4LLYA

Crystal structure of pertuzumab clambda fab with variable and constant domain redesigns (vrd2 and crd2) at 1.6a
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
220
structure length
220
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFTDYTMDWVRKAPGKGLEWVADVNPNSGGSIYNQEFKGRFTLSVDRSKNTLYLQMNSLRAEDTAVYYCARNLGPSFYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVATGPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords mutated Pertuzumab Fab heavy chain
total genus 48
structure length 220
sequence length 220
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llyA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llyA01
5ESVA 3SDDA 4QRQA 1MRDH 3MRJB 1RZIA 2PUQT 3IDYC 3P30L 1FL5B 1YEGL 3L3OA 2LAGB 1HILB 4HUNB 4X7TB 3AXLA 1Q94A 1P4LA 3S36L 4C4KT 1LILA 2IPKA 3CK0L 3UZEA 2VE6B 4M93C 1JL8A 3FB6B 4X0KB 5I19H 4NQXB 5I0ZA 1F58H 4M03A 4RSVA 4X4MA 3T0BA 2E7MA 2GFBB 4NNPL 1T7XA 4K9EH 5F1KC 3ARFC 3OAYK 3MRBB 4OKDA 1KLGB 5F9WB 3HG1B 2HG5B 3H7LA 3CX5J 5E00B 2AK4B 4OIIH 4BQ8A 1MFAH 1TLKA 5IGXH 2G5BB 4DZ8B 2Q3ZA 2P8PA 1ITCA 1PQZA 1VDGA 4JKPL 2QHRH 1Y0LB 4V1DE 4NYLB 3MRCB 4MD0B 5D2LA 3WFEL 3HNTL 1G7HB 1W0WA 2YMXH 1YECH 4FQHA 3FHQA 4PPTA 3IXAB 1KIRB 2YMXL 2X4PA 2APTA 4I0PD 1BM3L 1E4XH 4HZAA 5C08E 2WBWB 4NWTL 3GSOA 4S2SB 5E8OA 3VCLA 1RZKC 3MXVL 4YXLH 4RX4A 5MERB 4BH8B 3MLWL 1ZHLA 2QL1A 4EUPA 4NM8L 1ZSDB 1X4ZA 1NCDH 2NY1D 1T1XB 5F1SA 1NFIA 1XF3B 2JCCF 3P9LB 3Q3GB 3LCYA 3O2DL 1P5UA 4NWUH 2D4FA 3V4VL 4RGMB 4NDMA 5DC9B 1B4JL 5ALBH 4QXTB 1RK0B 4WO4B 3MUY1 3RGVD 1T89C 1XF2A 4R3SB 5IVXB 5CP7A 3BN9D 2CRYA 4PS4L 5F72S 1X5HA 3M07A 4DN3L 5IESH 2BNQA 5HD8C 4I2XE 3IXTA 1BZ7A 1J8KA 1ZWIB 5ENWB 1FFOB 2LQRA 4F3FB 5JR1H 3AM8C 3DTXB 3VXQB 5DRNB 2ZCLL 3SGKC 5HVFB 1ZV5A 3EYVA 4LSTL 1V7NH 3WFHA 1I3UA 1PZ5A 3PWJB 1H3PH 4KK5D 2A6DB 4ODUB 1QNZH 1QBAA 2WUCL 3OSKA 4P4RA 2ZSVB 3MOAL 1OTUC 3B8YA 4JFEB 1OTUD 1VACA 5D96B 1ACYH 4MZ3A 4HBCL 2SEBB 3UC0H 3VXSD 1PW3A 4G6AC 4WWKA 3TH3T 4QKXB 4QHNB 4DK3A 1HI6B 5I74C 3QO1A 4QRTB 1FBIH 3P4NB 3WLBA 1MRCL 1GZPB 4LSSH 1AGCB 5IMLA 1AGFA 2R1WB 2FB4H 3IDGB 2X41A 1ZANL 2J2ZA 2BY0A 4FXLA 1JYVA 2D3VA 3SGJA 3RNQA 5D7KE 2XY1A 1XGUB 3TO2A 2GT9A 5D1ZB 3BHBB 4YHNA 3BP4A 2HFEA 1EO8H 4JDVA 4ORGB 4HK0B 1S7WA 1R5IA 1EH9A 5TQ2H 4ZOBA 3UTSE 5JXAL 4FZ8L 1B0RB 3QFJD 5HJ3B 3O0RL 4ELMA 4YFLI 4M8QA 4I2XA 4R6UA 4R2GD 5EU6E 2GK0A 1ZGLA 3HTLX 4AEIH 5CD5D 4KMLB 5CUSH 1DQJB 1H8SA 4N0YL 2VJXA 1NEUA 2W91A 2H1PL 1LO3L 3U7WL 5BZWB 3UJTL 4H0HB 3ARBC 4M7KL 2YZ8A 5LCVL 3T2OA 2UZIL 4MS8D 1H15B 4J12A 4P5KB 5DFVD 1I1FA 4XAWL 3RPIA 1L0QA 4HAFA 5MHSE 5I1IL 1P2CA 4IIQC 1IAOB 3BAEH 1AD0A 3EYQC 4IS6A 3T3ME 1TZHB 4YHYC 3CU1A 4EIZC 4DW2H 4G8EB 1EEZA 1TETL 3Q48A 4R4BB 1YNTB 1HH9A 2BMKB 3TBWB 5HI3D 1AC6A 1OGAA 1CVRA 4Q2ZA 3JWDH 4JQXA 5HDBE 1EGJL 4BSWA 3GBLA 4PGEB 1EIBA 3ULUC 3AAZB 1WSST 2EDDA 4PJXF 3HE6C 1S5IL 2JIXA 2PXYC 5J12B 5JA9A 1UGNA 3LVEA 4LDEB 1G7PB 2YBRB 2FATL 4DN4L 5IJVB 1RJZB 4J1UA 1QBLL 4OGYL 2PW2A 4FFYL 1XGRB 5E2UH 3O4LA 3DBXB 4KKLD 5JPMA 4AZ8A 2JIXD 4WNQB 2VXVH 3T0EC 4HGKC 5C70A 2APWA 4M48L 5B38G 5DQ9A 4GOSA 1U2HA 2Z92A 1VPOL 4TULL 3VWJB 3BRGC 4Z95L 3S5LA 1CLZL 1ZVSB 2DBLH 4FQJH 3O6FB 3E6FA 3WE6A 1X5AA 1DEEA 4S2SA 5E8OB 2XIDA 4GW5B 2V7NA 3CLEL 3LOWA 5KVEH 1N5YH 3O11B 2X89A 5JDJA 1S7RB 1SMAA 1URLA 4FQXD 4ZSOE 2VXQL 3OKYA 5DD1L 1JE6A 4MJIE 3D3VE 2OK0H 1MHCB 2P4AB 5E2WH 3Q1SL 4RMTA 2MHAB 3ORJA 5FCSH 3BJLA 2VXQH 2J8OA 4U1HB 4H1LG 2JB6A 1OAKL 3NCCB 4ZXBD 3BQUA 4G80A 1NCUA 4KY1L 5D1QA 3E6HA 2W0PA 3BUYA 2O5YL 3MOBH 1K8DB 3VJ6B 1X5IA 3QQ9C 2DOCA 3RL1B 4CU7A 5CSZA 1TPXB 2JTDA 5HHOA 3LRSB 3PHOB 5IB3B 4LVHB 3OKOB 1A2YB 5EU6B 1A1MB 2WINA 3W2DH 4HX1B 3RVTC 4YDIH 5T1LA 1CFVL 4ODSL 5M7QA 3GMRB 3FO9A 1VACB 5E99L 4N5EC 1XIWD 2H6PB 3P73B 1UCBH 5EBWA 3O8XD 3UTQB 3OKMA 1DQML 4PJHB 3RJQB 2H9GB 4RBPK 1I7RA 1C1EL 1I85A 2DLFH 3IDGA 1U2CA 1IE5A 3CCHB 3AB0B 4QTIH 4Y5XA 1XF5A 2AK1L 4LCYA 1OGTB 1M05A 2D7NA 3VFGH 1G9ML 4HK0A 2HKFH 2DDQH 2E9JA 2GUOA 4JB9H 4LARH 1RJLB 1T4KB 3NN8A 5L2JB 1UA6H 1R24A 4OV6F 1ZLWK 1Z9LA 4LLWB 3MLXH 5CGTA 3STLA 2VAAB 4PP1C 1OM3L 5D2NE 1YYML 1NGPL 2EIZA 3VH8G 1LD9A 1MFEL 3SE8L 1AXSA 5DT1H 3RUGA 1VEPA 4Z7UB 1X5KA 3DX8A 3VXTB 1T6VN 1DQJA 3MFFA 1IQWL 1XH3A 5HGGS 3TH4T 2Z8VC 1ONQB 4GMTL 4MAYB 5ANME 2CIKA 3I3BA 3MV9D 4GXVL 5EOCJ 4LFHD 2IBZX 5IP4A 3UJJH 4FABH 1MCWM 2RJMA 5DGQA 4W6XB 4M1DL 2HT3D 3GUTA 1QFWL 1WITA 1BECA 3QJFA 3VFNA 3O6KL 3VFRA 4LCWB 1F6AB 3TGXA 3KPRB 3P4OA 4KKNA 1ED3B 1A21A 3TBWA 3N9GL 2ATKA 1OARH 1EZVY 4RMSA 3HS0A 3L3DB 4H20H 3R0NA 1P9MA 3MUHL 4TOYH 3TCLB 4OZIA 1TZIB 1DFBL 1JF1A 2EH8L 3RWJA 2I60H 2KZWA 3W9EA 4MA3B 1F4AA 5FK9B 1UVQA 5EO1A 4XX1G 1H3PL 1RJZA 4FP8L 3KPSE 2DQDH 3DI3B 2JLLA 5D7JA 1NCCH 4MA1B 4D0DA 2AJXH 5AD0A 3VXUA 5EOQL 3ZMRA 3O41B 1X5XA 3VMPA 2W0FA 4XCFL 4AQ1B 2V17H 1S5HA 4F7PA 3U46A 3DMMC 4ZFFB 5K9KB 4V1DA 1YY9D 1GAFH 3QUYB 5C0BD 4L4TE 2WW8A 2XI9A 1CDJA 2AJUH 5I73C 5F1NB 4YHLL 2ORBH 1KIQA 3WDJA 3OKNA 4HUWA 3HMWL 3V52H 2B1AL 4S10A 3BKYL 4M1CC 3S98A 5C07E 4BSVA 1KBGH 2X9XA 4JDTL 2OR9H 5MENE 4I77L 3VGAC 2DQTL 3QQNA 5LAXA 5GRVL 3GI9H 