2ATAA

Structural basis of dna recognition by p53 tetramers (complex ii)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
197
structure length
197
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*AP*GP*GP*CP*AP*TP*GP*CP*CP*TP*T)-3'
publication title Structural Basis of DNA Recognition by p53 Tetramers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis/dna
total genus 48
structure length 197
sequence length 197
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ataA00
3TS8A 3ZMEA 2J1XA 3Q01A 5LGYA 2YBGA 5G4NA 3EXLA 3WTWA 5BUAA 5LAPA 1LJMA 2H1LM 4IJTA 1HJCA 4IBVA 1UOLA 2J1WA 3QYMA 3VD1A 2ATAA 4L0ZA 4AGQA 4IBSA 2J20A 4IBTA 4IBWA 3EXJA 5AB9A 1HU8A 3Q06A 5AOJA 2J6WA 1IO4C 2BIPA 3D0AA 4LO9A 3WTSA 1EAOA 4AGMA 2BIQA 3IGKA 1T4WA 3D05A 1YCSA 2MEJB 1CO1A 4GUQA 3US0A 3US1A 1H9DA 4IBYA 2BIOA 4G82A 1EAQA 2OCJA 5ECGA 2X0UA 4IBQA 2PCXA 2J1ZA 1EANA 4KVPA 4XR8C 2J1YA 5AOLA 5G4OA 5KBDA 4LOEA 2AHIA 3WTTA 1HJBC 4G83A 3WTUA 4LOFA 5A7BA 3D09A 3KMDA 2BIMA 5G4MA 5ABAA 2GEQA 2FEJA 5AOKA 3D06A 4A63A 4AGLA 2WGXA 2XWRA 4IBUA 3D07A 2VUKA 2J21A 3IGLA 2XWCA 2IOIA 2AC0A 3VD2A 1CMOA 2X0WA 4AGOA 3VD0A 1TSRA 1E50A 1GZHC 3QYNA 1GZHA 2IOMA 3WTVA 4GUOA 4HJEA 3KZ8A 5AOIA 3D08A 3WTXA 2X0VA 4MZRA 3WU1A 1KZYA 2P52A 3Q05A 4MZIA 2IOOA 4IBZA 4L0YA 4AGPA 2BINA 4QO1B 4AGNA 4L18A 2RMNA 5AOMA 3WTYA 2ADYA 1TUPA
chains in the Genus database with same CATH superfamily
4F9PC 4PGBA 2UZPA 2I07B 4WWKC 4PRDA 4APXB 1JGUH 1UKTA 2VO5A 3U79A 5LGHL 3VRIB 2Q3AA 2WGNB 1WFNA 1NCAL 2AVFA 4OGYH 3N1FC 1RSYA 3AU1A 2ZJSH 3PQYB 4NKDA 2ESVE 2ESVD 2X4UB 4RDQG 1HYSC 4L9DA 2V0AA 4R4ND 1J9RA 3LZPA 5DJ8B 2B1HH 2BIPA 1BQ5A 3A4FA 3OZ9L 3ARDD 3KNBB 4IOFD 1SY6L 3VWKD 1NQBA 4BZ1A 5FYJL 3CC1A 1AS8A 3D8MA 4MXWL 1I9JL 1N12A 1QSFB 3WN6A 1ZHKA 3WXVH 2CCLA 2KLRA 2J1KA 4B9IA 1X5AA 1VPOH 2HLFD 3P9MB 4Q0XH 3D39B 1AANA 4I77L 5JORA 5GRJH 2DYPB 1PX8A 4J3OG 1BZ7A 4PREA 4LSUL 1XF3B 1UJTA 1XZ0A 2L7EA 4BKLA 5AW8B 4Q9RH 3GK8H 1HJBC 2IC2A 1R3IL 4HJ0D 1EFXB 1QI3A 1FV1A 1A7PL 3SDXF 3ULUL 1I1RA 4LARL 4JAMB 1JVKA 4UQ2A 2HVJA 3OAYK 1TZGL 2YPVL 3VRLE 1UXSA 