2ATAA

Structural basis of dna recognition by p53 tetramers (complex ii)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
197
structure length
197
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*AP*GP*GP*CP*AP*TP*GP*CP*CP*TP*T)-3'
publication title Structural Basis of DNA Recognition by p53 Tetramers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis/dna
total genus 48
structure length 197
sequence length 197
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ataA00
2X0VA 3KZ8A 2X0WA 3US0A 5AOJA 4LOEA 3VD1A 3WTXA 5AOIA 1EAQA 3D07A 4KVPA 5ECGA 3IGLA 2BINA 2OCJA 2J21A 3EXLA 3D08A 1EANA 1GZHA 4IBVA 5BUAA 1KZYA 4IBYA 1CO1A 3IGKA 2J6WA 3WTSA 5ABAA 4G83A 4AGLA 1GZHC 4AGPA 3VD2A 2YBGA 2J20A 4GUQA 4L18A 5G4NA 2ATAA 2WGXA 1H9DA 3WTWA 1T4WA 2X0UA 4IJTA 1LJMA 3D0AA 1IO4C 2BIOA 3ZMEA 5KBDA 2AC0A 1HJCA 1YCSA 5AOKA 3TS8A 3Q05A 3WTTA 2GEQA 2XWCA 4LO9A 3QYNA 2BIMA 4QO1B 4AGNA 5G4OA 2J1XA 2BIQA 4IBQA 5A7BA 2FEJA 4HJEA 1CMOA 3D09A 1E50A 1TSRA 2P52A 2AHIA 3EXJA 4GUOA 4L0ZA 4IBTA 2BIPA 4AGOA 3WTYA 3D06A 3WTUA 2J1YA 3KMDA 3US1A 4MZIA 4A63A 4IBUA 3Q01A 2PCXA 1EAOA 5LAPA 3QYMA 1HU8A 2IOOA 2ADYA 3WTVA 1UOLA 5G4MA 5AB9A 2H1LM 2J1ZA 3D05A 4G82A 2VUKA 1HJBC 2MEJB 4AGQA 5AOMA 5AOLA 2IOMA 3Q06A 4L0YA 4XR8C 4MZRA 2IOIA 4AGMA 2J1WA 2RMNA 2XWRA 4LOFA 3VD0A 4IBSA 5LGYA 4IBZA 1TUPA 4IBWA 3WU1A
chains in the Genus database with same CATH superfamily
1CT8B 4Q6IA 4YHOL 2AJVL 5LWYH 1AO7E 4HGKC 2P8MB 1M7IB 3BDXA 1T0PB 2D3VA 4U1HA 1H6UA 3WEXB 3AM8A 3GMMB 1FFOB 2BIIA 3KVDD 3QT2A 1OHZA 3FUHA 3L5IA 2IH3B 1NGPH 1QNZL 2X2IA 4DKEH 2O61A 4X6EA 2I69A 4V1DB 3S98A 3HNSH 2DQJL 1BXAA 3LTVA 3B9EA 3QH3B 2MPAH 4G8IA 4NQDE 2W0PA 5EUOE 4UT9A 5EU6E 4G8GA 1H6TA 3J27A 3GSRA 4Z7QE 2XSKA 4XP9L 1G7QB 3C12A 5B1CA 1N0LA 1MZZA 4UT6A 2VCOA 1P5UC 4XX1G 4CSSA 5T1DH 2A9NH 4CADB 4WFGE 4ANKA 1XGTB 4OFIA 5DT1L 5C3TA 5CU5A 4ZNEA 5C1MB 2CHWA 2LQRA 3DC0A 1I8LA 5I0WA 5F0JB 4KQ4H 8PAZA 1WZ1H 3IGAA 2CO1A 5HVHB 1Z0MA 1JPGA 2HFEB 3PHOA 3VQ1C 4AYFA 4LDLB 4ZFOL 2WWOA 1XD1A 3JTSB 4LDOB 2EUZA 4PWEA 2BIMA 1D5XB 3L3KB 3NPSC 1NAMA 2A38A 1AQKL 3GDBA 4ODXB 1NIDA 4WTZA 4DTGH 4DPAX 1QX1A 2Y06L 1QSEB 5E2VH 4X6DA 3M8OL 4AMKL 3CSTA 3QC6X 5I71C 2R0LH 4UAOB 4M48H 3MRPA 4ATWA 4OCMC 2XZZA 1BLNB 5IJKC 3HUJF 4G8EB 1IJNA 1U30A 2YJQA 4GRMA 5JXAH 1L9TA 4FN0A 2JNZA 3ULUL 3TU6A 4W68A 5FYJE 2B0SH 4K73A 5L6YH 4G80A 3TBSB 1IC7H 5I30L 3LKSB 4WGKA 3TV3L 2E9WA 2R4SL 5DFVC 5K93A 3N1QC 3CAFA 1ZGLP 1XL6A 4MB1A 1BQHB 3T77A 3RY4A 4MDRA 12E8H 3U9UB 1QLFA 1MOEA 4ICXA 3NABL 3CN3A 1U8KB 5IUSA 4NZTL 4P2CG 4DUXA 1ZA3B 1QQDB 4NCDA 5ID1A 4HEME 3D85D 1RIHL 4F2FA 4JQXA 1X5HA 1CGSH 4XN8A 1IM3B 1V3LA 2QTVA 5CBEA 3MLWH 5IQ9A 4XC1H 2EIZB 3A6OA 3TL5A 4QPEA 2EVHA 4F33A 1DEEA 2JKTM 2NX5E 5EIIA 1YN6B 2L7EA 1K3IA 1UZ6F 1AGDB 1KTLA 4NWUL 4Z7WA 1FN4A 4FKHA 5K9OB 4OBRA 3QORB 3NCYS 3MCKB 1RIUH 2V2XB 3W9DA 2JB5H 4ZMPA 1J12A 4L4VD 3QFJB 5ICZB 2BINA 1BFSA 4RAHA 1MQKH 1MHEA 4WK0B 2DLHA 1JZJA 1B90A 4FXTA 4KGJA 4KNTA 1B2YA 5F93C 2QL1A 3TBCA 3ZU8A 4LGSB 4WDIB 3N85H 3IJHB 1H8OA 5CINH 3QHZH 4I9WE 1IGFL 2Y3NA 2ZOTA 5F1SA 3PL6D 4N3UA 2DIEA 1JD9A 1HDMA 2DPKA 4JR9L 3VD2A 2Z7YA 4M1GH 2DWEB 3L7FA 3IKCB 5ACZB 4JPWH 5CJXC 4M6AA 1SLUA 1KXHA 4FQCL 3I9IA 1IQDA 1P5VB 3TIDA 1LE9A 2KLSA 4KVNH 2DQHH 3C6SB 2X4OA 5IM7B 2BMKB 2WQUA 1TTRA 3OAUL 4P9HC 5ICXB 1WUZA 2PP7A 1T1WA 4Q0XL 3WN5A 1P5UB 1WE5A 4UQDA 5A2AA 5A2IH 2MOGA 5CBAB 3G6JE 1E6OL 1ORQA 1HH6A 2YBRA 3B5HA 5BJTB 2YPVA 3DMMD 1WG3A 1IZJA 1CLOH 5T5FL 5IBLD 5KVFH 4N0UE 2E7CA 2Q8BL 3MGOB 1A7NL 3MR9B 4HIXH 3SE9L 3O8XC 3RGVC 4QKXB 2VAJA 1SOSA 4YSOA 1DE4A 3T9WA 4BA0A 5KSUA 2D0HA 4KZEH 5EN2A 3TPUA 5A6IA 4WW1A 3QAZC 2BFGA 3NPSB 1Z9OA 3D18B 4ZYKA 3KS0H 4CKQA 1CVSC 2X41A 3BKCL 1KLFA 4Z78B 4IMKC 2P5EE 2TSBA 5JOFA 2YAHA 4G9DB 5BRZB 1KUMA 4D0CB 5I71B 4POYA 3MV7B 1TMQA 1X5LA 4LLMB 4EDXB 3L3GA 1P2CA 2PTUA 1JXJA 3AVEA 3VD4A 1KENL 5J0BA 2R29H 1T1YA 4I4WA 4HJIA 4PG2C 5IMOA 1G6RB 3SKJL 1RQ5A 1S9VB 1TZIA 3ZUCA 4ABUA 3WKML 2BP8B 4QJ4B 4XRCB 2JQAA 3FK3A 1CGVA 1NDGA 5BZXA 1XR9A 3ZKNC 1O5PA 3I75B 3H3KA 3T3PF 2CRYA 3U9PH 3V4VA 4MMYA 5AW3B 4AQ8C 4PWGA 4DK5A 3PV6B 2HXAA 1MAKA 4TPRL 2FWOA 3ZQ9A 2IPTL 1TUPA 4AQEB 4I0PD 1KG0A 4RX4A 2E9GA 5CGYD 2EKSA 3FF7A 3V95A 5E5MB 2O5YL 2IMMA 4LOEA 1N6QH 5C71A 1UH4A 5LG1A 2VDOH 1C08A 2D4FA 1N64L 3KJ6H 3GK8L 2EJ1A 3CZKA 1G7LA 3GUFA 3O81A 4IHBA 1FUNA 5DK2A 4E9LA 3FO1B 1B0GB 4KUCF 1BJMA 1Q8MA 4UNVA 5ILTH 2H0JA 5JQ6L 5FDWA 4G7QB 5IQNA 2ZOKA 4OZ4B 3QUYC 1MZYA 1MXDA 4JRXA 4UIKH 4DKDC 3FQTB 4QOKA 5EBGA 1Z9SB 3M7OA 1TKWB 1ZMYA 1CN4A 1LP9A 1TTGA 2VC2L 1JGVL 1UM6L 4JDZB 4OZHB 4YDIH 1SBBA 2FEEI 4LSPH 4KI5E 2PYFB 4UDUA 1ZVSA 1C5DA 2NY0C 3FQ2A 2YK1L 3WJJA 4S11A 5L2KD 1VCAA 3PQYA 3JV5A 2BC4B 4GFTB 5DUJA 4YN3A 4XX1E 4ZUSA 1BEXA 4K3EL 4XXCA 3MI6A 4M02A 5MERB 4OCXL 4CMMB 5HYQA 1E9QA 2YN3A 1WEJH 3T8XB 3IU4L 3QP3A 4L3CB 3NZ8A 1BZ9B 3QDGD 3ZIMA 2B1HH 43C9A 1P1ZB 4ABVA 3IDJB 2JIXA 4NDMB 4R2GD 3REWB 2DQUL 1VJSA 1RXLA 1U8QB 2VXTH 4Z7VE 4LU5L 3UTTE 4O9HL 4L4JA 2Q6WA 4LMQE 4GUOA 1ZK5A 3HS9A 3BH8A 1BQ5A 1XCQB 5DJ2A 2BVTA 1R3KB 2KH2B 