5EA0L 2A77H 4U1HA 3HMXA 2PCPA 3FB7B 4I48B 4QRPA 4MJIA 1FO0L 4KXZI 5DK0A 4P46A 3KPSD 1YPZA 1UJTA 5D1XB 2HJLB 3MJ9L 4PB9H 4WCYL 5CJBA 1RFDH 1OM3H 2VLLB 4JVWA 3LRSA 3ZTJH 5EUKB 5GS2D 3WFEH 4XPHH 4HLZG 4PGBA 2WLZA 5DSCB 4PGCA 2HT4C 3LPFA 1U92B 2HMID 1YN7B 4YNYB 1U6AH 1WF5A 1K4CB 3ARBD 4L4TA 3VFTB 4RWYL 1KTLA 4WFGE 3RWFB 3TN0B 4GRLD 4NKMB 4JY4A 3MV11 4JREC 1QKZL 2YPLE 4J8RB 4DVBB 1Q1JH 3P4MB 1IC5H 2J6EA 1UH4A 4X6CE 4P4KD 4XAKE 2MKWA 5FXCH 1U58A 2NR6C 2R69H 5E8NB 5GISL 1A22B 1MCWW 4LCYB 1A6AB 2EE9A 1OGTA 2X4NB 2DM3A 5D7SL 1HHIB 2Y9RT 3SJVA 4IJ3C 3O8XA 4MVBD 1KEGL 4U6VL 4ZD3H 4R26H 1CQYA 4U6XA 3B2VH 4DUXA 2CD0A 3JTSA 4Y4HB 2VAAA 3U0PB 2EIZB 4Y7MA 4ZPVB 5GS1A 5BRZE 1YEHH 4HS3A 4PJ5A 5FOBA 3N1PC 3BJ91 4HH9A 4JO1L 2MJWA 3L95B 5HPMB 4HWNA 3RIAK 1II4E 4GSDL 1FO0H 4FXGA 1UXSB 5L0QB 4Z5RA 1BFVH 5HHOD 3ZKXB 4KROB 4M3KB 4O2CA 2H2PD 3E8UL 5DD6A 5KS9F 1JPTL 1ZHBB 3C60D 4KK6C 4Z95H 1KBGL 4JDTH 4JDZA 4RDQG 4XI5C 4PJGF 2VISB 3U4EB 3GZKA 3MLUH 4LPUA 5FYKD 3VFNB 1NMBL 3IRPX 4GKSB 1A6VL 4O4YH 2PYFB 3HMWH 2VZTA 3KPRA 4P2RD 2VLRB 4UT6H 1ZAGA 5A40E 5D7SH 2BY2A 1H3GA 2A74B 5IG7A 1HQ4A 2XG5A 1EXUA 4N90D 3MRNB 4N0FA 3HS0B 3JV4A 2E9WA 2AAVA 4JRWA 1NAMA 4XP6L 3ARXA 3PV6A 5T1KD 2DQGH 1YQVL 2BP3A 3BDBA 1N0XL 5DA4A 4YBLB 2F54A 3D9AL 5FDWB 3QWOA 5HYQA 5AYQA 3KWWB 3JWDL 3FMGH 3D69B 1EUTA 4J2XA 3ZL4H 1FYTB 4DN4H 4D94A 2PXYA 1S7UB 1J1PH 2XYCA 1QSEA 4PJIF 2Q86B 1A6TA 2ARWA 3FT4B 1N59A 4LAQH 4PRIE 4LSVL 5GGSA 4JZOA 1EEYA 4M9PA 1S7SB 1T5WB 5GXBB 3FFCB 3U46B 5E24E 1MCIA 3ARDB 4C4KO 1FFNB 5FYKE 3O3AA 4ZO8A 3MO1B 1N6UA 1I9RH 4QRRA 5E4IA 3OQ3B 5DHYB 1FYHB 2VL5A 1KIQB 1U8MB 3VRIA 1J87A 4R97C 4OQ1A 4FQLH 5F7MC 1FE8H 2HFFA 4S1SL 4KK6D 4KRNA 1RUMH 4KK9C 2NXYB 1G9NH 5I9QB 2DQEH 2I24N 3D6GA 3ESUF 4NHCL 1Z0NA 1U8KB 3O81A 5D70L 3SGDH 3OHXA 4F9LC 4CU6A 1LDPH 4KROD 1F02I 4FZ8H 3TBYB 5FCUL 2FX8H 2Z9TA 3GSXB 4F15C 1G7MA 1P6FA 1QBBA 1G9NL 1WFTA 4JN1H 4OD2B 3N1QC 3DXAA 4N0YH 1T2JA 3MODH 3MNVB 1IGYA 5JIIA 4JRYB 5F97E 2NY5H 5D2LF 3GIZH 4BZ2H 3O0RH 4OGAC 5GS0H 4NOFA 5CLWA 4PP1D 3DVNB 1RY7B 3MMEA 2Z31C 1MH5A 1JMXA 4G8GA 1MJ7H 1VGKB 2X4SB 4MB5A 1MCKA 1RUPH 4G9DB 4B0MM 5JNYA 1KEML 3BPCA 1HINH 4GW1A 4FQLL 3LPGA 5D7LE 3SDYH 4TNVK 3WO3B 4L8SC 2IMMA 1ZVHA 2J88H 3CC5B 5CEZH 5IVZA 1CFTA 5FKPB 4WUUE 2XPGB 1IEAA 1AY1H 4MYWB 2WIIA 3F12A 4WWKC 3IU4L 4LSSL 5T1KB 1VA9A 3MRMB 3TN0A 4KQ4H 4CVWA 1VESA 2Y6SC 3AY4A 3KR3L 3MROA 3OAZH 1S7TB 3SKJH 1FRGL 4HBCH 5B38B 1R3LB 4ODBD 2B1HH 5E0QA 3SKUD 1NCWL 1NJ9B 1KB5H 1YJDC 5IMKB 5FM4A 3SDCD 2DQCL 4LASL 5ADPH 1FFQA 5E8NA 5F8RC 3ZE0E 4JEGB 3EYQD 4MDJA 3W5NA 3FMGL 4GRWF 3BISA 5F7KC 2DI8A 4CN4A 2ICEA 3WD5L 1QYGH 1H3VA 3MBEB 1P69B 2VABA 3O6LL 4JFZL 3VG9C 3DRTA 5KZCB 4G43A 4A2MA 4X6CA 3BW9B 3CLFH 3V4VH 1MWAL 4HC1L 5TFSL 2K9UA 5DMJB 5JLZB 1G0XA 2DQGL 1IJ9A 2B5IC 3BEWB 1XGPA 1A6ZA 3GRWA 5IOPA 2GTZB 2DM2A 3HI1B 3NCEB 5JW5A 1MCBA 5D7LD 5DO2C 3HPLB 1A6UH 1YEIH 3V6OE 3V6ZB 4XWGL 4Y4KD 1CFSA 4K7FA 3T2NH 3BIKB 1SYVB 4NRXB 1S9WA 1A14H 4OUUB 4I3GA 4C59B 1TVHB 1TZGH 4XRCA 3SE8H 4LKCA 1RUKH 4XNMA 1FN4A 3CFIC 3O2DH 4ZQKB 2YPVL 4NRYB 1CBVH 2VDNL 3TV3L 4LIQH 3MCG1 5DJZA 4YXHL 1YZZA 3SKOA 3WFZA 2F53E 3IJYB 3EOAB 3T08A 4YHPB 4KGLA 3QH3A 4FMFA 3KPMA 1MHPH 3HB3D 5IKCA 2D31A 2WK2A 4KRPB 1A3LH 4ETQA 1WC7B 3RZWA 4MNGE 1L0XA 4DEPB 4H5SA 5DD5L 2WBJB 3T77A 7FABL 3FT3B 3B5HA 2AGJL 3QNZB 4BQCA 4L1DA 3WNLA 3CMOL 1R3IH 5KW9H 5HYQB 4KK5C 1TJIL 3Q6GL 3QSKB 4I18C 1BPVA 5GZOC 4GKZB 2F8XC 4K23H 2CDFA 2E8YA 2AV7B 5GS1C 5IB4A 2GY5A 3MTRA 4HGWA 3B9KB 1AKJD 3CDYA 2Z4QB 3QUZA 1J8HA 3FB6A 4RQQA 1CD0A 4NQEE 1MCSA 2R0WH 4NQXA 5C92A 3ULUD 1BBDL 4HMCA 1QFWM 4U3CA 4OUOA 2NY6B 3FRPG 2AGJH 5EZJB 2GFBA 3S36X 5SWQA 3SE4A 1NMCB 2DBJA 1CGYA 2F53D 1GYAA 4Y5VC 4P3DA 2J8HA 1E6OH 3BD4A 5BVPH 2XT1B 1PYWB 1SJHA 5CZXD 4BK5A 3ZYIA 1P84K 1V8HA 1B3JA 1MCPH 4LSUL 1YMHB 5C08B 1JUFA 3P0YL 3BPLC 5SV3A 4XVSL 1FJ1B 2X10A 3QWQB 5EO0B 3DX7A 3TBVB 1TZGL 3QEQE 5L8LB 5I1GL 2BSSB 1IC1A 4JZJA 3PUCA 1N5YL 2FO4A 5C0BA 1YN6A 1PKOA 3HC4L 1T1XA 3WDIA 3FOLA 1FNSL 3GKWH 2OR9L 1GAFL 3PXJA 4NQED 5GGTA 3ULUE 3B9KD 1F4XH 1S3KH 1VGKA 4CVXB 5J6HB 5LGKA 5AAMA 3H6JA 1G7JA 1KLFA 1J8HE 2YKLL 3HRZA 1QD0A 1YY8B 2GAZA 1NCCL 4G8FA 4N68A 4A2LA 3JWNC 4HWBL 1KJVA 1AHWA 1D5MB 3L7FB 4P99A 5LGHL 5FKPA 4I4WB 4XP5H 2VDOH 3WXVH 5F3BB 4YHKL 3N85H 5FUZL 2BNQB 3ARED 3L6FA 4PGDB 1CQKA 1J5OL 1T66C 5ENWA 1A7NH 1FRGH 4Z7WA 4PRNA 1FZKB 1ZS8A 2H32H 4RISL 3DVFA 4XNZC 4D3CH 1NJ9A 2GSGA 3SGJC 1NLBL 4LCWD 4H20L 2BSRB 3OX8A 1PZ5B 4FP8H 4TTDC 1OTSD 4UQ2B 5FHBL 2GCYB 2J88L 3H0TB 3KYAA 4MXQC 1S7QB 4JLRB 2AS5M 4XNXH 2W59A 3FONA 4LLVA 4WI7A 4Y16B 2FCBA 1FZOA 1A9EA 2BVTA 4LMQI 5CHNA 2VABB 5T33L 1A1NA 1JGVH 3CMGA 4DKEL 3MRFA 4ODHH 3WIHL 4MAYD 3CD4A 3QO1B 3GKZA 1I75A 4XXDB 4TVPD 5FA3A 3KYOA 4MJ6A 4NZDA 3D3VA 1J18A 2W9EH 4M1GH 1QLFA 1I7TA 4Z0BH 5D7JD 3N9GH 1JTOA 3U4AA 5HYIA 4L8CB 2JJSA 3RGVA 3EO9L 1OT2A 4GMTH 5E7FA 3B3IA 1ES0A 3LV3B 5C7XH 2BZDA 2EDWA 1TVHA 4G7VH 1DE4A 4LHUA 3K1KC 4MHHG 4P2QB 4QGYA 4X6EA 4RIRB 4EUPG 2VTFA 1L7TH 2FX8L 4JFFB 4P48A 1OPGH 7FABH 1LO5B 4D8PB 5ADOL 4M6NL 2OZ4L 4XZUB 3W11C 