2ATAA

Structural basis of dna recognition by p53 tetramers (complex ii)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
197
structure length
197
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis/dna
molecule keywords 5'-D(*AP*AP*GP*GP*CP*AP*TP*GP*CP*CP*TP*T)-3'
publication title Structural Basis of DNA Recognition by p53 Tetramers
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 197
sequence length 197
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ataA00
4IBUA 3WTUA 3EXJA 3VD0A 4L0YA 3IGKA 3QYMA 5A7BA 2VUKA 2ADYA 3WTXA 4IBVA 4AGQA 2BIMA 1HJBC 3Q05A 3WTTA 1LJMA 4IJTA 3D06A 2AHIA 4MZRA 4AGOA 4L0ZA 1TUPA 3WTSA 5AOKA 1EANA 2WGXA 4A63A 4AGLA 2J20A 1HJCA 1GZHC 4AGNA 4GUOA 3TS8A 4G83A 2FEJA 2J1XA 5G4MA 5ABAA 2MEJB 3D07A 1UOLA 2RMNA 3D05A 4AGPA 2OCJA 4GUQA 4L18A 4IBTA 1GZHA 4MZIA 2BIQA 4IBWA 1T4WA 3WTVA 2GEQA 2XWRA 4HJEA 4IBYA 2BIPA 5AOIA 4LOFA 5ECGA 2AC0A 1YCSA 5AOLA 1CMOA 2IOOA 3D09A 4IBSA 2ATAA 5G4OA 5KBDA 2X0UA 3D0AA 5AB9A 3QYNA 5LGYA 3EXLA 5BUAA 1H9DA 2IOMA 2YBGA 3ZMEA 5AOJA 5LAPA 1E50A 3WTYA 4KVPA 1EAOA 1EAQA 5G4NA 3WU1A 1TSRA 2P52A 4LOEA 2J1YA 2BINA 3D08A 3VD1A 1CO1A 2J21A 4G82A 2BIOA 1KZYA 4IBZA 3KMDA 4XR8C 2H1LM 2IOIA 4IBQA 3VD2A 2X0VA 1HU8A 5AOMA 4AGMA 3Q01A 3US0A 1IO4C 2J6WA 3KZ8A 2X0WA 2PCXA 2J1WA 3IGLA 3US1A 2XWCA 4QO1B 4LO9A 3Q06A 2J1ZA 3WTWA
chains in the Genus database with same CATH superfamily
1JDCA 4OR1A 2IDSA 3IRCA 5F7DB 1AGDB 1HH6B 4IOIB 3D85D 5F97E 4UQBA 4HCRH 3G9AB 2NY3C 3VGGA 5BVJA 3EXJA 4XBGA 1LE9A 1G9NC 2DWTA 1DN2A 3AG3B 3L2NA 1A3QA 1FV1B 3LZNA 1UQSB 5DQ9B 4F37F 2YRLA 4ODSH 4DP9X 5C2BL 1WZLA 4LQFL 1FH2A 4P2QA 2YMOA 2VLKB 5FWRA 5AAWA 1VERA 2DTML 5FF6B 3GIZL 1OTTC 1TUPA 5FXCH 3LZQA 5B38B 3KGRA 4MQSB 1ZIAA 3P0GB 1M05B 2OTPA 3U1SL 3QJFB 3SE8L 4XXDA 1JE6A 2VXVH 4IRSA 2GJ6D 1EDYA 3MLXH 3TBTA 4FLRA 3TJPA 1RZFL 3UTPD 2JKTM 2VDLH 1RK0A 2ZOWA 4LVOB 5D1QB 2HFGH 2YGOA 1OSPL 3NVQA 5AEAA 1W0VB 4HGMA 4HZLB 4U6HA 1AD0B 1DBKL 5GGVH 2QT6A 5IVZA 1XSKA 2EC8A 2XKNA 2A4EA 3GSOB 3P73B 4NRXA 4TQEH 2DRUA 5IBUG 3OGCA 1PLGH 3PWVB 3QYCA 3CHSA 4PQXA 3TF4A 3M45A 4J7RA 4N68A 5LO7A 4EXPX 4CGTA 1OAJA 4GW5B 5CBEA 3SKJH 3D0VB 4OI9A 3PGCA 5JDSA 1OM9A 2JLPA 1UJ3C 4MJ4A 5LAXB 1CF1A 3UFIA 4MXWH 1SXAA 2VDNH 2YPLA 4JHAH 3HE7C 4W9ZA 2IAND 4AJ0A 3L3GB 3CFIC 2P28B 3V0AC 3EJTA 1FLRL 1OP5H 2KBGA 1KN2H 5AKRA 1HSBB 4RGND 4MGXA 6FABL 4GMTL 1ZLDA 4NO2A 3FRPA 3DV6B 1M9WA 2IGTA 4RAUA 4TUOA 2ZXCA 1OWRM 4JDTL 2AEPL 5E8EB 1NPUA 4ODTL 3EJYD 4YSSA 1PL3A 3Q3GA 4LLVA 3MJGX 4C8XA 1FYHB 3ESMA 4WTXA 4DVRH 5F0JB 3U46A 1KTBA 1ZVHA 4L3EE 4NDMB 3WN5B 1SHXA 3D18A 4WRLA 4UM9B 3ALPA 3FQYA 1S5HA 2CD0A 4U1KB 4FRWA 1S9XA 5HGAB 5ESVB 3ARFC 3KPTA 1CFVH 3NJMA 3AADB 1PKQA 4JO4H 1XGTA 4LDEB 3ZTJH 1OGTA 1JNHB 3F6IA 3O6FD 1AKJB 2WZ6A 3Q8EA 4C83A 2OI9B 1XMEB 4WWID 3KH4A 5H2BA 2JNZA 4AYGA 2YUVA 3S2CA 3TA3A 5DJ0B 4Z7WB 3QFJB 4X98B 1IFHL 4RWHA 1J1OL 15C8H 2WYZA 5JHDE 4MJ6B 1T21B 2OZNA 4KC3B 1X5FA 4V1DE 4E9TA 3OG4B 2FCBA 3RFZA 1FL3A 3V0EA 1R5IB 4HOMA 5GGVY 4WO4A 2WWOA 3FYIB 1X4ZA 5EZLA 1N4XL 1MFCL 2AK4D 1G6RH 2N1TE 1EANA 3TTSA 3FCUB 5B3JE 1P4BL 1EEZB 4A63A 1DO6A 1MDTA 1E4KC 4RNRA 2PCFA 3M7OA 4PW9A 2X28A 2MCG1 3BKML 4XAKE 4KX8A 1FRGH 3G6AA 3CWGA 3RL1B 4XH2B 1RJZA 2HP4A 2LHAA 4NP4H 2FZ3B 5JXEA 4Q9RL 4UZSA 5LG1A 4JS7A 1OOAA 2EYTA 3ARZA 4MA3B 4TV3A 1GGIL 3ARSA 3QUKB 3FRUA 4QRRB 3M6DA 2Q76B 4XB8A 5BUGA 3A47A 3ECBB 3FMGL 3DX8B 1MLCB 4B9IA 3QEUB 2FT6A 4PMEA 2JLLA 1MCFA 3MOAL 1IKFL 4LCCA 3BDBA 1QPPA 3ZVVA 1Z0NA 3VGAC 3ZRFC 2DZEA 3UPRB 1FPTL 2YFOA 3CZSA 3LNDA 2ZD0A 2CRMA 2J8OA 3O0RL 2IOMA 3S36H 3T2PA 2WO2B 5J6SA 1S7VA 4QT5B 3L3JA 1TPXB 2OXHA 2P5EE 2B7DT 2HFEB 3SGJA 3W38A 1R6VA 5BW7A 3S98A 1XR9A 1JF1A 3CCHA 4XN5A 3J07A 1VFAA 4X8JA 3OHMB 1CO1A 2VZOA 1F3DJ 1GGYA 4XODA 4JFFE 4IU2A 4M7JH 4XMLL 3UX9B 3QFDA 3RP1A 2RGSA 4P2RB 4JFQA 4LL1A 4CBPA 2XUWA 4UI2A 3DX6A 4H88L 4H26A 3IJSA 2YRBA 1OB0A 1MJ7L 3IT8D 3ZKNC 4W4OA 3Q1EA 2K7QA 1ZAGA 4N2KA 5DFAA 2AQ2A 1F6AB 4ODVL 3OKLA 4DKAA 1ZHLA 2W92A 2FSDA 3DSFL 1P7QA 4LASH 4PJ9C 1Q9LA 3W0WB 2X4OA 4DP2X 1OLLA 1QUNA 2WIMA 3HPJA 4ODXA 1CFNB 2OTWB 4HOZA 2I9TA 4ADJA 4ZDHA 1T1YB 2YR3A 2VWEE 2XICA 3HJ0A 4HCFA 4B9ZA 1QHOA 2UZIL 3VRJB 1QZ1A 2FLMA 4A6YB 1WLHA 4BH8A 4JRXA 2BNQD 1QFPA 4DPCX 4K3GA 1CQYA 2QGDA 4JFEB 1K4DB 3CXFA 3PHQB 4XOCA 1FCGA 2CJ3A 3ULAB 4I9XA 4NS0A 4RFOL 1INQB 4I5BB 3O8XB 4PRPD 3GXDA 1H0DA 1CDJA 2LOEA 3NDYE 4Y7OC 1Y6MR 3MRHA 4DP4X 2WWKO 4MCYB 5D5ME 3D50A 3KYMB 1IM9A 4GAGL 1R24B 1ZPLA 3MRIB 2IBGA 1E5YA 1T5KA 2JCCE 4MA8L 3OMZA 2Z4QA 1RKRA 2G9HB 2BNRA 1OTUC 1B4JL 2Y25A 1MEXL 1RV6X 6PCYA 1KTDA 2B3IA 1PMYA 4EUPA 1JZJA 2WUBL 3MRMB 2PYFB 4O9HL 5IOPB 3F7QA 5DJ2A 2XDHA 5C08B 2PABA 5HHMB 1WE5A 1YEJL 2B0SH 3JVFC 3BWAB 4TNEA 4WSKA 3HNTH 5GZOD 2GK0A 2B4CL 4NXKA 4PRAB 3FOMA 3N1MC 4LSDA 5IB5A 3V6OA 4R6UA 3E6FB 4EZMA 5D8JH 3QXAA 3LIZL 2D9QB 5T33H 2GFBB 1WCBB 4KX9A 4K7PX 1WP6A 5KOVC 3H55A 2XZZA 2DKMA 3VTMA 3UPCA 2XN1A 2D9CA 4AT6B 3EG9B 2XQYA 3NIDE 4FABL 3MVSA 5DQJA 5EBGA 3KJ6H 4MX7B 1W2KT 3MYJB 5CNHA 1HNGA 2ICEB 4OJFL 4DP1X 2F68X 2GCYA 2QPSA 4NC1C 2BP0B 