK8H 1KLGA 5LGHH 3QIUC 2V2TB 4WU7B 4X5XA 3QUZB 5EO0B 3GMQA 3WL9A 5CD3A 5D7LA 1MNUH 2LAAA 1N3NA 3UTQB 1KNOA 4HKZA 1I85C 4JFDE 3GMLA 5MEQA 2R4RH 5F7LB 4AEHL 5I1AA 1V3JA 2AK1H 2C1PA 1VEPA 1N5AA 1H5BA 2IC2A 2VIRB 3O6FD 3V0VB 3H0TB 3O45B 4XNQA 2YD7A 5JOFB 4G7YL 1E4KC 2YPKA 3X3FH 1UXWA 1JMXA 3IU3B 4M7JL 4QTIL 3KPRB 2NY0B 3S34H 1N59A 2HWZL 4NQCA 2AEQH 3OKNA 4DKFL 1MCQA 2K7PA 3P11L 4MYWB 5DEGA 1OL0A 2XN9D 4MCYB 1QG3A 3VFGH 1OGAD 5FYKH 3CC5A 2A6JA 4DWHA 1WWBX 4I4WB 4NGHL 3VMOA 4KRPC 5C0BE 2AJSL 1CT8B 2DM7A 4S0TD 3WFEL 3VA2C 1EH9A 1N8ZA 1LO5B 3K3QA 1NANH 4I5BA 1RU9L 3KPRE 5GIRA 1FE8H 4HKJB 2XWJB 4Z7QF 1MFAL 2NY1D 5J8OA 4CADB 1MFNA 4NKIL 4E5XB 2DQFB 4U1KB 1ZTXH 2J6EL 2ATKA 3DUHA 1AGBA 4AENB 4ZAKB 2P43B 4I0CC 4H1LB 1NUNB 1HIML 1G9ML 1JPFB 4ELMA 3CFJB 2FO1A 4Z7NE 2X4RB 1JPGB 2IAND 1GGTA 3IS0X 3FQNA 3PWPD 4LLVA 4Z95L 4S2SB 2XT1B 5EOCJ 3O4LA 4OZIF 3BUTA 5CEYB 5E99H 2ESVB 1CD9B 4OCSH 4NZUH 1OARL 3QQ3B 1KT2B 3EW3B 3D2UD 3PV6A 4TQEH 2H3NB 2VERN 3LH2L 1BQUA 4GRLB 4R4NC 4DZ8A 4R7DB 3V4PL 5GSRA 2ARJB 1PLGH 4U6HB 1HH6B 2D4DA 5D7SL 2OTUB 3AS0A 2Q20A 3ARRA 3N85L 3BP4B 1I4FB 1ZT1B 4LLUB 5TDOB 2Y36H 5D1QB 2A73A 5CZVL 5IWLA 3FN3A 3RGVC 2MQ0A 3QDAA 2ESVE 5TGBA 3WKMH 2HT2C 3FJTA 4Y88A 5JLZB 1H8SA 4WV1A 2I07A 2EICA 3C6LB 4OV6F 5E4EB 5FV1L 3RUGF 2DTSA 2HMID 4AG4L 2YRLA 3QT2A 4KK5C 5C0JB 2EYTA 4PJFF 4BKLB 1WT5A 4NFCA 4JQVA 4L4VB 3HAEA 4P46D 4UILH 3QRGH 1M7DB 1EEQA 2FHBA 2R2HA 3JTSA 4LCCB 4Z7VF 4GBXA 5E2WH 4O2CA 3SDYL 1IFHH 2AV1B 1FNEB 5F7YC 4ESKA 3ORJA 3QXWA 1MHCB 2Q3AA 3VFUA 3GKZA 4PJIF 5ANME 4RGMB 1IAKA 4LSUL 5FO9B 2NR6D 1NEZA 1HEZB 4UT7H 4MA3A 2VDML 5IEHB 2C1OA 2XKUA 5CINH 3PWLB 2Q86B 3GBLA 4ZSOB 2Y06L 5IGXH 3RWFA 2YPVH 1FC1A 5JXAH 1AKJB 3H9SA 5FK9A 3QDMB 3W11D 4YHOH 2IEPA 5INDA 1TZHA 3FONA 4GG8B 4LVEA 4LBEA 5MEPA 1JGUH 3MUZ1 3EYVA 5GGQH 5F88A 5I1LA 5JQHC 2E9WA 4PIRF 4PJ7F 4U1JB 4ZOEA 3V52L 4RX4D 5EZIL 3B6SA 1OAXH 1NFKA 5E03A 5EO1B 3WSQH 1BQHG 2H26A 4PRPB 3SDXF 3T0DA 3HI6L 1IGFH 4U3HA 5FECA 5C0CB 3QEQD 5BRZD 1Y0LA 1ZVSB 2D0GA 3L9RA 3O9WC 4BK5A 4DAGL 4NN5C 3Q5OA 2WLZA 1U3HB 5SWSE 4MAYA 5C9KA 3NZHH 1LEGA 4JLRB 4JCLA 2QQLL 1VFMA 2HFGH 5F7EH 4OCWH 