4Y4FB 5FB8B 3MLPA 1QFOA 1E8WA 1XGPA 1X9RA 4JQIA 1KLUB 4LB8A 4R0LB 1GW6A 4LSVL 5DUJA 1VLXA 2EQDA 3OKNA 1NBCA 1FDLL 2DQUL 3FDWA 4DESA 2CSPA 4M6AA 1OXYA 2QQNL 2BW5A 1A6UH 5GGRY 2QFPA 2GYSA 1QWUA 3FMGL 1GC1C 4P46A 4QHNA 3CPUA 5A16B 1HAWA 3S6CA 5SWZD 3BUYA 3MRGB 2WINB 3TWCH 1BYNA 1CDJA 5TJWK 3DVNB 1MXGA 3MSPA 4J3TA 4PJIF 3REWA 3IDIB 3QIBD 2X5PA 4X5LA 4KHTL 5CZXD 3HNVL 2NLJA 4Z7IA 2ICEB 3QRLA 3AWGA 5EU5B 4AOFA 5MEQA 1BFSA 2HCZX 3P4LA 4DN3H 3CFNA 4AENB 3L3DA 2JKIS 4X9YA 4DFIA 2ODHA 4PWJA 3SDAC 3X2QB 1I75A 3GRWL 5FA3A 4EIGB 5EOTB 2QSVA 3I75B 5EZOL 5B8CB 2EINB 3EKCA 1N64L 3WJLA 3Q3GA 4J2QA 1R3JB 2KHAA 3L7FA 3TS8A 3LQAL 5GISL 2NUTA 4HC1A 1U2HA 2EC9T 2FB4L 4HS8H 4RGMB 5B1BB 1EMTL 3WUWG 4Z7OF 1QUPA 4N9GB 1IAIH 1W0YT 4MRBA 4FDWA 4JEGB 4DTGL 1IZJA 1PD0A 1ZHNA 3UBXG 5C07B 4HZLA 3U0PB 2EDOA 2HJKB 3FYIB 2R4RL 4IHBA 3W2DH 1DLHA 5E9DE 1DQQB 5E9DD 3ILQC 3LPPA 5DT1L 5CD5D 4P23B 4PJCB 3S2AA 4S1RH 5LNDA 2EDKA 1TEGA 4R4FH 1UZ6F 2GHZA 5C08D 3FH5A 3EYOA 2OJZH 4Z7VB 4Q6IA 1EXUA 1ERNA 2K7PA 1F4XL 1WGVA 4NRYA 2P9RA 2G9KA 2UXTA 4V1DA 3RWEA 4X5WA 4Z7QE 1I4FA 5J3HD 3UTSD 2J1YA 3Q13A 1QWHA 3F3HA 2MTAA 1E9PA 3TESA 4L8SB 3QHTC 3UEZA 5KN5B 3LB6D 2OSWA 1A2YA 1K4CB 4U1JA 2A4EA 4ANKA 4O02A 5F72S 4MD0B 4N85A 4K94C 2CBTA 4IRZL 4LBEB 3STZB 2HT4C 3NQKA 5C0IA 5EN2B 5FFLA 3O3DB 2E27L 2LLNA 3MC0A 3C87A 3ELAT 3RA7H 1LP9A 3NCMA 1I1CA 1IGMH 1IC0A 4MQXD 3MFFB 4U6VL 4WI4A 2HG0A 1SY6A 4S1DC 3A47A 4U1SA 3PDGA 1A6WH 1CICA 5LLIC 4B9PA 3WNIA 4FEIA 3VRJA 4G6KL 4OW6A 4R3SB 3ZQXA 5SV4A 5I71C 1CG9A 3VW3L 5BZXA 2HRLA 2C1OB 1GZQA 5I1CH 1IM9B 4RFEB 1H3UA 3C6LA 3IXTA 3ZKND 4GQ9L 3EYSL 1HQ4B 1Z3GL 3APMA 1CFMA 4GBXB 1A9EB 2D3VA 3LX9A 4OF0A 1UKQA 5I30L 3KLHC 4OI9A 3GKZA 5C0GB 4X99B 2CCWA 2ITDA 3N3EA 3ZIYA 1UURA 1LEKA 2VDRL 2C9QA 1PZDA 3PAUA 2FEDD 3MLSH 4X6BB 4XVUC 3UYRH 4HU8A 3VFVB 1E30A 3CHSA 1I8MA 3V0WL 1FL6A 3MRFA 2FECL 4IS6A 1EZVX 2OLDA 2YPVA 2AK4A 4AZUA 4G6MH 1FFQA 3U83A 5I76B 1I7UA 5JQHC 1CU4H 2HTKD 2IQ9H 3MV8E 1Q72H 3MV8D 3TIDA 4FFYH 1D2OA 4F2MA 1Y1DA 3IMVA 4JFHE 4JFHD 5HI4D 4NENB 5FXCH 4N0YH 3AABA 1NL0H 3BVXA 4CVZA 4X9IA 