4JL1A 1YEHH 4HK3J 3L95A 2R29A 3CHPA 4ZS6D 3RWFB 2CCVA 3K71A 4F9LC 5JW5A 1N67A 3TWYA 3BUTA 4JFOB 3UTSE 3HFFA 3V0WH 1IZKA 1ES0B 3NRFA 3S96A 3TU6A 1CJYA 2OSWA 1V10A 2Z8VC 1FFPA 3KYNA 3WNIA 3W2DH 3DC0A 1ZGLM 2BVTA 4LO9A 4B9KC 5T1LB 5B3NA 3S5YA 3VSQA 1C8QA 2XXMB 3LIZA 3IJYA 2BIHA 3KPQB 1J05B 3OJMB 5IMLB 4NO5A 1P69B 2EYRB 3ZTCC 1QI4A 4ZI8A 4PS4L 1UT1A 3VH8B 1SY6H 3FN0L 4TTDD 4N2EA 5CCJA 4F20A 1EBAA 1RK1B 3DYMA 4H1LH 4MB1A 5M94B 1CK0L 5DZLA 3E7JA 1H3UA 3DOIA 1REIA 4QR7A 5ACLA 4P4RA 4K3EL 2H32A 1W8OA 2P45B 3IFLL 4LLMA 1XDTT 4G7YL 3A4DA 3D5OF 4O2FA 5F9OH 5I1LB 1USZA 1Z3GL 3RI5K 1LEIB 4MJ5B 3K8LA 4PYHA 1C5BH 4AGNA 2VR5A 2P48B 5EN2A 3ZHLA 3L9EA 3RGVA 3QJQB 5LGKA 1YMMA 5C9JA 1OHQA 4TM9A 4X8CA 5AZEH 3AMLA 1SJEB 3BPCA 2OQJB 4N8VA 5DYOB 2X2JA 3WUWG 5IQOA 4ONFH 4MFHA 1D7DA 5IHUH 4JPVH 5T3ZE 3C60B 2XRAL 4LSRH 1QLFA 5AOIA 3G3LA 4Z7WF 2FWLB 4JM2B 2B15A 2EKSA 1CQKA 1NIEA 1FUNA 3VQ2C 4GLRI 1N5YL 1IJNA 4K4KA 4HKJA 4HPOL 3CFUA 4OFYA 1JVOA 1Y6NR 3FFCA 4X5PA 3X13B 5ABZA 3LKOB 5IESL 1XR8B 2XPGB 4JJ5B 3BFOA 1KIRB 5F7NC 5KSAC 1WBZA 1J10A 3VGDA 3U36A 1A6UH 2I27N 3LXAA 1NC2B 2OA9A 3C5JA 2XQBH 4K0OA 4KI5D 1GC1H 1S5IL 2I26N 2QR0B 2WANA 2JKSA 3IGAB 3R06B 3UXFA 1KLFB 2PO6A 5HHOB 3L4VA 4UUJA 4OM1L 5K5YA 3ULUD 2EUZA 3GMPB 2GB2A 2VLMD 1CGVA 2EE9A 1MH5B 4F58L 4WFEE 1WTLA 5AAMC 3TOPA 1KEMH 2ATPB 2BVOB 4JL2A 4KUCF 3QG6B 5L8LB 3SDAB 4OZGB 3ZHKA 1MFEH 4FNPA 2F1BA 3VXMB 3GF8A 3WEMA 4XT1C 2SEBB 2C8NA 4LGSB 1CCZA 1KXTA 3D3VD 3FH8A 1A2YA 2VXUL 1YYMH 2QHRH 5MENA 4S0TD 2YPVH 2XTJE 3JV6A 3VFOB 1I1RA 1MIEL 3FTWA 1QSEA 4NPYB 3SYQA 2EE3A 3Q6GH 4UWQB 1YUHA 2DQUL 1IILE 4KGLA 2OJZH 4LARL 5DEFA 1MLBB 4IEFB 2I7OA 3MRFB 1R5VA 2IAMD 3KG5A 4MBOA 1MWAH 3LNIA 1XT5A 4XTRD 1FFOA 5BZWA 2WQUA 1L5GA 4OVVA 4V2CB 4RX4A 3V52H 1AZBA 2H0EA 1KPUA 4ZW5A 1B3IA 2X88A 4AYID 3CBRA 2ZG1A 1D3CA 1UASA 1UA3A 3MTXA 2DQIH 1G1YA 4YS4A 2EAEA 3GJEB 5SWZA 4OZIB 4PRIB 2XN9A 3EYSL 1KJ3L 1ZVSA 3S3DB 1SJHA 1UYWL 1I82A 1X9QA 3GI8L 3BKYH 4MBRA 4Y5VC 4EVNA 5TTRA 1HJCA 4R9HA 1VIWA 1XF1A 1P5UA 2ADJB 2J8UB 3QEGH 4HC1L 1CXLA 5AUMB 1RJYA 2DWYA 3AY4A 4QWWD 5TH2B 4WUUA 3GSUB 3L3IB 2OZ4L 3WEXB 5J13C 1IMHC 3PGDB 3FQTB 2NY5C 3O4LA 3GPEA 2FEDD 3G5VA 4NYLB 3VFPA 3U0PA 3L3OC 4G8EB 1SEBB 3Q44A 5KVMC 2QVTA 2OMYA 4YXKL 1OGAA 5FYKL 4XNZB 3UYPB 1COBA 3SJVD 1UM5H 4PWGA 1TSHA 2BDNL 3FQ1A 5ID1A 2BOLA 2NY3B 4F33A 3HRZA 2VDQH 3D09A 3IPEA 4W70A 4URKA 2HJFA 1ACXA 2IXQA 3BDXA 4X6DA 1EUTA 5GS2D 3S5LA 4ODSL 4U1NA 2FE0A 3EF7A 3PHSA 4I9WE 3FUNA 4ZOBA 5T3ZH 1FNHA 2ZWYA 1NFDB 1R0AL 4PBVC 3W39B 5IFJB 1KTLB 1G4MA 5KYYB 4HA1A 1A6AA 2A73A 2MCMA 5GJTH 1XH0A 5H8DA 2Z0BA 3A6BL 3AWFA 4RBPK 3N2JA 2YOAA 1FORL 1LMIA 1D5XA 3H0TA 1QFUH 2DWEA 2XWJA 4OKVA 5CMAA 2OZ4A 5INCA 4G6JH 4AQZA 1OKEA 1CWVA 1Q72L 4AX3A 4IMKA 4Y4HD 3HE6D 3MRKA 5J1AB 2A0LC 3A23A 3BIAX 4Z7QB 3UZQA 1X5GA 3U82B 1ZA3A 2CR0A 3PWPB 4PVBA 3DTXB 3PJSA 4A2FA 5K59F 3LKNA 2AXWA 5E9NA 3N1FC 3I2CL 2BRRH 2W0LA 1KY6A 5HI4C 3MXVH 4DTGH 1BQRA 4ALAC 1QRND 3N5AA 3MRBB 2HVKA 5H94A 1AQDA 3E9TA 4CC1A 1NCIA 5IB1B 3CTTA 4P2OC 3EJQA 2ZPKH 2QSCL 3ZKSD 4LRIA 1UJ3B 1EFXD 4QCIA 2C3VB 4B5EA 1U58A 2K6ZA 4MD0A 4NCC2 4PY8J 2ICCA 4ICWA 4Q8BA 4BFIB 4HX1B 5CAYB 3EDKA 4HKZA 4HLJA 1U8JB 3JVGA 4E9YA 3QIBA 1MREH 3HE7B 4E41B 3SPVA 3VMPA 4MSWA 3TEWA 4X83A 3B83A 2K6YA 1W0YT 4AEIL 2Q86B 3FQRB 3MC0A 4HEPG 3ESNA 2F8OA 5EOTA 4DPBX 1PZAA 3CSPA 3HC0A 3HUJE 5FX3A 3P0VH 3VD4A 4F5CE 5I1AA 3TBWB 5CEZD 1UT2A 4OKDA 3FU7B 4GQPH 4H25A 5BNXD 3QUYA 5TK4A 3DOSA 3ENEA 2J1KA 4OLXH 1HL5A 2DKSA 4W9HC 2FEJA 5F3BB 4L3FA 3GINA 4DVRL 1S9KC 1F4XH 1HL8A 2CDGA 5LQBL 2F53B 2VRQA 1TNNA 2MNUA 3QPQD 5F7YC 3TIEB 2FWUA 2GEQA 3K2UL 2XWRA 3WY4A 4JY4B 3NCYP 3Q8BA 1JCVA 3RBGA 3VFRA 1KN4L 3GSNH 5I5MA 2X3BA 3V2AR 4GI6A 2FJGA 2G4GA 5DWPA 2C9SA 2GJRA 1FVCA 5D9SB 1QHPA 3MBEA 1MCBA 2L0DA 2GUOB 1MIMH 4GS7B 2RTTA 4BK4A 1ZPUA 4OF6A 1A1MB 1LK3H 5GHWH 1OM3H 1NBVH 4YC2C 3Q0HA 4LOUC 1BAGA 3DBSA 5BUAA 2WYTA 2VN6A 4MJID 5FYKU 3VGFA 1WS7A 5ANME 1DJIA 3UOAB 43C9A 5IWLC 1TKWB 2FATL 4XVSH 4G7VH 1CF8L 3SE4A 4UQ2A 4I48B 3V4PB 5IM7B 5JORB 3VFMB 4LLQB 4J39A 4I77L 2YUXA 1XTLA 4YSRA 3AQZA 3X14A 3D33A 2QQKL 2NXZB 3BH8B 1E43A 2R23A 3ETSA 1TEFA 2BZCA 4WW1B 3WLBB 2EZ0C 3GMLA 1M7IA 5C0NC 1YEGL 3EYOB 4H2CA 3DURB 3GM8A 4TTDC 4JCLA 5DJ6B 1YPZE 3QDMA 3HFMH 1JN6B 4LKXA 3HLKA 4IDJL 4JM2F 4HUVA 3LHPH 3OGOE 5CLTA 4S11A 2E4FA 1O7DE 1MI5B 2W91A 2APVA 5TPWH 5E94B 4WI4A 2IPTL 4M43L 5DC4B 4GRWB 4GSXA 4Z3HA 4HD5A 3EGDA 2P8MA 5K69A 1T0NB 2VZSA 2FWSA 4APQD 4TSAL 1X6NA 3VGAB 3HPLB 4MD5B 2ZKYA 1CT8B 1KJVA 4PWEA 5HHPB 2BNUA 3OKOA 4ZFZA 3V6FB 2K45A 3K2KA 4TVUA 2ZXDA 3ZRSA 3S36L 1T1ZB 3VSTA 4MMZC 3NEOA 3CD4A 1CVSC 3FONA 4GH7B 4LAQH 3NPSC 1BQSA 3HZVB 5FGBC 5JR1H 3S8GB 1O7VA 4FQXA 2HB0A 4JRYA 2AJZB 2BP3A 5J4MA 2MCPH 1E9PA 3Q5TA 3ZE2E 1TVHB 4HLZG 4Y5XC 4DW2L 5EIIA 4HFWB 4WKXA 1U42A 2G3ZA 4Y88A 5E5MB 1LD9B 3N1GC 2EADA 1DQLL 4KI5C 1BVNP 4Y5YA 1DQIA 1R47A 1HH9B 3MODL 1DDHA 2ZE0A 3GJFB 1UH4A 5CSZB 1N10A 5K39A 3IVKB 1SN5A 4GY4A 3Q2NA 2W9EH 4PJ9B 5KSUA 2X70A 1W6LA 1WBYB 4A68A 1KB9K 3ALWA 2LQRA 2D7MA 4IS6B 1OP5K 4WFFE 1NFAA 1C5CL 