2VQUA 3FT3A 3ARYA 4Y4FA 3W5MA 4M6OL 4WEBH 1CTNA 3I9GL 3ULUH 2VL5A 1L6ZA 4ZQKA 3U4EA 5DJ0A 3H2WA 5MP6L 1GGCH 4HZLB 4XVJH 5I1JL 5C0CE 3FT4A 4OZ4B 5A3ID 3TH4T 4QLRA 1LK2B 1R5IA 4X4ME 4WO4A 2W07A 3MLYH 4P3CL 4EDWL 2FLRT 5IW1A 3V9FA 3QCVH 1OM3L 4YXHL 4D2NA 1NCNA 3VGAC 2VXQL 3D39D 5DRZB 2DLIA 4QRPA 1FDLH 3BW9A 3MLXL 1D5MA 3B9KD 3G5XA 4MD4A 4NQEE 4KY1H 2XQYK 1MCBA 4LLWB 2JJUA 1RZFH 3I6GB 3DMMA 4AT6B 2W59A 3HNTH 3V8CA 1W8OA 2YSSA 3IFOA 1MPAH 1OTTC 5F96H 2P5WB 1FO0H 3U7WH 3I6LD 2IGFH 1HQ4B 4BSJA 1CG9B 2VLKD 5H35B 4RNRB 5F7DB 1B90A 4P4RB 5IM7A 5IW3A 4DEPB 2VITB 5FKAB 3FN0H 5DO2C 3EUUA 4PGZA 5D1ZA 4YUEH 3TZVB 3VFMB 3O6LL 5JNYA 32C2A 5DK3A 1JZ7A 3VGFA 2E9JA 4P2RE 3FAWA 1W0WA 3VXTA 3QUYC 5MENB 3CVIH 3X3GL 3MNZA 3QCTH 1JYVA 1U3YA 2EIZB 4DOHB 3DUUA 5BS0A 25C8H 4DN4H 4X8JA 4XP6H 1CIDA 1WCQA 2CRZA 5A2LH 2X4UA 4GMSH 5HHOD 5FIEA 1I7UB 2V2TA 3HNVH 2HJKA 4DW2H 3HZKB 2FEDC 3DVFA 4YHKL 4IMKC 4XHJC 5JIKA 2V17H 4A2LA 5FF6A 4H8WL 3KYNA 5EOQL 2VIRA 3V0VA 3ARVA 2QQNL 3C8DA 4YWGL 4LNVA 3QWOB 1SYSA 2VISA 4XBEL 2FO4B 4XP9L 1J1PH 4PLJD 4M9PA 4QRSB 5DMGD 1FN4B 3RVXD 5HHXL 4XGZB 1M6OB 5T3ZE 4L8SB 3FO1B 2EH7H 2CR3A 5D72L 4Z18A 1RUML 3DYPA 3WXVH 5HYFA 5IKCA 2ZSWB 5C70A 1QNZL 1T80A 1UCTA 3K4ZA 4IS6A 4L8BB 4PRDB 1JNHB 3MJ9H 1P4LA 2X5PA 3NFNB 1LNUA 4M9OA 1BWMA 2ITDB 4R0LA 4NO0B 1CT8A 5DQ9A 5EBLA 1NMCC 3LEVL 4HS3B 5FA4B 5I66A 3THMH 1NCBH 1LO5A 4OGZA 1MEXL 4TUJB 2H2PD 1YEIL 1BFTA 1NBZB 35C8L 3VXNB 1ZGLM 4HKJA 5DD1H 5GGVL 4OI7A 4CADA 4P2QA 3PWVB 2DQFA 1MWAL 4OCNC 2X4PA 4U1KA 4N5EC 4XNMB 4KTEL 4C56A 5BVPL 1QBML 1NJ9B 5D7IB 4FQXD 4PJAB 1JPFA 1TETL 3B8YA 5CUSL 2X4RA 4WWKD 3UTPE 4PRHB 4JPIB 3LRHA 4QCIB 1NAML 1NDGA 4KI5C 5ADOH 1YEGL 4TN9A 4S11A 4Z7WF 1UWXK 4F9PC 3MRIA 4KKBD 5F9WC 2X6MA 3S97C 1KT2A 4O4YH 4KMQA 4ODWB 1AO7D 2DD8L 2EXWC 5GRVK 5D7IE 2MKLC 3WNNA 3G5YA 3S4SB 4R7DA 2P5EA 4QGYA 5HDQL 2EYSB 1CE6A 4MJID 4NN6B 4OZGE 2OTUA 3I75B 1NGXA 5DD5H 5GZOC 2LU7A 2RCSH 3DXAA 2BHYA 2DDQH 2EECA 4LLUA 2XQBL 3LRGA 4HCRL 5TDOA 3GSXB 4JRYD 3ZKSD 3KS0H 1EX0A 4HUUB 1F3DJ 3KPSE 1IGIL 5DC9B 1S9YA 4M03A 4P5KB 3H7BB 3ZKQD 1JHKL 1NFDF 2EO1A 2BOBB 3K7UA 3GK8L 5DYOA 4Z7OE 1EBPA 4BH7A 