2ATAA

Structural basis of dna recognition by p53 tetramers (complex ii)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
197
structure length
197
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*AP*GP*GP*CP*AP*TP*GP*CP*CP*TP*T)-3'
publication title Structural Basis of DNA Recognition by p53 Tetramers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis/dna
total genus 48
structure length 197
sequence length 197
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ataA00
2XWCA 2H1LM 3D09A 4AGNA 3KMDA 2VUKA 2J20A 3US1A 1EAQA 3VD0A 4G83A 3VD2A 4L0ZA 2RMNA 1CMOA 3WTXA 1GZHC 4AGQA 1H9DA 5G4OA 4IJTA 5ECGA 1UOLA 4IBVA 2IOIA 3TS8A 3D05A 5LGYA 2BINA 4IBZA 5AB9A 3QYMA 1YCSA 1E50A 2AC0A 2BIMA 3Q01A 3EXJA 4LOEA 2J21A 1HU8A 3IGKA 1HJCA 4KVPA 1TSRA 2GEQA 2X0WA 3US0A 4XR8C 3D08A 2MEJB 5KBDA 4GUOA 3IGLA 1KZYA 1CO1A 5G4NA 5G4MA 5AOKA 2J1XA 2ADYA 1HJBC 3ZMEA 5ABAA 3EXLA 4GUQA 2WGXA 2ATAA 2IOOA 2BIOA 3Q06A 3VD1A 1LJMA 2YBGA 2P52A 2IOMA 5BUAA 4IBWA 2J6WA 4IBUA 4IBSA 3Q05A 4IBQA 2J1YA 3D06A 3WTTA 2BIQA 5LAPA 2XWRA 3D07A 4LO9A 5A7BA 2BIPA 4MZRA 4A63A 2X0UA 4AGLA 2PCXA 5AOJA 2FEJA 4L18A 2OCJA 3QYNA 1EAOA 1T4WA 4MZIA 3WU1A 2X0VA 2J1ZA 4AGOA 4HJEA 1IO4C 1EANA 1TUPA 2AHIA 4LOFA 5AOMA 2J1WA 4AGMA 4IBTA 3WTSA 3WTUA 4QO1B 3WTYA 4G82A 5AOIA 4IBYA 4L0YA 5AOLA 1GZHA 3D0AA 4AGPA 3WTVA 3WTWA 3KZ8A
chains in the Genus database with same CATH superfamily
4M8QB 4YHOH 5GGUA 4X4MA 4APXA 1HFUA 1DUZA 4A2LA 4M00A 1NCTA 5D7JC 2VDQB 4P9HH 5L8JB 2ZNXA 1CU4L 3TBYA 4BRVA 4BZ2A 2EDQA 1MJUL 4WW1A 2R0ZL 4WK2B 1G7QA 1PVHA 4BFRA 1KN4L 4ODHL 4G7VH 3EO1A 5EG6C 4HVBA 4XMZA 2R8SL 2RGSA 2WW8A 1RL1A 3MGTB 1IFHL 1IM9A 2F7PA 2J2ZB 1OEZW 1PLBA 3SDXF 4ZX3A 2BIMA 4AYID 3P4NB 4WZ9A 3DROA 2ZSWB 2X42A 3AMLA 4WI7A 3O6ML 2DWSA 4RGNC 1N0XH 2VLJD 5FOBB 2DV6A 4JY4A 2WUBL 2YRLA 1YECH 4CVZB 2VDRL 3U2IA 5C2UB 3SBQA 4KI5D 2D7TL 2M1KA 3RRQA 2QGEA 3O2VL 1WV7T 5CXPA 2WUCH 4X42A 4WDIB 5F7EL 4DPAX 4EQ2A 4QCIA 1IEHA 1SMDA 3HHSA 2WSKA 5E94A 4HUVA 1NAML 2BPBA 3OV6A 4FQIH 4H5SA 1QI3A 5TDNB 3QORB 4LLVB 2J1XA 4C83B 4IKNA 5CBAB 1BZOA 3PF2A 2A99A 3EYOB 4L37A 3ZE1F 4PRHD 5DWUH 5TDPB 1J8SA 3UDWC 3DX6B 3L1GA 5FYKD 1N8OE 5KOMC 4ZW7A 1IGFH 3VU2A 4Z7AA 2XN9D 1IAII 3VNZA 2Z8VC 4DQAA 5D5MB 1KPVB 5H35A 4XPBL 2ZNWA 1VLXA 1PD1A 3INUH 4U0QB 3BP5A 1E3FA 5BZXA 5AAWA 1BBJB 2B3IA 2KMWA 1D5IL 4RFNC 4IRSD 3SDAD 4X5QA 3T4YB 1JG9A 1MDTA 4YSRA 3HBGA 1AE6H 3FQUB 4LSPL 3S5LG 3VX1A 3H9HA 1QWUA 1NUNB 2FYYB 1D3CA 3R8QA 4PB9H 5HDOA 2W0FA 1A9EA 2R29L 4FEMA 3KHQA 3RHWF 4M61A 2ZCHH 4FFVC 5CU9A 5IROC 4PB0L 3H53A 5FKAA 3ECWA 4KK5C 5EOCH 1T80A 1LEIB 3FK3A 1TENA 3IGAB 4HKXB 1XZ0A 5K39A 3WS3A 3NTCL 4KKBD 1A3RL 1KYOK 1I8AA 1OAKL 1YEEH 1YPZA 3LKOB 4MA1B 5DXWA 3EOTL 3MLVL 3KPSD 3E6HA 5IGXL 1I3RB 1XB6A 3CXHK 4J5VA 5DDHB 35C8H 1JS4A 1Z9NA 4I0PB 4CA4A 1BMGA 3QJFA 2YD2A 2EIKB 4NO5B 1K85A 4HJJL 3ULVE 4M62H 4IDJH 1F3RB 4XNZB 2PPFA 3BD5A 5E00A 3UBHA 4XCYB 1KB5A 3L54A 1E4XL 2YAMA 5ES4B 1XO8A 2RQEA 3CFQA 3SQOL 3LB6C 2VLKD 5G4OA 5IEHA 1EVTC 5AVUB 5GS3A 3CZFA 5HI5D 2JWYA 3BPCB 3PABB 1KEGL 1GSMA 1QI4A 2FEEI 1E43A 1RUML 5AVWB 4ODTH 1VZHA 3L4CA 1PSKH 5GS1C 4KK9D 3QWOA 1CFNB 5FEBA 4CU7A 5D7IF 2J25A 5J1AB 1NANH 3FCSB 1ED3A 1J0KA 5E8DL 4U6YA 3VJ6A 3HE6C 1QFHA 2VXQA 1O7DC 2R4RH 5CINL 5C0BE 4XC1L 3V6ZA 2YD0A 1RMFL 1RZGB 4R4NC 3ILPB 5E6YA 5EN2A 3WEOA 4H25B 4ZXBA 1TVHA 2CKNA 1EEYA 3ZUCA 1C12B 4UAOB 1D6EA 5KBDA 4XAKE 2FJUB 5DLML 5BOPA 1AD0B 4IRJA 4LOVA 4LRNH 2A0LD 4MNGA 1WZMA 4I13B 5IBTL 3T1FB 1AYOA 4AW7A 3NACL 4FXLA 4JFYA 2XZAL 3FTXA 1FLTX 3MA9H 3L5IA 2BP5M 3FQXA 5FV2A 3LQAC 1DVXA 4F5CA 4R26H 4ELKA 2IFFH 1H15B 3MBEC 3FO9A 5F7DA 4JFZH 5LBSH 2WQSA 3PWVB 5EORL 4F8PA 4IBWA 4L8SA 3AU0A 3COOA 1J9RA 3GMPA 2J6WA 4HEME 4HOMA 4FKEA 4EUPH 4IBUA 2Z93B 4TNWF 1HZHL 2BCKB 1J7VR 4HDIA 1G7PB 3QUKB 4NC1E 2WZPA 4IEFA 1EZUA 1XMEB 2B16A 3OMAB 3QBTB 4YXKH 1OM3L 1WD8A 2YMXH 4OZ4B 5DFWH 3C5JB 4XMLL 4DPCX 3BP4B 2BZ7A 3RWIB 4ZUVA 4R96A 3H9SE 3ZN6A 3IS1X 4U1MA 3MYJB 4GKOA 5I76B 5B3NA 4N2OA 4QHUB 2VQ1A 4M6NL 1A1NA 1H3UA 3VWKD 4AGOA 1IFRA 2I5YL 4BGLA 1LO3H 2Z9TA 4QXGH 4DKFL 4Z7QE 1UACL 2PMZA 1QX1A 3MODL 3BLKA 5I9QB 3CH8A 4LAJH 1B0RB 2D4DA 4LLQA 5CILL 3EH4B 4PGEB 1EDHA 3V5KA 3RPBA 4PBVC 5IEKB 4BSWA 2DTMH 2OXGA 2WXHA 5IFJA 3WTVA 1L5GB 3UERA 4UT6H 4NWUL 4LLWA 4Y19D 4X99A 1R33A 1VEPA 3CIQA 2XWZA 1CDGA 2IMMA 4X6EB 5HHME 2EZ0C 3MGOA 3HMWL 4ODSL 3B5TA 3BAIA 4XP1H 5LQBH 4QRTB 3WV0A 3BUQA 4X8XA 4KPHL 4EI6B 2FJHB 5IJBC 3GDBA 4OLZH 5JIDA 2WWMC 4TL5A 1FORH 4G6JL 4XAWL 1JMZA 1KZQA 4K5PA 4U1SA 3TH3T 5GS0D 1FH5H 2WGNB 3I9GH 1JRHI 3QVAA 3GS0A 1ERNA 2BVYA 3RP1A 2X53A 4JRXE 4K2UL 5DD1H 1LE9A 2X89A 4NQDB 1UWGH 1A2YA 3UTQA 2R56L 4MXVE 1OGAA 5KAQF 1GYVA 4MS6A 4CJ0A 3BZ4B 1X9RA 4NPYA 3G08B 4CDHA 1RERA 5EFIB 4LFHG 1IMHC 4JR9H 2B1AH 5FDWB 5EO0A 4FNLL 4Q4EA 3EYVA 3L13A 5B7EA 4PJ8B 2GTZA 2QADB 2ADJB 1W16A 1NCIA 1H8LA 4FG4A 4PRBB 4NN6C 5FLUA 1PGRB 4BELD 1DCLA 3B2XA 4GUPA 4ZX4A 2K4WA 1WF5A 5J57B 5G55A 1E0OB 1TXKA 3GM0A 3BHBA 3HR5B 4KRMB 2HYMA 3CVHH 3A6CL 2IOOA 1XCXA 2KDYA 1DQDH 1NEZA 4MXWH 5EZJA 4KX8A 3VXRD 