1C08A

Crystal structure of hyhel-10 fv-hen lysozyme complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-HEN EGG WHITE LYSOZYME ANTIBODY (HYHEL-10)
publication title Crystal structure of anti-Hen egg white lysozyme antibody (HyHEL-10) Fv-antigen complex. Local structural changes in the protein antigen and water-mediated interactions of Fv-antigen and light chain-heavy chain interfaces.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 25
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1999-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c08A00
1OGAE 4U3CA 2FHFA 4BK5A 4XT1C 3LDBC 2DQDL 1BD2E 2ZCKH 1FNFA 3SBWA 1V5JA 1YYML 5FM5M 4JO3L 5GRWA 4P2OD 1IFHL 1G6RA 4LDOB 1TCRB 3WJJA 2UY6A 3H9ZA 4O2EB 4TRPL 1FHGA 3EYFB 3TO4A 3B8YA 2R8SH 3CXDL 4NQDB 4X98A 1NMBL 1XFPA 3ZKXC 4HDIA 2NY5L 4MWFB 5GGVH 1EVUA 4NNPH 5FA4A 1DCLA 1DANU 3RPIB 5C2BH 1PKQE 1HEZA 2NY2D 1L9NA 2Q8AL 5CMAB 2YUVA 2ZOKA 1I8LA 1WWAX 3OR6A 2ZKHL 2F8OA 4PJ8B 3W9EA 4FN0A 5DO2C 1TVBB 5CIPH 5E8EA 5KAQF 3V52L 3U6RB 3LQZB 2VE6B 3QFDA 4H1LG 3X3FH 2LAAA 2VLME 4X6CE 4JFDA 2BVPB 3GMLB 1T3FB 1YMMA 4M8VA 2A1WH 3CFDB 4GG6A 4R3SB 3QCVL 2J5LB 4JPIB 4YEEA 5K59F 5EBLB 1JNJA 4B0MM 3S96A 5HYJE 3UJTL 4JFQA 1EFXA 3P4MB 2F5BL 4L8CA 3O6FB 2CDGB 4JDVA 4R96A 4F9PC 4LHUA 4B53A 5GZNC 5DS8B 5H94B 4ODWB 2OMNA 5E95B 2BSTA 5ILTL 4KJYA 4S1RL 3O3EB 3OV6A 4Q7DA 5ICZA 3BOVA 4NOFA 2DQUL 3ZHKA 3PDDA 1I8MA 2ZCHL 5IFHL 2WSKA 5D1ZC 4HEME 4APQB 5D1ZD 2EIDA 1KYOK 3BKJH 3EYVA 3EO1A 4X4XA 1J05A 3SPVB 4O02L 4DAGL 5GXBB 2YHGA 2DJSA 3L3GB 3KLHC 1CDYA 5EU6E 4NHCH 5GRJH 1IQDA 3MNZA 4NO2B 1UH4A 4P59L 1QBLL 1MCQA 1GGTA 1WIUA 4KMLB 4R8WL 5L6YL 3IF1B 3CDCA 4XCYB 5HXMA 1A6VH 4U1LA 2G9HA 2QHRH 5F3BA 4HMEA 5SWSA 4LLVA 1HSAB 3RAJL 5CINH 4ELKA 1ZA6B 2DQFA 4UT6L 4XP4L 1KJ2A 1S9XA 4BJLA 3DGCR 1Y18B 1GC1L 1XR8A 3BMVA 4D9QE 2HP4A 4EI6B 4LKCB 3CFJA 3FO2A 2NY1D 3ECBB 5D1XB 1ZEAH 2OJZL 3FQUB 2YWZA 2A2QT 3MMEB 3T1FB 4QF1A 3O2DH 3O6KL 4EVNA 4JM2C 5C07B 2GCYB 3A6CH 3P73A 1HH6B 1ZE3C 4RSVA 5EA0L 4O2CB 3EOBA 1II4E 4WFGD 4G43A 1JF6A 1GPOL 1MVUB 1EPFA 1J12A 5IFJA 3RDTA 5DMIL 5AZEL 3BZFB 3FN9A 3KDMA 3BESR 1AQDB 3BH8A 1IKNA 3CVHL 4GJTB 5KS9E 4M1GH 4PJXB 1MRCL 2HLFC 3MUY1 1BJ8A 3V4PL 2HLFD 3WYRA 4OLZL 1IGIL 3Q6FB 1L9MA 2W9EL 2VNCA 2DLIA 1KC5L 1GC1C 2FLRT 3HI6L 3VGFA 3LV3A 4H0GA 5CGYC 2RR3A 4PJ5A 5D6CB 3O2VH 4R90L 3FO0H 5JHLH 1G84A 5SWZA 2EDQA 4DN4H 2R56L 3QUYA 3A6OA 1M6OB 1QYGL 1T1WA 1ZHLA 3HC3H 5DD0L 2BY3A 1Z5LB 2FH6A 3FB5B 4PR5B 5J7CC 1JMXA 4XPTH 5HHOA 1GZPA 1OP5H 3VG9C 1CR9H 4L3AA 1R5IB 2VJXA 3BP7A 3NIGE 1RZFL 2YD2A 5HGBA 4HUXB 5IVZA 5J6GB 5F44A 3ZMRA 2R0LH 4ZOCA 1UWXK 5GSVA 5E2WL 4P5TA 4XNZB 3AVEA 3NIFF 5DT1H 3KPSE 4OZIF 2DBLH 1XT5A 3U46B 2XY1A 3P77A 3FFDB 1XF3A 4NQTA 4FMFA 2X42A 4XNQA 1HNFA 2XG5A 1VCAA 3Q2CA 3G5VA 4LHJB 1NUDA 3KXFD 5DFWH 1ONQB 3F7VA 5BXFA 2ITDA 4LLQA 1AO7B 4NUGH 1AGBB 3AREB 1AGEA 3S88H 2CKBB 1T7WA 5IV2B 1MAMH 3STLA 3IDNB 3UBXA 1XR9A 2V9TA 5JW4Q 1YZZA 1WJ3A 5E9DB 3TIDA 1T1XB 1A6UH 1MIMH 2WZPD 2VN4A 3PGDB 4NRXB 4XAKD 4G7VH 1TZIB 4WHYG 4O2FB 2F5AL 5I8CB 4CVZB 2EO1A 4IMLA 4M1CC 3T0AA 3E2HC 4M1CD 3EDEA 4Z7VB 5L2JB 1AKJD 4NQUA 2UYLA 4JVPA 2ADIB 4X5XB 2WIIA 3RWIB 3ZDXF 4CKVX 1TITA 2J8UB 1U8MA 4Q6IC 4Y16C 3O2WL 3TESA 3RVUC 4JFFE 2XA8H 3WHXB 3UTSA 2L7JA 3WUWB 1SYVB 5FGBC 1PD6A 4I2XB 4EDWL 1CG9A 1J10A 1EEQA 5C08B 2A6JB 4NM4H 3WXVL 1T5XB 5EZJB 3UYRH 4OLVL 3QDMB 1DL7L 3NCJL 4JAMB 3HE7B 3LCYA 4Q97A 1FE8L 1NAKL 1WBXB 5M7QA 1A9BB 2IJ0C 4LSTH 2MCG1 4KQ4H 3B6SB 4K3DH 3QO1B 4NFBA 2B1HH 3EOTL 2DKMA 5GZOD 2FJFB 1Q9OA 4IJ3C 2NYYD 5FYKD 4LEOB 1U8KB 3Q1SL 1WAAA 4OIIH 2JJTA 3PV7A 1BBJA 1UM6L 3O9WB 5IB3B 3EBAA 3EZ8A 2EZ0C 1Q9LB 3MXVL 2EZ0D 2OZ4L 2P47B 4OZFG 5E8OB 5EBMB 5CUSL 3S34L 4B5EA 4JY6B 1N3NB 1MAJA 2NZ9C 3PL6C 4HSQA 5INCA 3U0TA 3PL6D 3H9SA 1G7PA 3PE9A 3RY6C 5DSCB 3K7UA 1U3YA 1FRGL 3O3DA 4OZHB 2QSCH 2P8MA 4QXUL 4PLJC 5L7XL 4AZ8A 5J9PB 1AJ7L 3U2SB 1GL4B 3GFUA 2WV3A 3N0PB 4U6HB 5EZOH 3QEQE 4D3CL 4Y2DB 1T04A 5HI4D 1UJ3B 3RZWA 3FHAA 2NY3B 1YEJH 3MRPB 3TH4T 3RIFK 3VH8A 1IAOB 1KTDB 1A14L 3IFPB 3MV9D 4FQCL 3ULVF 1I3GH 2N7AA 5BVPL 1N6QL 3HCVB 1U3HB 4NGHL 1ETZA 5IFAH 5J1SC 1AC6A 4P46A 4MSWB 3TBSB 4XXDA 3GJEA 5ESQB 1PLGL 1I1AC 2H6PB 5DEZA 2FNBA 1ZXQA 3O8XB 4HIHA 4OTXL 1P4LB 3D18B 2HT2C 2J2ZA 2JJWA 3R4DA 2HT2D 2PTTB 2UZXB 3AXLB 2CRZA 3BQUB 1KELL 4O58H 3W5MA 1OAQL 4NT6A 4JQIL 4U0QB 1Q72H 1QR4A 2O5ZL 5F3HA 4MS8D 3ARVA 3CDYA 4F7EB 1FCGA 3V4UH 2C7UB 1TVHB 4NKOB 5DK3A 3SJVB 1Z9LA 5EU5B 3LN9A 3QDGA 1VENA 1M7DA 5EO9B 4Z7WB 3T77B 1E6OL 5I8EA 2MHAB 2AJUL 2RIKA 3MV7D 2OCFD 1EJ6A 1NCAL 5GGSA 2R1XB 1DBKH 4FQ2H 4KUCD 1QR1B 5DVOA 1D5IL 5A2LH 5LGJA 1K3ZA 7CGTA 3WNPA 1P4IL 5F7WC 5ALCL 5ISZB 3SQOL 2GJZB 1S7SA 4QOKE 1NDMA 4QYOA 2A74A 5IF0A 5F7MC 4FXLA 1KB5L 2FLBT 3VXMB 3MNWB 2G5RA 4V2BA 4KK8D 4Z78A 3UCRA 5I15L 3IDUA 1K5NB 3BGFC 5I8KH 4GH7B 1BFTA 3QJFB 4PB9H 4I8DA 1P6AB 4QY8A 4EN3D 1FV1A 2QQLH 4RAVB 4P0DA 1BOYA 3RUGE 2YPLA 4PJHE 4WI9A 3MACH 5JPNA 4XPGL 1WAAF 5C1MB 5D72L 1QHOA 3MRCA 2QQNH 4HW6A 4LCYB 5TE4H 3JWDL 4S2SB 2GW5A 2W9DL 2PO6D 2X89D 5D96C 3TVMB 3U4BL 