3OAUL 2I9LA 5IWLC 4Q9RH 2LABA 5CBAA 3SKOB 1MWAB 1OF2A 2NX5B 5EZIL 2D7OA 1N6QH 4P4KA 4NKIH 1KNOB 5EDXA 1MFEH 4XTRD 3S4SA 1B90A 2WWKT 4XMLH 1HHHB 1NC4A 1ZEAH 2WNGA 4TRPL 4L9LA 3MPCA 4M7ZC 5AZ2H 1MLCA 2DKSA 4EN3B 2HLAA 2PYED 2HVKA 3I75A 3TO4A 4FFZL 1Z9SA 1UB5B 3K2MC 4UAOB 2VZVA 2XNAB 4XPFH 5C9KA 1UB6B 5IHBA 3TBTB 4G9FD 3EYUL 1UG9A 2AJYL 2G2RB 5B4MD 4ZDHA 1W8OA 2MCPL 3LKOA 4XWOD 1MUJB 4K9EL 1CK0L 5MEQA 2RB8A 4B53A 5MEPB 4HWZB 3MRLA 5E8DL 4O02L 3QIWA 4HW6A 5GGRB 5C07D 3RNKB 2EE3A 5BW7C 2R1XA 5MEND 4IJ3B 2FYYA 4OLVH 3CK0H 2LU4A 2NNAB 5EZJA 2EICA 4JRXA 4KI5F 4I18A 3H9SD 1NGZB 4UAOC 3WUWB 4YO0A 1N4XH 5IJVA 3P30H 3HCVB 5FGBC 3LQMA 4M7ZB 4KVNH 5EN2B 3MBED 2HFGH 2Q1EA 3CFBB 3EYFB 4Z7NE 1J0JA 2VRAA 2C5DC 2VYRE 5I8OH 2X40A 3DX7B 3TBVA 4JPWH 3I3DA 4U1GB 3C8KA 4OCXL 2MPAH 4MD4B 4U1IB 4PP2B 3EYUH 3O4LE 3PL6C 5L9DL 4J3XA 3FQXB 1EHAA 4X5WA 5J0BA 3O11A 3BN9C 3U6RB 2EYSB 3ARZA 4GSDH 3FFCD 1QFUL 1DBAL 2E27L 3GSRA 3I50L 5DJAA 2MSPA 4PJXA 3TNMA 3S88H 3LEVL 2KZ1B 5FGCE 5I75C 1KCLA 2FLRT 2ESVD 3HNTH 5C6TH 5GGTL 1YY8A 5C0RH 4G8GE 1R5VB 5MEOA 2R0LH 4TVSa 5E2UL 1OLLA 3MODL 1C08A 3U36A 5FKAA 2IH3B 4YUEL 1JGUL 2FATH 1H3WM 2XZQH 5EU5B 1D6VH 3VFUA 2CMRL 1R0AH 1JGDB 3GMNA 4PGDA 1LDPL 3FQWB 4XGZB 3VH8B 1Q1JL 5DRWA 4PRNB 1AKJA 5KSAD 3KPQB 3QUMA 2XZCL 1PLGL 1DEDA 3SOBH 2NX5E 5E1AB 1ZHKA 5IQ7L 2XWTA 3SEPA 3QUYC 4HIEA 2HN7A 2E5EA 4ISVB 5HHOE 4L5FL 5CS7A 3U82B 4NP4H 4ODVH 4DQOL 4PJCF 1HIMH 4LVNC 1V3JA 3R06A 4GQ9H 4TNVF 2NY1B 2VLRE 3MUJA 4LCUA 4CUCA 3GJEA 4PLJD 1UQSA 5IFJA 2QEJA 2NR6D 3H9SB 3D85D 5LCVH 1RIHH 1XF5B 2UV3A 4XC3H 2O5ZH 5L8KB 1WBYA 4BFIB 2IAMB 4N90E 4I5BB 3PGDB 3RX7A 4GG6E 5HHMB 3WHXB 1N0XH 2X44D 4P9HC 5JOEA 1FO0B 4AM0B 1PDKA 5D1QD 4TPRH 1AC0A 4U1MB 5JXAH 3S9DB 1YEDA 1U95B 5CBAB 1FVCA 3BH9B 4RMRA 2APXA 1EO8L 1KJ2B 2IFFL 4FXKA 5HI3C 1ZGLP 4QTHB 4TTDD 2H2SC 2BC4A 1MVUA 2BOCB 5C6TL 2PW1A 4K2UH 4MZ2A 2FJFB 3PGFL 1M7IA 4PRID 2H2PC 1F4XL 2A6JA 1DUZA 2FIKA 5TE4L 2P5EE 2BVUA 3RWEB 3D0VB 1FBIL 4MAYC 1H0DA 2VLRD 4XX1E 3EFFB 1UB5A 3BGAA 1T1YA 5HSFA 3MRJA 4LQFH 4MMXC 1UM5H 1TTUA 5L9DH 5EZOH 2QBWA 2IG2L 1HZHH 1HKFA 4K3DL 5FO7A 4NO5A 1MAKA 1BX2A 2IPKB 3EO1A 4JFDE 2EEBA 4FZEL 4LLYA 2VE6A 1Y6NR 2UYLA 3B9KC 1Q0XL 4HPOH 4EI6A 43C9A 5FB8A 3EYOA 5IT2H 2Y72A 4LPYA 3CVIH 4HXBL 4YPJA 1T0NB 1X3DA 5DEZA 4OM0L 4PUBL 3KLDA 3C08H 25C8H 3ZKSD 4I18B 4Y5VA 4LRNL 1DBKH 1NGZA 1NKRA 2HG5A 4P3WA 3KYKH 4XBEH 4P2OA 3IFOB 4H8WL 3G9AB 4FQCH 5C07B 5H2BB 1I1YA 4ZXBA 2BVEA 2DIBA 3GRWH 3VXUB 2EXWC 2WBJC 3FQNA 3MNZB 3MRCA 3O41A 4KC3B 4MD0A 1NQBA 5D2LB 3S3PA 4K3EH 4OCYH 1JZ3A 1AXTL 1W0WB 3JV5A 4Y16C 4ETYA 3VFPA 2APBA 1GGYA 1I3VA 4NC1E 5CJOH 4C58B 4K8RL 3MYJB 3VA6A 1HEZB 1G6VK 5ELIA 1TJGL 2W1NA 3VDAA 1ZHLB 4XPFL 2Z8SA 1NGYB 4WUUD 2C3HA 1LK2B 2WUBH 4HFWB 4Y88A 3BKCL 4YDVB 2BVYA 5DRZA 4UNUA 1PD6A 1F00I 2XTJC 3QYCA 1QSZA 1QTYT 3BT2L 2AK4D 5LBSH 3RIAF 4CNIA 2X9WA 3MA7B 1ULVA 3RY4A 1YMMD 2BY1A 2CUHA 32C2A 5F9OH 1MLBA 3PDOB 2AEIT 5L2KA 5FKAB 5EU5A 5CCKL 4AJ0A 2IC2A 1P4IL 3TV3H 4GJTB 2QSTA 1HHJA 3BT2H 3ZTJG 1OPGL 3KPSB 5FUCC 4RZCA 4JG1H 5A2KH 4Y4FD 4UQ3B 1LE9B 2ERJC 4YLQT 1CYGA 4TSAH 1C16B 3R4DA 5BV7C 1CXHA 4PBVC 4K94H 1D3CA 3PWVB 3I02A 4FOMA 4EOWH 4L4TB 1G7QB 3WO4B 4ISVA 3O2WH 1JNHB 5E94B 2EKJA 3HAEG 1ZLWH 1YNLL 3PHSA 3T0EB 2CQVA 3NH7H 3H9ZA 1WCQA 2CIIA 3OKKB 4KXZH 2VXSH 1OP5H 3PNWA 5BV7B 2Q6WA 1QR1A 3KYMB 4OBRA 1HCVA 4H25A 3Q5OA 2RFXB 5KTEH 3KYKL 1UJ3B 5ERWB 1XGYH 1NLBH 4GW4B 3U48A 3O8XB 4GUPA 3BP7B 2VC2L 3GM8A 3QUXA 5ALCH 5SX5K 4NSKB 4NZUH 3MV7B 1FO0A 2AI0L 2V7HA 1FAIL 1DFBH 3MLTA 1CDUA 5DQJA 2A6IA 2DICA 4KRLB 2F58L 5GS1B 2J7LA 4L8SA 1N8ZB 4ZO9A 1U93A 2EYTA 3OJVC 1A7BA 2JF1A 4FXKB 1T21A 4HWBH 1CD1B 4X7EC 2CLZB 3ET9F 4ZUVA 3MCLH 2BC4B 2O5XH 1UACH 2DLHA 1ORQB 4POZC 3JXAA 5GRWA 4JANB 1DCLA 4O2CB 1I1FB 1X5JA 3RPIB 3DMMD 5C2BL 2X09A 2AQ2A 3GKWL 5F9AC 1KB5A 1VPOH 4TULH 3SE3A 3LKRA 5DXWA 1K8IA 5FF6B 3VXSA 4C83B 5GIRA 4JJHA 2LVEA 4C56E 1DSFL 2PYFA 1VEOA 3X3FH 2BMKA 4RMWA 1DLHB 1HYRC 1M6OB 4H1LB 2R0KL 3FZUC 5F7HA 1NMAL 5A1AA 1YEFH 1YEEH 1NCTA 4XPBH 4I3RH 5EH1A 2BX5A 4JKLA 1QG3A 5DZOA 3T0EE 1BLNA 2MQ0A 3VXMD 1KCRL 1MI5E 4FQXC 1INEL 5D2NA 1TVDA 5CMAA 1RZKL 3T0VA 1I4FA 4JFDB 4HJ0D 4NO2B 3QEQD 2I26N 3LY6A 3QCTL 2F5AH 2QSCH 4G3YH 2FJHA 1HHKB 4L3CA 1FYTA 4WV1A 4PJ5D 2IQ9L 2PW2B 3A6BL 4LGPB 1EHLL 4UBDC 5BO1L 1Q9LA 5JPMB 1BJ1J 5KZCD 3HMXL 4W68A 1QR4A 4WFHE 2GK2A 3GSWB 1YMMB 3JWOC 4DOHB 1OW0A 2C7UA 3WFCL 5D5MA 3EJZC 3BMWA 3LIZL 1UJ3C 3CFKB 3DSNA 4NZTH 4KKAD 1NEZA 5CINL 4R4FL 2IFGA 3CVHL 5ILTL 1GJIA 1JVKA 3R8BB 4YDIL 1W0VA 2WIMA 4G6ML 3NCBB 4R7NB 4PLOB 3C9NB 2GJ6B 4H0IA 5KJRL 3CH8A 4LEXL 5JPNA 2AABL 1F6FB 4XCCH 3WJLC 4PRHB 1XIWB 3VGFA 1DLFH 5KBNC 5I18H 3CVHA 4UNVA 3QXDB 5TDOB 1N6VA 3NABL 4RFOH 5FA4A 3T0ED 3ZKXC 3BH8B 3TBSA 3WO4C 3SQOH 3TBYA 1FZJA 3RDTA 5HY9B 3HB3C 4RAVB 2JE8A 1CI5A 4LCWE 4LHJB 4NFCA 2EDHA 2CJUL 4PIRF 2YUZA 5DUML 1MHPL 4TUKL 3Q5YA 4YH6A 5ECJE 2ERJB 4PJIA 4DJMA 5C0RL 1RU9H 1IGJA 3K7UA 2FWOA 1BOYA 3EOYG 3V6FA 3GSVB 4LCIL 3BOVA 4AIZB 5HHMD 2ZKHH 5EG6C 1Y6KR 4EEEA 5F89B 4PRDB 3LEVH 1C5DA 5E2WL 1QSED 1KB9J 5I6XC 2IAMC 