4AEIL 5I17A 5C0NC 1GZPB 1XXFC 2Z91B 1OQOA 1RUAL 5I1LB 3BPLC 4JKNA 3KWWB 3T0EE 4MD5A 5B22A 1ANUA 4JHUA 1UM5H 2VR5A 2ATKB 1QNZL 4XBPA 1BXVA 4P46C 4A7QA 3TVMC 2CKBL 1FE8H 3CX2A 1ZT7A 3QO0A 4U05A 1QBLH 3ZO9A 3T71A 5F9WB 6FABL 3F5WB 1LILA 4HS6B 4Y5VC 3UROR 1QO3A 1P2CB 3FTUA 3IGUA 2ZKHL 4PP2B 3BAEH 3BFWA 3QQ9D 4I7ZC 1XF4A 2A6KA 4QT5A 3V4UH 1ZLVH 1AHWC 3WNMA 1RU9L 2P5EB 1JNLL 1TJGH 3BKYH 3W5NA 4AG4H 3KL0A 2AJVH 3C60C 3HMXL 3O3DB 3DYPA 2YA2A 4LVNB 5CSGA 1T66C 4KZEL 2YBRA 4LARL 1TF4A 3K80A 2R69H 3KPOA 5JDSB 4IOIA 2GITA 1BBDL 3UTTA 3BUDA 3GNMH 4XNYL 3IPBA 2C7UA 4YSPA 3NJMA 3QIBC 4U4BA 3AWEA 4WJ5B 1MREL 1NC4A 1V10A 3AXLA 4FXGA 4NZFA 4J6RH 5GZOA 5F6HI 4E41A 2DI7A 2QFPA 3B7TA 1MCPH 5D7LE 2VZVA 2CLRA 1XTMA 3PXJA 3FSOA 3LSOA 1B3IA 4NZDA 3UAEA 5GZNA 1CUOA 1S7QB 3VFMA 1GZHC 2CRZA 1JV2B 4PRIE 3ULSA 4BKLB 4PVMA 3RVUC 4L9LC 4YLCA 2VZUA 4NRZA 3LYRA 4OY9A 4QRPA 4OZFG 1JV5B 1M7DB 1WD9A 1OP9A 1JE6A 1UM6H 3VXSD 1L9MA 2ESVB 3JYCA 4XBGB 1KJ3L 5TQ0L 1YN6A 3B2VL 4K8RH 1PKOA 3A6OA 3DX1A 3LAFA 1K8IB 3RTLA 1QHQA 2GJJA 1YYLH 3BJLA 1ITBB 2VN6A 1E5UI 2F1EA 3GXPA 1BQ5A 3OXRB 3QUMA 3LKNA 1KFAL 1CLYH 4LK4A 4DCQB 3OXSA 3U2SA 5CEZH 1AG6A 2JKXA 1NBCA 3ZTJG 1IGCL 4P2RE 1JYNA 4JREC 4XXCA 1L3WA 4G8EB 1BIIA 3KDPB 3MLWL 3WGUB 5CKAA 2AK4B 3NCXA 5CLZA 1Z5YD 3VSTA 3LRSA 3ISWA 4UQCA 4GH7B 4PYGA 5CJOH 3NZ8A 3LN5A 3U0TB 5AB0A 1M42A 1HINL 4TUKL 1ZKAA 2DQJH 4TTDC 5ISZB 1JMXA 4ZMWA 3VGAC 3FMGH 2XWEA 1MRDH 5A6IA 3IWVA 4XPFH 1A6ZA 2BW4A 4XB3A 3GSNB 3EADA 1TZ8A 3I50H 4X7TB 3KG5A 1E5ZA 1IBHA 5JPNC 4ODVL 1BXXA 2YUXA 5T33H 1ET7A 4BBWA 3MV7D 1EAPA 1JZIA 1ITCA 1NOLA 1YEWA 4FTVA 1MZYA 5F9OH 3REWA 3QJVB 3LRHA 3NH7L 4YEFA 4KK8C 1LO5B 5DUML 2VR8A 5BMFL 3QNFA 2XC8A 2XOTA 3TBTA 3BH9A 1VGKB 1QSEE 3ZYJA 4DNLA 5C0EA 1F4YH 2IWFA 4ZUTB 1QFWL 2QDVA 2VMCA 5E8NA 25C8H 4JBSA 2VLLA 4PMFA 5DRXA 2JB6B 3KLHD 2OP4L 2EXWD 3DECA 3ARRA 4YZFE 4P04A 3NCYS 5I1HH 1IC7H 1N6VA 2EH7H 1M6OB 2RFXB 5GHWL 2DQGL 4XCNA 2I9TA 2Y3NA 1X5LA 5D7JA 3ESVF 2H8PB 3VD3A 5IB1B 5JQIB 4G7YL 2WOYA 2DWYA 4OLYL 4AIOA 5K9QI 2BRQA 3FUEA 3UTSB 4AT6B 1QTPA 2PW2A 3J7HA 2CHXA 4ODUB 1FVCA 1CR9L 4NWTH 3S8FB 4U1NA 5FYLL 4FCHA 4GRWH 4WU7A 2QDWA 2XXFA 1NGQL 3MGAA 3RQ3A 4F8OA 5GISL 4DGVH 1KC5L 5JOFA 3VAEA 4NN7B 4JN2A 5K1NA 4QRAA 5T3ZL 1YEDB 4UBDD 3RGBA 3FCGA 1KFGA 4XMWA 3VFPA 3HE7D 2YC1A 3OQRA 2MPVA 3MRDA 1U95A 3HI5L 3Q6GH 3FO0L 4WFFD 1U30A 4FXKC 4IKKA 1QYGL 3F12A 3H3PH 1YEIH 4JAMB 1QSFA 5CNHA 4NUGH 2K7PA 4K3HA 4OLXL 4XBMA 4B95C 3DSFL 4LCWA 5IVXB 3GRWL 4BQ9A 1JPSL 3QG7H 2B5IC 1BM3H 2WOBA 4KO6A 4N8VG 4OT1L 3EDKA 5DRNB 5IMKA 5DO8A 5HJ3A 4U1GB 3CZGA 2EIZA 4XC3L 4X6BB 1HOCB 4XBEL 1I9EA 2QKIA 3S9DB 3EGXB 4Y8AA 1HH9B 2XA8H 3VFUB 1YMHB 5I6XC 5CUSH 4UIKL 3W11D 2H6OA 1S7VB 1NOFA 5J0BA 4CL7A 5KWYC 1MFVA 1W0VA 1XGQA 4UZGA 2Y7QA 3I9PA 2NOYA 1DVYA 3CCHA 3GHEH 4NCC1 2WTPA 1T1XB 2ZOKA 2ZYRA 4ZD3L 3F7KA 3QDGD 1WPCA 5GJSL 3O41B 3SJVA 1YHPA 2CDGB 3HPLA 2MH4A 5IROA 2H3KA 3CN3A 5SWZB 2YA1A 2CUHA 5JMOC 2IAMD 2R4SL 1A14L 2HKFL 4G8GA 4NIKB 4ABVA 4ENEC 1UD4A 1LWRA 4XCCH 3HRZB 1QPXA 1JVLA 2HT3D 4ZAKD 1CWVA 1J1PL 3OJDA 4BQBA 4K15A 5CWSA 5KSAB 3FRUA 1E4KC 2UWEA 1P4UA 5CJ5A 3B2MA 1C5BH 3D3VA 4XMKL 4WV1C 3GHPA 2ZCLL 1HI6A 1NLBH 5EC2B 3WXWH 4N0FB 5HDBB 1HC1A 1N2RB 4P9MH 4DEPC 4F57H 1EBAA 1RFDH 3QJUB 4N0UE 2VDPL 1J88A 3VGFA 3A6BL 3S98A 5C7ZA 1L4IA 3V4VB 2OSXA 4XX5A 1BLNA 5DVMA 3A5VA 2GEEA 3WMSA 4AE1A 1RVFH 3DI2B 1KLFB 1VFUA 2ZD0A 3OPUA 4J8RA 1Q9LB 1G6VK 4OCRH 3ZE2B 4XP6H 3S37H 3A3YB 4LVEA 1VA9A 2XYCA 4GLRI 5I5JA 1ZDSA 4B9ZA 5CAYB 4JY5H 3NCMA 4AV0A 5GS1A 2G5UA 1P5VB 3JWNC 3NA9H 3O45A 1HHKB 1I4FA 8CGTA 2F54A 2IV8A 2NQ3A 4WWNA 5GSRA 1CD9B 1OE2A 3WCYA 2B3RA 5JLZA 1A6AB 3HE6A 1GGBH 4MMXB 4PCTA 5I23A 4G9DA 1CDYA 2F19L 3CLEL 3P2TA 5KANG 1N5YH 5E2VL 3ZTDC 1U8IA 1KGUA 3E9TA 3L3GB 4TXVB 4JQIL 1B0GB 3NPZB 1UOKA 4YK4C 4L3ED 4XP4L 2OW7A 2YHGA 4CVXA 3II3A 3JTBA 1CN4A 4QAWA 4K5OA 3S2AA 1D6VL 4U6HA 2C3VA 3VH8B 1G9NL 4PV9A 3MBEA 1D5ZB 4KQ3H 4M6OL 2WK2A 1N6QL 3TA3D 3MDJA 4LPWA 3FU6A 2KLTA 5FV1L 1BVNP 4Z3HA 4NCC2 4DW2L 1ACYL 2A5UA 1KCLA 3X1EA 1I7TA 2HJLB 2B20A 5GSVA 4KMTL 2HAZA 2D2OA 3PL6B 2VDQL 3UO8B 3V52L 2JCCA 4A7GA 2D4FA 4NQEA 3PGCB 4JQVA 4JHWL 3NEXA 2XWBB 1R47A 5CBEA 3ZDZF 4GG8A 2HFFB 1A7QL 4MCYA 4PGCB 2LGNA 1EEZA 4LB8A 3EDJA 1IAIH 1V05A 1E6JL 4P2OD 1ETA1 2V6HA 3MRLB 4YHLL 5ESVA 5C6WH 1Q0YH 3Q6FA 2FX9L 4NKMA 1BZ9B 1MXDA 5DGQA 5E1HB 4QRFA 2OJEB 1RZ7H 4V1DD 4DPRA 4NUJB 4OLWH 5DD6B 2D3JA 4K23H 5DI8A 4PHZA 2F9BT 2FEJA 1ZV9A 2R9HC 3VA6A 1DQVA 1HQ4A 5I19H 1YEHH 1EAOA 1SYVB 2XG5A 5DRWA 3SKUD 3SPCA 4PJXA 3RA7H 1KIPA 2VM4A 4L4VA 3ZDYB 2VAAA 1M7IB 3LZPA 3MV9A 3PWPE 4P2QB 1JGVL 2EVIA 3P9MB 1KV3A 2ZQKA 1W2KT 2DLEA 4N0YH 2J4WH 2MOQA 1A1MB 2QGCA 2CK0H 5IQLA 3RNQB 3UBXB 2YPLD 3LS5L 5IKCA 2GVYA 4LCCC 2VLME 4DTGH 1A6VH 3BKCL 3LKQA 3ECBB 1KNOB 1YN7A 4A6YB 1Q9KB 1T20B 1OPGH 4JM2D 4AEHH 4GKSB 5JHLH 1G5GA 2P1YA 5HHQB 5HHXL 2A74C 3L17A 4MQTB 1A21A 3RWDA 3VG9C 5A3IC 1P5UC 4H40A 1CMOA 3VXTA 3VFOB 3WFHA 2XJLA 4JO5A 3RZCD 3VSVA 5D7KD 4R2GD 5L8LB 1A7RH 3C09B 4L4TE 4I3RH 2CLZB 1FL3B 5D72H 5JHBA 5LVEA 3R4RA 1JOIA 2HUEA 