5JNYA 4ZAKC 2H1LM 2VDNL 4KDVA 3W39A 1U8JB 2NDFA 4X42A 1WICA 1RK1A 4P4KB 2FLRT 1QSEB 1DJYA 2V6HA 3B3IA 5C0DB 4TLKA 3RB7A 3T8XA 1KDIA 3SDYH 3ZY7A 1HL5A 4UDUB 1NCWL 1E4WL 1HI6A 2A0LD 2BNQA 1XB3A 3RGVC 2NUPA 4GLRI 4QXGL 2YXVA 4JFDD 4ZFQA 1R33A 3GRWA 5CEZH 1N6QL 2BIQA 3QDJE 3QFJA 1QHPA 3QDJD 4M4RB 1I1FB 3CVIL 2Z1KA 5IBTL 3GSVA 1CFBA 5GGRB 4X4KA 1JBJA 5JTWA 4HJTA 2DQTH 4YE0A 3ZX1A 1O9VA 2CMRH 3L1GA 1O7VA 4OUOA 4P2CG 4PRNB 5ECGA 1M7UA 4JM2A 3F84A 2YQGA 3BUTA 1TFHA 3T1WA 3GMLB 2Q8BL 3V6OE 5HTSA 1VZHA 5I6PA 2GBTA 1M9WA 3DMMA 4XBMA 4H5SB 4LPWA 3KYOB 4FHBD 4P57B 5FYKL 1E5BA 1X5IA 3SE3A 3V5DB 3F5WB 5GRVL 2K4AA 1XVSA 3U4AA 1DVSA 3L4XA 1O5DT 3MV9A 4HIQA 4KV5F 2KQMA 5AQ0A 3VQMA 3QXDB 3GB7A 3D3VE 3D3VD 4NKMB 4A68A 1XEUA 1NKGA 3GLZA 4ELME 1JWUA 3FB8A 1LP9F 3CDYA 2YD7A 3G6JA 2AVGA 4JKPH 3KWXA 5I1LA 5T33L 1X7TA 3D33A 1F1AA 4P2QB 1C1EH 1Q9OA 3ULVH 3I74A 3W0WB 1XR8B 5KYWB 2AC0A 2CH8A 1RIVL 1BZEA 1Q4NX 4QHMB 1ZANL 1AKJD 4B9KC 4ZFGH 4W9FC 4B50A 2CA3A 5DURD 1MIEH 4HXBH 1GYAA 2BNRB 4KROD 4R97B 3FO2A 3CLEH 5A6IA 2EXWC 1U8PA 2AXGB 1B2WH 4IU3B 1GZPA 3PP3H 1PD6A 1WGOA 2BIHA 4S0TD 5GRWA 1WH0A 4XVJL 4NZ8A 5CSZA 1K3IA 2D7PA 1VGEL 3ULUF 4MYWB 3RFZB 2XKNB 1ECYA 1ZV2A 3PAYA 3PFUA 5D7JC 4JFXB 4OZHE 4QHKI 4O4YH 2NT1A 1MRCH 1RHHB 4JS7A 5B39B 3GHBL 2P26A 2VN3A 2XICA 2WZAA 1MCRA 2GJ6B 2R0KH 4R2GC 5M95B 4X5QA 1XXFC 1HOCA 4LL4A 2FH6A 1HNYA 1ZA6A 4AEHH 4FMFA 2VLRA 1IM3D 3HI1B 2F1EA 3SDDD 4FJ6A 3GSWA 2YIHA 4LAJH 4QWWC 3TF4A 2ORBL 1KPVB 3TEUA 5GS0L 1Q1JH 4PWGA 3CVHB 4XMTA 1UA3A 4N2DA 5DUPL 4JPQA 4EZMA 5GQBA 3V4PA 5TQ2L 1U3HA 4NN6B 1QLRA 3LAFA 4G1EA 3PXHA 4EIBA 1A9BA 3PABB 1YY8A 2GTZB 3GSNH 4DPBX 1OY3B 2IG2H 1M2VB 1FRGH 1RUAL 5INCA 1AIFB 1FPTL 5D55A 1XBRA 2P80A 4NNYB 4FQXA 2E9IA 4PP2B 3EFOA 4HJJH 5FA4B 3EJQA 2WYHA 3SN6N 2X0UA 4ZS6D 5H94B 3EYVB 1ITCA 3VI4A 3FT9A 4LVOB 3L3HA 5HHOA 4Z77B 1WEJH 4U3XA 2J56A 3HE7A 4JM2F 2ERJB 1PD1A 2W60B 3WIFA 4OV6F 5JPNB 2MFNA 1RUPH 4K3HA 3T8VA 3VU1A 2KT6A 3J7HA 3APNA 1KULA 1ZA3A 5IJKA 4P9HC 2UZYB 4CUCA 4QOKE 2O72A 5E2WH 3S37H 1JPFA 4J3SA 2GVYA 3CD4A 5B1JC 3ZE1E 5K9JH 3ZTJH 3LS4L 