4JJ5B 5D7LB 4BQ9A 2LU7A 3NAAL 4P57B 2CKBH 4G9DA 4OI7A 1EERB 4J6RL 5DMIH 5E6ID 4GW1B 3QWRA 2R2CA 3VXNB 5IW1A 3X13A 4OZIF 3OXSA 5T1LB 3I02B 1M4KA 4IRJD 2FL5B 1OSZA 2XWBA 1T7YA 1GC1C 1YEHL 1N64L 5ESAB 1VFAA 3UTQA 2KPNA 4ZD3L 4D0BA 2IPUK 4N0UE 2I9TB 2HFGL 2CLVB 3QIBC 1K3ZA 1HE7A 3LN5B 5I15H 4O00A 3LN4A 4GW4A 3JVGC 4F7TA 1NBZA 4OGXH 1T03H 4J4PC 4M93B 1FL6B 2OX5A 4RRPA 3V8OA 4Q97A 4OIBA 2CRZA 4PJCE 4HJGB 1V3LA 5FGSA 4O02H 1F3JA 1E4WL 1LD9B 2ED7A 5ESQB 5FHAL 1MJUL 5JO5A 2WM0A 3IDYB 1F3RB 1U93B 5CAYB 4GKNB 1GC1H 3MGTB 4NUJA 4ZUSB 5H94B 4G9FE 4QO1A 2ZJSH 1ODAA 4KI5D 3VXOB 4K7FB 3MUZ1 2R4RH 3CPLA 5DJ2A 3WXWH 2CIKB 3GBNH 4JANA 2XZAH 4Z7QE 2VDKL 1DBMH 3D85B 1WFOA 1CLCA 1FDLL 3EHBD 3N1MC 2HKHH 3FQUB 1ZT4A 4FTVA 5BVJA 5JW3L 1LO3H 3U7WH 5I73B 2D0HA 3L3KB 2FH6A 3MLSL 3V7MA 4A6YA 4OIIL 3RVUD 5HYJB 1JRHI 1QPPA 3C2AH 2DQTH 1SJEB 4PJEF 1FNEA 2ZJSL 2XTJD 3RBGA 3HUJA 4URTB 3QXVA 3CZFB 3RU8H 4JHWL 4R0LC 1A7PL 4I9WE 1Y6MR 1WFUA 1J10A 2E7CA 5DJ0A 3LQAH 2YXFA 1E4WH 1T20A 2H3NB 3AS2A 4WO4D 3QJHA 4Y1AB 5TGBB 5AWNH 2FHFA 2ZUTA 5DK3A 4K3HA 2Y06L 3WIFA 3S3SA 2FB4L 4ZFOB 1IGML 4Y4HC 1T2QH 1KYOK 2NW2A 3GMLA 4TNWK 5DMGD 3VXPA 1CWVA 2YSSA 1S5HB 4KTDL 1WZ1L 3QI9D 1GVIA 4ZFFA 2IANA 4JQIL 4NQDA 4UDUB 3GI8L 4PY8J 3O3EA 1BMGA 2QQLH 2YHGA 5EWIH 5D9SA 43CAA 2AXFB 1RVFL 2R2EA 5IT2L 5A16A 3REWA 2VDMH 5C0DB 1PYWA 4MA8L 1IRAY 4FFVD 4EN3C 1N64H 5CJXA 4PRHA 1WQVT 4LVNB 1EJOH 3S7GA 4QHUB 1JUFB 5DJCB 3IDUA 2OSLA 1B0GB 4U6YB 3GSNA 1MFBH 4P9ML 3GHEL 4U6HB 4WW2C 2YEZA 2NX5D 4GQPH 4CDHA 2XG4A 5ETUA 3A6CH 1EA9C 2EXYC 1RPQA 3X17A 5KAQG 1CL7L 5GHWL 2Q76A 4P3CL 3ZHDA 1CL7H 5C8JB 3FTGB 1J05B 1C5CL 2Q8BL 2ZPKH 2IFFH 5D1XC 4F58H 2KH2B 4QWWC 3GGWB 5J6HA 2ITCA 2HLFC 4QCIB 4PGBB 3GHEH 2W9DH 2YS4A 3I6KB 2VITB 4N8CH 4GG6B 1TJHH 4G9FB 1D5MA 1BQUA 4CADA 4L1HA 4MLIA 4PJFA 3NOIA 3NFNB 1S9VB 3CFCL 5F3BA 2V2WB 3KPNA 2E9IA 3O6MH 1JWMA 4PJ9A 4GAJL 3CUPB 4KHXL 1N5AA 4RBPH 4Z7UF 1QLRB 3P0YH 3IFPA 3QZWB 5DHXB 2EIBA 3RWIA 1RZ7H 2X2YA 1P7KB 2WWMC 3IDJA 4ONGL 2ARJQ 1R3HB 2R8SH 1RUQH 2JK5A 5DO2D 1FFPB 3REVA 1U58B 2A1WL 4L8DB 1MHEB 1LEKB 4R90H 5M94B 4XNZB 1JGEB 4WW2B 3CIQA 3EOTH 4NP4L 4ODVL 2J3SA 2EEDA 2IMNA 4MNHA 3SDCA 2VZ1A 2BFVL 5CZKA 1FZMB 1FZOB 5DD0L 5C71A 2VWEE 4NUGH 4JZNB 5B39G 3WHE0 1MFCL 3A6OA 2AEPH 1O7VA 5IV2B 1NGWB 3QHFL 4X4ME 2W07A 4NBYB 1CS6A 3X12B 3I9GL 2X70B 4HQQH 2XFXB 3BGFB 3BYYA 1RZGA 5K59F 1QLFB 2YPKB 4JGMA 4XNYL 1KT2A 4WHTA 2YPLA 2PF6A 3O2DA 4L8CA 4F7EA 1CXIA 4E0RB 3FKUS 4G8IB 3GMPB 5DJ2B 3DO7B 2PR4L 5D1XD 5JHDB 2ICWB 2BSED 5KW9L 1DE4B 4JFDD 2P46B 5B8CC 4NQSB 4WFFE 4PRPD 5EIIB 4K7PH 1CGXA 2YD6A 1OB1B 4O51A 2F9BT 1A9BB 4FTVB 2P24A 3ARUA 2AEQL 3MRHA 4JO2L 3RY5A 4P2YA 3IVKA 2XN9A 2EE2A 1KN2L 4BZYA 4UIKL 4QRUB 4R0LB 1F3DH 4NRZB 1IC7L 1E4XI 4N0FB 3TT1H 4I0KA 4LIQL 2PYEB 5F44A 5CEXA 4UMGA 3G5VB 3MUGB 3EO0A 4XCYA 5AUMA 1MJ8L 2F54B 1Z9MA 2DTML 3I75B 2DYPB 3G6JA 3KPOA 2W60B 1MI5A 3FQTB 5CD3B 3KWWA 1FFRA 1NMCC 2AXGA 2XACC 4AMKL 2ZCHL 3ZSSA 2NY6C 1INQA 1KC5H 3OJDA 1FV1A 1RULH 3D2UB 1JHTB 3I3EA 5D5MF 1JZ4A 1HXMB 1ZT1A 5KTEL 4RRPG 1QZ1A 3QUKB 2AK4E 3OL2A 2B8OT 3DOSA 3O3AB 4ZTPH 1JN6A 4OGYH 1R3JA 43CAB 1Z3GH 3WS3A 2FZ3B 5A16B 3O2VL 3VA2C 5BOPA 2OTWA 1JZ8A 3MLZL 4K71C 5GRJH 1CXKA 1J86A 1MHHA 1CTNA 1KPUB 4YIQB 1ZLUH 3NZHL 2EH8H 2OP4L 1U8KA 2AW2A 2HH0L 1OAQL 3SDXB 1I8LC 4X4XA 3RKDD 1RI8A 1FH5H 2R1YB 3QIBD 5LXGH 2IBZY 4QXUH 3RVTD 3C8KB 3OWEA 2H2SD 3CGTA 4U1IA 2CH8A 3VFOB 1D5BB 2MCG1 3QIBB 1OP3H 1P1ZA 2DB8A 3PHQB 2UZYB 2ZKHL 1JV5B 1VEMA 3ALWA 4JPKH 5CCKH 2QJDA 2VZSA 1EAPA 1CGTA 4QHMB 4J3SA 3J8F7 3TNMB 2OXHA 2LFGA 3VGDA 4G8GB 5EZIH 3C5JB 2R29H 4M3JA 4NDMB 2X1XR 1RK0A 3HC3L 4UV7H 5LGJA 4XP4L 1QLEL 4OSUH 3FO1B 3UBXI 3B9DA 4U1JB 4JRXD 1U8OB 5I18L 2XPGA 4Z76B 2VB5A 4XP1H 5D7IE 5DUPH 3MRDB 5I6XB 4QOKD 3KPNB 5C0EB 4MSWB 4OD1L 3QHTC 1YYMH 3AS0A 3MRPA 2EECA 4P0DA 3UTOA 1FFOA 4F3FA 1A4KA 5JQ6L 3BESR 3CH1A 2VAJA 5C09A 4HKJB 4Y0GA 4OKVA 2R29L 5EZLB 5JW4M 4M1GL 1R3HA 1L6ZA 5ID0A 3DUUB 4PBXA 1T0MB 3REVB 3UYPA 1FG2B 4A6YH 3MNWB 4Z8FL 2A6DA 4ODUA 1GGBH 1NDGB 3VD4A 3U0TA 1M7DB 4JPKL 8FABB 4K7PY 4JN2A 3LKPB 4F9LA 4KVCH 3T1FB 4G43B 2V2XA 4KUCD 4WWKB 2HJKA 5B22A 2M1KA 3CSPA 1A7RH 1UCBL 1GZPA 4LCUB 5C1MB 1AGCA 2V9TA 3T3PF 4TVPL 3BMVA 4HV8A 5CFHA 5F7WC 3ZE2E 4C56D 4HUVB 2GTZA 1KT2B 2WUCH 4F7EB 2VDLH 3FQRB 5DEFA 2BJML 3NCYS 3ILPA 2VDOL 4QOKE 1BQSA 3BX7C 3MXWH 5C86A 4MXVE 4U33A 2ID5A 5E9DB 4XNMB 4D9RE 5F88A 3VXME 5E95B 4E41D 4X9HA 5D7IA 1N3NA 2DTSA 1YUHA 4ELMB 2BNRD 1YEDB 1U8JB 4NKQB 3TA3D 3WYRA 4HIIA 2X1WL 1YYLH 2XN9B 5C0AA 2NW3B 2XQBH 3R1GL 3RWDA 4QRUA 3IFNL 2Y23A 3QT2A 1A6VH 4NRZA 1ND0A 2Z31D 4POZD 1KC5L 5LJYH 4FNLH 3HR5B 2A6JB 2FIKB 2H32A 3VRJA 3QNZA 5KN5A 2IWGA 4UI2A 4JFEE 2P7TA 4KDWA 4KQ3L 2DYPA 4CKVX 1BQHA 4JFXA 1T1YB 1CTOA 4Z0XB 3DV4A 1EEZB 4ODWB 4WW1B 2DIAA 4Q6IA 5BS0D 5IB4B 1VKXB 3NIFF 3L5XH 2DQFB 4ZYKB 3TT1L 1CDIA 4HGWB 4LLYB 4EI5A 3MACL 3DVIA 4PGEA 5I30L 3ULVE 1YECL 4EI6B 1DDHA 3EYOB 4KU1A 1JFQL 4IRZH 3RBSA 2CUIA 3V5DA 1KPVB 2QQLL 3B6SB 1MNUH 4JQIH 4EBQH 3PP4H 2EDNA 1GPOH 2PNDA 5K93A 4Z77B 1J1OL 4UUJB 5H2BA 3O9WD 3SDAD 4ACPA 