2D03L 3IDGA 1OK0A 2PPEA 3O3AA 4LHJB 5DR5L 2X9XA 3LZOA 3VWJD 3UTZB 4TYUA 5AB9A 1A3LL 3ATFA 3QZWB 2WO3B 3FQTB 4GRWE 5TD4A 4X6DF 1NAKL 5JHAA 4PJBF 5D5MF 1AGFB 4Y4FD 1SDDA 3IGKA 2BP0B 1H3XA 1U6AH 4WTXA 3GSVB 3BFQG 4J4PD 1DVFC 5CO1A 1KELL 4N6RA 2Z92B 1JWUB 1ZOXA 2JI3A 2XWDA 3MVSA 2XNAB 2NY1D 3DDGA 4RZCB 4WTZA 3RWEB 3TO2B 2APTA 2L4OA 4JL1A 5AVVB 4RAVB 4I48A 4BZ2H 3S96A 3BQUC 3ETBJ 1VFAA 2ZXQA 4P46A 3TVMA 3VD1A 1R5WA 1P4IL 1NCUA 2DKMA 3GPEA 4LF3A 5BRQA 4ZZKA 3F7VB 5DEZA 3IPEA 5F97E 4FFWC 5TQ2L 2IWGA 4MJ6B 1H6FA 4Q52A 4D0DB 3D12B 3KGTA 3TFKC 1GW0A 4Y5VA 3AB0B 3OJMB 5DQ9A 2QBWA 4F2MA 2HZHA 3KVQA 2XWRA 3FTWA 1BG1A 3VXUB 3FHEA 5E2WH 1AHWA 3PWJA 5DURD 2N7BA 5EU7E 3UPRA 4PVBA 4W9CC 1W0WB 2IPKB 1HKFA 2ED6A 3C60A 3SDXA 1EK3A 4BZ1L 4UQ2B 3TTSA 4BFKA 3TBWB 2BZDA 1HCYA 1XR8A 2PWHA 3R0MA 2VERA 3GXNA 3QJQB 3VRJA 4WEBL 4YGAB 3IKCA 3N1FC 5I8EB 2WTOA 1IGIL 1I53A 3QIBA 1A5FL 4YHNB 1JVOA 5EU6E 2R2CA 1IM3A 3WOVA 5H37G 5ICZB 3TJPA 2VJXA 4DT2A 1NCAH 4XPHH 3ZL4L 3TZVB 2GSGB 2Y7MA 1TQBC 3F04A 4FS0A 3GSXA 5DK2B 4EE2A 2DQDL 1GZHA 1G4MA 1OT4A 4GS7C 4JFPB 1HNYA 2W9LA 3LV3A 1UA7A 2J44A 3KXFD 4P3CH 3TYGL 5KVEL 3QFJB 1D2OA 3IJSA 1UXSA 4OIBA 3FT2A 4PBXA 3NQKA 2JVUA 3P3SA 1U8QA 2DM7A 4GQPH 4TUOA 3QQXA 4AJVA 3MXVL 4BD4A 2UZIH 4JPVL 3UZEC 4U49A 3MNZA 3K81A 4JKPL 3OTTA 1JI1A 2I7SA 1NAMA 2BC4B 4UV7H 1GJWA 1G9EA 3ARGD 4JHAH 2CRYA 2BSTA 3QZPA 5LO7A 1JRHH 1SY6L 2HTKC 3TA4D 5LGYA 3REVB 2LR4A 3JTSA 1KLGB 4LSDA 3TJEL 1I1AD 1PCXA 2UUDH 4FKKA 2DKSA 2XUWA 4ODWA 5EEUA 1LXMA 1ZVYA 1NDGA 4OF3A 1WFNA 4YHMH 4M8RA 3WUWA 5FFLA 4HT1L 5IJVB 5C0BB 2WXJA 1ZA6A 4KXZI 3TWCH 3BZEB 2HTLD 3QZLA 2PO6B 4YAQB 5ICUA 4PWEA 1M1SA 2ODHA 3QWRA 3VDBA 1AOZA 1KBGL 1WK0A 1JTPA 3K4ZA 4IS6B 4MDIA 4OD2B 1KB5H 4FQLL 4N2CA 3UOAB 4CSZA 4IGBD 1WAPA 5JPNA 3FB8B 4H20H 4J3OD 1XGRB 2R29A 3D6GA 3UJIH 5FK9A 2WNWA 5CZVL 3QIUC 4EF3A 4JEGB 1JFQL 1ZTMA 2FBOJ 1MVYA 3D69A 5J89A 4OLUH 2WLYA 2E7CA 5FUCE 4GW4B 2DDQL 1BZDA 2GTWB 3WFZA 1SBSL 4JFFA 5DD3H 1CZ8L 2BX5A 2AXFB 2JCWA 1KY7A 2JE8A 1WT5C 2VN4A 3BIAX 3DJ9A 5D7IA 2VXQH 1E67A 4Y7MA 1DN0A 4FADA 3V0VA 2RH0A 3B9KB 1BZ8A 1VF5C 3H9SB 5AW3B 3GQFA 4UOQA 2P45B 2W60B 2OTWA 3HG1A 2DQCH 1KIQA 2FT6A 4ZNEE 1DJZA 1ADQL 1ESOA 5BRZD 1JUFA 2ZUQC 3VXQA 5AD0B 3AMKA 1OF2A 3V5HB 1EANA 5FAAA 3U0WL 2JKTM 2DIBA 4GXUN 5CHNB 2J1WA 1F2QA 1JWSA 1J5DA 1ND0A 4YDJA 3GUTB 4PUBH 2Y5TA 5DUPL 1CGSL 1UH3A 3VQ1C 3MREB 4AGPA 3OG6B 5I75C 2A6JB 3SY0A 2C1PA 3BO8A 3OSKA 5GGRY 2NXZB 1KN2H 4TRPH 1OE1A 2R39A 1SLVA 2ZWKA 4WHYH 3PHOA 5HHMB 5D4HA 1H8NA 4QIRA 3FJTA 4S11A 1WCQA 3ARQA 5EO1A 5GRVK 3ASOB 4FXKA 1MDAA 3ME0A 1DBKH 2Z6FA 1ACXA 3TNNA 4PTUB 2AQTA 1K8DA 4X5WB 4X5PA 4E9WA 2FQDA 3QXAA 3HI1B 2OXHA 3ARBB 4N2IA 3S5LB 4CC4C 5IMMA 5IBUG 4FG6D 3ZY7A 4HKJA 4AUJA 1S7TA 1TR7A 1IKNC 4GAYA 1G9NC 4XPTH 2BSSB 2NR6C 2QGBA 2FCBA 3BH8B 3GBNL 3MFFB 4XB8A 3ECVA 2WLIB 1OAQL 3RB7A 3GSRA 4IJ3B 4QJ4B 4ETQB 1F1DA 3HN5A 3LKPA 3BRGC 5A7EA 1QLFA 3QDJA 4M29A 5DVKA 4ZSOE 1F0LA 4QRSB 3T4AB 4MGXA 4ZYKA 3RDTB 1T22A 2V5SA 1G1CA 1HWGB 1BMZA 3DBSA 2O5ZL 3PREA 4C59B 1KXTB 3X12B 4FI8A 1AR1D 2J6EL 4AH2B 4X8JB 3E8UH 4G8FB 4JMXA 2G75A 2OCFD 3EJCA 3VCLB 4ZFGH 4X4ME 1ETZA 3MV01 1HS6A 2OV0A 3M45A 3ML8A 5IFHH 2A9DA 3LNGA 4P5RA 3DOHA 4M48L 3ZKSD 5F7FA 4A38A 5I1DB 5JORB 5KBKA 4R3SA 3TF4A 1PZAA 1O6SA 1BCIA 3T0WA 3UO1L 4DGYL 3CH1B 1E4KA 5FW7A 2A6DB 3SODB 4OJFH 4F15B 4WV1A 2DD8H 1FG9C 1EMTH 1QP1A 2AK1L 2IGLA 2A6IB 3QORC 43C9A 2O5YH 4JFDD 4FCAA 3TTYA 3QRFM 4NKDB 3WG7B 3BDYL 3PGFL 4F24A 4APQB 4MJIE 4Q9QH 1KYAA 3OB0H 1FL5B 3C9NB 2FSEB 4XE0A 2QPUA 2ZOLB 5JW5A 5BS0E 4LU5H 4KVNL 2GK0A 3VQ2C 5MP6L 3O8XD 1S7UA 2VSDA 1P4BL 1N0LB 2FX7L 4YGVB 2K78A 4PJ5A 4B9KC 3FU7B 3QCTL 1MI5D 4GW5A 4RIRA 3OZKA 1OTSD 4ZW8A 5C0AE 3BAXA 1SLWA 3HCVA 1T0OA 1R17A 4HZAA 1MFEL 1LO2H 5HHPB 3HNTH 1EFXA 3ATAA 1YYCA 2DLFL 2K6YA 3VRIA 4C4UA 1MH5B 2EDWA 3C2AL 5G5DA 3EJPA 5D7LB 3UZQB 1NC2B 2WB7A 1F4XL 3KPRD 1MUJA 2RMNA 4R8WH 2WKGA 4RRPG 5D93C 1WQVT 1E4XI 4Z5RA 4IBVA 2CR0A 5FOJA 3BP7A 3BI9X 3CFCH 3RVWD 4ABUA 3UEZA 5ADOL 1NFKA 1JXFA 4BH7B 1Q1JL 1REIA 3R18A 4NI6A 4MA1C 4ZX5A 2VUYA 3MKGA 4BFJA 1SJHB 4S1SH 4PWIA 5EC1A 1G84A 4PWKA 2H41A 3CHOA 3U36B 1JGDB 5HP5A 4CSSA 2XKNB 1YNTB 4ETYA 2BJMH 4YIQB 5JIPA 1OAUH 3SE8H 4ZODA 1ZHLA 2OMUB 5KW9L 1OIOA 1NBZB 4XPGH 2CKBA 4MAUL 4QI3A 4YLQT 2ITCA 3O6KH 4M7LT 3QHFL 4M02A 2L0DA 2FQFA 1QUNA 4AK1A 3X11A 4P2RB 5INDB 1MY7A 4PTTB 4X0KA 1EJ8A 5BNXD 5JW3H 2BFGA 2G60H 1E8YA 2W59A 4OUUB 1YUHA 2WGXA 4HKZB 2BY0A 3I6SA 3TH4T 3LIZL 4A2HA 4U6XA 4JLRA 5ESAA 3BD4A 1S9VB 3HMXA 4Q56A 3JYBA 2FB4L 3TXAA 5DMKB 4GSDL 4XGZA 5E8PA 1LP9F 2ZCKL 3G7TA 4H8QA 5DMIH 4YUEL 4J2XA 2BHYA 3BPNB 1NEZG 3D2UD 5ACZB 3BN3B 3QUMH 4AKOA 5EDXA 4A2EA 5F89B 3QC6X 4JQXC 4UAOC 3MUZ1 3HLKA 3OKEA 5J56B 2WJ7A 1VFBB 2VLRA 4UQ3B 5D1ZD 4IW4C 3C5ZC 4PFEA 3U7AA 4Z7IA 1FVDB 3ATEA 1U8OA 1ZLVK 1CYGA 3SPVB 4O2EA 2X6AA 1TZHA 2NNAB 5DUBB 4LCCA 5K9QG 3KVDD 1QSEB 5D4JA 3UP1A 5EUKA 5JW4R 4G8IA 2OK0H 3R1GL 4BE5A 4HX1A 3RAJH 5KZCD 3WTUA 1CCZA 5JQ6H 3GXUB 4E2OA 2I26N 3S37X 2NZ1A 2A74A 3L1OH 5DJAB 4NQCE 3EYSL 3MU3A 1RP8A 1P5UA 1H5BA 1BFVH 