1YRKA 5C0BB 5JYLA 1CLVA 2XRAH 3QRGL 3VFWB 2DM4A 2BFVH 3FFCA 3O8XB 3RGVB 3LNHA 1C16B 1YECL 3WMQA 5IMLB 1RVFL 4I2XA 1ZWIA 4O2FA 4JK0D 5F7UA 4TVPH 5A2CA 3CSGA 1GGTA 3QAZB 4K5OA 1M4KA 1X9UA 3GRGA 3C6LC 3N06B 3L9RB 3FZUD 4AUJA 2L7JA 3WJLA 3PUCA 2JQMA 3GO1L 1WQVT 5F89B 1QPXA 4UQEA 1OWWA 4QXWA 3RIAK 2FD6L 5L8KB 1KYUA 5F1KC 1F86A 3DRQA 1YYLL 3MX0B 2W9DH 1WTGT 4OF5A 1YDPB 5DMYA 3CZJA 1IKNC 3II2A 4MNGA 3EOTH 1EHXA 2E6PA 1R17A 2XKNB 1X9QA 4KX7A 1WP6A 4E41E 4NJAH 3IS0X 4U6HB 1U33A 2Y07L 1XGRA 4QHLA 2XWJB 3VI3B 1Y18B 2MTPA 3RVXD 1K4CB 4TQPA 3N0AA 2D3NA 5HYSA 2YGNA 2LLLA 2PUQT 2DKUA 1A2YB 2B4CH 3L3OA 1NBYA 2MNJB 2LE9A 1PCSA 4EUPG 3DDGA 1U8CB 3ZO0A 3EUUA 5D7LB 2JCCA 2Z0UA 1M56B 1ZT4A 2EVJA 4FXKC 5BZDB 3BW9B 4MD0A 3IJYB 2FR4A 4H8UA 4KOCA 4XHJD 1X7SA 3JV0A 3RBGA 2V17H 3S9DB 1EFXA 4L4TA 3UO1H 1HCFX 3PU7A 5DRZB 1K5NB 1RU9L 4GSUA 2QQKH 3KL3A 4GG8B 5FW8A 4JCLA 4UILL 4C47A 4ACPA 4YDKH 4OIFA 1RZ7L 5AKSA 1T5KA 1K6QH 2PO6D 4X80H 1P6AB 3ARUA 4M5SA 4NQEA 2ADIA 2XXFA 1A7PH 3BRGC 3T0EB 3OKNB 1FP5A 1HTYA 4WY7L 1J0YA 1J87A 4OGYL 1EX0A 3EGDA 5BZZA 2NY0B 3W38A 1G7IA 4H1LA 4ALAL 4GUPB 5MP6H 4Z77A 2G5BA 3IFOB 4XTRC 5C6TL 4IBQA 5F97E 3WIHH 4DP1X 1C8PA 3MMEA 4JJHA 3OZ9L 1YEKL 5I1HL 4OKVA 2H6PA 4N87A 2FBOJ 4YX2L 5CCKH 2E0PA 1FZKA 1HHGB 2QQQA 4RMWA 3SE6A 4OI7A 3AUVA 2Q87A 4FI7A 3EJSA 4RQQA 2FBJH 5FF6A 3OB0K 3U0WH 3L7EB 1GA2A 3EG9A 32C2B 3HB3D 3QUZD 4JBSA 5EOTB 1BZQK 2DTSA 4LLQA 2X4RA 4F37K 3SYQA 4KHTH 3TVMC 3PABA 1UKQA 3SD2A 2ROYA 5EEUA 3ZTNH 1I7RA 4EF3A 1VADB 2GBAA 3FB8A 1FVEB 2ID5A 4JFSA 4WI0B 3VGBA 1D9KD 2RGSA 1LO0H 3O6MH 1YMME 4EI5A 3BUQA 1U8PB 1RV6X 2HWZH 3VWKD 2B9BA 3QIBA 5JHAA 5BOPA 2XVKA 5F7LB 5E08L 1ODAA 5ALBL 3GWJA 1XIWD 4DOHB 4XBGA 3BH4A 3T65B 3T6VA 1E67A 1SYVB 3ARFA 3KPMB 4BFFA 1TVBB 3NP4A 5IIEB 2E56A 5EF2A 4P3DA 4P2OC 3C6LB 5DQ9B 3SGKC 2IBBA 4Q7DA 2I26N 3RZCC 5GGQL 1FO0H 3S4SA 1MRCH 2YOAA 3L3IB 1ND0A 4JFOB 4ELKA 1OAQH 4YNYB 3TTYA 3PAUA 4WI3A 4P99A 5ISZB 1NFIB 2DLGA 1AQHA 3F84A 4UUJB 2L4OA 3SOBH 4F92B 5F0LB 3A21A 3DO3A 2FL5B 2QSVA 3CC1A 4MJ5B 5DVOA 4HKXB 4OCSL 1ILSA 4AEIH 1KCBA 1PNDA 3FT3B 3MLRL 4CU7A 1N8ZB 1UC6A 3GLDA 4D9QE 1A3RL 4FCHA 4JZJA 5IQMA 2EVGA 4K0OA 3ABZA 3CV5A 3TC9A 1LM8V 4W70A 3SEPA 2VDRB 4OI9A 2RR3A 3IDMA 3HZVB 5HPOA 1UKTA 2Q86A 3ATEA 3KHQA 2UVFA 3V5DA 3PDOB 3O45A 4HJUA 2YMXL 2HRLA 2ENJA 1MWAH 1PLGH 3L4CA 5CLWA 2V2WB 1CDYA 3QXDB 4FXKB 4PYHA 1SJMA 3LB6D 1EK3A 4QRTB 4PJHE 2OTUA 3B2MA 3KXFB 4M29A 2R39A 3HRPA 3D4GA 3DO7A 4L8CB 3GSUB 4OZIA 1CFQB 2MCG1 2FT6A 4AGNA 3QO0A 3GMRB 5HYJE 1OSEA 1E4KA 3OB0H 1X5XA 4RGMC 3CN1A 4ZX6A 2HFTA 4K9JA 1FL3B 3BYTA 2A5UA 3IEAA 3VD9A 4P2RD 4HK3N 2ITCB 1NCTA 1OF0A 3CFMA 3BPCB 1PX3A 1ZT1A 1FLTX 1FRGH 1I9JL 3PHQA 1SXAA 1V5JA 2YQ2A 5IHUL 3EBAA 2HH0L 5DVLA 3HG1B 1F41A 2IG2H 3PP3K 4ZI8A 2NZ9C 3HS0C 4DH2A 4MD4A 1OGPA 3D0LB 4MB3A 2X1WL 5DJCB 3QCVL 5L88L 4FQLL 1Q9WA 3HC4L 1ACCA 3Q2VA 1TTUA 2ODHA 4PS7A 5F9JB 4FDWA 3VFGH 2AI0L 2HLEB 4PJIA 3KLLA 2VN4A 3V9EA 1K8IA 1D5BB 1KPUA 4QXUH 3TVMB 5EF1A 1W8OA 1MAMH 5C09D 1G9NL 1F4XL 3NAAH 4HLJA 5BS0E 3U6RA 4MS8D 1JPSL 1IM9B 2EXTA 1RZIA 4PRBA 1JYWA 2X3AA 1IEBB 5AW5B 3QJVB 2XWBA 4CVWA 5DJ6B 1K4DB 2XUWA 4JY5L 2DQ6A 3DBSA 5CEZH 5JW4M 4Y7OC 4P3WA 1LO2H 1UJTA 4DW2L 5IB1B 4PWHA 3HPJA 2VM3A 2J55A 4ZK8A 4P2OB 4XPBL 5DJDB 3RZCB 2XTLA 4GRWF 3DMMC 5EF3A 1CTNA 3G9AB 2IGFH 3UMTA 1U8LB 2BSRB 5B7MA 3RHWK 3VMPA 4XNYH 1T7XA 4A7VA 3QNZB 5JLZB 5E99L 2ZF9A 4LLDB 1LTXA 3KNBA 1NC2D 3NCFB 4XP1H 1A66A 4PP2B 4EKJA 4H8HA 3DX8A 3MRQA 4C59B 4N25A 3EBHA 1UHVA 1VACB 3UL4A 1R47A 1SPDA 3NT0A 4GEIA 4LKXB 1C5BL 3X1BA 1NCOA 2XX0A 2GJJA 3IK2A 2EUVA 3CXDL 4XNUL 4MDJB 3GXPA 4TNVF 3SJVE 5CN2A 4TSCH 1H9VA 3AREB 3U1QA 1QWUA 4HWUA 1AO7D 2XXCB 1VHPA 2D8KA 4BXVA 4PGEB 4WW2C 5GGSY 1PCXA 1E7UA 2HPTA 3EOAA 2I27N 1UOKA 3IJSB 4WUKL 4L3FA 1PZ2A 1HEZB 4J23A 2XPGA 3TYFA 2Z1KA 2KDGA 4NUQA 2AQRA 5I5JA 2FBRA 3KCWA 4B9IA 3QCTL 4M3HA 5LLIC 1NSNL 4PGDB 3CX5K 3ARDC 1DJIA 2OL3L 3T1FB 5C0JB 1JHLL 2YMOA 3FAWA 1F90H 5EU6D 4TSAL 3QEUA 2BNRB 2C1OB 5CD5C 5IQ7L 4OKDA 5CR1A 1E9OB 1YNLH 4G43A 3BP5B 5SWZE 2XT1B 4IBTA 2AABH 3HVNA 5CGYC 5DSCB 4FFYL 4FFVD 3O11A 3WNIA 4RZKA 5LAXA 4WFGD 4JPKL 3WS6C 1BWMA 1UEYA 4RGMB 5GS1C 2MRYA 3WIIH 1I4FB 1IBGH 4MWFA 1J9SA 2G2RA 4M7LH 5BVPL 4FQHA 2HT4D 1KJ2B 3O3AA 4JFQA 3TYGH 4GXVL 1S7XA 3MNDA 3BWAB 5LAPA 2P8MA 1M7IA 1H3UA 5B1KA 2OJEB 3UAEA 1MHHB 3WEXA 3DOSB 2E7BA 4TSBL 4YSCA 2CDEB 2QDWA 3GMMA 4K9EL 5C7XH 1MLBA 3HG4A 4FHJA 2DQCL 4IOIB 5D7IA 1PW3A 1GGIH 2IH3A 4F27A 2P5WB 1Z5LA 3BZFB 3SYAA 4V1DA 5JZ7D 1GGCL 2BZDA 2XCMC 3HS0B 4LRIA 1S9KC 1E4XH 1I9RL 5LQBL 3MV11 1AQ8A 4HBCL 4ONFL 5HYIA 2ATKA 4PRPB 4TTDD 2CCVA 4AKQA 1G7QA 1HI6A 2E7DA 4RMRA 1SDAB 5FYJD 1JWMB 3FTZA 3RFRA 2E86A 4G7YH 4K3HA 1WS7A 4CADA 4ODVH 1XGTA 3PGDB 2NYZA 4D9LL 4WNQB 1T6WA 2HFGL 5DLLA 3LNGA 1JNLH 3PPEA 5IBTH 1KEML 1MSPA 4JHWL 5C0NC 4QMEA 2HFEA 3DUUB 3PWUB 4OT1H 4XWOC 3S35X 2HT2D 1CIUA 3W5MA 3RKDC 2GQHA 5I15H 3JTSA 3TTSA 4P8QA 4XPAH 4KRLB 5AFAA 2XZQH 1D5XA 4ODXA 2F54E 3LKPB 2NY2B 3DMMB 1AIZA 1PKQE 4XWGL 2A1WL 1CDUA 1QSEA 1RFDH 1N7MH 4F3FB 5JA8B 1PEWA 2BVPB 3EO0B 