1HK6A 3H6AA 4DKEH 3KWUA 1T4KB 2MH4A 4GRLC 2X40A 2YPKA 4YHOH 4O2CA 3LEYL 4M3HA 3P73A 3HHMA 4M03A 1ODUA 3CUPA 1NCBL 3HNSH 2FJGB 2B1AH 4HIJB 4MKMA 2MRYA 3UG5A 4TSAH 2IWEA 3FU0A 1AVAA 3MKGA 1KJ3H 3RZCC 3WN5C 2EE9A 1OGAE 1KFAH 5IMOB 1T1XA 1N59A 1OGAD 2DD8H 5E5MB 2P46B 3W11D 4M7LT 1JPEA 1WTGT 5INDA 1DVFD 3P9WB 5E2UL 2VDQB 4GP8B 3W3BA 1QABA 1RURH 4F7EA 4ZMWA 3BT2H 4M5ZL 3QUZA 4M8QB 4FQQB 1BOGA 1ZVYA 4JKMA 3GUFA 3H1ZA 5F70A 4X6CB 3T4YB 5KYNA 3D2UA 3S36X 2A9DA 5C0CE 2F9BT 5JHLA 5C0CD 2CALA 4U0RC 4BFOA 3TVMB 3BN9C 4RIRB 3GIZL 5JXAH 2F53B 2ZQKA 3EGSA 2CBPA 4PP1D 1KYOJ 3LEVH 1SJHB 4KI5C 1X4YA 3W9DA 3I6GB 4YHKL 5I75B 5D1ZD 1QR1B 3AG3B 2CM5A 3ARGB 2NCEA 1V3KA 1A3LL 2IQAA 4FQ2L 4PS4H 1E4XL 3V6FA 2P5WA 3MRMA 4UAOB 4LHUA 4BFFA 3HRZC 2OCFD 1BZ8A 3QB7C 1B0GA 3IEAA 3HC0B 2JKSA 4PJ8A 4OZFB 1IBGL 1N4XL 4C83B 2H5UA 4PWFA 4TL4A 3GSXB 5HHVH 4QRQA 3HAEB 2OX5B 3BC9A 5F88A 1WC7A 3INUL 3OG6B 1GMEA 3K2MC 4MAYD 4TS6A 1I7ZA 2ROXA 2R27A 2WC7A 4YHPA 4RFNC 4P05A 3SE4A 4B5EA 1PF3A 3OHXB 2WUBH 3VD3A 1IC5H 3E8UH 2V5TA 3DSFH 3FSOA 4IIQC 3RY6C 3L3IB 4AMXA 1FHNA 3UDWC 4YZWA 2AEPH 1CLCA 2BHUA 4XP9H 4JRYA 2VB5A 2B3IA 4GYBA 4NXSA 4R7DB 1P2CA 3C9NA 5F9OL 3CE1A 1FNGA 3T3PB 2AW2A 2XTJB 3BZFA 4UU9B 1G0DA 3MLRH 5GJTH 2VH5H 2Z92A 4F15C 3VI4F 3FOLA 4EEEA 1W0VA 4WO4D 1N68A 4OGXL 4QJ3B 5HYJE 5IHLB 5HYJD 4L23A 3WAJA 1OSEA 3DIFB 1GCFA 4KRMB 1LMIA 1TO5A 2ID5A 3BUBA 3RTQB 1X4XA 4PS7A 5IM7A 3EAKA 2IAMA 2NY1C 4OF5A 2IALA 3HI6H 4JFWA 5AALA 4NKQB 4AQ1B 2PPEA 2HH0L 3SKJH 2PN5A 4MYPA 3LJ3A 1WBZA 4FLRA 4KGJA 5DZJA 2G5BA 1J9SA 2WTRA 4WEMB 3EDKA 3PWLA 2WWKT 3V5HB 2NZ9C 1JGVH 1Y7VA 1O5PA 4MNQB 3VFSB 1D2PA 2DLGA 2DM7A 1H3WM 4JFQA 2OMBA 4Y2LA 7FABH 1R3HB 5IB5B 2Z31D 4G2AA 4Y1SA 3L5IA 1T1WB 4KZDH 2CJUL 5FYLH 2DMKA 4ZMVA 1V27A 3OWRA 5E9AA 2WO3B 2WZPD 1DLFH 4YX2H 1BXUA 4JMNA 5A7EA 5GXBB 1MQKL 2XHNA 1G0XA 5B38G 2ADIB 2FJHA 4QHUA 4LZKA 1A7BA 3F65A 1M1SA 2E9JA 4JGUA 4AVIA 5DMKB 2BVOA 2BINA 4MMXA 4G11A 2VMFA 3FCBA 3V8CA 3A4DA 2QVTA 5J12B 1KNOA 4U6HB 2AQNA 3W37A 5HYEA 1FFTB 4XWOD 2V33A 4ZX5A 5LXVA 2H3NB 4QXTA 3QDGB 4TNFA 4X6EB 3VQLA 2OXGA 