4LLYA

Crystal structure of pertuzumab clambda fab with variable and constant domain redesigns (vrd2 and crd2) at 1.6a
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
220
structure length
220
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFTDYTMDWVRKAPGKGLEWVADVNPNSGGSIYNQEFKGRFTLSVDRSKNTLYLQMNSLRAEDTAVYYCARNLGPSFYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVATGPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords mutated Pertuzumab Fab heavy chain
total genus 48
structure length 220
sequence length 220
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llyA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llyA01
1QKZL 4OBRA 3WKMH 1EHXA 2O5XH 1G6RB 4P9ML 3EJYC 4OM1L 5EUOF 1INQB 5F7WC 1GVIA 2IANA 3Q3GA 5J6HA 2YPKB 5ITFB 1HNGA 2OTUB 1U95A 1ZAGA 5GJSH 3MBEA 2CD0A 2DLGA 3JVGA 3D3VE 2C7UB 3IXAA 5SWZE 4N8CL 1FCCA 3ZE0F 1UJ3A 4WNQB 2HG5A 4H88L 5IFAL 5F1IB 3MV11 4X5WA 3DWTA 5HGAA 3QRGL 3RVTD 5DWUH 3SE8H 3OBAA 3RWIA 1IM9B 1JWUB 4OLVH 1INEL 1UJ3C 5KVGH 4FFYL 2QKIB 5DD6B 3DUHA 1MHHA 2IAMD 1ORSA 5IW3A 3OWEA 2HFFB 1AQDB 1R5IA 1T1WA 4LQ1A 4BZ1L 1AHWB 3FQNA 5IR1A 4AYFA 4XC3L 4F7TB 1WWBX 2BSED 4DN3H 5FUZL 3VWKA 5FEBA 5E24E 1D9KA 5E2WH 1ZSDB 3DXAB 3OKLB 4HIJB 4WDIA 2FEDD 2QSVA 4JY5L 2XQYG 1FZMA 3RX7A 4FNLL 3AXLA 5B21A 5IK3A 4QRQB 3TZVC 4M9OA 3TN0B 4RAUB 3RY4A 4KTDH 4AL8L 1QP1A 1OTUD 1Z6JT 5C0DA 3HAEH 3MA7A 1R5VA 1HOCA 4KH2A 1CD0A 4LSTH 1E28A 2I07A 2RQ8A 3EDJA 4RGND 3HC3L 1U3JA 1J8HB 1NBYB 4YK4C 3VW3L 1YEGL 4JHAL 2P8LB 2R1WB 4Y4FA 1K8IA 3LKRB 3SCMB 3IVKB 3MRKB 4TPRL 3ULSA 2W1NA 1P1ZB 1XGTA 2XRAL 4BFIB 3FO1A 3VGDA 3TNNA 3NN8A 2AK1H 1OTSD 3HNVH 1OARL 1L0XA 1HSAB 3LRSB 3GSXB 1U41A 1T80A 2YSSA 5FDYA 4HJ0C 5F6HI 1LQSR 3RVUD 3S4SG 4G6FD 5CEYA 5FF6A 4HHAB 2VLKB 3RDTA 1UWGH 2AP2A 4XPHL 4P46A 1T7YA 4PUBH 4ZFZA 1I7UB 3FB8B 2E9BA 4PJFE 3IDGB 5TQ2H 1IJ9A 5IMKA 5HHQB 3LS4L 1HH9A 4JGMA 4Z7WB 3DRQB 1P2CB 1IGJB 2VXTH 2ZCHH 6FABL 4Q6IC 3MLTB 1VADA 1MCCA 3DI2B 1CIUA 1LO2H 3ZKSD 2EC9T 2C3GA 1BD2B 5TF1L 1YJDL 3PV6A 3NPSC 1YEEL 4JY4B 5AEAA 2GCYA 3CFIC 1JV5B 4OCXL 1XIWD 2AEPL 5DD5H 1G7JB 1PBYA 2D7TL 4OZHE 2Y07L 3ARUA 3TZVD 1DL7L 1BJ1J 4P5TD 3VD7A 3DJ9A 3V0VA 2X40A 2XZCL 4PJDA 4K9EL 4X80H 5K59E 1E4KC 1NGZB 5I74C 1ZSDA 2E6PA 5H37H 3GO1L 3DX7A 4ODXB 4A6YB 5DWUL 3OTTA 4UAOC 5IMLA 1TTGA 5HVGB 5KOVC 1I7ZA 1ZXQA 3MV01 2VABB 4KMQA 6CGTA 2VISA 2EDYA 4EI6B 2VZVA 5K9JH 1NAML 3SE4A 5M94B 3GMNA 3WS3A 3DURB 1D6VH 4UQ2B 4XPFL 5HI5C 3IKKA 1XF1A 1P5VA 2R29L 3QQ3B 4XRCB 5C9JB 5LGHL 2KL6A 3NCMA 1CFBA 1GHFH 3WUWB 4I9WD 3T08A 2BERA 4Z95L 2P5WA 4PRAB 1NCWH 2H32A 4P2RB 3WO4C 4ZPVA 1GC1H 5JLZB 4GSDL 1SBSL 3F7RA 4ZXBD 2DKMA 1WVZA 2XKNB 5D6CB 3JV0A 5DJAA 3FCTB 3PHQA 1SM3H 2GFBB 3QDJD 5I17B 5JOPD 3HR6A 1Q0XL 2PYEB 2XWTA 2RCSL 3QIBC 3TVMD 4YC2B 2DYPD 2AK4D 4MNGA 1SYSA 2WUCL 4UBDD 35C8L 3OB0H 1IC1A 4XB7A 1EXUB 3DX9B 4YJZL 3OXSB 2HJLA 2FX7L 2LFGA 2JJTA 4F7MB 5HDQL 4HLZH 3HS0A 4K7PY 4OLUL 4YDKH 4MZ3A 2Z31B 4FQIL 2R8SL 4KROC 4PRBA 4KZDH 1FL5A 1KLUB 1QPXA 1QLRB 3V6FA 1T2JA 2GW5A 4E0RA 3CDYA 2VLJA 2IPTL 1KTRL 1J1OH 3RVVC 1JGDB 3F7QA 4R0LC 4PJBE 4R97B 2NY4C 5IESL 2EDLA 3IGAB 2ZUTA 3EJZD 3HZMB 5F6IB 1CL7I 1BBJA 5I66B 3E6HB 3DXAE 4MQSB 5FYJL 1C08B 3MCG1 3FO9B 1BVKA 4NKDB 5DC4B 4M93C 3UBXB 5F3HB 1F8TH 5ETUB 1AY1H 1Q9LA 3HFML 3QIBB 2XZQL 4F9PC 1B2WL 5DD6A 3MV8D 3V4PH 2CRYA 1HN1A 3BPNB 1ZHKB 4JN2A 2MMXA 2R2BB 4JRYB 4IHOA 3ORJA 1KCUH 2IFFL 2GTZA 4KJPD 5IHBA 5I16A 3EYUH 1MEXH 4HW6A 2A6IB 2IWGA 1G9EA 3D0VA 2P8PA 3L5WB 5DFVD 1IBGL 3OGCA 4ZTPL 3KPRD 1PX3A 1MWAL 3ARFB 4XH2B 5FUOH 5GGRY 2YXMA 1A7BA 1M05B 4LSPL 1RJZB 3GHEH 3KPRB 4JREC 3H0TA 5I8EA 2CDGA 4XAWL 4J8RA 3BT2H 2E9IA 4RZCA 1XIWA 5C0CB 4ZSOB 3TA3D 3EOTH 1NCDL 4CW1B 2YWZA 5CUSH 5J13C 1M7IB 4UNVA 2EDEA 2PTTB 1BWMA 4PGZA 3WN5B 5JLZA 5I1AA 2V2TB 4HUNB 3DNKA 4LVNC 3SDDB 3FKUS 3LZFH 4YDIL 1VKXA 1YEFH 3MBXL 4K9EH 4X80L 4UI2A 4OBSA 3HN3A 1XCQA 1EAPA 4QHNA 4JPWH 1NMBL 1X4YA 4ERSH 2YBRB 3LKSA 4JFZH 4JO2L 3BZEA 4XP1H 1RHHA 5I1JH 2GIYA 3JUYA 3QUZC 4ENEC 1NBVL 4LCUA 4NO2B 5D2LB 4RISH 3OKLA 1YMME 1KULA 3DVNA 1GL4B 3G6JA 5DRXB 3WDHA 3AM8A 1QLFB 2WINA 1TQBC 2BFVL 4F33A 1I1YB 4V1DD 2CLRB 4P2OC 3NABH 1OM3L 2ITCA 2PF6A 2R0ZL 4KTEL 4DUXA 1EUUA 2DICA 4KDTC 3WFCH 1MNUH 3NH7L 3FRUA 3H9SD 4G7VL 4ODUB 3NCJH 1TJGH 4R26H 3SJVA 4NZDA 5JXEC 4DAGH 3FAWA 1ETZA 2MQCA 5FYKU 3HC0A 4QHUB 4ZUWB 5JW5B 3MGOB 2ZJSL 4GS7B 3E0GA 4EUPA 2IADB 1MFCH 4OD3L 4HLJA 4POZD 1MRFH 3SDDC 1I4FA 3VRIA 3W0WB 3BWUC 35C8H 1I1CA 1I7RA 1NLBL 3B2VL 3GJFB 4EUPH 3SKNA 3BP4B 1NQBA 4XPGH 3T0EE 2VZUA 1AR1C 4E9LA 5DYOA 3RFZC 4RIRA 5HPMA 5FK9B 3AREB 5FOJA 3NZ8B 3QFDA 3RWCA 1OSZA 5J6GA 5L2KA 5JORB 4BKLB 3MJ6A 3UPRB 1A7RL 1D9KB 1T0NA 2H2SD 4KC3B 3ZE2F 2J8OA 2BMKB 4CUCA 3V7AE 4Z18A 3HZVA 2XTJB 4OZIF 2W9DL 3LSOB 3N9GH 4HJGA 3CH1B 4JFOA 3QUZA 5HHVH 1YNKL 4NQVB 5KVMC 2A6DB 5E8OB 4K94L 4MB4A 2XQBL 3RIFF 1MCRA 1F4YL 2VLMD 3O2DA 2VNCA 3V4PL 1NMAL 3MJ9A 4BSVB 5HGHB 4FQQA 43CAA 2VISB 4R4ND 5GGUB 1CGTA 3HE6C 4Y4KA 4HDIB 5E9DB 1P7HL 4J7RA 3FB5B 2C3XA 7CGTA 3L9RA 4BSJA 3ABZA 1ZS8A 3DUSB 4TULH 8CGTA 4P3DA 5GGRB 