4LLYA

Crystal structure of pertuzumab clambda fab with variable and constant domain redesigns (vrd2 and crd2) at 1.6a
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
220
structure length
220
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFTDYTMDWVRKAPGKGLEWVADVNPNSGGSIYNQEFKGRFTLSVDRSKNTLYLQMNSLRAEDTAVYYCARNLGPSFYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVATGPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mutated Pertuzumab Fab heavy chain
publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 48
structure length 220
sequence length 220
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llyA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llyA01
4ZTPH 2F8VA 3KYNA 1XF4B 3QXWA 4UNTA 3MNZA 3ECBA 4NOBA 3FCTA 3QDGE 4QLRA 4XPTH 2J5LB 2H3NB 4Y4HA 2R0LH 5MENE 2N1KA 3C8DA 3BIKB 5IK3A 3DSFH 2FEDC 4XXDB 3VCLA 4JO4L 2YUVA 1FFNB 3RJDA 4CADA 2HAZA 2VE6B 3BPNC 2X05A 3BYTA 4YHNA 4GRWB 4ZPTB 2JK5B 4ZTOH 3QHFL 4ZFOA 5IUSA 5E24E 1VPOL 2W0FA 3L6FB 5T5FL 4K3EH 5F21B 1BJ8A 3O8XB 1E6OL 1EVTC 2V17L 4NPYB 4G42A 1KSRA 1KCSH 4GUPB 4NQTA 1ZHNB 3QA3A 3FB7A 1E4KA 4F8TA 4NQCD 2L7UA 1TNNA 1UCBH 1UGNA 2Z31A 4XRCB 3ZE0F 1RJLB 4LMQE 2RGSA 3IKCA 1I9JH 4PJ7A 3BKJH 1CGYA 3DRQA 3GRWL 4NJAL 4ERSL 3MOBL 3EO0A 3UZEA 3K74B 5C0GA 2PW1B 4R4FL 4LASL 1MEXL 1VACB 3O6FB 3RQ3A 2H32A 4NO0D 1CCZA 4ZAKC 5TDOA 3KR3L 3FOMB 1GHFL 3DROB 3WDJA 1NCUA 3SKOB 1Q72L 3O4LA 1NEZA 3IJSA 4YGVA 3QUXD 4QTIH 1T7ZA 4QRQA 3QQ3B 1ZVSA 1UWGL 5J3HD 1S9YB 1DP0A 4HH9A 5HJ3B 1DFBH 2A83A 3STLA 3EJZC 4E0RA 2O26U 5HYSG 3PWUA 2P49B 1CLYL 3CAFA 2P24B 5DJZA 3LRSA 3K4ZA 1F58L 1Z9SA 4YAQB 4AZ8A 3HLAB 3U9PL 1OD9A 4LPXA 4LLAA 4HFUL 1BFSA 3NAAH 1N6QH 3PGDB 1A64A 2YKLH 1DQJB 1A2YA 5DJ6A 3SDDB 3DX6A 4Z7UB 3VGHA 2AK1L 1FGVH 2IWGA 4M6OH 1FRGH 3ULVC 4R6UA 5D7JB 5FYKD 1WTLA 4G6JL 1DEEA 4CU6A 3EDFA 2QQLL 2VR9A 2EDXA 5LBSL 1E4XI 3QUZD 5I71C 2ADIB 4GAJL 4P3CL 5I1DA 4MS8C 43CAB 4L8BB 4QOKE 1ONQA 5GGSY 2V9TA 1D5ZB 3ARFA 3MRGB 3OAUH 4I5BB 1JPSL 3WUWG 3H3KA 4CW1B 5FO8B 1FG2B 1OAKH 4OZFH 1CICA 2HVJB 3JWDL 1YC7A 4AJ0A 1JK8A 3FQXB 2HLAB 4WWID 4MWFA 1BGXL 4IRJC 3HC4L 2H6PB 2IBZY 3UO1L 3RIFK 2AJZB 1MFDH 5TE7H 2BNUA 4R2GB 1J88A 3SE8L 4N8CL 2ZOKA 2AXJA 3RWEB 1PG7L 5F3HB 1RZKH 4PJFB 1KIUA 5GS2H 2APBA 4HWEL 4GSDH 4ZQKB 2HKFH 4RFOH 1R3JB 5D9SB 5IB4B 2PYEB 4WJ5A 1YYLH 2JIXD 3W0WB 4WFEE 1U2HA 4LPUA 4N0YL 2JF1A 1DSFH 4HF5H 4EN3A 2X4SA 2BVOA 3CCHA 4PTTB 4TVSa 2JLLA 3IFNL 3ILPB 4PGEB 2ITCA 5T3ZD 3MLVH 4EUPA 1CE1H 2VLJD 4F80A 5DUML 1Z3GL 2DJ4A 5FYJU 4IBLT 2AJVH 5JZ7D 3OZ9H 3CDGA 1E6JL 1AGBB 4WDIB 2W9DL 2KDGA 3MV01 3VGEA 4P2YA 4I2XE 2ITDA 1T1WA 5KSAD 1FN4B 4LHUD 3VXMB 4JRYD 1K6QH 3FB6A 3KPSA 1BVKA 1FV1B 3QEHA 4PY7A 2XZAL 4PJXE 4E9LA 1LE9B 2CUMA 3V4VH 3LD8C 4IRZL 3QNYA 5DVLA 1YEHH 3TJEH 2EH7L 4APQA 2HFGL 3VI3E 4OCYL 4BH7B 2Z8RA 4Q6YA 5KJRH 2XTLA 1E4JA 1EEYA 2F5AL 1J8HE 1AY1H 2HTLD 3KPPB 3P40A 2YZ8A 4NUGH 1KIPA 4P46C 1PSKH 5LCVH 1MI5A 3JBG7 4OQTL 3KAAA 4JKMA 4G43B 4MA8H 5T33L 3AROA 5IW6B 2XOTA 1M6OB 4C4KT 1IARB 3MOQA 4LSDA 5GGSB 5JHDD 2UWEB 1DQQB 4KRPC 15C8L 1QVOB 4Y1AE 3FN0H 2V2WB 1HXYA 2HN7B 2V5YA 2I24N 1OAQL 4L8SC 4HS8L 5GGQH 1UG9A 5T1MB 1HEZA 4PJBB 5KBNC 4PBWD 5D2LE 4KKNA 5T3XE 2ZNWA 3O6FD 4GMTH 2R1WA 3FO9A 2BC4A 1SBBA 5CILL 5K59F 4HIHB 1JGUL 1F3DH 1L9MA 4NO2B 3ZYJA 1FO0L 4BSWA 5IGXH 3SBWC 1MCHA 1CZ8H 4DUXA 3U4EA 3WNNA 1BOYA 4M7LT 3RVUC 3W5NA 1A6ZA 5I1GH 1G7JB 4HLJA 2FGZA 5D1ZC 4C56B 4CUCA 4TUOB 1UADC 1HN1A 3MLTB 4JHBA 3IDMA 4BQ8A 4ESKA 3FQTA 1EVUA 1QYGH 2VJXA 2YXMA 1YQVH 1CFVH 5I1CL 4Y4FB 4QNPE 2FYYB 5C3LD 1HQ4A 3L7EB 4MQTB 4K9EC 4HBCH 5DRZA 5B4MC 3WLWD 3HNVH 2R56H 4WI3A 5D7JD 1ND0A 4CADB 2ILLA 3ALPA 4OLZH 5E2TH 2EDYA 1DBKH 5CSZA 5EN2A 4YHNB 1RURL 4LDEB 3O3BB 4NNYA 2GJ6E 3U0TA 3I02A 2GEEA 4ZFOB 4QTHA 3THML 2W0FB 3TIDA 3KYMA 3SKMB 2F53E 5HHPB 5I75C 2ICEA 4PS4L 2BZDA 3ETBF 2BDNL 4IMKA 4YHOH 3QA3B 1V7NH 1T20A 5HI4C 3U7WH 4TNVF 1IZJA 3DMMB 3PQYE 5IB5B 1T5XB 4GAYA 5DJAB 3NN8B 4P9HC 5D6DA 4U1NA 3L5HA 4PRID 3GEWB 3CX5J 1AD9A 1CDCA 2XY1A 3REWA 1YY8A 1FZKB 3QXTA 1YN6B 3MRPA 3KXFA 2H32B 4HLZH 2UUDH 3MRJA 1L7TL 3PWNA 3I6LE 5JNYB 2DQHL 3BISA 3E3QC 1BJ1J 1NEZB 2GITA 1CR9H 2JB6A 2PYED 3ARYA 1BECA 3MLRH 5CEZD 5T3XH 1ZVSB 2LABA 3W0WD 3FZUD 1J9CT 1RZGB 1YNTA 1C8PA 2EDOA 1ZT4A 2A83B 5KTEL 4HKXA 4HKJB 5D4QA 3BRGC 3S9DB 1JL8A 3AU1A 2CO7B 3S97C 3GI9H 4HQQH 1TVDA 2DF3A 3MRDA 5DJZB 3LRSB 3MJ7A 3E8UL 5ILTH 3G5YA 1FVDA 2R9HC 2H2SC 2QQKL 2C3GA 4ODHH 2A9NH 2GTWA 4RMTA 2ZNXA 2ED9A 1YY9D 5FXCH 3VXMD 5E0QA 4OZIF 4X9BA 4K3JH 5DJ6B 2OZ4L 3UJTH 1MCBA 3DX6B 1KB5B 2AK4A 1D9KD 4NZRL 2VDNH 5DMIL 3SGJC 4IOSD 4K8RD 2WUCH 5D7LE 3VGGA 3FHQA 2V2XA 2NY5L 1BF8A 2APXA 5C0JA 1AKJA 3N9GL 4I18B 4DFIA 4K3GA 3G5XA 1S9XA 1V3MA 3ARFB 1VFOA 4I3GA 3QIBA 3HZYA 1FNEB 1CICB 1HZHL 4G8IB 5E8OA 5DQDL 4BQ9A 4U1SA 1ROWA 5IFAL 4N8PA 3AMKA 4PJ9B 1QNZH 1IAIL 5DI8A 3WE6A 2FB4L 2OQJB 3MA7B 4JRXE 4G7VL 2BNUB 5A2LH 3UTSD 1N8ZA 4DK3A 5LGHL 2AABL 5ICZB 4OLXH 1OAUH 2CDFA 4B50A 1T0MB 1OL0A 1C08A 3MCLL 4JGUA 4M3JA 1HSBB 4TSBH 1UB6A 2AJUH 1IQWL 1EEZA 3QNZA 1T89C 4XNUL 3BE1L 1XF5B 1GPOL 