5I74B 2YK1H 5EUOA 5JORB 1E27A 2H26B 2DKUA 3SE9H 3LS4H 2EDFA 1F58L 1QKZH 5DQ9B 4YFLF 3P11H 4YHML 3GSQB 4JFED 4WFEE 1TCRB 3PP4L 4ZOCA 1AQDA 2JJUA 4TSAL 3LQAL 5FYLE 4JHBA 1RIVL 4UINL 5L88H 2BVPA 4KFZC 3ROLB 4YEEA 4GW5A 3S96B 3KXFE 4AYFA 1TVBB 2BFVH 1LP9B 4TQEL 1LK2A 1P4IH 3PWNA 1HK6A 4MLSA 1T6WA 2P49B 3UPAA 1KG0B 4CVZA 3FOLB 4QHMA 4BFEA 1N7MH 3S97C 5JXED 3SDAA 1VERA 4R8WL 1HQRB 3MJ9H 4PB9L 4WCYH 3KJ6H 3TLRA 4UT7H 1IZJA 1F97A 4WTWA 3S88L 1AHWB 4AEIL 4WJ5B 4LCCA 5EFIB 3DUSA 2NCMA 1K5NA 5H37H 1FQ9C 4ODTL 1KGCD 4ZUWB 4NO3B 1QRNA 2NXZC 4PREA 4P23D 4UB0H 5LG1A 1RUAL 3GEWB 5EU4A 5E9DE 5D72L 3DRQA 3UP1A 4Z7WB 3CH1B 1I1AA 4MCYA 1F5WA 5CIPH 3UPRB 8CGTA 2EIEA 4HGMA 3MRGA 3B8SA 4PTTA 4X5XB 1C16A 3C5ZD 4HX1A 3WS6C 5DURD 3BGFC 3U0TB 4KI5E 3I6GB 2W0LA 4JFZH 3FCTA 2XTJB 5FUOL 3CX2A 1JNHA 5E94A 5DTFA 4XCNB 5HHQA 2H6PA 3P73A 2CR3A 5TDNB 3IDNB 1X5FA 5I9QC 3P2TA 4K7PX 1WLHA 4XXDA 2A0LD 3VFSA 3U9PH 4XP9H 3DROA 3I2CL 4M7JH 1MFBL 2WAHA 3LB6C 1KB5L 4HV8B 3KYMA 3UEZA 5DHVH 3H9HB 1UJ3A 1K9TA 5E2TL 5E8DH 4LSTH 2OBGA 3DETD 3G5ZB 4MA8H 3MREB 5E9DD 5HI4D 3MLTB 5HYJD 4NZJA 1P84J 4HK3N 3SDYL 6CGTA 1FHGA 3PABA 4PLKD 3WKNA 3OTTA 2OL3A 2V9RA 1XGQB 2WWKO 4WTZG 5F7FA 3VGGA 4IEFB 3VXTA 5ICYB 1A5FL 1T2QL 4Y19D 1UWXK 2CLZA 5HVWA 1X7QA 3VGAB 4JM2C 1ONQA 1BFOA 3BUTA 5ABDE 4C57C 2AV1B 2RHEA 1HHHA 3CNKA 1XCQB 3HI5L 2JJTC 4JM2A 5ESVB 3EFDH 1YQ2A 4LLUA 2GJ6D 5KSBA 4DGIL 2XKNA 2XNAA 4U1GC 2YRLA 3JSSA 5GS3A 3G6JE 4HZLA 4PRAB 1I8LA 4WDIB 2DQEL 3SJVE 3V0AC 1BD2D 3MGAA 3KG5A 4Q58C 5MEPA 5EU3B 1FE8L 2AQ1A 3WIIH 3QHZH 5AG9A 4EI5B 2B4CH 3GMQA 4KROC 4MA1C 5E2VL 4PV8A 5GSRB 4LLAA 4G6AD 2C4XA 1D5IL 5IHUL 2YC1B 3QO0B 4MMZC 4HJJL 3L5HA 3QDJD 5FAAA 1ZLVH 3HG1A 4P9HL 2FJHB 5IGXL 4YO0B 2AK4A 4EDWL 1PG7H 3G5YA 2FX7L 4U0QB 4DQOH 3GSUB 4QTIL 1JGVL 4MCZA 1RHFA 4D9QE 1TQBC 3AU1B 5MENB 12E8H 1Q9LB 3VXRD 4I0CC 2OJEB 1FVDA 2COQA 1DQMH 1N2RB 1IGIH 4HH8A 4B5EA 4LLQA 5I1KL 1MQ8A 4IHOA 2DQUH 1FH5L 4ZUTA 3HE7A 4C56B 2R4SH 2GJ6E 2HH0H 1OL0A 4DCQA 2ENYA 1JHKL 4BFBD 2K7QA 4MNQD 4OQTH 3TZVB 1YQVH 2NY1C 3FRUA 5GRJL 1YEFL 5C2UB 1EBPA 5I8EA 3CVHB 1RULL 1LEIB 3QUYD 3QEHB 5IMMA 4MS8C 3ECBB 2JELL 1AQKH 4RA3A 1Z9OA 3RWGA 5T3ZL 3WLWD 3WLWC 1EFQA 1JPGB 5GS0D 3FB7A 3ZHLA 3BD5A 1VGEL 1Q9OB 2EXYD 2ADGA 1FNSH 1K2DA 1M7XA 2Y5TB 3MLPA 5IVXA 2DLTA 4PREB 3SDAC 4RA0C 1JGDA 3GMNB 4N8VG 3RL2B 5EU4B 5DGRA 5F7YC 2CK2A 1KN2H 3MSPA 5EUKA 4DGVL 3QRGL 5CEZD 1I1CA 4XVUC 5CWSB 3QUMB 3G6DL 3MRGB 3WFHB 3QPQC 1BP3B 1ZHKB 3IJHB 3PWJA 1OTTC 1UKTA 4F7CA 1YN7A 2EDKA 4YHZL 4X6CF 1RK1B 1DBJH 4M5YL 2FL5A 1KYOJ 2XWBB 4GAFB 4XCNA 5HHQB 2SEBA 1XCTA 4TQEH 2ILLA 3IFLH 4H26B 3GSNH 3FN0L 1YPZF 4PRPE 2QQQA 2J6EH 3NCYP 4DVBA 1E6OL 2I9TA 2R4SL 4K7PL 4HQQL 1PKQA 2OTPA 4HKXB 4NQDD 3H9HA 3TO2B 4MDIB 4LVHC 3M17A 4FTVD 3QXWA 1HOCB 1BJ1H 5JXEA 5IHZA 1W72A 1HHIA 3DMMB 1TPXC 3JWOL 4X9IA 3SJVB 1QEWA 2D7PA 3VFWB 4F7TB 2WZPD 2VLJB 4JHZA 1FPTL 3QAZC 5HHNA 3JUYA 3TVMA 3VI3F 4EOWL 5KSBF 3N0PB 4XNYH 5CEZE 3O3DA 1XR9A 2VDRH 3WFCH 3PL6D 4NM4H 4YX2L 3QHFH 3V6OC 2I27N 5GZOD 5JO5B 3C5SB 5EUOF 2ED8A 1KTKE 1ZGLB 1XFPA 1UM6L 5BO1H 4XMLL 5J89A 1MVUB 5KS9A 2IQ9H 5J1SC 4NKIL 5BV7L 4LEOB 1PFCA 1REIA 4KTYA 2F5AL 4PGZA 4E42B 5C0CA 1KENL 3OPZH 5J13B 1H0DB 1X4XA 3RQ3A 3STBA 5IVXF 3GI9L 2Y7QA 3OAUH 4YFDB 2EDRA 4NQVB 2VLRA 4DVRL 4TUJA 1HH9B 5IK3A 4LBEB 2GW5A 3VWKC 4XP1L 4IIQA 3BPLB 4PFEA 4F2MA 3FO2B 4ZSOB 2G9HA 2YA1A 2BVQA 1LEGB 3U2SB 2ZUQB 1X6NA 4BYHA 1XIWC 2Q8AL 3Q0HA 2VO5A 4HHAB 3GBMH 2YC1A 3EJYC 1ERNA 2E8ZA 3LZFH 1T1ZB 1MFDH 4Y5VB 5C2BH 3X14B 4PJ8D 3KLAB 1YEKH 4LKXB 2PXYB 5J12C 3ZE2F 4DKEH 1JHLL 2P8MB 1XGRA 2O5XL 2XN9E 4HUUB 5I8KH 1RSFA 4OZGB 2ADIA 5BXFA 1VB9A 1N2RA 2P5WD 5E8EA 5T3XH 1CLYL 1YA5A 1A7QH 2ZCKH 3VWKA 5KOVC 1DBKL 5DJXB 3RY6C 2CRMA 4WEMB 1QRKA 1FAIH 1MIMH 2E7HA 3KYNA 4HUXA 5F6HJ 5T3XL 5DQDL 3KJ4B 5I71B 3SPVB 1QFHA 4FQXB 2NYYC 3VXRB 4EUPH 1AJ7H 4K3DH 3JWDC 5I1LA 1Z3GL 3QNXA 3O9WA 5I1JL 5ACZB 3ARGD 4XBPB 5C0JB 3UO1H 2Q3AA 3GSXA 4Y2DA 3IKKA 2P5EA 4RGOL 5IBTL 1YNKL 3PDOA 4PRHE 4XH2A 4MB3A 1IAMA 3NIGE 2ADGB 2R23B 5KANI 1K2DB 2Y5TA 4S0TD 5ALBL 1JK8A 1ETZA 4WI8A 3QIUA 1A6WL 1BD2B 4K2UL 5DUPL 1OWRM 4OAWA 2R2BA 1L4IA 1BGXL 3DPBA 1J05A 2DJUA 2XXCB 4KUCF 3HC3H 1ADQA 4R96B 1MCDA 1DZBA 1U8NA 3K81A 5FM5M 3HZYA 4DUWA 2CGRL 5IMOA 1CD9B 2ZWLT 4UOJA 4CMMB 5D93B 5F1OB 3S34L 4Z78B 3ZKQD 1A7OH 2X7LA 1FLRH 4MQSB 4APQD 2VDKH 5BQ7A 2DN7A 2YN5A 1MCFA 5T1KA 4YK4B 3CUPA 1FIGL 3O8XC 3S37X 4GRWE 3C87A 4OCSH 4UIMA 5JW3H 1Q9WB 3MGOA 1RZFL 3OKKA 1MJUH 1ZVYA 2VQTA 2Q6WB 1QR1B 1UZ6E 1UWXH 3UBXG 4KGJA 1MHEA 4OCRL 1J1XH 1DQQB 3QDMD 4MDJB 1KLUA 4X9BA 4ZAKA 3FB8A 1NEZG 5IB2A 2ITDB 1M05B 3WXWL 2YK1L 3BZFA 3VWJC 5JW4Q 4U7SA 5E99H 2GUOB 3VWJD 2VLJA 1T4KA 4NKOB 4WW2F 1CDBA 1KACB 4X6CB 3IETA 4MXWH 3HKFA 1JWSB 1QOKA 4OZ4B 1GPOL 1I3GH 1NAKH 3GMOB 2OZ4A 4XBGB 1BEYH 1FORL 4WO4C 4NIKB 4YHMH 3VE0A 4LK4A 3TIDB 3P0GB 5HXMA 2H45A 1AJ7L 5DZLA 2X4TB 5GRVK 4MQXC 3LAFA 5BS0E 5AEAA 4HWBA 3M45A 4FQQB 3FT2B 2ENSA 1DBJL 4HIHB 3G5XA 1TCMA 4HDIB 3M8OH 4K94C 2BNUA 1NCBL 2QKIA 5GGTH 1W72H 1CZ8L 3SDDD 4LCWA 4QYOB 1F6AA 3G6AB 2QLVB 4YHYB 