4O9HL 4CKQA 4LCIH 5CZXC 4GYBA 4K7PH 3AC0A 2X4RB 2A9MH 2OBGA 1TZAA 2AXWA 5DD5H 3U48A 4MX7A 5C0GB 3U1SH 3T2NL 4PG9A 3FQWA 2V8LA 1DSFL 5BZWA 4G83A 3QIWD 5IVXF 4AQAB 4F5CE 5BRPA 3A23A 1BQHA 3WO4B 2GCYA 2LT9A 4X9GA 2KQNA 3TIEB 1IT9H 1J0HA 2QTEA 12E8H 4FP8H 2FD6L 5EOTA 2Y24A 1X7QB 3K2KA 1I7UA 3QEHB 3QEQA 4J3VA 5E5LA 2AV1B 4FG2A 3HLAA 3ZOAA 3DBXA 4HWNA 5I9QC 3ZQXA 4EI5C 3OPZH 5AZ2H 4IMLB 4U3HA 1CICB 3CFDB 2ZUTA 2H2PC 5ESQB 1DVFA 4FQXB 4DN3H 3ILEA 4PWHA 5AL0A 1RXLA 1XIWB 2VRAA 3LS4H 3VD9A 3GMNA 4Y1AA 4JFQA 5CEYB 4GJTB 3DRQA 3BQUA 3IS0X 4KJWC 4XNAA 4WSJA 3ES6A 4UOW0 2N1TE 2O1AA 3MUGB 4L1SA 4TVPD 3WMQA 1EO8H 3DUUB 3IRPX 4QRQB 4ZFOB 3MBXL 3ESPA 1WWCA 1HJBC 3OR7A 4JFTA 4YN3A 5DFVD 2AITA 3RL2A 4E5XA 2WXMA 4N20A 1JGUL 1DJSA 1I9JL 3NJNA 5HYIA 4AXWB 1S9WA 2A4EA 4QOKE 3HNSL 4JO3L 2ITFA 4MCZB 4Q89A 1CLCA 3PP3H 5HDBF 1UFGA 5C0IA 3VGDA 2O6DA 4JZNB 3EF4A 4GAJH 4OZFB 3KYMA 2WLKA 3D4YA 1G94A 5KYXB 1MCWW 3MRBB 3LPGA 3D85A 3VVWA 1GGTA 1DBBH 1HL4A 2L8AA 4YDIL 2GSIB 1JD7A 1DVTA 1Z3GH 2WWOA 2GC4C 1VCAA 1YLBB 1H8OA 2ZPKH 3CVHB 4MAYD 4WTQA 4KXDA 5DT1H 2ZZUT 5T1KA 1OTUC 3DO4A 5IQMA 5FFOA 2GT9B 4AK2A 1PZ2A 4HXBL 3ZE2F 4XMUA 2XPGB 3KYNA 3DV6B 1JXGA 1UWXH 3I6GB 4QJ5B 3ULVD 4DIXA 2F5AH 2IXQB 3N85H 3IU4H 4XNUL 2R2BB 2GI0A 2PF6A 1ASQA 5CD3A 3WE1A 2RALA 1MCJA 1N26A 1X7SA 3B83A 4IBTA 4RNRB 3CG8A 1GPOH 2QZ5A 3B9DA 3EW3B 3U9UB 1JZ3A 3WTYA 1XBRA 4BFGA 1AYRA 4N0UB 1ZK9A 4HFUH 1RURL 3UZEA 2WCGA 1FUNA 3PV6B 3OAUH 1AAJA 5F3BA 2XWJA 5F9WC 5AYQA 2DQFB 5J6GA 2LOEA 4M7JL 4C56D 3EJUA 3P3YA 4MA3A 2OZ4A 4AVKA 3N44B 4S0SD 5D2NE 1QBAA 1HHHA 3PWLB 4NQUA 4NQVA 3GRWA 3QG6B 2E56A 1YC8A 1YDPB 5HDRA 4PM1A 1FNLA 1P0SE 1CURA 2F8OA 4LVNC 2PYFA 3QQNA 1IUZA 4EDXA 2Q8BL 3OJ2C 1G9MC 3T0ED 5E2TH 3KPMA 5FYJU 2HT4D 5T1MB 2ZWNA 4MSWA 1L7IL 1LQSR 3TS8A 4JCMA 1IKFL 1F58L 3KR3H 5DQJA 5DS8A 4EAEA 3E8VA 5C07A 2YD1A 1G7LB 3WHE1 2F61A 1UA6L 5DJ0A 2P7TB 3FAWA 5ITFB 2G9HA 3MROA 4YPGA 2WXGA 1DZ0A 2FZ3B 1FFNA 3VGHA 4NHCH 7FABL 5D8JL 1BVKA 3GM8A 5AVYB 2A83B 1HSAB 2O4EA 3UYPA 4MWFA 4FJYA 4N3UA 1JFHA 3EG9B 4NYLB 5HJBA 5I1JL 1RK0B 2Y3AA 4M7ZC 4HIJA 1OGPA 4H8UA 3DRTA 1O7VA 5IW1A 3WS6C 4I18A 4PRNA 4ZRGA 1ZTXE 5EU4B 1WT5A 1YAZA 3BEWA 5MEPB 4L8BB 4HWUA 4HK0A 3C6SA 1WIUA 3NFSH 1LO0H 2AABL 2NX5A 2WC7A 2YGPA 4GMSH 5FO8A 4AW4A 4E41E 2YA0A 4OCSL 1NGYA 4GAGH 3GKWL 4NQQA 5ELIA 4U3SA 5C0JB 1AO7A 3TN0A 4GXVL 4QHMA 3QB7C 5IMOB 4CAGA 2AXHA 1OPOA 5HYFA 1JHKH 1JPEA 1ZS8B 3AY2A 4AGLA 1D5MA 1P6FA 4Z23A 3RFZB 3LQAH 3VD4A 4HIHB 1AR2A 3G6DH 1NPNA 5HDQL 4N0CC 1FFOB 1X5FA 1YY9C 2J55A 4LLUA 4U0RB 3DK0A 2DQTL 3A21A 3ZIYA 3NCJL 4S1DC 1NIFA 4N8VB 3T3MB 1X44A 4NQSA 3QNYA 3PWPB 3RPIB 4PLKD 1QFWI 2Y7NA 5DC9B 1AZVA 2JIXB 2CBQA 2X3CA 4S1RH 2OA9A 3IJHB 4L8CB 2C4XA 4NAMA 1UG9A 4YOKA 2QSQA 4JRXD 1AFVL 2UXFA 4JQIA 3HTLX 2WVTA 4AL8L 3GSQA 1R3LB 3MRKA 3OHMB 3SKMB 5MEND 1KMGA 1R24B 1ZHKA 2V5RA 4QNPE 1EZVY 5B1CA 1IKNA 1VERA 3QUXD 2DRUA 3IN2A 4HKBA 4CN6A 3C8KA 3B43A 2NR6A 3DNKA 2EECA 1X5HA 3KLLA 3E3QE 2GQHA 3F7YB 4I77H 5EH1A 1YJDL 4L4TB 2KLSA 2GI7A 2Y06L 1ORSB 4LHQB 3GYRA 3SE4C 4FTVE 1G87A 1J5IA 4XVSL 3VUAA 2JLPA 4JG5A 3VI3F 4KUCD 4PRAA 2LU3A 1PY9A 1EV2E 4BH8B 5I1GH 1DJHA 3HI6L 4ZW6A 2P26A 5L4IA 4JRWA 3ZU8A 4F8NA 2W92A 4OCYH 3ZZ1A 2NXYD 1NL0L 1Z1WA 2QGDA 3LXUX 1BD2A 2AQRA 1TJIH 4RQQA 3EZ8A 4KXZH 4Z76B 3CSYB 3F7LA 1SMOA 3P4NA 4NN7C 5CN3A 4GBXD 2WQAA 2PTVA 3BUYA 4J3SA 4DVRL 2XY1A 5FOBA 3FO2B 3IAPA 5FYJH 4AC4A 4GW1A 4AWJC 4F9PC 3DO7B 4DERA 1YY8B 3L2NA 3KLAA 4WDIA 3MNVA 1ADWA 3SN6N 1MW0A 3ZL2A 4N8PA 4RDQG 2E59A 5AB1A 5IJCC 1NSNL 3QORA 4LLVA 1SVBA 1JK9B 1JPTL 2VXTH 4JGNA 4HMEA 1INEH 4ZG1A 4IU2B 2TRYA 1NPUA 4HU2A 2PWDA 4NXKA 1K4CA 1WBXA 4GFXA 4KKLC 2XA3A 5I8OL 3KYKL 1O9VA 1BYOA 4ZQKB 5IW3A 4X6DA 4U1GC 5E7BA 4PJBA 2C7FA 3SDYL 1OT2A 1KPVA 4X9FA 1RSFA 3ZKNC 4JPIB 1GIGL 3DX9B 3NCYP 5HGHA 1MCKA 3HHMA 2OJZH 4ENZA 3VFWB 2C34A 4M5ZL 5KVDH 4F1SA 1MPAL 4OIFA 2FBRA 3H4FA 5BV7B 1BBJA 1EUUA 1AQKH 5H2BA 4F7KA 3BE1L 3LKSB 2CGRL 3FQUA 4KTEL 5T5FL 3IJ8A 5EU6B 4PJIE 4PRID 3U4BH 4KI5F 4ILDA 2FYYA 1XGPB 4RSYA 4H0HB 3EYFB 2W91A 1SPDA 3SZ6A 4WUKL 4ZJ9A 3LRGA 1OM9A 1L9PA 2Z4TA 5D7SL 5LDSA 5HDWA 2IWKA 5IESH 4NO0D 1MCFA 4Q6KA 4DO4A 2YUZA 3BUTA 5I2IB 2FO4A 1L9TA 2Y36H 1N9PA 2VUKA 1LEIA 4G5ZL 1ZWIA 4NM4L 3ARVA 4IU3B 3LKOA 3GZPA 2W65B 3FS9A 1E4WL 5KSAC 4XOAA 4JDTL 4JE0A 4ZO7A 5DDHA 1XGTA 3GUFA 4R4BA 4NO5A 1UOLA 3TESA 5K9JL 4UT9L 4HUKB 1CU4H 4DQOL 1MJUH 2C9QA 4HOWA 5KYWA 2W0PA 3VXOB 3SJVE 3QI9B 2K8QA 4OB5L 1QTSA 3KM1A 3IRZA 3U4EB 3LJ3A 1DE4B 1KN4H 3KPLA 2W38A 4ODHH 4YSTA 3JV0A 1QFPA 3S4SG 1UGKA 4D0CB 4G8GE 5J3HD 3BPCA 3PABA 1IFHH 3DTDA 4MRBA 4DO5A 4Q97A 1P4LB 5BUPA 5JQHC 3KBHE 3TF7C 4JO2L 2XACC 1TZIB 1SUJA 2UWEE 3ESOA 3Q8AA 4G9FA 2CA4A 5J1AA 1MFUA 5FHBL 4BZ1A 4YJZL 2WUBH 4GIOA 4F7PB 4M7KL 3ASWA 2J8UF 4MMXC 4JO8A 3IXTB 2D7TH 1RZGA 4QRRD 3O2VH 5F7EH 1DZBA 3CC1A 4H25A 4NUPA 3BZDA 5DLLA 1NAMH 4JQXA 4YE0A 1PLAA 3FW6A 3FXIC 1AD0A 1KT2B 1OHQA 3C5ZA 5DF0A 2FWOB 2WXOA 3DGCR 2X38A 4IK6A 5JOPE 3WBDA 5CJ8A 3PQYD 1MF2L 3BFOA 4XNDA 5I74B 4NO2A 1H15A 5DO2C 1FNAA 4XPBH 4YQXL 3DSNA 3H3BC 1OCRB 4L4JA 