5BW7C 1MRDH 1QO3A 1S3KL 3WFEL 4UQ2A 2FBJL 4OZFG 4JHWH 5ETUB 5E7BA 5D1XD 1FAIL 1ZANL 5CWSB 3FRPA 2IH1A 4KK8C 3VXRA 1H3GA 1RZJL 3O3EB 1QRND 2LAAA 1MHHB 4ZO8A 4EN3B 5GPRA 3QIWD 4POZC 5EU5B 1FZOB 4QY8A 5EO9B 1YUHA 4JGJA 5FV2A 3TBTB 2NYYD 2NY2B 4FZEH 4S1QH 1CLCA 3RVTD 4U6XB 3CDGB 1JZ8A 4U1JA 3O6KH 4B53A 2EDJA 1IC7L 3BZ4A 3SE4C 1X5HA 1MCCA 2ITDB 2GUOA 4S11A 3FB6B 2ZCLH 3B5TA 1CLZL 1YPZA 5DRWA 2GFBB 4J7RA 4PY7B 1SY6L 1E28B 1RFDH 5IMLA 1W72H 3TBVA 1NAKL 3BP6A 3HUJE 4PRHB 4X7FC 4Y4HD 5HYFA 4HIXH 3CGTA 5D7KD 1F4WL 2MSPA 1QLFB 4O58H 1EEYB 5F7KC 5IB3A 1JZ3A 2D7QA 2HFEA 1KIPB 5BV7C 4LSUH 2QBWA 4ZAKA 2ADGA 3PP3K 2YD5A 1I1FA 3CPLB 5TQ2H 3MSPA 4LFHG 1U8PA 25C8L 3SDXA 3FN9A 3ZE0E 5F7DA 3VG0L 3ZDXE 3W9EA 2P8PA 4BM7A 1XZ0B 5FYLE 4JN1H 2D7MA 4FQCL 2D9CA 2Z31D 2EDWA 4ODVL 1HXYB 3ZTJG 5C0EA 4U1KA 4M00A 1WSST 3MRMA 5I76A 1HEZB 1T1XA 3HC3H 3DVFA 4G6FD 5GS3A 4XPGH 1JWSA 3WIHH 3LZFL 2R1WB 4P2RE 2BC4B 1ZTXH 2O5ZH 2VL5A 4DW2H 5IMKB 4MSWB 4DN3H 4PGCB 1E27B 3OKYA 4J6RH 1UH4A 3O4LD 3HI5L 5FYKU 4U4BA 3CZFA 5D7IE 4BYHA 1SVZA 4DGVH 4GRLC 3MJ9H 4F7MB 3LH2H 2NY7H 1A6ZB 4ELMA 1BOGA 4ONGH 2H2PC 5I74B 1LO2L 1U3YA 5IFHH 2DQJH 1CE6B 5B8CC 4P2OC 3MUHL 1BBDH 3H2WA 3MUZ1 3VW3H 2EZ0D 2R4RL 3MCG1 1J7VR 3LN9A 3FO1B 1AI1L 5HI3D 5H35B 1JRHI 3EFDL 5GSVA 1D5IL 4IRJA 4LKCA 4M1CC 1GGIL 4PJCA 4X0KA 3WFCH 4RGNE 3HA0A 1G7QA 1DUZA 3SKNA 1IFHH 1IKFL 1XMWA 5C0FB 4JN2A 5CKGA 2BHZA 4PYHA 4NNYB 4YHKL 3I02B 1UACH 5E8EB 1G6RB 4JCLA 4M43H 3TIDB 2Y7QA 3ARFD 4LSSH 5IT2L 2ICEB 3TA3C 3B6SA 3T0AA 2FSEB 5DLML 1XGUB 1CF8L 3QUMB 1CICD 4Z77A 5HY9B 1B9ZA 2NW3A 2AEPL 3U4BL 2JB5L 5EORH 3V0VA 5A3ID 4M62H 1HINH 2B7DT 1GL4B 3MZGB 4YQXH 5FYLH 5E70A 3MNVB 1X7QB 4JY4A 3K80A 3LQAH 5TQ0L 3MRJB 4WTXA 1KPRA 1AGFB 3T2PA 4CU7A 3BDYL 5H94B 1JI1A 3U4AA 3DVNA 4OZGE 3QZWG 2QSCH 4RFEB 1YNTB 2EDTA 4UDUA 4G9FA 2MCPL 1A6WL 4EN3D 3GSNB 4X4YA 3VXSE 4PTUA 3MBXL 1YEJH 3EOYG 1EAJA 1UH3A 1MF2L 4MNQE 1KLFA 3MJ7B 1V05A 2H41A 4P46A 3EZ8A 1QTYT 4NNPH 4XX1G 2NXZC 3FT3A 3KJ4B 4RX4A 3U7YL 1KJ2L 2OJZH 2GTWB 4UB0L 4M1DL 4BZYA 1ZVYA 3KPSD 3EHBC 5E2WL 1U42A 2IMNA 4XP9H 4DVBA 5JR1L 2AK4B 1G9MH 1Y18B 2YS4A 3HHRB 4P2QE 2PF6A 3GO1L 4WW1A 5EU6E 3ARBC 5HGDB 2KKQA 3I85A 3QEGH 5D2NE 1HHKB 4HHAA 5IOPB 3BEWB 4Y16C 4R0LB 4UDTA 5F3BA 2CUIA 4I1NB 3F7RA 1NL0L 4APQD 5F97E 1IILE 4L8SA 2BVPA 3G5XB 4UUJA 2CMRL 4UINH 1NBYB 1YDPA 3PXHA 3QCTL 3JTSB 3OF6A 3GUTA 1DBAL 2BMKA 4WUKL 1M7DA 1CD9B 5GS0H 1MI5D 3CFEA 3S3PA 5L7XH 2FECL 3P4OA 1EO8L 1YZZA 3SBWA 1XIWC 1EEUA 3WE6B 5F6IC 2VH5L 5HYJE 3GSWA 3SY0A 3C60C 4N68A 1SM3H 4WEMB 4X6DA 5A16B 4G5ZL 1I85C 5JHLH 1C08B 2P8LB 4XNZC 4XTRC 1AJ7H 4OGYL 2J8OA 1INQB 1NFKA 1MJUL 1TENA 3QNZB 5K59E 3IDJA 3QFJA 1H3UA 3QQ4A 4PRAA 5I8EA 4K7PY 2A6IB 1C5CL 3X3FH 4OM1L 3UTTA 4ZOBA 3G6JA 4QXGH 3CLEL 4S0TD 3MLWH 1QLRB 4MMZC 4KRNA 3V5DA 4ZOCA 3ARXA 4QY8B 5GRUH 1FLRL 2IPKA 5FOJA 4UIMA 2YD7A 3FQNA 3WIFA 4K94L 4KKLD 1ZHLB 3JWDC 4UV7L 3QP3A 3BZ4B 3GI8H 4HPOH 3MGTA 5JLZA 4DKFH 1EMTL 4HUUA 5IJVA 2E9JA 2GUOB 3I2CL 4X8JB 1BQLH 4MQ7A 1JNHA 3GKZA 4KJWC 4PD4K 4XPHH 1WZKA 3O3AA 2YRZA 3TBVB 4J3VA 4KK6C 3G6DH 4L3EE 4LDOB 2FIRT 1U93B 4R97C 1AGEB 2O5YL 3F58H 5F8RC 5CZKA 4M7KL 4HKBA 1H5BC 4MA3A 5KN5A 4GRMA 3L3KB 5IB3B 3L3OB 4GG6F 3GMOA 4G9DA 4NQDE 1B6UA 2E9WA 4OKDA 3RPKA 4N8VB 1LP9F 3ZE1F 2MHAB 3CXDH 3QEQE 4ZAKB 3SDYL 2DQUL 4WV1C 1QSEE 4DCQB 2OYPA 1EEQA 1U8PB 1UM6H 4M5YL 3RTQC 1FCGA 5L6YL 43C9A 2L0DA 2NW2B 2P8PB 2DQFA 3SCMB 5FKAA 1KNOB 2ENSA 3MLZL 4X6CF 3EOTH 2VDKL 3O2VL 3HC0B 3OAZK 3Q0HA 35C8L 4GKZA 3PWJA 2FH8A 4OCRL 4U1KB 4UU9B 4FQ1L 1WZMA 4XNYH 4MD5A 1OTUC 1WZ1L 1SEQL 4JFPA 1IGML 2FHCA 1U8QA 2IJ0C 4HUNB 2DQCH 2GI7A 4O02H 3KXFD 4PRPE 3D0LB 1F4YH 3I84A 3WMSA 2NY6D 5JPNA 4BFIB 4AEIL 2AQ3A 1BLNB 3SGJA 2PO6B 3L3DA 4IDJL 2I9LB 1IBGL 2FIKA 2GYSA 1CGXA 1OQOA 2VRAA 4WI8A 2HMID 1BFVH 4M4RA 3NIFF 4U3XA 3CVIL 2BFVH 4OGZA 1M7IA 3EFFB 2P5WE 1U2CA 3X17A 4O00A 4BZ2H 4NWTL 4R3SB 1JNNH 1K4DB 3WXVL 5HHMB 1LO5B 1BQUA 2BVUA 4ZTPL 3GSOB 4OD3H 2BNRB 5C0DB 4XPTL 4X0KB 4XAKE 2AK4D 4YX2H 2R0LL 3PWPE 3D48R 1G7QB 1DUZB 4S1DD 1VFAA 4UOW1 2WNGA 2XNAA 4NRZA 4TUJA 3V6ZB 3DSFL 1NH6A 3FT2A 1KXVC 3NCYS 1MIMH 1AKJD 4KDVA 4YGAB 1T89A 4HSQA 5BW7A 1PY9A 4NQUA 1A4KA 3BH9A 1KFAH 5B3JE 1P2CB 4ZTOL 4J8RA 1T3FA 1Z2KA 3QIBD 3B6SB 4F58H 2J6EH 1S7TA 3D0VA 4Z77B 4K3EL 2YPLE 4CU8A 4R7NB 3ULUC 1KCSL 1YEKH 1LEGA 3QAZB 4QO1A 1U3HC 4UT6H 4RQQB 1FYTA 5HHOA 1UCBL 1RIHH 1GOHA 1I9JL 3BKJL 1RUPL 1VFUA 2VOTA 4M93B 3SE4A 2FJFB 5BCAA 5J89A 1A02N 3O41B 1JGEA 1A7BA 4OFIA 1CVRA 1P7KA 1KF9B 4QCIB 3GIZH 5D6CB 3OG4B 1BEYH 3VXRD 4QTIL 4AH2A 1N6VA 2CIKA 1DFBL 4GKOA 5I73B 2ICWJ 2FEDD 4XHQA 4F2MA 2J88H 5C08A 4P46B 5DJCA 4X7DC 5BQ7A 3FJTA 4P57A 1KTLA 2DQGH 5F7MC 3HMWH 1OGAE 1MJJB 1FFQA 3IJHB 3JTTA 4DVBB 4RAVB 4PREB 5FV1L 3NAAL 1N6QL 1OT2A 3MFGB 2YKLL 5FO9A 1F2XK 1J86A 3UPCA 1XGQA 4HHAB 5ECJE 1FGVL 4M6OL 1FRGL 1TTUA 3KPQA 3HZMA 4G8GE 2Y6SC 4L8SB 4GKNA 4UUJB 4TVPD 2VLRA 4XP4H 2HRLA 3ARPA 5IB2B 3GUTB 2BMKB 3IF1B 5FUOH 1JI2A 1M7DB 4ZAKD 2Q86A 3OAUL 1RK0A 2KUTA 2EYSA 3M1BB 1NCWH 1QFHA 4WWKC 3NCCB 5L2JA 4Z76B 3K4DA 2WK2A 3Q2CA 3GSWB 4GRLA 