1S3KH 2VR7A 4NKMB 1HILA 1V8HA 4NNYB 5LBSH 3OWRA 1BLNA 1MFDL 3QYCA 4BFOA 4QRFA 2ZCHH 5C07E 4H20H 2YPKA 5GRYA 3UPRA 3MJ8B 3LOWA 1K85A 4H0GA 1IVTA 2NY7L 3KYNB 4X2UA 2XFXB 1EVUA 1JFQL 2ENPA 1KTBA 1DDHB 4QO1A 1I8MB 3LKSA 1DZBA 3K1KC 3N04A 2VMJA 1KFAH 1OE3A 4LHUG 1TQTA 4HC1H 4WW2B 1BQHA 1FC1A 5DD0H 5E6SB 3MV8B 2VLJA 4F7KA 3U9UA 4H8WC 4OZHF 4EE2A 4KFZC 1NBVH 3JV4A 4FNPA 3SCMD 3I50L 5IVOA 1ZA3A 1QQDA 4YFDB 1YEIL 4ZMLA 1U0QA 4W6YB 4YBHA 4OIAA 2YD2A 4Q52A 3QK0A 2XNAB 3ETSA 4HJSA 1ROCA 3ARDB 3O2DL 4OZGE 2EIZA 3FH7A 2WSKA 4ACTA 2E7LA 2RACA 4YHLL 2WIIB 1YN6A 1IIKA 1AGDA 2VR3A 3EHBC 4Y9BA 4JPIB 3L5HA 2Y7NA 4AG4L 5K9OA 3QORA 1J5OH 3BSGA 2V2XA 2K3HA 2CPUA 1XGZA 2Q8AL 1QSFE 5KS9B 4I5BB 1QWNA 5E6IA 5ICZA 5GS1B 4OR1A 2WXFA 1OAKL 4PLOB 4XHJC 1J48A 5KUMA 1SY6L 4EI6B 4CC0A 6PCYA 3BI9X 2P42B 5FO7B 3RB5A 4ERSL 4HUVB 3F7RA 1BZOA 4X6CF 5T3XL 3WKPA 3FS9A 5EEVA 2BM3A 4KXZH 3KH3A 3ZMRA 3IJHA 4C4BA 1MG3C 3GHBL 2BJML 4TRPH 3QDAA 3WFDH 1NL0H 2PO6C 1SVBA 4FF9A 4EDWL 2P5ED 3OKOA 3QWRA 1TZ8A 1EUTA 3QISA 1JGEB 3CZEA 1FH2A 1IGJB 2DWEA 5ACZA 3IKCA 1HAWA 1E27B 5HJGA 3U1PA 1XGUB 5L2KB 4LCVA 3C6SA 1ZJAA 2MQCA 3F6IA 2BMKA 5IM7A 2G2NA 4HIIB 3DVGA 3ZZLA 2X87A 3D9AH 2IADB 1P5UA 1P7QD 6FABH 1W0WA 5CBAA 3L13A 5AW1B 1PY0A 2ZG2A 3OVUB 5BJTA 1QLEH 4LRNH 3ABKB 5KTEH 2IDFA 5AVRB 2Z35A 4TULH 1YEGH 4D8OA 3WNOA 2CBQA 2LABA 3MR9A 5F9WC 4W9CC 5CF3A 4N6QA 3QUZC 4ODSL 4BE5A 3VI3F 3ZZSA 5JPMB 4G7VL 4EJ1C 5KVGE 4D2NA 1EMTL 1IZKA 3D18A 5DS2A 4JFZL 5C08B 1AZUA 2DWDB 3O3EB 2UVEA 5AL8A 2BIOA 4Z78A 3OWEA 4NAMA 4G9DA 5BRZA 3VWKC 4DWHA 4D0CA 1ZTMA 4P59H 5IHWA 4FCAA 3STZB 3MV7A 4EDXA 4G59C 2ZXBA 1XIWC 1HCVA 1V7NH 1W6WA 3VFSA 4F9PC 1QEXA 1L0YA 1FNSL 1VKXA 3KCPA 1GS7A 1J86A 4S1SH 3V79C 1A7QH 1GKOA 1N5AB 2VITA 4OZFB 1S9VA 5AKVA 2E27L 2BP8A 3FKUS 4XRCA 2VXSL 4I85A 5HDOA 1PZBA 2C3VB 1OTTD 1THCA 1A7RH 3UOAB 4PRDB 5BXFA 4D3CH 4QRPB 4UQ2B 2D7QA 3TFBA 3CFCH 1JZ4A 5D7SH 3T0WA 4LVNC 3UYRL 2VWEE 3K0WA 2X9ZA 3PV6A 1BP3B 4OLUL 1XTLA 3MRKA 4X98B 3M86A 2G30A 2VABB 3PE9A 3TO2B 2X12A 5E5MA 5FFOA 4M93C 1MW1A 1GC1C 5AB9A 3FT1A 2GHWB 1GAFH 3FTYA 3UPCA 5EORL 3FO1A 1B0GA 1FG2A 2F1AA 2XTJE 4AL8L 4PSRA 4AGQA 4ZXBA 3EHBB 2AS5M 3S2CA 2H4EA 3UTTD 2PPAA 5PAZA 1VFOA 3KHOA 2V6HA 2P7TB 1VRSA 3ZGIA 4OZ4A 3EYUH 2BW5A 1ZLVH 4IOSA 3DJRA 4DGUA 2WW8A 3MUZ1 4B9PA 1NPUA 1J0KA 1OAYL 1Z9SA 2ICES 5D2LB 3BT2L 1KIUB 1TKWA 4XXWC 1TLMA 4U3SB 3BSZA 3FQWB 4JDZA 1DLFH 1MCPH 1M3JA 1WC7B 2AEOA 2LFGA 4M7LT 4N2DA 1ZHKB 2JKSA 3T2OA 3CZSA 1MCRA 3P3RA 2VL4A 2QVIA 5H37A 2BC4A 4QRQB 2LU4A 3EZ8A 4FHKA 2OCJA 3IT8D 2PO6B 4IKLA 1KCRH 4HUMB 3CXFA 3U0PA 2HLAB 2EUWA 5MERA 4PQXA 1DVSA 2E4TA 4R4FL 4CMMA 2R0ZL 3ZUNC 4L3CA 2VLRD 1BZ9A 1WZLA 2FB4L 4L8BA 3FU5A 1A6ZA 5FUZH 1P1ZA 3WL9B 5AW9B 3KLKA 3IDJA 4WWKD 3WO3B 4NDMA 1L7TL 5DUML 3REWA 1QHQA 3GXMA 5FGCE 2BVOB 2WINA 3Q6FB 1EUUA 5CP7B 1DANT 4E41D 1AOZA 2FYYB 3INUL 1XCQA 5FYLL 3GXUB 2DBLL 2CU9A 1A8JH 2I07B 3ALXA 3UJJH 2YAPA 1R3KA 5D2NE 4ZO7A 3RBSA 5C0BA 3RWFB 3US9A 4ADIA 1ZDQA 3VFWA 1OARL 3L4XA 3ME0B 5F9WB 5GJSL 3RGVA 1C16A 1TJXA 5LGJB 1BZ7B 4XPTH 3QUZB 1J1XL 4PB9H 4RRPM 3TN0D 5IMLA 3HI5L 4YOKA 4NUGL 2G3MA 3KAAA 3E8UH 4NO5B 3WFHA 3MUHL 2VERN 5DVNA 4WJ5B 4OF7A 3NACL 4E9VA 3L4YA 2DICA 2J25A 2EXYC 3L9RA 2R8SL 2QGBA 4FULA 4IMKA 2B3IA 1HVXA 1ET5A 5F89A 3S5LG 3VWKB 1ZTXH 4OGXL 1IQWH 5E2WL 3PWPE 3V4PL 4MHHG 1OPOA 3B4NA 3FTSA 1LEIB 4NKQB 1EZVY 3MX0A 3NIGE 5DRWA 3T4YB 1SYSB 3US1A 3ZKMD 3L16A 1IFRA 4LL1A 2XKNA 4NWTH 4JE0A 2FVNA 2PW1B 4U6HA 1TCRB 2EECA 2XWJA 4PG9B 1ID5I 1EA9C 1MCCA 1Y18A 4TL4A 5C0GB 1K4CA 4FG2A 1OOWA 2P46B 4LVNB 4AQ8A 5TE4H 2Y24A 1LO3H 2A4CA 1A2YA 1AR1C 4RNRB 5T5NG 1EZLA 3DPDA 4ELME 3VXPB 5EEYA 4XAWL 5I1JL 5D7LA 4DVRL 3P0YH 2FX8L 1ADQA 1SBSL 3SQOL 1TF4A 5BZDA 3SDXB 2XG5B 3BW9A 1KY6A 3I2CL 1F45A 2YA1A 1YAZA 4S1RH 5IOPA 4PRHB 3UTPE 4Y2NA 1K5NA 2BY2A 4IRSD 4MXVE 4RMBA 3UG4A 4BFIB 4NAQA 4GG8A 4ODBD 3BO8B 4XNDA 4JRFA 4L5FL 2B1AL 1BAFL 4HKBB 2LU5A 1JZIA 4PJXE 1N5YH 5AWNH 3DXAE 4JFYA 2CNZA 3FT0A 3QJRB 4A6YB 1YMMD 4JHAL 1AZCA 3QQ4B 3ZE1B 1FNLA 3T0EA 3OKNA 2ZNWA 1JAEA 4RGOL 2Q0ZX 4YXLH 1SZNA 1VGEL 4GUPA 3FU9A 1EO7A 3QO1B 3IFOA 4UTAA 4FFVC 5ADPL 4H1LH 1YQVH 2EDOA 4ZNCD 1CFNB 4KMTH 3ZRCC 1PJWA 2OCCB 3DGGB 3MLZH 3QIUB 1NWPA 2VXQA 4BV1A 2HT4C 1XCTB 1GGYA 3S0PA 5GISH 3CVIH 3CZNA 1H9DA 3WTWA 2X4QB 1TITA 3CVHA 5DJ0B 4Z8FL 3L7EA 3P4LA 5INDB 32C2A 3EJPA 2FX7L 4AENB 3MREB 4WTZG 5EOTA 1WAAA 3F6JA 4D9QD 4CVXA 2KZWA 2GKIA 4ZPTB 1FVEA 2XWCA 4X4XB 4WI0A 3BN9D 1IARB 2VDNL 3PWJB 1MCQA 3O2WL 2VXVH 2Z4TA 2AEIT 1QFUL 2AQQA 2G75B 1U8PA 3FBQA 3H3PL 1ASQA 4H8VA 2DH2A 5DJZB 4OFDA 5CILL 3KR3L 3T65A 4ZUWB 3G5WA 1NFDB 3KPMA 4N90E 1TVBA 5IIEA 5IW6B 2OAAA 5DQ9A 3O6FD 1WA2X 3DJTA 4MAUH 4E9SA 4ENEC 3IMUA 1AYRA 3L3IA 3BD4A 4WWID 1KCUH 1DVFC 4HLEA 4HUNB 4PVMA 1OTUD 3QUMB 1MKFA 5ISZA 1NFIA 2NY5L 2ZWLT 3QIWD 1S7VA 4BZ2H 1MJ7L 1T2JA 3ELQA 5B7FA 4PJFB 4UUJA 1VZGA 2O5XL 2WZPD 3FFOA 5MEPB 4Z3IA 4HK0B 5G4MA 1ZV9A 2FL5A 1KB5B 4MJ5A 4HKXA 5HYJD 3QEQB 3AG3B 3NK4A 1N8ZA 5B8CA 1DSYA 2Z31A 2EDMA 3H53A 3RVTD 5CHNA 1JF6A 3R06B 4OGZA 1B3JA 2AFNA 1MJ8L 1G6RL 3ZXAC 