5G5DB 1NUGA 4LLAA 2VIRB 3IETB 3NP4A 4BFKA 2M2DA 3GQFA 1HOEA 5F96L 5GZNA 1ETZA 1UXSB 1L9OA 3CZUB 3HC4L 1W72H 5HDLA 4ETQA 1QLEL 5LDUA 4OZIF 1CGUA 1U0QA 3SYCA 2OMNA 1QTPA 3L81A 4U7MA 4F24A 3L45A 3L1EA 4QHLA 2A77L 4HUNB 1D2PA 4D0BA 2VR4A 2FX8L 5HVGB 4I18B 4QXUH 5GGUB 1TETH 1TEYA 2J8UF 4G11A 4IOSA 4I0CC 4NQUA 4NZUH 2VJ8A 1XIWA 2IAMC 2FLBT 5CIPA 2VSCA 2VDRH 2Q2LA 2PP9A 3BEWA 2Z92A 3L1OH 2VC2L 3SHSA 5T3XH 3S6CA 4GRMB 2BW5A 1KGJA 3BP4B 4XTRC 2L3BA 1NZRA 3BDYH 2X1XR 3R18A 4UV4L 4AOFA 5HGHB 1SUHA 5D1ZB 3ULVE 3DSNA 4WI7A 2VXSH 3TP4A 3WY2A 3ZIYA 3H53A 2OTUA 4BCZA 1R19A 4I2XE 1VACB 3O6KL 1U2YA 2IGFL 2BFVL 4N87A 1ZT4A 1JNLL 2AQ3A 2I85A 3FBQA 1WZMA 2EO1A 3KPSE 1NCDH 2WAQA 4HJ0D 4WNQA 5I75B 3FCSA 1NFDF 2C9VA 1XF4A 2Z64C 1B6DA 3P9WB 4YBLC 1C7TA 2WV3A 4B7IA 1GHFH 1EO5A 1T5XB 3LN4A 4J3OH 2AJVL 2EXYD 3H9SA 3RY5A 4F8NA 1XF3A 3ES6B 2V8MA 3GSXB 3U7AA 2FEDC 4XN2A 1KPVB 4FNTA 1P53A 3UAEA 1CI3M 3B2VL 1TYRA 2WVSA 4PJIB 2W0FA 3ULSA 3U2SA 2F0CA 4HIJA 3D85B 1JHLH 3SIKA 3K3QA 3A6CL 4Z7QF 4AGLA 1Q9OB 1CU4H 3QUZD 2CCLA 3AGWA 3EJCA 3C6SB 2H45A 4PJDB 2W60B 1WAAA 2L7JA 3TPKA 4PLNC 1L7IH 2ED8A 2VABB 3G5ZA 2VTFA 3WHE0 4JPSA 3BKJH 5SWQA 2JQMA 4QI3A 4AQEB 5IFHH 2GJ6B 2XACC 4UBDC 5EUOA 3HI5H 5K9QG 3KXFE 3QQNA 2F7IA 3HE6C 4Y4HC 1L0YA 1OO2A 2FBJL 5DFVD 2F54D 2Z1KA 2ADGB 4BQBA 5BRPA 3ETBF 1RIHL 3O0LA 2PW2B 1NL0H 4P5RA 1NJ9B 4V33A 4OLZL 4Z5RB 1FI8C 4OF3A 3FU5A 2PP8A 1DSFL 2I60L 4LCWE 4PRHE 4B60A 1E5ZA 1W6WA 2WXPA 4TYUA 3GFUA 4MDIA 4AYFB 3IKCA 3CLWA 4XOAA 1DBBH 2GTZA 2AEOA 3BGMB 3KWVA 3O2DH 1AGCA 4KROD 3CZGA 3K4AA 1EZVY 2VZTA 5TFSH 5CEYB 1JUFB 3F7VB 3P9LA 1F4YH 4P5SA 3QO0B 5TQ2L 3PQYD 3CFKB 2IANB 3CZJA 3I3BA 3QDHA 4X6EB 4P4KA 1H3GA 4PJHB 4GFTB 5DMIH 2CDEA 3WN6A 4AGMA 4MQTB 5EZJA 2OK0L 3MV9E 4XMKL 4CW1B 1GSKA 1KLGA 4U1HB 4B96A 4ISVB 2A9ML 3KH3A 4OQTL 3RY4A 1JGVH 1IQDB 1CGSL 1WQVT 3MXWL 4BZ1H 5D7SH 1BVOA 4DZBA 5CJOL 5AWNL 5T5NF 4ZRGA 1IC0A 5DR5L 3W11C 3NH7H 2J5WA 1DUYB 5KSAB 1T2QH 3DO7A 2W81C 5DRZB 3ULVH 3KHQA 2X89D 5IW1A 4OGYL 3IFNH 4ZO8A 4ZPTA 1JHTA 4XNMA 2XCMC 1R3HA 4L8BB 3DRQA 4QXTB 3EUDA 4FXLA 1RZKL 2LFGA 3QWRA 2F5BH 1CZ8H 1IEBA 1ID2A 1AE6H 3EZJB 1MJJA 3MZTA 1IGYB 2ADIB 5C0CE 4UYQA 7FABL 1XXDC 3ARQA 4Q6YA 5LBSH 3UMNA 3JTTB 2HN7B 1TQCB 4M6NH 3RWDB 4KOBA 1JMXA 1MAML 1A8JH 3BESR 4GRWF 1WIOA 3MLWL 2GT9A 1RZ8B 4P06A 1PX3A 4YDVB 1J5OH 2IDTA 2AK4B 4RIRA 2G2PA 4UMGA 3TASA 1HI6B 1ZOXA 3I50L 3LTVA 4JFXB 1BVZA 1MRDL 1U2CA 3VX0A 5ESQA 5I17B 3SQOH 3NRQA 4JY6A 3SDDC 2PNDA 1ORQB 3L4ZA 5D4HA 4KTGA 2XZAH 3NA9H 4ZSOE 3FN9A 4C4BA 2EEXA 3VXPB 4BBWA 1FN4B 4BM7A 1MCWW 4UOW1 4JFTA 3QDAA 4M9PA 3RZCA 1ZANL 4FADA 2IALB 4XVUD 4BWUA 4WKZB 3A67H 1WA0X 3L7EA 4U4BA 4YAQB 3HAEB 1DN0A 1FBIH 4IMLA 1BM7A 1S3RA 4NQDD 3VWJA 5C0AB 3NJIA 4C47A 1IGTA 5DK0A 2Y7QB 3BIKB 5CZRA 3GRGA 4KV5F 2YLHA 2VLJE 4APQC 2XC8A 1CFMA 3B7TA 4NJ9L 4Y5VB 4KVNL 1V7NL 4WUUE 1UA6L 2EDXA 4M61A 1NOLA 2GJZB 1A8ZA 3HI1A 3GDBA 2MKLC 1F2XK 2OJEB 1RU9H 3MV7A 1IKNC 5J13B 3U79A 4DN4H 3IDJB 2VISA 2YPVA 3TNMB 1V55B 1UCTA 3HI6H 2CO6B 4YHKH 2NQ3A 3RHWF 1MFBL 3L3OB 3RWIA 1H5BC 1IO4C 3MRJA 1CUOA 2PPEA 1NEPA 2JB6B 3ABKB 4UQDA 2R2BB 1IGIL 4AUJA 1CBVL 4GYBA 4WI6A 1L9RA 5JQIB 4XXWC 3AGVA 1PAMA 3S3BB 4IIZA 4LL4A 4X6DE 4BUGA 5CEXA 5JYMA 1NIDA 4OT1L 4OM0L 4OZFG 4NUJB 1NSNL 1A4JB 4XO8A 1AANA 4Y9EA 2FR4A 2CGZA 2TRYA 3F00A 3LRMA 5IG7B 3MJ7B 2H0FA 1SXBA 5J1TC 2Z7WA 4JKWA 4TUJA 3VFWA 2R27A 3VFNB 1URLA 5EEUA 1OZUA 5FKPB 4HULB 5BRZA 3NSJA 5I1IL 2KPNA 5E8DL 1Z32X 2OL3L 1P2CA 2XNAB 2GSIA 2IWKA 4CDHA 4XOEA 5FYKE 2BNQB 4XVJL 5I76A 1NOFA 1UC6A 5BS0A 4NKOB 2FB4H 1IAMA 4JKMA 5JPNC 2L7UA 3W82A 4X7FC 1FSKB 5I66B 4OTXH 3ZUNC 1E5CA 1I8LC 3D69A 1SDAB 4F93B 4PRPB 3ASWA 3S34H 4O02B 4RMBA 1U9KA 5IJVB 1BG1A 3H8NA 5A3ID 3D12B 2NNRA 2YBRA 3O2WL 1DEEA 2ILLA 3O2VL 5C71A 5HHQB 1BF5A 1SN0A 1T22B 4AENB 3QZMA 3RRQA 3RE0A 3VYPA 4P2OB 4EF3A 4MA7L 3AS0A 2BRQA 2VDOL 4OCRL 5HJDA 1X4YA 3C8KB 4PCKA 3UTOA 1QEWB 3QUMB 3QZWG 4Y4KA 1U8CA 4XCCH 2W5PA 1QKZL 3E3QE 4Z76A 3GUTA 5FGSA 3MR9A 4PJIF 1V7ML 2P26A 3B9KC 4J4PA 4K07A 3JZYA 3P3SA 4LXFA 2F58H 4R7VA 1G9MH 3ZT7A 1BZOA 2OL3A 3EADA 4L29B 3P1VA 4DUXA 4WW2C 4ZTEA 3TFBA 3D0LA 1E30A 3LMJH 1F11A 3O9WD 4YHNA 3K4DA 3WIFA 5CN3A 3C87A 2AV1A 2H1PH 1Z9SB 4PJDF 4HJ0C 1AIFA 3F65A 3FH7A 5T1JA 1BQHA 1T89A 1FYTD 2DV6A 2O5ZL 3EO0B 1KG0B 4HW6A 3UZEA 1HHKB 1D5IH 2EXYC 2DD8L 4N22A 5HDBE 4X9GA 1Q38A 3QXDA 4HOXA 1JI1A 3DO3A 3QI9D 1ZRUA 3RWEA 4FMKA 1DANU 1NWOA 1E9OA 5DMGD 3AITA 2IH1B 5GISL 3FF8A 3UMTA 4EAEA 1LHZA 1BM3H 3ZKMC 3ISYA 4R2GC 2VLKE 3W37A 2JVUA 2YD9A 1OGSA 3N55A 5CXPA 3GSQA 1QZNA 1G84A 3QUZC 2VXQH 1WVZA 4N0UB 5ITBL 4Q2ZB 1QSFE 1VLXA 3WFEL 1T80A 3QYMA 4YC2B 3RVWC 4PLOB 1JERA 4KKZA 5KTEL 1MAKA 2ZUQC 4MDJA 2Q7AA 3SGDH 5DK2B 2BVPB 1I8MA 4JKPL 2F15A 2V9UA 5D1QE 3FO0L 2DQTL 3NACH 4M1DL 1PBYA 2VAJA 3ARBA 4YSAA 1S7UB 4KPHH 1TQBC 2WAHA 2DM7A 1AO7D 1I3RA 1RFDL 1NUDA 4TXVB 1MHPL 3MO1A 3MMEA 3N40P 2KDGA 4CU8A 1KELL 1JXDA 4PLKC 4XPGL 4LSVH 1IAKA 1R3LB 3UO1H 1DJWA 4PJHF 2H3NB 3TT3L 3OXRA 1BIIB 1KIQB 2VR3A 2RD0A 2ZWLT 1SFHA 4P3CH 3MN8A 3GSNA 5AZ2H 4D9LL 5C0DB 3HMWL 