3W9EB 4D0BB 4EDWH 1LO5B 4DZ8A 5DMGD 3V6OA 3KYKH 4KKCC 3MV8A 4HKBB 2QSTA 3WFHA 4N0FB 1MCNA 4X6CE 2FX9L 5T3ZE 3C60D 2YD4A 4OZHA 1HCVA 1XMWA 2HKFL 5BXFB 3SDXF 4AY0A 1EPFA 4M5YH 1XF4B 5K9QG 3HPLB 3FQXA 1V3LA 5J12B 2VRAA 2APBA 3O2DH 1KNOB 3GMNB 4QCIA 2H3NB 3S96A 1Q9KA 4KFZC 2VDRL 2HTKD 2A0LD 5FYKL 4ZUWA 1EUTA 1T04A 5JW5A 3MNWB 1XGYL 2V5SA 5GGVY 4YBHA 1CXEA 1KGCE 5AYUL 1MVUB 4GBXA 4M7KH 4AQ1B 3RIAF 4B53A 1J12A 2EH8L 5MHSD 4U1NB 3P4OA 2E3VA 3ROLA 1CFTB 5F8QC 2XNAB 4Q6IB 3QDMB 4O4YH 3EOBB 4QHLA 3U0WL 4P2YA 5F89A 3OMZA 4NGHH 3REWB 3I6KA 4PG9B 4JZOA 1VACB 2V2WB 2QTEA 4OCWH 4FQHB 3RWCB 2VC2H 2A38A 1W0YT 2W65B 5BS0B 4KU1A 5F71A 3BSZL 3WV0A 5ID1B 1U91A 1HEZB 4JHZA 4ODVL 5E5RB 4OGXH 5EBWB 4M6MH 3FN0H 2R4RL 3VWJA 4DW2L 5IB5B 1CD1A 1IKFL 5HDBF 1JGEA 2X4SB 4YE4H 5EBLB 4HS8H 4AG4L 3UTTB 1FH5H 5FGRA 1PQZB 3QQ9C 1FL3A 5DVNA 1F4XH 2Y06L 2D3VA 4M1DH 4NPYA 3NVQA 1KB9K 5BRZD 3U36B 1A7PH 5I30H 3JTTB 1NC4D 1A1OB 4KK8C 4Y4HB 2Q6WA 3RWJB 5BRZB 4HD9A 4FQ1L 5ISZA 2AJ3B 2AV1A 1A6AB 2R1XB 3SN6N 3RKPA 5BZDA 4HMCA 4NZTL 1FZJB 5EUKA 1F45A 3S8WA 3MV7B 1S7WB 1KUMA 4HWUA 1T3FA 4XB8A 2C3VB 4HK3N 1A9BB 4E41B 3MLSL 2NTFB 3I75B 4QXGH 2WBJC 4NUGL 2FX9H 1NJ9B 5IW1B 1OP9A 3RTQB 3UTQA 1D5ZA 2Z4QA 3PHOA 5IVZB 5T1LD 2W60B 3SKMB 4Y16C 2HRPH 3QUKB 4D3CH 3UJIH 2A74B 3BZ4A 2XIDA 2P4AB 4XZUB 5HYJE 1ND0A 3SGJA 3O45A 3EYVB 5B22A 3ARDD 1H0DB 3L5IA 3KYOA 1EBPA 4YHIA 4KKNA 3QWRD 1MHPL 2EE9A 2P5EE 1IILE 3H0TB 1MVUA 3ZYJA 5IMMB 2B1HH 5K9KB 3VXUA 4OGAD 1T89C 3ME0A 5MI0C 1UWXH 1PZ5B 3IXTA 4LCYA 1MCEA 3SCMC 3H9ZA 5L88H 2OR9L 1ERNA 2Z9TA 4Y89A 1IC5H 1OAYL 2PYEE 4HUWA 3S36X 1A3RH 1UWEH 3W9DB 3VXMD 3IKCB 2X44D 5FYKD 1XCQB 4H26A 4RFEA 1G9MC 2C9AA 3CZJA 3QHZL 3MNZB 4OM1H 3KLHD 2BC4B 4A6YL 5A40E 4JFXB 4RAHA 4YLQT 2AI0H 2R4RH 4NOBA 2RGSA 4PJGA 5D93C 3BMWA 5JNYB 3W2DL 4DZBB 4UIMA 2I9TB 1U8NA 2BNRD 3UZEA 3PWPB 1T20A 4S1SL 1AC0A 7FABL 5E08L 3OGCB 3PWPD 5HDOA 4X8JB 5HHNA 3MRHA 2CR3A 2X6MA 5SWZB 1D5MB 1PKQB 2FX8H 4UINL 3HZKA 4HF5H 4LCIL 4ODVH 4FG6D 5ADOL 4PP1D 3MRCA 1C5DA 3K74B 3GSNH 4XNZC 5AZ2L 4HAGA 1N6UA 3BT2L 4PJEE 1Y18A 2CRMA 2VABA 4NKQB 4I77L 2UZXB 4HIHB 5FM8A 1VGKA 4XBGA 1ES0B 4F15B 2Q76B 1FJ1A 3BWAA 1FP5A 3QUZD 3CX2A 4OJFL 4ENED 3QFJE 4FQQB 4XP4L 1JRHH 3SDAB 3TYFB 4QXGL 2HWZL 4G80B 3BX7C 2WWKO 1FYTE 1G9NH 4M8QB 5J6GB 3NIGF 5IBTL 5IHZA 5BVPL 3SDAD 5KW9H 2ZUQB 3IDJB 1EEUA 1GJIA 5D7SL 4HZAA 1FRGH 3S35H 4LASL 2A74A 4OT1L 4D3CL 4D0DB 4WI8A 2Q3ZA 3UO1H 3NTCH 2LQRA 1CT8A 4LPTA 1RIVL 1R0AL 4X6DB 1F6FB 3C87A 4KJYA 5D71L 2BVQA 5MI0B 3ZTNH 2F54A 1H8SA 1UCTA 1W0VA 2BNUA 3QDGD 2VLKD 1JWSB 4M1GL 1CG9A 1EVTC 1NGQL 1ZHBA 2FRGP 5C0BE 4DCQA 2AK4A 4ZUUA 2JCCB 3VFSB 3AY4C 1UC6A 4KI1A 4OD1H 3HC0B 4YZFE 1INEH 2ZUYA 3MREA 3VDCA 2F5AH 5F7UA 1XFPA 3EAKA 4PRHD 2YPLD 2VE6B 3SDCB 3EOYG 1HDMA 5E94B 4LCWA 3ZDXF 2BRQA 4QY8A 1N6QH 4RMWA 1A3RL 2XOTA 4PG2C 4PJXF 1A6ZA 3IF1B 1KELL 4FFZL 4L8DA 4NJAL 4P5KB 4G7YL 2D7OA 3D18A 3FTGB 1UWGL 2R1YA 1ZLVH 1RK0B 3MRIB 4M1CD 3BGMA 4TNWK 1S7VA 1QLEH 2JIXA 3UTPD 5IB1B 3QFDB 2CKBH 3QDMA 4DWHA 4RGOH 4BFIA 1AIFB 2Y5TB 3ARBD 3V52H 3P11H 1T2QL 3TN0C 4QRSB 4F37F 1T0NB 1P6FA 4H5SB 1TTFA 3K2MC 5KSVA 4D9RE 1F42A 5ITBH 2DBLH 2OR8A 4HUXA 4MA8H 2W65A 1K9TA 3HTLX 2NY6C 4NKMA 4P46D 3VFRA 1DQLL 2WBWB 3GJEA 5BOZG 5JW3L 3UXFA 4Q97A 3RL1A 5SWSA 2YD9A 3VA6A 3QHFH 3N06B 4JKPL 4Z7WA 2DBJA 5HGDB 1OW0C 1WZ1H 5KJRH 1ZMYA 3ROLB 5D2NC 1FNEB 3P2TA 5TDNA 1GIGL 2DTMH 4PGBA 2N1KA 3ARTA 5CBAA 5JPMA 1KENL 4IRZH 5GGVH 2YD3A 4I3SH 4R6UA 3B4NA 1VACA 2V2WA 3KPNB 3TYFA 5F7YC 1UZ6E 4P2RD 2YPVH 4J8RB 3IDIB 4OGZA 4FFVC 4XCFL 3RGVB 1HINH 1FFRA 1S8DB 4Z77B 3WIHH 5D5ME 1P84J 2R0WH 1E6JH 1IAIM 1C8PA 1FGVL 4LGPB 1P1ZA 5GRYA 2R0LL 1Y0LA 1FC1A 1JI1A 5E8NB 1LNUA 3GMPB 3BPOC 3D3VB 2WMPA 2X4SA 4W4OC 5FO9B 2NY1D 3D3VD 1BEYL 3WNOA 1NFDE 4FQXD 3LKSB 2YBRA 2DLFH 4WTZA 1QFPA 3W5MA 1FPTL 2GK0B 3KPMA 1Q9KB 4X6BA 5HVHC 5DT1L 1VFBB 2H8PA 4DTGL 5J12C 2AEPH 5DD5L 3JTTA 1UXSA 2VDKH 1JHKH 5TE4H 1J0KA 4KV5F 3RAJL 5I1EL 3DTXA 3VRJA 5I8CA 4G9FE 1FG2A 3U4BL 4XPTL 3S5LA 1PEZA 2NY0D 2G5BA 1J0YA 3SQOH 3BP7B 3BQUD 3TO4C 3C2AL 3RWEA 2G2RB 3TNNB 3HG1B 5IKCA 3LCYA 5C08B 4G7YH 1MPAL 1OY3B 2X89A 4ZTOH 3T4AB 3DBXA 3PGFH 4MJ5A 2ZUXA 3HG1D 2HT2C 3OQ3B 4L8SA 5EOCL 1L4IA 2E6QA 1NLDL 3BI9X 5T33H 4HUWB 4XXCA 4M7LL 4TSAH 4NO3B 4JFPA 5CLWA 3FFCD 1HYSC 2NYYD 4I48A 1FNHA 3M8OH 2B7DT 4WO4A 3QQNA 1JGEB 4WFHD 4GAYB 5DJ6B 1P2CA 4GBXC 3CU1A 5ESVA 5JHLL 1PVHA 4HS8L 4AG4H 2DLEA 3GK8L 2IH1B 1J8KA 1J1PH 3ULVD 1BD2A 3D2UA 2F54E 4L3CA 4Y19E 5EO9A 3CFCL 1AKJD 1GPOL 3CAFA 4Y5VC 1BM3L 5GSVA 5CIPB 5ANMB 3BAEH 4I3RL 1BFOB 2DMCA 4MA1B 5CGYD 4NFBA 1QD0A 8FABB 1LE5A 1T0MA 2GJJA 4LK4A 4TYUA 3GGWB 1XGRA 2H26B 1DQQA 1CGSH 3LIZH 3VXRB 3TA3B 2B2XL 5INDA 1KN4L 2X4UA 1OARH 2F74B 2VJXA 1HNFA 1KF9B 3RJDA 2BCKB 2L7JA 1QLEL 4M6OL 3UJTH 3QA3B 3MUJA 4HQQH 3ILPA 3EO9L 2V7HA 3P4MA 4NC2B 3S7GA 3UBXA 2EXYD 1NCBH 5CJXC 4HK0B 4XCNA 1TFHA 1U42A 4LPXA 1WBZB 3NCEB 2EDKA 2XKUA 5E56A 2YXFA 1QFHA 5KSUB 1KB9J 3BUYA 5EU5B 5L2JA 4YIQA 3R4DA 3IS1X 4HIEA 2NY5C 3EO1A 3TYGH 7FABH 5GISL 1CD8A 4J3SA 4H25B 2OR7A 1HHGB 3H9SB 3P0GB 