1YEDB 2NZIA 1HDMB 4LVHC 3MRCA 4FMKA 2BCKA 2ERJC 4X6DB 3NACH 1T1ZB 1R6VA 5D1ZB 3EJZD 1MFDL 5TE7L 4GRWF 5IEHB 4YIQA 3UX9B 5B8CA 4P2OA 3MLYH 4JAMB 5I1JH 1D5BB 3RL1A 3IDJB 1Q9WA 3QQ4B 5I8EB 1U3JA 1RZKL 2GQHA 4GSDL 4AEHH 2HKFL 4RFOL 5FDWA 2WUBH 1GGBH 4AIXA 1YYLL 3QI9B 3VGFA 4JM2C 4C54A 1DSFL 2M26A 4HF5L 4QRRE 3CXHK 5I8KH 4UIMB 3ULVD 3RUGB 2FX7H 5D5ME 4RIRA 3ZHKA 3RX5A 4N0UE 5JIKA 3MLVL 3K1DA 1CE1L 4MS8D 4UBDC 4M7ZC 3IRZA 3NA9H 2AJVL 5BS0B 3OZ9L 4HUUB 4LNRA 3BHBA 5DEGA 3S35H 2ZJSH 3TA3A 1JYNA 4UOW0 4MQ7B 1JNHB 4YJZL 1MHCB 5F9WC 1K6QL 3EDJA 5HHMD 5I6XC 4HW6A 4BFEA 5E6IB 3T0DA 5C0IB 1KCVH 3WLBB 4IRJD 3V4VL 3NGBC 2W0PA 3P0GB 1T22A 5KN5B 3D3VE 3TJEL 4GS7C 3GJFK 3GMOB 1I9RH 2QKIA 5KJRL 4X6BB 4BKLA 1F3DJ 4HWBH 4RRPA 1UM4L 5ITBH 1AY1L 4D0DB 1LK2B 4N0CC 4NUGL 1DLHA 2RBLA 1FFPA 1PSKL 5LCVL 3D39A 5T1KA 4MNHA 3JUZA 4FA8A 4AG4H 5TF1H 4MA8L 5J7CC 3VFTB 5ACZA 1AC0A 2GKIA 5IR1B 4ISVB 5AUMA 5FKAB 2DAVA 3S88H 1RZFH 4LPYA 4JO1H 3V0AC 4IOFC 5EBLB 5DDHB 4YNYB 1TVHA 4LPTA 2K3TA 3IT8D 1HKFA 3PWJB 4F7PA 2Q76A 3MQIA 1LVEA 2DDQH 1JV5A 1T1YA 3QDMA 3DOSA 3FN0L 3CSYB 4NO3B 1NANI 5T1DH 1CD1A 5GGQL 2NX5A 4NKOB 5TF0A 5CJXC 1AE6H 5JUEH 1O7VA 4X4ZA 4X5WA 2H8PA 3H9SE 4GMTL 4OF7A 1NJ9A 4BZ1H 4QXTB 3HE6B 1EV2E 1XR8A 2L4OA 2EIEA 3CC5B 3PP4H 3L3DB 5IHZB 5IGXL 3ARBA 1QFWM 1CZ8L 1MCRA 4G9FD 4XBEH 4Y16A 3OKMB 1MHEA 4L3AA 1C7TA 2V5SA 4PJFF 2A6DB 5I1GL 1P69B 1VEMA 5BRZE 5MEQA 2X4RA 2EYTB 3DYOA 3DVGA 1CFSB 2E8ZA 4P46D 4MDJB 4YHZH 3BKMH 4RMWA 1QYGL 5ESAB 4RX4D 2O93L 1CFVL 2Q8AH 3MREA 1TZHA 1XIWA 4YBQC 2ZUQB 1EJOH 1T6VN 3S5LA 3LN5B 3C60A 4LCCB 4DWHA 4HBCL 3HNVL 4KRPD 2R56L 3N1FC 1I85A 4TUJB 3IRPX 5EIIA 1FHGA 1EUUA 3WEXA 4JFZH 4KDWA 1BPVA 4URTB 4OLZL 5E2TL 5ICXB 1DBKL 4LPVA 2JCCB 1BD2B 4J8RB 1T3FB 4KROB 3OF6D 3TLRA 2DS4A 4L9DA 2ID5A 5F9AC 1MH5A 5C0AB 5EBWA 4YHOL 5SWQB 3IDXH 4ZUTA 2FJGA 1V7NL 2IANE 3HRZA 3U7WL 4RWHA 2VN4A 3EDEA 3RVUD 2ZUXA 1GZQA 3BIAX 2AQ1A 4N9OB 3OKEB 1MCLA 4TRPH 1BFTA 3TBWB 1J1XH 1GC1H 1BVLA 3MRFB 4PJDA 1RUMH 4GO6B 3RWJB 5KSBE 1JGEB 3QFJD 3O2WH 1F45A 4PJ5E 5HTSA 3TIEA 5TH2A 5DFTA 5FA4A 2HFFB 2N7BA 3UTTD 4I9WE 5J11C 2UWEF 3EZJB 2VISB 4HFWB 1CR9L 2MFNA 1B6DA 3GSXB 3MLRL 4HT1H 2HT3C 3KS0J 1KYOK 5T3XL 5B4MD 5FHBH 1H5BA 5E56A 3OTTA 2X4QB 4LCUA 5FHAH 5EPMA 1MREH 5C08B 4L4VA 5BV7B 3P2TA 4PJHB 3GI9L 4HQQL 5DJCB 3RU8H 1MUJA 1D6EA 4WV1A 2LV4A 4P57B 5ILTL 1TZGH 4JZJB 1KTLB 2FEEL 3RTQA 3UYOD 4N9GB 3HCVA 3LKNB 2IALB 5GXBB 3RP1A 4ODHL 2GHWB 3B9AA 4HIEA 3JTTB 2A9NL 2HT2C 2WLYA 3RWCB 2FX8H 4NP4H 1R3HB 5EUOA 4K3JL 3UJTL 2ATKA 5HI4D 2ORBH 4Y5XC 2FRGP 4KXZH 2VDNL 4ZD3H 1FNGA 3VE0B 3ZE1E 2V5MA 2D9QB 3KPQB 2RCSH 2WUCL 3A67H 5FA3A 1NLBH 5C0CE 3LAFA 1UFUA 3L3JA 4OBSA 5DGQA 1HYRC 3PP3H 5F7UA 1MAMH 1RZ7H 3EJJX 1B0GA 4YE4H 3VXQB 1ZKAA 3SO3B 4YZFE 3RPIA 3RWHB 2YHGA 1FQ9C 3ZKSD 4PJIA 1ETZA 4QGTA 3UP1A 1X4XA 4GRLB 1PKQE 1QNZL 3AGVA 1IQDB 2GSGB 3JV4A 4RDQF 2EE2A 1NQBA 4TNWK 3VU2A 4OQTA 5C9JA 1DDHB 3V6FA 1QR4A 4BK4A 4AT6A 4OLXL 4P2OB 3RL2A 1OAUL 1KCKA 4NQCE 3OGCA 1BX2B 3RL1B 3HE7B 4AL8H 4TSBL 4X4XA 4HUVA 2AJUL 1IGTB 2ADJA 3SDAC 2R9HD 4IMLB 1MRDL 4JKPH 2QL1A 4L8DB 3CX2A 1V5JA 4LLUA 2Y5TB 5D93B 4ZUWA 3RY4A 1A7RH 1WC7A 3L5IA 3MRQB 1TJIH 3CFDA 1DN0A 4IIQB 2PNDA 4Z7WA 1KN4H 4FZEL 1R24A 1A7NH 4S1QL 5A43C 5JW4R 1FO0A 1N5AA 3RVVC 3O6KL 2FGWH 4LK4A 5ID1B 3CH8A 3T2NH 2CKBH 4NRXB 3VA6A 1OQXA 3T08A 4QRPA 2ZCLL 2P5EA 3MPCA 3WS3B 4C83B 1FZMA 5DC0A 1U3HA 1A0QH 1RFDL 1MLBB 1W72L 1KV3A 3OMZA 1AHWB 4HAGA 4Q2ZA 4HIXL 4X8XA 5DHVH 4J3TA 3W2DH 4B41A 4O58L 4BKLB 3U0PA 1NMBH 5BXFA 2MQCA 5B39A 1CFTA 4LSUL 4U2ZA 3VFSA 3D39B 4GXVH 3IDYB 3LN4A 2Z4QA 3IGAA 3GMNB 4MNHB 1BIHA 1KJVB 3HG1A 5TQ2L 3QJFA 4LSPH 4F9PC 4KK8D 1SYVB 4DKAA 4K94C 5AUMB 4J12A 4LLDA 4U0QB 5L88H 1AC6A 2BOBA 3X14A 4NC1E 4POZD 2DI9A 4JN1L 1FYTD 2N56A 3IXTB 2ESVA 4OZHA 4TUKH 5HHOD 3QDMB 3O0RH 2FLRT 3FFCA 4IRSC 4LLVB 3W9DA 3AS0A 1ITBB 3BRFA 5FKPB 3REVA 3RZCC 3E6FA 2VDQH 3HC3L 3ME0A 4JFFB 4OUUA 4XPGL 3WIHL 5GRVK 4ZG1A 1ZTXL 2O5ZL 3AY4A 4DW2L 3D6GA 4DN3L 4LGSB 3VFUB 4J6RL 3TT3H 3ARBB 2XKSA 4DGVL 3DV6A 3MJ9L 3LH2L 4YFLI 5L8KB 2NY7L 2P7TB 1BP3B 4GG8B 2J3SA 4U1HA 1YECH 5I0ZA 2KQNA 2X4RB 32C2A 3LQZA 4ONGL 4R96B 3NZ8A 5LGKA 5IFHL 2DQJL 3DVGB 1C16B 5C08D 4NKDA 3K4AA 1BBDL 3T0EB 4H1LH 2V2TA 4O2CA 5T3ZE 2VLJE 1P1ZB 2BERA 3VMNA 1N0XH 1Z9OA 2WBJC 3VW3L 3TNNB 3RA7H 2VZOA 5IWLC 5DUPH 4WWKA 1R5IB 4KMLB 4EDXA 1XIWB 4J1UB 4I3RH 1XGRA 4X4ME 4I0PC 3S5LB 1U91B 3SDCB 4JRYE 1AXSB 3ZTNH 3BSZH 2W0KA 3UJJH 2VSDA 4XCNA 4L4TE 3WFCL 5EIIB 3DIFB 3WEXB 3SKJH 1IFHL 3VD9A 2NY4C 2OZ4A 5J9PB 1S7VB 2VLRD 3IDGA 3W11C 3O9WB 2GK0B 4JY6B 3N0PB 1S9VB 1UACL 3NFNA 4M43L 2VQUA 4LSSL 4NRYA 3G9AB 5EZJA 1MH5B 4JFDE 4P99A 1KACB 4JM2A 4TNWF 5CJQH 2GCYB 2NTSP 2D2OA 4Z7VE 2FJGB 2VDLH 3HRZB 4GRLD 1RZIA 3L5JA 1P7HL 5DK0A 4PRNB 5JOPE 1KXTB 4M62L 3GMRA 3P11H 3GK8H 1HINL 4MAYB 5JHDE 2H2PD 4NUJA 5CKAA 2ZKHH 3AAZB 4P2OD 2Q6WA 5FYLL 4YQXL 3QPQC 4MVBC 3EYUH 3LQAL 4JQXC 3QXDA 1RIVH 4F33A 3VFMA 4X99A 4WVRA 4PV9A 4JPVH 2QSCL 2V7HA 2XWBB 4F7TA 4PYGA 1K2DA 4NFCA 4X5LA 2XZQH 4M1CD 3OXSA 1H5BB 1KENH 5TDPA 3U82B 4XCEB 1HWHB 1VB9A 4YHLH 