5IQ9A 4JFEB 3S37X 4Z5RB 3QYCA 3T0AA 1EJ6A 3IETB 3ZTJG 5HY9B 12E8H 1PKQB 3GGWB 4V1DD 4BKLA 1MNUL 5FO8A 1M7DA 4LCCA 4C4KO 3PE9A 3LSOB 4DGIL 3RWCA 1CVRA 4YFLF 4PLKD 1A5FH 1XGRB 1YECH 1SEQH 5KSAB 3VRJB 1HSAB 4AM0A 3ROLB 1T3FB 5K93A 1EJOL 3ARGD 3VXPA 1QRNE 3EOBB 4N0YL 1BMGA 4UV4L 3CLEL 3A6CL 1RZJC 4GAJL 4JRXA 1AQDB 5L9DH 4U6XB 3QIUA 3EYQD 1PKQE 4L3EB 5D7KD 5AYUH 5F89A 4ENED 4KZDH 4G8GD 3RA7L 1PD6A 1I85A 3GIVB 3WIHH 2PR4H 1Q9KA 2XZCH 2R69H 5GS2H 3VXME 5LGJA 4NO5B 2VE6A 4U7KA 3N0PB 1F4YH 1K4DA 4G9FA 2DQJH 5CJ8A 1E4KA 1ZT4A 3T3ME 5DJDB 3HPJA 4MHHG 4U1JA 3ZKXB 2Q87A 5AEAA 2WIIA 1F2XK 2UYLA 1KLUB 1S9XA 3VD9A 3LEXA 3UO1L 5HVHB 1QBBA 1AQKH 5BV7C 3MREA 3C6SA 3D87B 4NJ9H 1AIFB 1WISA 4TNWK 1NL0H 2H2SC 1IILE 2HKFL 1IC5H 2XWTB 4RMSA 5SWQB 5JOEA 4MDIB 3S36L 4I3SH 4X6FB 4KV5F 1IQDB 2R2EB 3F8UB 2VXVH 1AHWC 2DQCL 4LGRB 2DLGA 4Z77B 3EDKA 4XX1G 4AH2A 4I0KA 4D3CL 4X6DB 1KIQA 2WQ8A 1WFNA 4HZLA 1J9CT 1RUQL 1S7XA 2Z4QB 1MCDA 4ODXB 3TVMC 1UZ6F 3V7AE 3WO3B 3FB6B 1J8KA 3HFMH 5KS9E 1J8HB 2IPTH 1NFIA 2VXUH 2Z8VC 5E6IB 2X4QA 4OD1L 3GSWA 4EUPB 1VEOA 2CMRH 2YOCA 4M8VA 1HI6B 4S1SH 3UTSD 3TV3H 4PRID 4NFDA 4AT6A 2QKIA 2VLLB 4OJFL 3LN9A 2V7NA 5E1HB 3KJ6L 1NAKH 4I9WE 1OP5H 1Z9SA 2P5WA 4KAQL 2KBGA 4HQQH 3ZDZF 2X4SA 4EBQL 5H35A 5E2WL 1BQLH 4OLUH 4P4RA 3ARFC 4FXKA 5IMOB 3C09B 2VITA 4LLYA 4NT6A 2AJ3A 2VAJA 3RGVA 3TZVA 1H3PL 5B3JF 1KN2H 3AUVA 4ETQB 1Z9MA 1SJEB 3HPLB 4OKVA 5MENA 4UT7L 1FZJA 4J6RH 2XZZA 4X4XB 3AB0B 4APQB 2DQUH 1C7SA 1A7PH 4J4PD 5JXAL 3D3VB 4WW1A 4BUHA 2IWGA 1CN4A 2FCBA 4LOUC 3QO1B 3WIFB 15C8L 4ZXBB 5AD0A 1JGUL 2AK4B 1MCIA 1SEBB 3HZKA 3BDBA 1ZV5A 2BDNH 3ALPA 3G6JA 5CD5D 4BFEA 2B39A 3L6FB 1QQDB 1U8IB 3L5XL 3WN5C 4WNQA 4MQXD 4HAGA 5DJXB 4TSBL 3W9DB 5DR5H 4Z0BH 3KYAA 1M7XA 1CI5A 4PGDB 2OK0H 3EJZD 2JCCB 2D7TL 3SKJH 1QSED 1FN4A 1LDPH 1MLBB 5F97E 2H1PL 3FO1A 1FIEA 1RIVH 3D0LA 2QSTA 3VXUD 5F7EL 3GIZL 2YWZA 1ZMYA 3S35H 5KTEL 1BF8A 4X0KB 1NGQH 4RCAA 4D0DB 2OXGA 3BSZL 3RWEB 3KR3L 4NO0A 4HS3A 4Y19E 5FA4A 3L5WA 2DYPB 3SGJA 2JCCE 5JMOC 3O9WA 4U6YB 4M7LL 1KCRH 3TLRA 5C0EA 4JQIL 3MV9B 3ECBA 4OFYA 4QHLA 4KROB 2ZG2A 1B0GB 4XNMA 4OGXH 1S9WB 4U49A 1NJ9A 4Z78A 4H26B 