4G3YH 4E0RA 2DM4A 1V7NH 1QSFE 5LCVH 1CFNA 4TUKH 3PDOA 5D2NC 4XTRC 2NNAB 1QBBA 4Q9RL 2ORBL 4UUJB 1JPFA 4ZNEA 5B4MC 4EBQL 1B90A 5H2BB 5DHVB 5BO1H 1AE6H 1IEAA 3N1FC 4YK4B 3VGGA 1N0XH 1R3LB 1UYWH 2J6EH 5E94B 1VKXB 4PB0H 4LSPL 4OQTA 4CJ0A 1SBBA 1SJEB 1I3RB 3MRLB 2VLRE 2X4NB 3PIQA 5B38B 2E8ZA 1YY8B 2F74B 2DMCA 5CZKA 5D2LA 4X9BA 4PJFB 2PYEE 1S7QA 2BSSB 1KIPB 2DRUA 3QJHA 3S5LG 5HHXH 3JWDC 3SDDB 4N5EC 4KUZH 4N5ED 2E5EA 1QO3B 1NLDH 4AEIH 4WWKC 1FFNB 4MXWL 4WWKD 4CGTA 2DYPA 5JIHA 5HHQA 1G9MC 5TJWK 3GMMB 4HT1L 3U7WH 3QHZH 5B39B 3AMLA 1RZ7L 3ZT7A 2CRMA 3SGDH 2ATKB 1BBDH 5IKCA 4OZGA 4OI9A 2DKUA 3G5YB 1IC7H 1MY7A 3HAEA 4UT9L 4P4RA 3GMOA 2OQJB 4O9HH 1F3JA 1ITCA 1ND0A 4U1MA 3EIFA 1OCWH 2OJEA 1CLYH 2FJHB 5EPMB 5GGSY 5C0GB 2D9QB 4HUKB 2GK0B 4KPHL 1TJGH 3DECA 5E4EB 5T3ZE 1WFNA 3MRRA 3PXHA 3QB7C 4PG2A 1L7TH 1MEXL 5C07D 1CDHA 2H1PH 1KNOB 1QSEE 2B0SH 2V5RA 4HUWB 3MJ9H 2ERJC 5IBLC 1EV2E 5IBLD 5D71L 1BZ9B 3OXRA 3RZCC 4QXTB 5ACMA 3RZCD 3M17B 4MDIA 2QQKH 2HKHH 5KSBB 2GUOB 4XVJH 4GAGL 2VWEE 4JPVH 1HHHB 1UGNA 2VZSA 5T3ZL 1D5XA 4H8WL 1HOCA 4PRHA 4ZD3L 5D7LB 1XIWB 3VXOB 4O00A 3E6HA 4PRDA 4DTGL 4HGMA 3SY0A 1JPST 3WIFA 1V3LA 3NN8B 4BH7A 1FFPB 3GKWL 4UU9A 1VA9A 4N0FA 3O3AB 2A6KB 2V2WB 4KI5E 1LE5A 5IGXH 5F7NC 2A6DB 3OJDA 1F6AB 4JLRB 3NIDE 2IQAB 5A1AA 2CDEB 1NGZA 5I0ZA 1EAJA 3LDBB 4U6VH 2APVA 4NZJA 1MCOH 3V7MA 5JDSB 1KJVA 3HR5A 1OAZH 5HY9A 4MZ2A 1VFUA 4Y4FC 3V8OA 4XMPH 4E42B 1XH3B 1QD0A 4HF5H 5EORH 1X4YA 5D5MA 5TE6H 5FHAL 1IC4L 3VFMA 3KYNA 4H8WC 1KEGL 2EIZA 1X6NA 4ZFFB 3V5HB 4XP6L 2P4AB 3ZE0F 5I1EL 1SEQH 2XYCA 4H5SB 3PJSA 4LRIA 3HR6A 1T89A 5EU4B 1G7QB 1AD0B 1UC6A 2FDBP 1BQHB 3FO1B 1RHHA 3ARGA 3THML 5BZWB 3M45A 1BVLA 3SGJA 4U7MA 1J7VR 4M7LT 1AO7D 3G6DL 1MLBA 4TQEL 3PDGA 5ETUB 3DHJA 4MB4A 2VWEC 4UNUA 4DUVA 3RFZC 5EBWA 4C4KO 3RKPA 1KPVA 1FNGA 2OYPA 3T0XA 1FNLA 1QFUH 2ZUTA 3MRBB 1D5ZA 2A9MH 3H42L 3HZMA 2IAMA 4J3WA 5K9OB 4P3DB 4N1HB 4R4BA 4IHOB 3UZQA 3RWDB 1RUML 1XGPB 1LK2A 1YYMH 3U7YL 3VFOA 4RGOL 4KI5C 4ZO7A 4KVCH 4X6DA 1N6UA 1IFHH 5DD6A 1ZWIB 3C6LD 3KS0H 3DRTA 4U6YB 1YEDA 3EO9L 3EOYG 5L88L 3FOMB 1HXMA 3DX6A 3HMWL 1OGAB 1WICA 5BZDA 1NMBH 2VZOA 1KENH 3Q5TA 4X6EA 2IANE 3BZ4A 1BD2B 5HJ3B 3FT3B 1ZT4B 4U3HA 5EB9A 3FQXA 4PRIA 5CSGA 1A1MB 2C3XA 3AS2A 3Q48A 3D85A 5C08D 1TZHA 4OFDA 2HLAB 1CE6A 4OI8A 3C6SB 5HGHA 4IRSA 3V52H 1NC2B 1M05B 3MCKB 5CSZB 4NKMB 4XRCA 1IEBA 1PKQB 1OY3B 1TJIL 5IWLA 4G6FD 4Z8FL 1WWWX 1U8NB 1W0WB 3QCVH 5FA3A 3UJTH 4PV9B 4LASL 3G6JE 2F5BH 3PWUA 1YPZF 5T5FL 5DC9B 5C0CE 4X6CB 1CICC 1WZLA 3O9WD 5ILTH 2OX5A 3L3DA 2IH3A 3PHSA 2D7PA 2DQUH 4XBPA 1OTTC 5HYJB 2LAGB 4RA0C 1MHCB 2P42B 3S4SB 4JM2B 5MENA 1P5VA 1RUKH 4LF3A 3PQYE 3ZE2E 5DJCA 1NKOA 2IALB 2DQJL 1ZSDB 4O02H 1KPUB 4DAGH 4NNYA 2IH1B 4NZUL 5F9JA 5DK0A 3QPXL 5D93B 2ESVA 1FZOA 1VFOA 2FZ3A 1RZKL 4P59H 5I16B 2VO5A 4UBDC 3RL1B 4R8WH 2O5XL 1CZ8L 2FCBA 2H8PB 3FONA 3MRQA 3WLBA 5IP4A 3L9RB 1HI6B 1DN0A 4ONHA 4YHIA 4GXUN 4U2ZA 3QIBD 4TVPL 4RMTA 4G8GA 5MEOB 5D7SH 1B4JL 3RAJH 1X44A 4UT6H 1E27A 5DRZB 3TNMB 2X4OB 3MOAL 5F89B 2HTLD 1GC1H 1EHLL 3D39D 1FN4B 1ODAA 4I77H 2G75A 4PLOB 3U79A 4YXHL 1W72H 5C92A 2IQ9H 4GW4A 4AEFA 2I07B 3QWRD 2XTJD 4OCYL 2OJZH 3DROA 4FQQB 4G6KH 1NEZA 4Z0XA 1HXYB 4M7ZC 1RSFA 5I1DA 3BQUD 5DJ8A 3O6KH 3ZZ1A 4OLWL 4NN6B 5ACZB 3PWNA 3VG9B 2ZUWA 4MNQE 3NA9L 4PBWD 1J0JA 4KK6C 5EA0H 4P4KA 2HJKA 2F53D 1K4CB 1GPOH 4Y4HC 5IJVB 1RZKC 4QRUB 4Y4HD 2J1KA 3CVHB 3U0WL 4HKBB 1W0VB 4BELD 5JNYB 2FSEB 1WEJL 3HHRB 3CVHH 3KPRB 3I6KB 3RIAK 1F11A 5HVHC 1CXLA 3V4PH 3LN5B 4HJJL 4OLZH 1IGIH 4U1SB 3TF7C 2W9EH 2NXYC 3V8CA 5DD5L 2NXYD 1FYHB 1NJ9B 1N4XL 1KC5H 3QQ4A 4QKXB 3HI6H 1YEGL 3CFKB 4R2GD 1FL5A 4GBXD 4PY8I 4ZUSB 2VQUA 4WCYL 3VMNA 2EEDA 5KS9B 2F19L 3HC0B 3OGOE 5KOVC 2EKSB 1C5DA 1S5HA 3QIUD 3RWFB 4XNYL 1LO5B 5DD0H 5ERWB 1AGFB 1RURL 4NQCE 1BVZA 1CU4L 4MJ6A 4NYLA 4XHJD 5LGHH 2AQ1A 5BMFL 5ELIA 2ZSVA 4WTXA 3MV01 4QHNB 3OKEA 2PKDA 4YGAB 1KCRL 2VDNL 1UKTA 1A1OA 4PJDA 1B9ZA 2HN7A 1RZFH 5DMKA 1IT9L 5E8NA 1I7UA 3RWEB 1NFDE 2VYRE 2BMKB 4YQXL 5C0JB 5E2WH 4Q6IB 3HMXL 4P23A 5E5UB 4Y16B 1FIEA 2G5BA 1I7ZA 2WWKT 1C5BL 1LDSA 4KKLC 3T65B 2UWEA 2BNQD 4M5YL 3V7AE 4G9FE 4NDMA 1I85C 3OKMA 4OD1L 1DUZA 4KKAC 4I0PA 5A16B 2VTFA 4WFEE 5I17B 2X4SB 3GRWA 1U2CA 1BPVA 3VDBA 3QFJD 5C3LD 3GDBA 3MR9A 4GRLD 4E41A 2W0FB 3KPSB 5JUEL 4PJXF 4EDXA 3TP4A 3C60D 3ILQC 1IGFH 2FBJL 1MFAH 3IAGC 4PJ9A 2CDFB 4HWEL 3GM8A 2C3WA 2VLJB 2F5AH 4IJ3B 3JBG7 3DXAA 3LPGA 4UDTA 1ORSB 1CD1B 3SDCA 4KROB 4LSRL 3SN6N 5HYQB 1QVOA 4M02A 1SMOA 4C59B 4YXLL 5CBEB 3TZVA 1BREA 3MTRA 4R0LC 5I1LA 2APFA 2BVQB 3IXTA 2VDQL 4PJIA 2C26A 3SDDD 5DK2A 5IJKA 3QULB 3O2WH 3SKOA 4Z7NE 2AABL 1SYSA 1CL7L 2CK2A 1JWUA 4HKZB 5HHVH 1MUJB 4AQOA 1S9KC 1OD9A 1QFHA 4EDWH 1MHHA 3LEYH 3J8F7 5BRZE 4K7FA 4PRBA 2V5TA 1LD9A 5EOCH 1Q9WB 1EH9A 2ZUUA 4WW2C 3ARUA 3WXVH 4M7KH 1DBML 2EIEA 2W38A 4ALAL 1SBSH 3G6AA 3IB4A 4G5ZL 3SO3C 4ODUB 1LEGB 2VDOL 4LGSB 4JFFB 3V5DA 1P1ZB 3NCJH 3ARDC 2YZ8A 3LEXB 3W0WE 4CW1B 3AB0C 3ARDD 1FE8H 1NAKH 4DZBB 1FFRA 2PCPA 2VC2L 1UCTA 3OGCA 3ETBF 4HIIB 1ITBB 4X8JA 3NCBB 3EOTH 4I9WE 4QRPA 2EKJA 2CLVA 3C8DA 2V2TA 