1C08A

Crystal structure of hyhel-10 fv-hen lysozyme complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-HEN EGG WHITE LYSOZYME ANTIBODY (HYHEL-10)
publication title Crystal structure of anti-Hen egg white lysozyme antibody (HyHEL-10) Fv-antigen complex. Local structural changes in the protein antigen and water-mediated interactions of Fv-antigen and light chain-heavy chain interfaces.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 25
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1999-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c08A00
2EDWA 2P5EA 3ROLB 5J13B 2VXUL 1JK8A 2HJLB 2NY4D 2XZAH 3QFJB 2Z93A 3G6AB 1QRND 5DJ8B 2VZSA 1JGLH 4MAYC 3CFDA 5AWNL 1IGYB 1KJ2H 3FQXA 5D2NE 1DUYB 2XY2A 3PABA 1MWAB 3AREB 4H20H 1SJEB 2EDOA 3OKDB 3UTQB 3MJGX 5C7XH 3GM8A 2Q8BH 3MODL 3NA9H 1XR8A 5EC1A 1JF6A 1GPOL 3TPUA 1J7VR 2YPLE 4KUZL 2P7TA 2NY5C 5F1SA 2ITDB 5MHSD 1T89C 5BMFH 3IDJB 1MCQA 5IB5A 2VLRA 3QJFA 3TO4B 4ZDHA 3TO2B 5HGHB 1MAMH 1T0NB 3WXWL 3AVEA 3BE1H 5T1MB 3MXWL 4XC3H 3OKOA 3B9KD 3GSXB 3SKJL 3U4BH 2CQVA 4LFHG 4Y4FB 2XWBA 3HMWH 5C0EB 1FV1B 2IPKA 5FK9B 4M1CD 4QXWA 4HWUA 5EBLA 1IILE 2IMNA 1Q94A 1V05A 1I4FA 4Q6IB 4LSTL 5FYKE 5IT2L 2E8YA 3BQUC 3MCG1 5ACZA 4M7LH 2A73A 4YQXL 1ZT1A 2V7HA 3ZDXE 2E6PA 4G43A 5HDLA 2VQUA 1EEYB 4L4VB 1YEDA 3IFPB 4X9GA 1YECH 2BSRA 5HYSG 4ZTPL 3QIBA 3QCTH 3VXUA 1XF5A 1KTDB 1M4KA 3L7EA 4KC3B 1UKQA 1IAII 1G9NC 1HHJA 4FG6D 3D1MC 1VPOH 2VL4A 2ADIA 4XX1G 2MQCA 4HXBL 4BA8A 1MCSA 1G9ML 3T0EB 5F88B 3O6FA 2GJ6B 2UV3A 1G7QB 4JLRB 3T0DA 2KUTA 3FCTA 3QH3A 5IF0B 4IOFC 1Z3GL 2EIZA 3PL6A 1AO7A 3MA7A 7FABL 2AJZB 4UIKL 4XP1H 4PJBE 3LB6C 3MRCB 1NBQA 5FYLH 5JORA 3P4MA 3WN5A 2NLJB 4QRPA 4U1GB 4DVRL 3T8XB 5BRZE 2DQFB 3QHFL 4GMSL 4HPOH 2CMRL 3RVVD 3DIFA 4RWYH 5B8CA 3QUZB 3PWUA 4GMTL 2EECA 5ISZD 1BQHA 3HC3H 1Z9SA 2FH6A 1I3UA 3D9AL 4PRIB 1U8PA 1YQVH 3LN5A 1U8OA 5BZWA 1KPUB 5DMGC 2ESVD 1G6RA 3L1OL 3ZYIA 4AH2A 1A4KA 5FEBA 3FO2A 4G80A 4UTBH 4TULH 1PJ9A 4JQVC 2APWA 2DS4A 4AIXA 4P57B 1D5BB 1KIQB 1C5BL 1A6ZB 4MNGE 2UVEA 3W9DA 5J13C 4LGPB 4CN1A 2VE6B 3QQNA 2X5PA 1BFOB 4OGXL 4EI5D 4HH9A 2EEDA 3SHSA 5I74B 4FXKA 5MEOA 2AEQH 1UZ6E 1ZANL 1E4KA 1JJUA 2APTA 5E8NA 1HH9B 1NC2B 2XPGB 5E4EB 4LEOB 1IEBB 5EPMB 3W81A 4PJEE 4HBQA 5I0ZA 2ORBH 1MY7A 2HTKC 5TDNA 1C08A 4X9HA 2HAZA 4U6VL 3QUXD 2ARJQ 4TUKH 3WSQH 4D0BB 4RZCA 3RVXC 4XCNA 1D5ZA 1UWEH 1UG9A 2GT9B 3C08H 3OB8A 2AERT 5JA8B 3FFCB 4JFFD 4J3VA 1LQSR 4ODWB 4M3KB 5DD5L 4I2XA 1JZ5A 1OGAD 4ZAKD 2A1WL 1KYOJ 3MOBL 3CU1A 4J8RA 3QIUD 4NO5A 5IQ7L 4UB0L 4OCSH 2DQUH 5F44A 4MS8D 1YEFL 2CJUH 4KJWC 5BV7B 4RGND 3D3VD 1YNTA 1MQKL 1Z5LA 4LCYA 5CLTA 4PRHA 1IGCL 2V2TA 1I8IA 4PR5B 1LP9F 4GFTB 2D9CA 1YNKH 2DJ4A 1JGVH 1BZ7A 2ZG1A 5EU6D 3JV6A 5J6HA 2VKWA 3HE6B 2GAZB 2I07A 3VH8G 5EO9B 3KS0J 3ZLQC 1BHGA 2FLBT 2AXGA 5GGTL 1JMZA 2BHUA 2OCFD 1CGXA 5CEZE 4HGWA 2NY0D 1QA9B 3NZHL 5CAYB 5HDQL 5A2JH 3P11H 2VABB 1MRFL 4OCNC 5D1ZC 4K07A 4HAGA 2JIXD 3NN8A 4HWEH 4NO0B 2JB6B 3JTTA 3VWJD 1EUTA 1ORSB 4OD2B 3ULUH 1QTYT 1RZIA 1KB9K 1DDHA 2FECL 1CR9L 1INDH 4OCXH 3WNPA 1B3JA 4X5WB 2FD6H 1AD0A 4JY5L 4Y4KA 3KS0H 3SDCA 1YUHA 1CFSB 4YPGB 4FS0A 4X0KA 5HDOA 4P4KB 4PRNB 5DFVD 1CT8B 2P5EB 1BBDH 3SDYH 1A7OL 5AD0B 1JK8B 3RTQD 3ZDYE 4Q2ZA 3LEVH 5TQ2L 3P30L 1BZ9A 1QRNA 3L3JA 5E1AB 5LJYH 2L7JA 1T7ZA 1S9VA 4YGVA 3FQXB 2GTWA 1HINH 5E2VH 2ZUTA 2FB4H 1XF3B 1A2YB 3PABB 3NCBB 1Q9KB 3MLVH 5IBTH 1K2DA 1OW0C 3H3KA 4GXUM 3RDTD 1KB5B 3BWAA 4OJFL 5AUMB 2IH3A 5DZOA 1PBYA 1XR8B 5GXBB 1IARB 5F1KC 1AHWB 2R1XA 5JXAH 3MRJA 1NMCC 3EYSH 5EBWA 3HS0B 1EBAA 1HSAB 3T3PE 1UZ8A 1HHHB 4XCCL 3VG0H 2XNAA 3BESR 4QRRE 1EEQA 1I1CA 3KWWA 5AWNH 3BP7B 1QG3A 3FHQA 4RRPA 5F1OB 5I18H 4LSQL 3UYRH 4HKZA 3VGHA 1ZHLB 1JF5A 3I9GH 1RZJH 5E4EC 1TZIA 3B9KA 4I0PD 3L5JA 4XAKD 5B38A 4Z7UE 1TXKA 2YK1H 3BPCA 1U8NB 4OFIA 3NCMA 4ZO8A 3S3JA 5I1IH 5K59F 1G7HA 1MCJA 3VXMB 4QHUB 3MOAL 5ACZB 3FT3A 4R90H 1T66D 3VFVA 5GHWH 3CVHH 4HH8A 5J56B 3FQWB 2IALB 4M9PA 2E6JA 1QLEL 3SQOH 1OTTC 1YEDB 3L9RA 1UM5L 1AGFA 3MUGB 4ZFOL 2YWYA 4DKEL 5DJDB 1FZKA 2W60B 4U1HA 3QDHA 4Z7VA 1A7RH 3L7EB 1NCCH 4N9GA 3QFDA 3CMOL 2HH0L 4KMTL 2D3VA 1JPSL 5HPMB 4Y88A 2ATPB 2Y1VA 1I1FA 3O2WH 4EZMA 5SWSE 4HCRL 4KVNH 3TF7C 2O61B 1U8IA 5E2TL 1I9RH 2WWMC 3OQ3B 3O6FB 1ULVA 5CD5D 5DXWA 2OTWA 2CH8A 3GJFK 1DVFC 5FGBC 3FCTB 4YO0A 1NUDA 4LAQL 2OL3A 4HXAH 3WS3B 2OJEB 3RY6A 4KZEH 4NPYA 4Z18A 1R5WA 3BISA 3LRSB 3HI1A 5JZ7D 2C4FT 5JORB 3NIDE 1CF8H 3C8KA 5HI4D 4R4NC 3UJJH 3BDBA 1RUPL 3L7FA 5HSFA 2FIRT 1HYRC 2NR6D 5I1JL 1JZ6A 2IADB 1FGNH 5DMIH 3RA7H 5ISZA 5T1DL 1E6OH 4EN3B 4N5EC 1BQHB 2LE9A 1FFNA 3M17B 1Z3GH 2XKSA 3LN5B 1QR4A 2FX8L 3F7QA 7FABH 2ESVA 4GW5A 3V6OA 1NPUA 2G9HB 3V4VL 3FO2B 4IDJH 3S36X 3K80A 2OR7A 1X5YA 3B4NA 4DVRH 3MRDB 3UTSD 3QHFH 3PP4H 3QEHA 4N8PA 5IP4A 4Q9RL 2XA3A 1LK3L 4CMMA 4MXWL 4JRYD 4PJDE 4TYUA 1D5MB 2G60H 3MSPA 4I3GA 1TJHL 2ITCB 2P5WE 4CVUA 4EI5A 2HFGL 4HH9B 2AJXL 1YPZB 1PGRB 1R3HB 4P9HL 2AP2A 3T0VA 4PV8B 3L1OH 2OSLA 4FQJH 2Q6WA 4OI7A 4HLZG 4XBEL 1X3DA 4Z8FH 5EB9A 1LO5B 3KYOB 5DUPL 1RZGA 2DI9A 5D2LA 1FO0B 9CGTA 5CBEA 3QUXA 4F57L 1CIUA 