4G6JH 4UUJA 1M7IB 1O75A 3VGAB 3SCMA 3U46B 5F3BB 4R96B 2DTSA 2BRRH 2C26A 2YWZA 2FEEL 4XB7A 4NUGL 3TO4A 1EDQA 3QZOA 1TCMA 3O4LA 3IJHB 1A8JH 4HAGA 2PWFA 4M6MH 5DHMC 5LVEA 5TD4A 5E2JA 5E8NA 1N5AB 3BD3A 5ILTL 3K6SA 4P5KA 1OAXH 3OMZA 3MLUH 4YL4A 3L3OA 5CINL 1GSMA 4FJZA 1X7QA 5TQ0H 3KS0J 5EU3A 5IFJA 2QKSA 3VXTA 3NFSH 3N5AA 1U8IA 4U1MA 5C3IA 2Q2LA 3CHOA 3VX1A 4M6OH 2XC8A 4PI2A 3L3GB 1NAML 4ZX3A 2IGTA 8FABB 2NNAB 5I1DA 1OP9A 3EJSA 1F11A 3B43A 4HEPA 3VFNB 1IBYA 3AT9A 4Y7OC 4ENED 5I6LA 4FXKB 3KGUA 1MHCA 3BKJH 3K6IA 4JDTH 1OE2A 2VIRB 3WTUA 1L9SA 4XMXA 3JT0A 5J89A 3WIIH 4H25B 2QT6A 3FO1A 3P9LA 4HG4K 1WWCA 4JG1L 2Z0BA 3D85D 1HKFA 2CRZA 3WV0A 2WYIA 2L7UA 1Y6NR 1U93B 4GXFA 4H1LH 5E99H 3GC3A 3ZL4H 4OJFH 5EFIA 4W4NA 1S5IH 1JZIA 4MAZA 3G5XA 2Y07H 4ISVB 4Z3TA 3BP6B 1K9TA 4OLWH 4OLUH 2XQ0A 1TJXA 1JPSL 5DSCB 1UD2A 2JNZA 1HYSD 1M53A 4I8DA 4NQCD 2EDDA 2VXVH 1KOAA 3FU7B 3H7LA 2NY6C 1ZSDB 3T2PA 1FH5L 4X9HA 2AXHA 4P2YA 2LFEA 3WIHL 2PR9A 3DPBB 1P5UC 3FQYA 3L48A 3REVB 1NANH 1YYCA 2FQFA 4MLSA 4HCRH 3U48A 6TAAA 1EUTA 5E6RB 3OQ3B 4PVLA 1DQVA 3Q1SH 5BV7L 5IB4B 3VFPB 4PCSA 3GMQB 1A7QL 1JVOA 2CDGB 3A3YB 1E8ZA 4JREC 4Q9BA 3SGJC 1M71B 2R39A 3OHMB 1OLLA 4W9IC 4K8RC 4AEIH 2VC2L 3MRKB 5KSAA 5JO5A 4DHLA 2P8MA 1IGTA 3A23A 4BSWB 3QQXA 3QUXB 2EEBA 3FN0H 3F62A 4JPIB 4CSSA 4D0CA 2DQHH 3FCSB 3QE5A 5F7DB 3BKMH 4NPYB 1WFMA 4JHAL 2CO7B 1IEAA 3VYPA 3WFHB 4HUWB 2W65A 3A22A 4MA7H 2HWZL 2WBWB 3MOQA 3ULSA 1IGIL 5BJTB 1TMCB 1SBBA 1UENA 1N0XH 1INDL 4LEBA 3S3JA 3UBGA 3FT3B 1KTBA 5EOCJ 3V79C 3EGXA 5CZVH 1AC6A 4DEUA 4JPSA 2MPAH 3BO8B 3QDAA 1ONQA 1HILB 2IADA 4D0BB 2P7TA 1Z9NA 1FG2B 3SPIA 4OJCA 4FFZH 5L6YL 5EO9A 4NSKB 5CCGE 5J1SC 3P11H 3KPNA 3LD8C 2VZUA 4LRNL 3EOBB 4JO4H 1CK0L 4NAJA 4M62H 4NUMA 3PDDA 3J2PA 2MQCA 4LSRL 1I1YA 1KN2H 4NGHL 5T1LB 1LTXA 3L5JA 4MJ5A 3DUSB 3UMTA 4KKPA 3S36L 3O3EA 9PCYA 4GW5A 2BMKB 2AJYL 4U0QB 3OZKA 3ATDA 5ESVA 1X5YA 5J9PA 1WWBX 2UYLA 4OM0L 1R24A 4XBEH 3FS9A 3Q2NA 4OF8A 1FE8L 2ATKB 3X14A 1HAUA 3CFJB 4P3CH 1AZBA 4JFZL 5D72H 3UGXA 5D6DC 5HPOA 1H3XA 3WTTA 1TTGA 2Y22A 5HJ3A 4TULL 3H42H 3MNMA 5ALBL 4AIOA 3LVTA 