5JDSA 1YEJL 2D31B 4M61B 1H8NA 4NHCH 5FUZH 4XNQB 4NNPL 1UM5H 3BPCB 3HCVB 1JIBA 3TA3D 4CJ0A 4HIEB 2OJZL 2X1QA 2B5IC 1U8JA 5TGBB 4TQEH 4YFLF 5HGAB 1ACYH 2ATKB 5ISZA 4XP9L 1N4XH 1WUNT 1G9ML 1X5AA 2J8UB 5BJTB 1Q9KA 3QEGL 4RFNB 4Z7OF 1QSFB 4HAFA 1QBAA 3OKNA 1CDIA 3VDBA 1CG9B 4FMFA 4OLYH 5CJXA 5L2KA 3HNTH 4UINL 3RWGB 3DX8A 3TNMA 1P84K 1RJYB 4LRIC 3RPIB 3D39D 2EO1A 5T1KD 5GS0L 3OAZH 3INUH 1ETZB 1V3JA 3QCVH 4ONOA 2IG2H 5L7XL 3TZVB 1T7VA 2HG5A 4ZYKA 3BEVA 5F71A 2R8SH 4A6YH 3P4NB 3VRLF 5FECA 4FFVC 1SM3L 1F8TH 2VABA 2R29H 5CSGA 4JQVC 2B20A 5HGBA 1NAMH 5JHLL 2Z91B 3QDMD 5CIPH 1AJ7L 3I3EA 3VWJB 1IZKA 4X4XB 5CUSH 2NXZD 5F1IB 4QYOB 2NX5D 4PRIE 3EOAB 4N8VG 2X70A 2WWKT 3X3FL 4NYLB 4Y2DC 3EO1A 3MBEB 4YEFA 5DJ2A 3EHBD 2OMNA 4QXGL 1AXTH 3MLWL 3JVGC 3OX8A 3ARGB 4J3SA 2XYCA 3ARBD 2Q3ZA 3WIIH 5CEZE 2PYEE 1CLOH 5GRUL 1U95B 4Y16D 3BPLC 3W0WE 4NCC1 1FO0B 3VGAC 3VFPA 1A5FH 2BNQE 3ARDC 2VXQH 4OB5H 3GI8L 1U36A 4HPOL 3V4PH 5KS9E 4HJJH 2R2EA 3ZDYF 4DKFL 1PZ5A 3VXNB 3VRIB 3OJMB 4QRPB 2P5EB 1BQLL 1FZMB 4KXZI 1ZLWH 5IM7B 4BH8A 1JBJA 4XPHL 1XIWD 4ODWB 1KIRB 3KDMB 4ELKB 4F37F 3WD5H 1RK1B 3C60D 3D18B 3G6DL 3VXME 5IJKC 5IG7A 3PJSB 3F58L 4EXPX 1MCOH 4P48A 4XTRD 4B0MM 5HHQA 2GJZA 2GIYA 3HR5B 3NFSH 1S7XA 4KGLA 5C0BA 3CXDL 3LN4B 4PR5A 3HG1B 1HI6B 1UM6L 3BW9A 4LLDB 1U58A 3D87B 1PFCA 2EIBA 2CDGB 2YPKA 4IJ3B 3EOTL 4KK5C 4JRWA 1OCWH 4OZHB 3WFBH 4H25A 3FFCB 1N2RA 4C58B 1G9NC 3UTSE 3GJEA 4XNYL 1CXIA 4FQQA 1OTSC 2VZ3A 3F8UB 5JA8B 3HMXA 3MNWA 2EIZA 3E6FB 5I1AB 4R8WH 2DQCL 4O02L 4QHKI 2WIIA 1F4YL 1QUNA 4G8EA 1SMOA 4KJWD 4KMQA 3DXAA 3Q5TA 5HYSA 1MVUB 4YXHH 2ZCKH 4HUKB 3IDNA 2R2HB 4KK6D 4Y5XA 3BVNA 2YSSA 2IPTH 4CN4A 5FAAA 1WLHA 1I7UA 1TMCB 1QRNE 1BFVL 3NCJH 1UKSA 2WMPA 2IBGA 1HH9A 4L4VD 2BFVL 3MV9A 5CEZH 4TULH 1ZHKA 5DJ8A 5FB8B 3ORJA 4BZ2L 1JNNL 2BSRB 5FGCB 2NZ9C 5DA0B 4WWKB 1XCQA 2ZG3A 5GGTH 1VEOA 6CGTA 3RTQD 1AO7A 1WWBX 1KPVB 3WN5B 4MNGA 3VG9B 1UZ8B 2V7NB 4FQ2H 4LVHB 4P23B 4NN6C 4OD3L 3GGWB 4M8QA 4HMCA 4YBLB 3P9WB 1G7IA 1RV6X 4YX2L 3EYOA 5DQJA 3QIUC 3WUWA 4H88H 3QHZH 1OTUD 4MAUH 1MIML 3IDGB 3SDAA 3K1KC 5JIHA 1KFAL 3MRLB 5IHBA 4K8RH 4QT5A 2HJFB 1VESA 2J6EL 4F58L 5C09A 1U8KB 2X9YA 1JYWA 4KZEH 2UZXB 1YEKL 3O45B 1PD6A 1IL1A 5FFLA 4LARH 1IAIM 4XGZA 2BY3A 4Y5VB 4MX7B 3VGDA 1S7WA 3VFOA 1RIHL 1N7MH 1Y0LA 3TH2T 2BK8A 5GSRB 1JHTA 1MLCB 3TO2A 2LTQC 4HWZA 1HKLH 5GZNC 1WAAE 1G1YA 3CDCA 4K7PX 4NM8H 4PB9H 4PJ7E 5DQ9B 1HK6A 2CK2A 4UILH 4RGMC 4KZDH 1IKNC 4PV9B 1IAKA 3GIZL 3SJVA 5JOEA 3DHMA 1EHAA 2KH2B 1MCSA 3O2DH 5C6WH 3OXSB 2A74A 1BEYL 3OL2A 2VQ1A 4OZ4B 3GMPA 2PW2B 3IETA 3O4LE 1TJHH 2IPUK 4JFXA 4IEFB 4LGPB 4MB3A 4S2SB 2J88L 3GBNH 4IDLA 3H0TA 1QFPA 4JO3H 1XF3A 1A9EB 5LJYH 2XPGA 1IAOA 1S5HB 5B21A 3IVKA 4LCWA 4P9MH 2P44B 4LSTH 3ULVF 4F9PA 2LVCA 3HMWL 4Y4KC 4QRPD 2P5ED 3PV7A 2AV7B 3ULUD 4Q9RH 3WHXB 3GJFH 1U3HD 1M7XA 3RX8A 1MHPL 4OZIA 4PGZA 1LD9B 3LS5H 4KC3B 1Z5LA 4OAWB 2DMKA 3MROA 1AQKH 4DGYH 3OKNB 4IRSA 1MCEA 2AJ3A 3VXTB 1J10A 2VDMH 5L2KB 3OPZH 4XP4L 4ZSOB 3RZCA 2B4CH 4X5XA 1T21A 2ZWLT 5IQ7H 5FUOL 4OGAC 2BY1A 2FHBA 5DHYB 4PJCF 3HG1D 1NCWL 3E2HB 1WWWX 5LAXA 1X4YA 3MV7A 3QDJB 1LEKB 2FH6A 1HHJB 3K8LA 4M4PA 1R5WA 3ARUA 3OJDA 4X6EB 3T0XA 1P53A 4I0KA 3NACL 3U6RA 3FT4B 5JQHC 2ESVD 3HAEB 5DUBA 2JE8A 4Z9KB 4KFZC 1DQTA 5A2KH 3FFCD 1FH5H 3BQUB 3MLYL 5I1JL 2L7JA 3RJQB 1X5JA 2WBJA 1TXKA 5IWLA 4AEHL 2D7OA 1IT9H 4I0PA 2WZPD 2WUBL 4Z5RA 5BVPH 3U83A 2R1YB 2Z35B 4XCYA 2IMMA 3LKSA 1GGBL 3F7YA 3RBSA 2QSTA 4GQ9H 5I8KL 4JREB 2J8HA 2FX7L 2Y6SD 3L7FB 3RBGA 5F93C 5MI0C 4OIIH 2YUWA 4FQIH 2JJVA 1CXKA 1P4BH 4NKMA 3NA9L 1G0DA 2R2EB 4LKXA 2OR9H 1BMGA 3S35L 1I3UA 2ZJSL 2NCMA 4G6AC 5DRNB 2BJMH 1XF1A 3Q1SH 1XGPA 5FM5O 4BH8B 1E4WH 4WWKD 3VH8A 2XQYK 1W0VB 3ROOA 5MEOA 3P9LB 3QEUB 2O5XH 1KCVL 5HPMA 3C9NA 3CFJA 4OM0H 3EYQC 3KPSE 4OCXH 3VJ6A 2QLVB 4DKDC 4WO4C 1I9RL 4JLRB 1T2XA 4TN9A 1S7XB 5FM4A 4HWBL 1L7IH 3DHJA 5DRXB 5C0BB 4JQXA 5ITBL 1KG0A 4W68A 4BJLA 1J1PH 5HD8C 1WISA 3BXNA 4E42A 4RGOH 3DLQR 3MODH 4AG4L 3OKKB 1K4CB 5TF1L 2GW5A 2AKRA 4JM2D 1NBZB 5SX4H 2YPKB 4HK0B 1MI5E 1RZFL 3S88L 1VFBA 4JO1L 4ZNEA 1BBJB 3KLDA 1FCCA 1JTOA 2VZSA 4P5TC 4H25B 1N2RB 5F7EL 2M8XA 2DDQL 3T77B 2I9TB 4UBDD 2FD6H 5CLTA 2EIZB 5GRJH 3PNWA 5T1DL 1U8LA 2X4TA 4ZNCD 2P46B 5JUEL 4M9PA 4G8EB 4LSRH 1FVCB 3DXAB 5JOFA 4X6DF 3UO1H 4BZ1L 5HYSB 3GDBA 2J5LC 3S4SB 2A2QT 3PP4L 3LV3B 4AIZB 3N50A 1I7UB 3U30B 4XBEL 3FKUS 5H37G 1HH9B 2VIRA 5M94B 3MV9B 1QFWI 4PJAA 2HTKC 3G6JF 1A6TA 4N0CD 3L1OH 4FQJH 4LOUC 4LRIA 4YHZL 5DK2A 3O8XC 1AO7B 3BKML 3VXPA 5IVZA 3MV8B 2FO1A 2Q8AL 2VAAA 4GBXB 1ZGLA 3QRGH 1EJOL 4EUPH 3IJYA 5ISZD 2DLFH 4IOFD 4OIBA 1KJ2B 4HG4K 2W60B 3AS2A 3SGDH 5C07B 2NMSA 1KN2H 1LHZA 4JFZL 1IM3A 5L2KD 4JPIB 3ZDZF 1F6LL 4PJGB 4RA0C 3B9EA 4Y2DA 2DLIA 5EZOH 1UJTA 5C09B 2UYLA 1QA9B 5ACLA 3JVGA 1IL1B 1W8NA 4LHQB 4PJ8B 5EFIA 3IDXL 1KJ3H 2IQAA 4L1HA 1T0NA 2NNAB 3H42H 3WBDA 3VFOB 3FQRA 3V6OC 4OZFA 4U6TA 3TO2B 2EDQA 1UEMA 1NGYA 5JQ6H 4WW2B 3ARDA 3Q6FA 4TRPL 4CVXB 2VZTA 1YN7B 2DIJA 3JWOH 1J1XL 1GC1L 4LQ1A 1U8OA 2UY6A 1RUML 1MWAL 4RNRA 1EO5A 2AEWA 1A1NA 3MCKB 3KPMA 3O2WL 3JWNC 1ZLUK 1QPXA 1FL5A 