2Z93A 5AOJA 4HJSA 1W72H 2XN0A 3DUSB 2PCYA 3OJVC 2K3HA 2J43A 4KO5A 3ZBMA 4PJ9D 3WENA 1EVUA 5GGVH 3PL6C 1D5IH 2EC9T 4LSPH 1IBZA 3C5JA 5HBBA 3BP4A 2JV6A 1A7OL 3RWIA 4ONHB 2XVLA 2HJFB 3NSDA 4LGRB 2Z8SA 4KU1A 1NIAA 2R29H 3VYPA 1N4XL 1HHIA 4OM1L 4DSYA 2X1OA 2VM9A 4PGJA 2OSLB 4PB0H 4XWGH 5DVOA 1U58A 5FGBC 4X9IA 1SY6A 5IK3B 4WEEA 4Z0BH 5SWSD 4XNQB 3RDJA 2D0HA 2BHFA 2GUOB 3DA0A 3NSYA 1AGBA 3KZ8A 2V8MA 1QRNA 3ILQC 2NY0D 3NTCH 4TTGA 1A3RH 1OAKH 4MXVF 1JGIA 4K3JL 3CSGA 2EUXA 2FVNA 3T9WA 2XG4B 1QFOA 3EOTH 3MLVH 1C5CL 3GMLB 5GGRB 5IGXH 4OF5A 2DN7A 1B0RA 5I1AB 4ZUWA 2JCCE 4EI5A 4NQEE 4PGEA 2FIKB 1M71A 2R0KL 3DX0A 4XCFL 5IEKA 2XPZA 5KEZA 4HJJH 5CFHA 2OTPA 5J12B 1FGNL 2OMZA 3BEVA 1CI3M 4I9WD 1TZGH 1HAUA 3OKNB 4Y9FA 4X6EA 1TKWB 2QQNL 2BIHA 3PY9A 4P07A 1E4XH 5K9KA 1EDQA 3JV4A 5E6IB 2NUTA 3SQOH 2UUDK 2XWXA 4GIPD 2FJHA 4UUJA 4BIKA 2VSKB 1GJUA 2MNJB 2DPKA 3SBWC 3AT0A 3L4YA 1KEGH 5ABZA 1ZA3B 4BUHA 1RUMH 2Y1ZA 2DLHA 1DR9A 1KY6A 2N0KA 2ZWSA 3MNMA 4L8DA 4PJXE 4L4VE 4NQDA 3M1BB 4KHXL 1KYUA 1W8OA 5E8DH 5GS0L 3MV9E 4F8QA 3FU5A 4ZSOB 5CINH 1NJ9B 3QPXL 2GBTA 4XC1H 1RMFH 2YIHA 1INDL 3EDDA 1ZD6A 1RPUA 1O9ZA 5MI0B 2NYYD 1JYVA 1JNHA 1AQDB 3WUWG 5CCJA 2PXYC 1DQTA 1I1FB 2CD0A 2EILB 3C09C 3G08A 3KJ6L 1A22B 2E5EA 3W0WB 1P84J 3I02B 5DLMH 4OI8A 1J8HD 1ADQA 1TU2B 3LHAA 4N2DA 5LXVA 3W5MA 1OQXA 3EO9L 1TYEB 3KPQB 5IBTH 3BVDB 3NACH 5HVHB 4JANB 1EGJL 2XZAH 3UMNA 2PR4H 1T04A 3HAEA 4WNQB 5GGUB 1Q9OA 3HR5A 3GSUA 3CC5B 4JKMA 1SEQL 5EORH 2Z1KA 1USZA 5EF2A 4D9LL 3MLUL 2CLVB 3IGFA 1HZHH 5FYJE 5ETUA 1GZPA 4ZMZA 1AQMA 2PCXA 2Z91A 4B27A 3MRIB 4WW1B 5L4MA 1K5WA 2BMKB 5EZOH 5I1LA 4FABL 4CC1A 1G7QB 1OM3H 3NZSA 2UY7A 1T89A 3TO4D 1CIDA 1PFOA 2OR8A 4LPYA 4NX0A 4XMLH 3EO1B 3SHSA 3P9LA 2B08A 3SEPA 4JFED 4EEEA 1HT6A 1IILE 1NM9A 2E7DA 2BOCA 3FO1A 1IM9B 1B9KA 1UB5A 3LMJL 4K7PX 3V0DA 4MJIB 1R1CA 4GQRA 4QAMB 2PCFB 2PYED 1BGXL 3F5WA 3K6IA 3POHA 4M6NH 4AL8C 4KQ0A 4MS8D 2ICCA 3AB0C 3V55A 5BS0B 1HYSD 2Q7YB 2I5YH 7PCYA 4UDUA 2V7NA 5IJKC 5E95B 3J27A 3FYIB 4JY4B 2P5EA 1UACH 1F97A 5CN1A 3MODH 3N1GC 3OLEA 3O3DA 2FUQA 4Z3TA 5LG6A 1IV8A 3AREA 5E08L 2JQAA 5C0AB 3SOBL 2F2HA 4QCIB 1YMME 3TEUA 3HHSB 3N9GH 5GGTA 3QNXB 1RHFA 2XZZA 5IBLD 3I84A 2CSPA 1C1EL 2TRHA 4OSUH 4L37B 2NY2D 5G2NA 4ZMYA 4JFOB 1TTUA 1PJ9A 1UT1A 3HMWH 4MZ2A 4ODSH 4S1QL 4WJ5A 5LNGA 1CFTA 1GJIA 2RD0A 3MV8B 4MCMA 4KPHH 1O7SA 4K9EL 2P42B 1YEGL 5E2UL 1SXZA 4K8RD 2APVA 4LHUD 4G6JH 4H8HA 4XAWH 1L0PA 2J6EA 1DDHA 4LOUD 2X2JA 5GS2D 3TZVC 3IN0A 1EAJA 3Q2NA 2OR9L 3FONB 4J8QA 3Q1SL 1JV2A 1H3VA 3QH3A 2C4FU 4GNKB 1LMIA 4K2UH 1JPFB 1WEJL 4EZMA 3H7BB 1JV5A 3H6JA 3K6SB 3JWNH 1RD6A 2F5BL 1M05B 3CHQA 1MCNA 3EYQC 3LZRA 2ESVA 2R56H 3OKDA 1MFMA 4NO3A 4PBDA 1PZDA 4XBGA 3TFBA 3WS6A 4FA8A 5A6LA 5CEZD 1LK3L 5JXED 1K8IA 2DM2A 2NW2A 1Q90A 5JNYB 5F9JB 1E27B 2YXMA 3CN2A 4Y4KB 4M61B 1DP0A 1ODAA 2YKKA 3OXRA 3QDMD 4ANVA 1RZQA 5M7QA 1N18A 4FNLH 3D8MA 4KI5C 1KB3A 4OZGF 2IANA 5HI4C 5K39B 3MOAL 3ARFD 4HV8B 3QNZB 3FQYA 2WINB 5DWPA 2EVHA 3EH5B 4GIAA 3PHSA 4G8EA 4S10A 3E6HB 5F9DC 2AK4A 5F7UA 3A6CH 4PPTA 2RCSL 3D06A 3ZRFC 3V0GA 4YZFF 2GTQA 3U0TA 4AEIH 4K7FB 3FFCD 1SXNA 1XGYH 3UTPD 4PEEA 5A6MA 5ISZA 1QKZH 1RUAH 4HBCH 5IBUB 1TVBA 2DS4A 5E00B 4V11A 5E23A 3WDHA 2PO6C 1KB5B 4MMYB 1L9SA 2X1QA 1QNZH 1WHPA 3MC0A 2CKBH 4D9RE 4OF7A 4X7TA 2EIEA 3SDAC 1U8JA 1T4WA 2CIIB 3OB0K 4AMKL 3TPKA 1I8LA 3LNDA 1ZE3C 5KAQG 3SE3C 1TUPA 2ZP0T 2JJTC 3JSSA 3X1BA 5I15H 2UVFA 1LO5A 2E6QA 4U6YB 3VJ6B 4QGYA 2DQUH 3V6ZB 2VITA 3WNNA 4F7CA 3HMXH 4DWHA 2FHBA 4IOFC 5I6PA 4W9EC 4NQCB 4KZEH 1TVHB 1XMWA 1UWFA 1EEYB 3FQRB 2JB6A 4FMFA 4GKZA 4LARH 4X83A 1D6EB 1I8KB 4BSVA 5CLTA 4QXUL 4KK6D 4I4WB 4IRJB 1BBDH 1NCCL 3QSKB 1M6OA 2RFXA 1LP9A 2E4FA 2B1HL 2R27A 2XBDA 3B9KC 1HIMH 3D39D 3HB3D 4P59L 4XNYH 5C7XL 3CK0L 4N2BA 5E5MB 3ARUA 3V0HA 1MREH 1WFOA 3B56A 3FQXB 4QTFA 5IB1A 1UVQB 4UM9D 3SE4A 4ELKB 1MLBB 3DWTA 2BRRL 4KROB 5F7DB 6TAAA 3FUMA 1KGJA 3H2PA 4YS4A 2W9DL 5IQNA 4O58L 1V3JA 1GRWA 2NY3D 5B1BB 4HDIB 4Y5XC 1T2JA 3LIZA 4IEFB 5D7IE 3GK8L 4XOEA 3NDZE 3QJHB 1N6UA 1FL6A 3HC2A 1UKQA 1KJ3H 5TQ0H 2GJZA 5JXAL 2NXZC 4QHPA 4Y88A 4ZUVB 4ELMF 4R96B 1HE7A 2LTQB 3AW5A 1VZIA 1KIRA 4UMSA 4JRLA 5MERB 4F9PA 1EHXA 5L7XL 3V0WL 4G2AA 4LDEB 3V7AG 1A1NB 2F7OA 2X4QB 4PU2A 2W0KA 1KFAH 3STBA 2AJYL 2OMXB 4JAMA 4GXUM 3ARWA 5EULV 4EXPX 3OB8A 4FQJL 2VUOA 3ARBC 1IGCH 5IVXA 3WSQL 1UZGA 3MLWH 4HWZA 2P48B 3V5KB 4RSVA 3IF1B 2IBZX 3RJDA 4BSWB 2Y9RT 4RESB 4CGUB 5IFJB 3H0TB 4X6BA 1HOCA 4QOKB 4TUKH 4NNXB 3EGXA 5KVFL 2YXVA 4ERSL 1IQWL 1HH9A 2OSYA 3VFUA 1YMHA 3MGOB 3PP4L 1I1RA 5HVFB 1AS7A 2IDUA 3T4AC 4HIXL 3Q5TA 3TCLB 3RDTC 1JHTA 1OWWA 4HS3B 3PG2A 2VC2B 4X4XB 4ODVH 3N44F 4U1SB 3N0PB 1RUQL 2C3WA 1RK1B 3O41A 2ZP8A 2HMIC 4U2YA 3KGSA 4YBHA 3NH7H 4GAAA 4BXVA 3FAXA 1MCLA 3M6DA 1R5IB 3I3DA 5DUMH 1A2YB 5BMFH 5SWZA 2ORBH 4RZKA 3CAFA 5H4YA 2CO6A 3VWKC 2NY4D 1QFWH 3BGFC 4LSSH 4ZW3A 3IB4A 1R6VA 1GTFA 3QDJE 4OD3L 4JRYA 2OP4H 1ZV2A 4KJQC 5KSAA 3C6LD 5EO0B 1I7ZA 4LBEA 3M7OA 4Y2DD 5GHWH 1BVOA 3EYVB 2DQGH 1OSPH 4Y16B 5B38G 2GTZB 1OALA 2ZXAA 2ZF8A 4N0FA 4EDWL 3UG5A 5TE7H 4G7YH 4L3FA 