2UVFA 4JQXA 3PGCB 3SO3C 1VEOA 3MRPA 5ADOH 5C86A 4WUUB 1KB5A 4R7NB 2KZ1B 3H2WA 5EZLA 1FJ1B 3SKOA 2XG5A 3N0PB 1P84K 4OF0A 4MHHI 2LU7A 2PTVA 2K9UA 3MNWA 1B2WH 5CJBA 3PL6B 1JNJA 4F37K 1Q9OA 2YK1H 5GGTH 1JRHL 1BOGB 1REIA 3HB3D 4N0UE 3BW9B 2BSSA 2PXYC 5T1DH 4R26L 3MLWL 5D7SH 1OLLA 1KOAA 1E4JA 4Y8DC 3CNKA 1T20B 5EB9A 4OZGA 1QBAA 2DJUA 2D7MA 1JZ4A 5F9WB 3AB0C 5BZWA 1JTPA 3DARA 4LARL 3QWQB 2FGZA 4I3RH 3QUMH 3QPXH 4N90D 4CAGA 2WAHA 4YGVA 5DEGA 1I7TB 2UZIL 2YPLE 5DJ2B 1I1RA 3HE7D 1SEQL 3NZHH 4ZOEA 5C70A 1LHZA 5FKAB 4LHUD 4O2FA 3NAAH 5L8LB 2P47B 4NWUL 3T4YA 1RJLA 4KVCH 3GSRA 5E9DD 3MRIA 3QA3A 1QRKA 4IIQB 4R90H 1BZ7B 3RVVD 4WTXA 5EU4B 1LP9F 2NZ9D 3OL2A 1AXTH 3VXQA 4M7LH 3CSGA 4YX2H 4U6XB 3DMMD 2F5BL 2BJML 4CNIB 3TIDB 3VGBA 3MRKA 4HS6A 2EEDA 5F88A 5ECJE 5F9JB 5JORA 3FT2A 2B8OT 2NPLX 3V4UH 4PJHA 1TETH 1YY8A 4ZXBA 5DHVA 1LEIB 4JRXE 1KYOK 2D4DA 2VR5A 2DDQL 3BJ91 3ZT7A 3GI9L 4W70A 1H8NA 3LMJH 4Z6AT 4ZSOA 2Z4QB 2HJKA 3PHOB 5D96B 1I8IA 1IC7H 3EO9H 2XFXA 3KJ6H 4MD0A 3F62A 2P8MB 1RK1A 2LTQC 3D48R 1A6TB 1N3NB 4O02H 3QHFL 6FABH 5I73B 2ZPKH 3O11A 4L3EB 2ICEA 3QG7L 4UDTB 5BW7A 3HPJA 4NQCA 4F2MB 3QEQB 5EU6D 2EH7L 1YEEH 2DQHH 4YPJA 1SYSB 3HUJB 4JZNA 4OLXH 3SOBL 4QLRA 3WJJC 5T3XD 2A1WL 3MOAL 2X7LA 1Q1JH 4LIQE 4ODTH 4WFEE 2EDWA 1A7OH 2X4QB 5F8RC 4PJ8A 5CSGA 4F7MA 5C0BB 3A6CH 1LO0H 4ACPA 5D96C 3QO0B 1X3DA 3DO7B 4YHLL 1XAUA 1KPVB 1BAFL 3RUGB 3LH2L 1WFTA 3GMLB 1XGYH 4P46C 3U30B 3ALWA 5L2KB 2E9WA 1H3TA 5C0GA 1AXIB 5E99L 4Z78B 2QQLH 3CXDH 4ONHA 5E6IA 1T5XB 5C09D 4YXLL 4JFOB 1W0WA 3AS0A 4K7FB 5F1NB 4F15C 3IFPB 1JTOA 3VRIB 3ARBC 4U1SB 5IG7A 1T04B 4A2MA 3D6GA 2D9CA 2V7NA 3QWOA 4LCCC 4X5LA 1Y6NR 3WIFA 4I5BB 4WJ5B 5A16B 5IBUB 1SVCP 3LPFA 4RNRA 1WAAE 3VXTB 2AJXL 3PWNA 4P5TC 4PLOB 2EDQA 2XZAL 3VG9C 1S7RA 3HZYB 3QAZB 2VDLL 2O5XL 4NSKB 3RTQC 1AHWA 1A6WH 2IBZY 4KTYA 4PJIF 5CCKL 5IEHB 3WCYA 4HBCL 1WZKA 5HY9A 1F11A 5AZEL 3NPSB 5L2KE 3AB0B 1W72L 1JHLH 1HHJB 1NC2A 1DVFB 1HXYB 2FR4A 2VLRB 3V2AR 5I30L 3KPQA 1VSCA 1IKNA 5CZXD 4LQFH 2X9YA 4HK0A 4OTXL 3ECBB 1QFWM 4XCNB 1D5IL 1BFOA 3OZ9H 1ZLUH 3MRFB 5E0QA 3VG0H 4HV8B 4UDTA 5FGBC 3GKWH 3CZFA 3RP1A 5KSAA 4YDKL 3DVNB 4ELKA 5HYJA 3PGDB 4LSUL 4KZDL 2CGRL 4XCEA 4GOSA 4PJ7E 4GUPA 2CDGB 3NAAL 3TEUA 1ZHLB 5I1DB 3VD5A 5C2UB 3MV8B 3VA2C 4OLYL 4EQ3A 2VDOL 3TBWB 4HXBL 3CLEL 4R7DB 4WWKB 3W39A 1DEEA 2CLVB 3VXMB 3P0VH 1T3FB 1QSED 4FXLA 2JJTC 3HZMA 2GY5A 1ETZB 3RIFK 3QP3A 1MH5B 1I85A 5LGJB 4HH9A 1A2YA 4X99A 4Q0XL 3V4UL 2DQEL 3IDXH 3VFVB 4OLXL 1Q9LB 1MREH 4WEBH 2DTSA 2MQ0A 3DUUA 4JHBA 3W11C 2JIXB 1P9MA 1V7MH 3OR7A 2HMID 5E8EA 4OM0H 3MRDA 5DJ8A 3QCTH 4LNRA 5C0FB 4BK4A 5EBLA 4F7PA 3RWFA 2FECI 4X0KB 5CJQH 4AEFA 5FIEA 2H1PH 2YRPA 2BK8A 2L0DA 1CDJA 4XH2A 4MDJB 3HLAA 3GRWH 3OGOE 4OZFA 5F3BB 4WTZG 2XA8L 2LAGB 4XBPA 4LKXA 5CILL 1FV1A 1F13A 4Y5YC 1LP9A 1X5XA 2R29H 4XP5H 5HHOB 3GSOB 2FO1A 3GJEB 3UYRL 3ARXA 3BN9C 2O5ZL 5J11C 1L6XA 5DUML 3GZKA 4WW2C 1KN2H 4ZS7H 1WWAX 2R56L 1J8HD 5F1IA 1VFAA 3S4SA 3FQUA 3PABA 1URLA 4IDJH 4ESKA 1NCTA 5C0AD 1U3HA 2HKHH 3OR6A 2SEBA 3WFBL 4X6EB 1R3KA 4PJCA 4Z0XA 5GS0D 5IHLB 4LIQH 4NKIH 3CXDL 2WINB 2OR9H 5BRZA 1IM3B 5E2UH 4QGYA 3SPVB 5BV7L 2ZUSA 1FZKB 3O4OB 3M07A 5MEOB 5LVEA 1IT9L 4HK3J 5ACZA 5ICZA 4FFYH 4OZHB 3QCVH 3HAEG 4JO4H 3HE7A 1H15A 4I0PB 1KSRA 3MCKA 4GW4A 1FFNA 5TE7H 1G1YA 1A6UH 3U9UA 4G9FA 1MIEL 5AYQA 4TSCH 4Z7NF 4KKCD 2XT1B 3TH4T 4DW2H 3DOSA 3L9RB 2P1YA 1K6QH 3RUGE 4EIGB 1OF2B 2X89D 3RWEB 1W72H 2P24A 1S7UA 4TUJB 2FHCA 3MLVH 5H94B 3KYOB 5F7MC 3WXVL 3FRPG 2UZYB 1AY1L 4ZD3L 1ZVSA 3ALXA 2VXVL 1YDPB 4OF8A 4NNPL 2YUVA 1B3JA 5CP7B 5CINH 2DIBA 3T8XA 3HC3H 5MP6L 3FB7A 3C08H 1BF8A 5IESH 1RV6X 3C2SA 2JELH 4ZFOA 3C6LA 2ZOLB 4H1LH 2OMBA 4JHAH 4P46B 2X9WA 4HT1L 1A9EB 4FRWA 5DJXA 4X8XA 3BHBA 1QFUL 1CDGA 1U3ZA 4Y5XA 3KXFD 2AQ2A 3T4YB 4MNHA 4L4TE 1E0OB 4DVBB 4QXUH 4PJIE 4PJIA 2ICCA 3ZKND 2X4QA 1FLRH 4GRMB 3SOBH 4NKDA 4NUJA 3G04B 5GRZA 4JHWL 5B4MC 4GW1A 2YUZA 1E4WL 1K3IA 3L3KB 5HYJD 2H2SC 5C0CE 1U8NB 1H3XA 4FQXC 4YBQC 2WSKA 4UUJB 4D0BA 2BNRA 2UWEF 3K7UA 3ZLQC 4WUKH 1Q72L 1PYWA 2I60H 4KV5E 4ZXBB 1OTTC 1G9MH 5AWNH 4AEIL 3O3DA 4FQIH 4JQXC 3QUYC 4H5SA 4W81A 1R24B 5DUPH 5EU3A 5IB5A 1HSBA 3PV7A 4L4VB 3QO1A 3HC4H 2VQTA 2NY1B 1QBLH 1AC6A 1RZKH 4ELMF 1JWSA 3V6OC 2EDDA 1B0GB 1MEXL 2PYED 2EDHA 2Q8BL 1MFDH 2FNBA 4AIZB 3O3BB 4R3SA 2AK4B 4ZUUB 3VFSA 1NKRA 5HHME 5DO2D 1CZ8H 2I07B 5CILH 3RZCD 4J3OC 1X4ZA 1NBQA 3VXTA 2A0LC 1AGBB 4HUVA 2PN5A 2ZJSH 3WNPA 1W72A 3TJHC 2OI9B 2PXYA 3ZKMD 4EI5C 1B4JH 1O7VA 5E2UL 3QISA 4NN7B 3MV8E 2D03H 3C5ZA 4HPYL 5DJ0A 1N0XH 3LS5L 1OM3H 3ES6B 1LDPH 4QRTA 5DA0B 1S7XA 4RGMB 1BQLH 1JGLH 1S7VB 1U6AL 4P23C 5AZEH 2EKSA 3RUGA 5DT1H 5TQ2L 4KMTL 1DQLH 4PRNA 4YPGA 5FGCE 2YRZA 4G43A 1NJ9A 1Z9OA 4KY1H 2FHBA 1L7TL 5EZJB 4Z7NE 1ZLWH 1IKFH 5EDXA 2AS5M 2RB8A 4UU9B 4Z7QF 4YO0B 3SJVB 4P0DA 2LAAA 1K3ZA 4NP4H 1A2YB 4LLUA 3FAXA 2R2EA 4P3WA 2AK4E 2OXHA 2J8UA 1Z9LA 5DVOA 4YDIH 2HVJB 3HI1A 4M43L 2NXYD 1U58A 4O2EB 4H1LB 2D7TH 3NFPA 2IPKA 4CADB 1A3QA 3ZDYF 4ZD3H 1QFUH 4JO2H 3E3QE 5C8JB 4RNRB 5BJTA 5T1LB 3PWPA 1XGQB 1ONQA 5D1QC 1AO7D 4L4TA 1MRFL 1DCLA 1DEDA 3C08L 