1IBGH 4MSWB 1O7VA 1Q0XH 1LWRA 3QNYA 4X7CC 1SEBB 5C08B 3PWVB 2Q86A 3O11B 4KJQD 4K3JL 4PJFE 3CSGA 4XCNB 4NM4L 1ZANH 3AY4A 1Q9OB 4F3FA 3H8NA 4NP4H 3U4EA 4JFFA 5EUOB 4KKAD 5C07E 1CDYA 4PJGF 1KCSH 1OGAA 4ZAKA 1BD2E 1FL6B 1RZFL 4LQFL 5GZOD 3KYMA 2J5LC 1MNUH 1UWGL 4U6VH 3QIUA 1DQJA 2E5EA 3U9PL 1HILA 1YC7A 1SHMA 2QTEA 3D3VA 3WFBL 4U1KA 4M6ML 3BAEL 3LDBB 1ZXQA 4GBXD 3RNKA 4WFFE 4RA0C 4QTIL 3KPLA 4X9BA 5IVXA 3KLHD 1Q9LB 4KUCF 3VFPA 5JHDD 4JDTL 3Q6FB 4OF3A 3D18B 5C71A 5EIQA 2A1WH 4Z7QF 5EU6A 5JPMB 2IF7A 3JV6B 3MOBH 1NFDE 5TDPB 1DP0A 4HBCH 2R1YB 5IQ7H 2I07B 3QIBC 3CD4A 2AXGB 1GZPA 4OGAD 5H94A 4HGWB 4M8VA 3RIAK 1A1OB 4NOFA 4WUUE 1DBJL 1FBIL 3IFNH 3GMOB 1IGCH 1IKNA 1PKOA 2AJUH 3ZZ1A 2JIXA 4HZLA 5F1NB 4HGKC 5TDOA 5HHMD 3O6FC 2VO5A 1DEDA 3RX5A 1FH5L 3VWJA 5J57B 4GAJL 4A6YB 3RUGF 1VFUA 3REVB 1UB6A 4Y19E 1QFOA 3PL6C 4ZOAA 2NCMA 2YXMA 3CC5B 1ZGLM 4TVPE 2M2DA 5GGTH 3GUTB 4X5XA 5B22A 4XVJH 1MCEA 1ZTXL 2BX5A 1LD9B 4ONOA 2VAJA 4Y4KB 3WN5C 4EIZC 1XCTA 1HCFX 5L88H 4RAUA 3BO8B 3RPKA 1YUHB 4X0KB 3CPLA 4PBXA 3QDJD 4HS3B 5E5MA 5B8CC 1P7KA 4KK6C 3RTQA 2WZPD 5EOCJ 4FMFA 1UYWH 3L3JB 3A6CL 3X13A 4XCEB 4A2LA 4N68A 5ALCL 4ZPVA 1CR9H 3EJZC 3P9LA 2W9DL 1FIGL 3ALXA 3SDDD 5GS1A 2R2CA 3ULVF 4L1HA 3RDTA 5C3TA 2IH3B 1AGDA 1A0QH 4PYHA 3ABZA 1CLOL 1A7OH 3VXQA 4GG8A 1VFBB 2G2RB 1DEEA 1YN6A 5TQ2H 3MNVA 1OAUL 4H0GA 4PJXA 1UZ8B 2C26A 4KRNA 5I73C 2NXYC 3RP1A 3RFZC 4L8BB 1IGIL 1E4KC 1IC7L 3KXFE 5EWIL 3GHEH 5EOCH 1LO3L 4DKAA 3OAZH 5DT1L 4HKBB 4APQD 4JFDB 3GIZL 4LKCA 4J2XA 4XXCA 4I0PA 5ALBL 2BVOA 5B38B 1CGSH 3WEXA 2OBGA 4Q74A 3DSFH 5IB3A 5GS3A 1SVCP 3F7RA 3NCJH 1XEDA 3T0AA 4PJHF 1U9KA 3RAJL 3LN4B 4L8DB 2MKWA 4UQ2B 4RWHA 3RHWF 1GCFA 2VAAA 4OZHF 4OT1L 4PTTB 5D71H 4JFPB 3NIFE 2R2EA 5F3HA 3IVKB 5K9KA 3IDUA 4O5LH 2D4DA 5HYSA 5HTSA 3VGFA 4OAWB 5EZOL 1FZKB 4LHJB 4U1HB 2CIIA 1JHLH 3V6BR 3GSOB 1RI8A 5IHUH 5I1DB 3Q1SL 1I1FB 3MREB 3D0VB 3PXHA 5AG9A 4JKWA 3T65B 3HNTL 1XGQA 3I84A 2VIRB 1A64A 1D6EA 1QLEH 4MQ7B 1EDQA 2EKJA 2Z91B 1WIPA 3A67H 4JY4A 1DBMH 5GGUA 4KY1H 2AV1B 4YBLB 1P1ZA 1AC6A 4EBQL 5IR1A 4JFQA 1VACA 5FHBH 1S5HB 4RBPK 4ZUUA 4EQ2A 4NM8H 3PNWA 4ZSOA 1NBVL 1RZKL 2OTUB 4S2SA 1JPSH 4QY8A 1T1ZA 4JHBA 2YUWA 3KPPB 2C3HA 2P45B 4NWUH 5JXED 5F3BA 1MH5A 5E2TH 4U1LA 4LRNL 4K94C 4P2RB 5ISZB 3T1FA 3MGOA 4G9FB 2R4RL 3BH9A 1FFNB 3CFEA 1E4WL 3O6ML 3HZVB 2ESVB 2QKIA 4GW5B 1R3IH 1T5XA 1T5WB 4PLOB 2YS4A 4Y4KC 3KPTA 2GW5A 1CFQB 6FABL 1N59B 1XGPB 3OXRB 3SDCC 5AYUL 3UTSA 1RQ5A 1AXSA 1RUPH 4XRCA 1U58B 1BFVL 1B0GB 1MI5B 2NY4C 2PW2B 5I1JH 4JRYA 4KGLA 4MNHB 4XB8A 2FZ3B 5DHVH 4ACPA 4C4KO 3W9EB 5BW7A 3WE6B 2P1YA 4J3TA 2VTFA 2FX8H 4NDMA 2BSTA 4L4TB 2BNQB 1G0DA 2OSLB 3WNNA 4JN1H 3KPOA 4YWGL 1XGRA 1ZT4B 4LU5H 2VUOA 1QFHA 3O3DA 4JFHE 1NGQL 5D2LB 4NYLA 4MXWH 3HRZB 5I15L 4G6FD 1KBGL 4K9EL 5I30L 5DJCB 2DDQH 3MZGB 1F5WA 1TJHH 1EV2E 1OARL 5KVFL 5FHAH 2HFGH 1T1WA 4TQEH 3X11B 4F3FB 4UT6H 4D3CL 3BHBA 4JFFB 5L8LB 4NZRL 2E9JA 1V3LA 1QLRA 1MLBA 3OAUL 2NW3A 1OGAB 4ZAKB 1E6JH 3LQAL 5DUPH 3B9KC 4WV1B 5F7LB 5J8OA 3UDWA 4LARL 3QUMH 3MLXH 1ACZA 3QIUB 4XVUD 4M1CC 2V5SA 1FE8L 1ZHKA 4AG4H 1UJTA 5BQ7B 5E8EB 4G8EB 2ZSWB 1VFAA 1HEZB 4K3JH 1EHLH 2OR8A 3LH2L 4GBXA 1UKSA 2MMXA 4XWOD 5KSBB 5IVXB 4YXHL 1MRDL 4G6KH 4WTXA 2ZCLH 3WFDH 2Y9RT 4XMLL 4F7TA 5JHDA 3FO0H 1H3TA 3ZT7A 5D7LB 1CD0A 3D0LB 5DK3A 4X7TA 3HAEA 3U48A 1W72A 3GHBL 1MJ7H 3VH8A 1UWGH 2W9EH 4QRUA 2NY6D 5T3XH 5A3ID 1ZA3A 1OAXL 3TVMB 3RWCA 1R3LA 2CKBA 4FG6C 2VZVA 4GKNB 4N0YL 4FTVD 4M6MH 1J8HD 2AQ3A 3BAEH 5HY9A 3E0GA 3RIFF 1F90L 5E2UH 1YEEL 4HLJA 2VLJD 5A43C 1OP5K 4F7PB 1FJ1A 3F58H 1KOAA 3FO9A 3MRHA 1BEYL 1WTGT 2P47B 4E42B 1KJ2B 1BIIA 2O5YH 4PRBB 2ICCA 4YBLC 1NL0H 5BXFA 1UGNA 3MCLL 2Q76B 4JFEB 3EFDH 4LSPL 1KT2B 4PUBL 2FSEB 3NGBC 3RY6C 3DVNB 4X5XB 5F9AC 5IBLD 5HJ3A 2JTDA 1DBJH 4IRSD 4AZ8A 4C57C 4ZXBD 4NNPH 4RAUB 3CPLB 3MV9D 1GZQA 4OZGB 1QSFE 4HIXL 3QDJA 5E5MB 3LV3A 4IDLA 5TF1L 2QR0A 5DD0H 2VSDA 3RNQB 4EI6A 2VERN 1FH5H 3IAPA 3SKOB 2WNGA 2EH8L 3NAAH 3P9LB 3V6OC 3SDDA 5C0RL 3QXVA 2IANE 3ZHLA 4AENB 1F02I 5D70L 4QEGA 1A5FL 3CUPA 5KW9H 4EVNB 5BOZG 5DURD 3B8YA 2Y6SD 2DLGA 3VXQB 1Z0MA 3VXRE 1DEEB 2MTPA 1FNEA 1QBLL 4PJXB 4EI5C 3A6CH 1IVLA 4XBPB 3MLYH 5ALCH 2XKNB 2R8SL 4X7EC 4QHLB 2W9DH 4FQQA 5I1CL 4APQA 4JR9L 2DWEA 2YA1A 4NCC2 3GBLA 1HE7A 1RHFA 3S3PA 4IIQA 1NLBH 1WAAE 1IEHA 1JP5A 1J10A 2PR4H 3QUXC 3E6HB 4NC1C 5IB3B 5E99L 1PX4A 1OAUH 4F33A 4AT6B 4PREB 5FO7B 3S35X 4OQTA 1QBML 3AY4C 3G5YB 5EWIH 2VAAB 3VFOB 4HC1L 3MLSH 2R2EB 2P24B 4XP6H 5DT1H 5F3HB 1INEH 4EEEA 1F4XL 4X4YA 5E9DE 5KVMC 4ZAKC 5K9KB 4HFUL 5I1GL 3DXAB 4ZFGH 4NOBA 3HI6L 1OD7A 3GMPA 2WBJD 3QIUC 4P23B 1EH9A 1RU9L 1SM3L 2O5ZL 1PD6A 1RIHL 4MS8C 1WEJL 1FC2D 3MC0A 1BVZA 4PLJD 3DPBA 1NGZB 5HXMA 3RAJH 3C5JA 4EDXB 3OB0H 2OR9L 4KRPB 4DFHA 4OT1H 2CRIA 3JWDH 2VDOL 4JM2B 2E9BA 1KEML 3QI9D 1QVOA 1XGQB 3FAXA 5BOPA 2PYED 1RK1A 2H1PL 3V7MA 3KYNB 1QNZH 3V6FA 5I6XB 5FGRA 2GFBB 3O0RL 3DX6A 4D0DA 4DW2H 3H9SD 2W0KA 4ZPTB 5BZDA 5E08H 3HPLA 2NY0C 1LP9A 3DWTA 4W6YB 4ZSOB 4KUCD 5DEGA 2ENSA 1A9EA 4RISL 3MRQB 1LVEA 2LU4A 3EW3B 4QLRA 1IKNC 3HNTH 5JXEA 4PJIE 5D1XB 4L3CA 