4KJPD 4FFYH 4HEMA 2AK1L 5IJBC 3TX4A 3W56A 1J88A 4DKFH 1FNFA 4AL8C 5EOCH 3EO1A 3OKYA 5DLMH 3ZQXA 1TJGH 4HDIA 3GGWA 3L5HA 2FIKB 3HG3A 3L2LA 4LSTH 1RUAH 1PDKA 4U6YA 5E1AB 3ILQD 5D7IB 4RFNC 1BWMA 4D9RE 5I5RA 4L3ED 3EYVA 5LCVL 5B7MA 1MW0A 5K9OB 2CK0H 4G2AA 3ZL4H 3LPGA 5DZVA 2H3XC 2O30A 1JGEB 3FQXB 3FTVA 2X4SB 3PDOB 4G42B 4MMZB 5E8OB 5FA3A 3BPLC 1AS8A 1YJDL 3RWHA 5I15H 5ITFA 4YK4C 2G30A 5EU5B 1OXYA 2Q6WA 3OG6B 2UUDH 4LCVA 5CR8A 3LPWA 4Z3FA 3K6SB 5FO7B 1X4XA 2MCPL 2Q8AH 4JG0L 4DAGH 2NTFA 4KDWA 1JWUA 4GBXD 3Q48A 1H9VA 3V5DA 2V3FA 4ZMZA 4IU3A 2G5UA 1JPSL 5L88L 2EIMB 4JK0D 1NCTA 3GB7B 3ECVA 3X1FA 3LZLA 4OGXL 2B8OT 3GDCA 3N42F 4V1DD 2FEEL 4TOYH 4Z7WE 1N64L 4GAJL 3LSOA 1LO3H 1THCA 2H6OA 3NABL 4GLRH 2FQGA 2V17L 1I9RH 2JI3A 4QYOB 5EIVA 4IGBD 1E4XI 4JBSA 3SBRA 2QPDB 5AYUH 4QNPF 3TNNA 3WE6A 3TEZA 5LCVA 2AGJH 3LD8C 1P6AB 2FH6A 4I0PD 1I53A 2YO3A 5KW9H 5I30L 3PAZA 4XAKD 5DD5H 3UL4A 4UOJA 3K6OA 5E9AA 5HJ3B 1OIOA 5DD1L 3D3VB 1TQUA 3PL6D 2ODIA 2X6BA 4W9JC 3ZYOA 1DVFC 1T04B 1YNKL 4QXVA 3DJTA 3PDGA 1FVDA 4WGKA 1JPEA 1CXKA 3T6ZA 1RUML 1MCPL 4BSJA 1B0GA 1ECYA 4FTVD 1MCSA 2QLYA 5GPRA 1CDBA 3SO3C 4LLUA 3S35H 5IQ7L 5E24E 2WNGA 3AM8C 1CDYA 2PXYA 3EZ8A 3QCTH 3S4SG 4P9HC 4LDCA 3BYTA 2ZCHH 4XN8A 2XFGB 2IAMB 3BQUD 3X1EA 4CSZA 5DVLA 4EE2A 4F8PA 2GABA 4UM8B 2GYSA 3RB5A 3RZWA 2CO3A 4ZFQA 2F2HA 4JG5A 2F7RA 1FZJA 1BAFH 3MOBH 1ROWA 4NB7A 1KGYE 1XGYH 4NRYB 4EIZC 4XVUC 4CMMA 4NKMB 1Q9WB 1OTSC 2P5ED 2QEJA 3MJ8B 3JV5A 3N43B 5ICYA 2VZ1A 2UX6A 2CUAA 3LAFA 4YDJB 2P5WE 5FS5A 4MS6A 4Z7VA 3NN8B 4ZNEA 1RCYA 3GMQA 4KRNA 3VAEA 2FTAA 3V0GA 4JPKL 5CUSL 4NUQA 2IV8A 2FT7A 4F7EA 4JFFD 5AD0B 3ALXA 4J8RA 5TE6L 4DVBA 3ROOA 1JYWA 4UDTA 4YBLB 3GLAA 1M7DA 1IAIL 2N3JA 4Y8AA 4AVKA 1IKOP 4PGDA 1JTOA 1NGZB 3GXMA 1A4BA 1E65A 2D2CC 2DL9A 4A1RA 2DYPA 2OM5A 5LAPA 3B4NA 3F12A 5HY9A 1A1NB 1PLBA 2HMID 4FL4C 5T1KD 3VJ6A 1QLRB 2CCWA 2J6EH 3ARUA 2IDQA 3P4NA 5F7BA 3SJVB 2HFTA 2C7UB 2WZPA 5T1DH 2A83A 3JXAA 4ZMWA 2VM3A 1A21A 4MLIA 4L4TA 2WLKA 1CLCA 4HQQL 1TENA 5I6LA 4HGWA 2WUCH 5IHZA 4YUEH 3S37L 5FOBA 2BIOA 1N19A 1CICC 2ZCZA 1U3NA 4Y1AE 5IHBA 4JY5H 3QA3A 5DJDB 5F1NB 4PREB 2R9HC 4HUXB 3CVHB 4JFEE 2EEFA 2FWOB 2QELA 4N9GA 3T4AC 2ZKXA 1RHHA 4NNYA 5CP3H 3ROLB 4RGOH 5DS1A 1DUZA 2FLRT 4JG9A 2OFQA 5EUOE 2ZXGA 2WZAA 5MEOB 2I5YL 2Y36H 3MROB 4CJ1A 3TGXA 5F1IA 3NZ8B 1T0MB 2Q0ZX 4NN5C 4Y4HB 3HE6B 3FNKA 4GRLA 1BF2A 2X6MA 4XO4A 3IMBA 1YEEL 4MB3A 1DLFL 3SODB 1P9MC 3F7YA 2XV2A 5FFLA 2OSXA 4TLTA 1EGJL 2AVGA 2M83A 2RIKA 4CC0A 4S0SD 3Q05A 3IXAA 3LKSB 5A2JH 3FS9A 5DMKB 2M1KA 2IPKB 1MHHB 3LIUA 3WFBH 1QRNB 3BVTA 3X11B 3FSVA 2BSRB 4D94A 2WSDA 1JV2B 5HHME 5D7JC 5ERWA 4LT7A 2WGXA 3C6LD 1EFXB 1ZLUH 2MIZA 1QFHA 5JOPD 1MCIA 4KZDL 1UUNA 1S7RB 2DM2A 3NEEA 1JPTL 5FB8A 5K59E 4PBDA 2CZNA 4AVIA 4CU7A 4XC1H 5G4MA 5D7KE 4DPRA 4X6BB 1MRCL 1O9ZA 1CFTA 4AQ8A 3CSYB 3GSWB 1Z5HA 3B3IB 4FFWC 1MCWM 4DGYH 4J1UA 1KXVC 3GSRA 3V5HB 2AQSA 5AKTA 1A47A 2PW1A 3UC0L 1ASQA 4HHAA 5ALBH 3QH3B 4PP2A 4QTIL 1FC2D 4W1TA 3TBSB 1QVOA 1A6VL 4XPTH 3KWUA 4YPJA 4AV5A 1BD2A 4NC2B 3NJFA 3QDJA 4NFDA 4DETA 5EU6E 3GO1L 2X9WA 5K9JL 2JSFA 4L3CB 3FCBA 4AJYV 3CNKA 4PJ8D 4UT6L 4UNUA 3OXSA 3PAUA 5BXFA 5D7LA 4FJYA 3PWJA 2C1OB 5DMGC 3B2MA 3TURA 2WXRA 3I02B 4BSVA 5HYSB 3WTYA 2PMZA 2R8SH 5CLYA 1M6OA 3LRHA 4CC4C 3BCFA 3NDZE 1Z5YD 2COVD 3KS0H 4ZW3A 4N90E 4EN3D 5LKNA 1SHMA 4YE4L 1DJYA 1SHWA 3JZ7A 3QIUA 1E8ZA 1G6VK 2K6WA 4FLQA 5IMKA 3CZLA 1EAPB 2YWZA 2NZ1A 4TRPH 1JZDC 2GTWB 4QGTA 2ICWA 2NR6D 4UTCA 3VACA 4PWJA 5CINL 4XMXA 4MJIB 5LBSL 3GSVB 1S7WA 2A6IA 3RWCA 5KSVB 2Z93A 4GI9A 3V8OA 4I87A 3RURA 4AV4A 4D0DB 2DWDB 3L5XL 4BZ1A 1JTTA 3MLZH 1PLAA 2CLVA 2FIRT 3RUGA 1KJMA 1E5AA 2YRZA 1CL7I 2ZOKA 4HIXL 5BQ7B 2WQSA 3NCXA 1XZ0A 3US1A 1YA5A 2MNWA 3HNSL 3DROA 3EBHA 1RIVH 4Z8FL 4TVPL 3SDDB 4WWNA 1JFQL 3WENA 3MBXH 5LNEA 4A6YH 4S1SL 4KMTL 3UCRA 3M07A 2ORBH 4O4YL 4L0YA 3QORA 1P4UA 2QLVB 2XG4A 4XP1L 3DVGA 5DU7A 2BSSA 5ISZE 1KB5B 1ZE3C 1IQWH 3EGSA 3RILA 3ZJAA 1TZHA 4JCMA 3MLVH 3MLTB 2B16A 3CBJB 2PWFA 1SLUA 2NPLX 5T3ZD 2HLEB 4YO0A 3GK8H 1OCWH 3HZ3A 5LBSA 1OOWA 4KI5F 1NGYA 4APQB 4OF8A 5F9WC 1B90A 1RZJL 1CLYH 3ILQC 1ET5A 5KYUA 1TQWA 3MV7E 1D9KD 4HAKA 2ZCLH 1RP8A 3NJJA 4QHPA 5DJAA 4X4ZA 1RPQA 3EYFB 5SWSB 5KSBE 1BFOB 3EHBD 3H4FA 1X5HA 5INDB 3G5YB 2ERJC 3HZKA 2D4FA 1A6TA 1AXSA 1G7QB 5JPMA 2FGZA 4YHKL 4RMUA 1H5BB 2YC1A 4BKSC 3Q13A 2OMVB 2X41A 2RALA 2F8VA 1EHAA 1T1XA 3C9NA 3KLSA 4GBXC 4WFED 3UTTB 1JZ6A 3MKGA 2J4WH 4IHOB 1GJWA 1ZV2A 5HTSA 1E7VA 4ENEC 4YHLL 2ZOLA 2Y1ZA 3UDWC 4YR6B 1CYGA 4AWJC 4BA8A 5ADOH 1F42A 3FJTA 3V4VL 1WA1X 3I6SA 1S46A 3OKNB 3U6XS 1NFIA 1EEUA 1HCYA 3GHBL 2WWMD 3KPRB 3L3DB 1L0QA 2QMKA 1KNOB 5CP7B 5GS0D 1IGFL 3EDDA 4UQ3A 4UOZA 4IGBC 5JTWA 4QKTA 4NRZA 1R3IH 3BZEA 1NGPL 2XTJD 3DGDA 3L16A 1EZUA 3GBMH 4UILH 3O3AB 4QHMB 2EYSA 2JQAA 4XCYB 1HSAB 2IBZY 4LOVA 3BSZL 4FULA 2CJUH 3CFDB 3FT0A 2WOYA 3K2MC 4OCWL 5L9DH 4PB0L 2QFPA 4NM4H 3FU8A 4M93C 5C97A 1SYVB 3FT2B 5KVGH 5JPNB 1RJLB 3PL6C 5DHXB 4TF4A 3N43F 3QQDB 1BFVL 4MMXB 4Y4FC 1NMAH 4P46A 3G7TA 1ZHNA 2AMUA 2WXLA 2EDEA 5DWUH 3DRTA 1RURL 4X7TB 1RMFH 3HHMA 5IKCB 