4GMSL 2OZ4H 2WP3T 4XP6H 4DK3A 4PJXB 5DMIH 4TOYL 5EUKB 4C4KO 1AGFB 4U1IB 3MZTA 3BYYA 4HT1H 4I18C 1II4E 2Y72A 4G7VH 4L8SB 1CTNA 3DGCR 2P5WB 1J1PL 3QAZC 2PTUA 3OKEA 4PJHE 5F7LB 1F00I 3GRWA 4YZFF 4Z0BL 3LSOA 4X4ZA 4MMZC 3F58H 4U1KA 5EO0B 3SGKC 4WO4B 2CSPA 3H9YA 3EFFB 1MLCA 4PRHE 1PKQE 3C6LD 4NQVA 3UTSA 4F7TA 2OI9C 1F4WH 5A3ID 3FJTA 5IHZB 1A7QH 4JRYA 2B1HL 3FN9A 3SHSA 2H8PB 1IC4H 3CD4A 4MA3A 2ENYA 4DVRH 3H7LA 2A6IA 5B8CC 4U1HB 3EDKA 4QXUL 5DD1L 4ZPTA 1YYMH 1RUKL 3WLBB 2DQTH 4JCMA 3W39B 3VFWA 4MXVE 3VFNA 3CXHJ 1LDPL 4JFQA 1BD2E 2IG2L 4MAUH 3O9WB 3CFEB 3O8XC 4L3EE 4HWEH 1RVFL 3UBXI 4M7ZC 4YPGB 4U6VH 4X99B 4PS4L 4RFEB 3U4EB 4X9HA 4JQVA 3KPMB 4IRJC 3OSKA 4JVWA 1GPOH 2OL3L 2VAAA 5D2LE 1C08A 1L7TH 1Q94B 4G3YL 3ZT5A 2P7TA 1OT2A 1DP0A 4HWBH 4R96A 3KPSA 3KPSE 1XGUA 1XZ0A 3HI6H 1WZ1L 5KJRL 5IWLA 3VXUE 5I73C 1QKZH 3WKML 3GSVB 4HIEB 1GZPA 1MFDL 2IPTH 4NFCA 1U6AH 2XZZA 3B5TA 5DLMH 5CHNB 5E03A 3BGFB 1MY5A 5FGCB 4NQDB 1MCDA 1G6VK 4M1DL 4L29B 3TIEB 1S7QB 4KHXL 4JCLA 4P2RE 4TSBL 3ZDYE 1L0YA 3P9WB 1G6RH 4O58H 1WFOA 3FT4A 2NX5E 4ZUTA 2UV3A 1EGJA 2WQ8A 3UJJH 1HYSD 2AJSH 2FJGB 5TQ0L 2Q76A 1IGTA 4H1LG 1W2KT 4WWID 3RL1B 3BKCL 3THML 5DRWA 2BY2A 3UC0H 3QDHA 1P5UA 2I9LB 1AXSB 3CPLA 4ZS6C 1IQDA 4HGMA 1L7IL 4KI5E 4BZ1H 1M1SA 3HR5B 3OAYK 3U0PB 4XNYH 5TPWH 4DTGH 3SDCD 1GGCH 4LL9A 2A83B 2VDKL 2VO5A 2E27L 1CGWA 4G8GB 4PB9L 1BP3B 1NEZG 1XGPB 2AV7A 1LK2B 2P8PB 3L5WA 5FYJE 5EIIB 5BQ7B 3QEUB 4LPUA 3M1BB 1UGNA 1X7QB 2W07A 2X4NA 2O26U 4HPOH 4YXHL 1VEMA 2FR4B 1I1YA 1Z9SA 3TESA 3H42H 1XIWB 3MRNB 2XYCA 5E8NA 5C0CA 5MEND 1HI6A 2DYPA 2YEZB 2YZ8A 5D7IB 1FZJA 3OG6B 3O4OC 1B0GA 5MENB 5F1SA 3TT3H 2CLZA 3BD5A 3WJJA 5EZLB 1SEBA 5E94A 3QEQD 4LLQB 5EU6B 1HHKA 4LLMB 1A9BA 2FCBA 4NJAH 1NEZA 3CZFB 1BQSA 2NZ9C 4X7DC 1I8MB 4HDIA 2OXGA 2A6JA 3MLSH 4AZ8A 4KTEH 2QHRH 2OP4H 3BP7A 5EWIH 5D1XC 2A77H 3MR9A 1ZS8B 2IH3A 4GQ9L 2FLBT 2ADGA 2CO7B 5KVFH 1JN6A 3ES6A 3S3SA 4B41A 1RURL 1JZ5A 1U2HA 3HI6L 3JWDH 1F3DH 3UJIL 5L88L 2APWA 3DBXB 3EYQD 4Q58C 5FCSH 5EZIL 1B90A 1P6AB 1AR2A 4M5ZH 4J3XA 4O5LL 1ZGLB 4XX1G 3O6MH 1F5WA 3LQAH 1CBVL 1ITCA 4S10A 3RGVD 3RKDD 4BJLA 4JKPH 1EHLH 3OR7B 1P4IL 1WCBB 5DD1H 2F8VA 3W9DA 5KZCB 1YEDB 4YR6B 5TF1H 3MJ8A 3OXSA 5FA4B 2BSTA 4WHDA 3LKQB 4LPVA 5ERWA 2DQCH 1PFCA 2X1QA 4PJHF 3V6OE 2HTKC 1ZLSH 3M17A 2H6PA 4MJIE 1Q8MA 3F7YB 1JNNL 3AREA 1UM6H 4HUUB 3MYZA 1DBBH 2FSEB 2VXUH 1EO8L 2OJEB 4NO5B 2AEQL 2HVKA 2OMNA 2NY5L 3QI9A 5GHWL 4GJTB 1YEKH 3MX0A 3QFJB 4BFGA 2QQQA 4OT1H 4QGTA 3Q2CA 5FDWB 1FIGH 4PJBB 3D3VA 3W11D 2VDMH 1J0HA 1L6ZA 3V0WL 3HI1B 1FNLA 2HP4A 5IB2A 4NN5B 4MVBC 3QJHA 1ZA6B 4GLRI 2EDTA 1TNNA 4PY7B 3RA7H 1MY7A 3DSFL 3VXRE 4RAUA 3RI5F 4Q7DA 1X6NA 4EBQH 5IBTH 3WHE1 3X3FL 2PO6D 1KCLA 1VGKB 4XBGB 5KW9L 1FAKT 2C4FU 2DN7A 3GSNL 2AJVL 5A16A 4JO1H 1H3GA 4Z95H 2DQFA 3I6LD 3DMMC 4Z7VB 3CFBA 4HXAH 3FN0L 1FFOB 5J9PB 2Z0BA 4HPOL 5I8EB 3L3OA 4XPFH 1U8OA 4APQA 1INDL 2CIIB 2FO4B 3T0EA 5JHDB 1IAOA 1J05A 4JPKH 4JRYD 1CFTA 3RY5A 3O2DL 4LRNL 4D0DA 4NCC2 3ULSB 4N0UA 1WFUA 1KJ3H 5EOQL 1JMZA 3ULVF 1GGCL 3LOWA 3ARGD 3JXAA 4ODWB 1CU4H 5T1KB 3TCLA 2NR6D 4JFYA 4HKJB 1KCVH 1Q0XH 2XACC 1DVFA 2ZKHL 3GSNB 3LEYL 5K9QI 3O6LH 4H0IA 3U4EA 3QQ4B 3VI4E 1D5ZB 2BRRL 1LILA 3B9DA 1U91B 5EO1B 5IFHL 4JPVL 3OF6A 4S1QL 1JCKA 3CX5J 1A6PA 1FVCB 1GGIH 5E6IB 1S5IL 2Z8RA 4YQXL 4F33B 4XX1E 3UDWA 4KJWC 1FE8L 4CKVX 1BQUA 4FP8L 4N1EA 4UNTA 1JUFB 4IMKC 3PGCA 4JANB 2CKBL 5LWYH 3WLBA 2B0SH 1FNGA 3T0DA 5IV2A 3VWKD 1K4DB 1MUJA 4ZYKB 1FBIH 2CPCA 4I5BA 4WJ5A 1T1ZB 1JHLL 3H3PH 2EZ0D 3NMEA 3DO7A 1NFDF 2BP3A 1OAUH 3X13B 3BH9A 1UZ6F 2P5EA 4JKKA 3JUZA 5D70H 3TN0D 1I1AA 5FYKE 4F9LC 3ARFC 2VUYA 3QXWA 5DUBA 5JMOC 4BH7A 3VRLE 1NUFA 4TUKL 1CGUA 3MV7E 3O6FD 3RRQA 5JR1L 1F11B 1S7WA 1DLFH 3DSNA 5DXWA 5EO0A 4UT6L 1IGIH 1IGTB 4H8WL 4HH8A 4KK6C 5MEQA 1Z9MA 4F8QA 1UVQB 3KPSD 3C5SA 1FLTX 1M7DB 4QHKJ 2ZPKL 5H35A 4X9FA 5CHNA 4N0CD 4J4PA 5DURD 5GS2H 2WW8A 4JDZA 1YQVH 2VIRA 3L5XL 5BZWB 2BMKA 5LAXA 2NW3B 3W0WD 1KLGB 1S9XA 3LB6D 1BBDH 3FQTA 1ODAA 1RZ7H 5JDJA 2EIBA 4R97C 2H2PD 1MCSA 1KTDA 4NUGH 3K1DA 3UYOD 4BH8A 1FV1B 4XVUC 4LVOB 1N26A 1N64L 3UPCA 2D7QA 5I1HL 3OHXA 4OD2B 1J05B 5GS2D 3O2VH 1ZA3A 2HTLD 4P2RA 1D9KD 2VLRA 1OB1B 1J18A 3KG5A 1UB5A 3VXMA 4EBQL 5J06A 1OD9A 5E99H 4ERSL 3O11B 3TBVA 3NCCB 5D7LD 1HQ4A 3S4SB 3TT1L 1MH5A 3U6RA 2IAMA 2ZKHH 2F15A 4CVXB 1J5OL 3IDYC 1TVDA 1IT9H 4DGVH 2V5RA 2XWTB 1MAMH 3S36L 3VD4A 4NC1E 1JGUH 3L1OH 3EYFA 4N0FA 1OSPH 2ZZUT 1IZKA 3HI5H 1TMCB 4O00A 4I3SL 3EDFA 1WAAF 2ADIA 4XWGL 4EDXB 5KSAD 5L7XL 5DSCA 1TZIA 2IALB 4NQUA 2ERJB 1RFDL 1JUFA 3BEWA 4MHHG 5I1IL 2AJXH 5T1MB 4GG6F 1EXUA 2IMMA 4M61A 1FO0B 1AGDB 3ARVA 5KVGL 1IL1A 1EMTL 5L8KB 5MEOA 3CXHK 3U7WL 3V5HA 4P23D 2DOCA 3FO0H 4KK9D 3V7MA 5HDBE 4KJQD 1BF2A 3WIHA 1JWMA 4XBPB 5A43C 4X4XA 1IGFH 4XC3H 3ARQA 1FSKB 5AG9A 3NFPB 3BH8A 5CD3B 3U9UB 4YHNA 2QL1A 3TPUA 3IGAA 4ZTOL 1CDHA 5CINL 5GRUL 1LDSA 4TUJA 4Q9QH 5JO5A 4JZJC 4OI8A 4L9DA 4NNYA 1DN0B 3F6IA 2ZOKA 1LD9B 2R9HC 1TETL 5IROA 4R4FL 2DM2A 2Q7NA 4AH2B 2ADJA 1WEJH 2J5LB 5DRNA 1QSFE 4WV1C 3CJJA 4PLKD 3MJ9L 3IDJA 4JB9L 3T2OA 4EUPG 4MWFB 4PJCB 4Z0XB 