4LLYA

Crystal structure of pertuzumab clambda fab with variable and constant domain redesigns (vrd2 and crd2) at 1.6a
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
220
structure length
220
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFTDYTMDWVRKAPGKGLEWVADVNPNSGGSIYNQEFKGRFTLSVDRSKNTLYLQMNSLRAEDTAVYYCARNLGPSFYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVATGPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords mutated Pertuzumab Fab heavy chain
total genus 48
structure length 220
sequence length 220
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llyA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llyA01
4RAUA 4ZQKA 2VITA 1FZMB 4OFYA 1EAPB 1EJOH 2MKLC 3LMJL 4LPVA 5ALCL 3F7YA 5FGCB 4PJDE 3BP6B 3DIFA 1TVHA 1D5BB 3QFDA 5L8JB 4CVZA 4QTIH 3G5ZA 4OB5L 4X5XA 2QQNL 2APVA 3WUWG 2W9DH 4XWOD 2YUWA 2YA1A 5IB5B 2K7PA 4OIAA 4CVZB 2HH0H 1W2KT 3WCYA 1JZ5A 5ENWA 3C60D 3HNVH 1KJVB 3KPSE 4G42A 5SX5K 2X4OB 4HUWB 1F4XH 1F4XL 5D1QC 1CYGA 1AHWC 4XBPB 1RZIA 4QRSB 4MD0B 1A64A 4P99A 5CWSA 5JMRA 4NNXA 4HXBL 5C08A 4OAWB 3AGVA 4LHJB 1ZA6A 3KPRD 3RKDC 1BQHB 1F00I 2XQBH 3ULUL 1BEYL 5I1DB 1ZSDA 2VAAA 2Z92B 1V3LA 3Q5OA 2EIZB 4XHJC 3ULVE 1KJMB 4OD3L 5D1ZB 4RGNC 3LS5H 3G6JB 5DD5H 5I1AA 5HHPB 2J88H 1FH5L 3NZHH 3HR5A 2QADC 1WVZA 3LSOB 3D69A 2DMCA 1ZHLB 5DMKA 5E6ZA 1K2DA 5IJKC 1IAOB 3GMLA 4WEBH 4F7EB 3DMMC 4LCYA 1IM3A 2VDLH 5T3XE 4L4VD 1JGUH 4DVRL 1JWUA 3G6DH 3P40A 2F5AL 4WWKA 1MJUL 4XMKH 3CVIL 1AO7D 3HN3A 3UTQB 4CL7A 3BWAA 4HKXA 3JV0A 5D1QD 3T4AA 3GSUA 2A6DA 1NL0H 3G6DL 5J57B 1KB5H 4UILH 4CVWA 2PKDA 5D2NC 1OAXL 5SWSB 4HAFA 3MRQB 2F53E 4PJ7E 4NM4H 1QLFB 5GISL 4IEFB 4K9EL 4XNZC 2CK0H 4QWWD 5K9KB 1YUHA 5KSAC 4IM8A 4FABL 4FABH 4PV8A 2JIXA 1NAKH 3GBNH 1RZ7H 2OS7A 1JNHA 1QR1B 2O5YL 4LSRL 4OQTH 4BJLA 5IK3B 3L9RB 4UQ3B 1H8SA 4GW4B 2WBKA 1UKSA 5L6YL 2APTA 4JQVC 3D3VB 3L3KB 5ID0A 4K3DH 1CXKA 1KB5A 2DLEA 1EZVY 3RWHB 3AREA 3HCVB 4N9GA 2HT2D 3FFDA 4LLVA 2AJUH 4DW2L 4OBSA 3RWHA 3PHOA 3T77A 4N8CL 3CFKB 5EBGA 2C1PA 1ZLVH 2PO6B 1LEKB 3VWJC 3V0AC 5EC1A 2NYYC 1MREH 3KPRE 4P2CG 3VGDA 1HNGA 3DO7B 2XTJE 2J8UB 2HLAA 2C1PB 1AFVH 3GSNA 2OZ4A 4WHDA 3C5JB 4J4PD 3SO5A 2XA8H 4WFHE 2O5ZL 3KLDA 3HPJA 3G04A 1DVFC 3OTTA 3W39A 1MY5A 3TNMA 1R5VA 4BQCA 2C3VA 1NMCC 3BUYB 1T7YA 3UAJC 2F54D 4XP1H 3BKCH 4DN3L 2WP3T 5BZWA 1CGYA 5DD0H 1FL6B 5HHNB 2QL1A 4HWZB 1R3IL 4GS7B 2L0DA 1IC7L 4F37K 3LKPB 5CEYA 5DFVD 1CT8B 3MLPA 1WAAE 4I3SH 4N0RA 1AD0B 3PWPD 1EHLH 5BOPA 1GGTA 3WO4C 1A14L 3IXAB 5ITFB 2D31A 5FYJU 4U31A 4WI4A 4KI1A 5A43C 1KTLB 4QRPB 1HEZB 3GK8L 1UZ8A 1JYNA 1MHEA 3KJ6H 2H26A 5JNYB 1OHQA 1KXVC 5A16A 4X9IA 3NBNA 4JJ5A 3QULB 1TZGL 1JN6B 4LFHD 1U8IB 3T2OA 1A1OA 4Z0BL 1I4FB 3P9MB 1IARB 2XFXA 5E8NB 5HI3D 1UADC 1ZLUK 2BXYA 5F88A 2NXYD 3VXOB 1WZLA 4G3YH 1T5WB 4K7PL 3TIEA 1A0QL 2HYMA 4NZJA 1H8NA 3IKCA 3V4UL 1G7JB 4BSJA 2ATPB 3NAAH 1QG3A 1MFEL 1Q9KB 3FO1A 2BOCA 4L8BB 3LV3B 3N9GL 1NCTA 3BGMB 4FFZH 5F7UA 2CDGB 1MFDL 3KJ6L 3MV8D 5J06A 4NP4H 3E3QE 4GRMB 1MWAB 3OB8A 5SWZE 2R0KL 5GGRA 5EC2A 4X6FB 4L4TA 3VI4F 4MCYB 3T08A 3U9UB 2CDGA 4NM8H 2XN9A 1TCRB 1K9TA 4JM2D 4K3JL 2IADB 4YO0B 2VUYA 3V0VA 1YJDH 4CJ0A 2BVEA 2PTTB 4UTBH 3GMRA 5DMGD 2AK4A 5ITBL 3ABZA 1HDMB 2CO7B 1WWBX 1JRHI 2CQVA 2VDMH 4YAQA 2CLVA 1MRDH 4Y1AD 3WNPA 3QUMH 2VXTL 4BUGA 5L88L 3K2MC 2PCPB 4YDLB 5H37H 5ITBH 2VZ1A 3OSKA 2XZCH 4R26H 2BMKB 5DR5L 5C0BA 3GRWL 5DK0A 3NMEA 3GIZL 5CHNB 1T66D 1ORSA 4N0YL 4OZHB 4XPAH 5GS1A 3P0YH 4Y1AA 1NGZA 1E28A 3QQ9C 5CWSB 3IJSA 4FMKA 5CJOH 1Z3GH 3IU3B 4XCCH 1NEZB 2W91A 3I6KA 4YX2L 1ORSB 4PJIF 1FCCA 1PG7W 2J1KA 4G7VH 1MREL 1SVCP 4JO2L 4N0YH 3L7FB 3MLRL 5KANI 5D6DC 2AJVH 5HJ3A 5A2FA 3L3IB 4U1IB 4KTEL 1OGTA 1F4YH 1KIQA 2EDLA 3RP1A 2AABH 2QQKL 1TVDA 2DB8A 2H2SC 4MA7L 3FCTB 4KKCC 3N85L 1EBPA 3I75A 4JZJC 3RWJA 4PGJA 2BNQE 2BSRA 3U4BH 3OKDA 2ZKHL 4UMGA 3BP7A 4FA8A 1C5BH 3CDYA 3OKKB 4R96A 5I1CL 3PGCA 1SVZA 4YFLF 2WBJC 4HXAH 4NWUL 4S11A 4HUUA 4M61B 3QDJA 2R39A 5I73C 5DJDA 1FBIH 1N5AB 2IAND 4U6VL 3H6JA 1YEFH 4WVRA 4UV4H 3L7EA 3TPKA 3UJTL 2VLKE 1IFHH 2DJUA 1HQ4B 5D7JC 5MEQB 3AU1A 5HYIA 3T3PF 2ARJB 5K9JH 4HPOL 5JZ7C 1ADQA 3VGBA 4BFEA 2IC2A 4PJ5D 4UV7L 4QYOA 1X3DA 3QCUL 3AUVA 3OGCA 4ONHA 4J7RA 5HY9B 3ZE1F 1EEZB 3G9VA 4ZUSA 1G9MH 1DFBH 5I1CH 1NUFA 4NZRL 4OLUH 2YRPA 3CK0L 4LK4A 4NQEA 5I17B 1HXYB 3D48R 1D5MA 1RK0B 3FQRB 1MI5D 3KYMA 4K9EC 4XPGH 3UO1L 4YHPA 5JO5B 5IBLD 4WTWA 1GOGA 3ARFA 5CUSH 5D7IE 4KRLB 1T83A 3HCVA 4MXVF 1WISA 4XXDB 3LRGA 5GJSH 3KNBA 1BIHA 1T89C 4O58L 1CWVA 2O61B 1LNUA 2FB4H 3RPIA 4G8GB 4MAUL 5HI4C 5DD1H 3GSVB 3MCLH 2HG5A 5JNYA 1MLBA 3QHZL 4PJ5A 3FQNB 3RPIB 1EHXA 1NC2D 4X9HA 3QUXD 2Q8AH 4TUJB 4XVTH 3QNXA 3ROOB 2FGWL 3QWRA 1X6LA 2YD4A 1QA9A 2W0FA 4MYWB 3BPNC 5T1KB 3RY6C 2NX5B 5DQDH 3WE6B 2ADFH 2AJSH 1XIWB 4Y2DD 5C70A 3RQ3A 3ARED 3F12A 4GKNB 3MUGA 5HHNA 1QYGL 2O5XL 1KB9K 4J3UA 5GJTL 3DX7A 1RUML 4KK6D 4NQTA 5F7HA 1J86A 2KQNA 4KJWD 1H9VA 4NRZB 4RNRB 3MBEC 5K9QG 4NQCE 4O5LH 4H26A 3OJMB 1P7HL 2XN9B 5JZ7D 5EO0B 2JIXD 3GBLA 4XVJL 4YO0A 2P5EB 1A7OL 4LASH 5TE7L 5I9QB 4X6DB 1KUMA 1EJOL 5D96B 4DJMA 4M6NH 3E6FA 