4XBEL 5D2NE 3OF6A 3ESPA 4FXKC 1MQKH 1EXGA 3DUSB 3V4VA 3SOBH 4QY8A 3VWKA 2JE8A 1CIUA 4JFPA 2NSXA 4Y2DA 6TAAA 5L7XL 4JN1L 1M57B 4KXBA 3A24A 4WEEA 3VFVB 4NZTL 4D8PA 4QOKE 3QJRB 3CH1A 3GLEA 5CGBA 2WZ5A 2XWZA 3K5RA 2DMBA 5I18H 1UD6A 4AYSA 4OUUB 2J8UE 1UACL 4OGAC 4HMEA 2DOCA 2FX9L 3SQBB 4F7TA 4WW2B 4AJVA 3WNNA 1J8HA 3BEVB 3GMRA 5F1SA 2VJ0A 1K5NB 4BV1A 5I6KA 4PJFE 3GMNB 4NT6A 4Z3GA 2X4TA 3MRPB 4LSSL 3MNWB 3QC6X 4PRNA 4W6YB 1DL7L 3N91A 3MUZ1 4HOWA 3BWZA 5ENWB 3O6LL 4GUOA 2A4ZA 3MUY1 2ALAA 4X5WB 1A7OH 1D5IL 4JNXA 1CL7L 1M3JA 4WU5B 4LPUA 2MOGA 3IGFA 3UJTL 1DBML 1KFGA 3X12A 2APWA 5JQHC 4ANWA 2CLRA 1CTMA 3GZOA 5KVDL 4G1MB 4OF5A 1I8IB 1OE3A 2PUQT 1N7MH 1FL5A 1NFDE 4P57A 4R2GB 5B1JC 5ILTH 3CX2A 4LHQB 5J8OA 3OKMA 2VWEC 3WUWB 3U9UB 4F8TA 1F1GA 4JQXA 4XXCC 3QUZB 4FQQA 3A22A 4H7VA 3UGXA 3M1OA 3D0AA 4X5RA 2ZUQB 1RLWA 1RZIB 4XB7A 4LSPL 2VR7A 3GS4A 4UV7H 1UXWB 3RBSA 3EFOA 3BX7C 3PFUA 1WWBX 1YC7A 5D6CA 5E0QA 4Z7QE 5BMFL 2ESVB 3IXTA 1T20B 3NACL 1IGJA 1PZ5B 1TQBB 3PWPE 4GQQA 1MVYA 1BOGB 3L9BA 1A1OB 1DJZA 5JOFB 2ZOOA 2LR4A 3H9HA 4BH7B 5F9JA 5EF3A 1T0OA 2CO7A 2F54B 3QDGA 1YLBB 4DZ8A 2YPLD 3F2LA 2HKAA 3MCG1 4FP8L 1IT9H 3VX1A 2AQPA 1SXCA 1AGFB 4HEME 3P3TA 4IRJC 1OF2B 2FX7H 2YXWA 4O00A 4Q9CA 4NJAH 1BWWA 4X5XA 3RVTD 1C7SA 3UAJD 1MW3A 1WBXA 5C0IB 2NRDA 3WJLC 4YHIA 4E41E 1KT2B 2E9BA 2VXQA 3FO1B 1KLUA 4HK0B 2K9UA 3P4MB 1JBJA 4KDTA 1VFBB 4QHNB 3B9VA 3ZE0B 2RACA 3T4YA 3VQLA 1J86A 4IBUA 1KTKE 5FV1L 2J7LA 4BRJA 2CNYA 3KCPB 4N24A 4G8FA 4RFNB 3VD0A 3IMTA 2C7FA 4ZUUA 1G7MA 2AJYH 3WAKA 1U8PB 1JTPA 4XP6L 4U3XA 3EBAA 4YHPA 3U4AA 3MUUA 4FFZH 3TVMA 5I8CA 2WLZA 4HIEB 3BPLB 2JTDA 1XL6A 5DMYA 3T1WA 2Z65C 3L5WB 3ZZQA 4YK4B 1XQ4A 1T5WA 5BZDA 4YN3A 4K73A 4FQJL 2F53E 3PHOA 1I7ZB 1BBDH 1JGLL 1IBBA 5DD0L 3CHRA 3AUVA 2Z35A 3LZPA 3IS1X 1A7NL 2OX5B 1CN4A 3OKKA 2VDKL 2EXSA 3TA3D 1WK0A 4M7KL 2P3YA 3BXNA 5JNYB 4C59B 3U6XA 3ZU8A 2HA1A 1X9LA 1U6AL 1C1EL 4PGCA 3BP5B 4W81A 5KUKA 1FNAA 5G2NA 3ARGA 4PJBE 2FL5A 3JWOL 2JJTC 2HJLA 5E4IA 3FZUD 4WV1C 2GBVA 5DZAA 1GY1A 4F57L 3DJSA 4WHYG 3IDNB 2CKBL 5IGXH 1F6FB 1BVKB 1QASA 1S7QA 4UU9A 4KK8D 5F7KC 4EN3C 3EJUA 5MP6L 4H0GA 4NN6C 1BXVA 2I25N 4JDVA 3T0EC 3TYGL 3LD8B 1XL4A 3QJOA 2G2NA 1F02I 3IF1B 4I3SH 2R15A 1O7SA 1G9NH 4N0YL 1WISA 2MPAH 4KNUA 3QRFM 3N85H 5DVPA 3V5KA 1G87A 5FUOH 1QNZH 3ET9F 4AEEA 3AAZA 2P80A 2DQFB 4YXHH 5HYJA 2BHFA 2R4SH 3S8FB 4XAWL 2BCMA 2FUTA 1ADQL 4G8GE 4KUZH 3RI5F 2VITA 2W65B 5HYQB 2XXGA 3ZMEA 4OSUL 4JFSA 2QBWA 1BFSA 4LEOA 1MQ8A 2NW2A 3WJMA 4CU6A 2FQFA 3KBFA 3LKQA 1L9QA 3HCVA 1MG3C 2AXHA 2IEPA 5EIQA 1YYLH 4O51B 5C0GA 1MI5E 2EDJA 5C6TL 5BJTB 3V0IA 1HWGB 1SBBA 4CNIB 2EIZA 4GRWE 5AVVB 3B2DC 5F1OB 4HPYH 2Y2TA 5IY5B 2CKBA 4Z1PA 3LH8A 2OAAA 3O41A 4EDWL 2EABA 2J2ZA 2PWGA 5JLZB 4ZUSA 1K6QH 5C8JB 3CLEH 1N2RA 2XVLA 3T3ME 3VD2A 3FQUA 2EXTA 1HH6A 1TJIL 3T77A 4Z7VE 5LWYL 3PXLA 1QBAA 1FV1A 2IADB 1UQSA 2Y5TB 3GTTA 1XF2B 4QTHB 3U0TB 3DYOA 4DGIH 2B9AA 3HC3H 2E8ZA 3JTSB 1ADQA 4PGBB 4XP9H 1CLOH 1LL1A 4GO9A 1YMHB 1E40A 2XFXB 4UTBH 1JZ4A 3VXOB 1DBJH 1PPIA 4TSBH 1CG9A 2F9BT 1VGEH 3CHOA 3PXJA 4GMSH 5H37A 3VFSA 4XCFL 5B38A 2CXKA 4G7QB 1GCFA 3V0DA 1I85A 3RNKB 4KV5E 2WXQA 3QJFA 4LBEB 1OAXH 3M7FB 4NHUA 3DX4A 1ZWIA 3WV0A 1CGYA 4F7CB 4EZLA 1I3VA 2DPKA 4WFFD 1MW1A 1LO4L 5FHBH 4G8AC 4YXLL 2IH9A 4QRUA 4Z7UB 4QF1A 5T1DL 1HYSC 1VKXB 4F15C 4BFFA 4ABVA 3GXNA 4R5VA 1WFMA 1U91B 1CICB 1NPJA 1C9SA 4CL7A 2WWMC 3PWVA 1L9SA 4PB9L 3PE9A 4HSAC 1MFUA 1JZHA 4U1GC 5GS0C 1XCTA 1NTDA 3MJ9L 4U3SB 5CILH 3D0VA 4XP5L 4ZO9A 3RNQA 1IM9D 3T4AB 4AQ1C 2WJ7A 4DCQB 4QXGL 4L4VA 1A7PL 3DIFA 5LAXA 3G9VA 1Q1JL 2X4PB 4GG8A 1WUZA 3ZDZB 2P8PB 1GTNA 3KDMA 3ZSSA 1CBJA 4L9LC 4NN5B 3M1BB 5HGBB 3TL5A 4WW2F 1T7WA 1FCCA 4QO1A 3DV6A 1Z2KA 4K94L 3PLYA 3EOTL 1P1VA 3OBAA 5KN5B 3ULVD 1T4KB 4P5KB 4PV1C 3AU1B 3V4PH 3FQ2A 4KNQA 4KKAD 4PWIA 5CF3A 1FHGA 1EAQA 3GIVB 4OGQC 4AVJA 1RXLA 4KXZH 5TGBB 1VB9A 2VZUA 1D6EB 3DDGA 3C2SA 5EBMB 4OCYH 3LN9A 1G9EA 5D7JB 4NDMA 3OZ9H 2AJSL 3QQ3B 2HWZL 3MNVB 1BQ5A 1I3GL 3KPSD 4N6RA 2OW7A 3H3KA 4U1KA 3MJ9A 5B4MC 1GIGL 1D5BB 3DA0A 4XZUA 2ICWJ 2XV3A 3LEVH 1OHZA 4X0KB 2Q2EB 1JPFB 5CP3A 3KPMA 3CXDL 5HBBA 1RUQH 3US0A 3P11L 3B2UD 3BUYB 2W88A 3GMMB 2ZNWA 3O9WB 1PZ3A 2ICES 2YD3A 2ZX8A 5AOZA 4GRWH 3QFJA 4XPHL 4HS6A 4X98A 1MFVA 4CDGC 1FYTB 3DVNB 3O6MH 4NLAA 5JIPA 4ZFOL 3WTWA 4MJ6A 4MNQA 4MNGA 1F00I 4AM0B 4K8RL 1M1XB 3QQXA 5DJCB 3WMQA 4H8WC 2EDQA 3OV6A 3CJJA 4NC1E 1AD9A 4P99A 3QI9B 5AAWC 4F8LA 4OLWH 1EVUA 4G6KL 4IBVA 5B7FA 3EDFA 1JWSB 1EEZA 1Z0MA 4PJDE 4KAQL 4YHML 2RQ8A 2VB5A 1ZJAA 2CUHA 4IRSC 1JWMA 3LH2L 5A2LH 3MRRB 4GW4B 5TE4H 3B1UA 4LAJH 1TJHL 4DKEL 4F7PA 3RL1A 4JHBA 4J27A 3PY9A 5C0BA 3C5SB 2SODB 2A99A 3QB7C 5D2LB 2QQLL 5I0VA 1G7IB 3KXFD 3EOBB 4EDXB 4TRPL 2GJ6E 3PP4H 1U8IB 4QRRA 3UTPE 1B2WH 2XZQL 1UD2A 1F3JB 3IU3B 4XNYH 3SDYH 5B1KA 1JVKA 5FYLH 1VA9A 1K2DB 3GJFH 1HCVA 1OB1B 3EFFB 4BFGA 1GZHA 3INUH 4LCWD 2WLLB 3ZE0F 4ZFOA 3VDBA 1AO7B 3W1ZA 4EIUA 3UYRL 1KJ2B 4GXVL 1YNTA 2CMRH 2HH0H 2DQCL 3REVB 3HG1B 3MREB 2VLRE 4PGEB 4LCYB 5ID0A 5IMMB 1NBQA 4OBRA 3O45A 1IC7H 3LEXB 3KWXA 3IWUA 1YMMD 3MZGB 4PV9A 