1XCTA 3RX5A 3QG6A 4BQ6A 5B39B 5I16B 3S5LG 4N0RA 2PYFA 1BMGA 1RIUH 5KAQG 1NGWA 3D39A 1A64A 1CD1B 3MRNA 3TPKA 1IEBB 1RD6A 5F9OH 4FQLH 1FVDB 3RL2A 4OIIL 3ELAT 4ONFH 3MJ8B 1WWCA 3UTSE 2DD8L 4WFFD 1NMAH 5HYQA 4TVSa 1BVZA 4F7EB 3L95A 2LABA 5DJYB 2ICEB 1LEGA 43C9A 5F6HJ 1OB1A 4LVNB 2ZG3A 1G7JA 2W0KA 2NXZC 3DURA 3TBYB 1RUPL 3DETC 5H8DA 5C09B 4OFIA 3VH8B 2X7LB 3TZVA 5SX4I 1A4KB 4PV9B 4JE4B 5EN2A 5C08D 5GS0L 4NOFA 3QCTL 5B3NA 3MZGB 5JW3H 1ZWIA 2FO4A 3T0EB 2A9MH 5KVFL 3NOIA 4MB3A 3BGMB 1I3VA 3ARRA 4ODXA 4G6AD 5CMAA 2YSSB 3WEXA 4RMSA 4Y4HD 5DSCB 3RTQA 4I2XB 1MCOL 3QNYB 1DFBL 1Q0YH 2DQGH 3IJYB 32C2A 1WC7B 4DOHE 4JY6A 1NMCB 4Y2DA 1KENH 1MCWW 4MMXC 4PY8I 1A3LH 4PJFF 3SDXE 2YPVL 3ARSA 1U36A 2BXZA 2VN7A 1IGML 2GI7A 5B38A 1GZPB 4MXQD 1J8HE 3VFRB 4X6CA 5ERWB 1I9RH 2I5YH 3VWJC 1G7LB 4CJ1A 1AO7B 5M95B 4ZPVB 5C7XH 4U6HB 4QKXB 5HHXL 2VITB 4MA8L 4ORZC 3HZYA 4PJ9A 4NO5A 3HKFA 2HVKB 4KQ3H 4IRJA 3PDOA 4Y7MA 1EFQA 2K3TA 4GAGL 3RVXD 2G9HB 5HGGS 5JW4M 4ZO7A 1AJ7H 4GMTH 2HLAB 4KKLD 3NBNA 4PGEA 4OGAC 3O6LL 2I9LA 1QO3B 1CE6A 4XP9H 2PYFB 3TNMB 1QSFA 4IOIA 3ZHLA 4L4JA 4MS8C 1CVSC 4OQTL 5F3HA 4LF3A 4P57B 4NQTA 4P9HL 3KWWA 5CJOH 5I19H 4QRPE 5DJ2A 4JVUA 3T09A 2V2XA 4Y1AA 5BV7C 5HGBA 4G8GA 1RIHL 4EJ1C 2W0FA 4NC1C 3FO0L 3MRFA 4ZYKA 5FO7A 5MERA 2VMFA 2F8OA 1IKNC 5C3LD 4YHYC 4IHOB 1LO3L 3PQYD 1FORL 3MRHB 2GJZA 5CSBA 1LE9A 5EA0L 4E0RB 4D9LH 1T7ZA 4O2CA 3PQYB 3G6DL 4U1JA 3S5LB 1WCQA 1IEHA 2ORBH 2FBJL 1S78C 5TH2B 3SE9L 4WY7L 5EBGA 2VDPH 1DQQB 2IC2A 2GAZB 4QNPF 3CVIH 1S7SB 5TE6H 2J8UF 5JHLH 4JLRB 2AABH 5DMGC 4GFTB 1F4WL 3STLA 3QXAB 3MO1A 3U0TA 5JQ6H 1FFNB 1K5NA 2IBBA 3MRGB 2UYLB 1CU4L 5F70A 3TM6A 2ED9A 4X9IA 4NWTH 1BX2B 2VTFA 4J1UB 2PYEA 4P5MA 3E8UH 4X6BB 3UPAA 3WL9A 3M45A 5J1SC 2AK1L 3UAJC 5A2FA 4AEHH 4JY6B 3G5ZB 2X4RA 5FV1L 3O2WL 3DGGA 3KXFE 3DV6A 4URTB 4LSTL 3ARBA 4WW2B 3UP1A 5FGBA 1S9XB 3MRDB 1DANU 4S1DC 5DJCB 2DS4A 1CLOH 3FFDA 3Q1SL 2OQJA 5D7LA 2DD8H 1M05A 2VLJE 4MNQB 3RU8L 2MHAB 2ICWI 1DBAL 3U83A 4L3CB 1QPPA 3QG7H 2XTJD 2OJZH 4LNVA 4MJ5B 4MYWB 2DQHL 1TENA 4WUUA 4AL8H 2VYRE 1GAFL 4K3HA 1CQYA 4ZDHA 4E5XA 2CJUL 1FDLL 4XPHH 2BSRB 1IC7L 3GK8H 3EBAA 1AR1D 1CL7L 5H37G 3TO4A 2W9LA 3SQBA 1RHHB 4PRPB 5ETUA 1DLFL 3RPIB 5IW6A 3MUGA 3ZE1F 4NRZB 4B7LA 3MGTB 5HSFA 1KJMA 2NY4D 5SX5K 3VWJB 1U8PA 4RX4D 3AM8C 3GSUB 4LLVA 3RWGA 2FWOB 2OJEA 1SJXA 1GGBH 2EIZB 4IMKA 4NM8H 3AROA 4PRHB 4PJGE 5IVXE 4JDZB 4KI5F 4KROD 2VDQH 2AI0L 5CEZD 4MSWA 5FK9A 4PD4K 1WAAA 4PV8B 3NACH 3BXNB 1MI5D 3TBTA 4U0RB 4C58B 4HIIB 2MKWA 4HPYH 5AAWA 1MI5B 1I1AC 3UMTA 1DLHB 2OTUA 4H25A 4YEEA 4I77H 1JGLL 5HVFB 4L4VA 3MLPA 1RUML 1IEBA 5T5FL 3U7YL 3U4AA 2R23A 4ZMAT 4B50A 1NCAH 4LSSH 4QO1A 1HWGB 5CJ5A 5E8DH 1WSST 5EULV 3UX9B 5LGHH 5JUEL 4F7CA 3GBML 5DVLA 5F9DC 2HWZH 3OB8A 4P48A 3MRLA 3TH3T 1MCFA 2GJ6B 2OTPA 3OKKB 2COQA 3JWOL 3KPQB 1AGBA 5KSUA 5F7FA 1MJ8H 1LEKB 4TVPL 1Q9OB 2VWEE 5DHYB 4GKNB 3SDAC 4ORGB 4PBVC 4NNPH 3GIZH 2KBGA 1AKJA 2BOCA 3TF7C 3BGAA 4GXUN 1OQXA 4EDXA 4J3TA 4LQFL 4U1HA 5FKPA 3F5WA 1GHFL 3GO1H 4KGJA 1FVDA 3K4DA 2IQ9H 1RIUL 1AP2B 2DM4A 1N8ZB 4ELKB 5HYJB 5BS0D 4XTRD 4M48H 3TJEH 2D7PA 4G6JH 3R8BB 3BKCH 5FOBA 4OAWA 4JFQB 4P2OB 1SYVA 4KQ4H 4MJ6A 2MJWA 2QV2A 5DJXB 4BQ8A 5I75C 4UT9L 5CBEA 2FL5B 4RRPA 1FLRL 3LDBB 5C6TH 3IFNH 3FB5A 2D0FA 4POUB 4KRMB 4WI2A 3RWDB 3SE3C 4JANA 3C5ZB 3QCUH 4LSRL 4UIKL 2CIKA 5D93B 4RGNE 3S34L 4LLWB 5C08A 3FZUC 1NDGA 3HNTH 3RWIB 1YMMB 4POZC 2EZ0C 5DMYA 4MAYC 2IPUG 4HGWB 5A2KH 1XIWC 3U82B 2EE3A 1P4BH 3QO0A 4PJGF 3K80A 1BFTA 4BSWB 5C0JB 3HPLA 3ARYA 4U6YB 1VDGA 3EW3B 1N4XL 3WJLA 2IAND 3B9KC 2Z35A 4JM2D 4PRDA 2DQCL 4IM8A 5BV7H 1UWXK 1Q1JL 1U58B 1DQJB 1QG3A 3WDJA 3GSOA 3WUZA 1TITA 1HH9B 1S9VB 2ZCLH 2JCCF 3P4OB 1MCJA 1AXSA 4JFZL 3ARDB 5EOTA 2V5YA 1N3NA 1CCZA 2VITA 1W72B 3EFDL 5HD8C 1AQKL 4M6AA 4LVEA 1X5LA 3BN3B 1AQDA 1R5IB 3GGWA 1YUHB 1VFMA 3CSYA 5JHDD 3VXUD 2JE8A 1FH5L 3C8HA 2E7CA 3N85H 3MACL 4XXDB 2HT3C 2VDRH 1UJTA 4R4NC 1MRCL 2A9NL 2H1PL 4I0PC 2Q20A 4PR5A 2W38A 5ACMA 1QSEB 3PIQB 1G7HA 4DGYL 4S0TD 4NP4L 5DFWH 4IJ3B 5EZJA 1FZKA 3DETD 4LDEB 2B4CC 1NCCL 2IQ9L 4QHNB 5DGRA 2N7AA 1PQZA 4QRPD 2H3NA 2DM7A 3TP4A 3KNBA 2BZDA 4NGHL 5F21B 3A6OA 1Q94A 1RSFA 4EN3C 4UTBL 2ESVE 1K8DA 3T3PF 1T5XA 4AT6B 5FUOL 1XH3B 3ZKXB 2JK5B 4LSSL 5EA0H 4UB0L 5CGTA 4YR6A 3OAZK 3O3EB 3KJ4B 1YN7A 2FIKA 1VADB 4EN3A 1OP3K 1KG0B 2JCCE 4JFDD 2R4SH 4KKBC 5EOCH 4I9WE 1D9KC 2NTSP 3Q3GB 4JFDB 4QTIL 3C09C 3ZYOA 3PDDA 5B39G 5D1QA 4XPGL 1BOYA 3VWKC 4YHOL 3T2QA 1KT2A 3ZDZF 4Y4KC 1LO4L 3WNNA 4JM4H 3V8OA 1RZIA 3EZJB 4NO0A 2IGFL 2BVPA 5K93A 1HHHB 3HAEA 1QNZL 4NQCD 4HFWA 3TVMA 2RCSH 3BEVA 4GRWH 5I6XB 1I3GL 1NAMB 4RSVA 3VFOA 2I9TA 1QACA 5CCKH 3RHWK 1KC5H 2XICA 4NUJB 5TGBB 1SMOA 1RZFL 1G7MA 3R0NA 2QADC 4CBPA 4K2UH 3FT3A 1NGXB 3HZKB 4RWYH 12E8L 4K8RC 1UEYA 4GAJH 1MAKA 1SY6A 3IFLH 5IK3B 3MACH 2ADFL 1TJHH 1MRDL 4ODSH 1S8DA 2BNQB 3O0RH 4PJGB 1NGPH 1A0QL 2WBKA 1DE4B 3VFUB 1U8LB 4MSWB 1KB5L 3HHRB 5IR1B 1ZT1B 2GT9A 4YBLB 4M8QA 4FABL 2QQNH 2V17H 4GO6B 5C07D 5DA4A 4JQVC 3TCXA 3T2PA 3RY6A 5C0EA 3MPCA 1U8OB 3K4AA 4KJYB 2VDNL 4XVUD 3QJFA 4QRRE 1A1NA 3EGSB 1PGRB 