1N59A 4MQ7A 1HILB 3Q1SH 3RHWK 1RJLA 3BYYA 4R7NB 1T0MB 5H37G 1KB9J 2ZOLA 2ZPKH 4U7SA 1UM6H 3ARBA 5IVNA 2EYSA 1WFOA 2AEQL 1A4JA 1H9VA 1DQJA 4WJ5A 3CH1A 3MXVH 1I1AB 2OZ4H 3S34H 5KANI 1T66D 5CUSH 1U3JA 3WFEL 4JM4H 3GGWB 1T22B 3CFCL 5DDHA 3EDFA 5FUZL 1H3VA 3GJFA 3CLFL 1J18A 5IQ9A 3QUMH 5IHZB 1F2QA 4PGDB 1FRGH 3MJ7B 4QXUH 4HWZB 5CJXC 5L7XH 2J8UF 1AJ7H 1XF5A 4QXGH 4YBLB 5D7LD 5TF1H 1IM3A 2DN7A 4Y1AD 3SKMA 3QNYA 4XP1H 3TA3A 1WWBX 3U9UA 1ZLUK 1IGML 2YD4A 3OXSB 3QCTL 4MMXC 1A14H 2X70B 2VSDA 3MGAA 2E7HA 5E70A 2CIIB 4FQCH 2F8XC 1AFVL 1D5BB 1OHQA 3TC9A 5BVPH 1N6QH 2VLKE 4EEEA 2UWEF 3QIWD 4HZLA 4YHKL 4GFTB 1IM9D 1YA5A 3FB7A 1JNLL 3QEQB 4NGHH 5C9JB 1R3HB 4PJBA 4WTZG 4IS6A 3VWKA 2WW8A 5F7KC 3D87B 4R7DB 4MGXA 1QPXA 1PLGH 4C83B 4GXUM 2Z4QA 3VXSA 4F7CA 4OTXH 4QRSA 1GSMA 3CAFA 3GM0A 4LCUB 3JVGA 3B83A 5T33H 1OAQH 2A6IB 1CQKA 1DE4B 3QUZA 3UTTE 4JQIH 3BGFB 3Q5OA 1P7QA 3D6GA 4JHZA 4Y19D 1EEZA 3WIHL 2AV7A 2BXZA 5KANG 1JUFA 3BP5B 1I7RA 3DX9A 3FN0H 3FRPG 2NTFA 4OAWB 4HCRL 1VFAA 1CGYA 4HJGA 1NSNH 4DGIL 5FOBA 4K7PX 5D96B 1E6OH 2AJUH 1QKZL 2DAVA 2P5EA 4XNMB 2G60H 4I0KA 2MQ0A 4NUJB 1NCAH 4KMQA 4RIRA 3QWOA 4YHNB 5D2NB 3EGSA 1KCSL 1QACA 5D9SA 1UVQB 1C16B 3JV4B 1D5IH 1EAPA 5DURD 5FXCH 2NY6D 1W0YT 3D25A 1JGVH 1LNUA 1J8HE 1P4IH 2NY0C 5ALCH 3ULUD 4ZS6C 1QFOA 1H0DB 4N0UB 3O11B 3QHFL 3VFWB 5DZNA 2JB6B 2IEPA 5J11B 1KB5H 3IJHA 3P40A 4ETQA 1RK0B 2IADA 5T1KD 3H3KA 2BX5A 1PG7X 2Y25A 5C09E 4F8QA 4JFOB 1D5MA 5D7IE 5FYKU 2R69L 2XKNB 3BEVA 4FP8H 5SV3A 1K3IA 3MV8D 4NJ9L 3VFNA 3WN5C 1JPSL 1CXEA 4QOKB 4RMVA 4QHUB 4JKPH 1GIGH 3MPCA 4XPGH 1ZGLP 1PZUB 4LLWB 1JWMA 4PJ7A 2QSQA 4JO2L 2XN9A 4XBGA 4PY8J 4K7PL 3JWDH 1JWSB 2W9DH 2R0ZH 3U4BH 2KUTA 1HHGA 1DP0A 1I75A 2YMXL 4P2RD 4P2QE 3ZKNC 1K8DB 4Q9RH 2ORBH 3ZKND 1HYSD 3FCTB 1PQZB 1OAUL 1G9MH 3RUGB 4EBQH 4PJHB 2GJJA 1HQRA 5ABDE 4GMSL 3GKZA 4HWBH 4K3JL 3SGDI 1OTSC 5T1LD 3HE6A 4LCCA 2X05A 3NGBC 3ILPA 2BNRA 4ZUWB 1IGYA 3VI4E 3IDJA 4NKDA 3X13B 1QSFB 1TJHL 4G8EA 1LP9E 3I2CL 1UH3A 4LSPH 3WL9B 3MBEB 1PG7L 2DMBA 2GHWB 1YNKL 4WWID 3WMSA 3CMOH 1OT2A 3WKNA 5IR1A 4X5LA 4MJIE 5GGRB 3WHE0 2LU7A 1G0YR 3MGTA 4LSVL 4WHTA 2RJMA 5I73C 3BN3B 3DTXA 3NFSL 4M7LL 1PJ9A 3K80A 3B2UC 2XQBH 3QCUL 4DGVL 3B2UD 3QZWB 3TT1L 3D3VA 4ZFZB 3I9GL 3UX9B 5I75B 5DJ0B 4PJBF 4M7JH 3LS5L 1TXKA 2VLRB 3F7YB 1T1YA 1T21B 2JELH 4HT1H 2HJFB 1IGTB 1A7BA 2D7OA 5TDOB 1F02I 1RZ7H 4P3CL 2PYEB 2X1PA 1S9VA 1FZMA 1QRND 4LARL 5B38G 4KGLA 5KSAA 1ZHKB 2DQGL 4FQHA 4P2YA 3VFRA 5D1QA 5C6TH 3DMMB 2R1YA 5GRYA 3L5XH 3CX5J 1P5UA 2IPUG 4UT9H 5EU7E 5INDA 3VWJD 3LKQB 2GTZA 4JFEA 4BSVA 5EU6D 3E3QC 3HG1E 3HNSH 4R97B 3OHXB 5DWUL 2GIYA 4V2CB 4QHLB 5KBNC 2XQYG 4U05A 3RL2A 1J5OL 3MREA 2YA0A 4P2OA 1LDPH 4KPHH 1FDLL 5LG1A 3BRDA 5B39G 4HEPG 1WCBB 1KG0A 3RJDA 4JQXC 3MRFA 4ELMA 1MEXH 2VZ1A 3GIZL 1NANH 4A2LA 1XF2A 4YHZH 4Y4FB 1EA9C 4Y5YB 4DGYL 5ICXA 5L2KE 1U58A 4S0TD 5D71H 2P8PB 4Q9QL 5FYJL 2G2RB 3HUJA 5SX5H 3ARSA 4DK6A 1FQ9C 3KR3L 3K74B 3K4ZA 5K59E 4GAGH 4OZFA 1GOFA 2FGWL 2Z8VC 1C1EL 4H8WH 4IOSD 1QSEB 4Y5XA 4M93B 3GB7B 5AG8A 3P4OB 3O41A 3U82B 3DVGA 1Z0MA 4DTGH 1ZT1A 4MAYD 4ZDHB 1FL3B 1UZ8A 1JZ7A 3GKWH 3DX8B 4Y4KC 2VXQH 3RWHA 4NQED 5EOQL 2GI7A 5J13C 1WBZA 2GY7B 4YR6A 4PJ7F 3WNMA 1EHNA 4DQOH 5C86A 1DANT 4TUJB 3O4LD 1RULH 2V5YA 1CFQB 3IS0X 5C6PB 4TSBL 3LSOB 4PTTB 1RZ8A 1MFBL 1GZQB 1XGRB 2Z93B 3MRMA 4OKVA 1W2KT 4IIQA 4X5WB 4XGZA 1U95B 2DKSA 1IC4H 1C12A 1MJJA 1KEGH 2CO7B 3T0ED 4XP6H 5I1EH 3VRIA 2CRYA 2QSTA 3DI3B 4FQLH 1MRFL 1F97A 3QAZC 1A2YB 4WI5A 2H32B 4EKXA 4ZFOA 2VZUA 1BZQK 3FQRA 3Q3GA 1QFWM 3FQTA 3V6FA 3TH2T 3PV6A 2H32H 1U8JB 3THMH 2Z91B 1MHEA 5IB5A 1UKQA 4LVOC 5GIRB 4TQEH 5KSBF 2NQCA 1R24B 4GKNB 1X3DA 4N1CA 5H35A 5C0AE 2BHYA 4HPOL 4FTVB 1DZBA 2DF3A 5A2JH 4PJEA 4XPFH 4XAWL 3H42H 3C5JB 1OPGL 4J12A 4EI5C 2R2HA 1SM3L 2EDYA 2UZIH 3IFNL 1AC0A 1RUMH 4POZC 1XGQA 4I3RL 4POZD 3U7YH 2I5YH 4RGOH 5FDYA 1KJMA 3B2VH 2IF7A 4FQXA 5FYLE 1IJ9A 1AI1L 4NBZB 1CWVA 1ZHBB 2JLLA 2GITB 3WNKA 5IW1A 3HMWH 1JNHA 2LFGA 2Q76B 3VXRD 5LQBH 2PW2A 3K4DA 5FDWB 4XMLL 4OF7A 5FKPA 5DJXA 5GS3A 3CFBB 2O61A 1P7HL 4QTIH 3KVQA 1WIPA 1HINL 1X5IA 2IPKA 4L3CA 5FYLL 1G6RL 2AK4E 3ZKSD 2IANB 4JFFD 1KLUA 2HT4C 3MRHB 5DUBA 3DVFA 2X10A 3RGVB 5MEQA 1TJIH 4Y2OA 4JFYA 1IGCL 2JF1A 2YEZA 2ARJB 5DMJB 1TTGA 1J1PL 1T2JA 3VDCA 1AGDA 4LASH 5CWSB 5HVWA 2M2DA 3D0LA 1S7VB 4NNXA 5A2IH 1J8KA 3SKJH 1R5WA 3NIFE 1VACB 5C0BE 4OZIE 5ID1A 2R2EB 4LBEA 2BFVL 3SCMC 5EOTA 3SCMD 1N7ML 4J3OC 1NDGB 2ZCLL 1SJHA 4M7ZB 1FL6B 3G6JB 1PVHA 4L3EE 3SBWC 43C9B 3U83A 4KTEH 1NCUA 5C0CB 3FT2A 3ROOB 4K94L 4WI3A 3CPLA 2DQJH 3WJJC 2WWMC 2DM3A 4HUUA 4JFXA 2WWMD 2CIKB 4FFVC 1UQSA 3BEWB 4LPTA 4NZUH 1FZJB 3TO4C 3S8WA 4FFVD 3KXFA 3RRQA 4NFDA 3QPXH 4ZUUB 1AIFB 4JKKA 1RZKH 1BWMA 2O5XH 1CZ8H 2VZVA 4WHDA 1FZKB 3MNVA 1BQSA 3LQMA 5HVHB 3T2NL 2CRIA 3BUYA 2MCPH 2VZ3A 3PQYB 4U1KA 3B3IB 4JN2A 4TVPH 3EUUA 4AJ0A 5DEFA 1B4JH 4P57A 3V0VA 2VISA 3MOAH 3ZDXE 5CBAA 2HH0L 1EHLH 3T8XA 1B0GB 1BQUA 3UJIH 1NCTA 1E28B 4HLJA 4DWHA 5EO0A 3AGVA 1RIVH 4YXHH 5C0NC 4JFDD 1YMMD 1AKJA 2CLRA 3KPOA 5C0IB 4OCYH 1WISA 3TNNA 1LGVA 2XRAL 1G7JB 3KAAA 2R29L 