1MFAL 4DP6X 1PG7X 4QRBA 4JANB 1XSKA 4LHQB 1AR1B 3A67H 3H6AA 2YKLH 2UV3A 4LIQE 2Q3AA 3F04A 3H42L 4FYSA 4N8UA 4LSUL 3PDOA 1CR9L 1W80A 1CD8A 3N40P 4LDEB 4YHKH 4CVZA 3U7YL 4EBQH 5KVEE 3ILQC 2V2WA 1MW0A 4NBYB 4KMQA 3QXDA 4FXKA 3ZE0B 3AY4C 2ZAGA 2CG9X 5IMMB 3DSFH 4YGVB 5ICYB 3ZDXE 3KXFA 4PMEA 2OYMA 2BY3A 3GMPB 5B38G 3VSVA 4H4NA 1AG6A 4L8CA 4QEGA 3GSUA 3ML9A 2A73B 1DBJH 1CFQA 1MEXL 3HJ0A 5BCAA 5BS0D 1ZEAL 1W91A 2QJDA 1I31A 1GPOH 3U7WL 1EXHA 1OAUL 1BF8A 3D33A 4Y16D 3LQAH 2EDHA 3X3FL 2JV6A 1FL3A 1GZHC 1BM3L 1GRWA 1CLCA 1QBML 1RP8A 2CMRH 3BHBB 4FQJH 4NOBA 1JDDA 2BSCA 2FT7A 3MRRB 4N0YH 2Q2EB 4Y4KD 5LKNA 4NNXB 3ZYOA 1LEGA 3RL1B 5AW2B 4JJOA 1QEWB 3SZ6A 2YD7A 4JGNA 1KN2L 5C70A 4RISL 1KBPA 3DPBB 4L37B 3D0LA 3FUKA 2J6EA 2FZ3B 5DJCA 1U92A 3TT3L 4PVNA 2F08A 3L9EA 4PS4L 5FFLA 2WLHA 5F9JA 2ZYIA 3C5ZC 1BZEA 1LDSA 4EUPH 3VI4A 1WYJA 3TVMA 2ORBH 5KJ7E 5LXGL 4WEMB 4K5MA 3J8F7 2J5LC 3FHAA 3A24A 2ZUQB 4GIOA 3FTXA 3SJVD 3RPKA 4P9HL 1IM9A 2WSDA 1IEBA 3X3GL 3MFGB 5K5YA 1JG9A 1QSVA 1QBLH 2MOQA 1K4DA 4M6ML 4NZDA 4X42A 2VW4A 2PMZA 1MCWM 2P44B 1UXSB 4GW1B 5SX5K 2QQLH 5B21A 1JNNH 2AQ3A 5F7AA 1W72H 4H88L 1G9MC 4P2OA 4WU5B 4WW2F 3CN2A 4UM9A 5DJDA 1RY7B 3FN9A 4BUGA 4RIRB 5AAMC 1U8LA 2BSRA 1XF1A 1DVFB 1MREL 1XQ4A 4W93A 3D39B 3QNZA 5JLZA 1LWJA 4PJEE 4OW6A 1TTCA 1TJIL 1TQUA 3EYSH 3S34H 1CDJA 3FB6B 5SWZD 3BSHA 1KGCE 3WAJA 2BSED 2XWRA 1VACA 4PJBB 3RE0A 4N8VG 1FORL 4EN3C 1O9WA 4LKXA 4IIQC 1BREA 5CZXD 5HJDA 2X88A 1DN2A 2ADGA 5T3ZH 15C8H 2P9RA 5JORB 3KZ8A 1BF2A 5KS9F 4F7CB 3TIEB 3AREA 1JHKL 2QPDB 4LCUA 4NB7A 5F7NC 1Z0NA 4ZO6A 5ANHA 25C8L 2O1AA 1RSYA 4PGEA 1NCAL 1VZHA 3SPGA 4OF8A 3UIYA 3FPXA 1KBGH 3ARWA 4IEFB 1CD0A 2RIKA 3IJSA 4S1QH 1KIRB 5EPMB 3BT0A 4EEEA 2AVGA 2VL5B 3VM5A 2YWYA 4OGQC 2PR4H 4G2AA 2B39A 3QULB 4PGDA 1CICC 2OPCA 4YDLC 5GS3A 1QYGH 1HCYA 3CHPA 3JQOB 4G6FB 4TQIA 3DIVA 3T1FA 1GZPB 3DBXB 4Q9CA 2BNRA 2C1OA 2G3XA 4G5ZH 4QRRB 3BP5A 1E30A 2VRQA 4JM2D 3PV7A 5K9JH 5DSCA 4ZNEE 3GZPA 4PTUB 3Q2LA 2ARWA 2OW7A 2R9HD 1FYHB 5F1NB 5F7EH 1KB9J 1I4FA 4PVBA 1WGVA 2ARJQ 1S78D 1F8TL 1KJ2A 2F74B 4HWBA 4P4KD 4XMUA 4B9FA 1O7DE 5HSFA 1TZHA 4YUEL 2W5PA 1CXKA 3BWAA 5C92A 2O5ZH 2OJEA 5MENB 1MHHA 3AWEA 4P48A 3DOSA 1TR7A 4TNWK 4X6DE 2CDEA 1J0IA 5IB4B 4PCYA 1PGRB 4IOIA 4N0UB 2JH2A 3B3IB 3C87A 2P5WA 3EXJA 2CKBB 1AQDB 4KJWD 3HS0A 3OBAA 2AF2A 3TLRA 3TJPA 4LLWB 3SDAA 4NOFA 3L2NA 4X9BA 3ECBB 4TNVK 2IPUG 2VZSA 1UZGA 2AK4B 3C5ZB 2AEQL 3E38A 4JHBA 4MXWH 4FP8H 2ITEA 3LIZA 4PRPA 5C07D 4H8PA 5B3JE 2F58H 5LDSA 1M6OB 2ALAA 1JWMA 3C2SA 2P5EB 2J5LB 4MKTA 1NCUA 4F8NA 2BX5A 3MROB 1KLGB 3RA7L 3PGDA 3VG0L 5GZOD 2PN5A 1X6NA 4PLJC 1IBBA 5CFAA 2W95A 1YUHA 2H8PA 4WWKC 4G6AD 3PWUA 3DUUA 2EXWD 3JWNH 2KZBA 4EAEA 3BX7C 3ZRSA 2X4TB 5T33H 2PWDA 5J1TC 4X9FA 2UZXB 4S0HA 4GW5B 4LQ1A 2OP4H 4NQVB 4G72B 5DMIL 4CVUA 4F3FA 2DI8A 1GJIA 3TA3C 2BVPA 3AUWB 1X5KA 3EO0A 3JBG7 4Z95H 3ARGD 3SIKA 3FCSB 4Z7WE 4JFDB 1CJYA 5HYSG 3KWVA 4MJIA 5IROD 1E40A 4NNYA 1IC4H 3TEYA 4KK6D 2KBGA 4H0HB 1QACA 4GXUN 1NGXA 4F2EA 1ODUA 1UCBH 5JHLA 4J6RH 1KCVH 1NIEA 1QSFD 4EN3B 4IIQB 1NOLA 2VOTA 4N1EA 1Y7VA 3HHSB 3QXUA 2Y6SC 3KYNA 3K80A 4LPCA 1P69B 2XFXA 1XF2B 1TEFA 1MNUL 2QPSA 1DDHA 3VA2C 1JGUL 1I8MA 1MG2C 3MJ7B 2I60L 4KKCD 3DVNB 2VDLH 2W9EL 3S5ZA 4OM1H 1CF1A 4WW2A 5D2LF 3TCLA 5JTWA 2L3BA 2KI6A 1UB5B 3MV8A 4N2FA 3ZKMC 1P6FA 2XPYA 2Z8RA 4O5LH 1Q1JL 1V7ML 3REVB 1ZOXA 2AQSA 4Y4HD 1EO5A 3T3MB 3RY6C 1KYAA 5SX4H 2XNAA 4RESB 2HCZX 1CICB 3ARDA 4YDLB 1WFJA 4NHCL 5TE7H 2H41A 3LQZB 2VLKA 1QPKA 4WSJA 5BRQA 4RSVA 2BOBB 4A7TA 1DCLA 3G6DH 5KS9A 4I5BA 4MA7H 4YZWA 3WS6A 5GS1A 3OHXC 3T0DA 3LZFL 3QVAA 1UM5H 2CBOA 4E9RA 3QUKB 4LSSL 3RILA 1WIOA 1C1EL 4I3GA 1OP9A 1JIBA 5FO7A 4Y1AE 4HUVA 1CTOA 1HH9B 1CFMA 4IRSC 3O6KH 4XVSL 3KWWB 5HHME 4K8RD 3LKRB 1SOXA 4XO5A 5GPRA 3N1PC 4NJ9H 1KTRL 1NWOA 2WNWA 3IB4A 2NPLX 4HISA 1MELA 4C4UA 4N9OB 4NQTA 1JGEA 1Q1PA 1DBAH 1IGJA 3OSKA 5A6LA 2W0FA 4NS0A 4JY6A 4HYTB 5A3ID 1E27A 1WBZB 1XGUA 2IDSA 2WC7A 5CCHE 3ZZ1A 1M05B 4LLUA 1DQQB 2EYSB 1SN5A 4HIIA 3R1GL 2F7PA 2XVLA 3E9TA 1Q90A 4JFXA 1NUGA 3QB7C 2IADA 4C54A 1CE1H 1U8MA 2MSPA 3NCWA 5CM1A 3HNTH 4FABL 4OI8A 1ZLEA 1JV2B 1RUAL 3I6KB 2I9TA 4HDIB 4RA0C 1IC1A 4Y2OA 2VLRB 1IKFL 9CGTA 3BXNB 3KEDA 4M03A 1JZ6A 4HHAB 3VNYA 3SBQA 2GJ6B 1DO6A 3J7HA 1U8IA 3I9GH 1H8LA 3P54A 5JPMA 3V9CA 3VXSD 2MMXA 2VM4A 3Q5OA 4FZEL 4OQTH 3HUJE 5DD3H 4Q2ZB 3U36B 5C08A 2F1EA 3EO9H 3PHSA 5TK2A 3O3EA 3TA3B 5HGHB 1YLBB 3IETB 3D2UD 2XTJD 3LKNA 1EBPA 4JFHE 3STZA 4NM4L 1HQRB 4L0PB 4YSUA 1M7XA 4ZMVA 5IJDC 3SDXF 9PCYA 4JRXE 1WD8A 5E56A 2ZWYA 1A4BA 3TBYA 2Y36H 4QOKE 3CDGA 4XMKL 1II4E 4OZFA 2E59A 2F68X 1JYNA 1LP9E 5GRUH 1R1CA 1U3HD 5IVNA 3IFNH 1AKJD 4A66A 3GMNB 1KTDA 1OTUC 2C3VA 3K0YA 1F4YL 4Q4IA 4XCCL 4PRDA 3QIWC 1JXKA 4EXKA 4QRPA 4LXFA 4UQ2A 2E9JA 2EE6A 4GQRA 2VERA 3OQ3B 3V0WL 3L5WB 5AG9A 2CUMA 1MCOH 1X9LA 2HZHA 3KYOB 4IJTA 4JMXA 1SM3L 5CZRA 4H2AA 1VEMA 3ZE1F 1MI5B 2CRIA 4X98A 2H2SD 5DUPH 2NTSP 5BVJB 1N70A 4I9XA 4WKZA 5M94B 4GQ9H 1UACH 3AS1A 1IC5H 3QDHA 1OSZB 3GFUA 5I9QC 3MOQA 5JO5B 1E50A 2I32A 4A2HA 1NLBH 2FGWH 5T1KA 4AQAB 5F70A 2XY1A 1YEHH 