1QHPA 1CG9B 1K4DA 1MUJB 3B5HA 4ZTPH 1A6TA 3BSZH 3ZZ1A 1DQDL 2OCFD 5E2VL 3FO2B 4NN6C 5E1AB 4N8VB 4ZOAA 3GBMH 1C1EL 2ZSVB 1NDMB 3OKDA 3MJ7B 3S9DB 1MFEH 4M00A 4F58L 5E8PB 1EX0A 1TNMA 2ESVA 4XAKD 3CSBA 4UDUB 4JR9L 3OF6D 2EECA 4KKAC 2VC2L 4D0CB 2K1MA 2EKJA 3EYFB 4XP1L 4RA3A 4HFWB 1XGPA 2AV7B 1PG7X 3RWHB 4FZ8L 4MDJA 5DMIL 5FYLL 5SWQA 3ZE1E 1VENA 3A67L 2ITCB 2Y7QA 1KN2L 3VMPA 2AJZA 4MX7A 2WK2A 2E7HA 2X9XA 4JRYE 4KMTH 1NFDA 3QDMD 2XPGA 4GRLB 4EXPX 4P57A 3LKOA 1JWMB 2EE6A 1YEDA 3R06B 4NWUH 5GS3A 3I50H 2WQRA 4Y1AE 1RJZA 1GGUA 5CWSA 5AYUH 4GKZB 4YHNB 4RBPK 1KIQA 1SQ2N 4WV1B 4OI9A 2FB4L 2PO6A 25C8L 3T3MF 3DYOA 3GNML 1AXTL 4QTIH 1YY9D 3NCBB 1D7FA 1X9QA 4YGAB 4FTVA 3BQUB 5IJKA 3NFNA 3L3KA 4YHPB 3NIDE 2ED7A 5A3IC 3IRZA 4KTDL 4WHTB 4XHQA 5LAXB 5EFIB 3T0ED 5BMFL 2O5YL 4PLKC 2P24B 4MCYA 5B4MD 5DQ9B 5FKPB 5IIEB 4KWUA 3V8CA 3NA4A 1W0VB 3KS0J 3LMJL 3NCYS 4MWFA 1AO7E 5EC1B 1MCPL 4J2XA 3BP5A 1FL6A 5FF6B 4LPYA 4TSCL 3ET9F 4LCWE 4OAWB 2HN7A 4M4PA 2VDNH 2XKSA 1ZA3B 3TA3C 2GUOA 4XNQA 3QUKA 2XZCH 3MLZL 5E8OA 5EOTB 5K9OB 1E6JL 2AXFB 4YXKH 4X9BA 3V52L 2FD6L 2NY3D 1I3RA 2GK0A 2J7LA 3L3GB 3MV7D 4XHJC 4TRPL 5JQHC 5DEFB 3F6LA 4FABH 3EO0A 3CFEA 1N5AA 1KPRA 5D6DA 1XF5B 4LGSB 4DN4H 1EJOH 3ARDC 5J9PA 3RI5K 4CRPA 3P30H 2VOTA 2WBJD 5JHDE 4LCUB 2HT2D 5GIRB 5HYIA 1EAJA 1KXQE 5CD5D 1JNHB 2QHLA 5D6DC 5LGKA 1KYOJ 3K8MA 3SY0B 4UOJA 4K8RH 1ZEAH 4RMVA 1VHPA 1MQKH 1R3HB 4XAWH 2Z31A 5T1MA 3V6ZB 4O58L 2ZOKB 3IKCA 2Z93B 3JV4A 2J3SA 1FFPA 3Q6FA 2NXYC 1CFQA 1WBYB 4OGYL 4ZODA 1KJMB 3FQXB 2EC8A 4KDWA 1S5HA 3VRJB 1U3HC 5I8OH 5ILTL 1FVEA 1CDIA 2YRLA 3DI3B 3A6BL 1EH9A 5I1JL 4G6KH 1G6RL 1C5BL 2QADD 5ANME 5T1KD 3SDCC 5ESVB 2HJFB 5F7EH 1MLBA 3JBG7 3HS0B 3QQ9D 5FYLD 3BVNA 2CUMA 5DI8A 1TLKA 4NQXB 4IIQA 5FHBH 5I1GH 1ONQB 3UROR 3P40A 2XV6B 1PJ9A 4YEFA 4I0CC 4W6XB 3HZVB 3VMNA 1KT2B 4NBZB 1LK3L 2XI9A 3W9EA 2X10A 2QSQA 3X3GH 2VXSL 4N0CC 1TXKA 4HFUH 4Y5YA 3D9AL 3T0EC 3BE1L 3WN5A 1EEQA 4M7LT 1JI2A 3RBSA 2XN9B 3NTCL 4LU5L 4OZGE 1I9EA 2C4XA 4RQQA 1BREA 1B88A 2VR4A 4RFNC 1CT8B 4D94A 5T33L 2OP4L 5TFSH 2X70B 1LE5B 1G9NL 4M4RA 3LKNB 5D2NB 4RMUA 1H3PH 2OS7A 4O2EA 4XPAH 1GCFA 4NHUB 3BFOA 5C0IB 1A47A 4UAOB 1G0YR 2BCKA 4AMKL 1K8IB 1J9CT 1QLRA 3V6FB 3UYPA 1WEJL 4GRWE 2I26N 1NCNA 4JKLA 4TUKH 2IMNA 3SCMD 3EYUL 5C0BA 3CH8A 5ID0B 1EO8H 4I2XA 5I2IA 3LQAL 1ZLUK 1EGJH 2NTFA 4LHUB 4OZIB 1RIHH 5D5MB 5MENE 5EG6C 3QYCA 3KPOB 3PL6A 2ITDA 5DD0H 3PP4H 1A0QH 5EU6E 1LO4H 3MJ7A 2EIEA 1A8JH 1UCBH 2D2OA 1QO3A 4GKSA 1MOEA 3L5XH 1YQVL 1E27B 3EJYD 3SGDH 3DMMB 1J0ZA 1XGUB 4U33A 1Z0MA 1O7SA 2OZ4L 3EYVA 3AFLA 4MD4B 4HWZB 2XWBB 5D7LB 4ZG1A 1N5YL 1A1MB 3F8UB 1T6VN 3OX8A 1CGXA 3QIUD 3D0VB 3BPLB 4JFHE 2BVTA 3CLFL 5F89B 1N59A 4CMHC 5ABDE 1RZFH 2Q86B 1RZJH 1OWWA 1YECH 3JWDL 1CTOA 5E00A 4F57H 2XTLA 1EZVY 1ROWA 1MF2H 3OKEB 3IFOA 3OJMB 1DBBL 3Q5OA 4XNXL 2D7NA 3CFJB 4MAYA 1IEAB 3VCLB 4EVNA 5KTEH 3RBGA 1F90H 5D9SB 3L3HA 4EI5B 3MGTA 3GHEL 5KG9B 2Z8VC 3IDNA 3QJHB 2VH5H 5DJZA 1E4XL 1UACL 4NPYB 1R3IL 5C92A 3PWUA 2IEPA 1E4XI 1CR9L 5IEKA 3ZO0A 2FLRT 2FHFA 3QZWB 1JK8A 4WGVB 1HQRA 4W4OA 5IB3A 1MPAH 1JZ7A 4OF7A 3ZYZA 4JPKL 1I8KB 3QUYD 4X8JA 5HHNB 5SWZA 3EGSA 1MIMH 1OTUC 5DC9B 4IRSC 1IMHC 2Z92B 4QWWD 5TDPB 3QUYB 4ZAKD 3FO2A 4FQCL 5JOPE 2DI9A 3ALPA 4NRXB 2HLFD 4WWKA 5KS9A 1M71B 3CMGA 4F80A 1INDH 1P7KA 4JPVH 3FT4B 3NFNB 1HOCB 5T1KA 3L3JA 3DGGB 1U8MB 3NCJL 4LARH 4WU7A 4ETQB 2B20A 5DJ0B 1YN6B 1OAQH 4XBEL 4F58H 4XPAL 2XG4A 3BP4A 4ODHL 4XCFH 4ZAKC 3GSQB 1HKFA 3HA0A 3I2CL 1RJYB 4D0CA 5F7NC 3G5YA 1MELA 1A4JB 2HMIC 3RZCB 4QXWA 5DJ8B 3P77A 3TIEA 3IJSA 2AEIT 1PZ5A 4ONGL 1HSAA 1IGCH 2X1OA 1YJDC 1TTUA 4EKXA 3QIWD 3QDGE 1T89A 3STBA 5CAYB 3QUMA 3RGVC 4WI3A 3RKDC 1PY4A 1KJ3L 4HULB 2HLAA 3RVTC 4UQ3A 1KLUA 1AGEA 1FZOA 2AABL 5E00B 1JYWA 3FRPA 2FJGA 1S5HB 3MRMA 4PRPA 1WCBA 2YEZA 2Z91A 2PO6B 2F5AL 1I1AD 3QH3B 1JPFB 4JFXA 4LEXL 3LIZL 1YA5A 3E8UL 1KFAH 3EOBA 4TNVF 2GYSA 4Z76B 3TYGL 1KJ2B 3VXQB 3JTSA 1GZQA 3B43A 1NSNL 5IQ9A 4M5ZL 2RR3A 1JPST 3C5SB 3K2UL 3I6KB 4OCYL 4PG9A 1WUNT 3KPRE 4O02L 3BXNA 3AAZA 1UQSA 1U8IA 4I18B 3M1BA 2ZCKL 1NCBL 2R1XA 5ALBH 5BVJB 3I3EA 3MR9B 3H7BA 3VI4F 5JXAH 1CR9H 5BO1L 1JGUL 3L1OL 2CMRH 4XPBL 3U1SL 1H3WM 5F9WC 3M8OL 1ZHNB 1F6AB 1VFUA 5D1ZD 4GT7A 2XZAH 2AW2A 5GRJH 2VZOA 3HE6D 3MOAH 3LQZB 4WW1A 1QHOA 1WC7A 1T5WA 2BHYA 3UBXG 2EDBA 5D1ZB 1U93B 3QCUL 4PRIB 2ZNWA 5F72S 2YHGA 1QUNA 3UJTL 3VXRD 1FL3B 3AVEA 1OQOA 4JG1L 4OF3A 4R2GB 5DD3H 1T0PB 3CFCH 2WUBH 4J1UA 1O5DT 4NBXB 4M3JA 3SJVE 3U7AA 3W2DH 4JM2F 4RRPG 1Z0NA 5LG1A 5FM5M 3ULUL 3IU4H 3O6KL 5FYLE 1H5BA 2AXHA 1TZGL 1V7NH 2CK0H 4XCYB 1VGEH 3JWDC 3SDDD 2HFEB 4N1CA 3WLWC 5IUSA 4P3CL 4M02A 3D5OF 1A6ZB 5EZIH 4Z7UF 4MNQA 1MIML 1YZZA 5JIIA 2GSIA 4GUPB 3L3OB 2BVQB 3T0XA 5FYJU 3CCHB 1P7QA 3NGBC 5ID0A 4L8CB 2JCCA 3D9AH 3O6FB 4U49A 4DGIL 4MAYD 5CP7A 5DC0A 1J86A 3FRUB 3WDIA 2OYPA 4HSQA 4NDMB 3D85A 3IDGA 2XN9E 3KPSB 3QUMB 3DV4A 3G5XB 4JZJB 4OLWH 3GMOA 2MPAL 2HFGH 5D72H 4K7PX 3LQAC 1HILA 5C0AA 2IADA 1FYTA 2PNDA 4L8DB 2WWKT 5E8EB 2ZG1A 4P59L 3PL6D 2A9NH 3QI9D 3V95A 3F7PC 3MXVH 3MLWH 5CP3A 3GUTB 3QHTC 3JWOH 3DO3A 4R4FH 5DQJA 3O3EA 