4MJIB 2DBLH 1OGTA 4YBQD 3LSOA 3KXFE 2A74B 3SDDC 4Q74A 1CGSH 4EDWH 3LIZH 2VQ1B 4HT1L 5C70A 3GMPB 3RIAK 5FHBL 5I66A 5CZVH 2APTA 3KWWB 4JZNB 4JFXB 2LVEA 3FB5A 3VFRA 1I4FB 4LPCA 5GJSH 4Y8DC 5FHAL 1MREL 2YK1H 1UEYA 3MRHA 3DJ9A 3RU8L 2A9MH 3B9KB 3IVKB 1TZGL 4JFEB 3FQUA 3JV6B 3OWEA 4X7SH 1JUFA 3TM6A 4JDZA 4D0CA 4N0FB 2X89A 2NY1C 3OXRB 2FX8L 4XMPH 1WCQA 4NP4L 3P4LA 1JMXA 3ARRA 5GISH 5CJ5A 4R2GC 4ZD3L 5HDBE 3ZKNC 2DM7A 2RCSL 3A67L 5KG9A 1NLBL 3P73A 5F44A 4UT7H 4GJTB 3VFNB 3UYPA 2OX5A 1LNUA 4JG1H 2D03H 2RR3A 3KLSA 4OD2A 1HHIA 1MAML 1LMKA 2OTUB 1RZ7L 3BPOB 1GOFA 5C0BD 4YE4L 1AIFB 5DF0A 5CP7B 5DWUH 1DQMH 1HSAB 2EE6A 3MRNB 5LAXB 3KPLA 3CSPA 2F5BH 2HT3D 3H3PH 3LEXA 3PWVB 5I1IH 2OSLB 3PDOB 1K8DA 4XNMA 5IV2A 4V1DA 1KTKE 5AAWA 4U1GB 4QOKA 3RNKA 5EC1B 1EA9C 4AL8L 2WBWB 5D70H 1NGWB 4MCYB 1G9MC 3QRFM 4Y0GA 3ZO0A 1A3QA 4XCCH 4KV5F 4YDJB 4JKPL 4HK3J 2HT2D 3LKSB 3BOVA 4E41E 3H9HB 3DXAD 3F7YB 3MMEB 1T0PB 2OP4H 2KPNA 4F7CB 4RGNC 4DKEH 1A7RL 4QRTA 3VXRE 5C86A 1TVBA 1TJIL 3OQ3B 5BZWA 2NY4B 5GS0C 3DUSA 4BUHA 1ITCA 1A7NL 4KHXH 1WEJH 1WCBA 5I1HH 3MV9D 2OL3A 3IDUA 3TPKA 2FGWL 5DT1H 3T2NL 2CKBL 1NDGA 3A6BH 1VADB 1MJ8H 4P3WA 1KUMA 4M9OA 2DD8H 3VH8B 1VKXA 1AO7D 4MQSB 1A1MA 4P4RA 4X6FA 4HS3A 4H5SA 3UTPD 1A0QL 2FO4A 1B88A 2EC9U 4PJHF 4M7JH 1RHFA 1YPZE 4WU5A 2E7BA 1T5WB 3W2DL 2PCPA 1G9EA 3CVHA 1NMBL 5GHWH 4GG6A 4Y5YB 3SDAD 2F8OA 2RJMA 5FEBA 3BXNB 2AXFB 1IKNA 1LP9A 4GXVL 4PP2A 4TVPE 3T2OA 5JIIA 2CIIA 1K5NB 4FTVB 4LSPL 5C09D 5ADPH 1VFBB 5L88L 1BJ1H 5E9DB 4RZCA 3SDXE 2BY0A 4K7FB 4X6CA 5HVFB 4MDIA 4BSVB 2D0FA 4TUKL 1R5VB 3QFDB 3O0RL 3HI6H 1B4RA 3QZWA 3PNWB 3RVVD 2BSSB 2X4TB 5DEFA 3VXOA 1J0KA 3LDBB 4YWGH 1PLGH 1QQDA 2B5IB 2VDQL 3PDGA 4Y4FC 1Z0MA 4Y4KA 1IAIH 1DUYA 5JOFB 3J8F7 3EUUA 4W6XB 3SJVD 4ETQB 1VA9A 3TT3L 4JEGB 2MWCA 2HKHL 4Y1AA 4Y8AA 1M05B 1ADQH 3UBXG 3BZFA 5ANMA 3LMJH 2VIRB 5EOTB 2PXYC 1YECL 5CZXC 1IGYA 1KLUB 1A6TB 4ELME 5DEZA 5IROC 1ZGLM 1NGZB 4DQOH 1TDQA 4NKIH 4F7EA 3KLAA 4PJEB 2UUDK 1N0XL 3TN0B 3EJYC 4LCWD 5IVZB 3RA7L 2X1PA 5DUPL 4CMHB 2VAAB 1ZGLB 2RFXA 1F3JA 3DRTA 4I3RL 3K2MC 4POUB 3DI3B 1MFAH 4PGBA 3DMMC 1G1CA 5DR5H 3ZTNL 3BSZL 3U79A 3UJJL 4JY5H 1JPST 3MOAH 4D9RD 4NQEB 4YPGA 5TFSH 2J7LA 4OFYA 3SGKC 2WAHA 3QNXA 4HUXB 5FDYA 1GGCH 3SKJL 4IRSD 4V2BA 1RULH 3JV0A 2APVA 1EXUB 1KLGA 2DQTH 3PHOA 4PJCE 4Y2OA 4PB0H 4YHPB 2X4PA 3QO1A 3RZCD 3MRRA 4PRBB 4NHUA 5FCUH 2XTJE 3CLFH 3QDGB 5F88A 5MENB 5CJQL 3VFVB 5EFIB 2IQAB 4TVPH 4AM0B 3MV7D 3RI5F 3UBXI 3BPLB 4PV8A 4LAJH 2ICWB 3OBAA 2CRIA 2N7AA 1HH6A 3P11L 2ZSWB 3GK8L 4I3SH 2HVKA 3PL6A 2ZKHL 3KJ6H 2X4OA 5E94B 1SYSB 2BVTA 4WUUA 3F65A 2EYRB 3EYUL 2WBJD 2Z8SA 4NCC2 1RIVL 1ZS8A 5KOVC 4Z7NE 4KTDH 1CQYA 1A1OA 1MFEH 4I0PD 4JPVL 3F7VA 2FATH 2WLZA 3LB6C 2XZQL 4ODVH 3RDTC 2YA0A 1KENL 2VWEC 5E7FA 1CFQA 5D8JH 1Q0YH 5EC2A 4WO4A 4YHLL 4EI5B 4I18C 1JHLH 3HZKA 4G9FE 1KCLA 2NY4D 1IC5H 2P1YA 4JDVA 3W11D 4NHCL 5FUZL 2WIMA 3FQUB 5E8NA 5I1LA 1UM5L 3L5XH 1QHOA 4Q0XH 1RVFH 5ICYA 4ZUSA 4PJ9C 3MRKB 4TQEL 5AG9A 2B1AH 1W0WB 4JANA 1ACYL 1YMMA 4O51A 4Q97A 4LCIH 4P5TA 4OLEA 2DYPB 5DJ0B 5BMFH 4JB9H 2EC9T 1P7QA 3P73B 4MZ2A 2C1OA 4XVTH 4LLQB 5E1HB 2ICCA 1YEIH 1TQCB 1I8MB 1TZIA 3V4UH 4NBXB 4OLYL 3QPQD 1W72A 4MVBD 3HNTL 5J56B 1N3NB 3SQOH 1JP5A 2EDHA 1XF4A 2ZSVB 1OPGH 4WHTB 2YA2A 3INUL 3QCVL 2IG2L 1F42A 1MCFA 1F2QA 5IF0A 3BIKA 4QRSB 2R8SL 3D85A 4XNMB 5DC4B 4A6YL 4XXDA 1B2WH 2WSKA 2NY2C 2VE6A 1T2JA 1F8TL 4QOKB 1OWWA 2R29L 3T04D 2RAMA 3DYPA 4ZPTA 1NAML 2JK5A 1F90H 2E7HA 5E2UH 5CUSL 4X6DE 1BZ7A 3L6FA 4E5XB 3O8XA 4U6YB 3MO1B 4NPYA 5LGJB 4GUPA 1ZHNA 4YDLB 3QFJE 5SWZA 2X7LA 4K71B 1AXTL 4XRCA 3BUYA 3UTTE 1RJLA 3QIUB 4A2LA 3QWOA 3G6JE 4FXKB 4JFOB 3WIIL 4PJDF 1CLOL 2Y23A 2YUZA 2BVQB 4U6VH 5EZLB 1VACA 1WCBB 1A5FL 2VXQL 4OB5L 3V4PL 3VFWA 4HJJL 1NGXB 3BN3B 3MJ9A 5LWYH 3DROA 3SKOA 2QR0A 4PFEA 2E3VA 2LU3A 5JIPA 1LDSA 1OT1A 2MQ3A 3QQ3A 4P4RB 1JWMB 5HJ3A 3WD5L 5GZOC 1QSVA 3V6OA 4FFVD 5L0QC 3LPFA 2DQIH 1OVZA 1MCOL 2PCPB 4J3OC 2EDBA 4Q7DA 3U2SB 3VWKB 4O5LH 5DMJB 3L3HB 3NFSL 3RWFA 4YLQT 4DEPC 4I2XB 4YAQA 2XXMB 2APWA 3HLAA 3TV3H 5GIRA 1I3RB 2CIIB 4GMSH 1MPAH 4ORGB 4PJXB 4Y2DD 1DQJA 4Q9QH 1I3VA 3SDDA 4KUCF 4Z7UA 2COQA 2BSTA 4RZCB 2ADIA 4MDIB 2DLTA 1J8HB 1OCWL 3WFBL 5I74C 1G84A 43CAA 5F7LB 4L8BA 4RBPK 1NUFA 3B9VA 3ARDD 2RHEA 3MRGA 5DEFB 2VC2H 4PJIF 4HH8A 4CW1A 5A1AA 5FO8A 1QQDB 4S10A 4R8WL 1DUYB 1MY7A 4NZJA 3FQXA 3MUGB 3CUPA 3TBSA 2H6PA 3DGGB 3ILQC 1A7OH 4YXHL 2ZCKL 4Y1AB 1OD7A 2IPTL 2HWZH 2XA3A 3DTXB 1NMCC 1T83C 3RWEA 3NCJL 4PJFA 3C8HA 3IAGC 5D2LB 4DOHB 1T04B 4ZQKA 5CEZL 4WI9A 4TULL 1R3JA 4P2RA 5IB4A 2B0SH 4LIQE 4P5KB 5CINH 5GGTL 3R0MA 4PRDB 4PLKC 3DRTB 2ED8A 2X89D 4FQ2L 5I1EH 4PTTA 3VMPA 2HJLB 3SGEI 2H1PH 3ILPA 4F9LC 4KK5D 4PGEA 2ZP0T 4YPGB 3BWAB 1NFDA 2VUOA 4UQ3B 1TPXB 3CXHJ 1J12A 1NKRA 4H88L 5EO1A 1AGBA 3QHZL 4MAUL 3D69A 1OTSD 5B38B 1MCWW 1N64H 4NBZB 1FN4A 3MRRB 2VITA 3KG5A 4NHUB 1V7MH 2ATPB 1FV1A 3WNPA 5F88B 5J12C 4K8RL 3B83A 4WY7H 3LQMA 3KHQA 3AS1A 4P9HH 4KZEL 3DUUA 3BD4A 4LARL 2AEQH 3E1F1 4BH7A 3NFPB 3V7AE 3KPNA 1I1CA 3U9UA 3A6CH 2O61A 2BXZA 1HH6B 1N7ML 2HVKB 4LPWA 3KPPA 2GJ6B 4V1DD 4QOKD 