2Q7NA 5TH2A 1JBJA 3LMJH 4ZUUA 4MHHI 3PWPA 5J9PA 4JM4L 1F42A 4IIQB 1I1RA 5E5RB 4PR5B 2Q20A 1G6RL 3BD3A 2KQNA 1MAJA 2ZSWA 4H5SB 5DC0A 4G5ZL 5E7BA 1IQDB 4LSQH 2BVOA 5CMAB 1LK3H 4HHAA 1NKOA 3LZFL 4KRPC 4HSQA 3F5WB 5EBMA 2W60A 3IS1X 1SEBB 3BIBX 3JV6A 5CD5C 1KJ2L 2FDBP 2YRPA 3ZYJA 4M6AA 2JB5L 5C9JA 2VXVL 4FQIH 1D5XA 5KSUB 1F6LL 2VLKA 4R9HA 3QDGB 2CLRB 1WAAA 5SWZA 4MNQA 2N1KA 1ZT7B 2AXJA 5DJXA 5D5MB 4X6DA 1NEZB 2D9CA 5D71H 1IC5L 3QA3A 5C0IA 3NMEA 4M7LT 1S5IH 4QXWA 2CK0L 2DLIA 1WBXA 3OKEB 4XCCL 3T09A 1KGCE 1SBBA 3DV6B 2VZUA 4FQXA 3VFVA 5L6YH 3SO5A 2QSVA 1MCRA 4UBDD 1XIWA 2B20A 3EGSB 1MIEH 4M5ZH 3QXDA 4DZBA 1RVFH 3BZ4A 5D96C 5IF0B 5HBBA 1VADA 4X4XB 2A1WH 5LAXB 5ID1A 3EJZD 4JGUA 4ONGH 2A0LC 4KTDH 4F9PC 1NFDE 2H41A 5C09D 1XF1A 4M5ZL 2EYRB 2F15A 1WGOA 2MMXA 3L3GB 4FRWA 3PQYE 3ARQA 2IALB 4YHIB 3ZYZA 1MJJB 2Y06H 2YXMA 1I7UA 3CFCH 3UJTH 4AIZA 1BFSA 2NY5L 2R2BB 4RFEB 4DFHA 5F89A 3IGAA 1C5DB 1TFHA 3CJJA 4IRJB 5D71L 5DWUL 1PLGH 1DSFH 3C5JA 1HSBA 1S7VA 1G7JB 2A77L 2P47B 2E6JA 5HHVL 4PGCB 3DSFL 1JP5A 5D6CA 1T5XA 5ISZE 2X7LB 1TQCC 3BP5A 1JGLH 2ZPKL 1IAKB 2AQ3A 3MFGB 2ZOKB 3K46A 4M5YH 5DHVA 5DFTA 5TF1H 1HSAA 1JNLL 3LHPL 3LSOB 3RWFA 1OP5K 4JY4B 3UBXB 1VFAB 1G7IB 2R0LL 1NCAL 3NZ8B 4XHJD 4D2NA 1AE6H 4BUGA 1UKQA 1EVUA 4Y16D 1ZANH 2LAAA 3EBAA 5DK2A 5ID0B 1HH6A 2BSRA 3SCMA 4XPAH 1EV2E 1FG2A 1VENA 1C12A 1DN0B 2BSTA 4WUKH 1E28B 1G6RH 3LN4B 4F15B 4YJZL 3QG6A 4JO3L 4X0KA 3BXNB 1JJUA 1I8KB 4IDJH 1A1NB 4UILL 1XGYL 2C9AA 3R0MA 3JTSB 4Y4HA 2NXYC 4QNPF 4HJGA 1JNNL 4DKDC 2NY4C 3ZE1F 4AL8H 2EDXA 2QQKL 4MQ7A 3LB6D 1QO3A 4R97B 1VSCA 2G5BA 2ICES 3P9WB 4MWFA 5ISZD 1NANH 1UEYA 1B88A 4OGXL 1RMFL 3IDXL 2A2QT 4JRYE 3CPLB 5EPMA 1IGMH 4P5TD 3IDXH 3ARGB 3FT2A 4NO0B 4PS4H 4KJPD 4RIRA 4F37K 4HIHA 4UV4H 4FHBD 1AI1L 4MJ5B 4XI5D 4OGAD 5E56A 3VI3E 4K9EC 2VXSL 1UWGL 5D7IB 4ZG1A 3W39B 4QEGA 2E6QA 5J1AA 3QDJE 4FQ2H 4BUHA 5C0FA 2IH1B 2EDQA 5D6DC 4JY5L 5I75B 4HKZB 4YBLC 3F8UB 4PR5A 3PV6B 3W0WB 2ZSWB 1IC7H 1U8IB 1P7QB 2GY7B 3K0WA 2XICA 5KN5B 2AJZA 1NGXB 2HLAB 5DMIL 5E6IC 4QXTA 3QWOB 3ARFD 3PL6B 3BZEA 1I1AD 3H3PH 4GBXD 3JV6B 1KJMB 1UM4L 4JY6B 2X4QB 3CDGA 1NGQH 1H3TA 3V5HA 5T5FH 1UA6L 4X7TA 1BZ7B 3MBXH 2QHRL 2HKFL 2PR4H 3HNSH 1TTFA 4ZAKD 4HT1H 2CLRA 1EEYB 1ADQH 1KIPA 1A1OB 1ZT7A 2OL3H 5CKGA 2NNAA 5FUCE 4M6NH 5L0QC 1RIVH 1FIEA 1OTSC 3HNVL 1FC2D 5DHYA 3BWAA 2AXFA 1T22A 3BYTA 5C0DA 1J0IA 2R0WL 2VNCA 3REWB 1U0QA 3F58H 3H8NA 2F74B 4K3EL 4OCYL 3DV6A 4NQEB 3TIEB 3B4NA 3GRWL 1Y0LA 3HFML 5BCAA 3F7QA 1E27B 2Y1VA 3O3BA 3CVHH 3OHXB 3L7EA 5IF0A 1U91A 3GSNB 1H9VA 4KKCC 2X4PB 2DMBA 1RUQL 1XGUA 1FAKT 2GT9B 5D1ZA 3WSQH 4LVOC 1UWEL 3WIHH 3VFMA 2HFEB 4ORGA 2XV6B 3OB0K 1MIEL 3BVNB 4M62L 1IGYB 4M00A 1MJJA 2O5YH 5EU6D 2ADJB 5DQDH 5LWYH 4NGHH 1DVFB 4XB8A 3P9LA 2K1MA 3F7PC 2HJFA 5F3HB 2M2DA 3X3GH 3EJJX 4IRSA 2DWDB 5JNYB 4Y2DC 1JPFA 1I7ZA 4L29A 2CKBL 2KKQA 4NQDE 3HUJE 1RURL 4OB5H 4EDXB 1K85A 3DUSB 3OAZK 1K5NB 4FNLL 5SV4A 3WEXA 3FAWA 4HPYH 3LSOA 3MRMA 4YAQB 5IR1B 4Z7VA 3SY0B 4PJ9B 1L9MA 2YKLH 5DRWB 4LHUG 1IGCH 3DTXA 3HN3A 1YYLL 2HLFD 4KMQA 2JK5B 2O26U 1SM3H 2NZIA 1SBSL 3ZDXE 2F53B 5IBUG 1KPRB 3AB0C 5J1TC 2DMKA 1R6VA 3DIFB 4HFUL 2YN3A 1C12B 1DN0A 2IANE 3I6GA 4XCFH 5SX5H 2HN7B 4BSWB 3F7YB 5EOQH 3F7VB 5DTFB 2Y5EA 1I8KA 1V3KA 3BO8B 3BW9A 4S1DD 3I6LE 3T4AA 4QRTA 5ADPL 2J4WL 1G7PA 1F2XK 1UQSB 3WS6A 4YFEA 3HI1A 1NC2D 2Y36H 2PO6A 2YPLB 1V3MA 3JBG7 4CN6A 3U1SL 4QRRD 1IBGL 1CFSB 1MCHA 5BJTB 3IAGC 1EAJA 3BHBA 4YHNB 3NGBC 4IRSC 1GGTA 4WHDA 4I5BA 1QRND 5SX4H 4KVCL 4AENA 2D0FA 2X4UB 4N9GB 5BS0A 1WJ3A 1NUGA 3L3JB 4TNWF 3WSQL 3ZT7A 4M61A 2EE6A 3W39A 4ZFZB 1BEYL 3MRQB 4I2XB 4QY8B 1BIHA 5GJSH 1IMHC 1XGQA 5F7DA 3VG0H 4PRBA 3RDTD 1SQ2N 4L5FH 1IKFH 2VR5A 4DWHA 4FN0A 5IKCB 4FABL 4HKZA 3ZTNH 1MOEA 1ACZA 4X98A 1ROWA 1D5ZB 4I3RL 1FNAA 2YZ1A 2FJFA 4EVNB 4Y19B 4P5KA 4YUEH 2NZ9C 4XP4H 1MNUL 3ZT6A 1A6PA 4XCYB 3RU8L 1MY5A 4Y4KB 1RZFH 1QSFD 5TE6L 4R4ND 3AVEA 1BVKB 2HP4A 1C7TA 3S37H 3BUYB 1J12A 1EMTH 3BEVA 2CDFB 3C6LA 5I1EH 3D2UA 1QFUH 2E27H 2XXMB 3VFGL 5HDLA 6FABL 3EZ8A 4RCAA 3F62A 1FVEA 43C9B 1IGFH 1AGEB 1KCKA 1I9RL 1IAIM 5SWQB 4KQ3H 1NBVL 1UEMA 3LEYL 1R3JB 3TWCL 4DFIA 3WS3B 1T22B 2FGZA 3FO9B 3OB8A 2FHBA 5FYJL 3IFOA 3GBNL 2B0SH 3X11A 4LPCA 4P23C 2LU3A 4LAQL 4CW1A 3KPRE 2EH7L 4KAQH 3O3BB 1G1CA 4RGOH 3VFPB 3S5LB 4CDGC 1CVSC 3W2DL 4CJ0A 4P2QE 4ZTPL 4X80L 4C56A 4OF7A 3D9AH 1EPFA 2BSSA 3VFOA 3QIBA 2V2TB 3T0DA 3MXWL 4PG2A 1D7FA 4KVNL 1S7RA 1VFUA 4KRMB 4QOKA 1F4YL 4ZO7A 1CK0H 4KV5F 5SX4I 3MLRL 3QDGD 4DEPC 4R7DB 3U4BL 1GH7A 2HJFB 1NBYB 4XVJH 3THMH 4GBXA 2QQKH 3ZYOA 5GGQH 3NCJL 3QDME 1MCOH 3LEYH 3FO1A 3U79A 4P5TC 1P6AB 4O9HH 2NY3D 2NXYD 2EIDA 1GIGH 5CP3H 1HINL 5E6YA 4G42B 1X6LA 5C09B 4WRLA 1RUPL 5EZLA 2R2HB 1EJ6A 4OV5B 2JJVA 4XXCA 3B43A 3UROR 5HGBA 1A2YA 3GDBA 3UTTA 3NIFE 5TE4H 2DQIL 4LU5L 1OAUH 3PWVA 4UQ2A 5CJQH 3H0TA 1M7DA 1AGDA 2B5IB 3GIZL 3O4OB 4BZ2L 3MQIA 5DJDA 3AFLA 4JN2B 5EC2B 1HXYB 3F7VA 1H8NA 4X9GA 3ULVH 2WV3A 3VG9B 1JGLL 1J0YA 2RCSH 2VKXA 4IMKA 3T0EA 3RWJB 3MBEC 4ONFL 1MFAL 4PJEB 2BRRL 3ZKMC 1WWAX 3BKML 1Y18A 2EDBA 1UVQB 5FM8A 1U8QB 3DHMA 3D3VB 4K8RH 