1MI5D 4JDTL 4PJAA 1CK0H 2X70B 3MUGA 4KK6D 3DX8A 5ESQB 3HNTL 5K33A 3FQXA 2Z93A 5ICYB 3MRJB 1FNSH 3CCHA 2VH5L 4LK4A 4NHUA 2HFFB 4MAUL 1JFQL 1A7OH 4LLMB 4YDKL 5ID1A 3DIFB 3FOLA 4ODWA 5GHWH 2R23B 1J5OH 2R29L 5IK3A 2D7MA 3S4SA 5GS1B 1U6AL 2BMKA 1Q9OB 4YUEL 5IMMA 1AC0A 5C07D 4YHIB 4D0BB 3I75A 1NPUA 1JZ6A 1LEIA 5HBBA 4PJEE 1CGTA 1NUDA 2UUDK 1J18A 3GSXA 2OR7A 1FL5B 1A7QL 4P5KA 2NXYC 2VABB 3MRMB 2WBJB 4G6KH 4KK9D 3S5LB 4PJ9C 4RZCA 4Y1AB 1E6OL 3SEPA 4E41A 1HHHB 4WW2F 4Z5RA 1EHAA 3GNMH 4G8FA 1ND0A 5HY9A 4FOMA 3GGWA 3BAEH 3TO4B 1RZGA 4YK4B 1RVFL 5TDNA 3BWUC 3LSOA 3DBXA 3U1SL 4IRJB 2GK2A 5J3HD 1XGRA 1MHHA 4K3EL 4NM8H 4U0RB 4U3XA 3PHOA 3ROLA 3P4LA 1F42A 3NCCB 5EH1A 2WWMC 3IFPA 1E4WH 2ZCKL 3IGAA 4KUZL 2NXZD 3T3PF 1XR8A 1QP1A 2HH0H 4X8XA 5C71A 5DZOA 2ZPKH 1TQBC 3GSOB 4G6AD 2VDNH 5HGDB 3UZQA 4U6XA 4L3EA 2NY2C 4XB8A 3RZCC 3KPPB 3RPIB 1X5JA 3MGTB 3R06A 3GIVA 1A6VH 3MJ9L 4IMKA 3GSVA 1IKNA 2VLJD 3MV8A 5BVJB 1U8KB 1TMCB 2QADC 5JZ7D 2YXFA 3AAZA 3THML 5I76A 4KK8C 4OZIE 1TCMA 3A0OA 4HFWB 5DJDA 2A77H 4LCIH 5FB8B 5GGRY 4AY0A 4W81A 1KLUA 2FGZA 3RUGB 3RWGB 4YNYB 2BCKA 4AJ0A 3DO7B 2ARWA 3WEXA 2D31A 3QDGD 4LMQE 4PJFB 1T7VA 3HC4L 5DJAB 3LIZL 1JK8A 3VMPA 3IDJA 1G9EA 4NNYA 4Z7VB 4OQ1A 4IJ3B 4G9DA 1D5BA 4NP4H 4U1IB 5I2IB 1UWEL 2XWTA 1RI8A 4P49A 4WEMB 2R2EA 4PJIB 3EOAA 1FGNH 4Z77A 3FFCD 2GJZA 4JE4B 4CW1B 2VTFA 2V5RA 4X6DA 3MLSH 4FQ2H 3D0VA 3ULVC 4LSSH 4IRZH 4PBWD 5JHDE 2Z4QA 4ODXA 5SX5H 3TBTB 4PJFE 4Y16B 1YMME 3VCLB 3MNVA 3EYUL 4KPHL 3ZE0F 2NTFA 4Z7VE 4JM2F 2UWEF 3WFDH 1A7BA 3FRUB 1J8HA 5DD5L 4M7KH 5E6IA 2E8ZA 4LNRB 4PJ7B 4F9PA 4K9EH 3C2AH 4U1GB 4LRNL 3ARZA 3EFFB 4P2OB 4XZUA 4JB9L 3SDXB 4GLRH 1A6UL 3VWKD 4LDLB 3FKUS 3ZT6A 1FRGH 1CGSL 3IDGB 1MCEA 3MV7E 2KPNA 3BUYB 1A6PA 1DQLL 4I0PD 4M1CC 4CRPA 1A5FL 4CU7A 1FV1B 4ELKB 1YECL 5ELIA 2NX5A 5CLWA 1T5WB 2FR4B 5CEZD 1TPXC 4YGVB 1DQJB 2CQVA 1NDMB 1TQCC 1SJHA 4M7ZB 1IGYB 2YN5A 4NNPL 5MEOB 4YFLI 4L4JA 1EGJL 5F21B 1OHQA 2XNAB 5TFSL 5ADPH 4RSVA 1UA6H 5AYUL 1FL3A 3KPMB 3HG1D 4XC3L 5EO9B 4APQA 3MOBL 5ESAA 3RVTC 3BKYH 4Q9CA 4IDLA 2PR4L 2I9LB 4YDLC 1I3GH 2NY3C 4JO2H 1U3JA 1H3TA 3RU8L 3QP3A 4ZXBA 3EOTL 1C1EL 2WUCH 1Y18B 