5C0FA 4B0MM 2FR4A 2PKDA 2V7NB 4R2GB 3VWJC 4BM7A 5FO8B 2K3TA 3BH9B 5IJVB 3CFEB 1PZ5B 2XTJE 2QKIB 3QZWA 5H8DA 3OG6B 5EOTB 2AK4E 4GG6E 3IGAB 4G6JL 4NJAL 4F2MB 5GSVB 5DFVC 2ZWLT 4LVHC 4E9LA 1WISA 4G8GD 1JL8A 3FN9A 4ZUWB 2OJZH 5BVJB 1DUZA 3RTQC 4OZIE 1U95A 1UXSB 2A2QT 4OM0L 5A40E 2H2SD 3G6JE 2BMKB 3BW9A 3Q5TA 5EU7E 3GSUB 2YPKB 1WBXB 1E4WH 2C7UA 4ODBD 2BSTB 3HZKB 4DUWA 4M5ZL 1KLGB 3QEUA 2CXKA 3JV0A 2QQQA 5DUML 5GS1C 5ANMB 3K4DA 3KPOB 1L7IL 3AROA 3RDTC 6FABH 3QNZA 2CLRB 5AYUH 1E4XH 3KYKH 1FYTE 4NYLB 1NC4D 1BFVH 32C2B 4C54A 4NRYA 3C2AH 4Y2DD 3LKQA 3DRQB 4BUHA 3ULVD 4ONHB 1BWMA 3RWJA 1FL5A 4ZUVA 5J7CC 3PV6A 4E41D 3ZDXF 3QRGL 4XXCC 2VWEC 4I0PC 2VLLA 4UOW0 1P7HL 2WSKA 1J88A 1SJHA 4OLWL 1KBGH 4EOWL 3TNMA 3ILPB 4PS4H 2EDQA 3QHTC 4HULB 2ZPKH 3R4DA 5IFAH 5KSUA 3ARRA 3IKCB 3V4PH 3CCHA 4LLYA 4WEUD 1T66C 1EVUA 3WLWD 1MCRA 5F6HI 1HSBA 4NZRH 5F7UA 1JRHL 4E5XA 2WBWB 2APFA 4F7TB 4J1UA 5AYQA 1ZHBB 3STLA 2VXQH 1RJZA 3IDMA 3BI9X 3EO9H 2FATL 4LARH 4X4XB 3VH8B 3SE3A 4F15C 3JXAA 4QRUB 5EBMA 1ZA3B 5BS0D 5LCVH 3WKMH 4PLNC 3RVTD 5DLMH 2CKBB 2Y7QA 1KXVC 4KAQL 4FTVA 1J8HA 4FQ1H 2VXSL 4PJBF 4EDWL 4Y4HD 2X4SB 2X70A 5DRNA 2VLJA 1MRDH 3OAYK 1FJ1B 3GMMB 5IMKA 4HUVA 5IVZA 5CD5C 3CFBB 1ZVSA 3MUY1 1KC5L 4TRPL 4LLUB 3I6LD 2CIKB 1XGYH 3TLRA 5DGRA 3IJYB 4ZFFB 5DYOA 2DMCA 1OAXH 4V1DB 2LFGA 3FONA 1B4RA 4EXPX 1OGTB 2YR3A 5TH2B 5HJ3B 5JZ7C 4IRSA 5HI4C 4ZXBA 1F90H 1YEEH 4HK0B 5CSZB 3MV9A 5EC2B 4LCWD 4KTEL 4I13B 2NR6C 3LV3B 2QR0B 3P0VH 4JJ5A 2AJSH 4JO4L 2D0HA 1HWHB 3T2QA 4LSUL 4GKOA 1TETH 3MCLH 3PJSA 1WBYB 4LSPH 4PUBH 4LCUA 1P2CA 2EDDA 4NQDE 4ZOBA 4I3RH 1UZ6F 4S10A 4WJ5A 5BO1H 3CUPB 1QHOA 4PJEF 2YUVA 4HIXH 4HUUB 1E4XI 5TF1H 3GDBA 4P2QE 1HYSD 4HS6A 3BKCL 5BW7C 4MDIA 3CVHB 3UO1L 43C9A 5C70A 2HJKB 1RJYA 1EHAA 3SKMB 3TH4T 4L4JA 4OFPA 5C0RH 5GJSL 4HG4K 4IJ3B 4AK1A 5MENE 4OI8A 1CXFA 4B7IA 2DWEB 2GK2A 2Y06L 1A5FH 3K2UH 4IIQB 5GGSA 2J2ZA 4NWTH 4MD4A 1WT5A 1IT9L 3MRIA 4HAFA 3DOSA 2PF6A 2WWKT 3HZMB 2P8PA 4KJQC 1V7NH 4X7SL 2H6PA 5E8DL 2ED7A 2YC1B 3T04D 1JWUA 3S88L 1MF2L 2CK2A 1WZMA 4KKAC 3DX9B 1PFCA 4NRXB 3TBWA 2HWZH 4QRSA 2VDKH 4Q9BA 3X14A 1CGTA 3UDWC 5GZOC 3GMPB 3JWOL 4JDVA 1QBAA 4Y5XA 1WICA 3BMVA 2F54D 4XP5H 3PP3H 3PV7A 5E99H 5L7XH 2LVEA 1OWWA 1P9MA 2HG5A 4PJGA 1FLRL 5DUBB 4GBXC 2EXWD 4PBWD 3UJTL 3VCLB 4H5SB 2R23A 3KLHC 3QI9A 4Y5VA 1YMME 3VXNA 2PYEA 4HFUH 5C0BE 4GAYB 4KHXH 4N0FB 4QRQA 2DMBA 4LIQE 4D0DB 1UQSA 4P59L 4MJIE 3H9SA 4OGAC 4OFVA 5BZDB 5HD8D 1Z0NA 4KKNA 3L5XL 3V7AE 5KOMC 1GJIA 5IOPB 2QADB 5FKAA 5CEYB 5GRVK 3KLAB 4HKJB 4KK8D 5F93C 3TIDB 5CGMA 5LAXA 1A8JH 1XZ0B 1GC1H 1JZ7A 1X5JA 5ICZA 5F96H 1A3QA 4KVCH 3ZDYF 5F9WB 3P2TA 1I85A 1JTPA 5FXCH 2HMID 3JVGA 1FNGB 4HIEB 4RISH 4LGRB 2R2HB 5CZKA 4H1LA 4HX1A 3NOIA 3HFMH 5EZJB 1LEGB 2VC2H 5C0AD 4G8GA 3RUGA 4G8FA 5KSAB 1KCKA 1U8JA 1IFHL 1PLGH 5CHNA 3NABH 3O8XD 5D6CA 3C8DA 4JPIB 4LLMA 4QCIB 3S5LG 3T3PF 3UJIH 2ICWA 4WU5B 1BM3H 1YYLH 1DR9A 3SDDC 4OKVA 1F3JA 2ZOLB 1FGVL 4MA8H 3EO1B 5C9KA 1P7QD 3QNZB 2YSSA 4G6JH 3NCEB 1NC4A 2NY1B 5MERA 4K8RD 2DF3A 5FOBA 1QEWB 3VWKD 5I1AB 4M1GL 4NRYB 4Z7UF 1T0MA 4Y2DA 5J12B 3J8F7 4U7MA 4ERSH 3LIZH 5FUCC 5DJAA 1O7SA 2BOBB 5F89B 3LZFH 4IOIA 4N5UA 4M5ZH 2DI8A 3E3QE 4IJ3C 3FO1A 3PV6B 4KV5E 4APQC 3HMXL 5TE4L 4E41A 1FHGA 4UOJA 3S34L 3VDBA 3CNKA 4I3SL 5CBAB 1FAIL 3CU7A 1J5OL 3L3HA 4OF6A 1I1YB 2VLLB 3OGCB 4IIQC 5IESL 1XGUB 4L3ED 3C5ZD 4LP4A 1Z6JT 1ZMYA 5MI0B 3H9YA 5GRUH 3L3DB 4G7VL 1IL1A 2R1WA 2BVEA 4MWFA 3UPRA 1QR1B 4K7PH 1XF2B 1J9CT 3PUCA 2M1KA 3PDOA 1FL3A 4QHMA 4HQQL 3QDMB 2G5RA 3VGAB 2PO6D 1S7WB 3TM6A 2AQ1A 4E5XB 3H0TA 2FJHA 4Q7DA 5FECB 3QRGH 3STLB 5I9QB 1LO2H 1I1AB 3QQ9D 4DK6A 1LE9A 1GYAA 4PJHA 4EOWH 2NY6B 2L4OA 5BS0A 3GSNA 2O93L 4OZHA 3OBAA 2CDGB 4FTVB 4UIMA 3QHZH 3PWPB 1H15B 4P2OD 4Y4HA 5FA3B 2X9XA 4N1CA 2FL5B 3TT3L 3Q5OA 4TSAH 3NIDF 1NFIB 2X4TA 3QEGH 5IVZB 3L3GB 1MCWM 3DETD 3PDDA 4R7NB 2W07A 4YHPB 5I2IB 4D9RD 2IFFL 5E70A 1KLUA 1QSED 4F7EA 5JIIA 3EGSA 4RA3A 1NGPL 1Q72H 2OK0L 4PJCE 5IVOA 4KAQH 2UWEE 5JNYB 1EGJH 2BNRD 4BKLA 4Y16B 4ELKA 5JPNA 4S1RL 5JXEC 3OJDA 3E8UH 5FYKU 2JJWA 4LCWA 2DWDA 1YYMH 4NO3A 3F7VA 2LTQC 1KC5H 1KTRL 4PJDF 1ZS8B 2V5RA 3TN0D 2GY7B 3OJMB 5CJ5A 1U91A 4CRPA 4YXLL 1ZLVK 4E0RA 4LCUB 1YEIL 3HB3D 3AC0A 4RQQA 4O4YL 4X6CB 5D7IB 3L5HA 4DN3L 3NA4A 5HHQA 5J1TC 4NQEE 5CJQH 1MJUL 2BOCA 4YDJA 3T77A 4WJ5B 4M7KH 1KJMA 3CFCH 4PGBA 1MCKA 4PJAB 2FGWL 5EH1A 2WLZA 1NGYA 4M4PA 2CGRH 1HHGA 1S8DB 2XZCH 4LAJH 4RFNC 4RGOL 1C12B 4NNXA 5L9DL 1C5DB 1L7TL 1RJYB 4NQCE 1CLZL 4PJFF 4P0DA 5B21A 2O5XL 1U3JA 1EO8H 1K8DA 4OGYH 3VRJB 2C5DC 1P5VA 4CDGC 2GSIA 1XT5A 2YPLD 2E7HA 5DTFA 5LGJA 1QLFA 4QWWD 4MD4B 2N7AA 4MGXA 3H7BA 5F6IB 4GUPA 2E8ZA 4YHYB 3BKCH 3QQ4B 4JVUA 4JCLA 4WWKD 2A6KA 3KJ6L 2OYPA 1I3VA 4RGNE 1IAIM 5GJSH 3EYFA 3AXLB 4ZFOB 1ADQL 2B7DT 1Q9WB 4QRSB 4U6TA 1WFNA 3ZE1E 8FABA 4NIKB 1MCCA 1PG7W 4XVUC 1T2QH 1MCOL 1NFDF 4ZOCA 4HWBA 1EEZB 2F54A 1QSZA 5FYKD 1E27A 3T4AB 3R0MA 2JCCB 5C09E 4HFWA 2YMXL 4XWOC 1MF2H 1NAMA 1JNNH 3WLBA 4Z7WB 4DKFH 5DSCA 3QI9B 2AEIT 2AABL 3VXNB 4FQPA 2I26N 4QXUH 3KPNB 4U33A 1RIVL 3LY6A 5E7FA 2PCPB 4DGVL 5BJTB 