1FYTE 1IAII 5HHOE 1HKLL 4PG2C 2F53B 4NCDA 1JF1B 1GGUA 4NM8L 4PB9L 3KJ4C 3R4DA 4G43A 2NZ9D 4UILL 3RAJH 4KZDL 3ARTA 5IW6A 1A1OB 2CK0L 5H2BB 1LILA 4OZHF 5GGSA 4P4KB 3W39B 3FOLB 1TETH 4Z0BH 2UWEA 3PQYB 4HCRA 5F72S 4EEEA 3O2DL 5IW1A 1QVOA 4WFGD 1CFQB 5E6ZA 2V2WA 4R0LC 2HN7A 3QIUD 4WO4B 1TJHL 3S8WA 1ZXQA 4JE4B 1ZE3C 5T1MA 1N0LA 4PJBA 3BMVA 3T09A 5I1KH 1A6AB 3GBNL 4PY8J 3HAEG 4JO3L 1F4XL 1V8HA 4MGXA 5E8NB 5FK9A 4PGJA 5I1LB 2ZG1A 4FXGB 1NCCH 5GQBA 4OZGA 4QHNA 4HIHA 4P9ML 4LSTL 4NO2A 1UT9A 4WFED 4JANB 3L95A 4LIQH 4DJMA 4O51B 3UYRH 4FABH 4Q9RL 1P5VA 4NO5A 3AREB 1GC1C 1G7JA 1P7QB 3LS5L 3O6MH 4C56A 2A0LC 2HJKB 4R7DB 2F8XC 1AQKL 4TUOA 4DGYL 1CXEA 3MLTA 1ZSDB 1OM3H 4YDVB 4U0RB 5GZND 1W72B 5J6GA 5SX5H 3OPZL 2JJTC 1N6UA 2B4CL 4Y4FA 2FYYA 5IQ7L 2R2BB 3L7EA 2VLRE 1IM9B 3L3GB 1S7QA 4D8PB 3HPLA 5JORB 2ADFH 3MR9A 5T1LB 4I13B 3MZTA 1ZA6B 5IF0B 3D85B 2K7QA 3B3IB 4WHYH 2NR6C 1YJDC 2PXYA 2XWJB 3O3BA 2GY7B 2EECA 1T7XA 5IROA 1FH5L 1BZ7B 4JM2F 3SKMA 5HHPA 5FOBA 2VDRH 1FVEB 5L8JB 4Y4KD 1IT9L 1MJ7H 5SWZB 2X7LB 5BVPL 4JGMA 4CN6A 3WJLC 2YR3A 3R1GH 2N4IA 3MLUH 4WIQA 1Q0XH 2FWOA 3BUYB 3DMMA 4KDTC 5IB5A 1T5XA 2B1HH 2XQBH 3S37H 4HDIB 5GGUB 1J05A 3QWOB 5DJAA 2GT9B 4GQ9L 3NN8A 1RUPH 3SGKA 4Y1AD 3F62A 1FZKA 1RQ5A 3QSKB 4OIIL 4GW4A 1YN6A 1FPTH 4FQIL 1P4BL 1FNLA 3VFWB 1KC5H 5JNYA 3LRHA 2QR0B 2OR9L 4OGAD 4LLYB 4KI1A 4ONHB 2BJML 3Q1SL 1E4WL 3SCMC 4EIZC 5C7XH 1RZGA 1FNAA 1FC2D 3D9AH 4HKJA 2O5XL 4XZUA 4OM0L 3S4SG 3T8XB 4OCXL 1KYOJ 2QSQA 4OFYD 3RWFB 1UZ6E 5FGBC 1TJGH 4WFFD 3O3DB 2G2RB 4GFTB 4Z18A 5HYQB 1L7IL 5GIRB 1FNSH 1J1PL 2F15A 2AP2A 1KT2B 4AK1A 4RGOL 1ACZA 3MODL 1HHHB 1KB5A 3HUJB 2BSTB 2PO6C 4U1MA 3RDTA 4U33A 1RZ8A 3CFKA 3X13B 1WQVT 2J6EA 4HIIB 4I18A 6FABH 3G5VA 2GSIB 2WV3A 1WWCA 4EKXA 4W6YB 3D25B 3PL6D 1ZLUH 3KVQA 5KW9H 2F54E 1QSEA 4JFQB 4P2CG 1FNEA 5BVJA 2FD6L 4H0IA 5GRJL 1NUNB 4WUUD 4G8IA 1IEHA 1ZHBB 4G6AD 3OR7B 4PJ9A 2NY1B 4LSRL 5JO5B 2NX5E 3CUPB 3TBSB 3MA7A 2OQJA 2X1OA 3EYQD 5ICZA 5FF6B 4OUOA 1Q1JH 4TNVK 4BFGA 1JZ7A 1T0MA 3LKPB 3SHSA 1HSBA 1U8NA 1UKTA 4XMKL 1OARH 4WO4D 1XF5A 2J12B 4PBVC 1EK3A 1BF2A 1YEGH 4PRPA 5ETUA 3MYJA 1ORQB 4P2RB 3L1OL 1T4KB 5CWSA 5HD8D 1TCMA 4FQJL 5IKCA 5IVXA 1A6VH 5D1QC 1WBYB 3O3EA 3J7HA 5D7IB 1MHHA 4CDHA 1UKQA 2PN5A 2IPUG 3QAZC 3QRGL 3UTOA 5EU5A 1FZOA 1YMMD 2DLFL 4GLRI 5EO9A 1FFOB 1FL6A 2J2ZA 4G7YH 4P5TD 2VZUA 3TBTA 1NFDB 1EFXB 4TTDC 1P7QD 3B2VH 2Y06H 4U6XA 2X4UA 5F9JB 5EO1B 2PETA 4M93C 3D69B 4M1GH 1KN2L 2QQNH 5FCSH 2VITB 4JFHD 4JZOB 2DI8A 5AD0B 2GFBA 4MXVE 1E28A 2HFTA 4KK9C 5EZOL 9CGTA 3U46A 1A4JA 3CD4A 2D3VA 3DUUB 4PRHA 2YMXH 4RGNB 5IHUH 5EBGA 1KJ3L 3B5HA 4CNIB 1QLFA 3KPNB 3U9UB 3H42L 3D85D 4JHZA 5I73C 2O61B 1UM4H 3RVWC 2FECI 4HGKC 2EO9A 5SWSA 1GYAA 5JQ6L 1J0JA 3TYFB 2HTKD 4LVNB 3U0WH 1TLKA 4LSQH 3JWOL 3CPLA 3QR2A 3TC9A 4LOUD 5JW5A 2DWEB 1F13A 3O8XD 1S9WB 4OF5A 4PJDE 1XZ0A 2DBLL 2RIKA 5SWZD 1PYWA 5C71A 1XF2B 5IW1B 3ARZA 2VN7A 1CGSL 4EDWL 3LIZL 3C6SA 3P9MB 5CZVL 4ALAH 3RNQB 2YD6A 1X5GA 4U7KA 5GJSL 4YK4C 1NC4B 2YK1L 4XPAH 4KTEH 4Z0XA 5FK9B 4DN4H 1F11B 1VCAA 2A9ML 4JKKA 5IMKA 4OZGB 4QHNB 4MSWA 4PGCA 1QR1B 4L4VE 1E27A 3BD3A 4X7SL 1N26A 2C4FT 1EIBA 3L95B 1FBIH 4F7MA 3VXUE 3G9VA 4FFWC 4NO5B 4XMPL 3VXSB 4KJQC 5DZOA 1WFNA 2DMBA 1SQ2N 5GISL 1CE6A 5EUOE 4UT7L 1WBXB 1K8IB 1PVHA 5J6GB 4FQHA 4J3UA 4H8WC 4JG1L 2D03L 2XQYG 5ID0A 2MKLC 2XKUA 5FGSA 5E08H 1AFVH 3FO1A 1OGAA 5H35A 3TO4C 3SO5A 1UA6H 1S7QB 3HPLB 3ARVA 3MR9B 3F6LA 3QI9C 5DWUL 4P2QB 1DQML 5EU6B 3SDDD 5LVEA 4LDLB 4NQVB 3V5KB 5D2NB 5A2JH 3SOBH 3VH8G 2F5BL 1L6XA 3H3PL 2H9GB 5I1IL 3C5SA 4G8GA 4PJIE 4DZBA 1T83A 2PXYB 5C0FA 2F9BT 2JELH 4LU5H 4PJGF 3GIVB 5E8EA 3RGVB 5IVNA 1G6RA 3BGFB 5INCB 3G6AB 4MCZB 3ZYZA 1RHHA 5GRVL 5D70L 5FOBB 2FSEA 4X9HA 5DK3A 1XGUA 2X6MA 3QUMA 4FXLA 1FE8H 5HY9A 1M71B 3WL9B 1G7LB 4XCCL 5HYJB 5E6IC 2CKNA 2FL5A 2FWOB 2NY1D 4PIRF 1JPFB 1UVQB 1J05B 4F9LA 2OP4L 4WW2F 3QJHB 2I07A 2NLJB 2G9HB 3NBNA 4R2GD 1PX4A 4DKEL 3ZKND 4FZ8H 3MNVA 1X7QA 3DX9B 4GW4B 2HT4C 1OB1A 1QKZH 4QHMB 4KHXL 4YH6A 1AGFA 1NEUA 1WEJL 5I8OH 5H94A 5I1HL 4S0SD 1KXQE 3EKCA 4P2RD 4Z7WE 5DT1L 3L9RB 4RFEA 3A6BL 1MJ8L 2A73A 2DD8L 3IDIB 3WYRA 3GM0A 4QRRA 4XPFH 3GSNA 4XZUB 1EGJA 1YEFH 2E9BA 4QRPE 2P5EE 3FFDA 5ACMA 5DMGC 4M7JL 3ULUE 3MGOA 4QHLA 4MA7H 1BIIA 4JG0H 1P4IH 1TFHA 3LKQB 4PG2A 5GHWL 1G7MB 3ARQA 3BKCH 1CGTA 3C2AL 3I6GB 2GJJA 1HILA 3LY6A 1XEDA 1TTFA 2XT1B 3HE6C 3NIGF 1Y18A 4L3EB 1L0XA 4U1MB 2XKNA 2X4NB 3RDTB 5ADPL 5HGDA 1RZ8B 3CFKB 4EQ3A 1HHKA 1PX3A 5IOPA 3BEWA 3HG1E 1W2KT 5ESQA 4R0LA 4RGND 4YXLH 3QUYB 3G5VB 4NQDB 4ZFFB 4WFHD 3GMLA 3KS0H 5GS0D 4M03A 3MV11 1NBYA 3QEQB 3O81A 3JTSA 3HI6L 4TSAH 1QSEB 2OI9B 1B90A 5BVJB 1CU4H 2BSED 3BP4B 3Q3GB 4EI6B 2ESVE 3NCYP 4YWGL 4NZUH 1MAKA 1PLGL 4QRUB 3UROR 2ZUQC 1P84J 3DX7B 2V9RA 4LCCC 4L3CA 1D5MA 1KPUA 5A16A 5BOZG 4U6HB 4NC2B 2P8LA 3MACH 4F15C 1U8NB 1ADQL 1INQA 1KGCD 3LMJL 1U8HB 2WWMC 2G75A 4PRPB 3MYJB 3EOBB 2A6IA 1IVLA 2JJTA 4KROC 4DQOL 2VXSH 5IKCB 1NDMB 4S1SH 5IVXB 4NKIL 2YWYA 1A9BB 1QLRA 2R4SH 2R0KH 5HVHB 3GZKA 5FGCE 5CCKH 1MFBH 4MJ5B 1FL6B 1MFAL 4GW1A 5DR5L 4GKSB 4JY5L 3MOAL 5DXWA 5BO1H 