5D2NB 4OLYH 1KGWA 3C12A 2JXMB 2QV2A 2G5RA 3JWDL 2GJ6A 3RVVD 1NEZB 5EZJB 2Z65C 5E1IA 2P8PA 1CR9H 1EZLA 4NLAA 5ECGA 5FYLH 1H8SA 1CF1A 1U42A 2R7EA 3KLQA 1KLFA 5AVRB 5DHEA 3UC0L 4UTAL 3TYFA 2XVBA 5GISH 4MD5B 4G6FB 5E5UB 3S36X 3KD4A 4XBPB 1KC5H 4POZC 5T3ZH 4NN5B 1HHKA 1PS3A 1XHHA 2DQEL 2IIJA 3QO0B 1KLUA 3OKKA 1A9VA 2X6BA 4GI9A 1DJYA 4P4RB 3EXJA 1W8NA 1A6AA 4MMXA 3DJRA 3VXMB 1DBAL 5B3JE 3HI5H 3FO0H 4WWKB 1BF5A 5C08E 1QO3B 1QYGH 3OZ9L 1XF4B 2OZ4H 3WNPA 3APFA 4OLXH 3DSFH 3GSWB 1A7NL 3GRWH 1JPSH 4HYTB 1AY1L 2NSMA 5JIHA 1GA2A 3S34L 4OT1H 4YNYB 2DJSA 5DMYA 2YBRB 4PJ5E 2G2PA 1CB4A 1PG7L 3JWNE 4XC3H 3UTOA 2BS71 4XBEH 3PP3K 3RVXD 3MFGB 4K07A 3CXHJ 3T3MF 4D7PA 4AENA 2C7UB 3AU1A 4UIKH 3AXLB 1AP2B 2HJLA 1UYWH 1MNUL 2IEPA 3KYAA 4E41B 1OB0A 2AEQL 3PL6A 4N2GA 3ULUD 3MA7A 1A4JB 1BP3B 1WG3A 5GXBB 2VABB 4KXBA 2FSDA 1NIBA 1OLLA 5CGMA 3VFMB 3BUPA 4ZD3H 2HFFA 3ULSB 2WZ6A 4PGCA 2VH5L 2MTAA 4GP4B 1UWXK 2IGFL 4NRZB 1LWHA 3EOAA 3MRLA 1VDGA 1HNGA 4WLCA 5FGBA 4JVPA 3L3DA 1BZ9A 4F37F 1SBBA 5EU3A 4MZIA 2KZ1B 2OJEA 2R4SH 3CFKB 1A14H 2HKFH 4ZOBA 3V7AE 2H0JA 5DD6A 5DGRA 2KPWA 3GEWB 3GHBL 1PEWA 1HK6A 1BVLB 3FCTB 5L4FA 2CU9A 1QBBA 3MXWH 2WO2B 3QARA 1MQKL 2VERN 1SYVA 3DOSB 3FU9A 3LKNB 2ETWA 4TN9A 3QRBA 3RFRA 5IQOA 4XMKH 4FFYL 4H0IA 4Z7VF 3THML 2QT6A 1MRCL 1MFAL 1B4LA 4OGYH 1XAKA 3BQVA 3OXSB 4P2QA 3CZLA 1BQLL 4M1CD 4HG4J 2VDPH 3A6BH 3P9MA 1A65A 4OJAA 4R0LC 4K9EC 5DU7A 1WCBB 1PG7W 3B5GA 2L3BA 3LRSB 2WLLB 1OGTA 4I1RA 4A2FA 4NT6B 3UBXA 3GRBA 3VFGL 3SBWA 4DO6A 3S5ZA 2ENSA 2Y5EA 4PWFA 5HD8D 3UJJL 2B1OA 2VR9A 3ECBA 1U8HA 3PUUA 3UBFA 4YSSA 1T20A 2WO4A 1CFQA 4MDRA 3WELA 1QG3A 1TO5A 6CGTA 2IOIA 3GBML 2ZXEB 5HHQA 3GC3A 2XBZA 5DUJA 4NRXB 4ECNA 2IQAB 1TDQA 2WIMA 3MCKA 3GZKA 3D9AL 4OV6F 3DX4A 2UYLB 3NZUA 1EAPB 2F19H 2WWNA 3CLEH 2VLRE 2OTUB 4FTVB 1KGIA 4P3DA 4KXCA 1A6WH 5CJQL 2AC0A 4ZFQA 3CZUB 1ZAGA 2PXYA 2CLZA 5AW7B 4JQIH 5CR1A 4U3CA 3TBTB 3UTZA 4XP4H 2YD6A 5C0EB 3WO4C 3QZWA 2EDBA 3FQTA 3QR2A 3GS4A 3HZMB 2EDKA 5E8NB 3II2A 2VLLB 1G9NH 3ASNB 3JQOB 3PAZA 2GHWB 5I1EH 4ZMPA 5ID1A 5K59F 4M6OH 2HX8A 4XCNB 2BP0A 1BSIA 4KX7A 4QJ3B 4MBRA 1VADB 1OCZB 4GRLD 4DW2H 1ACYH 4FHBD 4NRYA 4WFHD 3BWUF 2MHAA 4FQXC 3RVTC 2Z92A 4WI9A 2X1WL 2VDQH 4RZCA 1ZHNA 3TO2A 2X6MA 1S4IA 4PS4L 3V52H 4ZMOA 4JHWH 3SKOA 1I7RA 1KXQE 1FVCB 4U1NB 1A7QH 2BIPA 4NCDA 5E6SB 3EYUL 3F7VA 4XNXL 1E6JH 4YHLH 4OFKA 4QY8A 5HDLA 4MJ6A 1RULL 4JN1L 3VI3A 4D0DA 2FX9H 4HIPA 4NP4L 3TCTA 4Y4HB 2OCJA 3SCMD 1MCRA 3V4LA 4Z7WB 3MRCA 3ZTCC 3VXUA 5IJKA 4HLEA 1AZUA 3CPLB 1ZXKA 3VFPB 2YC1B 1W0WA 2IPKA 1U95B 3MRDB 1TCMA 5F71A 5DQDL 4D9QD 4TOYL 4UQ2A 2VDNL 3TBWA 1X9QA 4Y1AE 1ASPA 5EB9A 4FNPA 4U7MA 1TQWA 1OGSA 3HVNA 3MRHB 4PJIB 2JKIS 5I8EA 1JGVH 4RWYL 4TS6A 2VZOA 3P69A 1TTRA 1M6UA 2XV0A 2ZXBA 5C09D 4TKWA 3WIHL 5IMKB 4R90L 1F8TH 2YUVA 4YHNA 5ICZA 5F7HA 1PLGL 5HJ3B 2EIZB 3LS5H 4Y5YB 3WUZA 5D6DC 1GAFL 2QKIB 3K1KC 3X1NA 4D8OA 2GSGA 3GB7B 4YXLL 2IH9A 5DK2A 5JYMA 4QLWA 1HN1A 2NSQA 3NZHL 3DJTA 4JFPA 1IGTA 5HHXH 3QFJA 2R0LL 4RFNB 4X4ZA 1XGQB 5L2KD 2AQ3A 2Y7QB 3R4DA 1JDAA 2DYPD 4P49A 3GZOA 5KBLA 2R23B 1CXEA 3SYCA 2ZOKB 4JG1L 5ANME 3ARDB 4L0PB 3PUCA 4QD2E 3SJVB 3NJGA 2DYSB 5EIIG 5LNEA 1CGTA 1J5CA 1ZMYA 2HVJA 5HXMA 5DR5H 3L2MA 3A4FA 5CM1A 2ED8A 4HUCA 4LL9A 1A3LH 5FYLE 3MJ8B 3FQ1A 5E8OA 1NAKH 2VXUL 5CLYA 2N56A 5LUMA 1UWEL 1WGOA 3H85A 1KLGA 2ALWA 2IPUG 5CWSB 3UBXI 4KTGA 2UWEB 3KDMB 4M6MH 4PRHA 5D9SB 3EAKA 4XMPH 4L29B 5T3ZE 1HI6B 5TK4A 5IJVA 5C0BA 1KELH 4MVBC 1G7MA 1EJ6A 3CQPA 3OGOE 4HIQA 4ZPTB 3BZEA 5F1IB 2X6CA 4CN1A 2PO6A 3ZKXC 4ALAC 4C55A 1NUDA 1C5DB 3BKML 3CBKB 3O9WB 3PPSA 1HTYA 4KRPB 1BLNB 4E9LA 3GXIA 1NFDE 2K8MA 2NY6D 3HG2A 3OF6A 2Z35B 1P4IH 3E7JA 4IS6A 5T5FA 4AQEA 4AJWA 1ET8A 3SDAA 5TQ2H 3T0VA 3FB8A 4HQQL 1NTDA 5AW4B 1TJXA 2JKNA 2NUPA 3SE3A 2OJ1A 5HYQA 5LHDA 3ZSSA 2JJTA 4ZXBD 1KEML 4PW3A 4OJCA 4I0KA 3ZTNL 4FULA 4L18A 1UXMA 2GTWA 3HNVL 1JZ7A 4JHBA 4G9DB 1PIGA 5SX4I 4BZ1H 4TLTA 2AXFA 4FXTA 2YFOA 1RIHL 4XHJD 3TU6A 3L3KB 5IY5B 1IE4A 4P23D 5D2LA 4ZAKC 2XWTA 1WHOA 4WEBH 5C07E 5AW0B 3APDA 4UT9A 4KKNA 2J8UA 3SPHA 5LJYH 1FYTE 1IGIH 3B9KA 2BNRD 2LU7A 1T1WA 2CPUA 1A5FH 3AZUA 2P80D 4U6HB 3JWDC 1QEWB 1V5JA 4F2EA 3Q44A 3V5HA 1YEFL 3MBEB 1WSST 3ZL4H 1DO6A 3DVFA 2ICEB 3RFZC 1WWBX 2BNUA 5LLIC 3GUTA 1MFNA 2DQDH 5DVNA 4Z3GA 4U0RC 2ARJB 2QPSA 4Y5XA 5GSVB 1XEDA 3TYGH 3RIKA 5KVEH 4MNQE 4C57C 2JCCB 2AGJL 3LY6A 4NQEB 1N68A 5DK0A 5H8DA 1N8ZA 1KACB 2NX5E 2A6JA 4M5YH 1LL1A 1O6VA 3QRGL 3WLWD 4ZS6C 4JHVA 4GG8B 4YHPA 3DYMA 4DUVA 3MXVH 4HJGA 1KTKE 4L5FL 4JPVH 4R7NB 3J2PA 4OBRA 4Z3JA 1AKJB 4JKPH 1AO7E 2GW5A 2LQRA 2F58L 2P43B 3D05A 4QXTA 3Q6FB 4KGLA 4IBZA 3PAUA 4JM4L 4GMTH 4RMUA 2PW1B 2ZKMX 4PTUA 4XMVA 3VDAA 1BM7A 4BFNA 5A40E 1M4KA 3ORJA 4X5WA 4Y2LA 3RIAK 4WNSA 3HI1A 3ARBA 3S5LA 3TJEH 5DMGC 1HQ4B 1MOEA 1TSRA 3MUHL 4PJXB 1KB9K 1BAWA 4L4VB 3EHBD 1Y18B 4IBLT 4HT1H 3MV9B 1NIDA 2DLGA 4R6UA 3MFFA 2WVVA 2BSDA 3IFOA 4HCFA 2WLIA 5INCB 3P02A 1CGYA 1ACZA 4WU5A 3JTTA 3FT9A 2AANA 3EGDA 5DZOA 3LNIA 3OKOB 4KJYA 4QRSA 1KBGH 5DS2A 2FWLB 2CBMA 4YDVB 3ZDZE 1YNKH 4FQLH 3RDTA 3RHWK 1CLOL 4K3DL 2X3AA 1HXMB 