1IAOB 5E0QA 5CMAB 3SE3C 5SWZB 2NY6C 5A3IC 3LPFA 1JPTL 3OSKA 3MBED 3DVFA 3O9WD 1WC7A 5DJZB 2IGFL 5F9JB 4YIQB 1MCDA 1FLRH 5IEHA 1N0XL 2EIDA 5FKAB 5I8OH 4BH7A 1IC5H 1MPAL 1S3KH 3C60B 4LMQE 3TBTB 1U6AL 4KROB 4MMZC 4OB5L 1QO3A 3SO3C 5T3ZL 5CP7A 3L3IB 1FVEA 3NCYS 1MIEL 3HG1E 3LKOB 5ICZB 1WJ3A 4NZJA 4JFYB 3WD5L 4U1NA 2NX5E 5HYQA 2MPAH 5J1AA 1DN2A 4QKXB 5IBLC 1GIGL 5BRZD 3D2UB 4IRSC 4LLAA 4KRLB 4ZXBC 4JANA 4HX1B 5A16A 5C0AA 3RUGB 2PTUA 3GB7B 1PY4A 1ZT7A 4X8JB 5CHNB 3IDYB 3O8XA 5D6CB 1MFCL 4CVXA 2AJVH 2J4WL 4OKVB 2Z0BA 5A2LH 1WIUA 4IS6A 3VGBA 5IQ9A 2MSPA 2X4RB 3QUMB 1P7QA 2YSSB 1MWAL 2JKXA 1G7JA 3EOTL 1JGEB 2Y6SC 1AP2A 3DX8B 3VWKA 5D96B 4RMQA 3EZ8A 1F4WL 3HTLX 4FNLH 4RIRB 2IFGA 1WCQA 4X6EB 2KKQA 5C9JB 3S37H 4HUXB 3DGGA 1TQCB 1R0AH 3KPMB 5ETUA 2ZJSH 3FB5B 4YDLC 3OKYA 3NIFF 3VD3A 1FGVH 4YC2C 4X98B 3OR6A 4L3EA 3BSZL 3C5ZA 4PJ8B 3MO1B 1WT5C 5ENWA 2VH5H 3NFNA 4OLYL 5F6IC 5D7JD 5JLZA 2ZNWA 3CXHJ 4MHHG 2Z31D 2MJWA 3QDGE 1FL3B 2G5BB 3DO7A 4NKDB 5ESAA 1AE6L 2PO6A 4F37K 4CADA 3S34H 2ICEA 4O2FB 4BSVB 5IMMA 3INUL 5IB1B 4D0CB 2HLFD 4Y5XC 1D9KD 4FQIL 4PJHB 2XN9B 4G7VH 1KIPA 2ZCKH 3GSNB 3CLFL 2DQIL 2KQMA 1T1XA 1QFUL 2IC2A 4PLJC 1P9MC 4P2YA 4UIMB 1SJVA 4HWNA 5LXGH 3EIFA 2H26A 4TUJA 2OX5A 3QI9C 4Y5VC 3GRWL 3MRLB 4M93C 1JHKH 2WUBL 3GBML 4MLSA 4ALAH 1OPGL 4JDZB 1QSEA 4LASL 2BFVH 5CEZD 2EDBA 3WO4B 3ARUA 4F7EB 3HC4H 3TCXA 3VJ6B 1KELL 1OTUC 4OD3H 3K4AA 2BNRA 2E9WA 4ELKB 4F58L 4ELME 1CN4A 4H8WL 3TBYA 4FFZL 4C56A 2HYMA 3OJDB 3TFKD 4L1DA 3PGDA 1UACH 2EE2A 1IAKA 4FXGB 4NO3B 5INCA 3ROOA 1N64L 2ZUXA 5D5MB 1YEGH 4LSRL 1PG7X 3TN0A 2CDFB 2HVKB 5MEPB 3RIAF 4E0RB 2VXVH 2X42A 3ARGD 1NGPH 4FOMA 3ZHKA 1I85C 5SV4A 3PHQB 3O4LE 5LBSH 3JVGC 1CZ8H 4LHQB 4YDJB 3T77B 3NCCB 1RUMH 3UTTB 1KJMB 3MRMA 4Z0XA 1UB5A 4L8CA 1F4YH 3LEXA 1KF9B 2HKFH 4L29B 5D93B 3PF2A 1V3JA 3HNSL 2EKSA 5D2NA 2H2SC 2W91A 3MJ7A 4NNXB 1R5VA 1RURL 3BKYL 4YXLH 1S7XB 2ADFL 1DE4B 2VKXA 1YEIH 5F8QC 1MUJB 3S3SA 2BRRL 3IJSA 1I7ZA 4LPUA 4OLVL 2YPLA 2FO1A 5DTFB 5LGJB 4ZTOH 2EDYA 2R0WL 3G08A 1H5BB 3DMMD 4JN2B 4PG9B 2YD1A 3H7BB 3C6LB 3UZQA 4QRRD 4O02L 4Y2DC 3AU1B 4LHUD 5IV2A 4YX2L 3ULVC 1FNAA 3MYZA 4WWKA 2A6KB 2DICA 2OQJB 4Z76A 4U0QB 1CLZH 2NY5H 1G7IA 1TQCC 3BN3B 1SYSB 4M7ZC 3VFTB 1OQXA 2V17L 3ARSA 35C8L 3QFJE 1N2RA 3WXVH 2YZ1A 5ICXA 2H41A 2OI9C 1AFVL 8FABB 4I9WE 5HI5D 1FCCA 2BSED 2YPVL 3QAZC 5BVPH 3P40A 2EC8A 5HGBB 1BJ8A 4ZMAT 2NY2D 3KJ6H 3QO1A 3WLWC 5ITBH 1T04A 4C4KT 5BV7L 4MHHI 3DVGB 1TNMA 3TJEL 5DFTA 4D8PA 4CU7A 3ZYOA 5JW4M 2XQBL 3AS0A 4GXVL 4MXVE 1NDGA 4MQTB 5J3HD 5DJ6A 4TTGA 5CD3A 4JO2L 4XHQA 2YEZB 3MBEA 3RVTC 3LKNB 3O9WA 4MZ2A 5SWSD 1JPST 2P4AB 4Y4HC 4UV4L 3WIHL 3V5KA 3PHSA 3QEQB 1OSPH 1G9NH 2F53E 3MFGB 2VDRH 2YRPA 1NMAH 2AABH 5GSRA 4DN4L 3ARDD 1RIVH 5DO2D 1FVEB 4DGVH 3MJ9A 3AAZB 4JKKA 1SEQL 3TEUA 1BLNA 3F12A 4G6MH 2VDLL 4PJBA 4ONFL 5D7SL 3WO4C 4U1NB 4YK4C 1HXYA 4L4VE 1MCNA 5ESQA 2IGFH 4MJ4A 5BRZA 3U7WL 5C0IA 5DMJB 3TYGL 3IB4A 4JANB 1F4HA 1EPFA 1ES0B 5T3ZH 4NKIL 1GGIH 2Z8VC 5I71C 4KHTH 4HPYH 1SY6A 1GOGA 2FBJL 3GJEB 2R56H 3A0OA 2HT3D 1EO7A 2EDRA 3BKJL 3T0EE 3FL7A 2GJ6E 2C3VA 1LEIA 5IHZB 4QT5A 2CLVA 1BQLL 4MNGA 4MX7A 2HTLD 4RNRA 5D1QB 4LNVA 2P5WD 1WAAF 4CNIA 1KB5L 1JYXA 3I50H 5IK3A 1HYSC 2VISB 1VSCA 3QNXB 1HCVA 4UT9L 1MFCH 4G3YH 2XACC 3UXFA 4PJ9A 2J4WH 5ETUB 1LK2B 4PJEA 1WIOA 2Y07H 3RU8H 4XP4H 1NCNA 2JF1A 1IQWL 4U31A 4D9LH 3VA2C 4PRIE 1OQOA 4OFYD 5FUZH 1MWAH 3OR6B 2LVCA 4ODVL 3MLWL 3EOTH 5ENWB 1M71A 4L9LA 5D7JA 1I1RA 1EAPB 1X4YA 2Z31A 3AMKA 1I8KB 1YJDC 1GAFL 3O45A 5I66B 2NNAA 4UNTA 5HHXL 1A6VL 3M1BA 1N5YH 1BOYA 1M7DB 2UZXB 4IOSD 3MLTA 4JY6A 3W39B 1TJGH 4CADB 3PWNA 2N1KA 1BD2D 4PB9L 4ZS7L 5IMMB 1E28A 2FO4A 4MCZB 1A6WL 1MCBA 3BSZH 4GJTB 4YUEL 1D9KA 1WCBA 3OGOE 2A9NL 4X6DB 2I5YL 3EOAB 1K8IB 5FB8B 5DQJA 3T4YA 4HT1L 4WFFD 2E9IA 3B2VH 4Y5YB 2EXWC 1DSFH 1AE6H 6CGTA 2DLHA 4TUJB 1KEGL 1FAKT 5HVHC 5KZCD 4DZBA 1NAKL 4PJIF 3RZCD 3SE9L 3V4UL 3NACH 1OM3L 3RKDD 2AJYH 3FFCE 4FQIH 3IDNB 1QSEB 1A3RH 1HHKB 4WUUD 5EO1B 1QFUH 2AI0L 4QXGL 5HD8C 1T3FB 1PAMA 2HA1A 5DC9B 3VFSB 5KS9B 3WHXB 3IF1B 4GKZB 3TZVB 4ZUTB 3B9EA 1M7XA 4KK8C 2X4PB 4C56B 1DFBL 4GG6F 3MRGA 1OHQA 2C4XA 3CSYB 3PQYB 4P3WA 4RFOL 5INDB 4Y19D 4NHUA 3S6CA 4OZIF 3QO0B 1MY5A 5EOQL 4TVPD 1FNSL 1OPGH 2F5BL 4LASH 3G6JF 1HIML 3ARGA 3FT2B 5GRZA 3SGDI 2H9GB 4I18B 3QISA 1CFTA 4LLWA 5EIIB 1I8LA 1KELH 4CU8A 5EU4B 2HMIC 4NKMA 4IRZL 1FNHA 1BX2B 4F58H 2ERJC 4BQ6A 4YLQT 1B2WL 3RWDA 4Z0XB 2DBJA 1KJ3H 1I3RB 1HXMB 2HFFA 5FOJA 5DRWA 4ODHL 5C0CE 4GRWE 3QB7C 3SBWA 2PETA 2VQTA 3CFJA 5ITFB 2P46B 3O8XC 2EKSB 1ZEAH 4LSRH 3MJ7B 5C8JB 1MVFA 2HRLA 1NCBH 1NUFA 1F11A 4D9QE 1NEZG 5I0DA 4LLVA 2DM3A 3BPLB 4FQ2L 4WRLA 1OOAA 1SMAA 3RPIB 1GGBL 3DMMA 4K8RC 3STZB 3GKZA 3VXTA 3VWKC 3O2VL 4QRRA 4XI5D 4BFIA 2Y36L 3HNSH 3KXFD 4LHUA 4OTXL 3V79C 3HC0B 4WWKB 4MJ6A 4HJJL 3AM8A 1G7IB 5CP3A 1YZZA 1N3NB 3C9NA 1N2RB 4YH6A 5DS8B 4OLVH 4Z7UA 1U92A 3CX2A 4ODTH 5D9SB 3C5ZC 5CEXB 4UDTA 5IEKB 4HIHB 3DRTB 1H0DA 4KGJA 3Q0HA 3GNMH 1V7MH 1XF4A 1RUKL 5DJXB 3O2DL 1J1OL 1S7QA 5DD6B 4EJ1C 4KDVA 1FIEA 2D03H 5CUSL 1TFHA 5HHNB 4X6FA 1B90A 