4TN9A 1ZEAL 3QULA 4POZD 3D3VE 3VA6A 1CQYA 4EVNB 2A0LD 4JREC 4PGCB 3MXVH 3OAUL 4Z7VB 3TO2A 3VXPA 2W1NA 5FOJA 4YHYB 1S7RB 1J0IA 3CVHA 3U0TA 4POYA 4I0KA 3ES6B 3HMXL 3QDMA 1EFQA 5DHXB 1BWMA 4MVBD 4ZXBD 1FO0B 4XCYB 2YKLH 2OTPA 3RIFF 4HIHA 5ESVA 1A1MB 5AYUH 2MCPH 5JPNA 1GGBL 1PFCA 1F58H 1VDGA 2AJXH 1CZ8L 1QQDB 5SWSE 3BH9A 4OD3H 4IJ3C 4KVNL 3NZ8B 5KVEL 1EIBA 1I1AC 5GS2H 3F65A 1U8QA 3HZMB 4FS0A 4IS6B 4OFPA 3WS6A 1FNSH 4Z7UB 5CJQH 5L7XL 1T22A 5GPRA 3U0WL 4KGLA 3EO1A 2X70A 4WI9A 1PYWA 4LSUL 5D9SB 5BRZA 4YHZL 5E1AB 4G6ML 4L8CB 5JW4R 3H3KA 3ZTNH 4Z7QE 1CGSL 5D6CB 4Z18A 3FT2B 3KYOA 3VGGA 3MV9D 5D7KE 3VXRB 1SEQL 5IBLC 4IRSA 1OW0A 5F7DB 2W60B 3UTTB 2HWZH 4I1NB 5IJVA 1I9EA 3GI9L 4GRLC 3QDMD 3VD9A 1YNTB 5FV1L 2DTMH 3ARSA 4H25A 1VADA 3ZSSA 1XCTB 4RGOH 2NY1B 3LS5L 3BI9X 3GSOB 5H8DA 4KMTH 3MV9B 2EXYC 5DK0B 3QAZB 5BQ7A 1JHKL 4PGZA 5I6XC 2XRAL 3C08L 4Z95L 1T21A 4FQCL 2DD8H 4P23D 4XGZA 4NKMA 3G5VB 1FYTD 4NZUL 1BZ9B 1YNLL 4X5XB 3EYFA 5KSUB 3TBTB 1UM6H 1HXMA 3F5WB 1P4LB 5EBMA 3WXVH 5JLZB 1RVFH 2QEJA 4PTUB 2A9ML 4DKDC 1WTLA 3PWNB 5HI5C 1UT9A 1XF5A 1U8NB 4EKXA 3T8XB 3RHWF 3E6HA 4BK4A 4TUKL 1KLGA 3WXVL 2WNGA 3IETA 2D03L 4L4TE 4ZG1A 3BPOB 1GC1L 4KMTL 3FB5A 4HUNB 3C87A 3QDME 4LLVB 3N50A 3RI5F 2OBGA 1E4KA 1N5YL 1IGIH 3B2UC 1QTYT 4TNVK 4OLZH 4AENA 4GW5A 5C2BL 5F1IA 5FF6A 2Z8RA 3QXTA 4P3DA 3VRJB 5FYLE 4P4KB 4D8PA 4JM2F 4MAUH 5DHVH 5F72S 3PWPB 3T0EE 1CGVA 4K94H 5BVPH 4LU5L 1PAMA 2I9LA 4Q0XH 3T4YA 5CKAA 1FFOA 4YR6B 5MEOB 1SM3L 3CC5B 5T5NG 2CO6B 2EEAA 3OAYK 5J11B 4KXZI 3GZKA 1UJTA 4X80L 3VFTA 3WIIH 3TH4T 5BZDB 3SO3B 5IK3A 2HVKB 5FA4B 3ULUF 5HHQA 3M17A 2IANE 4GXUM 5DQDL 2J6EA 1A6VL 3QEHA 4OFVA 5D96C 1BF8A 3ZDYF 4FG6C 2B4CL 5BV7H 1M6OA 1BECA 3C8KB 3OB0H 4HWZA 3HAEG 5CZVH 2Y6SD 3VWKB 2WUCL 5LXGH 1VSCA 4KDTA 5CP7B 3EJYC 2GJ6A 1CT8A 3HMXH 1LO2H 3F12B 5D2LA 43C9A 4OLXL 1UWEL 4OLXH 5DGQA 3ARFB 5IB1B 3HNTH 3MNWB 3WNMA 4CDGC 3U7YH 3OKMA 1FFRA 2EE9A 4DVBA 2V2WB 1UKQA 5A40E 5IGXH 4OZ4A 2FYYA 5CP3H 4XNQB 4UQ3A 5C09A 4EI6A 4M1CC 5ANMA 3TVMC 4J12A 3A67L 5MENA 3CCHB 4Z7UE 5DGRA 3CSGA 3SGJA 3VXSB 4Y5XB 4E5XA 2IBGA 4MDIA 4K7FA 3WFEH 1AGEB 1KCRL 5KN5B 4OLUL 3PWJA 1W72B 3DHJA 3V52H 3OPZH 5JA9A 1IC4L 4Y5XA 1AI1L 1NC4B 4XX1G 5I19L 5J1TC 1ZHNA 1RZ8B 2PXYC 4P5TC 3PHOB 4LQFH 5JHDD 3IAPA 3O3AA 3AAZB 1UM4L 2XKUA 2V7NB 2EH7H 2PO6C 3L6FB 4Y1AE 1BVLB 2AV7A 4HZLB 3S37H 3HG1E 2UWEB 3SPVA 1F90H 1ORQA 5K9QI 3O8XC 3C6LB 2VLRE 1JZ4A 4GG8A 2Q8BL 4H0HB 2PTTA 2GHWB 1YNKL 1T03L 5E24E 2G5BA 1QKZL 1RJLA 4PJXB 1NMCB 3HG1D 1YMME 4YFEA 3FQTA 3MV8E 2HLFD 2NY0D 1R3JB 5ACZB 5HHOB 1HHGB 3PQYD 1F13A 2IAMB 4R2GB 2E7BA 4RZCA 1SBBA 3GMOB 4G9FB 5A2KH 5F7DA 3UTTA 6FABH 2Y1VA 5IQ9A 3MRBB 2VLRD 1WZ1L 3IRZA 4OZHA 4YBHA 4IRZL 1UXSA 4TPRL 2AXFA 1MUJA 3IAQA 4P3WA 2R8SL 1DBJL 4QXGL 2CH8A 4XNYH 2BX5A 2VDKH 2QQLL 3LHPH 4P9ML 4L29A 3QXUA 4KKAC 1FVCB 1Z9LA 4M7LH 4IRJD 1GVIA 1MUJB 5B8CB 3EYFB 3K4DA 5KSUA 4HUKB 3GSXA 1CTNA 2B1HH 2EIZA 4G8IA 5FAAA 2Y25A 4PJBF 4HS8L 4EXKA 4N5ED 4F9PC 4OV5B 5IJKA 3TM6A 4CVXA 1J1XL 1ZVHA 3P4NA 2OI9C 1QD0A 1DQJB 3SDXE 3ROLA 4OV5A 1JF5A 3FMGH 2VL5A 5AG9A 3A0OA 3U30B 4F8TA 1NCCL 1CLZL 2EDTA 4HDIB 1ZLUH 4A6YB 3QEGH 1WCBB 3VWKC 3DETD 1WWAX 1PG7X 3RL1B 1S9YB 3KPPB 2FH8A 3WNLA 1JK8B 3DYPA 4NYLA 2B7DT 4F57L 4OM1L 3AXLA 1IFHL 4TTDD 3DGGA 3TPUA 5BV7B 1ONQA 5DJ8A 3RUGA 3QQ4B 4QYOB 3SDCD 1NGWA 4DZBA 5ADOH 3ULSA 2N4IA 2NY4B 3X11A 2NY6B 4NCC1 5C0EA 1ONQB 2BRRL 3Q2CA 5K9KA 3TJHD 1G7HB 1T66C 1FH5H 1DLHA 1NBVL 4NRXB 2JB5H 2DQFA 3K2UH 1BFVL 4UZGA 2EDRA 2GFBB 5D70H 1C12A 3OXRB 5I1HL 1W8OA 4AH2A 4PJAE 1YPZA 3L3HB 1P2CB 4PJ8A 1XF2B 4JCMA 5C1MB 3RPKA 4C4KT 3W0WB 4KFZC 1TQCB 2DBJA 2R1XA 1CD1B 2F54A 4D9RD 1JBJA 5CLWA 4P5TB 3MRPA 5I1KL 3NFSL 3V6ZB 2PNDA 3U4EB 3EKCA 3ZHDA 2QADD 2D7PA 1I8MB 2JJTC 2FL5B 2ICEA 2AK4E 2V2WA 1OLLA 1C1EL 4JHAL 3T65B 4U1NA 1JNNH 1G0YR 3EJJX 2VDOL 1J88A 1LNUB 3ESVF 1J5OL 3PHSA 3EDKA 2HG5B 4ZUTB 1IGML 4UU9A 2P5WD 4GBXC 3DWTA 3CFJA 4C54A 3RNQA 1JNNL 4PJCB 5KANG 4HD9A 4JFZL 4DKFH 5CJXC 5C0GB 5IMMB 3QI9B 5GGVH 1N5YH 4H88L 2PETA 1AKJA 5L2JA 4ZFGL 1JF6A 1KENH 4MZ2A 1JNLL 4R2GC 4YHPB 1FYTE 3U36B 5JO5A 4YPGA 1FZJB 5D7KD 3BXNB 5F8QC 1RIUL 4X99B 4L3EA 4HK3N 2E27L 5DRNB 3TWCL 3SE8L 3LB6C 4H26B 1INEL 4JRXA 1OP3K 1MHEB 4TSBL 3TBWB 4RNRA 1PQZB 1S7SB 1XR9B 2A6IB 4M7JL 3V5KA 2AJZA 1MQKH 2QQLH 5BCAA 5B21A 3UDWC 4ZAKC 2XFXB 1KIRA 1S7VA 4WTZG 5KW9H 3ULVD 4PG2A 5B8CC 1MCKA 5SWSD 3VI4E 1FRGH 3VXMA 1QFOA 3N1PC 3OGOE 4Z0BH 1T1XA 4XVUC 4LSQH 2BSTA 3TO2B 4Z7VA 3PXHA 3FQUA 5FYKD 4Y0GA 3DV6A 4L9LB 3NCYP 4X6DF 1RD6A 2F8XC 1ACZA 4KZEL 1X6NA 4LPYA 3VXMB 1JIBA 3T2NL 5J13B 3VXPB 5GS0H 3LV3A 1MCCA 2DF3A 3QXWA 4UQ2A 4RGMB 4WV1C 1F42A 3IDIB 3WFBL 4O5LL 1R3HA 2F54E 3M8OH 1S5IH 4PRNB 3QQ3A 5HGGS 5KBNC 4B0MM 4FFVD 4JN1H 5DK2A 3U7YL 4EN3C 1FNEA 2MCPL 3P9LA 1ZLWH 4I5BA 4F9LC 5L8KB 2R23B 4YQXH 4M7LL 1MCIA 2BDNL 1A4JB 4LEXL 3O41A 1HE7A 5D4QA 4QT5B 1IAKB 1YN6A 1QBLL 2IANB 4G9DB 1TZHB 4O2CB 4LCIH 1ED3A 1MELA 5IEHA 1KG0A 4HT1H 4HLJA 2XTJD 5DJAB 1FL3A 4NHUB 3P4MB 2OJZH 3TV3H 3C8DA 1UCBL 5I15H 5CILL 2W0FB 1NSNH 3CH1A 1T3FB 5D5MA 3VRLE 3QXDA 1QSZA 