2AK4A 3GMNB 1JP5A 3BT2L 2DQJL 1JN6B 1TZGH 5SWZE 4P5TD 4PJBA 4PG9A 3L6FA 5CHNB 5J06A 1PX3A 3AS2A 4Q9QH 3SJVA 5DGQA 3MA7B 4PREB 1HHGB 1XF3B 4M5YH 3SPVA 4OLVH 4V2CB 1JHTB 2F54E 4H25B 3V5HA 1QUNA 1AY1H 3UYPA 2F53D 4JO4H 3NCFB 1NL0L 4UOJA 1DE4A 4UV7H 1MLBA 4UT9L 2ZCLH 2ZOLB 3QUMA 3NVQA 3TJEL 1B0RA 1MVUB 5KN5A 1T6WA 3HC3L 2VXVL 3MLTB 5J56B 3MJGX 1DDHA 4B53A 4D0DA 4YHYB 2LE9A 5LVEA 4MCZA 5D7JC 2R0LL 5HHMB 1D5IH 4BQBA 1FVCB 2BX5A 4R7NA 4W6YB 5D5MF 1YEDB 3BKCH 3PJSA 4LVOC 4EJ1C 2IPTL 1TTGA 4MJ2A 2GT9B 3VGGA 2YC1B 1JZ3A 4Z9KB 4ORGA 2ARJQ 4JFQB 1AHWA 3WE6A 6CGTA 2D3VA 4S1SL 1AFVH 4LAJH 4POZD 3B9AA 3PIQB 5DVMA 1D5ZB 1C16A 1IC1A 5ESQA 2BZDA 3BGAA 5HJ3A 2ED8A 4QY8B 5SV3A 2AGJL 4OIIH 3VGEA 1UJTA 2VLRD 1NAKL 5ALCL 3TVMA 1N7ML 5IT2H 5I9QB 5E2UL 3DIFA 3RI5K 1BQLL 1D9KC 4L8DB 5ABDE 4ZFFA 1N6QH 4G6JH 4CDHA 2DTMH 5KVEL 3IU4L 3BJ91 1CDCA 1L6XA 1Q9OA 3KYOB 2CO7B 4YZFF 4GG6F 2G5BB 4D0BA 1MWAB 2IF7A 1IM9D 2NPLX 4Y2DB 1EIBA 2J5LC 3WFBL 3MUJA 3TBSB 1HKLH 3FO0L 4J6RL 1FL5A 1G7MB 4C55A 4WI4A 2PO6D 3KXFA 3MRMA 4P3DA 5JOPD 2DQUL 2VR9A 5FYLD 2VDQH 2A6DB 1P6AB 5L2JB 1NAMB 3QUXD 3TPUB 5LXGH 4OZHF 43C9B 3ARFA 2Y6SD 1KIPB 3UYOD 1OP9A 3SCMB 1XF2B 1D3CA 1YPZE 4NKMA 1JWUB 4CUCA 4ZFZA 4TVSa 2WLYA 3T65B 4FZ8H 5MHSE 1UG9A 2WK2A 4U6VH 5JW3L 3QPXH 1GZPA 5J1TC 4B50A 5CEZH 1CFSB 1G7JB 3T0ED 4Z7WB 5BXFB 5D70H 4RWHA 4LKCB 5DR5L 1DLFL 2EEAA 1XGTB 5FCUH 4NRXB 1SY6A 4ZYKB 3EYSH 3SQBA 1LDPL 4JRWA 1KEGH 1DFBL 3VRIB 1OP3H 2CKBB 1RIVL 4F15B 1KEML 3IAQA 2NY6B 1S7QB 3KPPA 3QHFH 3MGTA 3VDBA 1DL7H 3CSBA 1T7YA 1NGQL 2W9DH 5EBWB 4HC1L 3WN5A 2OXHA 3WMSA 5IMLA 1HNGA 4FQLL 5D6DC 4HFWA 4NN7C 3TGXA 2VUOA 1JNNL 5BOPA 1KCRL 1NFDB 1LP9E 1EEYA 3LAFA 3S37L 2CLVB 1QBLL 1SMAA 1U8OB 1C5DB 1QR1B 5T1KB 2C3VA 2EE2A 1QSZA 1EAPB 3D69B 1BZ7B 3O2VH 5FUZL 3GKWH 5DJAA 4ZFGH 7FABH 1HZHH 4KU1A 4DKAA 1S3KH 2P44B 4JEGB 5JR1H 2ICEB 5HHNA 2FX7H 3VRLE 3G6DH 2QQQA 4EI5D 3ZL4H 1FNSL 1Q0XL 1RUKL 4PJIA 1MJUL 3HNSH 4CW1A 1Y6MR 4YX2L 4RA0C 4RMQA 3G5ZA 2ZUVA 5C0DA 1S7TA 1T21A 1XH3A 5CWSA 4BFIB 5TE6L 3QUKB 3ULUC 4YDJA 4CN4A 4DFHA 1NCCL 5DHXB 5DQJB 1G0XA 4X4YA 3RWDB 4OF6A 4RGOH 4CVXA 1A3RH 2GCYB 2VAAA 1MREH 1VFUA 4LNRA 