3GJFB 3T0XA 3ZHLA 5B7FA 1KXTA 5CZVH 1OGAD 1YN7B 2VDOL 4FEIA 2O6FA 4NZUL 1JFQH 4WTWA 1DJXA 4X8JA 4ANXA 4OIIH 2O26U 4KQ4H 1EO7A 3VCLA 3HIZA 5ENWB 2GFBA 2NPLX 3WEXB 3S4SB 5JPMB 1D5BB 3ZZSA 1SBSH 2CG9X 2VTFA 3VXTB 3VWKA 1CZ8H 5AAMC 1ZANL 5I1DA 2C3XA 5JORA 2BO0A 2WXKA 4YBLB 1A66A 4Q9CA 2X4PA 4TSCL 1NGXA 2G2NA 4WQOA 3CH1A 3O3AB 2BNQB 4GFTB 2JJWA 1E2ZA 2A6DA 3T08A 3LRMA 1AHKA 4BYHA 4Q8BA 2A6IA 3IWUA 1UT2A 1ADQH 3S3CB 4MXQC 4K5LA 4NKDA 1AGEB 4XN7A 1N3NA 3VMOA 3U0WH 2Q3ZA 3KBPA 1SDDB 3W2DL 1KCWA 3DVGB 4I3GA 1BD2E 3HAEH 3MACL 2EAEA 4WVRA 4M4RB 3Q8EA 1TETL 1U92B 5FECA 3BVTA 2WP3T 1R0AL 1FL5A 3C9NA 1JK8B 2FSEA 3BUBA 2OX5B 5DUPH 2X44D 4RFEA 3N1PC 5IOKA 4ZTPL 1YMMB 3FTGB 3TT3L 4YGVA 4OFQA 3FU7A 3S96B 4IHOB 3FULA 5L88L 1VFAB 2H6PB 4P46B 3TVMB 2PTUA 3WTXA 1R5WB 2XTJB 2VZ1A 4LF3B 2Q2LA 3MJ6A 4BE6A 3ARXA 5BV7C 1FF5A 5KG9B 2PETA 2JKWA 1UCBL 2F53E 5HHPA 3K2UL 5EBMB 2V7HB 1KBKA 1EBPA 3JT2A 4G7SB 5D7LA 5DQ9B 1NC2A 3B8YA 2KI6A 4K3EH 4R2GC 1BIHA 3PWJB 1EGJA 4X6DE 2DLIA 4PJBE 3UTTD 2DI9A 3WJJC 1Y0LB 1DO5A 1EA9C 1UHVA 3C60B 1BMWA 5F1NB 4TNWK 1XR8B 1NC4D 3ATBA 4BH7A 2EIMB 5GZOD 3VRJB 1T2XA 2AJ3A 1SJHA 1OAQH 1G9MH 4IDLA 1BAGA 4K4KA 5GGTH 3S35H 3RX5A 3U6XS 2XKNA 4GP8B 5GZND 4YIQA 5F70A 1NCGA 1RUPL 5CZKA 3VXRA 1IM3B 2BVQA 4KDWA 2E8ZA 4J4PC 5LGHH 2Y2YA 4UINL 1PX3A 2OMUA 4B50A 4B97A 1OCWL 3MLSL 4QRPD 1C08A 1NBZA 4Q58C 3QI9C 3MN8A 3OAZH 2WQWA 5F0PB 3K0YA 2O5ZH 5C0CE 2BSCA 3VO0A 5IHZA 4B53A 2F8IA 5GGQL 2J6EH 3DV4B 5I0XA 1ECZA 4FNTA 1Q38A 1SOXA 4PTTA 5D4IA 3I6LD 4W6YB 3WTTA 5AW5B 2FO8A 1ZCRA 3N0AA 4OUUA 2GY7B 2X4UA 1JZJA 2JB5L 1RZJL 4K5MA 3CJJA 4JDZB 4M48H 4UB0L 2VDRB 1XX9C 4AV4A 3MRGA 5DMKA 2X4TB 4RRPM 4A2GA 1KTLB 2EYRA 3HAEG 3PRZA 1NAMB 3UO1H 4DGYH 1A6TA 2D0GA 3QCUL 4W9LC 3T77B 1UQSB 2AK1H 1AIZA 1IC5L 5ACZA 3T6XA 1MQ8A 3PHAA 4ZMTA 4O2FA 4ZFFB 1VFBA 4POYA 4NBYB 3BDYH 3G9AB 3PGFH 1FVDA 4M5TA 4R0LA 1NDGB 4OZGA 3WUWB 2QVMA 4JZJC 5FUCC 3STLB 2DH3A 3UJTL 1Z2KA 2FGWH 5DUBA 3NP4A 5I74C 3TT1L 5A2CA 3Q5YA 4KVNH 4G9FE 2VR4A 3CDGB 4PJGA 4LRIC 5MP6H 3DK2A 1P4BH 2APBA 2FX7H 2CIKA 3QCTH 3CSPA 5A2JH 4WUUD 1EAQA 4MDIB 4XVUD 2V9QA 3LEVL 1MIEL 3O4LE 5DJAA 2HLAA 1L0YA 1WA1X 5JPNB 2ZOOA 1MFEH 5AB2A 3ELQA 3JUYA 5FK9B 2DI8A 2X4RA 1GY2A 2A73A 3C2AH 1HHJB 3O6FB 4P05A 2VC2L 5C0GA 3FSVA 3O3EB 3D69B 3G5XA 5IQ7H 4X9BA 4KTYA 2WXIA 4AQAA 1CD0A 1MAJA 2H1XA 2OCCB 4BCZA 2WP3O 4UNIA 1WAAF 3FOMB 5D7JD 4YSCA 4UIMB 3CE1A 4L2YA 2OYKA 3WEBA 5KVEE 3I2CH 2F7IA 1Q1JH 3GS7A 3SQRA 5DC2A 2EDXA 1DN0B 3QEHA 1BA9A 2AV1A 4YWGH 1I1AC 4FTDA 3V0VB 3WKML 5FLVA 1DQLH 4YE4L 2OTWB 3RJOA 3FFDA 5ESQA 2CUAA 3DOIA 3S0PA 3VXQB 2FNBA 5J12C 1OF2B 1JN6A 2XRAH 5KW9H 1TJHL 5K33A 5CEYA 4MQXD 5G4MA 5FF6A 2HTLC 4HMCA 4MCNA 4MAUH 4XP5L 4U6VL 4ZS7L 3RTQD 1JWSB 3LQMA 1ND0B 1MCIA 1BX2B 2Z31D 3DHPA 2CM6A 4RGND 4Z18A 4F8LA 3FFOA 3WI9A 4IGBC 2WNGA 1QRNE 32C2B 3DMMD 1S7WA 3K5RA 4XRCB 3G5VA 3MUGA 5LB1A 1JZDC 4QRQA 5ILTL 3TIDB 3ZHDA 4ZFOA 3SY0B 3MV7A 3LIZH 3QJOA 4WGKA 2DWTA 1QSFD 3CQFA 3FB5B 2R1WB 4P4KB 4TVPL 3PYCA 4YSOA 2FB4H 3PHOB 5BO1L 3QUYB 2XVKA 4GSDH 4LCWD 4AXWA 5EO1B 3KYOA 4MCZA 4TM9A 4YUEH 3DETD 4ELMA 1XQ4A 1U8CB 4C47A 2YSSB 4JZNA 1LO4H 5EA0L 3RGVD 1XL4A 4GKLA 4OZFA 1HEHC 1RJZA 5CGYD 2OXHB 4F7TB 5KYXA 2DEWX 4OKDA 4X4YB 1J48A 4QUOA 3MLZL 4GAYB 5HHOB 5C92A 2GSIA 3HVDA 5J7CC 1SEBB 1KTBA 2ADGA 2EEBA 4OIAA 4TLKA 2AQQA 3V2AR 3RPKA 4OGAC 2GT9A 5D6DA 2YO3A 4O5LH 2XPGA 3LZNA 1COBA 3DV6A 1CF8L 3EFFB 3DX8A 2Z64C 3R1GH 3QDJB 2IXQA 3W9DA 1MJJB 1ZTXL 2R2BA 4ANWA 3CDFA 2Q3AA 4W9HC 4Z95L 2CR3A 4RNRA 1E8XA 4FFVD 5IROD 2M2DA 2Z8RA 4O9HH 3UCRA 4UV4L 2B2XL 4N0UA 4G8GD 2Q3XA 4Q74A 3QXWA 1NUGA 4XWOD 4A1RA 3PV6A 3T2NH 4Y9EA 1QW8A 4J1UB 1DSFH 1NMAL 4HH9B 2DQFA 2OM5A 2JJUA 3HE7A 3MPCA 2VQUA 2H9GB 1ETZB 1G6RL 3D3VD 2VN3A 2WBJB 1QZ1A 2QVIA 3T6ZA 4WF7A 1YDPA 1Z5LB 2FD6H 5IG7A 1O6SB 2Y4SA 2VYRE 3OX8B 2ZXCA 2EDDA 3DPDA 5TPWL 4EIBA 1IL1B 2MCPL 4G6ML 4HD9A 3QPKA 4X80L 3LB6D 4DOHE 5T1MA 43C9B 2EVGA 5KBPA 4WFEE 5C08B 3HRPA 1IJ9A 1CL7L 4EQ3A 1UH2A 3IMRA 3FC8A 4UI2A 5I1IL 5TJWK 2YSTA 2CAKA 3VQLA 1A3QA 2N0MA 3IXAA 5AOKA 5JW5B 2P7TA 5ITFA 2AAVA 4PGBA 2F54D 3V4VH 5CS7A 1GYWA 1OHZA 4MJHA 1RZFL 2FZ3A 2E9BA 3HE6D 4I5BB 4N87A 4TL4A 4R4ND 1ASOA 4GW5B 5F8QC 4Q0XL 3QDGA 3E6FA 3P77A 1J10A 1DFBL 1P7QD 3ELAT 3OKYA 3L3OB 1JGUH 3HCVB 4NC2B 5JZ7C 1E42A 1I9JH 1K5NB 2FLBT 3CLWA 4OGQC 1EFXB 5FM8A 3VRIB 5G5DB 3HNSH 2Q8AL 4LCVA 4BFEA 4XP9L 1PNCA 2WXFA 5MEPA 4L8BA 3ALWA 3HBPA 4ZAKA 3VFTB 1LE5B 4Y4KC 2VL5B 4BQ8A 3LXCA 4ZBJA 3F05A 3B6SB 4PRDA 2H4EA 2Z7WA 2N01B 4YDIH 1T83C 3BP7B 3E2HC 2GIXA 5IMOA 4XN9A 1H6TA 2I27N 1S5IH 3UPAA 4PLJC 4HXBH 3RFZA 5EC1B 4LLDA 3JV6A 1FBIL 2A1WH 4O02L 2Y0SA 3LXAA 4OF0A 1KDIA 3FKUS 4UTAA 5HJDA 4ZMQA 1FFOA 3UIYA 3IFNL 4GSXA 4XNUH 1HEJC 3LZFL 1Z0MA 5J6HB 2CNZA 3D7PA 4DP0X 4N8VA 2NW3B 3M7FB 15C8L 3PWPA 4PI0A 1DSYA 2XY2A 2PWFA 3X11B 2JIXA 1L0QA 1FPTL 5EZLB 1RURH 2P5WD 4UNTA 2IANE 2EACA 3IJHA 1DANT 1F11A 1YUHB 4M7JH 4PYHA 4XH2B 3BCDA 5D70L 4C8XA 2AK4E 1R3LA 4MMZB 4E42A 1R24A 3OVUB 1JGLL 4OFPA 5HYJD 1WBYB 1EDYA 1TQSA 2DMCA 1IARB 3WD5L 4ONFH 1AACA 2B9AA 3OMZA 4WI3A 