3LEYH 3G04A 2BVUA 4FTVE 2X41A 3SKNB 1J1XL 3SQOL 2Y5TA 1T1ZA 5DEGB 4KVCL 4LLDA 2Q7YA 5F96H 2Q86A 3OAUH 4BSWA 3R06A 3ZTJG 3GSWA 3V9FA 3DPBA 1UQSB 3KPOA 4YHMH 4XP6L 4MDIA 5BS0E 1MVFA 1OP5K 2DL2A 5I1CL 5IM7A 1BBJB 4NQDD 5ALCH 5IW6B 2E7LC 2VLME 3DUUB 4KRPD 1JL8A 3VGAB 4R4BB 4XNUH 5H2BB 1FQ9C 1OHQA 2MWCA 4M9PA 3BPNC 4LOUD 4HC1A 5IVXB 4MLSA 4MA7L 5HGDA 4JO3H 1A7QL 4M7ZB 5C07B 1V05A 1CLOL 4YFLI 1BGXL 2OBGA 5IB4B 1MCHA 2E9JA 4C57C 1JBJA 1F58L 4JPIB 1C16A 1YMHA 5DJCA 3W0WE 1JYVA 2MCPH 5D2NA 5GSRA 4PRPD 1G7QB 5CEXA 4UV7H 5EU7C 5KS9F 4Y19D 2F54D 1LO0L 4MQ7B 2DQIH 3T0WA 2NY4B 2WWMD 1FG2B 2CIIA 2CK0L 1Z5LA 1GC1C 1WQVT 2F54B 3QR2A 2HFEA 4LSPH 1AP2A 1WICA 2Z31C 1KG0A 2NY7H 4L1DA 1IEAA 3VCLA 4YHYB 4H0GA 5I2IB 1J1OL 1H15B 5DJAB 1LVEA 4JG1H 3MCKB 2DQTL 2IANE 5DD3L 1M7IA 2H32H 5IGXH 1B0WA 4MNQE 5KSAC 3KXFA 4JG0L 4NRXA 3VG9B 4FS0A 2HT3D 3ARWA 4Y4HC 3TLRA 3SO3B 2ATKB 4RX4A 2Q8AH 3BIBX 5DD0L 3B2UD 1BBDL 1KGCD 5JPNA 4YK4B 3LRGA 4OZFH 1V5JA 3EDDA 4CN4A 4PS4H 3U6RB 3D85B 3BJLA 1P9MC 1TQBB 2I5YL 2FYYA 1PG7W 4XP9L 1OAXH 4X7TA 4S11A 1NCUA 5C0NC 2FJFA 2C1OA 3OKMA 3TO2A 4NN6B 2HVJA 4HWBL 5CZVH 2IQAB 1FNGB 3MOQA 1XR8B 3B3IB 1A3LL 3GMLA 4XP4H 3HNSL 3EHBC 3RNKA 1HKLL 1OAKL 3BZDA 4C56A 5BVPH 5DRZA 2OK0L 3ULUH 2ZWLT 2Y36L 4JFDA 1I9JL 4NNXA 8FABA 1MCWM 3SE9H 1JHTB 4NO3A 5JZ7D 3GSWB 3JV5A 1E4KA 3OAUL 5F97E 5KVDL 3I3DA 3X11B 2ZG2A 1DQML 3PJSB 3WE6B 3F12A 2QQLL 4AENA 2CKBA 2BVOB 4P4RA 4XMKH 1BLNA 3W5NA 3I6GB 1MJ8L 2UVEA 5D9SA 3BISA 1GXEA 4WHYG 1ZTXL 5B3JE 3PWLA 2GQHA 5BRZE 3CFDB 5E4IA 3WSQL 5I1LB 1KCSH 5IOPA 3IJSB 1WT5A 5K9JL 3VFUA 3WKNA 5HYSB 1YUHA 5D7KE 2NW3A 5DVKA 3GFUA 4WRLA 4X7FC 2HRLA 4HUXB 2FATL 3NIDF 2ZOLA 3WYRA 1ACZA 4PJ5D 1PYWB 4FXKA 2MFNA 4UT7H 3WFCL 2V5TA 1NGWB 3D39B 3ULUC 4XWOD 1LO3H 1R3LA 4G9DB 4C83A 4G8FB 4N90E 4QRPA 2HFTA 1NH6A 1P4LB 2ICWJ 1G9ML 5AWNL 5EUOE 2AVGA 1RJLB 1GZQB 3RWDA 3BIKB 4S0SD 1QFOA 3DVGA 3DX8A 4DKEL 2R1YB 3UTZB 2D0GA 5ENWB 1BPVA 4WO4C 3RU8H 3HRZB 4MQXC 5FYJH 2J6EL 1CLZL 3MXWL 5LCVH 5SV4A 4MQTB 4F9LA 1NBZB 4NQEB 4PJ7F 4QRSA 3TWCH 4LLAA 1WJ3A 4NCC1 1RZGA 4P9HC 4UILH 4U6YA 4ZFOB 1E4WH 4K2UL 2OSLB 4JRXD 4MXQC 2Q3AA 1OAKH 4ZNCD 25C8H 1CFSA 4B5EA 4YDJA 1CL7H 4WO4D 1DBKL 2NNAA 4YH6A 1K8DB 1VA9A 1QQDB 3WNMA 5GS0H 3A0OA 4ZDHB 4ISVB 1JPTH 3TPUB 4U3XA 3VXOB 3RL2B 3MV9D 3IAQA 2A6KA 2A6DA 2FH8A 4MB5A 1GAFH 1LMKA 2DKUA 4GQPH 2CKBB 3MA9L 4C59B 5F7DA 4Z76A 2W9EH 5HHMB 5CBAB 5JPMB 3DVFA 5GIRA 3KYMB 3BH9B 4JG0H 4AJ0A 4DKDC 5EU4A 5FHAL 4LLVB 4UUJA 2OK0H 4OLEA 2ATPA 2ADJB 2CKNA 3KYNB 1ZLSL 4BKLA 4HIXL 4DGYH 4TVPH 4GAFB 1XR9A 3JVGC 2UY7A 2DIJA 2Q7YB 4NFDA 2XTJE 1EV2E 2VDML 4G6KL 3V0WH 4Y88A 5F88B 1LK2A 1Y0LB 1IGYA 4I13B 3ZL4L 3KPTA 2XN9D 5C0GB 5DJ6A 1MI5A 4KXZI 1RAMA 4EIZC 5FO8B 1JPSL 1J0JA 4LDLB 2PR4L 3MLUH 3VD9A 5IVXA 4WV1A 5DHVH 4LF3B 1CE1L 1FYTD 2VIRB 1CK0H 1YEIH 4LBEB 3CMOH 5ANMA 1UXWA 2NMSA 3NH7H 4HIHA 3FL7A 3KDMB 4G42B 4Y4KB 4K55A 5E9DA 4PJAA 2VXQL 4OZ4B 2NW2A 4NYLB 5C9KA 1A7PL 5GS0C 3BKYL 2H2PC 1N0LA 5C2BH 3KYAA 1LE9B 5L9DH 3ESUF 3LB6C 1NKOA 4PREA 3WO4B 2XQYK 1FIEA 1HHGA 2DWEB 3EOTL 5KVEH 5EOQH 4HMEA 5DURB 1CXHA 4X6FA 2GAZA 4DEPB 1ZT4B 5H2BA 4NQDE 4ZUVA 3QEGH 1YEFL 3IJYA 3O41B 2HLFC 1I8IB 1T4KB 5F1OB 2XFXB 4WI6A 3B9KA 3RHWF 4J6RL 4IDJL 1L9NA 2GHWB 3ZKXC 1NMBH 4EN3D 3QEQE 2H9GA 1H3PL 3HCVB 2KQNA 4OGXL 5IB4A 1S9YB 5T5NG 3VWJD 4IRSD 5C0RL 4OSUL 3KLDA 1QR1B 3EO0B 3MNVA 2Y5EA 2DIAA 1QLFA 5EBMB 5D72L 2IH1A 4PTTA 3KHOA 2ZUQC 2XXCB 4G8GD 1Z5LB 3VFOB 3ROOB 4IJ3C 5E2TH 1L0QA 4QYOB 3FFCA 4XGZA 2YC1B 1IL1B 1KB5B 4R7NA 2VLLB 3RJQB 2AQ3A 5C6TL 3CDGA 2NY2C 3FTGA 4N9GB 1QOKA 5HJ3A 3BVNB 1C5CL 1JGVL 3FT3B 4QHKI 4JREB 1FBIL 1IC5L 4ODSL 3U2SB 4X4ME 5C6PB 4JFEB 5HYFA 4HIXH 3VFMB 1I7TA 1YNLH 3U9PH 3QPQC 4KQ4L 4JFED 4TULL 5CWSB 2ARJA 3MFFB 1RUQH 4FOMA 3TO4B 1KB5H 3RX8A 3MA9H 2DI7A 2B5IC 3SGEI 1XR8A 3B3IA 4OZGB 1FGNL 1A7OL 4HCRH 1U8IB 4MJID 3VFPA 1MF2L 1XF3A 5SWSD 3TIDA 1TDQA 3PWNB 1ACYH 4G42A 4UV7L 1MRCH 4BFBD 1ADQL 1BQLL 3PWJA 1OGAB 3D25A 1QFWL 4NIKB 4NSKA 3DXAA 1BFSA 1R3JA 4CN1A 4Q9BA 3CSYB 5FYKH 3CU7A 2AAVA 3CFBB 5DFTA 1IARB 3QUXB 1BQHA 4FFVD 4LKCB 2GITB 1YJDH 4F7EA 4N8CH 4JRWA 1H3VA 3PNWA 4C56E 4LSQL 2NX5A 2R4SL 4ELME 4N0UB 4YXHH 5IGXL 5K9OA 3LEVL 3CIQA 5CD5C 5DK3A 3C5ZC 3GMRA 2Q8BH 3C5ZD 2NXZB 3P3YA 4KHXH 3RZCC 1AI1H 2B4CH 5D7JC 3LV3A 3VFGH 4NZRL 4XZUA 4YHOH 2NY0C 1J8HA 1NBYA 2CDEB 3BDYL 1YMMD 4Y16A 4WVRA 4CGTA 2J8UE 4KPHH 4XCCH 5E6IC 4HUKB 3MBEC 3MUGB 4OSUH 2BC4A 4KJWD 5DK2A 1YY8B 5IP4A 1X7QA 4FA8A 3ZTNL 2VDLH 4F57L 4IMLA 3H3KA 4XCEB 2QJDA 4MJ4A 3VXPA 4PJ7B 4G43B 1A6WL 1MAML 2M26A 1JZ2A 5BXFA 5JNYA 3H9SE 3THMH 2NLJB 5I0ZA 2IANB 5J6HB 3N85L 3WD5L 5IBLC 4O4YL 2GUOB 1NAMH 4XNQB 5IV2B 1QYGH 1JZ6A 3UCRA 4OFPA 5I1IH 4N9GA 4GW5A 3FFCE 1EEZA 2M2DA 2Z8WC 4LHUA 4OZIA 3DROA 3PWVB 1CYGA 1DLHA 3PP3K 3EJJX 1D5IH 3HUJA 1W0WB 3C60C 4CVZB 1F97A 4JRXA 3L5HA 1KELH 4WENB 2L7UA 4TOYH 1YPZA 3P4LA 4DJMA 3B6SA 1UH2A 4J6RH 1T1WB 4FQ2H 4H20H 4I8DA 5DR5H 2GJ6A 4NJ9H 2XZQH 2X1WL 2DAVA 2NXYB 3JZ7A 3EYSL 3LN4A 4LHUG 4JVPA 4FQCH 1QSVA 1RZ8B 3LRHA 1NAMA 3D69A 4PJHB 2JTDA 1ZANH 1Y6MR 1AKJB 3ARGB 