5I1IL 2XA8L 5I5MA 1D6EB 2P7TA 4GINA 4YMPA 1HK6A 2ZKMX 2DH3A 3WSQL 3OHXB 3NCJH 3FFCE 1GSMA 4LE8A 4D0BA 1JWUB 4I2XE 5GRJH 2UZIL 5D2LA 4BIKA 1KIUA 2CR0A 2FTAA 4HS3A 3FQWA 3U4KA 1YY8B 2Z7ZA 1KY7A 4HGWB 3VRIB 1WC7A 3KYKL 1ZHKA 4IRSB 2JJSC 2C1PB 1ORSB 4FKEA 3IVKA 4WGVB 1HNFA 3D0VA 4U1SB 5EEZA 2CE6A 4QRQA 3AXIA 4B9GA 2WUCH 1DEDA 4LBAA 1A1OB 4PJAB 1Q0XL 4WHTB 3Q1SL 4FLOA 5C0FB 2OV0A 35C8H 4ZDHB 4JX0A 3BZ4B 5GS0H 4NO2A 3DTDA 1BQSA 3PWPD 2MOVA 5CN1A 4O02B 5C0DB 1MNNA 3WL9A 2HJFB 1UXMA 1THAA 4YHOH 2AJVH 4MNGE 4CGUB 3B3BA 1IBDA 4QXGL 5JPNB 2BVOA 4TVSa 3Q6FA 5CP7A 4PJFF 4NI3A 1H0DB 2DM7A 4KRPD 4PJ6A 2BVUA 4Y4FD 4YHNB 1QNZH 4MCMA 4R7XA 3OMAB 2I07A 4YHYC 3RWFA 2DQJH 4AIEA 4GI9A 4WI8A 2OZ4L 4N24A 3HAEB 4NPYA 4F58L 2NSXA 5BW7A 3ME0A 3MYJB 3EW3B 4F5CE 2ZKHL 3T8VA 1RLWA 1BZ7A 2JCCE 2X89D 3NUKA 3IE4A 2Y7OA 3L45A 3MJWA 3ZK0A 5K9KB 4XP9H 4NO5A 3ZPDA 1BOGB 3EH4B 1BZDA 3ABMB 1LGVA 1RHFA 2W60B 3KPSE 4JJ5B 5CZKA 2R51A 4L4TE 5DT1H 1AQMA 5DMKA 1CTMA 3RTQD 2AZAA 3V7AE 4EIGB 7PCYA 1FSKC 2QGDA 1BF5A 3UTPD 5DU7A 3ZE0F 4GO6B 5JXEA 4L18A 2FSEA 4F9PA 2QFRA 3NRQA 1EGJA 3DDFA 1SYSA 2P80D 5FWQA 3T3PE 3ZSTA 3RGBA 2XXMB 4NQEE 3DXAD 3EO1B 2A74C 4FQXA 5C0AB 2NLJB 3BYYA 2DLEA 3JWOC 2Y06H 1R4XA 2PW1A 3LYRA 4PJHB 3U82B 1TCRA 3M8OH 2JFCA 3PXHA 4PG9A 4AMKH 4HIJB 4UTCA 2OSXA 2HX8A 4HWNA 2PPFA 3BMVA 1T66D 4IRZL 4BK8A 3TESA 4B0MB 3O41B 5E8EA 3VXPA 2P52A 3ULUH 1T6VN 5FLUA 5IVXB 1KIPB 5D1XB 1EDYA 5AVVB 1A1NB 1IIIA 1UA6L 3H56A 3UZVB 1NDTA 3CVCA 1Z5YD 1FF5A 5J6GB 4XO8A 5I30H 3SDXA 4R7LA 2XG5A 3DX6A 2HN7B 2V5YA 5I9QB 3TV3H 1SFHA 2R4SH 3JWDC 2F6AA 4PRHA 4GSRA 5GGUA 4XBEL 2CHXA 4DEUA 4DZBB 4M3KB 3IDIB 1A6WL 5F88B 2XBDA 4BFGA 4MJ6B 3NABH 4FA8A 4HKBA 4N4YB 3BN3B 1BVLB 4L1SA 3M45A 2IGTA 3HMXA 1MCKA 3NA4A 1NTDA 1RIHH 4ORGB 5T1MB 4A6YA 1XAUA 3QQ4A 4KHXL 2ZXWB 4XXWA 2ZWSA 3HRZC 2AJZB 4DGYL 3WNMA 3KBFA 4N90D 4NWUH 3QO1A 5F9OL 5FIEA 4ZQTA 4PHXA 1ZLWH 1PAZA 3DVIA 4BSWB 1CFNA 3H85A 3QRLA 1VPOH 3DGGA 1ZVHA 3QIUA 4BRVA 2ZKXA 2R56L 4WU7A 1XCTA 4P4KC 3VXRB 2EICA 4TNFA 1KEGL 2X4QA 3QDJB 1S46A 5INDA 2WXNA 3Q8EA 1CXLA 3MREA 2VZOA 3CVHH 1SJHB 5D4JA 1IGFH 4PD4K 4R7NB 3EYOB 3RTLA 1FGNL 4JR9H 2YGVA 3DROB 4LSQL 3PWJA 4MX7B 4PJBF 4YHYB 4X5XB 3WNLA 1I7TB 4J6IA 5F1IB 1W16A 4HJGB 2G75A 2N1KA 3FTWA 3PP4L 1UQSB 3LEXA 4FQCH 4J7RA 5FR3A 1DBBL 3ATFA 4G83A 3LD8C 5DJZA 1LD9B 2OQJB 3OAUH 4RFNC 1MCBA 4N8PA 4F8PA 2F53B 2YBGA 4PLKD 4XGZB 3KS0J 1NFDA 2EH7L 4ZUWA 1A47A 1F97A 4ZPVB 5CZVL 5F3BB 3VM7A 5IW6A 3PIQB 1QO3B 2IVFC 3CFBB 2VO5A 4JKPL 2WYHA 2WLMA 1E6OH 1KN4L 3GPEA 4NQSB 5GZOC 5JW3L 2NYYD 1PS3A 4HQQL 5T5FH 4ZO9A 1T5WB 4Q56A 5BOZG 3QUMA 1FSKB 2Q8BH 1A7NH 3D8MA 3SE9H 4OZIE 4PJFA 1OXYA 2NZ1A 3LPGA 3GXDA 5MEPA 1OD9A 4HK0A 1KB5A 1SVCP 4AW4A 2ICEC 4PJ8C 3QEQA 2A74B 4RSYA 5FUCE 2GUYA 1GHFL 3BKCH 4YFLF 1G5AA 3S2AA 4B3VA 3ARGC 4MKMA 4WSGA 5IROC 3W1ZA 3RL2B 2H5UA 5C0IB 2VQUA 4HXAH 5I73C 1T1ZB 5J56B 4PCKA 4JANA 5CAYB 1KENH 5JDSB 3QEHA 2OMUB 4X5RA 2WP3O 3CMGA 3FUNA 3SKJH 3K6OA 2EEBA 2K1MA 4NIYE 4GJTB 1J11A 4Y9GA 5IMMA 2BOLA 3W57A 1A1MB 3IJ9A 3ISWA 4H26A 4YGVA 5ICYA 2G9HB 2QADC 3GMPA 4QF1B 1RUQL 5HYEA 4TPRH 3D50A 2IPTH 4ZOAA 2BZ7A 3P73B 2A73A 5MHSE 4BFJA 1ZXQA 1ZLUK 2ZXEB 4AGMA 2O5YH 5AW6B 5HYFA 2CGRL 4M6OL 3CFTA 4N6RB 4WO4A 5BMFL 1N64H 3GK8H 3BPNB 3HRZB 4YLBA 4E9WA 3H9YA 1NANH 2HTKD 5TGBB 3BHBA 4CJ0A 5FECB 1BMZA 1MH5A 2BOCB 3MRRA 3KPTA 2AANA 3I6GB 3JVFC 3FQUB 4MNHB 3WN6A 3BE1L 4QHPA 1QEWA 1PZCA 3LH2H 4P2AA 4JLRB 2JJTA 5D4QA 3T2LA 2F8XC 3DPBA 4L37A 3FCTA 4ZMYA 5DYFA 2LGNA 1O6TA 3COOA 1J9QA 3NEEA 4YHZL 2A77L 2FZ3A 1JGVH 5I8KL 4Y2DD 3CFDB 2YK1H 4K8RC 4JPQA 1AHWC 1Y6NR 3TJEL 4PUBL 2EZ0D 1XMWA 4L8SB 4DT2A 4WTWA 4K3EH 1A9VA 3D25A 2XX1A 5TTRA 1A9BB 1ES0B 3U83A 4OCXH 2YD0A 3S96B 1F11B 2AQNA 3IU4H 3BEVB 1T20B 2BVEA 3LD8B 4N1HB 3B5GA 1OAZL 1AD0B 1PZAA 4XVOA 4DETA 1UXSA 4RFNB 1V55B 2DQUH 5I1CL 4LU5H 1I85C 4O9HH 5GS2H 5E24E 5DVMA 2P24B 5JW4R 2WXRA 4GT7A 1LK2B 2DIBA 4G8GD 4RIRA 3AITA 4G9FB 2G60H 4B7LA 1DVFA 2HX7A 1FC2D 2H0EA 3EJZC 3D39A 5IFJB 3T3MF 4HG4J 4N0CD 5GIRB 1YECH 4YEEA 1RVFH 3FB6A 2DM2A 4D8PB 5KYYB 4KKQA 2BS8A 4BE6A 1ZHLA 4PJBA 3UYPA 2FIKA 2ICEB 2WKOF 4PJ8B 3FTUA 1VFBB 3K8LA 1DVQA 3EOYG 4MQ7B 4BYHA 1BWWA 3ZT5A 2FH8A 2X9XA 3UFIA 1ZGLB 5JORA 3GO1H 2XTJC 3Q01A 2DMGA 4F7CA 5A6MA 3TIEA 2VZ1A 3QJOA 2FD6H 4YSAA 2AJSL 4NC2B 5E9DB 5I73B 5EEWA 1ZLUH 3G5VB 4HD9A 2XKUA 3W0WB 4DHLA 1YYLH 2VMCA 3RVUD 4PRNB 4OCWL 4G1MB 4K7FA 4KKBD 4IEFA 4V1DE 4I88A 5AOMA 3VGAC 2ZXDA 3WS3B 4DF9A 2P4AB 2VL5A 1H5BC 1XH0A 1KGIA 2R15A 4LL9A 2Y07H 4YHML 1C7TA 3QULA 3P30L 2NW3B 3S3DB 5FKPB 5H37G 1NGYB 1GZPA 1WJ3A 2WKLA 3DBXA 3F5WA 3OR7B 2QADB 1VEOA 5K1VA 5TQ2L 4OCRL 4QRRA 2IQ9L 2H2SC 3U7AA 2ESVB 4PTUA 4DAGL 1X7TA 3RAJL 3WCYA 5F1NA 5B1JC 4FQPA 5KEZA 1L7IL 5DS8A 3QJTB 2GSGB 4N2HA 3OAYK 1GZHA 2YRLA 2F74A 2DI7A 3UADA 1XH3B 2GC7C 1USQA 4EZKA 1XZ0B 5DYOB 1RU9H 3EH5B 3Q8AA 1JZHA 1QSEE 1RZFL 5K39A 2XVGA 5MENA 2QMKA 3I3EA 4G6KL 1FPTL 1T89C 3DX0A 1RK0B 4UILH 4W9EC 5GGSB 3RJOA 5IB4A 3UBXI 1QFWM 1RZ7H 3B3IA 2Y7SA 3FN3A 4UTBL 3L1EA 2CKBA 1AQDA 3U4BL 3A5VA 3JYBA 4KKRA 2WB1A 