2EZ0D 5DJYA 1QHOA 4OLEA 4EBQL 2Q8BH 3MTRA 3V0FA 2YAPA 3RVWC 1A6UL 4PP1D 5D1XD 5SWQA 3V9FA 3OKEB 3IDNA 3DX3A 1L7IH 2WWMD 5TE4L 4M43L 1CTMA 5EMYA 2VLRB 4M03A 1IKFH 1R3KB 1A8ZA 3F7YA 2W80C 3N1QC 1U8OB 3TA3A 1F58H 4Z7VA 3PDOB 5C8JB 2VZ3A 1I31A 1TZHB 4PD4J 1UA6H 4KROC 4NNYB 2CXGA 1CIUA 5B38B 3FRPA 3ZHNA 1DJGA 2Z0UA 5FYJD 5D8JH 3QJSB 4Z7WF 1BZEA 3QWNA 4FGMA 1YEJL 4YHKL 2A74B 2E7HA 1RZJC 2QZQA 1WAEA 3P4MB 4Z76A 3VG9B 2GBUA 4B9IA 1H5BB 2X70A 3CSYA 3QZNA 4WFGD 4N6QA 3SDDB 4LVOB 2WUCL 1QVOA 4V1DA 1LP9E 5AAMA 5EEZA 2LTQC 1YVLA 4PG9B 4JDEB 4B9PA 4PJIF 5IOPB 4FFYA 4HFWA 2EDJA 2AABH 5BZWB 1P84K 5A7BA 4ZT1A 2AI0L 4OCSH 1FZMB 3GKWH 2GCYB 1QMUA 5EOTB 1PZCA 4GXVH 4YFEA 4UU9B 5C0ND 1JK9A 4A7SA 1I7UB 2WLNA 1TLKA 4LP4A 2EDYA 3DBXB 1K3IA 4RGMC 2G5BA 3Q2VA 4ZQKA 3GIVA 5SX4H 3S8WA 5I71C 3I6KA 2NSXA 1DVFB 2YPLA 4KKRA 3M88A 1NLDL 2YAFA 5DHXB 4JFVA 3NCJH 2V2WB 2F15A 3GMNB 4Y1AB 4JX0A 4DZ8B 3W81A 2UVEA 3D0AA 5EO9A 4JFHD 1QI5A 3ES6B 2HN7A 4ODXB 3LKSA 4N24A 5EU6A 1GC1L 5AW2B 1XGPA 2AQPA 3U0PA 1G7JB 3EYFA 5EHFA 1AFVH 1T66D 3QO1A 5KVGE 1WA2X 4JG9A 4AL8H 2AKRA 1K3ZA 1YEEL 4W9IC 3RL2B 1AQ8A 3DVNB 3R06B 3VA2C 4MLSA 5I2IA 2UWEF 3NSXA 3WJJA 7PAZA 4BFFA 4HGWB 2VW6A 3QIBD 2CDEA 3EFDL 2E7MA 2XBTA 5C1MB 4Z7UA 2W65A 4HK3J 5A2BA 4N90E 3ZGHA 2H26B 5ANMB 4JK0D 3MRJB 3D85B 4Y16C 5TF1L 1YJDH 3DDFA 2Y06H 3L4TA 5D1QE 4J4PA 1BG9A 4W93A 1V55B 3D34A 5T1KB 1HXKA 3RVUD 3QK0A 4F20A 4XCEA 4XVSH 5D2NC 3VXOA 1KGCD 3QI9A 4LNRB 3VB9A 4MAZA 5HGAA 3U4EA 3PCYA 5SWZE 5I5IA 3BMVA 1XB8A 4D0CA 3HS0B 3F7RA 3PAVA 4R7XA 4ZDHA 4YSUA 1NL0H 1ZLEA 4GB9A 1E9QB 2HJKB 1P4LA 1VACB 3NAAL 5I82A 4D8PB 3P1VA 4JRYE 4DVRH 5BUAA 1HKLH 4OGZA 5F3BB 5DFVC 3X13A 1DLFL 2IPUK 4F7PA 3W3BA 1KTDB 4MA3B 1LQBC 1NFDB 2ZCZA 4WWKC 2Z4QA 5IF0B 1J11A 2W95A 4ZUSA 3NBNA 5JHDD 4NQVB 1WWAX 2GJ6E 1NSNH 3M8OH 3NESA 3NP3A 4OFYA 3WIHA 4C4KT 2IFFL 1JPTH 4TTDD 3CBRA 1U8NB 1P1ZA 3QHZL 3G6JA 2WXQA 4L23A 2FWOA 2IQ9L 4FZEL 4EDXB 3ZE2E 4RDQF 3O2WH 4JZJA 4LPUA 4MAYC 3TBBA 3SDYH 2JCCF 1GIGH 2MFNA 4LRIA 4LESA 1RZ8A 4N2HA 3QZOA 2YMXL 2IFGA 1BOYA 1E7UA 2XKSA 3DUSA 4M5ZH 1MPAH 2HA1A 43CAB 4DVBB 5C07B 3PXHA 5CCGE 5DJ0B 4CVWA 1FYTB 3KXFA 3H9ZA 1UB6A 2G9HB 3MROB 4KK8D 3BE1H 4HWEH 3EFOA 1HL9A 3ESNA 2CGRH 1YZZA 4I3SL 4KTEH 4NUMA 5DYFA 5T5FH 2V17H 1UT9A 4JFFD 1WUZA 4ONHA 2HJFA 3KAAA 4HUUA 3UYPB 5D7SH 2AXJA 1S3RA 2H2SC 3VQMA 4W6WB 2OSLA 5IK3A 2CO2A 2O5XL 2LFGA 2QSTA 2CUMA 3DRTB 5IW1B 4AVJA 1JERA 1X5KA 3K8KA 4PJXF 5HHNB 4I18B 4PRNB 2GUOA 3HG1D 4N5EC 4MNQB 4G5ZH 3TNMA 4FMKA 3C6SB 2LU4A 5KANI 3BVNA 3VFVA 2NX5B 4UT6L 2XG4A 2PNDA 1VENA 1XZWA 1UZ8A 1E4WH 1ZSHA 3GMLA 1I1AA 1FVEB 5GGRA 1CFMA 5I1AA 1NGYB 1M3JA 3F64A 1OE3A 3QUZB 4FHJA 1FJ1A 2VDPB 2FIKA 5AW1B 1CDUA 4X5LA 3RY5A 2BSEA 2Y2WA 3TN0B 5K9OA 4UT9H 5LQBL 2AW2A 2BS9A 4PGZA 2CO7A 4MJ2A 3S35X 2DM4A 1D5MB 1TKWA 1ZIBA 4OB5H 1QTYT 2CDFA 2J21A 3VACA 1BAFL 4LLUB 1IZJA 2NY7L 5DC4B 2HLFC 2KS0A 4IGBA 1ZA3A 3DXAD 3ZQ9A 5PCYA 4UQAA 5I75B 5BVJA 5L9DL 2NCEA 4EN2A 4TUUA 3ZTEA 3E3QC 5FHBH 2ICWA 2KL6A 3PWNB 3FL7A 1UWYA 4M7KH 2X40A 4TSAL 3X3GL 3ZDZB 4NOFA 2YLKA 1GGCL 1PMYA 1X9LA 1Z9LA 3GSQB 5BXFB 2JKLA 3QDAA 2X7LB 3VDCA 3ZMRA 3GJEB 3W0WA 4CC0A 1ZDQA 3I02A 5FX3A 2VDKB 3KPQA 3QDHA 1Z3RA 3D4ZA 4HKBB 4ES9A 1VSCA 2EYSB 1MF2H 4QRBA 5EIIB 4WNQA 2FATL 1CD8A 1HXYA 1W9XA 3CC5A 1CLZH 4HZ1A 4YQXH 4ES8A 4Y9CA 3EH2A 3WY3A 3UPCA 1UM5L 3FHAA 2CLVA 1ID5I 1V54B 2AF2A 3DJSA 3MRIA 2BMKA 4LOFA 3VYNA 4KZDL 1SHSA 1DUYB 4PRAB 3FN9A 5B8CB 2H0EA 4ENED 4MJ4A 1A7OH 4KKQA 2FNWA 1CGVA 2IH8A 5TFSL 4C4KO 2Q6WB 1OOAA 4UZUA 4Y7OC 3VSQA 3BW9B 1BD2B 1N4XH 4MJIA 4RQQB 4Z3FA 4OM1H 2PCFA 3AGVA 3OMNB 3KNBB 2J20A 5SV3A 4Y4HC 5BS0A 2Q7YA 5IT2L 3BUYB 4AKPA 4EOWL 4KDVA 4AYBA 4GW1B 3GTVA 3VW3L 2WZ0A 1C5CH 2WY3B 2LE9A 3KLAB 2I32A 2DWXA 5C0AA 3MNVB 4J3WA 4Z6AT 2R0KH 3S88L 2F53B 4XCFH 3QNXA 2HB0A 1WYJA 1FGNH 2I9LA 1J0YA 1P9MC 5SX5H 4JFOA 1K4CB 1WBXB 1KBVA 5E9DD 4PJ5D 2QQNH 3WGVB 4JUSA 4FQHA 3VI3E 2QLVB 3T2OA 4WEUD 3MV8A 4X6DB 3RIAF 2ED7A 5GRZA 4PJBB 4Y5YC 5HPMB 1U2YA 1GCFA 2QKIC 3LN4A 2MCMA 5HGHB 3VXUE 3D2TA 3DIFB 1JTOA 3FONA 3RGHA 4K8RL 5C9KA 4YVUA 1JPFA 3D1MC 4KAQL 4PRPE 5B1AB 3H7BA 5H2BB 3WNIA 5L4JA 3K6SA 4KHXH 5GS0H 1M05A 1NA8A 2WD0A 4N1HB 3QPXH 1INDH 3RX9A 1ROWA 2GBVA 2C9VA 3ARDC 2QSCL 1OOWA 3NN8B 5JNYA 4JKWA 3KJ6H 4K55A 5F9JA 1E27A 4Y4KA 5C0CB 1SJXA 2BWQA 5EEXA 2FO4B 5D93B 1FA4A 1JSYA 1LYQA 3EO9H 4DF9A 5GQBA 1T83A 1AXTH 1E2VA 1EGJH 1ZWIB 4P5TD 1KTJA 4HV8A 3HZKB 3BGAA 3RURA 1EH9A 3QNZA 3LPFA 2WINA 4JFDA 3Q1EA 3PJLA 3JBG7 1SVZA 1SEQH 4RBPH 3QFJE 4HP5A 1XGTB 4R4BB 3GXFA 4PJCA 1FFPA 3O0RL 4D9LH 1MRDL 3MLUH 3ENEA 4K7FA 3SDCB 2QLYA 4OQ1A 1U3HB 2WYTA 4AY0A 3BZ5A 3U9WA 3I50L 4B9YA 1VAHA 3MBWB 3KW8A 4FABH 5KYWB 3WKYA 4LSRL 3WU1A 5E0QA 4MMYA 1I8UA 1U3ZA 1MJ7H 4KH9A 1NFIB 2ICWI 1MI5A 2XQYG 3O9WC 3KPLB 4KRPC 4Q4IA 3AACA 4LEEA 4KI5E 2LAAA 1GC1C 1R5VB 1NKRA 1TYRA 2LU5A 2CIIA 3A67L 3LMJH 3GZQA 5ACLA 2B14A 4KH2A 4M1GH 1BGXH 3Q43A 4LMQE 4AZUA 1GMIA 1KCKA 1JDCA 4G9FB 4PRHE 1I85C 4JUTA 1JP5A 1LD9A 1NCBL 3WY4A 4S2SB 5I1HL 2XN9E 4E9YA 4FQ1L 1HHGB 4FZ8L 4PCKA 2VDML 5E08H 3JUZA 3O4LB