5AW4B 1XGRB 3M17A 1I9JH 1SXNA 2OR8A 3VDCA 4XVOA 5FUZH 1OPGL 4FE9A 4JLRA 2XN0A 1WG3A 3IMUA 1T6BX 3CX5K 3MV9D 3VXSA 1BXUA 5JA8B 4Y9BA 1AGEB 4HLEA 4PJHE 5HXMA 3QR1A 4N5EC 4P2RA 1A5FH 2HAZA 4X6FA 5I1KL 4HZ1A 2APXA 3FAWA 3ZDWA 2XV0A 4JHWL 1SLXA 3LCYA 3VI4B 1KEGL 2HFFA 1RZGB 4L3EB 5DJ0A 5DA4A 3VFTA 1DFBL 2GTQA 2IH8A 5A43C 3W0WA 3DX3A 3L6FB 3CN0A 3QEQA 4X8XA 1BIHA 1CFNA 2HLFD 1N59B 1MJ8H 3MRLB 4JAMB 1ZT7A 3JSSA 2CM5A 1L3NA 1AACA 2CM6A 2N01B 1V3LA 4X8GA 3OLDA 4AEHL 4OD2B 4LSQH 3TA3C 4FQ2H 2QVFB 4GBXB 3BVNB 5D4JA 4UIKL 1Q94A 5J9PB 4AZUA 3AG1B 2HRGA 1K4DA 2XBTA 5D70L 5C0CD 4ZO6A 3PWUB 1F2QA 4GAFB 1XGPB 2AXFB 2GBAA 2OSLA 3O8XA 3FZUC 4V1DB 4WO4C 4XNUH 1HCFX 4YWGL 5DRWB 4LU5H 2LAGB 1R24A 2VM4A 2VMCA 4B95C 4WDIA 1QSED 1NMBH 4IGBB 3VFGL 1NLBL 4E9VA 1XWVA 4OCSL 5B1CA 1R46A 2G9HA 2OMTA 4LIQH 3HR5B 1DQMH 3T6XA 2AK4E 3UBXA 4F2FA 1FNGB 3PIQA 2Y9RT 4MD4B 2UYLA 5JXEC 3MRMA 1R9FA 5LNDA 5E56A 5C08A 1E4HA 1XCQA 3ILDA 4M93B 4BSWB 2E9WA 1HHGB 4QRPA 4D3CL 3PL6B 3QQ4B 3BWAA 2XWBB 4TUKH 5KBMA 1D6VL 3B7UX 3KYOA 3IK2A 1E4XH 3PNWA 4XPBH 3BZ4B 3IDXL 1A9EB 4FTVB 3WFDL 2X4QB 4LCCC 1H3XA 1J5DA 3CC5B 2WKOA 4FXKB 3E6FA 4UB0L 2XA8H 1ZLSH 2VLJD 4PFEA 4TSCL 1JGDB 4AYMC 1F86A 4DSYA 5EFIB 1WCBA 4ODHH 2UY6A 4WUUD 5C0AE 1DQQA 4Z78A 2EECA 4S1DD 1TJXA 4WK0B 4B5ZA 4L37A 4ERSH 3OHXA 3ZDXE 3QJHB 3EG9A 1JXKA 4X9YA 1SOKA 2Z6FA 2OULB 2NOYA 1DE4B 4H20L 5HDQH 1ZXKA 4QRSB 3SGJC 4GJTB 3WCYA 5BW7C 3HKFA 1HINH 4Z7NB 2P5EB 5TDOB 5CD3B 4ZUTB 1HDMA 4GIOA 4LHJB 3HKZA 4OI8A 4Z7UF 1G7LB 1GZQA 3CVIL 5HVHC 5A6MA 2LT9A 5E6IA 3X3FL 5DRNB 1UM4L 1J0JA 2W9DH 2I7SA 12E8H 4JFFB 4RDBA 3I9GL 3KBEA 4TS6A 2A5UA 3LNFA 4JFOA 4AYBA 5EDSA 1VSCA 1ES0A 1KCUL 3MLUL 3C5ZD 2V37A 5L4MA 3MLYL 3VG9C 2VUYA 2NYZA 4JFYB 3PG2A 4X50A 5KOMC 4R96A 4U6XA 3TJEL 5T1LA 1R3KA 1HEHC 4NGHL 3FO9A 3NZHH 5CU5A 1UXMA 5EB9A 5T1KB 3ZDZF 1IFRA 1LO2L 2ARJB 1J05A 1ODUA 5D96C 5EU7C 4W9KC 1WFTA 1MCOL 3CFBA 5JYLA 2L4OA 2A9CA 3OPZL 3PV6B 4LKCA 5HYIA 1ET8A 3US9A 1EEYA 2B2XH 2DQEH 4YX2H 5FYKD 4WI0B 4EI6A 2LABA 2X6UA 1T3FB 4M1GH 4HU8A 2DAVA 5ADPL 4NQEE 5K33A 4EPSA 4PJEA 3WS3B 3ZE1B 3VW3L 1XEUA 4F92B 4U4IA 2YGVA 3WO4C 2DDQL 5I23A 5I71B 4ZZFA 5I1LA 5D4IA 4MJ5A 1WEJH 2VR8A 4OIIH 2BMKA 3AS3A 3U9PL 5HVWA 1W91A 4M8QB 4EQ3A 2VQ1B 4RZCA 2ZXBA 4BQ6A 1BVLB 1GPOH 3UJIL 1BEXA 3FTGA 5IVNA 2K3TA 5KVDE 5LJYH 1GGBL 3BYYA 4PI0A 4P59H 1D2OA 2YJQA 4JO3H 5DYOA 1SVBA 4B9GA 5L2KE 3QIBD 5F7EL 4CRPA 4NIKB 5HD8D 5JHLL 3NTCH 4MJHA 1KENL 2J1XA 3RX7A 3FB8B 4IRJB 5J11B 1I1YB 4OW6A 3DUHA 3R8QA 3BFWA 2O6EA 1EJ6A 1AC0A 1BGXL 2BS8A 3P30L 4LEBA 5L4JA 1XSOA 3X13A 3D30A 3LKOA 1HE8A 4JJ5A 3V6OC 1KIRA 5GGTH 5DUML 1MOEA 4HS8H 3VXNB 4JZOB 4XNXL 3C6LB 4KFZC 1QX1A 4Q74A 1INEL 1EJ8A 1TTGA 4A04A 1VHPA 2QR0A 2X44D 4HUUB 2NUTB 5FWQA 5HHOA 4HIHB 4N86A 3I74A 3PCYA 2V5RA 3UG3A 2ID5A 5DVKA 1PS3A 4LP8A 5MI0C 1XSIA 2MKWA 2E9GA 4LLWB 2ED9A 2HLAB 3PV7A 3B2UC 1SBSL 2YBGA 2ZUYA 4Q6IA 1A9BA 3GTNA 1FNEB 1ZV9A 5EC1B 4KKCD 5D2LF 3HAEH 5ALCL 4PS3A 2A9BA 2E27L 5GRJH 3S3SA 4OZGA 1FO0B 2Y06L 1UM6L 2R0WH 4YQXH 3RL2A 2P24B 1TDQA 1RLBA 3I9PA 4PR5A 1XD0A 5AVSB 3IWVA 4Z7OF 3VXMA 4DFHA 2SEBA 1U92B 1RUPL 1TFPA 1QSFD 2B4CC 2XLLA 3L7FB 2PWHA 2BVYA 1QR1B 1KCWA 1N0XL 3VI3F 3WELA 4JO2H 2MHAA 1FGNH 1NCCH 2NY5H 4WV1B 4Q97A 3NSFA 4PBXA 1LTXA 2R56L 1NIFA 5CGYC 2ETWA 4NPYA 5D1QD 1P4LB 3GWJA 4O2EB 5EF2A 1OAKL 4FG6D 2HRLA 4FQ1H 1C5DB 3TEXA 5JHMA 1PU0A 5FDWB 5CN2A 3FKUS 3MA9H 4EN3B 1FL6A 1XFPA 3F58H 4FERA 1LO5A 4NWUL 4NN6B 3BLBA 4D9QE 2WVUA 3OMNB 4GG6A 3WNPA 2XV6B 4Y16D 5M95B 1FVEB 1UZ8A 3BUDA 4QHKI 3QDMD 4F7MB 2BP5M 4FFZA 3BSGA 3VRLF 1ZCRA 2I9LB 4LLDA 1JK8A 3IGKA 2A6DA 1P1ZA 1BQHG 1WO2A 1KFAH 4BIKA 2YIHA 2MWCA 4PJXB 4OZIA 4UDUB 1BZ8A 3G6JB 1FNLA 1HZHH 3OB8A 4FNRA 4OZFB 4BFEA 3MLPA 1MPAL 4NENB 3VI4F 1JGIA 2ZWZA 4PWKA 3G6DH 2DS4A 3LPFA 4AEFA 2ADJA 2BOBB 3IU4L 4N4YB 1ERNA 3U1PA 2EUWA 3WEXA 4R7LA 4JFZL 3RGVC 2A3TA 2R83A 3FQTA 3H3BC 2WLIB 3N9GL 2H8PB 3PFQA 4KRPC 2A6KA 1E9QA 2YPKB 3JWDL 4D9RD 1TTRA 4NYLA 3RWJB 2Q3ZA 5HYFA 4JO1L 4G83A 3FT4A 1ZT1B 4XP4H 4HF5H 2Y2WA 1PSKL 1UWGL 5L2JB 2NNAB 1ZHBA 4N8UA 3KLHD 4FQXD 1IJ9A 5CLZA 5HI3D 4NI3A 5TJWK 4B6ZA 1KBBA 4UM9D 4O02H 1IC1A 1LNUB 2BIQA 3WNLA 1BSIA 4ALAH 5IB2A 1YN6B 4AK2A 5FAAA 2IFFH 4U3CA 4YDIH 3U0WL 4RWYL 1QFWL 4K3JL 1AKJD 3HR6A 1CMOA 3COOA 3QUMH 2N1KA 4NKIH 1X5ZA 1RERA 5F7AA 4KMLB 5IFJA 1KTLA 2PO6C 1SUJA 2PR4L 2ZKWA 3DGGB 1NPNA 3QQ9C 1QBLL 2AEQH 2MJWA 4ZUVA 1UB6A 2HLFC 2R0KL 4NQCA 4BQCA 1YN7A 3IFPB 2OR9H 4KI5E 4JGUA 3QZWB 4PUBH 4LCUB 3BIBX 5HPOA 3ZN6A 4CUCA 1I9IH 3QNXA 4PVNA 5I26A 4MZ2A 4S2SA 3KW7A 2RB8A 4IK6A 3DDFA 1B2YA 3NJHA 5JW3L 1NDGB 1IGML 2NY7H 3DPBB 2IVFC 4F15B 4JEGB 1HT6A 1B4TA 3F5WA 4YL9A 1MN4A 2G5RA 3SCMD 1FG2B 5FM8A 4N2AA 2FD6L 4R7DB 5TE7L 4BZ2H 5EU4B 2FNBA 3IRPX 4U1GB 1M3IA 1GJUA 1YECL 2Y1AA 4A2GA 3T0DA 3BKCL 4MNHB 1TF4A 2XTJB 3BW9B 4WO0A 5IB1A 1OANA 3W9EB 3D3VE 1UB5B 3VTTA 4AQ1B 3W9DB 2KDYA 3ARTA 1GA2A 4UTBA 1PNDA 2C3VA 3P4LA 4XVTH 3HHSB 4MXQC 4WJ5B 4CADA 2Y7SA 4BFIA 5IVXE 2OCCB 3BHBA 1AYRA 1U8JA 3LOWA 2HPOA 4X7EC 4JZNA 1KCVH 4Z7NF 3TTYA 1FF5A 4FQCH 2NX5E 2C1PB 