3NMEA 1CDHA 4G42A 3G5ZA 4MQSB 2V2XB 2PO6C 3WJJA 2XQYK 1AR1D 1BGXH 3R1GH 4HUKB 5JIHA 1HNGA 1OCWL 1QSVA 2D7QA 3FZUD 4ONGL 3QQ9C 1KGCE 4NRZA 1TPXC 5LWYL 1AFVH 3H3PL 1OSZB 4WY7L 5HVWA 2X7LA 3PHOB 1UCBL 5L0QB 5C6TL 5M94B 1DANT 3O9WB 2YRLA 2A83A 5T1LD 5SWSA 1II4E 3LD8C 3V5KB 5ESVB 2IBZY 2HKHL 3OKKB 4KI5E 1DQQA 5EZLA 3ARDA 4NQUA 2YKLH 3DETC 1LO4L 3VXME 4F9PA 4GRLB 3AB0B 5LQBL 3MPCA 3EJYD 1P4LA 4K94L 3G9AB 4P5KA 3FB7A 5CJ8A 4A6YL 4ZUSA 5C0IB 2E7BA 1U8KA 5HI3D 1T4KA 3LKSA 1ED3B 1CL7H 3P77A 3FMGL 2ATKA 1JWMB 2R0LH 3VMOA 4Z7OE 1U8MB 4DN4H 4YFLF 3V52L 4XMKL 1A4JA 1BFSA 4JZNA 1A3LL 3OKLA 3QPQD 5FYJH 3S5LB 1EO5A 3TN0C 5JMRA 3MRKA 3QXDA 5D8JL 3D39B 4PJ7B 1OLZA 3DTXA 3N0PB 2C3VB 3MTRA 1LEIB 2GJZB 3KPRB 3ZMRA 3IDGA 2J8HA 3KLSA 4Q0XH 4PJDA 2UZIH 1ZSDA 2P5WA 4CNIB 4NO2B 1JWSA 3C8HA 5CZVL 1KCRL 5D2NC 3HNVL 2FBJH 2R0ZL 2C1PB 4ENED 1X6NA 4ORGB 4PJ9B 3PIQA 3H6JA 1MFBL 5ADPL 1F6AA 1J87A 2EIBA 4JFHD 1MSPA 5C2BH 1CICD 5EO0A 1CGWA 4XCYA 4OFYA 5JW5A 3OJVC 1U2CA 2Q7YA 4QWWC 1DQTA 4GQPH 2QV2A 2B1AL 3BP4B 3CFKA 4AL8H 5D7JB 1I3GH 3QPXL 2WK2A 4PJFA 4U1SA 1C1EL 3UYPA 4P3DA 2NNAB 3MJ8B 1JNHA 1PY9A 4WWKC 1PX3A 2Q8AL 4PP2A 5C07A 1KN4L 4MCYA 1YNLL 12E8L 5AG8A 2XFXB 3MLTB 3RL1B 1BD2A 5DDHB 1N6QL 3EO0A 1YPZE 3L6FB 4P46B 3ARFD 1ZA6A 1WTLA 2VDPH 2NW2A 1ORQB 1BAFL 4M02A 3FAWA 2F19L 1D9KB 1WCBB 1J1PH 2BJMH 4HJ0D 4NCDA 1RZ7H 1ACYL 5ICYB 5DQJB 3X17A 1GAFH 4MAUH 1ZHNA 4YDVB 5DI8B 3ZKND 5FM4A 2IH1B 1QQDB 4FZ8L 4XPFH 3F7PC 5L2KB 2ZUQC 3KNBA 4GAGH 5E94B 2A6IA 5GJTH 4CJ1A 1YEHH 4R7DB 4OLXH 3EHBC 4ZS7H 5C08E 4IEFB 1NFDA 4XZUB 3RZCA 4OLUL 2DQHL 4J3OC 3MUHL 2BCKA 3TBSA 4YUEH 3LQMA 5EUOE 2DBLH 5HHOD 5L0QC 5DA0B 3MBEC 1A1NA 4WUUA 3O9WC 2WUCL 4JPWL 4DJMA 5IFJA 1BQSA 1RSFA 4HT1H 2AK1L 1UH4A 2VITB 5CLWA 2OL3L 4PD4J 5DJ2A 5I76A 1S7UA 3TWCH 4P2CG 1CL7I 3QJHA 4PGJA 1LDSA 1N7ML 5DR5L 4W6XB 1OM3H 4Y19A 2CRYA 1IZKA 5SX4H 5IM7A 5CGTA 1RULH 2X2YA 1MHCA 3QQ3B 4GS7B 4KKCD 2XA8H 4YR6B 1N8ZA 3ARGB 1CFTB 2AI0H 2PNDA 4QXGH 3L5WB 5TGBB 1NCWH 3N85L 3MRBB 3BJLA 2SEBA 1QSFD 1TENA 3MBXL 4HCRA 1AXIB 1JPGB 4LLQA 1DFBH 4U3HA 4I1NB 2FX9L 4W4OA 5KAQG 1X5GA 3EAKA 4PGDB 3V6ZA 3H3BC 3MV7B 1MFDH 2X1OA 2IAND 4LBEA 1B4JH 5FKPA 2UZYB 4XTRD 4XVSL 5FYJU 4I77L 1FNLA 1G1YA 2F9BT 1F11B 1P6AB 3GJFA 3L95A 4QYOA 4KV5F 3FQTA 3MA9H 1G6RH 2R29L 3VXRD 4NNYA 4ODHH 3DMMB 4WI8A 1EX0A 3QCVL 3TT1L 4NUJA 3UAJD 2Z35A 4WW2F 5E2JA 3KXFA 1DQDL 2DKSA 5T1KD 4U1JA 2CRZA 4ZO6A 1T7VA 2CK0L 3CDGA 4Z7VF 1FZOA 4PJ9C 3BEVA 3JV4A 4FABH 4QRTA 1BBJB 4F7CA 3FTGB 4AEEA 2J6EL 2DM7A 4Z7UB 4J6RL 1UEMA 1MFEH 4MD0A 2I9TB 2LAAA 4UDTB 4BH8A 4L9LC 5HDBE 4N0UB 5D7JC 1H0DB 1IAIL 2Z31C 1K9TA 5TPWH 2Y36H 4IRJD 4NQXB 4QOKB 1S7QB 3TPKA 1A7BA 4HJJH 5ADOL 2OM5A 4HZAA 1I9JL 5E9DD 4C59B 3G5ZB 4DZ8B 1T0PB 5JMOC 1S5IL 5GISL 5FFLA 1KIUA 1QPXA 4NRZB 5TE7L 5CILL 2HLFC 1CS6A 3U79A 4HUNB 1D9KC 4ZYKA 4JGJA 2E6QA 2EZ0D 5C92A 4KKLD 4JFDE 4LVOC 1S9XA 3I6LE 4NQSA 4X80H 1HH6A 5T1LA 2A83B 4YXKL 2FH8A 4UUJB 4OKDA 3WFHA 1BMGA 1FN4A 4PJCF 3U0WL 4UINL 2UWEF 4LLDB 3U9UB 4ETQA 4DVBB 2XWJB 4FN0A 2VL5A 1QOKA 2BY2A 1OCWH 4P5TD 1NFKA 5F7NC 2XZAL 1JYNA 2WQRA 4TNWK 3H3PH 5LWYH 2ZKHL 3BUYA 3R8QA 5I17A 3MGTA 1UCBH 1JGLL 1KJ2L 3TYFA 4Q9CA 3OV6A 3V7AG 4MJ2A 3CZFA 1PEZA 4X99B 4H20L 5KVDH 3W82A 4KU1A 4C83B 2C1OB 3MLUH 2Z9TA 5TQ0H 2Q8BL 3KHOA 5A1AA 3NA9L 1YQ2A 3TFKC 5ILTH 2EC9T 2WINA 5DZNA 1D5IH 3FN0H 3X12A 3IXAB 4RX4D 5IWLA 4UAOB 1VHPA 2XTJD 5BMFL 1IM3A 4K94H 1W8OA 3WIFA 3ARGC 3NVQA 4J3XA 2EDFA 3RX7A 1I8LC 3LS5L 2AK4D 1HZHL 3BE1L 3UYOD 1MRCL 3N1PC 3SDAB 2J12B 3BZFA 3FMGH 3U6RA 1MCFA 3NH7H 1T21B 1G9MC 1ZSDB 4WHTA 4XPAL 3U4BL 3G04A 1MJ8H 4OSUH 2APBA 5FM8A 4MJ5B 4XMKH 3SBWC 3HMWL 2H3NA 1NCAL 1YY8A 1D5XB 1URLA 1XIWD 3U0PA 1CXHA 1AQKL 3PIQB 4GW4B 1L0QA 4M7LL 1XH3A 1FC1A 4RRPG 2GTZB 4P2RE 3KR3L 4XPTL 4G9FE 1CICA 3VXSE 1FYTD 4WVRA 2P8LB 3GI9L 1N6VA 1NBZA 3C09B 2Q7YB 3DMMC 3ZE1F 1YECL 3CFKB 1IEAB 1RZ8A 4YFLI 1OAZH 2D31B 3LKRB 2Y5TB 3QCTL 3HNVH 3VXPA 2R0ZH 3MFFB 1OP3H 3GSVA 1VPOL 3AM8C 1K6QH 3H42H 4PP2B 5J6GA 5C07B 3IETB 5F7EH 5DVOA 1MI5E 1N6UA 1X9QA 3SKUD 1MFBH 5JR1L 1INQB 3V5HB 1RMFL 2VZTA 3NPSB 3MRFA 3D5OF 4FQXD 3ZL4H 3ARFA 4YEEA 2CUHA 3P73B 5CKAA 1AQDB 1AD9B 5HI5C 1MLCB 4L4TE 2BNQE 1I8MB 3QPXH 2A9MH 5F7MC 1C1EH 1A6TB 4JO3H 1KN2H 3FT4A 3O4OC 3WL9A 4XP1L 2NY2C 2BNUA 3D69B 2RFXA 3HE7D 3WJJC 1WITA 2D7TH 2N4IA 4XVTH 3BFOA 3EYUH 1YMHB 3K0WA 1L9NA 4HPOL 4JRXD 5DHYB 3RZCB 4RWYL 1Z9MA 5I19H 5J3HC 4XP9H 4YHNA 5IW1A 3HI5H 1FCGA 1LGVA 4H26B 2FHBA 1ACYH 5EN2A 2FIKB 3D48R 4N1HB 3ARBB 2LABA 3FOLA 4Y1AB 1S7RA 4UTBL 3GSWA 4TULL 1ZGLB 1X4ZA 1H3WM 2EDHA 1UXWB 5I76B 3RRQA 3HR5A 1FSKC 5DMKA 5HGAA 3QJHB 3ARDC 3FQRB 5IW6B 3TBVB 3OKMA 1JZ2A 5DO2C 4JVWA 1V5JA 4LCIH 3DV4B 1ZE3C 3TNNA 4F9PC 4XNQB 5KSBE 3VMNA 1JPFA 2XRAH 3FQUA 3RJQB 2AEQL 5C0JA 4MAYB 4JPWH 5D7LE 1G9EA 4XNYL 5ERWA 4PV9B 4BQ8A 4G9DB 2OL3H 1VFMA 1QSFA 1FQ9C 5J4MA 2EYSA 1EERB 1AY1H 2NY3D 1KCUL 2KL6A 3REWA 2CLZB 2W65A 2VQ1A 4TUKL 1FZMA 3WSQL 4AEFA 3DV6B 4NQDD 5ID1B 1AGBA 1VEMA 5GS2D 2IANA 2HT3C 3KPQA 3MMEA 1UWEL 3RL2A 2DLTA 3C08L 3EDEA 3CFIC 5GGQL 2XTLA 1HN1A 2VDQH 3N85H 