3D34A 4LLWA 5J7CC 3RJDA 1RJZB 4WY7H 3SDCB 1CXEA 4OGYH 5E4EC 3VFNB 2AK4A 2C4FT 4KRNA 3U25A 3C5ZA 1AHWB 4ALAH 4HOXA 2J4WL 4N2LA 3JVGA 1F2QA 1TT6A 3DGDA 2OSLA 1W0YT 4PH8A 1M6OA 3LIZH 4YQXL 5JQHC 3ZHKA 5KBLA 2XN0A 2VMFA 3ULVH 3MROA 1KLGA 3OZ9H 4AQZA 1YEKH 5I1HH 4YX2H 3FBKA 3MLPA 4DEPC 1V10A 2BSSA 2GJRA 2WTOA 3NJFA 2BSTB 3FQRB 3AC0A 2ICCA 5IGXL 2H2PD 2X9WA 1WDAA 1LE5B 1UKSA 5H2BB 2DYPA 1U95B 4PCTA 4GW5A 1V3KA 3HA0A 4HCIA 4NQVA 3BUYB 1AZRA 2LLNA 2V5SA 1R9FA 3PREA 3KPNB 3GXTA 3NIFE 5DURD 5ERWB 3D69B 3BAEL 4JFDA 5DJ8B 1ANUA 2VQ4A 5GGRB 3VCLA 4HALA 4X9IA 3GTTA 5E08H 5ALBH 3RDTC 3VXSB 4PV9B 1HZLA 3QFJE 3EDFA 1L6XA 3GIVB 4EN3A 5EU5B 4XOBA 5FB8B 2EIMB 2A0LD 4J3WA 4NRXB 5GGQH 2WAQA 2JI2A 3SY0B 5IK3B 3GSNL 2WBXA 1XF2A 3MYZA 3F01A 1Q72L 3MJ7A 3BPOC 3DVNA 5HHMD 4QWWD 3SKOA 3VD0A 1UB5A 1DSFL 1NCWL 3T0VA 5AQ0A 1KC5H 4JO3L 3VGAB 2VIRB 1BLIA 3IJEB 3MLRH 2V0AA 2CGYA 2X4NB 4BH8B 2YA0A 4NZRL 5HGBA 1A3RH 3REVA 5BNXD 3UJIL 1CICA 4PJAF 4Y5VB 3FU7A 3PF2A 3VMNA 3OKKB 3M1CA 4HEPG 3QE5A 3HEIB 2NR6C 5I8CA 2WKOA 3LQZA 3B6SB 3ZOAA 4HBQA 3A6BL 1TLKA 2W9LA 1KPVB 2WLKA 3Q44A 3FH5A 4BSVB 2BOBA 3GSXB 4MQXC 4FD0A 2JWYA 2YMXH 5KSAC 1S7UB 2VB5A 4DFIA 2E5EA 2K8QA 2VUOA 1ZS2A 3UBXB 2RHEA 2Z9TA 3H9SA 3K6SA 4KDVA 4RX4D 2WXMA 4KVCL 2ITDB 3AACA 2K7PA 4GKSB 1B0IA 2KUTA 3KWWA 4DP7X 1BVNP 5BO1L 3WKQA 1DANU 3NJXA 3TPKA 1RPUA 4CBPA 1D7BA 3DUHA 4X50A 3L81A 3ZMEA 5BRZE 5AZ2L 1XD0A 3EZJB 1B4RA 3KL5A 3MV7E 4NLHA 5E2TL 4OM0L 1R33A 4KJYB 4V2CB 1X7QB 1NIFA 4JFHD 3QYNA 2C9XA 5JW4N 1WBZA 1PF3A 5E4EB 4JRXD 3BP4B 1BXXA 1CGXA 1M05A 4QHMA 4XXDB 5E8NB 5G4OA 1DQQA 1A9EB 2EYSA 4JFPA 4XP6L 4QOKD 1A4JB 1W6LA 1A25A 3DX3A 3GSQB 3NN8B 4JS7A 1BBDL 4M5TA 5IVXA 4KAQH 1RULL 1XX9C 2Z4QB 3ILEA 4HMCA 2ITFA 1I9JH 4U2YA 5IHUH 4BSJA 1T7YA 1U2CA 2HH0H 3I6KA 2BIPA 3OAZK 4FS0A 1MDTA 3PQYD 2VAAA 4DEPB 2H32H 1E90A 3BXNA 3DLQR 3W37A 3IMSA 3QCVH 5L88H 4L3AA 3FTVA 4HHAA 4OF6A 2IQAB 3HC4H 4FQLH 2NXYC 4PJHF 2GJ6A 3IN2A 1UWFA 2AI0H 4NKOB 4AVJA 3VVWA 3CFQA 3VD3A 4HA1A 5I66B 4XMLL 2WKGA 3CX2A 4DESA 2YS4A 1G9NH 1AHKA 1F4XH 2VGLM 2JIXD 3QWNA 1XH2A 2FJHB 1JPSH 5HI3C 3TA3A 1FVCA 4ZMAT 2R2EA 5FYJL 5F8QC 2XETA 1A4CA 4G8FB 1JTOA 1HQRA 4JY5H 3F65A 4FA6A 4KQ3L 3RDTB 1CU4L 3HN3A 2CLZB 5D7JB 5IWLC 2V37A 1JZ7A 4DW2H 4FFZA 4ZRGA 3KL0A 2DL2A 3FFCD 4XPBH 4ZUVB 1CI5A 1OKEA 1MLCB 2E46A 3C60A 2A7BA 3K4DA 4W4OC 1C9SA 2VZUA 1G9EA 3IBEA 4AT6A 5E99H 1HWGB 2Y1YA 3BPOB 4ZAKA 3KGUA 3L5WA 4R4ND 4XP5L 5D70L 3OX8B 3RWHB 5AAWA 1GTFA 3KYOA 5I6MA 4TVUA 1MI5A 4PJXB 2W38A 4FFWD 3TOPA 4YXKL 2GK0B 3AZUA 5BVJA 2IAMA 1C5BH 4H2CA 2C3XA 2ZSVB 1K3ZA 3CXDH 2PP9A 4L9LC 4XNUH 2OYLA 1FO0B 4HGMA 4HHWA 5C0CB 3V6OA 2J88L 1JMXA 1YYML 2CDFB 2OX5B 2Z93B 3M1BB 4OJFL 4OTXH 5JO5A 5F44A 3DWTA 2YA2A 4UANA 3IYLW 4P57A 2WWKO 4K94L 2ZIDA 3CFEB 4A7UA 2QBWA 3KLDA 2FIRT 1D6EA 4WUKH 1NFAA 5C0BE 3W11C 5C6WH 5DDHB 1EHLL 5KSAB 4AEEA 4CKVX 3OHXA 2HUEA 2K3TA 3RX5A 3GI8L 3QCTH 2ED8A 1JWUA 2IFFL 4MAYC 1NSNH 4BKLA 5MEQB 5FUOL 2OL3H 1J88A 3H7BB 4KFMA 1JHLH 3VRIA 3MODH 4TSAH 4WJG3 4U6YA 3AADB 5IQ7H 1HWWA 3BAKA 2BNQA 1ORSA 1F1GA 2YGPA 4ZMNA 4U1SA 3NVQA 5E6RB 5L4IA 4N8CH 1IEHA 3AAZB 4FFYH 1A1OA 4PJAA 4WHTA 3KPSD 5D4IA 1EFXD 4DERA 3ESMA 4L4TD 3BZ4A 1MWAB 3GZQA 2AQ2A 5BVPH 2HTKC 4M8QA 1OALA 5C0DA 4GXVH 2HJFA 3FONB 3UMNA 2RJMA 3KD4A 2EDYA 4PBVC 4MYPA 4FQQA 2AAVA 2OXGB 2V3FA 3H0TB 1DJGA 3IDGB 4JRLA 4NQED 5JPNA 4N20A 4TSBH 3B9KC 1MCSA 3NPZB 4JQIA 4JFFA 1RZJC 4K9EH 1H0DA 3VI3E 1JF5A 4BZ1L 2DQCH 2UYLB 2R0KL 2ZOLB 3BUPA 4YHNA 4K2UL 3ZQXA 1GGCH 2AXWA 4W6XB 4S0TD 2OBGA 2F1BA 4EVNA 1I9RH 3HAEA 5LQBH 5LCVL 3ECUA 1HX0A 4HBCH 5KAQF 2NXYB 1IAIM 5D7LE 1SF3A 3KWTA 4X7SL 4KUCD 4OJEH 3TGXA 4MCZB 5EH1A 5K9KA 1JE6A 1JGLL 3BAYA 4I77L 4OLWL 2CIKA 1UVQB 3DX2A 1KYDA 1DQJB 4IDJL 3VXMB 4YC2C 4JJ5A 3CLWA 4D9LH 4X5PA 4OCYL 4PI0A 1PNCA 1KXQA 2HFGH 1A0QL 1T7VA 3AM8C 1KEMH 4JHWH 1UURA 5B22A 3S36L 1LWRA 3BJLA 3OXSB 1J7VR 2EDJA 3AY2A 3GKZA 4EI5D 4C56B 3EO1A 7CGTA 1EGJH 3QIBD 5C0AA 3T0EE 2XYBA 4XWGH 1SUHA 1E4XI 2I24N 3NSFA 5DTFA 2DYSB 5EO1B 1O6SB 4JO8A 2NT0A 3ARFD 5CGBA 4YLCA 2F0CA 4NQXA 5J4MA 1HFUA 4HIJA 4N0CC 2W8CA 4DVBB 1BAWA 1MFDH 2UUDK 3LRHA 3RWDA 4LARL 4XN9A 4PY8J 3O41A 3GD1C 4MQTB 1T3FA 5M7QA 1Z3GL 3CTTA 1ROWA 5D1ZI 5D1XA 4V33A 1A1NA 1XGQB 4O2CB 3UZVA 3S8WA 2NY7H 3AMLA 4HUUB 4L9LB 3CLEL 1OY3B 3VWJB 4PR5B 5J6GA 1JFQH 4KNSA 1DQKA 4JM0A 3MJ9L 2HN7A 5KYNA 1WAAE 2X38A 3FUDA 4I1PA 3R8QA 4DZBA 1E4HA 1R3JB 3IDIA 1Z1WA 4KKBC 5F88A 2FJGB 2AJ3B 4U2ZA 4KKAD 4PRAA 3WDJA 4MJ6A 3I50H 1BVLA 1YEIH 5T1MA 1V3MA 1DFBL 3NCYP 4GKZA 4M5ZL 4MAYB 4K7PX 3L1OL 5FHAL 4ANVA 4DOHE 3DOHA 1AGFB 2YLKA 3C5SB 2AJZA 3X2QB 1HNGA 5BUPA 4YHLH 2JJSA 2UXVA 3GLEA 3U2JA 3K6DA 4TKWA 4XNQB 1KSRA 2WPGA 4AE1A 4BSWA 2EDLA 2Q8AH 4AKPA 4JO4L 3B83A 3LRKA 5ISZE 2IC2A 4X0KB 4YDMA 4GEJA 2G9KA 1OAKH 1T04B 2HT3C 3VXNB 5D7KD 4Q9RL 3FDWA 3L48A 1UUSA 1SY6H 1XVSA 1P53A 4IQHA 3VXRA 3QDJA 4LEBA 5T3XH 1GS6X 1B0RB 1QBBA 4G82A 5FX3A 1SJHA 3GHBH 4UNIA 2BJMH 3B9KB 2HKHL 3EYOA 1I8UA 1WD9A 2IOMA 5DFAA 4EDWH 4LNRB 3DROA 1H8NA 1U93B 4MX7A 4AQ1A 1QKZL 2IOIA 4X5XA 3NSXA 4QRAA 4OZGF 4HJGA 