4K94C 2NLJB 1TNNA 4OLWH 1INDL 1YMHB 1AXTL 2JJUA 2Q6WA 4PJEF 3NA9H 3UJJL 5HI5C 5E8PA 1JPGB 2AXGA 4FFYL 2D2OA 1IKFH 2JTDA 4YDLC 3U0WH 2XZAL 1WEJH 1U3ZA 1RZJL 1JHLL 4HJJH 4MNQB 5DEGA 4G80A 1N4XH 3ISWA 3FTGB 1EERB 1YEGH 3MJ6A 3FFCA 5JO5A 1XAUA 5EC2A 3D0VB 1NGXB 5FM5O 3X12B 4WCYH 3EOAA 1EK3A 4LLYA 2JE8A 4C56E 1CD9B 3KWWA 4NN7B 3ZT5A 4Z6AT 3BE1H 4F58H 2ZWLT 4XNYH 4GAJL 1EXUB 1RJZA 4HS3B 2Q3ZA 3OB0K 4ZTPL 5BMFH 3OAYH 4X0KA 5SWSD 4UB0H 5BCAA 1A22B 5HYSB 1G7HA 5I19L 2XTLA 2VDNH 1UFUA 1NGYA 1NL0L 4BQBA 4RNRB 3AS3A 1OW0A 5E6IB 2P5WD 4MNGA 4TTDD 3LB6C 1SVCP 1IT9H 3L3IA 1RZJC 4R0LB 1CGXA 4NQCB 3TWCL 4YQXH 4XCNB 3KPMB 4P3WA 1CDUA 2B4CL 1S7WA 3ZKQD 3ULVE 4U0RB 1HHJA 2UVFA 4NBYB 4M5YH 5IB4A 2FWOA 1DBAL 4OD1H 2AEWA 4NO0D 1T7YA 1CGSL 3RDTC 2XWTA 3RDTD 3WSQH 2X1OA 3QQ9C 4BQ6A 2X5PA 1OLZA 4I5BB 5JUEH 5EUOF 1IKNC 1Y0LA 4F57L 1XCQA 4G9FB 3CDGA 3EYOB 2FBJH 5I74B 3V95A 3ULVL 3IDGA 4KZDH 4HWEH 2EYTA 3IU3B 4LIQL 3WJLA 1VSCA 5I1CL 4LP4A 4LSRH 3KS0J 4BZ1L 4RGNC 1KN2H 4RGND 1KEML 4YXLH 1UB5A 2YSSB 4KDVA 1P2CB 4W70A 5JW5A 4N0CC 2SEBB 3QUYC 5SWZD 4N0CD 2B4CC 4HUNB 3G04A 2VDQH 4ODTL 3VGHA 4ZXBB 1DQQA 2DOCA 4ORGB 3MYJA 4BH8A 2AABH 2HVJB 4OLYL 4ZUTB 1CL7H 3HRZA 3DV4B 2WWKO 3RNKB 5F1IA 1K4DB 1KSRA 3IXAA 4WV1A 1TETH 2PYED 4Z77A 3RJQB 5GGUA 4FFZL 2E3VA 4V1DE 5EWIL 1DBMH 3KHOA 5JW4R 4ALAH 5AUMA 3HZVB 2B1AL 4G5ZH 3T08A 4P5TC 3REWB 2ICES 4LU5L 4P5TD 1MJUH 2VDOH 1NMCC 4JQVA 3H3BC 4YGVA 4BZ2L 4PUBL 3AROA 3QUKB 4QGYA 4QRRE 2VC2H 5BRZB 2CKNA 1MCFA 3LPFA 4LLAA 4P49A 3FJTA 2KPNA 5EN2A 2OR9L 5GGTL 2I24N 4FABL 4IM8A 4PGJA 4DJMA 4YFDB 5F6IC 3RVWC 3EYFA 5BW7A 1WAAE 5KVMC 3W0WB 3MLRL 3OAZK 4NQDA 3I84A 1NQBA 4LPXA 2HFFA 1S9YB 2AEQH 5CFHA 4MWFA 1UB6B 3UYPA 5JZ7D 4EN3A 3S36L 1JTPA 1I9IH 3CFCH 3W9DA 1FGVL 2VDML 3CLFH 3KJ6L 2Z31B 1TVBA 4Y0GA 3MRGA 3H9SE 5DVKA 2PO6A 3RKDD 1N2RB 2EC9T 3LQZA 4K3EL 2Y6SD 2FR4B 3WKML 4H25A 5J1AB 4MD4A 2BVPA 2I9TB 4KKCD 4PJAA 2CGRL 5C70A 1JN6B 3RVXD 2AKRA 4JPIA 3WCYA 3OR7B 4JGJA 2V7NA 1SQ2N 3L3HB 3JUZA 4PTUA 4KTDH 1FFOB 4PYGA 3P4MA 3WIIH 1EHXA 2MFNA 5CS7A 2LE9A 3L5IA 3O6FA 4JG0L 5IHBA 1H15A 2BOBA 4LDEB 1JNLH 1HKLH 1MVFA 3C5SB 2Y5EA 4IDJL 2QR0B 3GI8L 5A2FA 1A3QA 3F12A 2NY0B 1CFTB 3T0BA 2QL1A 3TBYB 4Q0XL 2D0HA 4O51B 3ULUH 1MFNA 5F1NA 4APQA 3H7BB 4RFOL 4X6BA 2VLKB 1MWAH 3SPVA 1RJYB 1HYRC 3IGAB 5IMKB 2JJTC 3CU7A 1K2DB 5DI8B 2R4RL 4NO2A 4JREC 3HB3C 3BSZL 4JCLA 3WXWL 4L5FL 3IF1A 5FKAB 4HCRH 4XCYA 4M43H 4NC1E 4HLZG 1ZLUH 2F54E 3SDYH 2XV6B 3QDGE 4HXAL 1QKZH 1NGWB 3L95A 4UOW0 1LEIB 3V6OA 2NW3B 3UTTB 4N9GA 3SGKA 1GGCL 4W6WB 5A2KH 2XKSA 1KCSH 2ZP0T 1DFBL 4Z7UA 4MQXD 4EI6A 4LKCA 2KQNA 2GSIB 5E6ZA 4OQ1A 2GKIA 3OKOA 2LQRA 1E4JA 1CLOL 3ECBA 3BKML 4K8RC 1P7KB 4K8RD 3NGBB 3BZDA 3FQUA 1WT5A 2X6MA 4CDHA 3QHFH 4NRZB 5GRVL 4ODHL 5AD0A 5ID0B 5F72S 1FC2D 5C07A 2GCYA 4L4VE 4KUCF 3GMPA 3P9MB 4AT6B 4J1UB 1CTNA 1XCTB 4F7TB 2D31B 2E7BA 4NCDA 4TULL 2R69H 1MVUA 2HRLA 1J8HB 2Y06L 2WINB 4P46C 4JFPB 1JPSH 4P46D 2BERA 4RWYL 5EO1B 5I73B 1N8ZA 3PWVB 3CVIL 3KLAA 4URTB 3NPSC 1I1YB 2YPLE 3Q6FA 4JO2H 2ZUSA 4R26L 2Q8BL 4K7PH 3RWGA 3MUGA 3TV3H 1AGCB 2YMXH 1MHPL 1A64A 1OAUH 4M8QB 1JZ8A 1ZLVK 3VJ6B 4GMSH 4NC1C 4K3JH 4LCWE 1KTLB 1LVEA 5HD8C 1JGEB 2OTUB 1Z5LA 3F65A 5HD8D 1XGUA 5K9KB 1KGCE 5DVNA 1DLHB 5ANMA 1TJHH 4PR5A 5F9OL 4JY4A 3I2CH 3V5KB 4EUPH 4PJAF 1GH7A 3MA9L 1PG7H 4BFBD 3ZE0E 1ZTXL 2X4RB 1OSZB 4XI5C 2E8YA 3BKYL 2E7LC 1YQVH 1MFEH 1OOAA 3VFTA 5J6GA 3LRGA 1I1FA 4LSVH 2H26B 2ZNWA 4K2UL 3NFSH 3I75A 3DETC 5IMOA 4M7LH 3QCUH 4DGVH 1V3KA 3U46A 3TT1H 3MRJA 3QDAA 3I9GH 5EU3B 5ECJE 3MXWL 5FHBL 1NANI 5FUOH 3D9AL 4MJIB 4HFUL 4OQTL 1ONQA 4X83A 5EOCJ 1QHPA 4L8BB 4P3CH 1AO7A 4ISVA 3DIFA 1AGBA 2QEJA 3GMNA 2DQGH 2EDNA 5IV2A 3IDNA 1J1XL 3S3JA 4JE4B 4PP1D 5DTFA 3S37L 3ZKMC 3M8OL 1HHKB 1U8HA 1T1XA 1U91B 2Q7NA 3BZEB 4MA8L 4NRXA 1HK6A 1MREL 1U2HA 4JB9L 1UG9A 5DQ9B 3QZWG 4CVZA 4JZNB 3WNLA 3DSFL 2XWBA 3B9DA 3JZ7A 5L2JA 4UQ3A 1J5OH 4JRXE 2ADIA 1DTUA 1FDLH 3C6LA 5IVXF 3RWIA 3GBLA 2WBJD 2UV3A 1AXSB 3ARZA 4IRJB 3HG1B 4HFWB 4Z7UF 3WHXA 3GI9H 4HIJB 4I18B 4OCWL 3WUWA 3P9LA 5DR5H 1SYVA 4I2XA 2VL4A 1F42A 4HIEB 4DGYH 5IB2B 2C4FT 1MJ7L 5FYJH 5C08A 1PKOA 5F9WC 2A6JA 3SKUD 4YHOL 1T5XA 4JGMA 5EZJA 5F93C 3BN9C 3FQWB 3QDMA 4J4PA 1FG2B 3BN9D 5I30L 1C1EH 3GIVB 2IPTL 3SDXF 1FJ1B 4JAMA 1A5FL 1VGEL 3HE7A 3QAZB 3B4NA 1EUTA 4F33A 1A9BA 1YPZE 2P8LA 5L2KB 2I27N 1ZLWH 2KQMA 5J57B 4AH2A 1D6VL 3ELAT 4NRYB 4YAQA 4Q9BA 2DYPD 1T20A 1X5ZA 5EOQH 2HA1A 4LEOA 1J11A 1U8KA 3HC4L 1JYVA 1HSBB 1ERNA 4GQPH 4NC2B 3CIQA 4YO0A 5DJYB 3R8BB 2DQIL 4D0DB 3U0PB 3O9WA 5IB3A 3OX8B 4MDJB 2D0FA 4BSWB 1BEYH 5EBMA 4TSBH 5E8OA 1L6XA 1N3NA 1MFBH 3E1F1 2HKFL 2WUCL 5HDOA 2GK2A 2M1KA 3CMGA 2KBGA 1PYWA 3CXHK 2WQRA 1MELA 4FRWA 4H1LB 3U2SA 4X7TB 5CZXC 3OQ3B 5CZXD 5GPRA 4PG2C 1KB9K 2QLVB 4Y2DA 2R8SL 1MRFH 1UJ3A 4CJ1A 4LP5A 1U6AL 1IAOA 3PF2A 5GGVL 1KTDA 4YHML 2FIKB 1NCBL 3DBXB 3QH3B 3FO9B 2D0GA 1M71B 1OARH 2ICEB 5T5NG 2EH8H 4OF0A 3QIBA 3C09C 2DMKA 2B2XL 4HPOH 1NC4B 4XAWH 3X3FL 2NY4D 4P5MB 1U8QA 4G6AD 2XY2A 5ESAA 1BFVL 2HRPH 2RAMA 4M1DL 3GMQA 3C2SA 1ADQH 5CP3H 3LRSB 2A1WL 1SM3H 