1CU4H 4MGXA 5CINH 3RX5A 3D39A 2X4RB 1DN2A 4NKDA 4CAGA 5C0CD 1HYSC 2XWJB 4O2FA 3MYZA 4D0DB 3RY6A 3M17B 3O6FC 1RUML 1EGJH 2AABH 5INCA 1MPAL 5IHZB 4AENB 3QFJA 3NIGF 2X4UA 1F4WH 1IT9H 1R24B 1V7MH 3QUZD 4PB0L 3STLB 5DQJB 4QXUL 2Q87A 4AIXA 4L8SB 3BSZL 5FIEA 1AIFB 1KTDB 4QY8A 3ZZ1A 5FEBA 4RISH 3QXAA 3IF1B 4YZFF 1OOAA 2NY3C 5C0AB 3PP3H 2F8VA 1R3KB 4GRWH 1CD1A 2FX9L 4GAJH 4J3WA 5L6YL 3C60B 2Z31B 4XPBL 1J1PL 3HE6B 3RWHB 4JO4L 1AO7A 3HI6H 4Y19A 4UT9L 5MP6L 1CCZA 5IQ7H 4OLYL 1TJHL 2AKRA 1WZLA 2ZOLA 2XZCH 1K8IB 1MCCA 3UJIH 2G75B 5FF6A 4U4BA 3I2CH 2BNRB 4XNUL 4APQB 4QRPB 3SDDB 2Y7QB 1DQLH 1Q72H 1RZIB 1BVKA 4RAUA 4E41B 1UB6A 3MV8D 3QEUB 1H5BC 1IEBA 3TBTA 4Y4FA 1R0AL 3PE9A 3N85L 1KN4H 1NLDH 2ATKB 5TQ2L 5DEGA 4Y4HD 3FO2A 4FQIL 4L3AA 4ZSOA 2VLLA 4AEHH 4YDKH 4UT6L 1BQLL 2ADFL 5GGVL 1FVEB 2FYYB 3L3HB 3ARBB 5CEYA 1HYSD 1WIUA 3WNMA 3MV8A 3V5DB 5ICZA 2DTMH 4KH2A 2A9NH 5F9WC 2YD5A 5EO1B 1TNNA 1QFOA 3EAKA 3EIFA 3ARDC 4DZ8A 5HD8D 4LSUH 2VC2H 2F5BL 4DOHE 3FFDB 4N0CD 4J8RA 3V8CA 2KL6A 5CSGA 2ADIB 4OCWH 4GFTB 2X5PA 4QWWD 5E8EB 5C0ND 4Z7WE 3QUML 4D0CB 4JO4H 1TCRA 2NXZD 3ES6B 2Z93A 4GS7B 4QRSB 1A64A 3GK8L 5EWIL 5KSBE 4XVSH 2CXGA 2JELH 1O5DT 4NN7B 1A6AA 1ZA6B 4HUXB 2VQ1A 3MV8E 3OKNB 1W0VB 3NH7L 5BMFH 1MCPL 1HNGA 5BRZD 4EUPB 5IW6B 1LP9A 4JCMA 4WUUA 4NFBA 1OARL 4K3JL 4CVZB 1IARB 4PJBF 4ZPVA 5TF0A 4HS3B 4PJ5B 1IT9L 3O9WB 4PB0H 3BH8A 4ZS6D 1G84A 4HH9B 3HFMH 5ISZA 2J8UA 2C1OB 1IGIL 1OTTD 1A4JA 2K7PA 4M1DH 4PJ8B 4I48A 2E7LA 4CL7A 1YNLH 1LO0H 1GGCH 4PTUA 2XRAL 3EYSL 1QRNB 1KCUH 3LH2L 2FX7H 4P2RE 5KOMC 4J4PA 3RVVC 5ACMA 2ZUXA 3WMSA 3DRQB 5F9DC 1LNUB 4OZFA 4P57A 4GKSA 2OYPA 5IHUH 1MRFH 5KG9A 1XAUA 3OF6D 3H3BC 5EOCL 4X5XA 3OJMB 3WL9B 3P4LA 1EO7A 3QEGL 5CBEA 1QQDA 4RGMC 4YNYA 3DYMA 1XZ0B 1A3LL 3BP6A 5BQ7B 1FCGA 3L5XL 5IM7B 1G9MH 4PJBB 2FGWH 5F9JB 1RIUH 2HRPH 3TFKC 2NLJB 5F6IB 4PJEA 2N7AA 2FBJL 3BPNC 1LVEA 4MAUL 1CICB 2FRGP 1FNFA 3MRRB 5J7CC 2CGRH 3DROB 1QHPA 3D69A 5FHAH 2VDNH 3VXSE 3E1F1 1JYXA 4JY5H 1GGCL 5EBLB 3W9DB 2DS4A 1P4LB 5FM5O 3BP4B 2Z91B 4NN5C 4P3CH 3V2AR 3TEUA 1A14L 2AVGA 2IAMA 3MV7D 2A38A 2IPTL 3MJ8A 1CFBA 4IM8A 3ZDZF 3T2NL 1P53A 4JREB 4BELD 3ME0A 4LSPL 5FDYA 3TN0C 3B2UD 3C6LC 1CFVH 2DQJL 4ODSH 1AI1H 4OM1L 3CSGA 3ZKND 1MVFA 2OL3B 4PUBH 5E00A 3L95A 4IMLB 2HFFB 5H94A 1EEUA 1DTUA 2NY6D 3ARFB 5KANG 2X42A 5DMKB 4KKLC 4NYLA 5C08D 2BJMH 2OCFD 3C60A 3U0WL 4AL8L 2DQDL 1G7HA 4MA7H 5I1CH 4KY1H 1P2CB 4YE4H 4DTGL 3W82A 4O2EA 1AD0B 2BNRA 1TZHA 1KEMH 3RVXC 3U9PL 1F8TH 2F19L 1A7RL 4BH8A 5MERA 2HTKC 1MY7A 1HQ4B 1S8DB 1OGAB 2NYYD 5FO7B 2V5SA 3QG7H 2YUVA 4LCIH 3EO1B 3ZLQC 2AERT 2GJZB 3KPLA 2UVEA 1UZ6F 2JCCB 1CR9H 3RA7H 5HGDB 3BPCB 3KDMB 2VH5H 4QGTA 3W11D 4PV9B 1KN4L 4NHUB 3QULA 1JWUA 3HZVB 1RD6A 4H1LH 5DLMH 4Y2DD 1S7UA 3U30C 1JPSL 3UYRL 3AREC 5C9JB 1ZLUK 4D9LH 1WWCA 1IQWH 4WNQA 3PV7A 2ATPA 4D0CA 3EYVB 4P5MB 4NQDB 4UDUA 2Z93B 3STZA 5ILTH 4Z0BL 3O3EB 3T0XA 1FDLH 4AT6B 3TM6A 3NFPB 5DJ8B 1C5BH 1KCSL 2NTSP 4PJCA 2CDEA 4N1EA 3O3UN 4Q9BA 35C8H 1PEZA 2VN4A 5GQBA 4JQVC 1MEXL 3NPSB 1U42A 3EGSA 4PJAA 1MHCA 4FS0A 3HUJF 4HKBB 2EC9T 5IMMB 1MELA 1I9IH 4ZNEA 4F80A 2C3VA 4MJID 3QCTH 1BIIA 1TNMA 2J8UB 3P3YA 1A0QH 2W38A 3UTSD 4Z9KB 3RX8A 2OM5A 4NRXA 2IAND 1YEJH 3UCRA 3L3GA 1T03L 3QBTB 1J5OH 2VERN 1R5IB 5DZNA 1WTLA 1ZK9A 2C26A 1D6VL 2VSCA 5DVMA 4X6BA 4ZQKA 1D6EA 4RFEA 4L9DA 3FTGA 4EBQL 5CSZB 2JCCE 4X6DF 3OKOA 4CBPA 1LE9A 4LCCC 3L9RA 2MTPA 3D0LA 3HA0A 1B6DA 1GXEA 2VZOA 4HBQA 3TC9A 4CADB 1BBJB 3QRFM 3GMRA 1SM3L 1V5JA 1AR2A 3I50H 1JGUH 4AEFA 5F9JA 3ESVF 1XCTB 4L4VA 4ELME 3H3KA 2NLJA 1UENA 4PG2C 5F21B 5TPWH 3NZ8A 2H8PA 1IAIH 2CSPA 3IFPB 3QZWA 1AR1D 4JFOA 3MLUL 4Z7VF 5M95B 3KVQA 4I8DA 2NZ9D 2NY0B 4R4BA 1M71A 4TUOB 4I0PA 1L7IL 4E5XA 5EBLA 4KKAC 2A6KA 4WU5A 1JGEA 5EIVA 3CFDB 1UCTA 5JIHA 2QHLA 3TVMC 2ICEB 5ALCL 3LKNA 1IAIL 1ACYL 4RQQB 5GRYA 5L2JA 3QUXB 3X3GL 1MAMH 3OR7A 5HHNB 1UZ8A 3B5GA 4NNYB 4OCXH 4OD3H 2OLDA 2R69L 3X12A 1A6ZB 1R5WA 5ITFB 3RAJH 3ISWA 1RZGB 3BQUC 4Z7UA 1E0OB 2Z0BA 2FSEB 5E6IA 3RTQA 4RGNC 1G6RB 1T21B 3ARFA 5ACLA 5I8CA 3O4LB 1TIUA 4PJFF 3L5WB 3GMPA 5KAQF 1WEJH 4NCDA 1S9WB 4M6OL 3VI4E 5KJRH 1JYWA 4PJ7A 4FQ1H 2NY2B 5F8QC 5GISH 3QIWC 3H9YA 4KAQL 2DQJH 3QIWD 3V4PH 1I8MA 3E6FB 2YUWA 5C0CB 5CJ8A 5GS0C 3WBDA 4EXKA 4O2EB 3D3VD 4O51B 1WUNT 4NN6B 3U83A 3SKJL 5J6GA 4JZJB 3F58L 4NWUL 1F90L 4QHKJ 3HE7C 4LLMB 4UU9A 1LDSA 1YN6B 4N1CA 5IK3B 3TWCH 3OF6A 4LBEA 1ED3A 3QPXH 1AY1L 1DLHA 1M6OA 4RFNB 1D9KB 3O45A 2G9HB 5EO9B 1NCDL 5GSVA 3IDIB 3TJEL 5I66B 3EOTL 2XKUA 3QI9B 3B9EA 2WBJA 3T77B 4Q6YA 4CVXA 2OI9C 1TZIA 3BE1L 1Q8MA 3M1BA 5JOFB 3PDDA 2AJZB 4HJJH 3TH2T 2R8SL 3CZJA 4HCRA 5E1HB 3HC0B 1G7LA 1QPXA 1QVOA 3IKCB 4PV9A 3FQTA 5CD3A 1GGUA 3MLVL 3QDAA 3QNYA 4U2ZA 3MR9A 3S37L 5DD3L 1KJMA 4GXUM 2ARJB 4HUKB 3HAEB 4O5LH 4B7LA 3WIIL 3GM0A 3WN5A 4HUUA 3QXUA 5HHOB 5IB3A 3AUVA 2Z4QA 3QUZB 5C3TA 4JN1L 2APFA 1KIPB 5IJKC 2GSGB 3MJ6A 4Y1AE 1AP2A 2AJUL 3QDMB 3A67L 5ADOH 5E6ZA 3RHWF 4NCC1 5CJOL 2D7TL 1IKFL 2YD8A 3KYNB 4TVPE 1S7QA 1FNGA 3FONB 4LLVB 2ZP0T 1QFWI 4Y16A 4JGJA 4X7CC 4JHAL 3VXRA 2XZZA 4PJAB 2BCKB 3DURB 3HR6A 5I1JH 5FA4B 