3OMZA 1UQSA 1J8KA 3LSOA 1W8NA 3L3JB 3MRBB 4YO0B 3GRWA 1LD9A 4GIPD 2OQJA 3MGTB 5DI8B 4LPTA 4ZFFB 2F53A 3FUMA 4KH2A 1MCIA 3SODB 4ZPVA 1CBJA 5F3BA 5TQ0L 3PIQA 2P5PA 3WV0A 1J1OL 3CFBA 3B56A 4HW6A 1EXGA 4OLEA 2N59A 4YC2B 3KXFE 3F62A 2CQVA 5I2IA 3N91A 1NJ9B 1T5WA 2RB8A 2B8OT 2VW6A 2VDKH 4YSPA 3X11B 1HCZA 3NRFA 4U6XB 5BUAA 1I1AA 2DLFL 4I3SL 4KXZI 3OR6B 4ODSH 7FABL 5E95B 1FIGL 2RH0A 3QJHB 4H5SA 5DGRA 3ZT7A 5MHSD 4G7VH 4JPSA 2O6FA 2YRBA 3SZKC 1TQWA 1EMTH 1Y0LB 4DGVL 2A74A 4G8GB 4JFZH 2CAKA 4OLYL 1MIEL 2I5YL 4MNQA 4RCAA 4KROC 5I1KL 2WYZA 4RDBA 4Q9QL 3RL2A 1TNNA 1GYVA 5C0IA 2ZX8A 1CFVL 2GT9B 1T83A 1T6BX 3EH1A 4DQAA 4DP9X 1JI1A 1FNSH 5KBDA 5JDSA 3HG1E 4FI6A 5IESL 2OMUA 3WFEL 4PGCB 2A0LC 1FZJB 1JPGB 3UAFA 3PHOB 3Q05A 2Q10A 1F0LA 2BDNL 2RTTA 2E27H 1TZGL 1KGWA 1WFOA 2VXSH 4P2QA 4WI7A 5EU7C 2BWIA 3K1DA 1CI3M 3JTTB 5ENWB 3EDJA 1X4ZA 1A1MA 4WLCA 2G9HA 4QWWC 1OE1A 3UYRH 3APDA 4YJZL 2OMNA 2ADJB 2R69L 2ZCLL 4TUJB 1XB3A 4Z7UB 4OLUH 2JQZA 3JSSA 1P4IL 1GYCA 3MRPB 1J0JA 4PWKA 1JV5A 5GZNC 1QZNA 4GRMB 3F8UB 3HRZA 5EORH 2QMJA 5AB1A 3EF4A 5TGBA 5H4ZA 1FNGB 4AL8H 5FECA 1ML0A 1JHTA 2HTLC 2J56A 3C5JB 3I6GA 4X8JB 5F7HA 1H19A 4MNHA 1YO4A 3FU8A 3T77B 4MXQD 1HYSD 5HDQL 1NEZB 1PFCA 3F58L 1OAYH 3O0RL 3VUAA 3BT2H 3ZRFC 4KV5F 2QVKA 2EE9A 1TEYA 4GH7B 2JB6A 3CFDA 4NKIL 5CBEB 1HZKA 1UWGL 1TJGL 4F33B 2AQPA 3FN0H 4CL7A 5EIIB 4O02L 1MRFL 2X0VA 4H0IA 5GJTL 2GI0A 4Z3HA 5C6PB 4L8SA 3ECQA 1XTMA 2GCYA 3K8MA 1A9BA 4XI5D 5EV7A 4R4FH 2HJLB 2R0ZH 3IMRA 1J9CT 3LPOA 4HCRL 2FB4H 3BEVA 4G6JH 1T20A 1FG9C 3TZVC 2IV8A 1AD0A 4HIEB 1L7TH 4V1DD 1UFUA 5DUMH 3LRLA 1ZD6A 4ZTOL 5K69A 2MWCA 2XHNA 2ZPKL 4JKMA 1VFAB 1CD9B 3PL6A 2P24A 2R7EB 5ESAB 3INUH 1LK2A 5FYLH 1QABA 4K23L 2DBLH 1F4WL 2BNRE 4G9FA 4EO5A 1CLYH 1YJDL 3JZYA 5TF1L 2CJUL 3FSOA 4DKFL 5EMYA 4P2YA 5IFJA 1OARH 4HJJH 5T1LB 1HZHL 1DVZA 3FO0L 5CSBA 5GJSH 4XXCC 5E9NA 5GIRA 3TNMB 5EOCJ 1JWSB 2ZJSL 1J1XH 4WENB 4D8PA 3DKHA 3HI5H 4PI2A 5FGRA 2PXYC 4NUGH 1BAGA 4LSTH 2ICEA 4FZ8L 2BZCA 4PJ8A 4A55A 2QR0A 3AXLB 3NACH 1VFBA 3V6ZB 2OMWB 1S9YB 4MQ7A 5IVZA 5DZJA 3LEYL 1U8JB 4QYAA 2R8SH 1YCSA 3DX4A 1T1WB 1U8NA 4KROB 4UQ9A 1HXMB 4LO9A 4OGXH 3TBWA 1U41A 2WWMC 1QLEB 5E9DA 1OWRM 5E2WH 1HH6B 3TEWA 3V4PH 1N9PA 3G5VA 3ZTDC 3CPLA 3W0WA 1AG0A 4I1NB 1QSED 5LGKA 2BH0A 2EDNA 4F7PB 1RSFA 4PRNA 2P5WE 2C3WA 3HKZA 1DE4B 4GAAA 1DBKL 2V8MA 3WS3A 1R19A 5I82A 3Q8FA 5CJOL 4N68A 5FYKE 1TDQA 1PL3A 5JOEA 4PRPE 2FLMA 4R4NC 3K71B 3IRPX 4OF0A 5FKPA 2NNAB 3OR7A 1DBML 5JOFB 2QVTA 1H15A 2IMNA 4DPRA 4FFWC 2FE0A 4XAWH 5I1JH 2CXKA 2ESVA 3DYMA 1SVZA 3BQUC 4DVRH 1IGTB 2FX8H 4ZODA 2H1LM 2J1ZA 3OC5A 1SBSH 3AXHA 4YHPB 4ZFGL 5KN5B 1OOAA 3SQOH 4GRWH 2EIBA 1L9RA 2FK9A 2GSGA 2YUXA 3G5XB 3I2CH 5I6LA 5AD0A 4L1HA 3L3HB 5DFTA 1ZY9A 1JVOA 1XH3A 2OR7A 4NFDA 1XZ0A 3IDNB 4Z3FA 2LAAA 2YAFA 1R5VB 4FLQA 4L5FH 4LF3B 1BAFH 3KGRA 4NENB 5GGSA 4XE5B 3BDYL 1U58B 4YWGL 1MVFA 2WO3B 5ABZA 3VXQB 4JHAH 2X0WA 4Q6YA 2J71A 3QORD 3NGBC 1CD1B 1CS6A 1IGIH 2X1QA 1RJZA 3SDCA 3UROR 3TF4A 4HCFA 4JRYB 4RGOH 5E6ID 3TNNA 3I3DA 1AHWA 1VGEH 2HVBA 4L48A 4XPFH 5ADPH 3QARA 3QCUL 2YXFA 1OP5K 4IBVA 3E3QC 4YBQC 2X05A 1XZWA 1KT2B 2WJ5A 5FDWB 1Z9MA 4FI8A 3IMTA 1GIGL 3MV8E 3V5KB 2BSTA 5FPIA 3FQRA 4NT6B 4KUZL 3TZVB 4UIMA 3QWRD 1LE5A 1BJ8A 1IBZA 2FX7H 4KXBA 2YAMA 4MXVF 1I85A 4NQCB 4HMDA 3BCDA 1OF2A 4FXLA 4E5XG 4Z1PA 1ZKAA 4E68A 1C5DB 5E4AA 3PQYB 3OLGA 4PJXF 4UNUA 2VDNH 1LNUA 1QUPA 3EDKA 2VLKE 3O2WH 4JO1L 5KBMA 3WJMA 4HU8A 4WFED 5ERWA 1QFUH 3D69A 5A2FA 1KPRA 5DJ8A 1QP1A 1OO2A 3ZO9A 5FGBC 2P47B 5HYQB 5KS9E 5CILH 5AW8B 4PV9A 2PXYB 3KR3H 4XT1C 1UENA 5JUEL 3SPHA 2Y2WA 2J8UA 4DKEL 3UAJC 4GBXC 5EU5A 2QSTA 4QY8A 5FB8A 2HG5B 3LNIA 1MVUA 4NRXA 1PD0A 3SY0A 2F9BT 5IK3A 1WWCA 1IAMA 4AV0A 2Q6WB 3SE3A 4B53A 1EZVX 2NY5H 1TJMA 3BH8B 5LO7A 1MJ7H 3JWOL 1F58L 1P4BL 1CG9B 1YUKB 2O5XH 4IHOB 2VMEA 2XWEA 4EI5C 3HG2A 3A4DA 3VYOA 5BRZD 3TBBA 4OSUH 3T2NL 3L4TA 2F5AL 1A6VH 1JP5A 4JG1L 2VIRA 3GYRA 3MV7D 1ZWIB 4O2FB 3THML 4BDVB 4BH8A 2X4NA 2ETWA 4XCEB 3QHFL 5JOPD 3ROLB 1WTLA 3ARFC 5L2KE 4NO3A 3MRNA 2FLBT 3KW8A 4Y5VA 5CLYA 1MJ8H 3K72A 4LPUA 1BOYA 1G6RH 4KH9A 1MFAH 3GJFK 4R6UA 5JR1H 4JEGB 1IX2A 5LNDA 1KPVA 3AB0C 4M5YL 3HNVL 3H42H 5ETUB 3K6NA 3JWDL 1ZS8B 1CR9H 3BQUB 5BV7C 5B1JA 1S7UA 4A2EA 1UATA 4LOFA 3H4FA 2NQCA 5E7FA 3FT2B 1EERB 2FECL 1FL6B 5DVPA 3UBXA 5AUMB 4IBWA 2X3BA 2EE2A 4YGAB 1Z32X 4NYLB 5GRVK 1RI8A 2VN6A 3KPOB 5C08E 2IWKA 3TONA 4FAAB 2GIYA 2EYRB 5D6CB 1HE8A 4F37F 1T89A 1MEXH 4XNXL 3MRIB 1ZEAH 1BEYL 3OG4B 3U7WH 5DHDA 1OAUH 4ZXBD 3CFJB 3QDMB 2FUQA 4YPJA 3T1WA 3NGBB 5AYTA 4WI9A 3X3FH 1X7QA 3IGUA 1A22B 3KYMB 4POUB 2NZIA 1CFTB 4WUUB 3VQ2C 2FHCA 1QBMH 3NIDB 1ZT4B 3ZGHA 3BP4A 4IOSD 4XXDA 3NJMA 4GFXA 4D0DB 4IM8A 1A9EA 3UBGA 4MD0B 3VSQA 5KZCB 2FR4B 3GSQA 4A2GA 2Y7MA 3NN8A 1E4WL 2Z4QA 3MLWL 4L4TB 2GYSA 2MNWA 2WVVB 4PEEA 2R1YA 4PJ5B 4QRPE 2OK0L 1OM9A 1KN2H 2XWZA 4MBRA 4RISH 1OAJA 3BVWA 4OJYA 5DC2A 1G87A 2K70A 3K4AA 3LQAC 3KGTA 3PJLA 1OQOA 4AOFA 4XNZC 3TT3H 4ZMOA 1E4KC 2IQAA 2J73A 2MQ0A 3QC5X 4LEOA 4PS4H 3ZDXF 5DEGA 1YY9C 2ADIB 1SUJA 1MQKL 3B7YA 5HHOA 5I66A 5LXGH 4EPSA 2CM6A 