1P4LA 5E5RB 3CFEB 3QWRA 2XXCB 2PTTA 1KULA 4Z5RA 3BQUA 3WHE1 5C0AB 1CBVL 1V7MH 4UDUB 4JO1L 3VFGL 5I6XC 2RB8A 4AMKH 3N1MC 1AI1H 3C8HA 3QR2A 2NR6C 5CJQL 4FFWC 2F53A 4YDVA 4FFWD 2DLEA 3GSUA 1RJCA 2HJLA 1QTYT 1TVHA 4NKOA 5T5NF 1YQ2A 2YC1B 2UVEA 4XMLH 3W39A 4KI5F 4H0HB 4Z7WA 2FD6L 4Y5VB 4WU7B 3P0VL 3PGFL 1G6RB 3BKJL 3ZTNH 2H2PD 5FYLH 2R1XA 3OJVC 3TO4B 1G6RH 2HTKC 4R4FH 1QR1A 4GBXA 3RTQB 4XPHL 4HDIB 2XG4A 5I1HL 3WUZA 3QG7L 1E4KA 5BRZD 4LRIC 5ISZA 1T89C 2IC2A 1HEZB 2VDKH 1MY5A 2EDRA 2GJZA 5DC0A 3QIUA 2YKLL 2ZOKB 3ARGC 3OR6B 2KKQA 3ARGD 1J1PH 1QNZL 3SGJC 1A6VL 4YDJB 5KN5A 3U4EB 5FECA 2AK4B 3JTSA 2AK1H 3BD5A 5C0DA 4Z95L 3QFDB 1K5NA 1JV5A 5J12C 3CZFB 3QJFA 1I7TA 2BFVH 2COQA 4BZYA 2IAMC 4RAVA 2W0PA 4MQTB 3OZ9L 1QA9B 2GYSA 2ATPB 1AY1L 1T1ZA 1ZEAL 4KRNA 1QBAA 1EFXB 2FEEL 1T2QL 2R2BB 4LCYA 2P46B 4L8CB 3TVMA 4AIXA 4K94H 3T4AB 5C0BB 4R96B 1OP5K 4LHUB 4PJXE 4U4BA 5TDPA 1DN2A 4OZIB 3LKRB 4UUJA 4LKXA 5CGTA 3QQ3B 1JZ5A 5H2BA 2AEPH 5DHVA 2DWDB 4OCMC 3QFJA 1MNUL 2QKIB 4L3EB 5HHNB 4YIQB 4GRLA 3T2NH 3NZ8A 2XA3A 5E4IA 3LIZH 3C60A 3EO1B 4M1GL 1OB1B 5JPMA 3D85D 1O0VA 5E94A 2DIBA 1VKXA 1PG7W 4ONOA 4MQSB 3MFGB 4FXGB 4IRSC 3RVVD 4AIZA 3RNQB 1I3RA 2X4NA 1X5KA 5B38A 3HTLX 1YY8A 2F74A 1IQDB 2VOTA 3O2VL 4OFIA 2ENYA 4UIMB 5GS1A 4PJFA 1CI5A 3LZFL 3FO0L 2DM2A 4WUKL 5IWLC 5JHLL 1KIPA 4U1LB 2G9HB 1ZAGA 3BPNB 2XRAH 5F3BB 4LVHC 2R29H 3SDDA 2ITCA 4AEHH 5C0FA 3HC3L 4N0YH 4CMHC 4KK9C 4NCC2 2DQFB 4KK9D 1WQVT 1AXTH 1CF8L 4H0IA 1XR8B 3ZSTA 1ZANH 3UJJH 1QSZA 4XPTL 3IS1X 4FFYH 5CAYB 1KJ2H 3GMMA 2YXFA 2YPKB 1KFAL 1CR9L 2ATKA 5IBUG 2XPGB 3TCLB 2XZAH 3N1GC 4FQIH 1RZJH 4YUEL 3G5YA 2OK0L 2R0LL 3UPAA 4JZJA 1MCJA 4QF1B 4EVNB 1A6PA 4HWUA 4IOIB 2OQJA 3QDJE 2QQQA 2DBLL 3EOBB 1S7UB 4LPCA 1UADC 5FIEA 1DLFH 2FJHA 1YJDC 5IFJB 4I0CC 5CP7A 5EPMA 5FV1L 4DKDC 4S11A 1U93A 5KZCB 2HG5B 3HPJB 4XWGL 3OKDA 3ZO0A 4NUGL 2DICA 3STBA 3T3PF 4RMRA 1CGWA 2EDWA 2YRLA 3DO3A 4G8GD 3CX5K 3LV3B 5MI0C 3TIEB 4MXQC 4WVRA 3NFPA 2J8UE 1NL0H 1X5JA 1FVDB 4GRWF 1CN4A 1BZ9A 4M6OH 4QXTA 4C56B 1F13A 2LU3A 1FBIL 5GS0L 4HGKC 1HHHA 1ZHLB 2HMIC 2DL9A 4QWWC 5C09D 4JPKH 1JZ3A 2HMID 2B4CH 5D7LA 1XIWA 3VXOA 5FM4A 3MX0A 5HHOB 4YZFF 1DBAH 3NN8A 1FFPA 2UWEE 3TPKA 1CL7I 3LKNB 4P4KC 2IFFH 1K6QL 4P4KD 2FJGA 3CJJA 3O3AA 1SJXA 4JGUA 1LK3H 4LOUC 1CGSH 4LOUD 2Y7QA 1ES0A 1F6AA 5GSVB 4YX2L 4JLRA 4F15B 1NMCB 3QIWA 2NXZD 5D6DA 1NFIA 2CDEA 5AAWA 1NBVL 5AYUH 3P77B 4P2QD 3EYSL 4XNQB 5JDSA 1ZS8A 4LIQH 2EIBA 3G5VB 2D9CA 4LSTL 3L7FB 4R9HA 3F7VB 4KQ4L 5FAAA 3CCHB 3RX8A 3SQBA 4LLDB 5BXFB 2E27L 5IG7A 15C8L 2B1HL 5GS0C 1P6FA 5F6IB 3DYOA 2VMFA 4HUVA 4ONFL 1KEMH 1I8IA 3STLB 1JHTA 3UBXB 4ZFFA 4OIIL 4ODTH 3INUL 3JV6A 5FUCE 1Q38A 2ED7A 4OFVA 4PJIE 2QADB 4Y19A 1JI2A 3AC0A 1H8SA 5JW3L 2AV1A 1S8DB 2EECA 5EU4A 1BQHA 3FO1A 3IRZA 5JDJA 3KLSA 4IMLB 4G42A 1VADA 2AS5M 4JRYE 2UYLB 1RUPH 5EWIH 2BCKA 4MD5A 2K3TA 2AW2A 35C8L 2WIIB 1JCKA 2QSCL 4CMMA 2W59A 1CXFA 4P23C 5EIIA 4BZ2H 3MRBA 2LTQC 4W4OA 2EO9A 5JQ6L 4PUBH 3UTSB 5K9OA 4P3DA 4AM0B 1MCNA 5DHXB 4WY7L 1OF2A 3RWDA 4I0PC 1CG9B 3GJFK 4I0PD 2OR9H 4WW2F 4FABH 1CS6A 1MCWW 1N5AA 3L3OA 5T1KA 4OD2A 4CNIB 2CJUL 3FOMA 5TE7H 1OGAA 3MLRH 1EO7A 3VXUD 5I8OH 1Z9SA 1IAIM 1D9KB 4QRRB 1QRKA 2W9LA 4PJ9C 4G8FB 4PJ9D 3ES6B 1A1MA 1MQ8A 1S78C 4HX1B 3EFDH 1Q9OB 1FGVH 4GT7A 3KJ6H 4WO4B 3SDCC 1C08A 3SJVE 2HLAA 3SDCD 3GO1L 4I3GA 3C6SA 5BV7L 2CK0L 4F7MA 3TEUA 1NC2A 1M05A 4OLEA 3K2UL 3MCKA 5CSZA 3TZVC 4NKMA 4L8SB 1CFSA 4JREB 3WKMH 5IJKC 4MHHI 2EDKA 3VFSA 4FNLH 5L2KD 2CGRH 2EDEA 1U8NA 1W0WA 2DTSA 1TIUA 3V4UL 4OLUL 2EXYD 2CLZB 1KN4H 4NJAH 2C1PA 1AH1A 3U0TB 5GS2D 3H9SB 1G7PB 4PV9A 4XX1G 3QA3A 3REVB 3O3DB 1RVFL 3HA0A 2P8MB 3J7HA 4JG0H 3KG5A 4KRPD 4X6CA 1NBZA 1BF2A 4XC1H 4FQ2L 3GI8H 4PGZA 1T5WA 1R3JB 1H3TA 1T04B 4PJBE 5FOJA 2ZG1A 3VH8B 3FKUS 4K8RH 4L4TE 4XMKL 1A3LL 3BP6B 2Y23A 4JZOA 4MA1B 2GY5A 2YPVL 4RFOH 3S4SA 3VXSE 5BV7C 2XI9A 3LKOB 1CIDA 3P0YH 3MCLL 1NCDL 1ZSDA 2E9WA 2JIXD 4N8CL 2IH1A 1ETZB 2WUBH 2R4RH 3ARBC 3BH9B 1D6EB 3N85H 3SDAD 5D8JL 1YY9D 5I16A 1C5CL 4PB9L 1CK0H 1QRNA 4TNWF 4HIHB 2AGJL 3NPSB 1UWEL 3GEWB 2QQLL 4WFHD 5MEOA 5I0DA 4HXAH 3NCCB 1QOKA 3R0NA 3VWJA 4ZUVB 4UOJA 2QQNL 2X4OA 5EU6A 4EUPA 5ACLA 1GGCH 1NC4D 1DFBH 4K07A 2DQHH 1H5BA 5F3HB 1SY6A 4MHHG 2XQYK 3TLRA 4XWOD 1MFDL 3KYOA 3BKMH 5LAXA 3TA3C 2F54B 3TA3D 4LSQH 4GMTL 3QDGB 1M7DB 3DUSB 1HXYA 4N5UA 1I8KB 4M61B 5I8EB 5C0AD 5E2JA 2RGSA 4M03A 1A02N 5GGSB 2CXGA 2YBRA 2WIMA 1AR1C 1N0XL 1ROWA 5IEKA 4PB0L 4GG8A 1K4CA 4M62L 5F1SA 3FT4A 5LGJB 3EO0B 2Y06H 1YUHA 3ULUF 2XIDA 1TNMA 3L3KA 3VWKC 4HKBA 4WU5A 1W0VA 4HC1A 2FSEA 4RWYH 2ZUQC 3BGMA 3EJZD 1ZA3A 1S7SB 3CVIH 1NDMB 4QYOB 5M95B 2A74B 5IF0B 5TGBA 4D9RE 1IAKA 3LN5A 1J86A 5HHXL 1J0HA 2VB5A 2Q8BH 1FGNH 4PJ7E 3P4NA 3JVGC 4Z78B 1GAFL 3CSYB 5DA0B 4MAYA 3QUZC 3GSOA 3QUZD 1MHPH 4AEIL 2CH8A 3UTPD 3I3EA 3ZTJH 4QY8B 4LSDA 4RZCA 3G9AB 1EVTC 1FV1B 3ARRA 2EKSA 5IUSA 1WTLA 3QHZL 4IRZH 3QPQD 4P2CG 3HS0A 2YPLB 1J0KA 3RWFA 1LO5A 4QT5B 3TJHC 1AGFA 1IGJB 2H2SC 2AK4D 3QEUA 3RX5A 5F9OH 4QHNA 2P5ED 3MA9H 3QBTB 2HVKA 3ZHLA 3QRGL 1JPFB 1FVCA 3KNBB 3BKYH 4OM0L 3IDXL 4LCWB 5JA9A 