1PJWA 4D9LL 1MDTA 1QBLH 2CKBL 2WUCH 4JKWA 1XGUB 4F1SA 3FXIC 1S9VA 4O2EA 4WU7A 5DJYB 4YHLH 2EH7L 3FTWA 4OM1L 3C5ZD 4ZTEA 1ZLSL 5AWNL 4S2SB 4AGLA 1UB5A 3DURA 4HV8A 4PJHA 4Y1AE 1RLBA 2AZUA 4F58L 1XGTA 4XCNB 2FX8L 2C3VB 3DRQB 4C58B 1U4EA 3BW9B 4MB3A 3HCVA 3C5JA 2AKRB 4ZTOL 2MSPA 1I8LC 1CMOA 4NUPA 4FF9A 3MJWA 4AQEA 5DJCB 5BO1L 4M4PA 5I6XC 3DIVA 1LE9B 4QNPE 2K45A 4Z7OB 2VDOL 4KKZA 4PGBB 3MROA 2YHGA 3QXAA 4E9TA 5E51A 1KCKA 3T2QA 3KPTA 3VGBA 4BM7A 1BQRA 2PXYC 3VXNA 1NGYA 1U42A 1X6LA 2QQQA 1GAFL 4WFGE 4DQOH 4WFGD 5CEZD 3WTXA 4P3DA 5HDWA 4RMBA 5IOPA 2XV2A 4TRPL 1GTNA 3B9KC 5HGAA 4HHAA 4F7KA 4RRPM 4CU8A 2BSRB 3O6KH 4NI6A 5BRZA 4E5XA 2ICWB 4N86A 4NZRL 2HT4D 4AV4A 1NTDA 3IDNA 3B2UD 3N43B 4RGNB 1S9YA 2GUYA 3ILEA 5TPWH 1ZHKB 5DI8B 1X5HA 3HMWL 3NDYE 2HKHL 4S1DD 3AS0A 3QUMA 5D7KE 2BOBB 5D7KD 1J5IA 3JWOC 3TXAA 1S46A 4RMQA 4GUPB 1JD9A 2IBGA 2EDEA 4R26H 4JKNA 1IKNC 2MJWA 2WKLA 1ZVSB 5IIEA 4ZNCD 4X6DF 5L4FA 4YIQA 4YXKH 4ZUTA 1BMWA 3ULVD 1W72H 4HIIA 4FQLH 1JNHA 3KLHD 3QO0A 1H3VA 2F54E 2HYMA 5DRZA 1NKOA 4Y4KD 2F54D 3QFDA 4GKNB 4KH9A 4HUVA 1RZIA 4BRVA 3N41F 5ANMA 3IGAB 4XVUD 3U36A 3TF7C 4PWIA 1PU0A 1T1ZA 1F3JB 5CEYA 2PCYA 3II1A 3SQBA 4DVBB 2OCJA 5ADPH 3CZGA 3DNKA 1XGPB 4OJYA 2FSEB 3GMOB 3V9EA 1MPAL 4DK5A 1RI8A 2JCCE 2VRKA 4WFHE 5IFAH 3QI9B 1S7RB 4ZMOA 2XX0A 1DBBH 3QRFM 2XZQL 3SOBH 3CFBA 2AJXH 2KKQA 3MNVA 2XIDA 3TT3H 1JG9A 1F2XK 5KG9A 4KTEH 2W07B 3BUYB 3B7TA 5GRXG 1UM5L 1XH2A 3X12B 1HDMB 4LPUA 2GJRA 3LRHA 4ZAKD 1JHKL 1CDIA 3IDJB 1DBKL 2NLJB 3ZZLA 1BEXA 3TA3B 1IX2A 1YN6B 4XOBA 1QVOB 2WO2B 5ITFB 3IU4H 4ANVA 1RERA 2RH0A 4BZ2L 4B6ZA 5FR3A 4LCYB 2J21A 2FWUA 4AKQA 1T5KA 4OT1L 4P9MH 4PJHF 4N0RA 5K1NA 1BQLH 5KSUA 3TO2B 3IRZA 2DAVA 5MENE 4ZOCA 5MEND 3L9RA 2X0WA 4RX4A 1E6JL 1IFGA 4PJGE 3O2WL 2MKWA 3KEDA 3ZDZE 3SJVE 3FPYA 5DZPA 3SJVD 4DPRA 1MXDA 1EAPA 5AB0A 2DQMA 5EU6A 3WKMH 4HUNB 3QPXL 3X3FL 4JO2L 4X0NA 5IT2L 4M93C 2X0VA 4W9EC 3T09A 1N8OE 1G9NL 1Q0YH 4LCCA 1WFOA 2EE6A 5C09B 2CNZA 3UP1A 3HE6C 3EOTL 3PE9A 2NNCA 1DUZA 4OTXL 4JRXD 1MREH 4HG4J 2XA8H 3CLFL 4F8OA 4Z7UA 4Z3GA 5GGQH 2EYRB 3WFCH 4QXWA 3IS1X 