5IEHB 5D8JH 1XFPA 3FAWA 1D3CA 2BY0A 4RRPA 5JOFB 4JFXB 3EHBD 2CKNA 3MLYL 5IMOA 3O0RH 4MQXC 3W9EB 4ONOA 6FABL 4HDIA 2CIIB 3T4AB 3UYPA 4NM4L 1A1NB 1DL7L 4AT6A 4TRPL 4MXWH 1AXSB 1RUPH 5LVEA 3KS0J 1NL0L 2R56L 3AXLB 3AY4A 3NZ8A 2ICWA 1ES0B 5HJ3B 2L7UA 3H3BC 4I18A 2CIKB 2X2YA 1WAAF 4DWHA 2VAJA 1ZAGA 3CFIC 2WIMA 3JWDL 2EYRB 1CDJA 3BT2H 5D1XC 1GGIL 1S9XB 3BZEA 1CI5A 2P46B 4AMKH 3E6HB 1S7RA 4JN2A 2R1WB 3PQYB 4W4OA 5LAXA 1P69B 3C9NB 1YPZB 3B2UD 4LBEB 3VFMA 4HFWB 3VD3A 3F7VA 3R0MA 4WO4C 3R1GH 4JDVB 1VHPA 4QHLA 4KV5E 5JQ6H 2ED9A 5DJXA 5F7LB 2CUMA 3VD4A 5EZIL 2HP4A 3HZMA 1X5LA 4N90E 4RMSA 7FABL 1U3ZA 3ARBB 4P4RB 2XTJB 3FO0L 3DOSA 4ONGH 4XPTH 1K5NA 3QXAA 4TSBH 1NJ9A 4OKVA 4EOWH 2WM0A 2VXQL 2GK0B 4WW2A 1EEYB 4ZTPL 4JM2B 3UTOA 1FZKA 3T0AA 5FYLL 4DUWA 3U48A 3MGTA 4P2RE 4QNPF 1I3RB 3DO3A 3KYOB 3RNQB 3BWUC 4PJXE 1K8IA 4OLEA 2Q7YB 4ZPVA 3P77B 1JPSL 4JRXD 4NN5B 2JELL 3INUH 4JR9H 5HVHC 3DMMB 3OAZH 5KSBF 2CGRL 2FIKB 1QSEE 3FHAA 3WN5A 2NY5L 1Z0MA 1TVBA 5HGHB 2BNQD 1C5BL 3BKJL 4JFEB 5TGBB 5IHZB 1U3HC 4ETQA 5DEFB 3VXMD 4I3SL 5F89B 4WV1B 4GW5B 1G6VK 2V5SA 3MA7A 3SDAA 3GIVB 4KH2A 1K4CB 2RFXB 4NQDD 3G5VA 5AWNH 4HSQA 5J0BA 1KPVA 3MJ9A 3TVMD 4J23A 1ZT1B 5IEKA 3BVNA 3OKLA 1SQ2N 1TENA 3S3SA 2B4CH 5CEXB 4U6YA 3RWIA 3OR7A 1NBVH 2X89D 3S35H 4MDJA 4QHMA 1INDL 4F7MB 5ANMB 4Q9CA 1BGXL 3O2WL 2Y07L 5E8DH 4NQDA 1YMMA 3QHFH 4Z7WF 1MCOH 3FO2B 5HHQB 3NCFB 4P5TD 5DSCA 3GMMA 1U58A 1WFOA 4LKXB 5ILTH 3QSKB 3RGVA 4N1HB 5CSBA 3BEVB 3DX8B 1U8PB 2WIIB 4G6FD 1VESA 4PRIA 3DRQA 5DZOA 3AAZA 3GMMB 1BJ8A 3BQUA 4N8VA 2WP3O 3IGAA 5BO1H 2ORBH 1NCBL 5EOQL 1IKFL 3BD3A 1WWCA 4GT7A 1INDH 3VE0A 3BQUB 3B9AA 4CMMB 4GG8B 3MA9H 4JO1L 1WBXA 2XN9E 4Y4KB 1FNAA 4MCYA 4RAUB 3FJTA 3O9WB 5EOQH 4JFFA 3W81A 5BZDA 3DIFB 2IWGA 4MJ2A 1YEJH 4O2CA 1X44A 1IMHC 4LSDA 4G8GD 3C2SA 3KPNB 4Z7VF 4P4KD 1PX3A 4N8PA 4AM0A 1ETZA 4HPYL 3ILQC 5HHOA 1H3XA 3TCLA 1LEGA 4KK6C 5DJ6B 3AM8C 1R6VA 4G7YH 4Y16D 3PP4L 3CVHB 3U0TB 3L5WA 4FQ1H 2ZUSA 1HSAA 4PRDB 3DUUB 4R4BA 2VWEC 2ADGB 1RURL 3LKNB 4JZOB 3GBMH 4JY5L 5DR5H 4JFED 2D3VA 1T1YA 4WNQA 1HKLH 5FHBL 3HE7C 3GHBL 3MLUL 5DHYA 4RX4A 4PJBA 3U83A 1OL0A 1LO0H 5L88H 1OP5H 2ZCHH 3S34H 2AXFB 4FQLL 3KLAB 4TQEL 4ZO8A 5DHYB 5MEPB 1R5WA 4Y7MA 3C60A 3LQMA 2D7TL 1HI6B 4U1GB 3RNKB 3CZFA 1FO0A 5J12C 1UQSB 3KXFD 1XGRA 5IHLB 4KVNH 4YBLC 1MH5A 3HI1A 4LVEA 2H32B 3O6FA 5IW6A 4ORGA 5F1KC 1BQSA 4H5SA 4LKCA 4ZDHB 4XNYL 2NYYD 1SJHB 5HHPA 1WIPA 5IB4A 4I2XE 2H32A 1I75A 1MIML 3PDOA 2IANA 3QIWC 4K7FB 4OFYD 3AROA 3QDJD 5F9WB 1U8QB 3AC0A 4IS6A 4OFDA 4GG6E 4Y4FD 2YPKA 2ZCKH 2GCYA 4J6RL 1JV5A 3VFWB 4G6AC 5FGBC 5IFJA 1HILB 3D0LB 4IRSC 1K3IA 1IQDA 3GMPA 5DA4A 4JPKH 1CXFA 3TIDA 4Q6IA 4POUB 1NLBL 3I9GL 1JK8A 1TQBC 4NYLB 3JZ7A 1BJ1J 5DMIH 4Z7VE 2FR4B 1IAIH 1CLOH 3QDJB 1CLOL 1OTUD 5A2IH 2ZUQC 1DEDA 3RWFB 2DD8L 3QEUB 4OTXL 1HWGB 2DLHA 8FABA 3ARVA 1AIFA 4MNQB 4JG0H 4C83B 3X12B 3IDJA 2FB4L 3E0GA 3FO9A 4HEPG 8FABB 1CGXA 4NKMB 3HUJA 1FPTL 1N6VA 5CKGA 4KKBD 4DN4H 5ACMA 3L3KA 3UTTD 4HIJB 4HJJL 4ZXBB 4XVTL 5TDNA 4OZIF 5DMYA 3VXTA 4Q9RL 3FFCA 4WFHD 4HUMB 3VFMB 3LH2H 1N3NA 3I75B 4Y2OA 3MZTA 3OKNA 3O6KH 5CINL 2H2PD 5IROC 4J2XA 5E6IC 4RMTA 4ZFOB 1WC7A 3AS2A 8CGTA 2CLZB 1OAXH 1PDKA 1K4DB 4LLUA 3S97C 4JG0L 3BZFA 3JWDC 1JHKH 2HTLD 5ISZB 5SX4I 5JPMB 3MCKA 1QBBA 3JWOC 5D1ZD 4Z7WA 3Q0HA 3U0PA 2UVFA 2BNUB 5JXAH 3KDMB 5CEXA 2BXZA 4KUZL 4ZUTA 1S78C 2R69H 4C58B 4HG4K 1EFXD 2DWDB 4JO4L 1V7MH 5TPWL 1FZKB 3QUYC 4XC1H 1IM3B 4NOBA 1GGIH 3OGCB 3HE7D 2OI9B 2Q3ZA 1P84K 3DI2B 4WWKB 2PW2B 2Z31D 1NEUA 2R69L 3GFUA 3UMTA 4U1SB 3QUXB 1MCPL 2X40A 3S6CA 1YQ2A 1ZANH 3WLWD 2HKHH 5LQBL 2R1XB 4NQVB 5KAQF 3MNWA 5LBSL 1ZHKA 5HDLA 3EO0B 3T0EC 1T80A 3RZCB 4K8RH 4D0BA 5JQ6L 2WBJB 3BZ4A 3D0VA 1TCMA 3QUMB 5T1MB 3IDNB 1NC2A 2GJ6B 4PRPD 3WYRA 2Q76B 3OXSB 3PL6C 1UKTA 2I07A 4CUCA 2L4OA 3W0WE 1PY9A 3MACH 4HGKC 2VDNH 2LU4A 3TBSB 3H9SD 4BQ9A 3CZJA 3BO8B 3BIAX 5K9JL 2AEWA 2FD6H 4I0CC 4MDIB 4NC2B 4W6WB 5F3BA 2VR9A 1DTUA 3OAUH 2B5IC 1I8LC 1OP9A 2W0KA 3EFFA 3TN0A 3RTQC 5DEZA 4MA1C 2F8VA 3IDIA 1PZ5A 2CDEA 2CKBL 3A6OA 4YHLH 5E95B 2LFGA 4JJHA 5CGYC 2R2HA 2RB8A 4P5TA 1G7JA 3IB4A 4ENED 1F3JA 1FCGA 2VXUH 4QOKA 4TULL 5E8OA 3TO4A 2X1WL 5GRUH 3BEVA 5TDOA 1U8PA 2CKBB 3OX8B 2BDNH 4HULB 2Z93A 1Q0YH 1J0ZA 1OF2A 2YRLA 4PJDA 4DKAA 4GKNA 1M71A 2ZUYA 1G9EA 3F7YB 4YLQT 4LIQH 1L4IA 2Q86A 4ZFFB 4PJFF 1TTUA 5GRXG 1MIMH 2ZUQB 3C08H 4Z95H 4I0PC 4ZUWB 5IG7A 1NUNB 4AY0A 1CFVL 5GS0L 4LNVA 4M9OA 1CIDA 3TV3L 2ZG1A 4NKDA 5IVXE 2ZUTA 4M48H 1T1XB 4KK9D 5CZXC 2X4QB 3QHFL 4QHNA 1OP5K 3QUML 2Y7QA 3EJZC 1RZFH 3I3BA 1MFDH 1A0QH 3D85B 2DOCA 1ZGLA 3UTSB 1HK6A 1NLBH 3QPQC 3B8YA 1I1YA 5FYJE 4PJ8D 5GHWH 2E7MA 2DS4A 3BH8B 1R3HB 4WNQB 5IBTL 4NZTL 4S1RH 1C16A 3LS4L 4NO2B 5MI0C 1A4KB 5DRWB 3QA3B 5IM7B 3EOYG 1F4AA 2CDFB 5E6IB 1TTGA 3O11B 3RU8L 2X4UA 1C16B 1U93A 1Z9MA 3PF2A 4JHBA 2DYPB 4U2YA 3UTPE 1CD0A 3D39A 4X9BA 5HDQH 4NQEE 4NUJB 4Z5RA 4O02L 5ALCH 1MRDL 1TZHA 3LMJH 2GJZB 2FZ3B 2HA1A 5DJAA 1CL7H 3L3IA 1FNGB 1A7OH 1ERNA 5D93C 4FRWA 5SX4H 2VR4A 4F9PA 4ELKB 4LBEA 1XF5B 4NJ9L 4X6EA 1KTDB 3VDBA 3EO1B 1KC5L 4WW2F 4IIQC 4J3XA 2MQ0A 1OOAA 