2RFXA 4PFEA 4BYHA 2BMKA 5I1AB 5FO9A 3QUXD 2GJ6E 4LQFH 3T0EA 1TJGL 5HHME 1ZVSA 3T65A 3G5ZA 1MI5D 5C0BD 1L7TL 1CE1H 3MXWH 2X1QA 5FHBH 5A16A 3L7EA 3D9AH 4L9LB 3PIQB 2B0SL 4HFUH 4OQTH 5F9WB 1E4WL 2WP3T 2VL5A 4L3ED 1CYGA 1WC7A 2AJXL 2W0FA 3KPSA 3A0OA 1S7QB 4L8DA 3QJHB 1FO0A 1JMZA 5EUKA 1GRWA 3M8OH 4JPVL 4RAUB 1CLZL 5CCKH 3PXJA 2CDFA 2I60L 4YHLL 1MREH 4JFEE 4JB9H 2WM0A 2ICWA 3QNZB 4JKLA 1ORSA 1BIIB 3DSFH 5DVMA 4YBQD 5HYQA 3NH7L 1FORL 3Q0HA 3HZKB 3BO8A 5J3HC 1RMFL 2BVQA 2QJDA 3HE6C 3CZJA 1U8LA 2F9BT 3JWNC 3HAEB 2EYRA 2BNRD 3GMOB 1OAYH 3VXRA 1F3JB 3HAEH 4OCWH 1DSFH 1ND0B 5F1OB 3MJ8B 3DWTA 1A6ZA 1MJ7H 1X7QB 4J8RA 2XWJB 1X6LA 1BIHA 4HF5L 4ENEC 5EORL 4ODUA 4ENED 5I30H 5KSVA 4JJ5A 4JFFA 2IPTH 4WEBH 3LEXA 1VGEH 1YNTA 1KPRA 2RCSH 4UOW1 4S1DD 1SEQL 3D3VD 1IC5H 3FZUD 4HIIA 2Y07L 3MA7B 1D6VH 1ZLSL 2VQ1A 3OXRB 3CFIC 1HILA 4OZ4A 4AEEA 1Q0YL 3DGGB 2BZDA 2ENSA 1CGUA 4R7NA 5KSAC 1QFWL 1IILE 3VXQA 2X7LB 5KSAD 1D5XB 5CEZD 2PW1B 5D1QC 2DQIH 2VR4A 1HOCB 2WK2A 4PRHB 3X11A 1YPZB 3BVNA 3E6HB 4W6YB 3GGWA 1T22A 2A9ML 2FBOJ 2HKFH 4UU9B 2WUCH 3EFFA 5IMLA 4JEGB 3BHBA 2H3NA 1WK0A 4HWZA 4HBQA 2N56A 4P2OC 3VD3A 4KVCL 3ALWA 3QT2A 4ZQKB 3ARFB 4LMQI 1AHWB 1NGZB 1XGYH 1F4WH 1IBGL 1RZGB 1KENL 2GSGA 1KJVB 1U6AH 2FRGP 3OXSA 3N1PC 1FC1A 2XZCH 3HR5B 4TSCL 4UINL 5HY9B 4YHMH 1NCBH 2NY2C 5D7JD 5MERA 5ADPH 2MQ3A 4N8VA 5CIPB 3VFMB 1D5BA 4RQQA 2R1WB 5HI3C 3KYNB 1UM5L 5HI3D 2DL2A 3QDHA 2EIZB 5C9JA 1JE6A 2B2XH 1R3HA 1EO5A 1NGQL 3PJSB 2HFEA 3GSNA 4Y5XC 3IAQA 4R7DA 4PJEE 4C83A 1BFVH 3G5XA 5IOPA 4M1DH 4OF8A 1RHHB 3LOWA 4ZFOL 2NCMA 1W8NA 1UXSB 4LCUA 3WFDH 2D3VA 1MLBB 3H9HB 3B9KB 1JF5A 4U1JA 1CBVH 1BX2B 3VFGH 4JO1H 1BVKB 1DBBL 2A6IA 4RGMC 1DE4A 2XOTA 1KPVB 5CJQH 4BM7A 4FG6D 3IDIA 1NCCL 2QADD 2MMXA 5BOPA 1ORQB 3HZMB 2IAMB 3BP5A 5HBBA 3C5ZD 4S0SD 4RRPG 4R4BB 2XFXB 1LK2B 2LVEA 5JXED 2FD6H 1KCVH 3VFOB 4L9DA 4IIQC 2X4UA 1UZ6F 3BPCA 3P0VH 3PGFH 2B39A 4NUJA 3V0AC 3DRTB 3JV5A 4X6FA 1RUKL 3UZEA 4NC0B 2RBLA 3RPKA 3DX6B 1UVQA 2Q86A 1C16A 3JV4A 5BZDB 4X6EB 3MLWL 4G6JL 4UAOC 3L5HA 4XPHH 3K4AA 3FAXA 5I1HH 4AENB 1V8HA 3QG7H 3FQXB 4PRIB 2FYYB 5LWYH 3HNTL 4V1DD 2YKLH 3VFWA 5E99H 2AEIT 1HZHL 1JL8A 4A2MA 2O93L 1QNZH 1RK0A 3D2UB 4IRSB 3UAJC 4JFOA 5D7SL 4Z95H 3UAJD 2XKNA 4XRCB 1D9KD 1IEBB 3X14B 1KCLA 3OKYA 1FYTE 2P5WA 3DNKA 3S35X 4I77L 4QOKA 5DRWA 3V2AR 3BKCL 3UXFA 5FA3B 4QHUA 3OZ9H 4PRPD 2NY1C 1W72L 4LVHB 1BAFH 1MFCL 1AY1H 2IQ9L 3VA2C 4LLWA 1ZV5A 4P5KB 1EBPA 1T2QH 4G6KL 2VLLB 3HPLA 2D7TL 1HE7A 2E6JA 3BISA 3KPRE 3PWUB 4GW1A 4FQXC 1RU9H 3VDAA 5EUOE 4FQXD 1UEMA 1F90L 1K8DA 3C2AL 1FCCA 4NO0A 1PQZA 4D0BB 3RUGA 2IH3B 4RX4D 4ZFGL 3TN0D 5D7KD 1MNUH 1GHFL 5L9DL 1NCWL 3UTOA 5GGQL 4ZUWA 2OL3A 1PX3A 2DLFL 4MXVF 1X5XA 4G8IA 4LF3B 1YEHL 1QSFA 5DJCB 5JTWA 3MBEA 5DVLA 4NN5B 5F9JB 1JRHH 2AJ3A 3U1SL 5DK0B 4GKSB 4LHUG 4K3HA 5GGRA 2FZ3B 4WDIA 1YJDH 5FK9B 3S35L 1KCKA 1X5GA 3FONB 3UYOD 3LZFH 4WUKH 1I1RA 2EDJA 1DN0B 4YHIB 4I4WA 1VEOA 3P0GB 1HH9A 1CCZA 2Y36L 2ED9A 5DJ0A 3IDMA 1E27B 2VLRA 2VDPL 1CF8H 5LGHL 3F7YA 3FMGH 3W81A 1GGIL 3L5WA 3NBNA 4M48L 5DF0A 3FOLB 2HJFA 3LD8B 2PYEA 1KFAH 4GG6F 5JMOC 2P7TB 4GW4B 4XHQA 5DQDL 4AK1A 5BVJB 3DROB 4LVEA 4YUEH 2OK0H 4Z0XB 1SVZA 3DMMA 2RHEA 1RUAL 2PYFB 3BDYL 3PGCB 3Q6GH 5DJ8B 3ZYJA 3N9GL 3IDYC 1RIUL 2YA1A 1FP5A 3R06A 2HJKB 4J7RA 3SOBL 4QHLA 5E0QA 4KAQL 4XCFL 4PV8A 4WUUE 2VLJE 4XWGH 1F11B 3VW3L 2BVOA 1WCBA 2OXGA 3TBTA 3QDJB 5J6HA 3MUZ1 1IGFL 4J3SA 1FL5B 1MFAL 3UDWA 1IMHC 1VEMA 4Y5YA 2GFBB 3DUHA 4PGBA 2YOCA 5JW4M 2G2RA 1A7QL 4U6XB 5F97E 2YRZA 1F3DH 4MNGE 1FBIH 5GS0H 4L4VD 1J88A 5FYKL 4ZSOE 5ITFA 1F4AA 3GB7A 4MJ4A 3OTTA 3P4OA 2ZSVB 1HHIB 3WO4C 2CMRL 3VE0B 3UBXI 4ZDHA 1FL3A 1CGTA 5IIEA 3OKLA 5CJ8A 5JHDD 3DX8A 3SE4A 3DURB 2HN7B 1K6QH 5HHVL 3LQAC 1RFDL 3IT8D 4ZAKB 1WZKA 1B0RB 3LEYL 1E6JL 5HYFA 2BVYA 3T0DA 5EG6C 4ZYKB 2YD1A 3MV9E 5EOCL 5JIIA 4YX2H 4P23B 4M7KL 2G5BB 2V5MA 2LTQB 1SBSL 4EJ1C 1B4RA 2XT1B 1CFQA 1NBVH 2UWEB 3F5WB 1GOGA 3VRJA 4NDMB 3EYSH 3QI9B 3L3JB 4ZPTA 5C8JB 1GZQA 2R39A 2P24A 1DBJH 1VDGA 2PUQT 4KMTL 2Z93A 4F2MA 1A7OL 3FFCD 5HHPA 5GZOC 2E27H 1RZIB 15C8H 4GUPA 1S7RB 1YDPA 3MZGB 5GHWL 1U95A 4JO4L 3MR9B 2NYYC 3H8NA 4ONFH 4RMSA 3GRWH 2CO6B 4U1HA 2A9NH 3INUH 5GGRY 1WUNT 2ZPKL 5JW3H 5DJDA 2PXYD 1QP1A 4JHWH 1U8JA 3MRKA 2Z91A 4JM4L 4UDTB 4XC3H 3P30L 3ESUF 1JGUL 1OW0C 1Z6JT 3NA4A 1R24A 3ARWA 3QUML 3KLDA 2ICCA 3TZVB 35C8H 1CVSC 3MV7E 3O4OB 4PJIB 4U2YA 3SKOB 3X3GL 5JQ6H 3C5JA 1UEYA 3QXDB 4QXGL 5TF1L 3UBXG 3IKKA 5HI4C 4XP1L 4UT7L 1KT2A 4WY7H 4HMCA 1BF8A 3K3QA 3KJ4B 3ALPA 4JRYB 4K7FB 4PRBB 5HPOA 1R3IL 4U49A 5C0EB 2MOVA 2CJUH 2GITA 4AQ1B 3V5DB 2ADJA 3MZTA 2Q76A 2PCPB 1PFCA 3AM8A 5DUPL 3FB6A 4QRPB 5IEHB 4JHAL 3CFBA 4JRXD 2RQ8A 3MV11 5BV7B 4XH2B 3PHQA 3WJLC 4D0CA 2V2TB 1N59B 1FAIH 4XCEB 3GO1H 3DVNA 3PWPD 4ESKA 1A1NB 1RJLB 5BV7H 2CK0H 3NOIA 3K2UH 2IANA 2ZOLB 5T33L 5HDBF 1AD9B 1BFSA 3ARBB 5I76A 4ONGL 2J8HA 1DQJB 1DVFB 3CH1B 3RGVA 4MS8C 5D2NE 5JOPD 4PJAE 1F5WA 4XNXH 2XZQL 4OLUH 1GJIA 1UT9A 3FN0L 3GJFB 5AZ2H 1RUQH 4WV1C 4F3FB 5J56B 1NSNL 2W1NA 5CWSA 1EEYA 3GJFH 1RVFH 1S7VA 4N0UE 2LVCA 1XF5B 2G60L 4OUOA 1IM3B 