3FQRA 5I1GL 1TEGA 3EOYG 1ZLWK 3A3YB 4KHTL 5GRVL 5B8CA 2ZTBA 4YE0A 3R7QA 4F3FA 4JJOA 3BISA 4JFHE 2MNJB 3TBWA 3IAGC 4OIFA 4WWKA 5BZXA 1J1PH 3RIFK 3D06A 2V2XB 1IBHA 1T7YA 4OAWB 4MZRA 2DM3A 3HA0A 2P5WD 3VVWA 4WEBH 1P5UC 3K8KA 3ZGHA 5ICXB 3AY4C 2EC9U 2O1AA 2Y6SC 2PPAA 4S1DC 3TO4A 1MFAH 3CFEA 1NGXB 4KO9A 1UA7A 3L9RB 2X4RB 1B3JA 1M9SA 1MSPA 3BVXA 3D07A 2A9NH 1S7TA 5MHSE 4JVUA 1TFHA 2DQ6A 4MQ7A 5EDXA 1GR7A 5BVJB 6PAZA 2E74C 3HRZC 4XBGB 1LE9B 2VQ4A 1A1MA 4RRPA 2AF2A 2JMRA 3FUMA 4MNQE 4MNGE 2A1WL 4UINL 3QHZH 3F05A 1AQKL 4BFJA 3ZE1F 3FO2A 3SJVE 4IKKA 2VO8A 2O61B 2J56A 2ZF9A 1TQTA 8CGTA 4P2QB 3FQWA 3UERA 4ACTA 1KCRL 4I48A 1E90A 4Y1AD 3NJGA 5IM7A 3QE5A 2W80C 4LLQA 2VMEA 3TEYA 3IYLW 2QVIA 4FI8A 5SV3A 1HEZA 2XX1A 2NY2C 3BH8A 25C8L 2F19L 1PZBA 5AOJA 3C75A 4XXDB 1K8DA 2BW4A 4IRSB 3WLBA 4HH8A 2YJLA 2PWEA 4BQ8A 2MSPA 1ZHKA 1GOHA 3BCDA 1RK0B 2H2PD 3EYOA 2NZIA 4IMKC 5DJ8A 1GH7A 4DEPC 1IEAA 3T6WA 2JKRM 4YHYC 5FO9A 3QUHA 1H3WM 4P0DA 4AK1A 2Y07H 3P0YH 4R3SA 4U6HB 4R4FH 5IVZB 4R8WH 2XKNB 4NRXB 4ELKB 5GGRA 5E94A 4G3YL 2OXGA 3ULUH 3NCCB 3CDYA 4X2UA 4ZBJA 3N0AA 2PPCA 1IBGL 3BPOC 5JIDA 2Y22A 5CBEB 4K7PH 1T0NA 3GRWH 4J23A 2J5LC 1EMTH 5JDSB 3HPLA 4LRIC 2XIBA 1XEDA 5HJBA 4JB9L 5HHMD 2XWCA 5HHPA 1QACA 3KWWB 4PY7A 5I0ZA 2Z0UA 8FABB 3V6FA 1Z9LA 2JFCA 3APNA 3WTUA 2YPLB 3QIBC 4FG2A 3E3QC 4A7TA 2OYLA 5HD8C 2MFNA 5I1EL 4ADIA 3HZVA 1OCOB 1YQVH 4MB5A 3L8QA 5D7KD 5E2VL 3KEHA 3ZUCA 1HHJA 4NO2B 3VXSE 3KPLB 5F3HA 4BKLB 5J57B 1BLNA 2N0MA 1W0WB 4OJYA 4RAUB 1IBZA 4TUOB 5C0EA 3UP6A 4WI8A 4JHUA 1MUJB 1YAIA 5GS3A 1OL0A 4ABWA 5K9QI 4HFWA 4MCNA 2CA3A 4EOWL 4WY7L 5F7UA 1ITCA 4JG1L 1MY5A 3QEHA 4YOKA 4XMTA 4N1CA 3SQRA 1CLZH 3THMH 3D18B 3QO1A 5EU6D 1S5HB 3QJVB 1S9XB 1SOXA 3IVKA 2NY1C 4HJJL 3S4SB 1RAMA 3C8HA 3WG7B 5J0BA 3QEQE 2N7AA 1OCZB 1XGTB 4FLHA 4PVLA 1OGTB 5IBTL 4KKCC 4IS6A 4C83B 7PCYA 4YZWA 4F2ME 1IB5A 4WF7A 1KSRA 4HBQA 5IQ9A 5BV7L 3MBEC 3QWRD 5H2BB 3M8OL 5G5DA 2VIRA 5E6RB 3IETA 2BVUA 1BEYL 4N90D 3VNYA 3D4CA 3TA3B 3RWGA 4HZAA 2BC4A 4PEEA 3ASOB 4KZEH 1HKLL 4RISH 4NQSA 1DQDH 4PJXF 4NWTH 3U4EA 3TCTA 1OK0A 1WZ1H 3G6JF 5IB4B 3ZXAC 4WO4B 4G71B 3SE4C 5ANMB 1TTBA 1OAYH 1PLCA 4ILDA 4I18A 1IVLA 4IHBA 1AJ7H 4HT1L 3DPDA 2O6CA 2AKRB 5KYNA 1BQKA 1F1AA 2AI0L 5IUCA 4KHXH 4NNPL 4K7PY 2B5IB 5FO2A 3EJZD 4JPQA 3WU1A 3FYEB 4J6RH 2P1YA 1S3KL 3FUEA 4RMTA 3G6AB 4JFDA 2UXFA 1RJZB 3ZK0A 5IQNA 1TITA 1MCCA 3C08H 3VA2C 4FQIH 2BSED 4MB4A 3MV8A 5GS2H 2EYTB 4HXAH 5D1ZA 1A4KA 5DT1H 3RZCD 1LEKA 1MF2H 1MCJA 4OB5H 5E8NB 1RUKH 1U3ZA 3ARWA 5ISZD 2NNXA 4Q9QL 3RJOA 3U83A 4DOHE 2X1WL 2ZUSA 3VXRA 1BQLH 1XCWA 4FZ8L 1D5ZA 3GTVA 3CVHH 2HKHL 3AROA 2VJXA 5FCUL 1PGRB 4F2EA 2YAFA 4BCXA 2E75C 2IWEA 2FJFA 3AS2A 1PF3A 4QD2E 2JELL 3MV7D 2CR3A 4WI9A 2PR9A 2BJMH 1S7VB 1E6OL 1KPVA 1N6QH 5FYJL 2R1XA 2OXHB 5DUPL 4PJ5A 3APFA 1IBYA 4FQXC 4PJIA 3KLHC 1LP9E 5HI3C 2E7BA 2FH8A 1OV8A 2AQ1A 3KR3L 1UWEH 1Q0EA 1VF5C 3CCHB 3IDIA 4R97C 4ZUWB 1IC4H 1VFAB 3BT2H 2RCSH 3IAPA 5SWSE 3RGHA 2Z8RA 3BPNC 3DV4A 3ML9A 4IU2B 2DQHH 5H35A 1FAIH 3Q9QA 3QFDB 4PW3A 3LZFL 1KUMA 1TTCA 3C6SA 3GJFK 3M46A 3FSOA 4JFQB 4LQ1A 2H7WA 5I6XC 4XX1E 2OMUB 5FA4A 3DK2A 1BECA 2DL2A 4H26B 3IJSB 4GKNA 4NIYE 4V2BA 4N20A 3DHMA 1QNIA 1WCQA 4MASA 5FHAH 3RIAF 4CSTA 3J8F7 4Y5YC 5E1QA 2V5SA 2WSPA 1J9CT 3SPHA 1IM3A 3A6OA 3N06B 3UTTE 3INOA 3L1FA 3OKLB 3VG9B 2VABA 5BUPA 3VA6A 1Q9LB 2X4OB 4K3DL 1QUNB 5A2IH 3HPJB 1NCBL 3F85A 1E67A 5D96B 4LMQI 3KPRE 4ZDHB 3Q1SL 1ESOA 4CKQA 3WTVA 3DXAE 4APXA 5CEZH 2ADGA 4FGMA 4BH8B 5GZNC 4GSDL 4P5MB 5C09A 3HN5A 5DSCA 5HGDA 43CAB 4BHUI 3P9MA 3SPCA 4QAWA 1LO0H 2IOOA 2DJUA 1TJMA 1QATA 1A0QH 1H0DB 1M1SA 2IQ9L 1YEDA 3TH3T 3WO4B 3QW9A 3MRHB 4D2NA 1IM9B 1U8KA 3F3HA 1LQBC 3GMOA 2VN4A 1XIWC 2NY4C 2NYYD 3GUFA 5CZVH 2WPGA 4X80L 5AW5B 1OLZA 2MQ0A 2Z4QB 3IJ9A 3QWOA 5E9DA 5E2UL 1U3JA 3H4HA 1KTDB 1JDAA 3CFKA 4Y4KD 3OR6A 5E5UB 1B0WA 4EUPB 5L4IA 2EDMA 4QOKD 1NGQH 5DJ2B 3MGOA 1I7TB 4J4PD 4DEUA 4ODUB 5I1JH 1T83A 1EO8H 1F58H 3NFSH 5JXAL 1N70A 4ORGB 1Q90A 3FOMB 1H6TA 1H8OA 4R26H 2UX7A 4FQLL 1DUYA 1L9MA 1U3HD 3WXVH 5TQ0H 3UGEA 1H3PH 3WNKA 5HPMA 1KF9B 5ECJE 2BERA 3NMEA 1CE1L 1HIML 4LEXH 5DZJA 5F88A 2NY3D 5B7EA 4AG4H 3U6RA 2A38A 5MI0B 3O6FA 4KRLB 1KB5H 5A7BA 4E5XA 5DQJB 4QXTA 1YEFL 1E2ZA 4PGZA 1WD9A 2C3WA 1TLKA 1RHFA 1ZLVK 2GCYB 2EEAA 3RY6A 5JDJA 4ZPVB 5F3FA 4J3VA 5E5LA 5BPPA 4XBPA 2BCKB 3K71B 5JW5B 2R0WL 2HN7A 1OTTD 4L5FL 1KTJA 3KEDA 3N41B 5F9DC 5FYJU 1ILUA 3SZKC 4FNLL 1VPOL 1FZMA 5I8OH 2DYSB 2ROXA 5E6SB 4XMVA 3B2XA 1RZ8A 4YSTA 1OW0A 1PJWA 2H0JA 1FFPB 4PU2A 4ECNA 3GKWL 1DO5A 5I17A 1BVNT 1SEQH 4FHBD 5JW4Q 3REWA 3IJYB 4RLDA 1ORQA 3PWPD 4L9DA 5E08L 4NO5B 2H2PC 3CMOH 3F58L 2LLLA 1FN4A 3B37A 3TZVA 3WSQH 1H6FA 1C16B 1U95A 2ESVE 3KXFB 4DF9A 4KJQC 5IEKA 3E38A 3UTQA 2EIEA 4TMPA 5T1MB 2CO1A 2W07A 2YN5A 3AABA 5FO8A 2HTKC 2Y24A 5JIQA 1ZTMA 2MPVA 2X12A 3QJSB 4IBSA 1URZA 3KYKH 3X3GL 4YAQA 1E3XA 2OSYA 3LKPB 1YY9C 4LHUA 4P4RB 2WBKA 3QFGA 1DANT 2Y7QA 3BIKA 4LCWB 5IFAL 3ZL2A 1A6ZA 5I28A 3UTZB 4O2FB 3C2AH 1W80A 4P9MH 4E41D 1LILA 3HE7D 3ARDA 4QMEA 1O6TA 2GJZA 5C3IA 5EN2B 1QA9A 3BO8A 2GUYA 3D52A 3RGVB 