2NCEA 4CUCA 3FRPG 4H1LB 5DQJB 3WELA 2UWEA 4Z77B 3WIHA 2G5BB 2FJHA 4UV7H 5E0FA 4WTXA 1KYFA 4B41A 2A9ML 2IALB 3LY6A 4HJ0C 3F64A 3X3GH 1IGYB 2NUTA 2Z8VC 4M6MH 4Z7OB 5DUBA 4IMLB 4JFEB 2OMBA 3RDTA 5D7JA 2B20A 2OMTB 2YD4A 5D8JH 1YPZB 2HA1A 2WQWA 3QXAB 4GBXB 5C0BD 5FF6B 1BECA 4H88H 4LLYB 2LW3A 2YZ1A 5D2LE 4ZUVA 4JPWL 2IPKB 3RGVD 3GJFH 3BISA 1MLCA 5FW6A 2B3RA 1MREH 1IRAY 1KGXA 3PABB 3KBHE 2PCXA 1BVOA 2HKFL 4LASL 1TJIH 2WO4A 1XSIA 4LPWA 1DR9A 3CSPA 4LP4A 3D05A 4EI5B 3MUY1 3LV3B 5B4MC 2V9UA 4XPGL 1FORH 1P0SE 5HBBA 1IKOP 1Y1UA 4HIXL 1EXUA 2YXWA 1TYEB 1FO0A 1DQLL 3EYQD 1J8SA 3IXTB 4Q14A 2XZAL 5C0CA 2R4RL 1RL1A 4ZD3L 2JJUA 1JHKH 2CDFA 2OX5A 2Z93A 3M1BA 2NR6A 3S4SB 3F7VB 2X44D 1CCZA 25C8H 3HFFA 3AB0B 1NCAH 2D31B 2YUVA 3SE4A 1OT1A 3CFEA 4UCFA 4QGYA 5E4OA 3ZKND 1OW0C 3IMBA 5BV7B 5KSAA 2DMHA 4WHYH 3QI9B 2UY7A 4TLTA 5MEQA 4U31A 2XWTA 5SWSB 4PM1A 4XPHL 3H7BA 3PNRB 3W82A 3V0AC 5D7LD 2R29L 4GRLC 2KYIA 4JB9L 3ECVA 4Z7IA 2D3LA 3SHSA 3ARQA 3GB7A 4P06A 3VRLF 3WNJA 1TU2B 3RJQB 5GHWL 3AAZA 3N1MC 4BD4A 4OJDH 2WD0A 2Y5EA 1UWXK 5I24A 2AJUL 5G55A 2ED9A 1V54B 1MWAA 3VFTB 5D1QC 4KMLB 2HPOA 1F8TH 5ANMB 5HHQB 4YUEH 1DJWA 4X4MA 5B1AB 2IBZY 3CE1A 4H44C 4LGPB 3ILDA 2HSIA 2OXGA 4W9FC 3H0TA 3LS4L 3APNA 3MUUA 3T0ED 2M2DA 4JDTL 3HCVB 2HRHA 4MXQC 5KVGL 2NY0D 2UYLA 3MNWB 4K8RL 3IPEA 1KMGA 1NPNA 2UY6B 2WM0A 4B7IA 1AI1L 3T6WA 1GMIA 4XNZB 4LQFL 5CSZB 1JZ2A 4P2RA 5GSRB 4URKA 2AEQH 1ACXA 3WFCL 4NHUB 4MCZA 5I26A 4XOAA 3PUUA 1RUPL 2KHAA 3SDXE 5I1LB 2A9DA 1UVQA 2HP4A 1EO8L 4U1KA 1DQJA 4JKLA 2YQGA 3P69A 3VGDA 3VXMA 4HP5A 4LSPL 4JUTA 5E23A 4PRHE 5EN3A 3RA7H 4IBUA 3EF7A 1CK0L 4KK9D 1YVLA 5CGMA 3BVUA 1HL4A 2AXJA 2APBA 4Z3EA 1LLAA 2GJZB 2X70A 3OXSA 4MD4B 5IWLA 1GYAA 2EDFA 2XXGA 3LEVL 3GT6A 4NQQA 3HE7A 4C56A 3IKKA 3CC5B 4DUVA 3VDAA 4PJIB 4Z7UF 2WLLB 4W4OA 5DMIH 4LBEB 3AU0A 1N3NB 4UI2A 4UINL 5EO1A 1O6SA 5FO9A 3KDPB 5IFAL 5BPPA 2VR4A 1ETB1 2OR8A 3U6RB 4OLVL 4DVBA 2RMNA 2CBTA 4MLIA 1INDL 4PRBB 1K8DB 1RD6A 4R9HA 1H3PL 2QLYA 3SBWA 5HVFB 3WHXB 2O6CA 3JWNC 4PJ7B 4M61A 2CO7B 5ISZD 4Y8AA 4AC2A 1EDHA 1SFDA 1XGQA 4HUUA 3RU8H 3NCBB 1MFUA 2NDFA 4PR5A 4U7KA 3VWJA 4ANUA 1MNUH 3QQXA 4J3OH 2EEDA 2JTDA 2I60H 1A6UL 1MCWW 3RWEB 2YLHA 1KACB 2W9EH 3POCA 2Y7QB 1R3JA 4RMVA 3SY6A 4F2MB 2AJ3A 5LGHL 5IUCA 3LZPA 1AR2A 1Q1JH 1V7MH 1XO8A 3QZWA 4XAKE 4MAYA 2YARA 4KBPA 3ALPA 2WO2B 4FG6C 1AGFA 2W94A 1XF5B 1NFDE 4GRLB 4NHCH 2C4XA 4F57L 4YSSA 4J4PC 4JFWA 2HRPL 1AO7A 5EBMA 4ZMXA 1ITBB 3OZLA 1CGUA 3SKMB 1QTSA 4TOYL 3VH8G 2IH8A 2B7DT 4D94A 3KXFD 5EB9A 4MCYA 4X0KA 3EOAB 3LZFH 3BGAA 1T04A 4PJFE 3VXNA 4JDEB 5D1QB 4LSSH 5A2LH 2XQ0A 5AKRA 3TYFB 5DJXB 3MV01 1V27A 1C1EH 1SHSA 4PVLA 4NQDA 1DZ0A 3QEQE 1O7SA 4N5EC 4XVSH 1B0RA 4QYOB 1Q4NX 2ENYA 3K7UA 1WRFA 4KXDA 1L9SA 4PS3A 3B9KA 4GKNA 5DZPA 3H9HB 1E28B 1BPLB 1QW9A 3WXVL 1X5AA 1PZ3A 3GLZA 3K2KA 4LNRA 4MRBA 4U1JB 1U93A 5SX4I 1KBWA 4IU3A 2YXMA 3SGDH 4XTRD 2O6PA 2CH8A 1YN7B 5LAXB 2NDGA 2QQKL 5E6IC 3L3JA 3MRBA 4YO0A 4H8QA 3HG1D 3SE8L 4MWFB 3VSUA 5DI8A 2G2RB 4ZFFA 4E0RB 3R1GH 4FQHB 4OQ1A 3MXVL 3ZE0E 2O4EA 1S7XB 1GOGA 4FABH 4IGBC 1H3WM 3QWOA 3CZLA 1IKFH 1OCZB 3GDCA 3TVMD 1NJ9A 3X11A 2F7QA 1MLBB 2BXZA 4FLRA 3O0LA 4U6XA 5D7IB 2NSQA 3LNEA 3HG5A 3LS5L 1Z5LB 2IDQA 3OR6A 4DK6A 1OP3H 3QJHA 3UTSB 1IM9D 4POZD 5HGGS 3TEZA 1WV7T 2YAOA 4FZEH 1Y0LA 3WDHA 3S37L 1CQYA 2ATKB 4YR6A 1HI6B 4J3VA 5D1ZA 5BQ7B 3LKOB 4NKDB 1H3GA 2YRPA 3PAZA 5ADOH 4P2OD 3GJEA 4NM4H 2GT9A 3LVEA 4UM9D 4ONOA 3RZCD 5HI4D 4GB9A 1CDGA 1P4UA 4RGNC 3RI5K 2JCWA 4HAGA 4PGCA 4DKTA 4A2LA 1FZJA 4XMKH 1P6WA 1M9SA 3V4UL 2H0PA 4XCCH 1F4YH 3BKML 3JTTA 5ENWA 4XVTH 3P1VA 4Y5XC 3V0WH 4Z23A 2NXZC 2NX5A 3QR2A 1SM3H 3TO4C 2ADJA 1R34A 4TUJA 5LBSA 4Z7UA 5IP4A 2Z91A 1HILB 4MA8L 3ARED 4OVUA 3ESPA 3FHQA 2N7SA 5HY9A 1ZLDA 3CFKB 4JCMA 5FGSA 5E1IA 2CRZA 4PCSA 3CGTA 3H3BC 4QIRA 3ZT6A 2CUAA 2YPKB 5J3HC 5B3SB 1YMHA 3UPRB 2C4FU 2FNBA 1AIFB 4HIHB 4QRSB 3QJFB 3VFMB 4LSVL 1FNGA 4AK2A 3APCA 4PN6A 4QO1B 2VDLB 1QFWL 4HC1A 3I9AA 3C5JA 1RZGA 4X8JA 2XA8H 1LDPH 4BQCA 5ES4B 5I1IH 4JUSA 3D39E 1ZK9A 3WSQH 2BNRD 2VLJB 1LP9F 2F8OA 4UYPA 1KGUA 1NEZA 3GQFA 3JV4B 3BEWB 4YSQA 3TH4T 2UZIH 3HI6L 2PCYA 1P1VA 1CLZL 3V55A 4OD2A 4DO5A 4E36A 4Z7NB 1U8OB 1I3RB 4PJBE 4R5XA 3KYKH 4M9PA 3VGFA 1FFRA 2NNCA 5EC2B 3W81A 1HSBB 2CPCA 3TWYA 3OPZL 5L9DL 5CIPA 3BAJA 4I18C 1Q0XH 1ASOA 3DHJA 2QPFA 3NIFB 1UXLA 4ZXBC 2CWRA 3Q1SH 3H2WA 4LAQL 2NY4C 3L95B 4OD3L 3SO5A 1RPKA 2HJLA 1AE6L 1T21B 3ZR5A 5E6IB 4O4YL 1VEPA 1FVDB 2FNWA 4JO2L 4M62L 3SPJA 1NC4B 3RX8A 4HIEA 1BVZA 4QGTA 2P5WD 3AQYA 2NZ9D 3OG6B 3HHMA 2HVKB 2XN9B 3BFQG 4U7SA 1VFAA 4IGBB 3T4AC 5FYKD 3F7KA 1FBIL 2R7EA 2OYPA 5ESAA 5EDSA 4WEUD 3IDXL 1KXVA 4PRPD 2IBGA 4UB0H 5EIQA 4A2MA 3F2LA 3ULVD 2OZ4H 4QRRE 4F58H 5GS0C 5T1LA 5C0EA 3OKOB 3TNMA 1JWSA 4GAYB 4BBWA 3FQXA 3GEWB 2IWFA 2F7IA 4R26L 2XYCA 1RUML 3KGSA 2OKMA 3NA9L 1I1RA 3AXLA 1QA9B 3V10A 4FNTA 3V6ZA 2OMWA 4LIQL 1S9YA 2WNKA 5ABDE 1U8JA 3DVGB 2DTML 2OFQA 3OJDB 2Y72A 1JZDC 1HXMA 2FQFA 4URTB 5KVEL 3QSKB 3H2PA 1W0WB 2ZXCA 3HC0B 4KTGA 5MENE 4MSWB 1CE6A 2NY2D 5B39G 5BUGA 4ZW3A 3E6FB 3ARZA 4QLRA 3UTQB 4RGNB