2R2EA 4WI4A 3SKMB 3QNYB 4JQVC 3U9UB 2E7LA 2R2CA 3BAEL 4KY1L 1NDGA 4GKZA 4CDGC 1TQCB 3VCLB 1JGVL 4L29A 1A3RL 1FL6A 5DJ2B 4OT1H 4XMKH 5BJTA 1A3LH 1IZKA 2YPVH 5GQBA 5C0CA 5EZIL 3T2PA 1Q0XL 3ROOA 3MCLH 1NCDH 3H3PL 2VXUH 3ARFD 5MHSD 3FB7B 2Z35A 4KK8C 4N8CH 2CIKA 5BW7C 1FPTL 3BEWA 4PJBB 2FIRT 3ZDYF 4IS6B 3VWKB 4NQDD 4FP8L 1AIFA 4HJ0D 4L4TB 3OKNB 5D8JH 1C5CH 1CXHA 1INQB 2GAZA 4C57C 2M26A 4EN3C 4ZOAA 2BNUA 3VXSB 4F7CB 2AGJH 4D94A 1GVIA 1UWEH 4N1EA 4PGCB 3B3IA 4GLRH 4R4ND 4JKPL 4WFFD 3VH8G 1GIGL 3HFML 4PJ8D 4MVBC 2ARJQ 5IVXE 2PO6C 4MVBD 1R5VA 2MJWA 3VFUA 1N0LA 2R0ZL 1B0GA 1P7QB 1E28A 3L1OH 4Z7UE 3ULSB 2AV7B 2XKUA 1I7RB 1MFDH 2BJML 1VFAB 1G9ML 2J5LC 4HJGB 4GMTH 1BJ1H 4HWBL 5FOBB 2WBJA 4MA3A 1FVEA 3ARQA 4OBSA 4TNVF 4RIRB 1NUFA 3O6FC 3QWOB 3EGSB 2GEEA 3O6FD 1BZ7B 5D9SB 1JPGA 1S3KH 4M62H 5TH2B 1EAPB 3WE6A 3SDXE 4ZNCD 3SE9L 3D25B 1Q1JL 1LNUB 3CMOL 2X4PB 4ZTOL 1LILA 5ALBH 4APQC 4APQD 4MNQA 5FF6A 2IADB 4LSSH 4K3GA 2Y9RT 5DJ6A 5JOEA 2XQBL 1GAFH 1D5MB 1OSPL 3BEVB 3GHEL 3D0VA 1NGXA 4M7JL 3MO1B 3ROLA 3X12A 1YEFH 5SX5K 4M6NL 4Q2ZB 4BK4A 1GOHA 5E1AA 2JELL 4DKFL 2CD0A 5LJYH 4HBCL 1H3UA 3KYKL 5IESH 5I1JH 4LDLB 4HS3A 4GS7C 1F3RB 1JWMB 2C4XA 4PJ7B 2VIRA 3SKNB 2AJYL 2XN9B 4XBGB 3D2UD 4LEXL 5C6TL 3UEZA 4E5XA 5HYSA 5HPMB 4J6RL 1QLEL 3L5XL 5ANME 3V6OC 1J0ZA 4KRLB 5AG9A 3SGKC 2VITB 4RNRA 3GHBH 3QRGH 4M6MH 3HNSL 5E6IA 4JG1L 3GSVB 4OM0H 3IDXH 3HMXA 2VABA 3IU4L 1AXIB 1K8IA 4NWTH 3ZTJG 1HQRB 4PJCA 5A3IC 2LV4A 4NQCA 5A3ID 5D1XD 3HE6B 4LCCB 3ILPB 5EBGA 1LDPL 4XCNA 1WT5C 3D69B 5IK3A 4NKDB 4TVSa 4G8EB 2HT3D 2UY7A 4AG4L 2K7PA 5T3XD 2DB8A 3GUTA 3VFPB 5IR1B 1ED3A 1NFDA 4YHZL 1E4WH 2APXA 4YNYB 1B88A 3U9PH 3MGTB 2AJXH 4WHTB 5IW3A 2GJ6B 5HHMB 2V17H 3S7GA 4WI8A 1CDJA 4MD0A 4G9FA 4OM1L 1A6WH 3EYOA 1SEBB 1CXKA 1CLZH 4X80H 2I60H 1MF2H 5I1GL 2VQTA 4YHLH 4CADA 2MQCA 1T1YB 1M7XA 4KU1A 4NO5B 3DUUB 3NH7H 1FORH 2VXQL 3QEGL 4WEMB 1FZMB 4BUHA 1ZKAA 1RMFH 5D1QB 3PP4L 4ZXBA 4MCYB 1WV7T 5CEZH 5KTEL 3MBXH 3NACL 4ORGA 4DQOL 3LMJL 5INDB 4JFEB 2GTZB 4BSVB 2HVJA 1RULL 4ZUTA 1A8JH 3LN4B 3WS3A 3VXTA 3DV4A 1VFMA 3RNKA 4U1NB 3BXNB 5EC1A 1K4DA 4CVWA 2CR3A 3MREB 4P2OB 2D4DA 3BYTA 4F9LA 4BKLA 2WP3O 4XNZC 1KG0B 3MRFB 4PRAB 2A73B 3BIAX 4ELMB 3IVKB 3NFNA 3ZKXB 3T4YB 3QUKA 2JCCA 5BRZA 4FQLL 3HAEG 2Y07H 2W60B 5DXWA 1OQOA 4FTVE 1ZLSH 3W11D 3AAZA 3HUJB 1EBAA 2GT9B 3KPLA 1Q9KA 5D2LF 2OM5A 4DOHB 4HH8A 1Q0YH 4UQ2B 3ARED 4M5ZL 3W0WA 1QFWH 3HLAA 3QDJD 1TTUA 1L4IA 2Z0BA 4EQ2A 1JNNL 1S9YA 1N5YL 4OZFH 1UB6A 3O41B 4X7DC 5E9DD 4Z76A 4XPFL 4GO6B 4YPJA 5F7FA 2BRRL 3MLVH 2NW2B 4YPGA 4KK5C 2Z31A 2UZIL 4DKAA 4KK5D 4OZGF 3N1QC 2I5YL 1N2RA 3RBGA 3B2VL 2W65B 1J9CT 3C6LC 1DUYA 5SX4H 4NCC1 3VI3F 2I9TA 3IKCB 5DMYA 1IBGH 4GW5B 1JN6A 4HPYL 1UA6L 4LNVA 5E03A 5LQBL 3OR7A 4UINH 4TSCH 3MLTB 3L3HA 4PJCF 4X4YB 4OKVB 5EULV 5D1ZB 4XGZB 3E6FB 1C12B 5IT2L 4QTIL 5KW9L 1MJJB 1KIRA 1UM5H 8FABA 1VB9A 4J4PC 4DUWA 3TFKD 3QDMD 4J4PD 4UAOB 2QR0A 3VRIB 4EXKA 2IGFL 1X5LA 1NGQH 5J89A 1CFTA 4KRMB 3HE7C 3D39E 4ZFOB 4DFIA 3TBYA 3HE7D 3FQRB 4O51A 4MCZB 3FQTB 2BOCB 3V6FB 1GCFA 2B8OT 5FGRA 5IB5B 4OGYL 2VLKA 5C71A 3U48A 4KI1A 1RJYA 4XP9L 4Z7QF 1DBBH 4H26A 4Q9CA 1K2DA 1DDHB 1NCCH 4DN3H 4DKEH 4PJEB 3SKJL 3O9WC 2F53E 3UC0L 4HGWB 2R2HB 5FKAA 2NY1B 4MLSA 2ZSWA 1XGQB 4YDKH 1YN6B 5DQJB 5FCSH 4PJGA 1MCRA 1NGWA 4F80A 1XF1A 1CIUA 2FEEI 4TVPE 1WITA 4KTEL 2OR8A 3SE8L 1HDMB 5IW1B 3DX7B 3T3PE 3WBDA 1JNHB 2GSIA 3MLWH 4G6JH 3TYFB 3L5JA 1VPOL 4Y2DC 3JV0A 1P7KA 2PW2B 4Y2DD 1UJ3C 2NY3C 4GRWE 5FKPB 2NY3D 3LKSA 3HNTH 3IJYB 2O61B 1ZGLA 4QTHA 1HZHH 2DQTL 5ID0A 3G08A 3GSQB 4JY5H 5DA4A 5D5MF 2OSLB 2MCPL 4LNRB 4M9PA 3QISA 3QIBC 2IPKB 3P9MA 5DYOB 4L3CB 4J3TA 1XCTA 1Z3GL 2BSRB 9CGTA 3U4AA 1LO3L 1KLUB 3MLSL 1U3HD 2JCCF 3NTCL 1J8HA 2HTLC 3MFFA 3W5NA 4QHMA 5DUBB 3CUPA 2WINA 1JRHI 1W72B 1XGTB 4JFPA 4LFHG 4YZFE 3UJIL 5MEQB 3BKCH 4JFYB 3PWVA 3GSRB 1RIVL 1MFCH 3O8XD 1I1YA 2CR6A 2VERN 2XTJC 4QGTA 5E2TL 4HMDA 1AGDB 5C09A 3OAYK 5D7IA 2FO1A 1CFVL 3BQUC 5CKAA 5F88B 2D7TH 1R5WB 3BP4B 1FYTB 2BNQE 1F90H 3C2AH 3MROA 4JRWA 3CLEL 2J8OA 5ITBH 4M8QA 5EOTB 1S7TA 4RFNC 4JPWH 2BHZA 3F8UB 1EMTL 3EYUH 1SJHB 4ZFGH 1IKFL 2DWEB 5DRNA 3SJVD 1KTLA 1GHFH 5L9DH 1JGEA 5E6YA 1NCWH 2OTUA 5GGQH 3ARTA 4FXKA 3IDYB 4NQXA 4X6DF 3BWUC 2DLFH 4LVNC 1YEHH 4KXZH 5EUOB 2Z92B 5IM7A 4P2QA 1U92B 1S7XA 2OP4H 4JFXB 4R2GC 5GJSL 1UQSB 4LLMA 4GBXC 1INEH 1EFQA 3KXFB 3U1SH 3ZLQC 1ZGLM 5JR1L 3S35H 1E4KC 12E8L 2WNGA 2H26A 4F7PB 5ISZD 1WFTA 4G6ML 4XP5L 2YK1L 3QIUC 1LP9A 2WANA 5EZLA 3BE1L 4F58L 5IB1B 2Y36H 2EE2A 5E00A 1Q94A 5DEFB 3VXMD 4XHJC 2VISB 1QG3A 2HAZA 2VDPH 4BQCA 3WO3B 2IWGA 5CBAB 1TQBC 4UB0L 3EAKA 1GGIH 4M48H 3QO0B 4QNPF 4L4TD 5EO0B 5CJOL 3E2HB 1AKJB 5I66A 2CLRB 5DQDH 2VXVH 3EDJA 3KYMB 2PR4L 1RUAH 3BDYH 3KPNA 4Q58C 2Q20A 1U91A 4ACPA 3N9GH 3WO4B 4OGAD 1RIUH 1NKRA 1M7IA 3TVMC 5J8OA 5DQ9A 3TVMD 3ARXA 4JZNA 5ENWA 3SOBH 4YHPA 1P84J 4KAQH 4KHXL 4X9GA 3LQAH 4XCFH 3WLWD 4PJGF 1T83A 4KZEL 3MRIB 5KOMC 3VW3H 4GRLC 4UI2A 3WSQL 3WNOA 5EFIA 4IRJA 4NHUA 1J0IA 4YK4C 3C60C 4JN1L 3VXUA 4HZAA 1NEZG 3QXTA 4I18A 4WIQA 5I2IA 1PSKL 3UPRB 4BSJA 1EZVY 5IB2A 