3KPPA 4KK9C 1MJJB 4JY5H 1CFVL 3AXLB 3MRCB 3MUZ1 2C4FT 3VFTA 3LD8C 2LVCA 5TDOB 2DQEH 5CLTA 4GQ9H 3MODH 3KPLA 5J89A 1SHMA 5EOCJ 1G7IB 4FQLL 3BPLC 4LLMA 3GB7B 3NA9H 4G6ML 3U36A 3V0AC 5F1KC 3IT8D 3QDAA 2I27N 5T5NF 3AREC 4MQ7A 5JXAL 2VWEC 3BP6A 3WS3B 3GIVB 1P7KB 1WT5C 3QDGA 4O5LH 4M93B 1N7ML 3UTZA 2X70A 3V0VB 4NQCE 1YYLH 2HT4C 1QFWH 1V3MA 5CS7A 2WIIA 5FECB 3IF1A 3UZQA 1RVFH 1P4IH 1DSFL 5DMKA 1KC5L 3SPVA 4PY8J 3CDFA 2VZTA 2XRAH 4C54A 4MJIA 3F7VA 3EO1B 1A5FL 4Q9RH 4FMKA 1QSEA 1EFXB 1QVOB 4Z0BH 4OGYH 4X83A 5FOBB 1NANI 1EFXD 1RZJC 2HRPL 2VAAB 2CQVA 4GAJL 3SKMA 3N1MC 4M61B 3CGTA 1MJ7L 3I3BA 5FB8B 4CU8A 1AI1L 4GG6A 2FYYB 2CDFA 3WXWL 2J12B 3KDMA 1KXTB 2ZNXA 4XVSH 1FVEB 3ARPA 4PTUB 4K7FA 5F1NA 5E95B 1V3KA 3GMMB 3VFVA 1JPTL 3UEZA 2OQJB 3TJHD 4LCCA 4XMLL 2Y23A 5EBMA 3KLSA 1YN6A 1OT1A 3QXUA 4XCYA 1ZOXA 5FHBL 5LXGH 4LLYA 5D7JB 1UG9A 1NDGB 5GZND 4PBWD 5C07E 1K2DA 3MROB 2PXYD 1CDUA 2VLLA 3GJFH 1LK3H 1BWWA 2JB6B 4RFOL 2IJ0C 2IG2H 2FH6A 4MAUL 4OLWL 4U2YA 1JTTA 5A1AA 5IQ9B 4QRRB 5IMOB 2MOVA 2P46B 3H42L 2B0SL 4PRNB 4TSBH 4DKAA 4QRRD 1T6WA 5LQBH 4KPHL 4XCCL 3U2SA 3UPRA 1CN4A 1IM9D 4BH7B 3B83A 3VU2A 1GRWA 4HXAL 1CDYA 4OF5A 4KY1L 2FWOA 4FZ8H 3NABL 1OAZH 1PSKH 3GMPA 4K3DL 3VXSE 1AE6L 1QEWA 4NRYA 5E7BA 4CJ0A 3KPLB 4XGZB 5FXCH 4MA1C 1UXWB 4Y16D 3O8XB 3QEHA 4X4MA 4DAGL 4CDHA 5MEPB 3T2NH 3L7EB 1WWWX 1QFWI 2FX7H 3D1MC 5KSAB 1F3JA 4U3HA 5JXEA 3DTXB 1C7TA 3BQUA 3PWJB 4Q6YA 3D0LA 3ARFA 1ED3A 1Y6KR 4D9LL 3TN0A 2NR6C 1Y18B 4WHTA 4MQXD 4KROB 1OD7A 3A67H 3PIQA 4X4YB 1RHFA 5EU3B 1ULVA 3ZTJH 2X4UB 3HG1A 5IKCB 3LQZA 4JFEE 4RGNB 4WW1B 4HKBA 4IBLT 4R0LB 2CRZA 4KZEL 1P7QB 3L3HB 1RUQL 1EHLL 2PTTA 4YFLF 2O5YH 3BOVA 2YKLL 3MLXH 2ID5A 5KS9B 3T1WA 1A7RH 2EEAA 1NGYA 4P99A 1I1FA 3R0MA 3K1KC 1T2QH 1XF4A 1EAPB 4GG6B 2IH3B 3HMXL 4MD5A 3GNMH 4I48B 5FUCE 4OCRL 3DX6A 3WHXB 4JPIA 4EXKA 3KYKL 4MGXA 1ZLWK 4F2MA 2XQBH 4NN5C 1SBBA 4Z5RB 1D5BA 2J2ZA 3CSPA 3QB7C 5DTFB 5CGMA 3OKNA 3QIWA 1KEML 3T4AA 2JB5H 4XNUL 5DQJB 4Z7UA 4C55A 4U6HA 2CH8A 3BYTA 3RZWA 1QQDA 3MV9A 2DLHA 4ZQKA 4FG6C 1HDMB 1T0MB 3FB6A 3FZUD 1HHIA 1VPOH 3BGFC 3MGOA 4WU7B 4ETQA 3MLTA 4U1IA 4TTDC 1BD2D 1NUNB 5DJDA 1OWRM 2DQJH 4LEOA 2GTWB 3U7WH 3Q5YA 4JPWL 4M7KL 5HDLA 5LXGL 5EBWA 1P69B 3KYMA 1QZ1A 4PJEF 4M6ML 4RDQF 1JF1B 4YDLC 5T3XL 1I7RB 3K4ZA 2BNRE 1J11A 2UWEE 5C8JA 2FJFB 4PJCE 1B0RB 4QXTB 2V2XB 4RWYL 5DDHB 1OSZB 1I8KA 2VSCA 1FPTH 1RZ8A 3C6LC 3P9MB 4P2CG 3RQ3A 3PWPE 4MA3B 4A6YA 4PJDF 2X09A 1KCRL 1S7RB 1HSBB 3VH8G 2F74A 2Y4SA 3QNZB 3D87B 4YGVB 3D0LB 4NKIL 1I4FB 1FGVH 1ZK9A 3BMVA 4M43H 3S3JA 1UENA 2EDRA 3QFJD 3L95B 1KPUA 1KIQB 1MLCB 3K8LA 4IRZL 2BOBB 4D8PB 3OKOB 2RFXA 1ZE3C 4KRLB 3GM8A 4FP8H 3GIZL 4UT7L 4P5MB 5GSRB 2PETA 4I3GA 4YIQB 4KI5D 3VH8A 2R0WL 4N9OB 5BVJA 4Z77A 3O3DB 4PJ9D 3I50L 1ND0B 4HUMB 5FECA 2DF3A 2CLRA 1DVFC 1PSKL 2XKNA 2NLJA 1G7PA 5D6CA 4D9QD 3QRFM 3LKNA 2W9DH 5EC1A 5FYJD 3GSNA 1D5BB 3S37L 4PLNC 2X4PA 2MHAA 1X5FA 3V5HB 5I1DA 2HJKB 1IQWL 3GB7A 5F44A 4HKZA 4ZFGH 3DROB 2A9ML 4WU5A 5HGHA 4BSVA 1JHKL 5TE4L 1F4YH 4PJFB 3RAJH 2YD8A 4BZYA 1YECL 3P73A 5EORH 1SEQH 3NZHL 4G6MH 4L8BB 5J57B 1YEJH 4HWNA 3T1FA 1X5KA 1RJCA 4JKMA 1JHTA 2DM3A 1OAUL 4PV9A 3JV6B 3REVA 2CO6B 2B2XH 4U7MA 4GBXB 2EDOA 1OGTB 3C5JA 4NQEE 3JTSB 5F9OL 3L7FB 1N5YH 1AO7A 3AUVA 1H5BC 1BZ7A 4Q9CA 1NUGA 3C9NA 1A5FH 1A02N 4Q9RL 3MYJB 5IT2H 5I66A 4MD4A 2Y7QB 3GKZA 4BM7A 1IAKB 3BO8B 2MCG1 2G75A 1CDBA 3KR3L 2NY2B 3VWKB 4XNZB 3Q6FB 4NM4H 1X5HA 3QIBD 1SJEB 4PJ8C 4OFKA 4RGMC 3TVMC 5ID1A 1DZBA 2NY2D 4OI7A 1I7UA 3FB8A 4OUUB 1LP9B 3X11A 1CE6B 2YUWA 3BD4A 5GISH 5H35B 1FYTB 3V4VL 1A7NL 1DL7H 3MLYH 4WEUD 1C5DB 3EFFA 4XMLH 3VXOA 4QTHA 2C26A 1IM9A 1JWUA 1J5OH 5IG7B 2DRUA 5GSVB 4JDTH 4FN0A 2P8MA 4Q6IA 3O8XA 1IAIL 1MLBB 2IBZX 2D31B 1RZKL 4CNIA 4AIOA 1DJSA 3VXNB 3N1GC 4PJDE 4EOWH 5DJZB 5INDB 2ARWA 4J23A 1OCWL 4LSVH 3P4NA 4PD4J 3CCHA 2R2HB 5SX5H 3BPOB 4PGEB 2VXUL 1CE1H 4LASH 2YWYA 5HY9B 1NCCH 4U1KB 2HN7B 4XC1L 3AS3A 1JJUA 3SDXB 4WI4A 3VGEA 3LY6A 2LU3A 4R8WL 4NDMA 1WBZA 5L9DL 2ERJC 2CDEA 2XN9A 2VKWA 3HI5L 5IW1A 2FBOJ 2CR6A 1RY7B 1R5WA 3BIKA 1DQMH 1YC7A 4I0PD 3GHBH 3BZ4B 1M71A 4KRPB 3HUJE 2NW2B 2GY7B 2VH5L 4U7SA 4G9FD 5AD0B 5BZDB 5T1LA 2IF7A 4Y2DC 3JV6A 5GPRA 2B5IB 2J4WH 4LEXH 4W4NA 2R39A 4GRLC 5I76A 1NBZA 3RNKB 1JVKA 4GW5B 1JYNA 1IAOB 3B9AA 4PJEA 2H6PB 3SDYL 1FNFA 3MRGA 3HMXA 4CMMB 4MZ2A 4PJ5E 5IVXF 2CLVA 3ZSSA 5ILTH 3C9NB 4MDIB 2YK1L 5GGTL 4I0KA 1RULH 1WBYA 5EORL 4CU7A 3B9KB 4ZNEA 1T1XA 4FNLH 4LRIA 5GJTL 2BSSB 3QFJA 4MA7H 4L4TD 2IGFH 4IOIB 4WGWB 3B9KD 3IU3A 2QQKH 3FQWB 3K46A 2BY3A 4K3EH 3BPCA 4ONGH 2D4FA 3I6GA 1UM4L 3L3DA 3X14A 5CEZL 2DB8A 5ICXB 4K71C 3BUTA 3O4LB 5INCB 5IFHH 5MERB 3V4VH 4PRHA 2WLYA 3FOMB 3LHPH 5C0FA 1FO0H 4YAQB 3ECBA 1KEGL 3P11L 4JFHD 4XWOC 3KJ6L 4EI6A 3QULA 2YC1A 4JJ5A 4KHTH 4TNWF 2I24N 3AY4A 1YEJL 2B39A 4MXWL 4OFYA 1IAIH 5IF0A 1KJ2A 2EYRB 1RMFH 4PFEA 2AQ1A 3LKOB 3U1SH 4BQCA 4Z7VA 1U0QA 4FFZH 1S7SA 5HD8D 4LAQL 5FDWA 1YPZE 5ICYA 3KVQA 5IJKC 4G9DA 1R3LB 2H32B 4U3CA 5FFLA 1H3UA 2J88H 4OLZL 1GOHA 2KUTA 3FQRB 5KSBE 5GGUA 4LP4A 4LP5A 5CKAA 2YA1A 3O4LE 1E6OH 3P0YL 3QO1B 5IT2L 5E2TL