2AS5M 3N1GC 2E7LC 4I2XA 2B4CH 3QQ4A 3SDXA 4NQSB 3WBDA 4W6WB 3PNWB 4XNUL 3VXOB 3X11B 3N1QC 3PP4L 4UU9B 5BOZG 5T3XD 3ZMRA 4RMTA 3OB8A 5D7LD 5DQDH 3NPSB 1W72H 1DQJA 5E9DA 4OF0A 4PLNC 4U1LB 4PJ9A 2CDGB 1RZKC 2FECL 3LDBB 2XNAA 4JZOB 5EU4B 1H0DB 3IFNH 4KZEH 4HXBH 4BM7A 5J7CC 1C5BH 3KPMA 2Q1EA 2FZ3A 4IRSD 5TH2B 3P0YL 2BVQA 3HAEG 4NQCD 3JVGC 4ZS7H 4WFHE 4D9RE 3HE6C 4XP1L 2MMXA 2IQ9L 4CKVX 2IH1B 3VDCA 3JV6B 3ZSSA 1RZIB 3VI3E 1A9BA 2OI9C 1JGDB 1Q1JH 1JYXA 1MY7A 1A6AB 3QXDB 4XC1L 4CU6A 3U9PH 8FABB 1BEYL 3K74B 3JWDH 3BH9B 3MLRL 1BD2E 5CHNA 3MLUH 1NEZG 2ORBL 3TN0B 3MA7A 1S7VB 4M5ZL 4PB9L 1XF3A 3T0WA 4DVRH 2P46B 1I9IH 3CK0L 2BVEA 4UIMA 5DK0B 1JHTA 4P23B 4H25A 5IFJB 3ARQA 1UZ6E 2XYCA 4YE4H 3RZCA 4W4NA 5GGRA 3UX9B 3DETC 3MBEC 1ACYH 5T5NG 1J87A 4D9LH 2BNRB 2YN3A 2ZOLA 3UC0H 3GI9L 4HUVB 3OF6A 4JFHD 2NZ9C 2ZG1A 1QPPA 4O2FB 1OAUH 4MB4A 5F7UA 3QA3A 5BO1H 4UBDC 1MFDH 4ODVH 3O41B 3BGFB 4LSSL 3O4LD 4FQCH 4RA3A 5C3TA 1Q94B 5F71A 3ZDZE 5IJVA 1MIMH 5CBAA 1YEDA 4OGAD 1OW0C 1VEMA 1FH5L 5C0RH 5E2JA 3UXFA 4K94H 4PGCB 3LB6C 3ZDXF 3CH1B 1Q9WA 4ALAH 5T5FL 4PRBA 5DJZB 5KAQG 2N56A 3BPCB 1B2WL 2AJXH 3C2AL 4K9EL 4YHLH 3WS3B 2VZOA 2XN9B 1PG7X 2JJVA 5D2LF 3BQUC 1OGAB 2IALB 2HJLB 4MGXA 4QY8A 1JE6A 1FRGL 1XT5A 3WFHA 3LD8B 2X1OA 3HE7D 4GMTH 1KJ2H 1RD6A 3MC0A 2NY1B 1AE6L 5GXBB 4GBXD 3SE4C 4JDVB 4QXUL 1INQA 4GS7C 3WKNA 1GC1H 4Y2DA 3UJIH 4EIGB 1NUFA 3NGBC 3GMMA 4WTXA 1HHIB 3GUTB 3TBSA 1ZHBB 5F7FA 3T1FA 1OTUC 1F45A 1G7MA 1KTRL 1TJHH 2IANB 2IG2H 3CXHK 4FXLA 1SYVA 3BYYA 4WCYH 1G6RH 4G8EB 5D8JH 2G5RA 2J1KA 3VH8A 4ZDHB 3PWPB 4GKSA 1IRAY 2L7UA 3O2DH 1D5XB 2HG5A 5K9KB 1MHPH 1F11A 1TZGL 1UKTA 4Y5YB 4MD5A 5T3XH 2VUYA 4XNZC 1CGXA 5IBLC 3VFRB 3D9AH 2BNQE 1CFSA 3BEWB 2ZUYA 3G04B 4M5YL 4JFDA 5IVXF 1K5NB 2Y1VA 4CMHC 3VFWB 5DVOA 5HI3C 1XGTA 1OPGH 2OBGA 1AY1L 4HPYL 1K8IB 2H9GB 1V5JA 2P8LB 4X4ZA 3BP5B 3O3AB 1TCRA 1YEEH 4JO4L 5CJBA 4TVPD 2GY7B 1EFXA 4N0UA 5TDPA 4ISVB 4RWYH 2CKBA 5A2KH 1RULH 3BIAX 4QXWA 5EU5B 1B4JH 3TWCH 2Y07L 2A6IB 5HGHB 4MAYD 4RMUA 5IHZB 4UTAL 5EU3A 2RR3A 5EBWA 3RKDD 2O93L 3LQAC 5D96B 4P46B 5I1IH 5C0BA 4YH6A 1CQKA 2VZ3A 4Y4FD 1BFOB 3SE9L 4M8QB 2Z91A 3VFOB 2CLVA 