2DD8L 4KZDL 3CSBA 4HKXB 2OR7A 1A7QH 4WUUB 3F7QA 3Q5YA 2MKLC 3KWWB 4N90D 5GS1C 3FQWA 4QLRA 1FG2A 1KN2L 25C8H 3MRDB 1RJZB 1MH5A 5FYKH 3GIVA 5GRUH 3RI5F 1FFQA 2OS7A 4U3XA 4X0KB 3SDDC 1KXQE 2V2XA 1FAKT 5JLZA 1G7HB 5L2KA 3QG6B 2CMRH 1CQYA 4Y1AE 3LH2H 5DJAA 4MMZC 4NRYA 5ESVA 2VAAB 1DEEB 4MNGB 4E9LA 1RFDH 3CX2A 3PL6B 1OTUD 5K9JH 2A83B 4GAYA 1E6JH 4TNWK 3O6LL 4NPYB 1TETL 1HSBA 4LRNH 3HRPA 4ZSOB 3FL7A 1PBYA 5IMMA 2A77L 3U0PA 1S7WB 4JZJC 1HHJB 1LWRA 5IB4B 1MJUL 4GRMA 2FWOB 4MX7B 2Z8RA 1U9KA 4X99A 4PLNC 1PAMA 4KMTH 4M4PA 1R3KB 1A7OH 1JGLL 2YXMA 3MV9B 5GHWH 5FB8B 5E5MB 2AXHA 4IDLA 4JO4H 4XX1E 2D7MA 1M4KA 3CXHJ 4H1LA 4X7TA 5T1MB 1Y0LB 2JIXA 1CGVA 1XCQB 4HKJB 3SO5A 3KPQB 1RK1A 5DD3L 1LEKA 2HWZL 3I6LD 4MNHA 1U8IB 3IDGB 1G7IB 4Y19E 3SDAA 2EYTB 4LCIL 1T66C 3DBXA 2NX5E 3QH3A 4PY7A 4B50A 3FB8B 3QUMB 1A6TB 3P30H 3MLZL 3V4VL 1JGUH 1I9IL 2ICEA 3N06B 3VFVB 4Z7OF 1IAIL 2D7NA 2FX9H 1UB5B 3G04B 4XBEL 1NC4A 3ARYA 5J06A 1QZ1A 2FL5B 1QEWA 3MYJB 4BH8B 1XIWC 3X3GH 1VFBB 4P5MA 1KTKE 1XIWD 4YFLF 4UT7H 4PJDF 4DZ8A 1UXWB 3FAWA 4OFKA 4Z77B 1FH5H 2Q7YA 4BQ9A 3ULUE 1R3IH 5C0AA 5F70A 3MV7B 4KTDL 3JWOL 3WIIL 4F8TA 4NSKA 4RCAA 2Q1EA 2M8XA 3QIWC 4YGVB 5D6DC 1HKLL 3MRNB 2AJSL 1A6AA 3MV8E 1XEDA 2YC1A 4I3SL 3H9YA 5DUPH 4DFHA 4Y5VA 4JHAH 5EN2B 4PD4J 3ULUL 2IBZY 3P4LA 4WU7A 1I4FB 4RFEA 5TF0A 1MWAL 3DRQB 4HK0B 1P69B 2FB4L 3RTQA 2HFFB 3F58H 1PW3A 3T1WA 4ONGH 4HK3J 4AL8H 4P2RE 4EN3B 3IETA 4U33A 3W9DB 2XZQH 1GXEA 1QLFA 4ERSH 5JXAH 2APWA 4M43L 2FEDC 4YDJA 1YEKL 3U4EA 3JWOC 2FEDD 4GLRI 3MRGB 5DO2D 2AK4A 3HI5L 3SDYL 2PO6B 1G7LA 3LEVL 1HIML 4PJIF 1T0NA 4CN6A 5KSUA 3GK8H 3CZFA 4H25B 4MD4B 1X5HA 4PJAB 1PZ5A 1MCHA 1CLCA 3UO1H 2CUMA 3CDFA 4W4OC 3BAEH 4KY1H 8CGTA 2AKRB 2NY6C 1MCWM 1QA9A 3DV6A 1J1OL 2V7NB 2ATPA 1A3RH 4G9DA 3ULUC 3QNXB 4PTUB 5TDNA 3QUXA 2V5SA 3TBVB 3MC0A 5E08L 5GJTH 2MKWA 1KB5B 2R2BA 43CAA 2JJSA 5EZIH 1Q0XH 1MI5A 1NPUA 3T4AA 5C0BA 3WD5H 3H3PH 4OZIA 1H15B 2BOBB 5GZND 5JA8B 5C3TA 2NY5C 3LKRA 1FPTH 4FZEL 5FO7B 4K23L 1OGAD 3F12B 3QQ3A 2DWDA 1BD2D 4L3EA 2QKIA 5HHNA 4YIQA 1HQ4A 1JGDA 5F1NB 3DYPA 2VDRL 2DIJA 2NY7H 4QRQA 4UILL 4GAFB 1QRNE 4X6BB 1OB1A 2DLGA 3U36B 3RY5A 1XMWA 3HFMH 3QXWA 3UTZB 1T7XA 4FXGA 2FX7L 1G7MA 3RNQA 1NC2D 4WWKB 3KLHD 3TV3L 3E3QE 1F8TL 1C7TA 1R0AL 1MJ8L 1HYSC 4UIMA 1TENA 2BJMH 2VDLL 3PG2A 4GS7B 3ZSSA 4IMKA 2V7HB 1IQWH 1L0QA 2BC4B 5K33A 2C1OA 5IVXB 3L95B 4WGWB 2R23A 4X7CC 4N9GB 32C2A 1AR2A 3VXNA 4Z7UB 5IHUH 1X5FA 4PRNB 1UKSA 2VLMD 3OKKA 4QXWA 2I25N 4PIRF 1F3DJ 3SE9H 2YPKA 2Y5TB 2LU4A 1Q1JH 3OKOB 1SY6L 1YQVL 1MFEL 1JF1A 1KIQA 2XPGA 2J88H 4OCRL 3TCLA 4ZTOH 3NCYS 5HYJD 4OF5A 4HS8L 5I9QC 3GBML 5AD0B 4ZO6A 1PGRB 4IOIA 4XZUA 4G7YH 4JM2D 2EEBA 3GMPB 2JK5B 4O5LH 2ZUVA 1S7UA 3SDXB 5B3NA 5T3XH 1OSPH 3GHEH 2ERJB 1HNGA 5FUOL 4M6NH 4OV5A 5D93C 3RZCB 3MLYL 2OTWB 5AYQA 4DKFH 4HBCH 1F4HA 1N8ZB 2HG5A 3HPJA 3KYKH 4NQEE 3KLAB 4HC1L 4ZS7L 1EO8L 1V3JA 1WFUA 2YUWA 2AJYH 3I02B 4LEXH 3RWGB 1AP2B 1FSKC 3MUGB 3PUCA 3O4LE 2X4QB 4J6RH 1QLEH 3TIEA 3VWJC 1ZLWK 5CGYD 1YECH 1FVDA 5BS0E 4JDZA 3SE3A 1H5BC 4JG1H 4C56A 5SWQA 3IU4H 5FYJE 4CAGA 1BHGA 1XGUB 5ANMB 4YEFA 4TOYL 4JY4B 4NN6C 3T0EE 4AG4H 3V6ZA 1FYTD 4D9QD 3LKNA 1IE5A 3GI9L 3LVEA 5DR5L 4MJ5B 5D7JA 3VFTB 3VRLF 3ZE1E 1ZT7A 1I1FB 1OT1A 2ADGB 7FABL 1BFOA 2AXFB 3I75B 5IMOB 3KPRD 3QEHB 2D03L 4OM1H 1MIEL 3MRJB 3B5GA 1U0QA 4XB7A 2BVEA 3PWLA 3EKCA 4ZOBA 5I1GH 5K93A 4BFIA 3UPCA 3L7FA 4MAYC 3CCHA 4LLDA 1HWGB 5KVEL 2MWCA 1BGXL 4ISVB 3QEGH 3DIFB 4HHAB 3GMNB 5J1TC 1OQXA 5DTFB 3PP4H 2CKBH 1U8HB 1QFWI 1FO0L 1UM4L 5KTEH 1UZ6E 3NACH 3LMJH 3DI2B 2K7QA 4LPUA 1MQKL 1S8DA 4RMQA 3C5ZA 1BEYL 3VXRE 5L8LB 2XWBB 5JXEA 4JFZL 3QYCA 1PDKA 4Z18A 1I3VA 4UQ3B 3C6LB 4U7KA 2XNAB 2EDLA 4MAUL 5HGDA 1JI1A 4GOSA 4Y16D 3H0TB 3T0EC 4PS4L 5SX4I 3ZT6A 3RVUD 4AM0A 3P9LB 5GGTA 3VA6A 3RQ3A 5DHYB 4M00A 1MCPL 3C8KB 4V1DA 3VGEA 2PN5A 2DQCH 3AY4A 1WSST 1F4YL 1OARL 5H37H 3F6IA 4FOMA 2EH8L 3STZA 4CNIA 4M5ZH 4KTYA 3KPSD 4LMQE 4QCIA 2GTWB 4DVBB 1JNNH 4NZDA 1N5YH 1D9KA 4QRRA 2DJUA 3L6FA 1T4KA 3BIKA 4F33B 4YE4H 2P8LB 4G8FA 2E6PA 3ES6A 3RA7L 4HX1A 4G6FB 4AH2B 4YAQB 2BRRH 4PRPA 5TPWL 2HRPL 4WUUD 2VLJD 1ADQL 1G1YA 1T20B 4WO4A 3HN3A 4D8PB 4EIZC 1QPPA 4KROC 4ODSL 4KROD 2J4WL 2LABA 2F58L 4ODXA 2X4TA 2YUZA 4YO0B 1ZK9A 4A6YA 1V7ML 4L8SA 3H6JA 3M1BB 4AMKL 3CK0L 1CICB 4MXVE 4OGXH 4YH6A 3TH3T 3TT3L 4RX4A 4HPYH 2DDQH 1UA6H 2QBWA 3TN0A 1XZ0B 4KKNA 1OGTB 5F7DA 5FO8A 2NZ9D 2CLZA 3O0RL 3QSKB 1JFQL 1A47A 5ICYA 1PYWB 3REVA 2AJVL 3JTTB 2BY0A 5IT2H 5KW9H 4PLJD 5KVGL 4JJHA 1A9EB 3ZTNL 4ELMF 1T0PB 1T6WA 4OCSL 2IGFH 4R4FL 4UMGA 4W81A 1R3JA 4PP2A 1ACYH 1BJ1J 3BD3A 5CEYA 1G9NL 5TFSL 3FN3A 4JFDE 3BP6A 4LLUB 1YMME 3H7LA 3HUJF 1KCUL 2VDKL 4OGYH 1KBGL 1BP3B 3QIBB 3B8SA 4GG6E 3LKOA 3K8MA 1S9WA 4WEUD 4XP9H 1MLCA 2AK1L 3D39B 3BH9A 1D6EA 1KACB 1K9TA 5BOZG 1U8QB 4TUOA 3UC0H 5ESAB 1VESA 2GQHA 1DQML 3GMQB 4PG9A 1I1AD 4WI7A 3GSNL 1WZ1L 5B8CA 2WLZA 2XTJB 1HCFX 1NUNB 4Z5RB 3GSXA 4JKWA 3S97C 5F9DC 3GMRB 4ZUVA 3SE8H 5HGGS 3ZYIA 1DQLH 1T2XA 2F53B 4YDVB 3QRFM 5CHNA 3GSUB 4YBLC 1MPAL 4RFNB 2HJLB 4Y4HB 5CEXB 1OLLA 3LAFA 1VPOH 2F54A 1G9NC