3FQTB 1HQ4B 2HTLC 4JFEE 4R26L 3VXRA 4P2QD 4QHKI 4TPRL 1KPVA 4NJ9L 3SKNA 1KTLB 1RJCA 2ZUSA 3GIVB 4LDEB 2DQUL 1JGUH 4O58L 2CJUL 5T1KA 2VZUA 5KVEL 5MEND 4OZGE 3BQUB 1FG2A 1YN7A 4I77H 1U3HD 4R4FL 1WAAA 3SJVB 4F7CB 4OZFG 1YNKL 4XNUH 5DFWH 3BDXA 4FQHA 1JGVL 4XWGH 3CDFA 4MLIA 1KYOK 2R29H 3VGDA 1M7IB 3C09C 4KFZC 4MD0B 2HLAA 3C87A 1S9YA 5L2JB 3HCVA 5GIRA 2X89D 3BYTA 4MB5A 3TT1H 1F2QA 4IRJA 1DQDH 4AEHH 3U30B 4RFEB 2R15A 1KG0A 1ZWIA 1U8LA 1IGTA 3VRIB 5DQDH 3W0WB 2CK0H 3MRNA 1PKQE 5E9DA 5IHBA 3P11L 3GMQA 4OV5B 4S11A 1WZKA 4HWEL 3VD7A 1U8HA 4J6RH 5IB4B 1YDPA 1KNOA 4ZYKB 2BVPA 4R4BB 1IAIH 4MD5A 2QSQA 1INDL 4NC0B 4OIIH 4NQSB 1WZ1H 3HUJB 1RUAH 2FD6L 4HDIA 1YY9D 4ODXB 5EU5B 1YMMD 1AH1A 4JPVL 2CKBL 5FCUH 5MEQA 2VL5B 5C0BD 2IJ0C 2I25N 4ELMF 4NKQB 4WW1A 1BBDL 1S5IH 3RZCC 4AY0A 3GMNB 3KLDA 3SDYL 1MHHA 5GISH 4P5TA 5DEFB 4YEFA 3RKDC 3I6KB 5CILH 4MJID 5KN5A 2GJJA 4RAVA 3N1MC 1HINL 4MNQB 4OUUB 5E2VL 1WWBX 2FB4L 2IQAB 3DXAE 3CZFB 3OXSB 4XNMA 3MLVL 1S7SA 4UINH 1LEKA 3D25B 4PJIA 4XH2A 3P3YA 3SDXB 2VLME 5FYLE 2WIIA 5GGSY 5IIEA 3O3BB 3E6FB 1M6OA 2WINB 4XX1E 1F8TH 5JXAL 3X12B 4B53A 3DUHA 3ARVA 1T20A 4RX4A 3EYSL 2ZKHH 3VG0L 3F7YB 1ZLSH 3WIFB 1CFBA 1KCVH 4P9MH 3THML 3UYRL 4QF1A 2AK4A 4IBLT 4GG6A 3I9GL 2A77H 2H32A 1RZJL 2XXCB 3OR7B 4PYGA 4YAQA 1DLHB 1MHEA 2BERA 3BZFB 2DTMH 3LRGA 5GGRY 5IG7A 4OZIA 4WHTB 4W4OC 2EYRA 4CVWA 3MGAA 5KVGH 2YK1L 3NPZB 2YD2A 3G6JA 4OZ4A 3VFMB 1XGTA 3MRPB 3VXOA 2CSPA 3GO1H 4M8QA 5I1IL 1XIWA 5GRWA 1Q38A 2VLKB 4R90L 1MREL 3BXNA 5GHWL 2APXA 3CVHL 5FDWA 2AJ3A 3LS5H 1XH3B 4LNRB 4P49A 1CCZA 4X7FC 1HZHH 1MRCH 1FYTA 3HZYA 5C0DA 1F2XK 3SQOL 4NT6A 2IG2L 3ECBA 1TZHB 4XPAH 4M43L 1TVDA 4JZOA 4QGTA 1FDLL 4JQIH 2J3SA 3MX0A 4XI5C 1A7RL 1NCAH 4PG2A 2ADGA 1T2XA 1NCCL 2AXFB 5GGVY 3UPCA 2HN7A 1VADA 1LNUA 3O2WL 1CTNA 3LS4H 1AQKH 5I1EH 3KR3H 4KVNL 4XPTH 4JAMA 2UUDH 4PY8J 4CW1B 1I9RL 4FQXA 3GI9H 1RJLB 3ZT6A 3KJ4B 4MXVF 3BGMB 3IXTB 1A7QL 3MR9B 5ANME 2A0LD 5E5RB 4YHZH 5DD3L 4HXAL 3U30C 3P0YL 4KZEL 4IHOA 1OAYL 4P9HC 4OUOA 5FA4B 4DAGL 3JUZA 4KWUA 4BSWA 1CF8L 3C5SB 5JR1H 3HE7A 3BKML 1AR1C 1D7FA 1RMFH 5D1ZB 3UJJL 2R4SL 3NTCL 3ELAT 3PE9A 4F7MB 3FZUC 5IFHH 4D94A 5IKCB 1FGNL 5DMIL 2LU3A 4GW1A 3RA7L 4MB4A 1E6OL 4U7KA 1UH3A 1HI6B 2DLEA 4F37F 3FOLB 4IDJL 4O51B 2NMSA 3QULA 5ABDE 4HC1A 2J8OA 3WFCH 1WWAX 3QWOB 3FKUS 5T33H 5FGCB 3BZEB 2JK5A 4KMLB 4EUPG 1AC0A 2YBRB 2E27L 3PP4L 5HGAB 4W6WB 3OKMB 1TJIH 3IU4H 2EXYD 3TNNB 3V5DA 2G60L 3IDXL 3EJYC 2DL2A 3FQUB 4HK3J 3FRUA 3K1KC 5C0JB 3ULUE 2MNUA 2GUOB 2LV4A 3VGGA 4FQJL 2DJUA 1EJOL 5HI3C 4DUXA 2PUQT 4Z8FL 3VFGH 2M26A 3TC9A 1IGML 1JN6A 5SWQA 4LMQI 1NMCB 5IWLC 3QPQC 1A9BA 1IBGL 2DKMA 2UYLB 1Q0XL 3TV3H 3BVNB 5EU3A 4N1EA 4NQDA 3DURA 2MWCA 3KPQB 2CDEB 4NQED 4ZQKA 1NEZB 4XNYH 2IEPA 4NP4L 2P44B 1MEXL 2YD3A 1KV3A 2BP3A 2J8UB 4PGEA 3UROR 2MCG1 1OB1B 2GSGB 4K23H 4RDQF 1KCSL 1DL7H 2PN5A 3BDYH 3VFRA 4P2QA 4V1DE 4QHNA 1MQ8A 1KCUH 1MNUL 4MVBD 1KJVA 1JV5A 3DYOA 3BX7C 3GSRB 4HF5H 4NBZB 4PGCB 2ZUYA 4NQCD 4YE4L 3FFDB 5T1KB 4ENEC 3RWGA 5MENA 2VN7A 4B7LA 1YN7B 4M6AA 5I8CA 5GGQH 4DTGH 3UBXA 4J12A 2DL9A 1U3HA 1NMBL 4JFXA 1CICC 1OVZA 1A1MA 3G5XA 1X7QA 4R26H 5DD1L 3VFNA 4TPRH 4J3SA 3GBNH 4PGZA 2R39A 3IU3B 4NJ9H 2V2WA 2X89A 3FB6B 4HBCL 3MNZB 1EHXA 1PQZA 3PXJA 4IRJB 4O58H 3QBTB 1ZWIB 1IGTB 5EORH 4UDUB 5KVEH 5CSBA 3IFNL 4G7YH 4K71C 1NGWA 2AJUL 2BVYA 4R4FH 1MAJA 4U49A 2YD4A 2X4OB 3ARFC 5HYIA 4CKVX 3B9DA 3KJ4C 4O2CB 1KNOB 3HAEG 4HJ0C 4U1IA 1DVFB 1CXIA 5E8PA 4HJGB 3RGVD 4CVZA 5C09D 5DMYA 1VKXA 4PY8I 4PJ5B 3ZKNC 4XVJL 3EYVA 5EUKB 3D85B 1CE6A 1U93B 3P0GB 5IMLB 3FOMB 3QG6A 4K3EH 4U0RC 2BSSA 5FM5M 4OFKA 5B3JE 1YMMA 4YHOH 5L88L 4NBYB 1UJ3B 5C0BA 4UTAL 1I7TB 5K9JH 3O3EA 5I1LA 1HDMA 2MHAB 2W0FA 3SCMD 4MJIA 3P4LA 1UYWL 3TCLA 3HAEH 1WFUA 4OCWL 4RAVB 3HRPA 1W72H 3QA3A 3SY0B 2K1MA 3EFFA 1IM9D 4XGZB 1EBPA 3V8OA 1LEKB 4LPXA 4PJIB 3EDFA 4JPVH 2CKBH 5SX5H 1ONQB 3HG1D 2YRZA 1A0QL 4GRWF 1OF2A 4KPHH 4UNVA 2NX5D 2Z93B 3OAZK 4WO4D 1W2KT 2X4UA 5HHPA 2HVJA 4KKCC 1JNLH 1Q0YH 3CFDB 1BF8A 4YPJA 3MYJA 3GHEL 4U05A 5EOCL 4M4RA 3HHRB 1TTFA 1MHEB 2GI7A 5IVNA 4FFYH 1T1YA 4GSDH 3AUVA 2GIYA 5EC1B 1CGSL 1VFOA 1Y0LA 3TPUB 3DSFL 2P7TB 1XGTB 3VXOB 4M8QB 3NCJL 2NYYD 5IB5B 4XTRC 2P8MA 1Z9OA 5E24E 2VLRB 3THMH 5FDWB 3QJFB 1RZKC 5D71L 4ZDHB 5JQ6H 1R24A 1FZJA 4NGHH 3HZYB 3OKEA 2Z92A 3OKOB 4O5LL 3NFPA 1K85A 1RIUH 4JZOB 1UKTA 3VA6A 2J5LB 1QFWH 2XWBB 5GRYA 5EDXA 3RWIA 2IPKB 3UAJC 2A6DA 2A6JA 2ADGB 5EBLB 1JHLL 1G7MA 5D7KE 1Q94B 2W0PA 1C16A 4L5FH 1I4FB 1ZKAA 1UM6H 1GL4B 5IHUL 4UILH 1VADB 1MCPH 1I7UA 1MREH 4W81A 4ZD3L 3UPAA 4BFBD 2A73B 3G5VA 1ZT1B 4BZ2H 2V7HB 5T5FL 3LSOA 4G43B 4Y0GA 4WW2A 3A67L 2IG2H 4M43H 2IQ9H 1DBML 2BSRB 4X5LA 4KY1L 1FDLH 3QIBB 3VXUB 3QDGD 1XF5B 4IRJC 2UVFA 5FHBL 5JW4Q 3U7AA 1NLDL 4NM8L 4IHOB 5CKGA 1HHJB 3FQNA 2YN5A 2ADIB 2KZWA 4AIZA 1S78D 1K4CA 2YN3A 3HE7B 4JM4L 4OQTH 3CH8A 4NWUL 2R9HD 4KI5F 1X5FA 1W0VA 3U0TA 2Y5EA 2YUXA 3LHPL 5EZIL 4R6UA 4BK4A 3ARTA 3CX5J 4K9EC 1A7QH 2EZ0C 3QH3B 1ZOXA 4KKLC 2EIZB 2X10A 3PL6B 4UMGA 1AO7B 5DD3H 3P0YH 3MA7B 4WFGE 3TP4A 5J06A 1HKLH 1BVKA 1R3IL 3AFLA 1OAYH 1BQUA 