4MQ7B 4ONGL 2X44D 2ICCA 2M8XA 4WW2B 1EAPA 4DGVH 4LL9A 2FL5A 3C08H 4JN2A 5EPMB 3BDYH 2JTDA 4WO4D 4BSWA 3WJLC 4A6YL 3KGRA 4TRPH 4N8CH 1YQVH 1MCFA 2RFXA 2HTKD 4QRPD 4WJ5A 5DVKA 4G43B 1QKZH 2NLJB 2Y72A 4OIIL 4LLQB 2WZPD 2YUWA 4HPOH 3F5WA 4NJAH 1FORL 5IT2L 2YBRB 3DMMD 4OF7A 5SV4A 1P7KA 1DVFC 4OCRH 5E8DL 4H20H 4FHBD 1VDGA 1MAMH 4HUXA 2ZNWA 4QYOB 3QUKA 3DPBA 5AWNH 5ITFA 5DQJA 3GO1H 3RWDA 5IB3A 3D25A 2Y7QB 2GEEA 3CX5J 2GCYA 2IFGA 1JWSB 5D1ZD 3WIIL 5H37H 1T1XB 3KNBB 4R97B 4NO2B 1FYHB 4HX1B 4FQIH 3VFTB 3HRZB 2HKHL 2VDQL 2NW2A 5FOJA 1CR9H 3ROOB 1D9KA 4WRLA 4J1UB 5LXGL 4HUKB 4XWOD 1KCVH 1YUHA 4OLXL 3EBAA 3GSUA 3TCLB 2NCMA 3PNWA 5DJCB 4Y0GA 3LN4A 3U30C 1UADC 5EU7E 2I5YH 1MJ8L 4RGNE 3VI4F 3VXOA 3X11A 3QEQE 5BRZE 4UU9A 1WGOA 2W0FA 5CEZL 4N1EA 3TF7C 2YZ1A 2NZIA 1OP5K 4LIQH 2R2CA 4PV8A 5D70L 3HKFA 4QO1A 1A8JH 1KCSH 1XZ0B 1ZGLA 3D39B 1BBDL 1MJJA 5CP7B 1R0AH 1V3LA 2CDGA 3RWJA 3IDYB 1OSZB 1I9JH 4MX7B 5C08A 5I8CB 5EU4A 2DWEB 1KEGL 3B9KB 5ANMA 3ARDC 3DROB 4NQVA 4JM2B 2UWEB 3QXAB 3B2VL 2A6KA 4Q7DA 3Q5TA 3VFNB 3Q1SL 1IGCH 1RJYB 1HINL 2C3HA 1JGDA 4LFHD 2VLKB 4NSKA 1U8HA 3ZHKA 3JV5A 2FB4H 3O6KH 1KPVB 8FABA 1PG7H 1T7ZA 2AEPL 2HYMA 2HVJB 3TN0A 1SMOA 4YEFA 1ZA3B 1LWRA 5GRZA 2BNUB 3MCKB 3ZKMC 3O2VL 5DK0A 4QHMB 1H3WM 3GKWL 1XCQA 2W0LA 7FABL 1JGEB 4O9HH 2X10A 4P2QD 5EWIH 3RIAK 1I8MB 4C56D 4LKXB 2EDOA 3S8WA 1Z0NA 2AXFB 4ZD3H 5HDOA 4E9LA 2BSSA 1ZHKB 3MRDB 4RBPK 1YYMH 1XCTB 1F4XL 5C9JB 4CN1A 2F5BH 3NOIA 3G6DL 3QFDB 5CGYD 5HHOB 2X42A 4NQXB 1IEAB 2AQ2A 2CUIA 3BPLC 5ICZB 1HHKA 1VESA 2VKWA 5HVWA 2Q76A 4WDIB 1E4XH 4JPWL 4ZFOA 5CJQH 4ZO9A 5EOCH 4C83A 5FUOH 1ULVA 2DQGL 4OFIA 5J11C 1OAQL 2R2BA 2BVYA 2R1YB 5C0FA 4KQ3L 3O8XD 4OQTA 3C8KA 1NMBL 2E8YA 3RTQB 1OLZA 4XWGH 2G60H 2P5ED 3CH1A 2P7TB 3SGKC 5C0NC 5HHOE 3BPCA 4PJCF 1FJ1B 4N1CA 4EKXA 4PPTA 2MHAA 4HLJA 3DXAD 4GRWF 2B4CL 4ONHB 5A40E 2CIIB 3VW3L 4GXUN 2YEZA 2JJWA 4NQEA 4U1SA 4XPBL 3STLB 1G7IB 3QISA 2VZ1A 2G75A 3KPLB 5A43C 1UM5H 1FIGH 1LE5B 3BZFB 3GI8H 4DTGH 1MCSA 1JTPA 3EOYG 4JPVH 2XZAH 2BHUA 2ZUXA 4FQQA 1T2XA 5C09E 1KGCD 5J12C 1NCAH 2FECI 2B1AL 1AGFB 3C9NA 3ZKNC 4EEEA 2CGRH 5FOBB 1P9MC 3IDMB 2O5ZL 2E7LA 4MHHI 