2X4UB 1ZHLA 5GS1B 2R23A 4C56D 2EH8H 5TFSL 5KVFH 1L9NA 1GGCL 3ZE2F 1RULL 2DQTL 4PB0L 3ULUH 4HJGB 3P0YH 1NC2B 5CBEB 2NXYB 4X8JA 1OTTC 2DRUA 5C0NC 4K07A 4Y4FD 5FCUL 1I1YB 5GGRA 5FO7B 1OF2B 1S78C 3CLFL 3WJLA 4XBPA 3U46B 1A4JB 1U93A 4KDTA 3T3PF 3PWPB 1AGEA 4P5MA 1JJUA 1T2QH 4TVPL 3DNKA 1INDH 3L3KA 3L3OA 4FOMA 1LDPH 3O6LH 2ICWI 3CH1A 4P0DA 5SWSB 5TE6H 5C92A 3T4YB 2JJSC 4N8VA 2PXYD 4XBGB 3GMQB 2MHAA 4I3SL 5K9JH 1A47A 2HA1A 5CZXD 3E6HB 5BZDB 4OBRA 3KJ6L 3UTQB 4DCQA 3DBXA 4JZJC 5JA9A 5JW5B 4GAFB 1JHKH 2YPLB 2R0WH 3EJYD 3ZL4H 2F74A 2V5TA 2NW2A 1KCUH 4KTDL 3SCMA 2CLZB 1KNOA 3BN9C 1MFEL 1PYWB 3HC0A 1NBQA 2FATL 3CIQA 3MRBB 2ARWA 4LMQI 3DMMD 4H26A 3C6SB 2NY3B 5L0QB 4EQ2A 3UPRB 4UU9A 3FRUB 5D8JL 1Q0YL 5FGBA 1W8OA 4DEPB 3T1WA 1JHLL 3U36B 4Z0XB 5KSBA 5E8DH 1IC5L 3D0LA 1VEPA 3SO3C 1UXWB 5DMKB 4L29B 2VR4A 3L5XL 2BX5A 4Q0XL 3RWDB 1A6PA 5E5RB 5ENWB 2Z8VC 1RVFL 4BFIA 4EVNB 1BLNA 2PO6A 2I9LA 4FN0A 2B1AL 4WU7B 3TF7C 4PJAF 2XRAH 3OHXA 3R8QA 4LCIL 3V6BR 5BMFL 4JB9L 3EFFA 2NTFA 5ISZE 2CLVB 3HE7C 4PJEF 4NN7B 1AGDB 4FQHB 2GK2A 4HV8B 4XVTL 5ID0B 4Q58C 1YEIL 4R3SA 4Y89A 2Z92A 1K4DA 3V4UL 2D0HA 3ROLB 1LO5A 1OGAB 3SQOL 2W07A 1A7PH 1OPGL 3GSOA 2BNRA 5C0DA 3LB6D 3TFKD 2MNUA 5E99H 5D93C 4ODSH 1BZQK 4RBPH 3RDTD 3C5SB 3ZSTA 4G8GB 4NJ9H 5C0CA 3MA9H 5HVGB 3I9GL 1NMCB 3V6ZA 1FYHB 4DZBB 3G04A 4IIQC 2XZCH 3LKRA 1B2WL 4HJ0C 2MJWA 5EOCH 4L8CB 1P2CA 1F90L 1RHHB 5E2UL 5IBUB 1QSED 5CGTA 1H3VA 5D1QA 2F19H 5I16B 2X1XR 1C5DA 4F57H 4R7NA 4ZXBC 2FL5B 4PJ9D 5EA0H 4RQQA 2P42B 1NCBH 2CGRH 1AHWC 5I2IB 2I07B 1VGKA 4MHHG 3EYVA 2C1PB 1I8LC 3MFFA 1JPGB 5E00B 2FJFA 1ZLVK 1OB1B 4U6VL 3O41A 7FABH 3PF2A 3IDYC 4PRPD 5J12B 4QCIA 5K9KB 5LWYL 3WKNA 5D6CA 2A73B 1X5XA 4R4BB 3GMMA 4QRRB 7CGTA 1ZWIB 3ZYOA 3TH4T 5D5MB 1LO0H 3FFDB 4NDMA 4JCMA 4HEME 4N0UB 5C2UB 3W81A 4KKAC 1OOAA 4O9HH 3MGOB 5GGRY 1X9QA 2NY2D 2D7TH 4HLZG 2DQIL 4QHLB 1BIIB 2VO5A 1B0WA 5J13B 3RVXC 3EW3B 4O5LL 2G5BB 4RMUA 4O4YH 1HILB 1UWEH 5JXAH 4LVOB 4MXQC 1BWMA 3TV3L 5E4EC 1AQDB 1MJJA 2ZUSA 2AJSH 3IJHA 3P77A 4RAVA 4PREA 4GMSL 1MPAL 5IB1B 2M2DA 1B4JH 2XKNB 4Q9QL 1H8OA 3OB0K 3H3BC 4MHHI 4OTXH 3D3VB 5ESQB 4YHMH 4OT1H 4PRHD 3PWPD 3FONB 3GMLB 3S36H 3H7BA 3WKMH 1CL7H 3O4OC 5IB2A 1IE5A 5SWSD 3IFPB 1OSZA 3IF1A 5E8PB 3T0EC 2CPCA 2VC2L 4HGWB 3M1BA 5CHNB 2FLBT 4XC1H 5B38G 4ZDHB 1N5YH 2R15A 2YEZB 4Z76A 1FP5A 5E5MB 4ONFH 1YEDA 1HDMA 3SDCC 4L3CB 1D5MB 1KPUB 4FRWA 1T1ZA 1MWAB 3MXVH 5D1ZA 2LE9A 1A7OL 3WDIA 5GZOD 5IEHA 5JW4Q 3TESA 1EAPB 2HWZL 4JAMA 1D5BA 5SV4A 5HXMA 3OSKA 1QHPA 1YC8A 2G75B 4ODXB 4F3FB 5DJXA 3O9WC 3L3IA 5DO2C 3T3MF 5EDXA 2OJEA 5TE4H 3H9SB 2FZ3A 1Q9LB 2B0SL 5DZLA 3TO4A 5CFHA 1M1SA 2OK0H 3QI9A 5CINL 3C5ZB 4OV5B 1ES0B 3X11B 1BWWA 4KQ4H 4OFVA 4I48B 5I1EL 2HYMA 4XP5H 3RUGA 2R2CA 4GW1B 2BOCA 2WM0A 2H1PL 3O11A 2FEEI 4MNGE 2CXKA 5BRZB 2R23B 4MAYC 3UTPE 5BS0A 2IF7A 1P4LB 4NFDA 1I7RB 2ARJA 2A77H 1N64L 2D7NA 4LEXH 1EERB 1MHCA 1V7ML 2VZ1A 5GGRB 4HC1A 1OGAD 1QD0A 4HX1B 4XBPB 3CFIC 4PLOB 5E6IA 5EU7E 3BO8B 5C0IA 3WLBA 1DZBA 5DJYB 4WY7L 4P5MB 2BRQA 4ODBD 4P9HL 3ILQD 4H0HB 1YYMH 4L4TA 4WI6A 3OKLB 2CH8A 1U3ZA 2B2XH 2AEQL 3CH1B 4G8GD 4X6BA 3BJLA 3A6CL 2VKWA 12E8L 4D0DA 1LK2A 3DBXB 4PJXF 3BMWA 5F89A 1PDKA 1ZT1B 1CN4A 4JFDA 2F74B 1EZVX 4NNXB 5CMAB 3VFTA 5IR1A 1E4XH 2VLMD 4HKZB 4ISVA 3RAJL 3VI3F 4PLKD 2W91A 1I8KB 2IANB 5CEXB 2I60H 5CIPA 5EBLA 2EDLA 5DDHA 1URLA 4YNYA 3NA4A 4H26B 1TETL 4Z0BL 2XI9A 3BT2H 1MCQA 4KTYA 4RFNC 4C55A 3N1MC 4JO2H 3SJVE 3HMXH 5CBAB 3CSYA 4NO3A 2FCBA 2XWTB 1LO3H 2QHRL 2YD4A 3NH7H 5KSBB 3OGOE 3T4AB 3DO7A 3QT2A 4NKOA 5E1AB 2YD2A 5ITFB 4PJ5B 5I1KL 2DJSA 3LHPH 4LLWA 3F12B 3D1MC 1NCCL 2FJHB 5JW4M 3OKDB 2W9EH 4J4PC 4QXTA 3WO4C 5HSFA 3HE6A 3CC5A 5IHZA 3TZVC 5ELIA 1A14H 4O2FB 3K81A 5DVKA 4WNQB 4R4NC 2JTDA 4LCWE 4LIQL 3OKMA 4QRRD 3B5GA 3UYRL 3OHXB 4FABL 2A6DA 5D2LF 4DUVA 1M4KA 2CKBB 1RU9H 2A6KB 3UTZB 1TNMA 3O6ML 2NTFB 2EYTA 3VWJC 4OZIE 1CFSA 2Z92B 4MDJA 1OM3L 2WANA 1Q9OB 3NIGE 5DD6B 1CDBA 5ESAA 5GGVH 3MBEC 5DHVB 2Z93A 3LN5A 3I75B 4LCCA 4LCYB 1ZLWK 2ADFL 3ARGC 1UENA 2FHFA 2DKMA 4FFYH 5C0CB 5DYOB 4FP8H 3G04B 1MQ8A 2X1WL 3LKRB 3B43A 5GRXG 5ICXA 3MV7E 4QNPF 2JCCA 3F5WA 1BD2A 4HG4J 5MHSD 2FR4A 2P8MB 4CN1A 1Z6JT 1UB5B 5D1QB 4R26H 3V5HA 1C5DB 2UZIH 5C0AA 1KOAA 2VDRL 4HEPG 1H3XA 1XGTA 1PKQB 5SWQA 1MJ7L 1D6VH 5F1OB 1HNGA 3R1GL 5I30H 3MLUL 1Q0XL 1OAZH 3TCLB 1VGKB 2D0GA 3QULB 2B1HL 2XQBL 3S37L 1PGRB 3TPUB 3EYVB 4NQCB 1MCNA 2A0LD 3MFFB 3OKEA 2GTZB 2UZYB 2VLKE 3ZKQD 3TBWA 1LQSR 4ZFGH 3MRFA 1AR2A 2VLLA 3RWJA 1FPTL 3E0GA 3OB8A 2HFFA 2ARJQ 4PG9B 1KC5L 5CLWA 5LQBH 2VISA 4HFWA 3GSXA 3GMMB 4GXUM 1JZ4A 1XGYH 1CD8A 2VAJA 5C7XL 4IJ3C 3QUXB 3D9AL 4H1LB 2BY2A 4IOIB 4NDMB 2X4QA 3MUJA 4PJHA 2NR6D 3S7GA 2JJSA 4C4KO 4ZMAT 3K0WA 2BNQA 4L9LB 2HH0H 5J0BA 5EBMB 4XVSH 3A6OA 1TJGL 3KYOB 4JZJA 2CLRA 1GJIA 4N9GA 3LKNA 2IALA 1FNSL 2DQEH 3P77B 2VXTH 3RWCA 5CSBA 1CXFA 5HPOA 1MHPH 1R3HA 3GNMH 4NGHH 4CVWA 1UYWH 4OFDA 4XNXH 5MEPA 3HR6A 3VE0A 5EG6C 4LEOB 1IEBA 1NCDH 3H7BB 4RMSA 1FZJB 2Q7YB 4YK4B 2R1XB 2IC2A 1NBVH 4HZLB 6FABL 1U0QA 3QUZB 1OSZB 4ZNEE 4XH2A 3PABA 3VXQA 4MMXC 1AD0B 1YNLH 5KW9L 4MZ3A 4M7LH 