4RAVB 1KEGL 4ELKB 3OR7A 5HD8C 4OIIH 4GSDH 3WD5L 4K71B 3A24A 3ZDYB 1EXUB 1I7TB 2AEQH 4WW2B 3RI5F 4WUUA 2ZOLB 3EDFA 5D96B 1KTCA 2K6ZA 2NQCA 2X10A 3SGEI 4GG6F 3HPJA 3TJEL 3BZ4B 3QHFH 4JY4A 4K3EH 3E9TA 2WOYA 4LSSH 1LVEA 1E9PB 3ZHNA 1Z5LB 4QRFA 3LIZH 5CS7A 5AB9A 3CFIC 5DVLA 4X8GA 3C8DA 1T20B 25C8H 3PGCA 2YOCA 3X3GH 5BCAA 1NGQH 1NUFA 2VJXA 3X13A 4H26A 1F1DA 1A4BA 4KUCD 2X3CA 4CBPA 2PCPB 4QRPB 2EXWD 1BAFH 1LP9B 2EDNA 4N2FA 4V33A 2QDVA 4YK4B 1MCKA 3NTCH 1BDYA 3T0XA 3L2MA 3QIUB 1BQKA 3BPOC 2BIIA 1SOXA 2DIAA 3GZOA 1N19A 2NR6D 5D7JD 3BGMB 4Z8FL 3CMOH 3C8KB 2JJTA 5D7IB 3D7PA 3SKNB 4QTIH 4U2ZA 4NQXA 3TZVC 3SCMD 1QI4A 4P2RD 1AKPA 4PCKA 2NYYC 2JJVA 3G04B 1YMMB 2E9WA 1XEDA 1G84A 4NQDD 3SE8H 3PWUA 4XX1E 3MO1A 5FS5A 5DC2A 4BCXA 4K5LA 4N1EA 1I8MB 1FL6B 1LO2L 3H4HA 5C0BB 1MUJB 3OAZK 3MU3A 3T65A 2CG9X 2W94A 4UOJA 2BSTB 2H0FA 1UH4A 3MRLB 1KCVL 2NX5B 4HKZB 1GHFL 2AEWA 4NIKB 5I82A 5D70H 5HYQA 2L4OA 2ESVA 4EI6A 4F2MB 2EEAA 2ED6A 1E28A 5IWLA 1N7MH 1XR9A 3GXPA 2HX7A 1RUQH 4FQIL 3S48A 1NBZA 3ARDA 1UWGH 5JHDE 4U49A 3MLYH 4HIHB 5JHDD 2WM0A 4FG6C 3OAWA 5EB9A 2EEDA 2DB8A 4HK3J 3FCTA 2GBUA 1U8MB 1CFTB 5SX4H 3IDYB 3KBPA 3KBHE 2LGNA 1DZ0A 5I66A 5AZEH 3V9FA 4L0YA 5FDWA 2Y36H 3F7PC 4IGBD 4PB0L 3LKSB 4BZ2A 1UA6L 4PWEA 3LPOA 5JR1H 2K78A 2LV4A 2Z0UA 2IH9A 3OXRB 3U7YH 1ZS8A 3ABLB 3ECBA 4YSAA 3RJDA 3BSZL 4Z7UF 3U4BH 3VFGH 1C16A 1FLRL 4APQB 4LQFL 1MG2C 1FGNL 4MKTA 4NZTL 4LCIH 5BUGA 3HZVA 2YFOA 4JM2B 3WHE1 4UBDD 2WLIB 5FM4A 3KHOA 2A83B 3Q2CA 2OTUB 3RZCD 4GT7A 1FVDA 4J8QA 4Q9QH 5K69A 1HEHC 4ZQKB 4WDIB 1DUYA 3N1PC 4MA8L 2VQ1B 2OJ1A 3ILPB 4UM8B 4XNMA 3HC4H 4F8TA 4EZLA 4MJIE 1B3IA 1T4WA 4YZFE 1WIOA 3R06A 2UWEE 2RALA 3QWNA 1JWUB 3GHPA 5FYLD 4X5PA 1HL9A 2XXFA 1G9EA 3FRPG 5HDQL 5I1LB 1BWMA 2FCBA 3BN9D 4P99A 1FNLA 3F6IA 3CBJB 2PF6A 5E0FA 1OPGL 2FX7L 2MCPH 3IK2A 4KI5E 4FQ1L 3EUUA 3V4VL 4KI5D 4AQAA 5IB1A 2VMDA 1A1OA 4BRJA 2CD0A 1CF8H 5E2TH 5ABAA 1DJHA 4NCDA 4HX1A 4DH2A 2CCVA 1HSBA 1YVLA 1GZPB 1TT6A 2G75B 8PAZA 4PFEA 4MASA 4NUJA 1KT2B 3DV6A 2ZUVA 2XA3A 2GUOB 5ICUA 5F7EH 3PLYA 1FFPA 1TPXB 1IARB 5DJXB 4JG9A 5F96L 1NLBH 