3SKUD 1WBYA 4FQXB 5ACZA 1IC4H 3FO9B 3QZWA 3EYOB 4HXBL 2DQIH 4DUXA 1C5BL 5FYLL 3IFLL 5CGMA 4JO3H 4XNYH 3PWPA 5D5MB 1QSFB 1A02N 3LMJH 4ZS7L 3FTGA 4JRXD 1D5XA 3QIUD 1FZOB 3DI2B 1FO0A 1Q1JL 5BZWB 1K9TA 4HIEB 4DGYH 3BI9X 4LHUA 4N8VB 1AGCA 1U8NA 1AO7B 4FZEL 3U9PL 3EKCA 3QJFB 3CXHJ 3GHBL 2VZTA 5GJSL 4S1QL 4HLZH 4XBGA 4GQ9L 4G9FD 3G04A 4GW4A 4DVRL 1GZQA 5IQ7L 1I9IL 4MJIB 5D71H 4WHYG 3VFWA 3KS0J 4OFPA 1HXMB 3OKLA 1YMHB 4JFOB 2P8LA 3GBNH 3BP5A 3O3AA 3ZZ1A 3JVGA 4JRYB 3TT1L 3HE6A 5LQBH 1IBGL 5EOTA 3UC0L 3LEYH 1CFVH 3UTTB 1OAUL 2A6IA 4GAYB 2ZJSH 4KRPD 5BO1L 5IHZA 4GG6B 4FXGB 3MRGA 1INEH 2R8SL 3R1GL 4V1DB 4MJIE 3U9UB 4P46A 1QZ1A 4CMMB 3QJHA 3LKNB 5I74B 5DI8B 1QFOA 3MBEA 4G42B 1FFNB 5F44A 1RHHB 1BFVH 4OZHB 1ZVHA 5C0RL 4XPHL 4QHNA 2A83B 3V4UL 2WP3T 5EPMA 3ARGB 1KB5H 4ETYA 2EDDA 3BPOC 2Y23A 4ALAL 1LO2L 4GG6E 3OXRA 2AJXL 3IF1A 4JY5L 4K7FB 3LZFL 4HXAH 2ZNXA 4X6EB 1MSPA 4GLRI 1A2YB 3CXDH 2BJML 3VD4A 5DHVB 2YMXL 4AEEA 3P4OA 5EB9A 4IIQB 1ETZB 2G9HB 2PW2B 2XKNB 3QQ9C 2IADB 2YBRA 3TBVA 1OW0A 2BVTA 4GMTL 5D9SA 4PV9B 5K9OB 3Q5YA 5L2KA 3IKCB 2P5WD 4R4ND 1MCOL 4WGVB 1G7PB 3VG9C 3HC0B 3WLBB 4QYOA 3KYKH 4FQ1L 5D7KE 3UYRH 3DWTA 1IGML 4G8GE 3UJIL 4WFFE 5SX5K 2BOCA 3BQUA 5DC0A 1JWSA 2OJEB 4OZGA 3KNBA 3RGVD 3U2SB 4WCYL 1TJHL 1I1AC 2IG2L 4HX1A 2HT2D 2ZG3A 3HRZA 1N5YL 1PY9A 5FYJH 1G7HA 1MY5A 2VN4A 3WLWC 4IOFC 5MEND 4M6MH 3ARSA 3INUH 1A1MB 1EO7A 4KK5D 4J3XA 4F7EA 3S4SG 3TCLA 4LCWB 4LCUB 1AXIB 2XI9A 3SE4A 5FGCE 4U0QB 5T3XL 4G6FD 3D9AL 2LVCA 4K23H 4TPRL 2VXSH 3O3BA 5M7QA 1RUPL 3D39A 1P4BL 3JWOH 2A9MH 1MHEB 2YKLL 3BKMH 2CPCA 1OCWH 5FYJE 4RRPA 4HUWB 1RULL 4LAQL 1JYNA 1CIUA 3UTSB 3K8KA 3DV4B 1B4JL 1EFQA 3TWCL 2EE3A 4PRIB 4M61B 4LU5L 4M1GH 4JM2A 1T5XA 1DQDL 4OTXL 4OD2A 3VFNA 3C5ZC 5IBTL 1CLYH 1XAUA 1K4CA 4PG2C 4K71B 4UT6H 1XGYL 1RIHH 1CLCA 1MCPL 3SE8H 3S9DB 5DMJB 4BZYA 4Z8FH 2CSPA 2FYYB 3PG2A 1ORQA 4W68A 4Q9RH 2LU4A 4ELMF 4JN1H 3MCKA 1R3IH 3P0GB 3QAZB 3T77B 3UTSE 1J0ZA 3C08L 4FNLH 2AXGB 3BDYL 3O9WD 3DX7B 1A1OB 4C59B 4FP8H 2XRAL 4OFYD 3RWIB 1I8MA 4OCYL 1QTYT 2AXFA 2O5YL 2H6PB 1ZHKA 2DQHL 1R3LA 4U1HB 3SGEH 1K3ZA 1NBYA 4HIIA 3QEGH 5I1DB 4JG0H 4Q2ZB 1MLCB 3WIH