1J0HA 3FCTA 4H20L 2B1HL 3BT2L 2F74B 5FV2A 2YUZA 4A6YA 2E7HA 3GSWA 4LDOB 4KRPC 1JPSH 4JFFE 4LGSB 4WW1A 1MCNA 2VDKL 3MRNB 1Z5LB 5B38A 3LQZA 3WKMH 4GRMA 2BSSB 2AJVL 4FQLH 2XG4A 1BAFL 5I1AB 4IRZH 4OLWL 1I7ZB 2VLJA 3JVGC 4PJIA 1YEFL 3NTCH 4UT7L 3O6MH 5L2KD 1G7QA 1T6VN 4XPTL 3MOAL 3X11B 5ISZA 5EU4A 2IH1B 1BFSA 5J6HB 4WW2B 4O9HH 3O2DL 3CC5A 3WBDA 3LN4B 5DJCB 3MBXL 1VEMA 3QIUD 4N0CD 3R1GL 5DRZB 2JB5L 4ZUSB 1ZT7A 3NCJL 4MSWB 5C0EB 3W0WA 4ZOCA 5IVZA 3VH8G 4K94C 4MJ5B 4F15C 4WFGE 5HPOA 4APQD 5ETUA 4FXGA 1CFQB 2RJMA 4MCZB 5HGHA 15C8H 1XGQA 5C0CB 4Q7DA 3SGKA 5J1AB 3X3FH 3IJSB 4PS4H 1G1CA 1CD8A 4PGBB 4PV8B 5JIPA 2LE9A 1YEGH 3LCYA 3QBTB 5E2VH 1XEDA 3OKLB 3NFPA 1CICA 4XWGH 3SE4A 2ZCLH 2F19L 5E94A 1LD9A 1SEBB 4CNIB 5KSVA 1QUNA 4X8JA 2PYEB 4NQXB 5FO9A 3CXDL 5B3NA 5M95B 1IAIM 1OGAD 3C6SA 3D87B 4XNQA 4IDJL 4DCQB 3DVIA 4U1NB 3TJEL 4O58H 1IM9B 2Z8WC 4MJIA 3ARPA 4NQCB 1JPTH 1H0DA 5DJ0A 2H41A 5FKAA 3EYUH 3DX8A 4FQ2L 4M9PA 4K3DL 5GSVA 1QFWH 5E7BA 1AGCB 4JDVA 4PLJD 3V6FB 4M4RA 4KRPD 1J9CT 2H2SD 3QZWG 4AIZA 1NC4A 2OTUA 3TNNA 4JVPA 4P2QE 1P6FA 3MOBL 2HLAB 3QUXA 4X6DE 3EOTH 5DJDB 5SWSA 4GMTL 3REWB 1OARH 2DQHH 2R4RL 2OTWA 1PQZA 1S7SA 4FQQB 1Z6JT 2QTEA 2X4PB 5H94A 4HCRH 1T1ZA 3PABA 1ZT4B 3JWOH 3REWA 3V5HB 2KQMA 4TQEH 5T5FH 4P4KC 4HH9B 1HHJA 4G6JH 2Z91A 4JFPA 1RIUH 3IDNA 1A8JH 2GW5A 1CBVH 2L7JA 2PW1A 4FP8H 4JDZB 2IALB 1AY1L 4Y5YA 3FAXA 4XVSH 3S4SA 1CE6B 7CGTA 2FIRT 2EDHA 5B22A 3CU1A 2IFFL 3VXOA 5ADPL 4NO0B 4FQ1L 3W82A 3D25B 4PRDA 1MJ8L 3MV7A 5HYJE 2ADGA 4JZOA 4YHMH 4EDXB 3LKPA 5EO9A 3D85A 2ZJSL 4APQC 1IGFH 4IIQB 5H2BB 1JGEB 4M6NL 1AGFA 3EFFB 1YY8A 4NPYB 3ZE2E 3LKQA 4P5KA 4L9LA 5AAMA 3QH3A 5IQ9B 2D31B 1JTTA 4LSPH 1A47A 4M6AA 5EOTA 1BIIB 3O4LD 3OAZK 2IGFL 4OAWA 4LRIC 4GH7B 4TVPE 5CFHA 4HWNA 1NBZA 2FJHB 3RWIB 1LGVA 1I9RL 2DI7A 4PGDB 5K59E 1MCSA 4IOFC 1FHGA 1VACB 4YX2H 3ULUH 2F5BH 2D7MA 4LLMA 1AGDB 2P5WB 4OB5H 3PDOB 5HHXL 1CXIA 4NUGL 5FGRA 4NJAH 5C71A 5I16A 3LEXB 1NPUA 1P6AB 2YK1L 1CFVH 3RA7H 5L9DL 4DQOL 2VLJE 4PJIE 1MAJA 2C7UB 2HFFB 4WI3A 1M7IA 3GSNH 4A2MA 5CILH 5EA0H 5T3ZL 4ZNEE 4NNYA 5JOFA 1KTKE 4OCYL 3VFUB 5HD8D 4N0UB 4FFYL 4XP9L 2IEPA 4Z7NE 3ARTA 4H1LH 3UBXB 3O6LL 4P3CH 5FYJH 3P2TA 4N8VB 4HJGB 3I2CH 3UBXG 3QXDB 1B4JL 3ET9F 3WFBH 4M7KH 4M7KL 2F53B 4PJ7B 2QSTA 2G75B 2DLTA 5IF0A 1AD0A 2DQTH 4X7CC 1IAIL 3K1KC 4XNXH 5T1LA 5GS0C 3MUY1 1B6DA 5D7IA 2VLME 1GC1C 5BRZD 5I1KH 1A6TB 4P23B 4NNXB 4JFQB 5D7JD 4ESKA 5BMFH 2X4NA 3SGEH 4DUXA 4LVHB 3G5XA 4AM0B 3UYOD 1EMTL 5F7WC 4OLYL 1JL8A 5EU3A 1U95B 1CF8L 3DVFA 3NCCB 1EVUA 4PJEA 3R4DA 5GS3A 3DROB 3CMOH 1PD6A 2OJZL 4RA0C 5CSZB 4WY7H 5HXMA 1ZT7B 4I48B 1MFEH 3RVWC 4UINL 5DRXA 1JFQH 4H0GA 4KK8C 3MXWL 5GS2D 4ZXBA 2EDDA 3P0GB 1S3KL 1IILE 2GJJA 1GPOH 5I8EA 3TH3T 1M7DA 5HYSB 4QOKD 2R1WA 1FFNA 4X6BB 4X98A 3I6KB 4JZNB 3GMNA 4WFED 5EUOF 3VFGH 4HQQH 4JQXC 2P8PA 2XT1B 2EIBA 3U7AA 3BIKA 2B4CC 5DS8B 4K9EH 3G9AB 3N1GC 4WEMB 1CF8H 3P0YL 3QXAB 3ZTJG 3HZVB 2NY5C 4ORGB 5F44A 5H35B 4TPRH 5I1LA 3IFNL 1N0XH 1IGIL 2BSSA 2JJSA 2G60H 4KKBC 3NTCL 2IQ9H 5HVFB 3JWNC 3QR2A 1MRFH 3R8BB 2HFGH 1Y6KR 2YA2A 3O3EA 1J1OH 5F96L 1KBGH 1MQKL 4RGNB 2V5RA 4MS8D 4NNPL 2C9AA 4P4RA 2IQ9L 3KXFB 2HN7B 5DC0A 4S1DC 3THML 2QQQA 5CBAB 3HR5B 3C5ZA 4NQCA 4QCIA 2YS4A 4R90H 4IRSB 1JNHB 5AG8A 1I3RA 1AGBB 4JEGB 5FGSA 1YNTA 5GSVB 3SE3A 3GNMH 2R1YB 3QT2A 4RX4D 2DIBA 5DEFA 5JDSA 1L6XA 1HWHB 2DQHL 3QYCA 3S36X 3DUSA 1OD9A 2ZUUA 2F8OA 4N8CH 1ZV5A 4XCEA 3OKNB 4HC1L 2D7NA 3BDYL 1IT9H 1NC2B 5I74B 2FIKA 2QHRL 4P0DA 3O4OC 2MQ3A 2D4DA 1MCWW 2F15A 5HHOD 2D0FA 1A6PA 3HZYB 4KI5F 5EU7E 3IVKB 1BZ9A 4OCRL 3HUJF 1CFBA 4MA8L 1ND0A 3CX5J 3DVGA 1N26A 4TSCL 1IGJA 5FDYA 3GMQB 4OZGA 2FD6L 1U8NA 3MV8A 1KSRA 4F7CA 4L4JA 1Z9OA 1VB9A 2VDNL 1XIWD 3QWOB 4Y2DB 1QR1A 2FX8H 1MCOL 1BM3L 1MPAL 4KJYB 5TDNB 3ARZA 4F7CB 4IMKC 4H8WC 3G6AB 3DV6B 2EIEA 5ESQB 4NQDB 2X4RB 5JDJA 2I9TB 4OCYH 2CMRL 1FZOA 3K81A 5C0GA 5IMMA 3TFKD 1R0AH 2DMKA 3O3AB 5KVDH 2ILLA 1YQVL 2DDQL 4XXCA 4X4YB 2JK5B 1Q9KA 2BNQB 2HFEA 4OM1H 3WEXA 1MLCA 1VCAA 3KPQB 2GTZA 4HWBA 3VXUD 3LN5B 4PJ5B 2EH7L 3HLAA 3MNZA 4OUUB 3MRIB 2P5EA 3LRSA 4P23C 5HGBB 3E8UH 5KJRL 12E8L 3KPSD 1BBJB 5TE6L 3CK0H 3MYJA 3PDGA 5TH2B 2GY7B 4KWUA 3IJHA 4EBQH 2ATKB 5I30H 1UZ8B 1MI5B 5GRVK 3ARBD 3WFCH 4PGEB 2VISB 1AXIB 5EUOE 4YHNB 4WUKL 3QCVL 1KPUB 4Z76A 1QRND 1A7QH 4KY1L 1OP3H 2WUBH 4GRWH 1M1SA 1QRNE 3NIGE 3NOIA 3BSZH 2ZCHL 3LS4H 1TTFA 2B39A 1GGCL 1HN1A 4GSDH 1YY8B 4WWKD 1E6JL 2Z93B 1UEYA 4XP5H 4ACPA 1CLYH 3QEQE 3CFEB 1K8DB 4HMDA 4NUJA 4S10A 3TWCH 1U41A 1ZS8B 2DRUA 2WBWB 4XP4L 4XVSL 4JFDA 3LOWA 2DLGA 3HTLX 5FO8B 3LKRA 5AUMB 3ZKNC 3WLBB 1TMCB 1U95A 3SDCC 1FG2A 4NT6B 32C2A 3U2SA 4HIIB 4FTVA 2V2TB 3BN9C 4MD5A 2Y06L 2ZNXA 1B0GA 4M6MH 2YR3A 4OCNC 1RIHH 1H3TA 5DUML 2IFGA 5KG9B 1GC1H 1P4BL 2OP4L 4FQJL 1BOYA 5I66A 3UPRB 3RWJB 5F3HA 1U91A 2EE2A 3ECBA 4MNHA 2FO4B 4LVOC 1MFCH 3HG1B 1OF2B 2VRAA 3PG2A 4PTTB 2YPLD 1Z3GL 4B7LA 1Q9LB 5C07A 3BPLB 4EN3B 3X14A 5ICYA 3PWUA 3CPLB 1WEJH 1RI8A 2G75A 4P2OA 3WNKA 4NOFA 1GSMA 3TA3C 2WWKT 1GGYA 5E1AA 4Y8DC 4IRJA 5DURB 5BVPL 4QRRD 4LLDA 5GXBB 2W65A 4UT7H 5F7YC 2NXZC 3IU3A 