5F7DA 1FFPA 4DAGH 5CWSA 1B0RA 3P4MB 3WN5B 4QRPB 1UJ3C 3BKMH 2R4SH 1VEPA 3NTCH 2AS5M 3DIFB 3LQAC 4Z7OF 4P5TC 5B8CB 2APVA 3PWUB 2PTTA 3QDME 3SOBH 2ADJA 3W11D 1G7LA 1L9MA 4PJCA 1U8PB 4LSSH 2UWEA 4QXTA 1U8OB 3GSQA 5BZWB 2GQHA 2OMNA 1G6RB 1MCLA 4AH2B 1A4KB 1TQBB 4JN1L 4WU7A 4G80B 3O3AA 3QZWG 4LU5L 2E27H 1JN6B 1WBZA 4DCQA 3EYOA 3W9DB 2V9QA 3PWPE 2YUZA 2DDQL 1A9BB 3IDXH 4DOHE 2E7LA 2WLYA 2XTJC 4NQDB 5FHAL 5I73B 2NXYB 4FXKB 5KG9A 4JHAH 4J3WA 3O4LD 4NQEA 4TQEL 5MEOB 2XV6B 1A7NH 4UT6L 2Q1EA 1CFNA 4IOFD 1EJOH 1KIRA 5E8NB 1KCLA 2OP4H 1E6JL 5FF6A 3VFRB 1CTOA 3VU2A 1IGMH 4QHNB 4M61A 5TDNB 1C08B 5DRXA 1MFAH 3QUML 2D0GA 3MLXL 3MQIA 4ZODA 3EOBA 1KJVB 5EU7C 4NQCA 2H8PA 4AG4L 3ETBF 4BJLA 1QFWI 1XIWC 1ZVYA 5ID0A 2FEEI 1TMCB 3B9VA 4RZCB 4WENB 3O41A 1JBJA 1D5ZB 1EHLL 4YDKL 5MENB 2X1PA 1YEJH 5DK2A 1MCHA 1MEXH 4OZFA 5DVMA 4G6KL 1CFVH 5H2BA 2ZCLL 4PRPE 1FVDA 3WFDL 4U1MA 4I2XB 1VCAA 3FO0L 2XG5A 3G5XB 4CN6A 3A6OA 4HLZH 1YPZF 4X6CE 5D7IE 1MJ7L 4J8RB 3WFEL 2W9EL 4NO5B 5T3XL 4PG2C 4YE4H 3MACH 3MNWA 2C4FU 1VERA 4DK3A 4PJAE 1YNTB 5ECJE 3SE8L 3QFJD 3VE0A 1Z5LB 4NKOA 4LCYB 1JUFA 4PRHB 1AXTH 5E2UL 2V2TB 1I8IB 1NMBH 5IBUB 2WMPA 5MP6H 3F58L 4FQXC 4I9WD 4OBRA 4WHDA 1BZ7B 3ARED 1IGFH 5DD1H 5J6HB 2O5YL 1NL0L 3I85A 3RGVA 2WBKA 4Z78A 3EFDL 3BP6A 5EUOF 5C09A 1ITCA 1VKXB 2WP3O 4KKBD 4MA7L 3EYVB 3GSNL 3QG6B 2XWTA 3HE7C 4NNPL 4GQ9L 2EDTA 3BEWA 3HMXA 4I4WA 3NN8B 1M1SA 4UU9A 3TO4D 5IGXH 5DD0L 1DBAH 1HDMB 2W0FB 3SCMA 1R5IA 4MJIB 4N0CD 3JTTB 4BQBA 1RZIB 1DDHB 3W5NA 3NAAL 4HUWA 4Y4FD 5CJBA 3BH8A 1CXKA 1ODAA 1AD0B 2F53D 4JG1L 3DYPA 1Q8MA 2Y72A 4LPCA 2RCSH 2D7MA 2DQDH 3QXAA 4LRIA 3SDCB 4CMHB 4UTAH 5KW9L 3CSPA 1S9WA 3HG1A 3U2SA 1P4BH 2JCCE 1S7TA 2NY4B 3PGFH 1OF2B 5E2WL 1J05A 4MQXD 2EH7H 3N9GL 2NX5A 4Q2ZB 4WO4A 3U82B 1BZ9B 4L4VD 5HHPB 1QRNB 2R0KH 4Z7WE 1D6VH 4Z5RA 3MLYL 4KRMB 4OCWH 1S9VB 4YGVB 2GTWB 2E7CA 2YOCA 1NCTA 1VGKA 3WJLA 1TQBC 1EMTH 1K2DB 4XBGA 5SWZE 3BWAB 1NLBL 2NY3C 2R1XB 2PR4L 3MRJB 1BVLA 4U6HA 4AEIH 2QLVB 5EBWB 4PTUA 5DQ9A 3T0ED 3BPOB 2XNAB 4Z7NE 2GJ6D 3KWWB 1P84J 5F7YC 3WKNA 3GEWB 5K33A 1H3VA 4HKZB 4LP5A 3MLSL 3DBXA 1F45A 2QQKH 4XP6L 1BJ1J 1INEL 1ZVHA 2KQNA 1QACA 4P48A 1JHTA 4AIOA 1TZIB 4ZFGL 3B9KB 5JOFA 3NFPB 4C58B 4Z77A 3OB0K 3BPCB 5HDBF 4JB9L 2BVQA 2QQNH 2Y4SA 4ISVA 1G7HB 3QUZD 4ODUA 3RWHA 3FT3B 4I5BA 3VFVB 1HQRA 4K7FA 3G5VB 4PRID 3JWDL 1U3HC 4G8IA 5K9OA 3T2PA 1BP3B 3R8BB 4AM0A 4WW2B 3TIEA 3L9RB 5T5NF 1QNZL 2B0SH 5JTWA 1AGFB 1L4IA 3T09A 1BJ1H 1IRAY 4XB7A 3K4ZA 4Z7VB 3QDGA 2W0LA 4PY7A 4DW2L 5CINL 4N9GB 3QFDB 5E08L 3T3ME 1UA6H 3MV11 4U6XA 1L6XA 2ZSVA 3NCFB 1VGEH 4ZD3H 5F9OL 1DQMH 3CJJA 4M62H 5T5FH 3OKNA 1U8IB 1XCQA 1W0VB 3B43A 3U0TB 5F7FA 5A2IH 1SYVA 3ZSSA 2ED9A 2EEAA 1NC2D 2OTWB 2AV7A 3ARWA 3UP1A 4YO0B 2OL3B 3NGBB 1NLDH 3DUUA 5T3XE 4NPYB 1R5WB 1YY9C 3ES6A 3HI1B 3QWQB 3C8KB 2OTPA 4EUPA 4JM4H 3L7FB 1ADQA 4WUKH 3EYQD 3IT8D 4M7JH 4OCRH 4X6BA 2OJZL 1NGXA 3FFCD 3LHPH 5EZIH 4NZTH 2KBGA 4R9HA 5B4MD 1T6VN 1H3PL 3CLEL 1KPRA 2FWOA 1G7LB 4K3DH 2UWEB 2EDEA 3LRHA 5HGDA 3R06A 4ELMA 4XT1C 1MIMH 5D6DA 3UX9B 5GS0D 3U1SH 3O3AB 2XN9E 3MRRA 5GGVH 5LG1A 4CMHC 1E4XL 3IS0X 4H1LG 3QEHB 3KYKL 5JOEA 3EYOB 4CMMB 3U36A 3J7HA 1BZQK 3C2AL 4UI2A 3PDGA 4EI5B 1NSNH 5KG9B 2XQYG 3O4LA 4U6YA 1QZ1A 3HE6D 3OX8A 4W4NA 5KSVA 1TVHA 1KIRB 2Q6WB 3JV5A 3V0VA 5C0CD 2X4NA 1F3RB 5I1KL 4NUGH 3MROA 1RZGB 2AQ2A 2B4CC 3ARPA 1UWXH 3OG4B 5IROA 3I02A 1NBYA 1C8PA 4H1LH 5CBEB 3QUXB 5F8RC 4OI9A 4W68A 3QNYB 4PS4L 4O9HH 3BPOC 2ZPKL 4NO0D 2Q86B 5ID0B 5IFAL 4D9QD 3V4PL 1ZLWH 3R0NA 2Q7NA 3U4EB 5DK2B 4OZFB 1ERNA 5D5ME 5H2BB 3L3KA 1ZLUH 2CXGA 3SEPA 5HGGS 3VGEA 3S8WA 2VXQL 4KQ3H 3WS6A 5HYEA 3EO9L 3KYMB 1LO0H 4TUOA 3CH1A 3UTPE 1DQJB 3B5GA 4P4KD 5LCVL 3WKML 1HILB 4RGNB 3UTTE 1QKZH 5DLML 1C5CL 2HJLA 5DEZA 3D3VB 3E3QC 4U1KB 4FQ1L 4YDKH 3QFJA 3G6AA 2XZZA 5E00A 2NQCA 3RNKB 3RI5K 5DJ8A 3ULVH 3KPLB 3OZ9L 5J0BA 1IGYA 3F8UB 3VFPB 2CPCA 3C6SA 4MA1B 1DUYA 3S97C 4WW2C 3AREA 5EU6B 3OKDA 3UTQA 4ZO7A 1N0LA 1IC1A 2ED8A 3WFEH 2A0LC 1XGYL 4Z78B 1PVHA 1GZPB 5HHOE 5H94B 4B5EA 2NY0B 1CGVA 3SE8H 2C9AA 1RAMA 3C2SA 3CVIH 1J0YA 2WIMA 3IDJA 5T5NG 4I4WB 1KGCD 2JIXB 4HZLB 3TO4A 5TDOB 4MYWB 3TO2A 5HGHA 3P0VL 2AJSL 3VWJB 3MV8E 3X3GH 4D2NA 1UB6B 1TETL 5KSBF 5HBBA 4I3RL 4HUWB 4Y4FA 4MA7H 4XCFL 5C0EA 1DBBH 1FV1A 2F53A 4KI5D 3GSNH 1XCTB 5DVNA 2JELL 5BO1L 4GQ9H 1O5DT 4Q6IA 2P43B 1T7YA 3AS2A 5JIKA 1YA5A 3VXMD 4LVHB 3RVVC 1XF1A 1W0WA 2EXYC 4YFDB 1P7KB 1WGOA 3GMRA 3RTQB 1EJ6A 4MZ3A 2NX5B 1I9EA 3JWOC 3P4OA 1EEYA 4L4VA 3BGFB 5A2FA 3X13B 4HKXA 3IFPA 4ZPVB 2JB5H 4P4RA 1JYWA 4TOYL 1T83A 5GS1B 5KJRL 2B5IC 2ID5A 4JG1H 3EJJX 4Y8DC 3TGXA 3RDTB 1R6VA 4TNWF 3GRWA 3K2UL 2OS7A 4NWTL 1AGDB 1E4JA 4GG8B 3BYYA 3AS1A 5E2WH 1YN6B 3GK8L 4FHBD 3N9GH 3MNVB 4PTUB 2E7LC 1BREA 3T0EA 2IPUK 3QEQE 1QP1A 1L0XA 5F88A 1V7NL 2GJ6A 1YEKH 1G84A 1I7RA 4OZGF 25C8H 1U42A 3QG7L 5IF0A 1AI1L 4OQ1A 3PP3K 4OD1H 2AJZA 3IDIA 4LKCB 2HWZL 2VDKL 3MRCA 1P4IL 2ICWI 4I0PB 4LEXH 2BVOB 5F6HJ 5IW3A 3WEXB 4G5ZH 4MVBC 4KQ4L 3T8XA 2DQFA 3VG9C 2NZIA 4XP5L 5L7XL 1OAQL 1WUNT 5LGKA 2DQJH 3QUZA 5J89A 1QYGH 4EN3D 5CIPA 4UZGA 4PRIA 