3KCWA 1YMMB 1Q0XH 4Q52A 4AIZB 5C9JB 3TNMA 3VB9A 3DJZA 4KRPB 1RZQA 4P4KC 3T8MA 3BPCB 3ZE0E 4N8VB 1PFCA 1YEKH 3NAAL 3TBBA 2EVIA 4FEMA 4URTB 4JR9L 1RI8A 5EN3A 5KVFL 2VO5A 1RULH 2DIBA 2R2BA 3CFTA 3VXQA 4Y2NA 1QLFB 4GQ9L 3WE1A 4F8QA 3W5NA 2EKSB 4LP5A 3CHXA 4Y7MA 1KZQA 1HU8A 2BOCA 3VD5A 2I07A 2R0ZL 2IG2L 3C5XA 3ESVF 2F53D 4HKJB 3GXUB 1PD6A 2X0WA 4PI2A 2AANA 3ARFD 2DMGA 3NK3A 4NUJA 2IFFL 1SXZA 1J8RA 3FPYA 1F45A 2F61A 4JN2B 4O2CB 2OLDA 2JH2A 4ZS7H 3C5JB 4KY1H 5DD3H 5DJZA 3MJ7A 3KLAB 5DZPA 1AVAA 1FH5L 4ABUA 2PO6B 1S6NA 1YG9A 4UUJB 3K0YA 4P5TA 4Y2LA 1NDMA 2O5XH 4MTMA 5EORH 3VSVA 5I1CL 4DKDC 3JUYA 4M7LH 4PUBL 2EEBA 4LCIL 3KLKA 4OD3L 4NAQA 2BNQA 2ZP0T 4NKOA 3BAXA 3QHFH 1A64A 5GIRA 3TWCH 3WI9A 5C0CB 2ZX5A 5DD6B 2X4NA 5I66A 3RGBA 5AW9B 3RPIB 1SQ2N 4PRPA 1KXTB 2WTOA 4U1LB 4WUKL 3BZFA 1F4WH 4S1RH 3S37X 4BHUA 5MENB 5DYFA 4TULL 4YSQA 1GAFL 3QCUH 5JMRA 2CHDA 4HAGA 1SYSA 4G8GD 3JV6B 3GC3A 4PRDA 3DX9B 1QSEB 3D25B 1DVTA 2OCJA 4AENA 5J6HA 1YUHB 4J12A 3EJZC 4YBHA 4TVSa 2AP2A 3WNOA 5E2TH 4YSUA 4WNSA 4IQHA 2ZAIA 1QSZA 4CSPA 3MLRL 1UUSA 4ZSOB 1OSEA 1T1WA 3QNZA 5J06A 2H26B 1P7KB 5BZWB 3FQNB 3RZCC 1H15A 2PTTA 4ZQTA 1CURA 1L5GB 5LG6A 4L0PB 4PCTA 2PTVA 2QSVA 1KPUB 4L29A 1GGCL 1FNSH 5GZOA 1SRDA 5LGYA 3VWJC 1FWXA 1XMWA 1UXLA 4WWPA 4RBPH 5D6DA 1HNYA 1SJHB 3EO0A 4EVNB 1KG0A 3H3PH 3HN8A 1MCQA 2NYKA 1HHKA 5D1XE 1P5UB 3MRGA 3NZUA 4HCIA 1RJYB 4UT7H 4DGVH 1G5GA 4WUUB 1FIGL 1LVEA 2G60H 2YD8A 4G7SB 4D0CA 2QVMA 4NI6A 5LGHL 4DGWC 1VEPA 1AQHA 2J21A 2L7QA 3OAUH 3VFPB 3VD3A 4POZD 5C07A 3DTDA 2OMYB 1OP3K 4KKLD 2R4RH 4RMQA 4PJGA 4AW4A 3EO9L 4F33B 3HRZB 1BZ7A 3POHA 4N0UA 4AL8H 2GITB 4DN3L 2HJFB 4L4TD 2VDPL 4X6DB 2EVFA 2EINB 1GZPA 3SBQA 1U4EA 3V9EA 3C5ZB 5DK2A 4PY8I 5LVEA 3MUHL 2OW6A 2ZKHL 4Z7UE 3BN9C 1S7UA 1A6AB 3K5SA 4RFEB 3FOLB 2MOVA 4NM8H 4I0KA 4UQCA 5JIIA 4X7SL 1E6JH 3H0TB 2ITDB 1AP2A 1IAOB 2UZYA 4K5LA 4OKVB 4XPAH 5CMAB 5I16A 4LB8A 5INCB 1HTYA 4DEPB 3H6JA 5CCKH 3M1CA 3MRKB 1FDLH 2WBJA 4YHYB 4GRLD 1A4AA 3LVTA 4XMPL 5KJRL 4M48H 5E1HB 5D72L 3UZQB 4GNKB 5F93C 1ZA3B 3HTLX 5IK3A 2G2RA 4HWBH 4MDRA 5EWIH 2ZYRA 4P07A 1XXFC 2VYRE 1PKOA 2N7BA 2PYEA 2Q3AA 1OTUD 1X5YA 2OMXA 2HVKB 2E8YA 5H37G 2W0PA 3BPOB 1VDGA 5D2NC 1BZ9B 1CXIA 2J5LB 4UAOB 3V9FA 4QCIB 5E1AA 5D7IA 3U7WH 2VSMB 2GHWB 4Y4KC 1UADC 4NQTA 2VH5H 2YKLH 5HYEA 1QBMH 1JGEA 2VL4A 5DMJB 2HKFL 2X4SA 2PLTA 3QIBB 4J4PC 4MMZA 5IQLA 3SPVB 1ZTXL 4MSWB 3ILPB 4YDLC 1NFKA 3PNRB 5EU5A 3I9IA 1KC5H 1W8EA 2AJXH 3BAEH 3HC0B 1I1FB 3WFHA 1MZZA 5FO7A 3Q8CA 4M5ZL 1Z3RA 4BE5A 1KBWA 3MX0A 3N41F 1YC8A 4H25B 1U3HC 3IJ7A 2DJSA 1HAUA 1T89C 4LBAA 3DOSB 3QDJD 3QAQA 2KUTA 3UZEC 5G4NA 2ZSWB 4EN2A 3GB7A 4P9HH 3ZLQC 1XGZA 3WEOA 4NBYB 3CUPA 1S9WA 2E47A 4JRFA 1JGUL 5IROD 2CDGB 5HDBB 5IB3A 1QG3A 4HUKB 3UJJL 3CLFL 1FYTE 4M3HA 2V2WA 2NY1B 3E6HA 3F84A 4HXBH 4M5YH 3TBVA 3MA7A 5MEQA 3OAWA 3GRWA 4QYOA 3VFRB 3AREA 2FJGB 2XBDA 5G55A 1YUKB 1FVCB 3AXIA 4M4PA 2UWEA 4JQVA 4ZMAT 3NIFB 2R2EA 3T8XA 4L1HA 1SPDA 5FECA 4O5LL 4ODWB 1V3KA 2HVJA 5TK2A 3PJNA 4FF9A 2YMXL 4P3WA 5F21B 3CDFA 1QSFB 5E4AA 2DTSA 3UZVB 1ZA6A 2EH7H 4XWGL 2V5MA 1HQ4A 43C9B 4NWTL 3H7LA 2GC4C 3V7MA 5D2LE 5AB2A 4ZK8A 1WUNT 4UQ2B 3SDXA 3AG4B 3ARBC 4NCC1 3WO3B 3KGTA 5EZIH 1NIAA 5E99H 3MFFA 4TPRH 1G5AA 3X14B 2J88H 3LZOA 3PPEA 4Z7OE 1BXAA 2R23B 1TMQA 2AJUH 1WIUA 4MCZB 3DECA 2WLHA 3CK0H 1PEWA 4JFDE 1M7IB 1K3IA 2VLRD 4Y16B 1ZS8A 1DQTA 4L2LA 3V4UL 3VI3E 1AO7E 3CSGA 4NRYA 4R84A 3QDMB 2UXGA 1J1XH 3QORD 4LKXB 3EIFA 3HG1E 2VL5A 3IBEA 3AWEA 1H8NA 3MJ8A 5BO0D 4HJIA 1B9KA 2JB5H 1RUKL 2CBTA 1AY1L 3NN8A 1WGVA 5ACZA 5KVEH 2DBLH 4UNVA 2NSMA 4AGPA 2F5AH 4K23H 3O4OC 2P8MB 4MQXC 4Y9CA 2V9TA 1GL4B 4XCEA 3BP7A 4N0FA 3VRLE 2CQVA 4OLYL 1KCKA 1G0YR 4QYAA 1EHLH 35C8H 2NDFA 1EZSA 2BNUB 4UNIA 5T5FH 3LHAA 4A38A 4ZTOL 3S88L 4ZFZB 3T71A 3BGAA 5AZUA 3VRIA 1Q0YH 2DQJH 2PCPA 2W94A 2H0PA 1UOVA 3LH9A 4FKKA 4XI5C 5CS7A 5JO5B 3O3EA 5E2WL 4WJKB 3FONB 2CR6A 1AOHA 1A1NA 4NHCH 4FQXB 3VI4E 3VXUA 3ZHNA 1QLRA 1XBDA 3CGTA 3GI9L 1IC5L 4JRYB 3OX8B 2YHGA 5KSAD 1R1CA 2L7EA 2BLFA 3D39A 1XB6A 4R97B 2C7UA 4JPIA 1E9PB 1RZ7H 1B4LA 4X9HA 4N2CA 3RKPA 3BPNB 5HJGA 3OR7A 2F18A 2ZICA 1A25A 4WHCA 3OKDA 4LPWA 4XHQA 5EIIB 3TPUA 2XETA 3R1GH 5I6XB 3GBNL 2B1HH 5DGRA 2K8QA 4FQHB 4ZW6A 2HJKA 2YD7A 2HG0A 2XWTA 5D7EA 5J7CC 5C0FA 2F8XC 4L8SB 1JZ5A 4W6XB 4PREA 1AZCA 3FT3A 1NAKL 2R0LH 1OSZB 3VXTA 4AI7A 5K39B 3QG7L 5LLIC 2XZCL 3ROLA 3TYFB 1NBCA 4DQOL 2X70B 1JSYA 2PN5A 1MFDH 3CH8A 4IRZH 4E9LA 3Q8FA 5MEOA 2ZSVB 3MROA 1RJCA 1TVBA 4L1LA 4ZXBA 3BH4A 1TR7A 3NZ8A 1ACYH 4HFUL 4Y4HA 5C09E 1LDPH 3MLSL 1YJDC 1ETZB 2XWEA 1OT4A 4N3UA 2Z31A 4AZ8B 4ETQB 1A3RH 3WDJA 3LKSA 3SCMB 1JD7A 4PD4J 2BFGA 3JBG7 4P46D 2IPKA 2DQDL 2D7TH 3X11A 1CVRA 2BSRA 1F56A 1EIBA 3NT0A 1JV2A 3EYUL 1P6WA 3QRGH 3OKEB 2PXYC 2X38A 3OF6D 4G9DB 3SYAA 4M6MH 3FU0A 3OAZK 4B9PA 5IOKA 1EFXA 1XIWB 1OAQH 4OD1H 5CIPB 4BA0A 4Q4IA 1S7RA 2ZWKA 3QSKB 5ICZA 3RA7L 4FTVE 2LGNA 1J5IA 3CDCA 4RMWA 1LE5B 3CVCA 5C0AD 4OLUL 5AW8B 1YDPA 5EBLB 2BH0A 2HX9A 2IJ0C 3E2HC 4NBZB 3I6KA 3V5HA 1S9VB 3TS8A 1A6WL 4HLZH 5HYSG 4BK5A 2YARA 3Q2WA 2OTUB 2XJKA 3HS9A 2NT0A