4PJXA 4ODHH 4NSKB 2QLVB 2K3TA 3SBWC 4TYUA 2VQ1B 4MJIE 3S35L 4KQ3L 1JE6A 4MSWA 3S7GA 3N1MC 3P4OA 2NY2D 3EGSA 5JXEC 4PBXA 4HKJA 4MWFA 3GMOA 4OGAD 1JRHL 5SWZA 3QO1A 5C0BD 3MX0A 3UJIH 3MV9A 2ZOLA 5I1EL 1S8DA 1U8LA 4JN2B 2BERA 4YHOL 2HTKC 5I8EB 4GFTB 2CDFA 4JFEA 5TGBA 2ITCB 1L9MA 3KAAA 4QHUB 1MIEL 4PJCF 1BVKA 5BS0A 4K2UL 1RJYA 1I7UB 5CAYB 4PTUA 3D39B 4JFDD 2VABB 1A6AB 1JPFB 1OTSD 4Z7QF 2LABA 3RVUC 4CNIA 5KSVB 5D9SA 1JGVL 2ED8A 4ELMF 1NFIB 4P9HC 4PRHB 1G9ML 1H0DB 1W0WB 3WFZA 1JPTL 3U0PB 4OCSL 4OCSH 3WHE0 5KAQG 4WFFD 4OZFH 4HCRA 1SBSH 4D0CA 4NBYB 2VERN 2WBJD 1MVUA 4ODVH 1T20B 1VADB 1MIEH 2PXYD 4OGAC 5ETUB 4DGVL 3ZYIA 4YBQD 4XPBH 5C0FB 3ARFC 2PR4L 2P42B 1NCAH 5JORB 1T83C 3WEXB 4ZOEA 3VXSD 2OTWB 3FQRA 3MBEA 3OWEA 1KGCE 5A3ID 4X6CF 1FGVH 3MRJA 3VFPA 2W9EH 4ETQB 1WBZB 5TF1H 5KJRH 3SEPA 4WUUB 1F11A 1KN2L 2GYSA 3RWCA 5TPWH 3D0VB 3RBGA 2RGSA 4L8DB 5ERWB 4EUPA 3MROA 2BVUA 1V7NL 1RZJL 1V7NH 1YYLL 4MAYC 1QNZH 4PJFA 3PXJA 4XNUL 1KTRL 3WIIL 5EZJB 4P2RA 1EEUA 2EDEA 4EJ1C 5CP7A 5DD6B 4G43B 4HK0A 1BQLL 3RTQA 1I8KA 4LGRB 2VDPH 4FQXA 3HAEB 5DO2D 5CCKH 3MNVB 2V5MA 2R0ZL 3QH3B 4JG1L 4CU8A 5JTWA 3LKQB 4D9QD 3H42L 5DLML 2X4RA 4FQXB 3S96A 1GIGH 1O7SA 3TT3L 2NX5A 2MWCA 4J1UA 3QI9D 3K0WA 5MEPA 1MAMH 1T04B 4MJID 3SDXA 3HA0A 3BPLC 1CDCA 5TDOB 4NC0B 4XNUH 3C5JA 3TCXA 1KACB 5EB9A 5JIKA 1P84J 2FNBA 4M1GH 2WLZA 4MA8H 2JB6A 5FO8A 5T3ZD 2QJDA 2C7UA 4WI8A 5C0NC 5SX5H 3LZFH 1FDLH 1HHGA 2NY1D 5L2KA 5F6IC 1EV2E 5IMKB 1A6UH 3C8KA 1E4XL 3NABL 5CLTA 2NY5H 5BJTA 3EOBA 1AKJB 3CNKA 4X6CE 3IU4L 5EO1A 3BX7C 1GAFL 3UTZA 4YUEH 4UTAL 5T1KA 4R0LB 3VGAC 5LJYH 1BD2D 1NCNA 4P5KB 4L9DA 4DGIH 5FM8A 3NA4A 5DDHB 4ZFZA 2WQRA 4RSVA 5GRYA 1OSPH 2BNRE 4NN6B 4R7DA 1DP0A 3NH7L 3HI6H 4QY8B 2B1AL 4NGHL 3IS1X 1KT2B 2NLJB 3SY0B 4E41E 4XP5L 5CS7A 1UWXH 2DQEH 4OJFL 1I3GH 4P2OB 2VR5A 1I1AA 2DI8A 2NY3C 1LO4L 3GKWH 5ESAB 4WDIB 4MLIA 4L8SC 2V17L 5I0ZA 1LWRA 5DQ9A 5D7SH 3I3DA 3VMOA 3BHBA 1D5IL 5E2UH 2IBZY 5E2UL 1I4FA 2K9UA 3ZTNL 1N6UA 12E8H 3IU4H 1DDHA 5D5MF 5BS0E 2C3XA 1HINL 4LQ1A 2ZG3A 4NKIL 4UNTA 1YA5A 3BP4A 2YPLA 3T1FB 2PYFB 4QTHA 1QEWA 1PKQE 4OIIH 4PGCA 1RULH 3HI6L 3K7UA 1FLTX 3FO1B 2OJEA 1M7DB 3HI5H 4LHUA 2OLDA 3FT2A 5IVXB 4YHYC 1T5XB 4NO3A 3MXWH 3UC0L 2I26N 5BVJB 4KJPC 1ZANL 1C7SA 1MCBA 1VERA 5T1LB 1KELL 3BIKB 5CJOL 2CLZA 4ODUA 3TF7C 3WDJA 4N0CC 4JM4L 4OZFB 4A2LA 5DC9B 2I27N 5CJBA 2VABA 2J8HA 1FYTA 5D5ME 4G7VL 5FUCC 3VG0H 3LN4A 1FJ1A 4WFGD 5DJCA 4J8RA 4D0DB 4HAGA 1S7WA 1G7LA 1CXHA 3S35X 4IRJB 4CN4A 5MEOA 1A7RL 1YEEL 3O6ML 1FJ1B 4JRXE 1RK1A 1RUAL 3L1OL 1IZKA 2UZYB 3GRWA 4RFOL 3IF1A 3GKZA 2AEIT 3UTQA 35C8H 3C6LD 1MFNA 5FA4A 4E0RB 4G9FA 4XBEH 3SKJL 4HJGA 3QQ9D 1A3LL 4M3JA 1RHHB 4KDWA 4QRSA 5DTFA 4ZNCD 3ALPA 4KDTC 4KQ4H 1B0RA 2IPTH 2EXWD 5IWLA 5I17A 5I8KL 3IFPB 1OAYH 1BWWA 2AABL 2QQKH 3QO1B 2FWOA 3FT3B 4OI7A 2FATH 4JE4B 4JZNA 5ELIA 4ODWA 4X8XA 1MHCB 4MJ5A 3VXTB 4Y5VC 1XGUA 3TT1L 2COQA 4M7ZC 5J6GA 2YWYA 2DBLL 4ALAL 5IW1A 1EDQA 1PBYA 4RMUA 1OB1A 4OQ1A 4H1LA 1EHAA 1CFTA 1HOCA 3DROA 2XPGB 1BGXH 3O2WH 1Q72H 2VIRA 3GI8H 4OFKA 1OAKH 4LCCB 4DAGH 4KROB 1REIA 3S3PA 1DLFH 1SEBA 5D7LB 1DFBL 4IHOB 2E7CA 3ME0A 5ESQA 3T8XA 3BAEL 5EIIA 4ZSOA 3VXSA 2W9LA 1AHWA 3GMNB 2PO6A 1LO2L 3U9PH 2JK5A 1RUKH 4R4NC 5F1NB 1A7NL 3EAKA 4LCWA 4XPBL 2VYRE 4MS8C 2ADJA 1A7QL 4KY1H 5TDPB 2X4SB 3BEWB 2A9NH 1FBIL 3MFFB 1QLEH 1TIUA 3MA9L 4JO1H 4QEGA 1OSZB 1WZMA 1CLCA 4FFZL 4XPGL 1PGRB 2I5YH 1PSKL 3HZYA 3QFJE 2CJUH 2W59A 2XNAB 4C4KO 1E27A 1TZIA 2YUVA 4YXKH 1FYHB 1VA9A 1FFOB 1RJCA 3WD5L 3WD5H 5HY9A 4FQ2H 3QEQD 3V5HA 1IGMH 3D25A 4FNLH 3V5DA 3RDTA 2NQCA 2UWEF 4KKLD 3ARDD 3TZVB 3DMMA 3D1MC 4GAYB 3SO3C 3L5XH 4UAOC 1KCSL 3M17B 4Y5YB 4WFEE 2FRGP 2R15A 2YSSA 4P2RB 1NMBH 4WWKC 5JOPD 4E5XB 5I1GL 4MX7A 1SYVA 1XCQB 5DJ2B 5FYKU 1KENL 4YGAB 3MLZH 3MRDB 1HZHH 3ARDA 5LGJA 4GAGH 4JY5H 4V2BA 3RDTD 2BRQA 3HE6C 4OD1L 1PY4A 3IVKA 2A73B 1N7MH 1NDGA 5IESL 4MX7B 5E4EB 2GI7A 3MR9B 1J5OH 2VQUA 3Q5TA 5A16B 3TBYB 3ULUE 1INEH 2X89A 1JN6A 3HLAB 4FMFA 1DQML 1ZS8A 2P47B 3KJ4B 2OK0L 4JRYA 2VZ3A 4JGMA 3MR9A 5IW6B 3HPJB 4U1JA 1YEJL 3WJJC 1QKZH 5B4MD 1EGJH 2OYPA 1HIMH 3R06B 4DOHB 1V3KA 4LPCA 2DQIL 4EI5D 3PGDA 4EUPG 1G6RA 2O26U 4AIOA 2P44B 4I4WB 1JYWA 2ESVB 2H1PH 4N0UA 2DIAA 3KHQA 2IPKA 4LF3B 3MBXH 3T1FA 5HTSA 2YMXL 1JGLL 3PGDB 5L2KB 3H9SE 2PO6D 2AGJH 3UPRA 1INQA 4M6OH 1QEWB 4FFYH 5DXWA 2GT9B 2H3NA 1DBBL 1IGCH 5EA0L 5T3ZH 4JG1H 4J3TA 4Q6IB 1UWXK 1WIOA 4ZOAA 1Q1JH 1UA6L 1IAMA 1I9RH 2R8SH 4JN1L 2IBBA 2XWJB 5E99H 4XNXL 2DQJH 1QHOA 4GXVH 4LLQA 5JR1L 2IGFH 5KOVC 4U1KB 5T33L 5DVMA 2X05A 4JJ5B 2ZNWA 3NA9H 4RAVB 1FNLA 5EZOL 1P4IL 1CU4L 5GSRA 4X6DA 3U0WH 2J2ZA 4HW6A 3FQUB 3B6SA 1TJGH 1D5BA 2X4NB 5DFVC 5KZCB 3WKNA 1CFSA 1UENA 4DQOH 4Y4HD 2J4WH 2VLRB 3ULVH 4PLOB 5GGUA 3SCMC 4ZODA 1KCUL 5AYQA 4QXWA 1NBQA 2BCKB 3FKUS 5DRXB 2F74A 1HHIA 3KPMA 2JCCA 4ODSH 1U8OB 3C2AH 2LU3A 4OIBA 4L4VB 4MLSA 1VPOH 5EBWB 4MXWL 4TRPH 2J5LB 3O9WD 5J6GB 5JW4Q 1BQHA 1L6ZA 1AXTH 3LSOA 3CDFA 1MCFA 3D69B 4XH2B 1B2WL 3KLHD 5D7JA 3GJFB 1DQDH 4DVRH 5E2TH 1T4KA 3O3BB 4L1DA 4OLYH 3UTTE 3VH8A 2G5RA 4WU7A 1OPGH 1XGPA 2ZPKL 1KGCD 