3RWHA 5JTWA 3IU3B 4WGVB 4HS6A 5FYJE 4FFZH 3WN5C 3FAXA 3VG9C 2YN5A 1BVZA 4P23C 3SCMD 1IQDA 2GSGA 4YBLC 1K3ZA 2UVEA 1DDHA 4ENEC 5JPMA 1Q1JL 1BX2A 5CAYB 3HE7A 3ES6A 1NMAH 4PGDB 1OARL 5DJXB 1IGTA 3L3IB 1HXMB 1IMHC 2OJEB 5HI5C 1IEAB 1YEGL 2FZ3B 4IMLA 3IAPA 3TO4B 2NY5C 3WFHA 4I9WD 4L8DA 4PJAE 1A6VL 1CDUA 1WWAX 3GSVA 3AB0B 2Y5TA 2JIXB 2PO6D 3MJ6A 1TCRB 3C2SA 3SPVB 3N1PC 4KU1A 1I1RA 2BOCB 3O11B 3MRQA 4Y5VC 3QQNA 1TQBB 2ZUTA 4IIQA 4G7YL 2YWZA 3K7UA 3N85H 2YD3A 3B2VL 2Y06L 2CDEA 1I9IH 4OD1H 3QISA 2VLJB 5ID1A 1BZ9A 4M1GL 2ARJB 3KNBB 4NRXA 1UJ3B 2QQNL 1KEMH 1HYSC 2YD9A 3U1SH 3WS3A 4C83A 4ZXBA 3BKYH 1TITA 1ZEAH 5DURB 5KSAB 4CKVX 4LHUB 4KJPC 4JRYB 2BNRD 2HLFC 1PY4A 1MLBA 4JJ5B 3C09B 1INEH 1AHWA 4L4TB 5C8JB 1CL7I 4ZO9A 2YMXL 2J4WH 4JFYB 5IHUL 1EPFA 1EHLH 4N1HB 5C0CD 1I8LA 1A3LH 4PPTA 1RZJC 4N90D 1B0RB 5F89B 1MELA 1JWUB 2Y25A 3GMNA 4NQXA 3U0WL 4A6YB 4Z7UF 5GRWA 4LSQL 1KJVA 3KPRE 4JFDB 3HUJF 2IEPA 2OS7A 4DTGH 1FJ1B 1SYVA 5D1QD 4UIKH 2AI0H 4O2EB 4Z7VB 1NAMB 5CIPB 5F1SA 3NPSC 4NN5C 5FYJH 5F7EH 1NPUA 3IXTA 2MKWA 5JHDB 1CK0L 1TIUA 4KI5C 5M95B 4TTDD 4LLVA 3BZEB 4ALAL 4P3DB 5HHNA 3DO7B 1WAAA 2LFGA 5FKPA 3ZDXF 5DD0H 4LLWB 3HNSH 4KTEL 4MA1B 4I4WB 4XPAL 4DN4L 4JFFA 1CS6A 3GRWA 5DJDB 1CIUA 3VFUA 4KK9D 3E2HC 1MCJA 4DAGH 1U8IB 1FBIL 1R3LB 1X5FA 2MPAH 1WBZB 1J5OH 2P7TA 4GG8A 5KOMC 3CDYA 4R96A 4K55A 3RVWD 1OSPH 1C16A 1AH1A 3BQUC 3M8OH 5IBTH 3S36X 2EKJA 3QG7H 3T0EA 1J8KA 1QRKA 1P1ZA 5D7IF 3TNNA 2DWDB 5E08L 1AFVL 1R5IA 4J1UA 2ZZUT 3IAQA 2VXVH 2Z93B 3BP7B 3RHWF 1U91A 3SDCA 1UA6L 1AXSA 1NFDF 3ARWA 1MQKH 5I18H 1KEGH 2PTTA 3SOBL 4X7EC 4F15B 1NLDH 3DIFA 4JREC 1JE6A 3F5WB 5J9PA 1S7VA 3QUKA 2JELL 4LU5L 3O9WA 2GK0A 4BQ6A 4JY6A 4RAUB 2FR4B 1S9VA 4MD4B 4UAOB 4Y88A 4OCNC 4QXUH 3PIQB 2ED7A 4KQ3H 3V5HB 4V1DE 4JJHA 1XGTB 1FE8L 2GCYA 4ODUB 5HDQH 3P0VH 1I7ZB 4YFDB 4ZUVB 3UBXA 3BRDA 3QHTC 4FFWD 1ORSB 4KJQD 3NZHH 4PRNA 1CDGA 5D1ZD 5KVEH 4MAYA 3T3ME 1I8IA 3AAZA 2OTWB 4FZ8L 1MWAH 2DM4A 2VLLB 4LNVA 4WFGE 5DFVC 4KKBC 1DBMH 3DV4A 4BELD 4PRIB 1QKZL 1PQZA 1FLTX 5I8OL 2H26B 2XTJC 3TO4D 2BP3A 2XWBA 4RWYH 3QI9D 2X09A 3RWIB 3GSUB 4NQSA 5IMOB 4PJBF 4XCEA 4XPFL 5ADOH 2K7PA 3QWRA 4U1IB 3AXLA 1YEFL 3ZYIA 2D31A 2CJUH 4M61A 2BNQB 4OZGF 3OJ2C 5KS9B 4TSCH 4XNQA 4MA7L 5BS0D 4JG0L 1P4IL 2CLRB 1T7YA 3BPCA 1A6UH 3BKCL 2DM3A 4I8DA 5TGBA 5HGAA 2EDFA 5DVNA 4GG6E 5LXGH 5E6ID 5DURD 5HGHA 1G9NH 2J8UA 2X2YA 5MEPB 5BJTA 1LP9E 4UT9H 3BGMB 3C5JB 3HPJB 5C0RH 3U30C 4L4TD 1D9KB 1IEBB 1QSFA 3PHQB 4YXLL 2HP4A 4S1RH 3LKOA 2LU4A 1CG9A 1L4IA 2IFFH 4MJ6B 3DURB 4XH2B 2HT4D 3PABB 3RWGA 4JR9H 1JRHH 2Y07H 2A6JA 2VXUH 1RUAH 4Q6IB 1RJYA 4TSAL 4X6CE 1CU4L 4HS6B 4J4PA 4ZO6A 3ZTJH 1IGJA 1YMHB 1ZA3B 4NZUL 4JFDD 4FG6C 3TZVA 2KL6A 3WXWH 4GBXC 5DHXB 3MUY1 2GAZB 3LPWA 3P4NA 1VGEH 1LE5A 5JPMB 2WP3T 4DZ8B 2C5DC 5JOPD 5DMGD 3UTSB 2Z91A 3HB3C 1A22B 2BVYA 3ES6B 3MACL 4QF1B 4WI7A 5J1AA 3VWJA 4JVUA 1LO4H 2IH3B 4TOYH 2H2SD 5F1IA 4QYOA 1H15A 3EOAA 4XX1E 5ANME 3IFOB 4NYLA 5DD5H 3T0BA 3WFHB 2VXSL 3MBEA 4S1SL 3ZSSA 1XAUA 5GJTH 3NIFE 3PG2A 4DOHE 5E95B 3HE6D 3GSVB 5D1XB 3DGCR 5D7SH 2R4SL 2R0KL 3CNKA 3ARGA 4OCSH 5AWNH 5K9OB 2AERT 4PJ8C 1G7HB 1LEIB 1QRNB 1U95A 2PYFB 5CCKL 1MFBL 3QIWB 4HULB 2OL3H 3DARA 5BO1L 2CDEB 3HFMH 4WW2C 1JTPA 2EH8L 5MERB 5KVFL 3V8OA 1BZ9B 3UC0H 1WGOA 3G08B 3GJFB 4QWWC 3VXNA 3VRIA 1Q94B 1UC6A 3Q5YA 3ULUL 3P0YL 4ZXBB 5IM7A 4WFFE 1BQHG 4ZFZA 4ODWA 4ZUUB 1GXEA 1CDYA 1KIRA 3KDMA 4ELKA 5DTFA 1RD6A 1RK1A 3D18A 3KYNB 3KLHC 2RQ8A 1CXHA 2P48B 3PJSA 3MLXH 3MNZB 2AS5M 3ECBB 1T2QL 3CVHH 3FCTB 1INDL 3EAKA 4MYWB 3RY6C 4EXKA 4Y4HB 3HR5A 5FYKE 1LDPL 3WFZA 3O6LL 1U6AH 3VDAA 5TE6L 2WWMD 5IK3B 5HYIA 5K9JL 1WF5A 1BD2D 3B9KC 4J3XA 4NQXB 3VCLB 1WIUA 4KROD 4JHAH 1GAFH 1HI6A 1NCTA 2X9XA 1JHKL 4Z6AT 2R0WL 1CVSC 1OLZA 3ZL4L 5C0AD 5KVGH 1KCUL 2CDGA 4WUUE 3FAWA 5IVOA 5JXEC 3B4NA 2AEIT 4G42B 4Z78A 3DWTA 3RIFF 1ZLVH 5DS8A 3FB7B 1EHNA 2E27H 3M45A 4UI2A 5HHNB 2Z31B 5H8DA 3IKCB 4PJ7B 5I1AA 3DRQB 3BPOC 3W5MA 4WENB 5E8DL 5E4EB 3EO0B 1KELL 4DGIH 5C0GB 1OTTD 5C0ND 4D3CH 4G6FB 5IBUG 4NZDA 1S78D 1Y6NR 4OSUH 1MCPH 1MVUA 5TDOB 2HRPH 4D2NA 2EE3A 4Y19A 5EOCJ 2R2HA 3WNKA 2DJUA 2HKHH 4H20H 4KKCC 3O4LB 4HMDA 3IJSB 5FM5M 4YGVB 5A2IH 2XRAL 4QRQB 4HH9B 3O4OB 4U1GC 3STLB 1YMME 5IVXF 4E0RB 2BNQD 4AMKH 3PWUB 5FB8A 3LPGA 4XP1H 4JDTH 2BSRA 5F6HJ 5IQ9A 2IAMC 3AMLA 1WFTA 3OB0H 1KPVA 3WN5A 1UZ8A 2V7NA 4P23A 1A7PL 4JFHE 3BN9D 2LU7A 2DKUA 3GGWA 4N5EC 4MD0A 2PTTB 5E99L 2JJUA 4ODSL 4F37K 3X3GH 1A2YB 2P47B 4NJ9L 3MA9L 1H9VA 2DQDH 3PGFH 4HWNA 2XZCL 3QUKB 4UOJA 3S98A 1MY5A 2BRRH 1DEEB 5EOCL 5DMYA 4ZO7A 3MRLA 5I1DB 2EXWC 5FYKH 2HJFA 1ONQB 4GRWE 1U8KA 4WTZG 2F19L 4OCWH 4F57L 5IIEA 3UBXB 1BM3H 3O45A 3IS1X 5EA0L 3S34H 2PR4H 5EOQH 2E5EA 4Y5VA 3SE9H 3UZQA 4MX7A 1NCBL 2KZ1B 2CGRL 1JK8B 5DD3H 5B3JF 4MWFB 1I8IB 4XHJC 3ZKXB 5GSRA 5SWZE 1MLCA 1FSKB 1ZLSH 3HE7D 3IB4A 3DV4B 4Y5YC 2ZOKB 5DQ9A 7FABL 1PQZB 3S35X 2OLDA 4RMVA 4X7TA 4HUWA 1ADQA 4E41A 1X5IA 4LP5A 5F1NA 4ZOAA 5HBBA 2EDKA 1F02I 2XV6B 4NQSB 4WJ5B 4D9QD 1I3GH 4OZ4A 3QCUH 2PW2A 3AXLB 1EHXA 1LO0L 3HZVA 5AZEH 3STZA 1QACA 1EDQA 4S2SA 4O9HL 2X4SB 2BVOB 3CCHB</