5E6ID 4CN4A 5LVEA 1KPUA 1GGCH 2W9LA 2AXJA 4UQ3A 4BZ1L 5HYSB 2Z8WC 2IBGA 3E2HC 4KHXL 4F15B 2HJFA 2YD6A 4P57A 1D5BA 4JB9H 1KIQA 2CIIB 1A6ZA 4RGNC 5FYKL 1BFOA 2V5YA 1YJDH 3OKNB 4MA1C 1D6EB 3WNOA 3LCYA 1GC1L 5F96L 1HH9A 1NC2A 2XPGA 3L3OA 4JY4B 4KVCL 4LEOA 1IEBA 5GGUB 5EPMA 4ZO9A 3RGVC 1P1ZB 5IR1B 4JFQB 1VACB 5CINH 4ZUUB 3PNWB 1A7PH 1EXUA 4HWBH 4S2SB 4YHLH 3DO3A 4QY8B 1T1ZB 4D0BA 5C08D 5F9OH 4EUPB 1AGEA 2VDML 3HFML 2VC2L 3OPZL 1HHIA 5F3BB 1MH5B 4HD9A 4I48A 4WTZA 4X6BB 4PBVC 1NAMH 3FFCA 1X44A 4U1LB 4DQOL 5HHVH 3SCMC 1PLGL 4KDWA 4ODWA 3T1FB 3MGOB 2Q3ZA 3NABL 4J3UA 5JHLL 1EHNA 3UJIL 4JM2F 1BM3L 3WHE1 1YYLL 1T5XB 1GGUA 1KFAH 4FP8H 4MA8L 4LRIC 4KZDH 4X6DE 5FCSH 3UTSB 4WI7A 1AXSB 1I9IL 4PB0H 4XRCB 1A6UL 3ZDZE 3U36B 3A6BH 4JRYB 4PR5A 4WO4C 3CLEH 1H3PH 4ERSL 3BGFC 3LIZL 5M7QA 3BMWA 2ARWA 3DI2B 3GM0A 4JVPA 4U6YB 3LZFL 5TE6H 4NDMB 3WJLC 3HE6A 3K8LA 1DQLH 2GAZA 5EO9A 3WIHA 5I75C 1UM4H 5C0CA 3V0VB 4DUVA 4W70A 3VI3E 1XGRB 3ZTNH 1QA9A 2X09A 3O3DB 1A14H 4JREC 1NBYB 1TIUA 2VABA 5GRUL 5KS9E 2EO9A 3BPNC 4NO0A 2BC4A 4K7PL 2NYYC 1T1WB 3NBNA 7CGTA 3PQYE 1ORSA 4OD2A 1F58H 3BHBB 1QLRB 1MLBB 2NW3B 3L3KB 2BDNH 4BFEA 1OD9A 4NN5C 5I1KH 1LO2L 4GT7A 4KI1A 5AZEL 3KG5A 1CDUA 4YPGA 1CFSA 2MOVA 1ZHKB 4P4KA 4PRNA 5K93A 3ZKXC 5AD0A 4K8RH 4XNXL 1VFAB 1KTKE 2DIAA 3QHZL 2CR3A 4GBXB 5E00B 5E1AA 5DVLA 3QXWA 4TSAL 4FRWA 1CI5A 5JHDB 3QEGL 3C6SB 1XF3A 1A2YA 1Q9KA 1KACB 2QJDA 4X7TB 1J0HA 3HAEB 3VI4E 4JRXE 1W72B 3P4NA 3JSSA 1KB5A 5AUMA 4KMQA 4FXLA 1AHWA 1Q72L 3NIGE 3RWCB 1R3LB 1C5CH 5H35A 1EGJL 1S78C 3HS0A 1HSAA 5HY9B 1HHHA 2OMBA 3OZ9H 1SBBA 2R9HC 3E8UL 3BP7A 4WFEE 4JG0L 3FO9B 3MRHB 5HHMB 1ZHLA 1YYML 1JTOA 2F8OA 4HWZA 1R3KA 5C3LD 2VUYA 1BIIB 4JFDD 5BXFB 2JLLA 1ZAGA 3ARZA 1CU4H 3ULUF 1U8NA 4PP1D 5CEZL 2F53B 5CJQL 3UZVB 4M7KL 3CFCL 3O6LH 3VXMA 4QHUA 2CO7B 1GZQB 1NCUA 4P3CH 1W0WB 3QDJB 3ZHDA 43CAA 2CGRL 3GMRB 3FQWA 2GYSA 8CGTA 2IALA 2XZCL 4EI6B 3P4OB 5JW3L 1MFNA 2BZDA 3W11C 2VR9A 1OAKH 4HKXB 3MUGA 1AGCA 4HEPG 4P4RB 1LILA 5DJDA 3SDDB 2W60A 1XR9A 1RUQL 4XCFH 5D6DC 1EO8L 4OGYL 3VFWA 1U41A 3LMJH 1FG9C 1H9VA 2B1HH 2JELH 4N8CH 3T2OA 5HPMA 2ATPA 3MZTA 1FNEB 2CO6B 5TFSH 2O61A 1BWWA 4K2UL 1I7RB 1X5ZA 4XC1H 3NCYP 4TOYH 1CDIA 4FQQB 5KJRH 4APQB 3WS3A 2ZZUT 2OJEA 3IDIB 1DBKL 3LRSA 5IROC 4YHML 2BY1A 4JPKH 1JMXA 1T2QL 3GK8H 2WWKO 4F33B 2WM0A 2IADA 4TSCH 2ZUVA 2GHWB 4P2RD 4EN3A 5CIPB 4FZEH 2X1XR 4G9FD 4JO1H 5K9QG 4M7LT 3VXSD 1JNNL 5E6IA 3M17A 3QG7H 4WGWB 4DKFL 1AI1H 4X4YB 3FN3A 4QXUL 4UQ3B 2G9HA 1F42A 4H25A 1P4IH 3D39E 3WS6C 4PJ7E 4K7PX 5GGRA 3K8MA 2WBJA 2HJFB 4KQ4H 3MRDA 3KPRE 2AVGA 5AZ2L 1OAQH 1NUGA 1MI5D 15C8H 3MLRL 1D5MA 3C5JB 2ITCA 1IQDA 2OZ4A 5I8OL 4HSQA 1IC5L 1S3KL 1YPZA 5B3JF 1R3HA 1NKRA 1QVOB 4RMSA 4CAGA 3EZJB 4PV8A 2DLIA 3UC0L 4L4TD 2BNQD 1RK1B 3AREC 3QCUH 4BZ1H 5SV3A 3V6FB 3L3OB 3DX6B 1FLTX 1LO5A 3KYOA 3S7GA 2D4FA 2J7LA 1J8KA 3CDCA 3ZTJG 1FO0A 2MPAL 4KKBC 4NZDA 1Z2KA 3HPLB 1EXUB 1LP9B 4LSVH 4EKXA 1V8HA 5DEGB 5FYKH 4MSWA 3GMLA 1H3UA 1A9EB 1JZ4A 1SEBA 1SMOA 5C08A 3PWVA 1AGEB 3KPSE 3O11A 4JHWH 4M48L 4JGUA 4WGVB 5EFIA 1Q9OA 4L3CB 5C0FB 1HHIB 2RGSA 4YGAB 4I48B 3TO4C 2DAVA 2FR4B 5EUOA 1RVFL 2LTQB 4N0CC 5KANG 1IC4L 4DGYL 1P69B 1FL6A 2AJVL 3BP5A 3O2DA 4Y4FC 3QZWB 3ZTJH 4NN7B 4OIAA 4P99A 4Q6IC 1T7WA 5F7WC 2VDMH 2WANA 3OPZH 3S4SG 3QP3A 4HV8A 1DUZB 4UT7H 4MQXC 1F3DJ 4DQOH 1U95B 1Q9LA 4RFNB 4FNLL 5L2KE 4KJYA 3Q6FA 3D18A 3MUZ1 5D7LD 5JHLH 5D72H 3BW9B 2QSVA 5JPMA 2X6MA 2C7UB 3F65A 3MJ9H 3S37L 3ZYJA 5TDPA 4S0TD 1CBVH 1R0AL 3QEUB 2R1YA 1T83C 2ZJSL 1PW3A 1RV6X 2XZQL 5C0CB 3TVMD 1PZUB 4GRWB 1KENH 1T22A 1A1OA 4JCMA 1I9IH 1A6UH 3GMOA 2VH5L 4G6FB 2V6HA 2ZCHH 2QHRH 3T0EC 3LKQB 2JJSA 5F1NA 2WAHA 3QT2A 2BC4B 3S36L 2X4QA 4WEBL 1SY6H 1F3DH 3RWJB 1UVQA 4A6YA 1FL5B 4ZUVB 3REVA 3RGHA 4JKLA 4JFED 3CC5A 3GUTA 4H8WC 4A2MA 1LD9A 1A22B 4LF3A 4Z6AT 2I60H 1G6VK 1J0JA 4U1GC 3CXHK 3CXDH 1SJHB 1RFDL 4YZFE 3BO8A 3OL2A 5CJXA 2XG4A 5DHXB 2ZCKL 3TNMB 4HMCA 3Q5YA 4HS3A 3DYMA 3QUZC 3UTOA 5KSUB 1MAKA 5L6YH 2AXHA 3CCHB 3F5WA 4LLYB 1HSBB 4XCEA 5LXGL 2D7PA 4UBDD 2IPTH 3MV01 2BY0A 3MV7E 4J1UB 1JHKL 2QL1A 1JI2A 5K9QI 1RJZB 1QBBA 3IDMB 3FRPG 3OF6D 3P4NB 4UV7L 2GCYA 4ALAL 5AZEH 5EBMB 2BFVL 2WV3A 3HC4L 2VXUH 4XNXH 2Y7QB 5H35B 1VFBA 2G2RA 5I1HL 1J8HB 1J0ZA 4OD3L 1FFQA 1FVCA 2X70B 5DRNB 5I74C 5CGYD 2VLJB 1KSRA 4L8BA 2VMFA 1S9KC 5DZLA 5IMKB 4HUVB 1UACL 3SO3B 2D9QB 4HWZB 1ZVSB 4HKBA 1K3ZA 1R3KB 4JFDA 4YHIA 1YEGL 2GKIA 1UENA 3MODH 4HIIA 1P6FA 5DYOB 2VXVL 4LFHD 1GPOH 3FONB 4N0RA 1EIBA 4KUZH 5LBSL 3RVUD 1CZ8L 4IRSB 4N0UE 4ZXBB 1RUML 1ZV5A 3LN4A 4L8DA 3MV9B 1F4YL 3EYQC 2HKFL 4UQ2A 2RHEA 2FJFA 4JG0H 4PTTA 4QOKE 43CAB 4JFPA 2NXZD 2WW8A 1U3ZA 1WWCA 2XIDA 3N1FC 3WXWH 4JJ5B 2XT1B 5B4MC 3IVKA 4Q6YA 3MXWH 3DXAD 3KDMA 3PJSB 4XAWL 1AGCB 1P2CB 4OAWA 3SKJH 2RAMA 1HWGB 4TVPL 4DKDC 1XR9B 4P23D 3SPVA 2VLMD 5CEZH 5FYLD 5KANI 4NN7C 3VFWB 5GS0C 5BV7C 5HYJE 1MELA 3GSOA 4ZNEE 5E5UB 4LSTH 5I1DA 5IT2H 2EDNA 4ZTOL 3MREA 3D0VA 1A6AA 2D7NA 5DURB 4KRPD 1GOHA 4YQXH 3T65A 4JM2D 4HS6B 2QSCL 5JW3H 4MDIB 2EE9A 2VIRA 4MQ7A 43C9B 2Z91A 2NY5L 3T0WA 3HE6C 1JIBA 4ZTPH 2AV1A 1RUQH