3MCLL 5J6HA 3QIBA 1NGPL 1AH1A 5KG9A 5LWYL 3MLSH 2IMMA 4PJCA 4G6FB 4W6YB 5JDSB 2B0SH 3E2HB 2IH3B 4LHUD 2A6DB 3CSYA 2W60A 3NIGF 5J56B 4N68A 2ZOLB 1A3LH 4M93B 5C6WH 2AJUL 4OIIL 4F37F 1NAMA 3HB3C 3KYAA 3BGFC 4ZS6D 3DLQR 2Y23A 3WHE1 2HJFA 2RFXA 1LP9E 4OZIB 3QG6B 1MEXL 4UT9L 5HI5D 1NAMB 4BSWB 2VUOA 2O5XH 3MRJB 4K71B 4NCDA 5IIEA 2NR6C 2ZPKH 4MB4A 5IP4A 5B4MC 4PGBA 5DZLA 3ARWA 1IEHA 3EBAA 3JTTB 4JFOA 2OSLB 2XIDA 3IDJB 2O5ZH 1DQMH 5BOZG 3QRGL 3LVEA 5H37G 3SDXF 2VLMD 4MA7H 5BRZE 5J7CC 5E94B 4NQEB 3QO0A 4NNPH 4G43A 1KNOB 2NY6C 2X44D 4N9GB 2IPUK 2R0LL 4NO0A 1KFAL 3RAJL 4U0RC 4G8FA 1YEIH 5FUOL 4YXHH 4AG4L 4FXKB 2AJ3B 2ZP0T 3TN0D 3RX7A 1CS6A 4Y16C 5JHDB 3DNKA 1Q9WA 3IGAB 5ID1B 4ZYKB 1AR1C 3O45A 1U2CA 1KEGL 4CN6A 1HHHB 3IYLW 3ZKXC 3U1SL 3FFDB 3MBEB 1KOAA 3CFBB 5FM5O 2FCBA 4KUCF 4I5BB 2D7TH 5F9DC 4S1DD 1ZHBA 1VFUA 2X4SA 2JB6B 4PJHF 1I8MA 3KDMA 4WUUA 4PJ9C 1R5IB 2NR6D 3KPQA 1YY9C 5I9QC 1X7QB 4LEXH 4OGZA 2FHFA 1ZHBB 3KPOA 1KPRB 3OB0K 4OF5A 4MGXA 4TVPD 3T0XA 5TE6H 3GGWA 1T2QH 1KIPB 2RIKA 3LRSB 2VISA 3RKDD 5E2JA 1SJXA 3QEHB 3UX9B 2YPLE 3HPLB 1J0YA 1DANU 4X5WB 3RWGA 1GAFH 3QUZC 5HDBE 2Z9TA 1QPXA 1ZGLB 4UDUB 1S5IL 4HWEL 3NABH 4WV1A 1AJ7H 4FTVE 3OF6D 4R8WH 2PF6A 2AI0H 5FOBB 5I1GH 1NLDL 2PTUA 3Q48A 1MCJA 1KTLA 4WI6A 1YJDC 3CMGA 4UI2A 3ETBF 5IGXL 4UQ2B 3I6GA 5D72L 5C6TL 3OKMB 4YH6A 1UXSB 4I18C 5DRNA 4MA3B 1IM9D 4ZSOE 3V6BR 4G8GE 4JQIL 4EDWH 1JYVA 3K80A 3WSQL 1L7TH 5JHDE 2AKRA 1T7ZA 3FOMB 3E6FB 5D1ZC 5F9WC 4G3YL 4K7PH 3E8UL 2QSCH 4Q2ZA 4B5EA 1DN0A 1AP2A 3TIEB 2E9JA 2R9HD 4F2MA 3VDCA 3B6SB 5GQBA 3FOMA 1JFQL 5GRVL 4KAQL 3B3IA 1I8KB 1CFSB 4QNPE 4U3XA 5I66B 1JF1A 5I18L 4GRLB 3IDXL 4HUWA 4OI9A 4QTIL 4PG9A 4PD4K 3C60B 1YN7B 3VXNA 5I8OH 5GJTH 1F90L 1NMBL 3B83A 3L6FA 5KVFL 3N9GH 2FR4A 3R8QA 3WSQH 4HZLA 4EEEA 3HNVL 5DQJA 3SPVB 1OAYL 3VXME 3RL1A 2BK8A 1N7ML 4LLDB 5D7IF 5CJ5A 2AS5M 2HLFC 4ZQKB 1XF4A 1FZMA 5JOPE 4MJ6A 4AIXA 4NJ9H 5F8RC 3MC0A 3PL6D 3HUJE 2RCSL 2VZUA 2Q1EA 1OD7A 1TCRA 1CL7L 4HLZG 3GHEH 5F6IB 4WU7B 1LDSA 2D7OA 3VXRA 3ZE2F 5HHXH 2R4SH 2YD3A 2C3GA 3HNSL 3QXVA 1JYXA 4QWWC 5JXEA 2G2RA 3DVNA 4KMQA 2YPLB 5EFIA 2X10A 3DX6B 3FRPA 2OZ4H 1GZPB 3VGAB 1L7IH 1HKFA 1BD2A 2YD6A 4YAQB 2HT3C 3RFZC 2JELH 4LSPL 5AYUL 4YDVB 4N1EA 4ZO9A 4D2NA 5K59F 1MHCA 2BJMH 3QIBD 2V6HA 1TVBB 3T04D 5GGSA 1CD1A 4Y16B 5IMOB 2X1XR 1DZBA 3VXUE 4FZ8H 1JPFA 1MHPH 3T0WA 3VFRB 4PUBH 2CPCA 5CJQL 3BW9B 4JPVH 4LKCB 2UUDH 2W0PA 4N5EC 4WI7A 4ODHL 1I8IB 1ZSDB 2E7LC 4GG6F 1SJHA 4QRPD 3H2WA 4QHKJ 2FZ3A 4M1DH 3RUGF 1DVFA 1IBGL 2X41A 2ICCA 2P4AB 4K2UH 4M43H 3BP4B 4N90D 4MDJB 3VFWA 1U36A 1EO5A 1GOFA 1KLUB 4E42B 4HPOH 3QO0B 4DGYL 1DVFB 4YDIL 4X7TA 3P3YA 4YHOH 3RGVC 2OQJA 3AS1A 3UJIL 5C92A 1IJ9A 5BW7C 4RBPK 4ENEC 3L3GA 5T1KD 3SJVA 3BAEH 5I76B 2DQTL 3MRFA 1NCCH 2AEQH 3QUZB 1WCBA 1FL6A 3CIQA 5HHME 2HT3D 2EDOA 3RTQD 2F19H 2ADJB 2EC9U 2WUBL 4F58H 4RISH 4E41A 3VW3H 1D9KD 4JCLA 3N0PB 5E2VL 2XZQH 1A7BA 2EDYA 2IPUG 5KSBA 4FXLA 4Z6AT 2VXSH 1BLNA 5IW1B 3GEWB 2QSQA 4CAGA 4GG6B 5C8JA 4DZBB 3WS6C 4RISL 1FPTH 1UVQA 4X7DC 4PY8J 1KEMH 4K3GA 4HMCA 2AK1L 1PLGH 4GXUN 3VGFA 1RZ7L 3ZL4H 3HC4L 4LCCA 2C3HA 1Z9SA 1ROWA 2DQFB 4MAYA 3ZL4L 1C08B 1FORL 1S7QA 4JM2C 4P2YA 3RTQB 3K2UL 2XV6B 5C0AD 1S7UB 1JZ2A 2OL3L 3T0BA 4JHZA 4QOKE 4X0KA 3ZT6A 5BZWB 4PGEA 3Q1SH 3RGVD 1QRNA 3AREB 4NN5C 4JFYA 3MRDA 2FGWH 5IMLA 3QCVH 2P45B 4LKXA 5E08L 4LOUD 3SDXB 2WSKA 1BJMA 1OTTC 3CSBA 4FQPA 5DEGB 5HYJB 3TBYA 5CD5D 4ZAKD 3WIFB 3TBVB 2R0ZH 2VOTA 4XC3L 3O4OB 4NBZB 4JHWL 2EDWA 1S9WA 2YWZA 4LMQI 4NQXA 1K8DA 1V05A 4LP4A 3DO7A 3HC0A 2KH2B 2GTZB 4KTYA 2RR3A 2BNRA 1T04A 1BHGA 1B4RA 5IEKB 2WZPD 3CFJB 4NDMB 4KHTL 1AP2B 3EYOB 1QO3A 5BV7L 5JMOC 1A22B 1D6VL 1P7QA 4GLRI 5C0JA 3TZVA 4F80A 3FB8A 3AB0C 2BP3A 4PJHB 5DD3H 4LCWB 4WGWB 3CGTA 1ADQL 4R7DB 1HSAB 1J11A 2Z31A 3H42H 1FL5A 1HH6B 3QDGB 3C5ZD 1BVZA 3OZ9H 1CCZA 3LKSB 2N7BA 4D9LL 2IMNA 2ZWLT 3PABB 4LLQB 2B1AH 4NGHH 5GS1B 3I9GH 4HX1B 1BD2E 2EDXA 3G5ZB 2FO1A 2MFNA 1FNFA 1YYMH 5EZOH 1ZLSH 3ZYOA 3BP5B 2BOBB 4QY8A 2A1WH 3VXUB 4Y4KC 5IB3B 1CG9B 1PEWA 3QIUB 4V2CB 1JZ3A 3LIZL 3SDAD 3R06A 3RX5A 4WEBL 5IVNA 1KJVA 1G6RB 2OZ4L 1HQRA 3HE6D 1FVEB 3EFDH 3WO3B 3QPXL 4G5ZH 1UA6H 3DHMA 5DYOA 3NZHL 3GSWB 5E00B 2XKSA 1KIQB 3EGSB 4EXPX 5FGBA 1AJ7L 1YJDL 1C5DA 32C2B 1FO0H 3H9HA 2APXA 5FUCE 2BFVH 5T1DH 1YMHB 4JZJB 2FGZA 4HKZA 2DQDH 4FFVC 5EU5B 5DVKA 5FKPB 1YEKH 3F7VB 5IROA 4JFEE 3HC3H 4GAJH 4PJBB 4IMLB 5CGTA 5ANME 1LP9A 4AQOA 5GRZA 1U8OA 4U3HA 4Z7UA 5F1OB 4OZIE 1NBZB 5E5RB 3BOVA 4QGYA 5AZEL 3CFCH 5IVXF 4LLMB 2P5WE 4NZUH 4PIRF 1Q9LA 2NY4C 4P49A 5C07B 4G9DA 1A6AA 1T7VA 3PNWA 1CTOA 1GOHA 1RZKL 4UUJA 4TVPH 1VGKB 1H5BC 3REVB 4PLKD 3QUYA 1QLRB 2XN9D 1KEML 1RZFL 2DQDL 2JCCF 5FECA 4J8RB 2WWMC 2XZCL 1WT5C 4R26L 3UTSA 2AW2A 4MJ4A 3C09C 2W0LA 5C08D 2A6KA 2X4OA 4MCZA 1JJUA 2VXTH 4MQXD 4KHXL 3LD8B 1BFTA 2M1KA 1EVTC 1PJ9A 1JI2A 3DSFH 3DSFL 3KYKL 3FQXB 3MLXH 3HMWL 1M05A 3DX9A 2GSIA 2VH5H 5L0QC 4WWID 4Y4FA 4LL9A 3FL7A 4PPTA 4NRYA 1U93B 5F7EH 1T89A 3ALWA 4ZUUB 4JFQA 3FQXA 2EDNA 5C07E 3W11C 1L0QA 1U8KB 1I9IL 2ZUVA 4Z7UF 1G7HA 1UH4A 1E6OL 4JFOB 3KNBB 4LCWE 3X17A 2OSLA 