2FO1A 2H9GA 5C08A 3QNXB 4LDLB 1BVZA 1LMKA 4ZTOH 3TNNB 4OIAA 5EO0A 3RGVB 1H3UA 4CMHC 4H88H 1Q0XH 5HVHB 3KR3H 4LSDA 4P2QA 4X6EB 5C0BB 5JQHC 3ABZA 1CFQA 5D1XA 1AFVH 4YHKH 4ZTOL 1P5VA 3L1OH 2RIKA 4QF1B 2VDML 4NQCD 3IU3B 4PRDA 2IG2H 4DKFH 5L2KD 1AXSB 5IROA 4U7KA 3RUGB 2B39A 5L7XL 2FEDC 4Y1AD 2ZCLH 3MV9E 4C54A 3IAQA 4JO3H 4XP9L 5JOPD 4FG6D 3Q5TA 4P4KB 1WWWX 3MOQA 4L3EE 4UTBL 3UX9B 1YJDL 2YA0A 3SGEH 4Z76A 5GS0L 5GZNC 2PTTB 4KI1A 4L9LB 4MD5B 3RZCC 1GGIH 3L6FB 4F57L 3MA9H 4X6FB 4OZHF 2OR7A 5CIPB 15C8L 4AEHL 3KPTA 2IPTH 5I1GH 1QFWH 5D5ME 3DGGA 5D1ZC 1FL5A 1M71B 4TUOA 3H2WA 2IBGA 3BDYL 2F53A 3OX8B 3HZKB 3QQ4B 4ZDHB 3H42L 3LKOB 1MUJA 5D70H 1EO5A 3WNPA 3FB8B 2ITDA 4ZPTB 3TCLA 4NM8H 1NPUA 4MAUH 4K8RD 4WENB 5CZVH 5E5MA 3S35X 3Q6FB 4NKOA 1X5ZA 2HRPL 4DAGL 2A9ML 3MRFB 2FGWL 4ENEC 5L2KE 2Q7YB 1F3JB 3OKDB 5ESQA 1E4JA 3UZVB 3DNKA 5FOBB 2YD9A 2N4IA 5JOPE 2NY5C 2MKLC 3RTQB 4L3ED 1NAML 4GQ9L 3OXRA 1KEGH 1UXSA 5A3ID 2YWZA 5C0BE 4JAMA 2F8OA 1O7SA 2DM7A 4LNRB 4F7PB 4V2BA 4V1DB 1ZMYA 3PIQB 1F4WL 4GG8B 4WHYG 3GSOB 5IQ9A 1DANT 2LTQB 4M61B 3E2HC 3KGRA 4LRIA 3U4EA 3RP1A 1TJIH 3LS5L 5BVJB 1BZQK 4G6FB 4HUWB 2BERA 1AXTH 1SMOA 3LS5H 3VXUE 4KUZH 3KS0H 4KZDH 1IFHH 5DJAB 5DD5H 1XF3A 3Q3GA 2CMRH 4QT5B 1NAMB 2UWEA 2A73A 2MWCA 5CGMA 3GB7B 4HC1A 1FNEB 1VFMA 3L3IB 5SWZD 4QXGL 2ZUSA 3M1BB 4LRNH 1MLCB 1IQDA 1MAML 3N50A 3HNSL 2YUXA 3WV0A 1R5VA 4HCRL 3MBXL 4Y4KA 4HXBH 1BQHB 1C08B 1NAMH 1Z5LA 3IJSB 2BHZA 4PJDF 5ICXB 2DQIH 5TGBA 2ARJA 3Q1SH 2HJLA 4BZ1H 2BY3A 3L3OB 3WN5B 5J11C 3HPJB 3C09B 2DQFA 4ZYKA 3AXLB 3QUMH 4XGZA 2VR4A 2BHUA 3VH8A 4HWZA 5GGSB 2YSSB 3BDXA 3KPQA 1OSPH 3TESA 1UC6A 4YXHH 3JVGA 4WFGD 4BSJA 2DAVA 1KPVA 4LAJH 4JPWL 3B6SA 4Y5YC 4K3GA 3V7AG 2YPLD 2ZSVA 1K6QL 2VL5B 3VRIB 2A9NL 4GRMA 5T5NF 3TO4C 1DVFD 1WBXB 3OKEA 4OJFL 4WWKD 1PQZB 2VDQH 4QHNA 3EYFA 1BZ9B 2LV4A 2BCKA 1QYGL 3DURA 3P4NA 4BKLA 1U41A 4P23A 4WVRA 5AYUL 5T1DL 1VADB 4BQ6A 4LASH 3SDCC 4FQJL 5ID1B 3DX6A 3TFKD 3KXFB 3ZDYE 1RMFH 1EUUA 3VCLB 1AGBB 2NTFB 4MD4A 4HK3J 3C5ZA 1UT9A 4R4NC 1W0YT 3PGDA 3ULUH 2AJXL 4JRYA 1FSKC 1OAXH 2IALA 1I7UB 4U0RC 1OT1A 2MCPH 4QF1A 3ARPA 3U0PA 1I9IL 5HJ3A 1NBYA 3PWPE 4M8QB 3F7RA 3S4SG 3GNML 1G9MC 3B2UC 4QCIA 1S7VB 4H88L 4NJ9H 5INDA 3K2UL 2B2XH 2ESVA 3SO3C 2P5ED 5HDOA 5MEOB 1A0QL 1T5XB 5F7EH 4Z5RB 5H8DA 5BZWA 2PW1B 4M7LH 3VD5A 4WJ5A 4RMUA 5EFIA 3MV7E 2IH3A 1DUZB 4NC0B 2WIIB 3F12B 4JQVA 1H3XA 4BQBA 4GRLC 3HZMB 4JDZB 1N5AB 2VISA 4X6FA 3PXHA 5CIPA 1MEXH 4IS6B 4HUMB 1I1AB 4F9PA 3LKQA 4R2GC 4RDQF 4G8EA 4GLRH 3VW3H 2XTLA 5E8PB 1INEH 4W4OC 1EMTL 5I1EL 1O0VA 3FOMA 4YDLB 3SCMB 2DL9A 2BSTB 3JV4B 4GXVH 4HIEB 4HWUA 5DJDB 2UYLB 4NT6B 3WNNA 3W81A 3MBEA 4HULB 1XMWA 15C8H 1W2KT 2C3XA 3DRTB 4X99A 4PJDB 5IV2A 3PWPD 1EFXD 3UMTA 1WVZA 2Q7YA 2ORBL 3WLBB 1JPSH 1AGFB 2YBRA 3ZTNL 3B83A 4P2OB 3MLXL 4G6FD 4J1UB 1JZ5A 5HYSA 3HPLA 1QA9B 4EIGB 4HD9A 1NL0H 5F7EL 4LF3B 3FT4A 1JTTA 1BHGA 5EPMB 1NH6A 4JAMB 5T33H 3INUL 2V5TA 4ODXB 1S9YB 3G5ZA 3FRPA 4XNXL 1NFDA 2Z92B 4PG9B 5D7KD 3C6LD 4LKCB 2X1QA 5LQBH 4WIQA 5EIIA 3DLQR 5IQ9B 1OB1A 2DLFL 3U9UA 2DLGA 1U8MA 1XR8A 5GS2H 4D3CL 2V7NB 5D1ZD 1B0WA 2NPLX 3ULUL 2I60L 3LKSA 2GEEA 2AI0H 3VDBA 3ALXA 3QFJE 3KPMB 2Y36L 1A7NL 1DP0A 3PWLA 5FUZH 1YMME 2PYEA 5CEXB 3U4BH 1LO2H 4HEPG 1H15A 2MHAA 5AYUH 5I1CL 1XCQA 4WHCA 4FQ1L 5T1MA 4WGVB 1WV7T 4OFYD 4ENED 3D18B 2CRIA 4OD2A 1NMBH 2V9QA 1E6JH 3O6KH 2ED9A 1Z5LB 3IJSA 5JR1L 4S1RL 2FNBA 5D1QB 5MHSD 3V95A 2IEPA 4LPVA 4Y4FB 2R56L 2AV7A 2ZNXA 4WDIA 1JHTA 1KF9B 3HC4H 3MMEB 3R8QA 1LK3L 3GIVA 4WU7B 1IGCL 2L7JA 2FEEI 1HXMA 1VFBA 2X4SA 2P45B 1B4JH 5CEYB 3MXVH 4YXLL 2VQUA 3C5ZC 5FGBA 3GMMB 1J7VR 1K6QH 4LL9A 3LDBC 4P3DB 3BWAB 5IVZB 1CFTB 4O5LL 2FZ3A 4GBXC 4LGRB 4PJAF 2OXGA 3B2VL 3GSUA 5GJTL 4R26L 4ESKA 4U6VH 3AU1A 4LARL 2E3VA 4AH2B 3MLWH 1KENH 3OPZL 4OCMC 2BHYA 1AD9A 5IB1A 1G9EA 4ZAKC 3OGCA 3VWJA 3BFOA 1XEDA 3BWUC 4I0PC 4Y5XB 4H25B 1IVLA 3V5KB 3ZSTA 1B2WH 4NNPH 2X4OB 2WBKA 5E4EB 4MXQD 2D7QA 4U7MA 3VFMB 1KJ3L 5TE6H 1IM3A 5CILL 4J4PD 1V05A 2J5LC 2YOCA 3PJSA 3VGHA 4GRWB 2V7HB 1CLOH 5C7XL 4LLWA 2I25N 2EEAA 2EO1A 4PLKC 3UZQA 5C0GB 3LS4L 1KCUL 3QQ3A 5F3HA 1YEGH 2MQCA 2DWDA 4NZTL 4PJHE 2DJ4A 5DVLA 1GCFA 5EU7E 2C1OA 4RAHA 1A4JB 2GAZB 2P5WA 4PJ8A 1WFNA 1KJ3H 4U05A 4NQUA 7CGTA 5LGJB 3NFSH 4OUUA 1B2WL 4WI2A 3DARA 4OZHB 3E6HB 3A6BH 1EHLH 3LD8B 4ZODA 4HEME 1S7XA 1KB5B 3GJFB 1K8DA 2AJ3A 3GUTB 5H35B 4RZCB 5GIRB 5HVGB 1FZKA 1ZS8B 4OM0H 3IJYA 5CZVL 3PG2A 5D2LE 3K3QA 3P77B 3VU2A 1YY9C 1GHFH 2HTLC 5BMFL 4LGSB 3C8HA 2HTLD 5E8PA 1NGQL 1MI5D 4XAWH 5IEHB 3H42H 4G6KH 1N26A 5CBEB 1MQKH 5KVDH 3O6ML 2UZIH 4XTRC 5B8CA 3F7YA 2VLMD 2V5MA 3LKPA 4NT6A 1Z6JT 4HWEL 2B1AH 3S5LG 5KSAB 4OCWL 4DAGH 4PJDA 4PJ5E 4YXKH 1U8HB 3MA9L 3W9EB 4W70A 2W9DL 4RMVA 3EW3B 1SY6L 1EDQA 4F58L 5HYSB 4WWID 2R56H 3BDYH 4ERSL 5AD0B 4YR6A 2CDGA 4LP4A 3VFWA 3ILPB 3RWCB 2VXUL 4DK6A 2ICWJ 4N9GA 5L7XH 4PG9A 3OZ9L 3OKLB 1D9KD 2C3WA 1BQHG 3SCMC 4P9MH 5F1NA 1AFVL 3E3QC 1BVLA 2DQCH 1CT8A 3C2SA 2YR3A 4G6KL 4HIIB 1DQLL 3JZ7A 3N1FC 1X9QA 5F7DB 1GHFL 5FGCB 4XNUH 3CSYB 4MAYA 3MOAH 3CDFA 1KULA 2NY2D 3EOBB 3QUXD 3VDCA 3C6SB 3CFEA 3TF7C