3OXSA 4HGMA 3W5MA 4Y4KD 4IOFD 4KRMB 4PJFE 5ICXA 1EO7A 2EE3A 4G8EB 4U6YB 5KS9A 5C0RH 3KPSB 3NGBB 1OT2A 3VA2C 3QWQB 4KJPD 3TN0C 3EDDA 4RBPH 1MCLA 3V79C 1F3DH 4YXHL 4Z9KB 5FUOH 4HS8H 3HMWH 3VWKD 3LEVH 5IVOA 1KLUA 3I50L 5CJXA 4PJGA 4YGVA 2H45A 3BDBA 3ROOA 2NY7L 3SDDC 4YHIB 3F7RA 4BKLA 4POZC 3X13B 4U6VH 1F97A 3CX2A 4JFDE 3BKYL 1E4WL 1S9YA 1ZKAA 4X4XA 4FQQA 1KB9J 3OKKA 2J8UA 3MGOB 1T1ZB 4P9MH 3HZVA 2BSED 1OAQH 1IEBB 2EO1A 4M61A 3TT1H 1JNJA 3BKJH 4P2RD 1UYWL 3U1SH 4PJDB 1I7RA 1HQ4A 3A6BH 4U05A 1KFAH 3RAJH 3QUMA 5IUSA 5GGQL 1T2QL 1PW3A 2Z35A 1QLEL 3QI9A 5L2KE 3PQYE 3FFCE 1FVDA 4ZAKA 3GK8H 4ZUWA 3V6OE 3ZKMD 4UBDC 4H1LG 4LNRB 1KCKA 1RSFA 2H32H 1UB6A 4OCWL 5GGSY 5EO9B 3B5GA 3GM8A 1CFQA 4ODXB 3G08B 4RGMC 1DQLH 4NBXB 1NCDL 1XGYH 4QRRE 4LQFL 5F9JA 4XCNB 3D39E 2X4PA 5HPMB 3UTZB 3O6KL 5IHZA 5SWQA 3NCMA 3O3DA 2Q8AL 4XHQA 2BVQB 1IL1B 1NFDE 5T5NF 3IXAA 1LO3H 5C3TA 2ADFL 2VLLB 5KSAB 3U82B 2PW1B 4PREB 2ZSVB 2V7HB 3LEYH 4LDLB 3O3UN 3JSSA 5MENB 2DM3A 2GY5A 5JW4M 4QHMB 4PP2A 2C4FU 3WJJA 4H8WL 4Q2ZB 1M71B 2MHAB 1MF2L 1D9KA 5KOMC 2UV3A 3QHZH 2BC4A 5DHVB 4NT6A 4IIQA 3QUKB 4KJYA 1LE9A 4UTBL 4UIMA 4TTDC 5CMAA 5C9KA 1W72H 1X5XA 5HGDB 5F7FA 5BRZB 3UO1H 4OCXH 5DYOB 2YEZA 2BC4B 5E00A 1A6WH 1MFAH 4GRLA 1CDYA 3I6LD 3MOBH 4ELKA 1Q9WB 4WTZA 4PJ8C 5DFWH 4KAQH 4UIMB 5CMAB 4YHML 3CFDB 2ZSWB 2R29L 5FHAH 4NQED 4UDTB 4ZS7H 5SV4A 5D1QA 4QO1A 3MUGB 1VGEL 2XQYK 3JV4A 1RZ8A 2JJWA 4LAQL 4F7PA 5BVJA 2FJFB 4R0LA 5EN2A 4JM4H 2V7NA 2X1PA 4LEOB 4GKSA 1CLYL 3AFLA 4Y4HA 5J3HD 2EH8L 1N6QH 4XNMB 1U8MA 1MHHB 5E03A 2FX9L 3STLB 5EBLB 5BXFB 1CICD 4HLZH 1U8MB 5A3IC 2UYLB 1E6OH 1F6LL 1DN0B 1UB5A 5ENWB 1LEIB 1P4LA 1FIGL 5EBMB 2YXMA 4TVSa 3N85H 5LGHL 5GGRY 1C5CH 3S98A 1A2YA 1NDMB 4JY6A 3IXTA 4GS7C 4QF1B 3SCMA 1A1NA 2XQBL 2Y7QB 4PRNA 4FQIH 2IG2L 4Z7OF 2NW2A 3SDDB 5B3JF 3BGMA 1B90A 1ES0A 1Q1JL 3WO4B 5FYKE 1UZ6F 1ZK9A 4XCCL 1JHTA 5IVXA 4PUBL 1A1MA 4M5YL 3WV0A 4QT5A 1RJYB 2KZ1B 2XTJC 1K4DA 2MJWA 2DM4A 2CK2A 1UM5L 4P46A 3MLRH 4KQ3H 1DE4A 2ZOKB 5E70A 1F2QA 4WGVB 1JHTB 5AEAA 2X4UB 3VFNB 5MP6H 5BMFL 3X3GH 1WZKA 4PRPE 4L4TD 1JWMA 5J11C 2XRAH 1TJHH 2VIRB 1JWUB 4IOSD 4CGTA 3O8XD 4RMWA 2WANA 4KVCL 4LSVH 5IFJB 1IM9A 1LHZA 2FX8L 4MJIB 1UXWA 3VXNB 2OCFD 2VDLL 2ZKHH 4G80A 4S0TD 4QHLB 4UTAH 4NKOB 5IR1B 3FN3A 5CZKA 5I76A 3Q6GL 2WINB 5F3HB 2D9QB 3QIBB 4OQTA 2ENYA 5J9PA 4PS4L 4C56A 3CUPB 3D85D 2FLBT 1RU9L 1EH9A 4DOHE 1NFKA 4D3CL 3D6GA 3MQIA 3KYKH 3MRNA 2XOTA 4NFBA 3CVHL 5DK3A 1BOGB 1CK0L 5TDPA 2N1KA 5KSBB 2GSIB 2VDOH 1NCAL 4NRYB 4Y19A 5IFAL 4MQ7A 5IFAH 3CMOL 1NGPH 4GW4A 4BSWA 4KVCH 3DV4B 1NKOA 3LQAL 3ARRA 3ZZ1A 1JP5A 1TPXC 2D03H 3TBTA 3MRCA 4F33A 2G2RB 3DVNB 4LSRH 4OQTL 5C9JB 4PLNC 5HYQA 4KKAD 4OGYL 3UBXI 2ARWA 4U33A 1NAKL 1RHFA 3ULUC 3B8SA 3TO4D 3ARUA 4Y5XC 3C5SA 4JKPH 5E5MB 2DQGH 1NANI 5ID1A 4DGVH 2YSSB 4XAKE 4Q97A 4KU1A 3ZDXF 5J1SC 5IV2B 2BNQA 2HFEB 2GK2A 2ARJQ 4JO3L 4DW2H 5D2NA 4HGWB 1J0KA 2H8PB 3BQUC 1LO0L 3S96B 2G60L 4JPIB 3T09A 5GGTH 1T0MB 3IDMB 4ZFGH 4LP5A 4GUPA 4MHHI 1FC2D 3HRPA 2XQYG 4U1HB 4M7ZB 4N9OB 1KPRA 5L6YH 2IBZX 2CR3A 4YR6A 1UYWH 4OZ4B 2I9LB 4DTGL 1V3MA 4N0UE 1JGDA 4HK3J 3FN0L 5TE4L 2A74B 3FONB 4XCFL 2LU7A 4XI5D 3RVVD 5I2IA 2IPKB 3SE8H 5DJZA 1HYRC 1UB6B 3G5YB 1MQ8A 2C3VB 2HT4D 1SHMA 3WS3A 2VWEE 3HE7A 5D1XD 1MJJA 2CMRH 2MKWA 5D1QB 2VDQL 1P7KA 3QEQA 4KXZH 3FQWA 3H7BA 3ULVF 1CZ8H 3UZQA 1KEGH 1N0LA 1N59B 7FABH 2I60H 2R9HC 1SMOA 2FBJH 4YBLB 4LRIA 4Y4HB 1WFTA 2NY6D 4HX1A 2J6EH 3RVXD 4QRTB 3SDCB 2A73A 2MTPA 3H3PH 4JRXB 3QFJA 1RMFL 1UACL 1MLBB 1J0JA 2A6IA 2EZ0C 4S1QL 5ACLA 1EUUA 3CH8A 2HKFH 4MD5B 3ARXA 1FE8L 3TA3D 4HH8A 4JRYB 4LOUC 2H26B 1HQRB 3KWWA 3EIFA 4TULH 4RWYL 1PZ5B 2CDEB 4R8WL 5EU5A 3NCYS 2WIIA 4DKEL 2CLRA 2CKBH 4YHLL 4XI5C 4YUEL 1T03H 1SYSA 3WL9B 2QKIB 3Q6FB 5HDOA 5KN5A 1Y0LB 1NCUA 3MLWH 4JQXA 1LO3L 5GGRB 1ZHNB 4X6FA 3TBVA 3CLEH 4LSTH 3WJLA 5DO2C 3LN5A 2X4TB 3O4LE 2HVJB 2Q3AA 4NP4L 1V3JA 2GSGB 3VFSB 3VWJA 1AO7B 3D5OF 4MJ6B 1AXTL 3ZMRA 4K55A 1SMAA 3FRUA 1P9MC 4H8WH 1QR4A 4Q9BA 3X3GL 2NXZB 5EOCJ 2KPNA 4MNGB 4ZO7A 2KUTA 5KZCD 4R97C 4XP4H 1R24A 5AZEH 4MMZC 1A7RH 3QQ4A 3P4OB 4OF7A 4N0FA 1HINH 3C5ZC 5C86A 3GBNL 1GYAA 1OTSC 3QFDB 5I16B 1QSVA 2Z4QA 2DM7A 2VO5A 2B0SL 3LAFA 4GAJL 5JW3L 2WK2A 4AZ8A 2XWBB 4D9RE 2E8ZA 5CBAA 3SKNA 3FFCD 4AEHH 4Z7WE 4ZD3L 1QOKA 4R7NB 2Z4QB 5JUEL 1DQJA 4L5FL 4V1DB 4JZJA 1B0RB 1QVOB 1NGZB 5AD0B 3FT4B 3CPLA 2NW3A 2NXYB 4PRBB 2X9YA 3MRBA 4L3EE 3GJFH 4P57B 5IKCA 2DN7A 5C0CA 3ILQD 2JJTA 5HDBF 1YPZE 1CGTA 5E6IA 3QDGE 4ZUUA 3TZVD 4BFBD 3EYVA 5DJ8B 1ZWIB 1CG9A 4NWUH 1RZGB 4IOIA 3QIUC 4HJ0D 1T22B 1IVLA 3HKFA 1O7VA 4MQTB 5FYLH 2RCSH 1W0WA 4M8QB 4OF0A 4FTVB 3V6OA 1J8HD 4A6YL 2R2BA 1I9IH 4IOIB 4NQDE 2J88L 3FO0H 1IGJB 4JREB 3C6SB 4DCQA 3TYGH 1X5HA 4PRPB 4PBWD 1MRCL 3T1WA 1V8HA 2EYTB 3L3JA 1HILA 4NN7B 1XGPB 1ACYH 5CSZA 2DM2A 3QCUH 3QP3A 4CVXB 3QJFA 1DLFL 4JKKA 4KTDH 4K7PY 4NIKB 3M07A 5HGAA 5J4MA 4HEME 1EERB 3I02A 3P4NB 4OLZL 5F6HJ 3H9ZA 2OXHA 1E4XI 3W2DH 3ARBA 3HNTL 1DBMH 5I1IL 5EZLB 5FM5M 4JVUA 4M5ZH 3QZWB 5GRJL 3PGCB 4QXTA 4YFDB 2OR7A 3RWFA 1A3RH 2WWMD 3RKPA 1EUTA 3DTXA 5FGCE 5D6DA 3UDWA 2NTFB 4ODTH 3QG6A 3X3FL 2VB5A 1CE1H 3WFHB 2FSEA 1AD9A 1QSED 1XR9A 3FB6B 4D0CB 3GB7A 3QIWA 3LB6D 4U1SA 4LNRA 3V8OA 2A6KB 3LY6A 1EBAA 1R3KB 4MA1B 2M2DA 1UVQB 1U2HA 2XWTB 3Q3GB 3N1FC 3IFLL 4L3ED 3CLFH 2OX5A 4GMSH 2DQCL 4O51B 1KLFA 2Y6SC 5J13C 3P9WB 1OWRM 1VKXB 4YK4C 1PKQA 1NGXB 3VJ6B 2DTSA 1AI1H 5I19H 1T2XA 5GHWL 5JIIA 2X1OA 4JDTL 3LQAC 3PV6B 4RFEA 1FSKB 3F7QA 1Z2KA 1KB5L 4UILL 2FL5A 3T77B 3MRLB 2VMFA 3PGFL 3RWEB 1DUYB 1U92B 3ZE1E 4J4PC 1ZVYA 1MFBH 4RMVA 4XXDA 1CBVL 3MRGA 4Y19D 1B9ZA 2ITDA 1C8PA 1LE9B 4FZEL 3TN0B 4FNLL 1D5IH 4HHAA 2H2PC 3NIDF 4MXQC 2GEEA 3BPOC 2OK0H 2QSCL 5CD5C 4LLWB 5T3XH 3B4NA 3V4PH 2HRLA 4BELD 4R3SB 3QQNA 1OQOA 4Y2DC 1JZ8A 2J12B 1U3JA 3P0VL 4U0RB 3SKMA 2QV2A 3OR6B 3H9YA 2ERJB 4CMMA 4YPGB 3MLZL 4X4ZA 5INDB 4LEOA 2WBJA 3BZ4B 1BQUA 3OZ9L 2BHUA 1XIWA 3H8NA 5T1MA 1I85A 3RU8H 3T2NH 4JFFB 1KN4H 2YC1B 5CIPB 4PBVC 2DQIH 4KUZH 2AJZB 3ZKND 3SJVE 1WBXB 2R2EB 1YYML 4RMQA 4X80H 3MBED 1U8JA 1UB5B 4JPVL 2CUIA 3SBWA 4NRZA 1DDHB 1R3LB 2FX9H 3OG6B 2JKXA 4P5MA 5ALBH 2AP2A 1E4JA 2BSTB 3B9KB 3IDGB 4PJXF 4HS6B 5CD3A 2MPAH 1NANH 4IMLA 2A0LC 4DN3H 4PR5B 4NN7C 1BD2B 4KJQC 1JPGA 4Z76B 1XGTB 1JF1B 2J8UE 2ZUWA 2NW2B 1S8DB 1U8LB 3K46A 1FQ9C 1EHLL 3WNNA 3O6FB 5I71B 5EOTB 3T0EA 2FATL 1GGBH 3GI9H 3EOAB 1DVFD 2QR0B 5TE7H 4HIXH 1QRKA 5EBWA 1DCLA 1Q0YL 3MTRA 4DUVA 1R5WB 3S37L 1CD9B 3GSXB 4WW2C 3NN8A 4I18B 1IAKA 1YN6B 2I24N 4IRJC 5GIRA 3EDFA 1DQDL 4XWGL 3QUKA 5FECB 1BX2A 2VN7A 3LKOB 5IT2H 3U79A 4LSUH 5FYLD 3O3EB 1U42A 3ARQA 1A5FL 4YC2C 3LRHA 2AK1H 1FNSL 5D5MB 4UUJB 1BX2B 3LKOA 3GMRB 1NFDA 4WUKH 1ZOXA 1DSFL 2JJUA 2EEBA 3KPRA 2PXYB 2E6JA 4NZDA 1D6EB 3PIQB 2XZZA 5IBUG 4XP9H 2AJXL 1ZLVK 1DL7H 5I18H 1F6AA 1H15A 1P5VA 4F7PB 4C59B 4YQXL 2PCPA 1JGUL 4JLRB 3SJVB 3VW3L 3T2PA 4M03A 1ZA3A 3C2AL 5J89A 4YK4B 3W9EA 3DGGB 3TPUB 1U3HB 1QSFE 5GISH 5LCVH 1ZGLM 4XWOC 1H3VA 1NCWL 3DBXA 5CHNA 1BZQK 4Q74A 1BQHG 1N4XL 1QBAA 2KKQA 3JWDH 2IAMD 4OM0L 1CFTB 1HOCB 1OWWA 1VEPA 1ZE3C 1K85A 4PY8I 3DBXB 5M7QA 4KROC 2YBRB 1RZGA 1YY9D 3CVIH 4X83A 5C9JA 4WUUD 5DI8A 2EYRA 1CDIA 3TESA 3OMZA 2CRZA 3FT3A 1LDPH 5EUOB 3FO2A 1KJ2H 3P73B 1JZ6A 2VSCA 3P11L 4E42A 3ROLB 3BQUD 3PQYA 5B39B 3GNML 1RQ5A 3BYTA 5C08B 1MJ8H 1MI5E 4O51A 4KMLB 3CFKA 2DL9A 3IDMA 1YEIL 4L4VE 1RUQH 4NHCL 2APBA 1I7ZA 5FA3B 4RMRA 4HBQA 5HYSG 1B3JA 3K3QA 2P49B 1IEAB 4JAMA 5C0IB 3STZA 1Q9OA 3MV7E 5HYJA 2XKNA 4I77H 5F96H 4U1HA 4D0DA 1KN4L 4OSUL 1G7LB 4PJ5E 4E41B 4WU5B 3MNZB 5F1SA 3PWPA 2QADB 5E9DB 3ARGB 3O9WC 2ARJA 4GG6A 2FSEB 2GUOA 4KDVA 2HMIC 4K23H 3P0VH 1RHHA 3CDGB 1A6VH 5A2LH 3P77A 5DSCB 1JRHH 4TUJA 2VDPL 4URTB 3TCLB 1K8IB 1IKNA 1T0NA 4BZ1L 2FDBP 2C5DC 4FN0A 4AG4H 3RL2B 2DKUA 2VXVH 3B9EA 3FQWB 3H7BB 4M6OL 1T20A 3RIFK 4CW1B 4DFIA 4XP1L 1MJJB 1RAMA 1RJZB 2AJYL 3ISWA 1YQVH 2DDQH 2VLLA 2AXHA 3D3VD 3RL2A 3KYMB 2XNAA 4HC1H 5IQ7L 1HH6A 3D2UD 3MOAH 3VE0B 3VJ6A 4W68A 3V5KB 1FAKT 3KJ4C 3ZT7A 4X9FA 4O9HL 3GSNB 2C1OA 4R4FH 5HVWA 1I1AB 3WIHH 3RWCB 2VKWA 4LIQL 3BD4A 4WHCA 4QRRB 3D3VA 3WXWH 4UV7H 4JQIH 4EDWL 4LF3A 5IB4B 1B88A 1WCQA 4BZ2L 1INQB 3DARA 3V7MA 2JLLA 1CGSH 2BVYA 1BZ7A 4YC2B 2ED7A 3MRHB 1B4JH 4G5ZL 4HS6A 4WY7L 3ILPA 4Q6IC 1U58B 1NCBH 1BIIA 4X9GA 2VDML 3NFSH 3AREC 3RIAF 4C56D 1F58L 5FKPA 1W72A 3BSZL 2DTML 2FO4A 1QBML 3PJSA 1VEOA 1OT1A 3C6LA 4I2XB 4JANA 1HYSD 4NWTH 2Y5TA 4NWTL 2W9EL 2P7TA 3NCEB 4XMPL 5EC2B 5DT1H 4QRQB 4Y19E 3VXQA 3O2VL 1MH5B 4K3JH 1BVLA 2AV7B 3T2QA 1FFQA 3WFDL 4RAHA 4O02H 4JFHD 3BN3B 5CIPA 3MUHL 2XZAL 3DXAE 3HZKB 1BBDH 3KR3L 5EU6D 4HBCH 3VCLB 1Q94B 4ZTOL 3W9DA 3BP6A 1MWAL 1KYOJ 2NMSA 2DKMA 2QHLA 4QF1A 3SCMB 3PP4H 4NZTH 1ZEAH 1KYOK 1Y6NR 5TFSH 5JUEH 5IMKA 3LKNA 4V1DD 2HTKD 2BCKA 4NPYA 3VD5A 1MRCH 1Y18A 3FTGB 2V5YA 5E2WL 3UPCA 1QVOA 1FIGH 4ZXBC 2FEDD 1KC5H 3ZDYE 1NGYA 3HB3D 1A7PL 2D7QA 5E1HB 1IC5H 5I1DA 4KQ4L 3KLAA 1H3GA 1A4JA 2EDQA 5HI3C 2EH8H 3BN9D 3EUUA 2NLJA 4LARH 4PJEB 1QQDA 4MNQA 1U8IA 1ZVSB 3MRKA 3L3OA 1ZMYA 3UYRH 4BK5A 3FOLA 1NEZG 4P46B 3L1OH 1RUAH 4LASL 1B6UA 4ODTL 4XPHH 3B3IB 3ZKSD 2VXQH 1F6FB 4G8EA 4DEPC 3E2HC 4Z77A 1FFPB 5E8PA 1DANT 1TNNA 4U6XA 3OKDB 3GSNL 4X98B 1JMXA 1RIHL 1Y0LA 2EXWC 4Z0XA 2BSRB 4NQUA 1ADQH 4ERSL 1JHLH 5F9OH 4R96B 3BGFB 1XMWA 4LPXA 4GAFB 4B41A 5IWLC 2CR6A 4JPKL 5D70L 3PWLA 1RIVL 4O2EB 4P57A 5IKCB 4HIXL 5IR1A 3V8CA 4D3CH 4OKDA 3RUGB 4LLUB 4XB7A 4FOMA 4Y5VA 4YIQB 3RZCA 3OKOB 2Q87A 3WFHA 1NKRA 4OZHF 2RHEA 2VZOA 1NUGA 5GRJH 1BFVH 3KXFA 4P46D 1GCFA 4GW1B 2LTQB 1IE5A 2BVPB 5EU7C 3MRRA 2Q7YA 1TJIL 4QCIB 1QLFA 2YHGA 3T0ED 4K23L 1UCBH 5I15L 4NKIH 1HHKA 3Q6GH 1NBYB 5ICXB 1DQLL 3HUJB 1RFDL 1W0VB 4HF5L 3MJ9L 3MJ9H 1T0NB 3EZ8A 1D5MB 3C09B 4XAKD 2D4FA 1F2XK 4JFYB 4GQ9L 4YE4L 3RJDA 4GQ9H 4Y89A 5IVZB 5EIIB 4L3AA 4PJGB 4YGVB 1MCHA 2EO9A 5IBUB 4DK3A 1WC7B 1GZQA 1J87A 3SOBH 5GJSL 4UB0L 4WUUE 5D71L 3BZFB 3T3MF 4RRPG 3NFNB 2O61A 4JHWH 3GO1H 5E2TL 4UNVA 5F1IB 3GSVA 5MEQA 1OGAA 1OAZH 1IEBA 3CSPA 1DN2A 3A67H 2UZIL 2UZIH 5K9OA 3MRGB 4PJDF 4I0PB 1WQVT 1N2RB 4M4PA 3VMNA 4KKNA 1QSFD 4O2FA 4YDJB 2YD5A 5LG1A 3MJ7B 1MF2H 1S3KH 1WUNT 5D2LF 1S9VA 5LQBH 4XC1L 1QA9B 2ESVA 1AGEA 1AE6L 1F8TL 3GM0A 1UM4H 4JKPL 3NPSC 3RGHA 4ZSOB