1KB5B 1E50A 3H3PH 1KBPA 3KWTA 3VMOA 2WVVA 5E9DA 2ITFA 4KJQD 1QACA 4DGYL 4N22A 1QBML 2M2DA 4NN5C 4PU2A 2Y5EA 1CZ8L 4FXGC 3KCWA 1RZQA 2OW7A 1GYVA 1YEIH 4NHCH 1IEHA 1CD8A 3BP7A 3KM1A 4NN7B 3TA4D 3K8MA 2QZ5A 5DMYA 2NOYA 2XZCH 2VDRB 3S4SG 5AW9B 3P40A 1MWAL 4FL4B 3HS0C 1U3HB 5BZWA 1CL7I 2DQIH 4AGNA 1NC4A 4YO0A 2A1WH 4L18A 1TETL 4Y19B 1A8ZA 1LO0L 3FQ2A 3O6FB 4WI5A 4MFHA 3MACL 2VGLM 4JPWH 1PTZA 3C60C 1L0XA 4RRPA 5AKTA 1HSAB 2AXJA 1YAZA 3WNLA 1QLEL 5IF0A 2DLFH 1CXHA 4HQQH 5F7NC 2NY1D 2HJFA 3PWPB 1G7IB 2D03L 1QYGH 1BPLB 3DSNA 4HKXB 1QNZH 3ESNA 2PYEB 2B16A 4Z95H 4Z5RB 1TNNA 3VI4B 4HUMB 1L5GB 3L3HB 5HHOB 2C3HA 2DMHA 3Q5TA 3D50A 3QUYD 1Z2KA 1NC2D 4Y9FA 5KVGE 2VDNB 3MJGX 1I1AC 3ASNB 4U3CA 1G7MA 3S5LG 5DZLA 2AABH 2QJDA 4HGMA 4MA1B 5DJ6B 3UPRA 2WNWA 3BLPX 2XQYG 4F2FA 1YNLL 1TZIB 4LPCA 4MA3B 1BQSA 3LN9A 4TNWF 4DJMA 4FYTA 1TJGL 4IMLA 3LN4B 3QSKB 3F58L 5DUBA 1QR4A 5I1JH 5F7WC 4M7KH 4B5ZA 5HYSB 4A67A 1AY1L 2FHBA 2YKLH 3P73B 5DR5H 4X7SH 4EIUA 1J0JA 5KVFH 1UWFA 4KDTA 1E43A 3FQTA 4LLYA 2QHRL 6PAZA 4CMMB 3VXRE 3VXRD 3JVFC 3OR6B 4PGEB 1EK3A 1NCJA 1RUMH 3FFOA 4R5XA 4OI8A 3BPCA 3QCVL 1N59B 3VGEA 3B6SA 3ZMRA 1LEIA 4I18B 1G7JA 1PJ9A 3MV8A 4UI2A 1NMBL 1ZK9A 3POCA 5DK3A 4H8WH 3SHSA 4JO3H 5M94B 2W9DH 4K07A 5DWPA 1KCUH 2ZD0A 5T8IA 1RU9H 2O5NA 5GZOC 2LTQC 5I0ZA 2RIKA 4OGZA 4BUGA 3R19A 3TOPA 1T66D 4A7SA 2IOIA 2JLLA 4MXVE 3RVTC 3VD2A 2X4OA 1RJZA 3AROA 1NCTA 1R0AH 2X4SB 1ET5A 1GY2A 3EW3B 4Z7WE 1JFQL 3QG6A 2R29H 2VITA 4WNSA 1P5VA 3VG0L 1GOGA 3DX4A 3MRQA 3BWAA 3GXNA 4I85A 2IQAB 2BSSB 2H4EA 4PLJC 4AQ8A 2VLJD 2P5WB 1DQML 1WSST 3QDJA 2DQDL 5EUKA 1I3GL 4OFQA 3DO7A 2GQHA 3SEPA 2Y4SA 2FATL 3DIDA 4PJ8B 3TYFA 4ZUSA 1VKXB 3FO0H 9CGTA 2A9MH 3H55A 4NUQA 4QRQB 1SHXA 2DQCH 2FJFA 3TLRA 1WC7B 4NRZB 1BVZA 1I7ZB 1L7TH 1S5HA 4QRRE 5A43C 3VFUB 4QRRD 3V6OA 1IMHC 3RWDA 5AW2B 1YYLH 2X44D 4GFXA 4WTZG 4OZFH 5CEXB 1KCWA 2KLTA 5K9OA 3WCYA 1CXFA 3BAKA 4JRYB 4A66A 4AYMC 1KBGL 1XSIA 3CCHA 2FHFA 3HI5L 1P2CB 3GI8H 3L1FA 1KPRB 4UINH 1RJLA 4Z76A 1N5YL 4LEEA 1RIUH 2HJLA 2V5RA 1UOLA 2H32B 5E6IB 4FQJL 4JM4H 5F7LB 3BZFB 3D3VA 4U1LA 2A9CA 2QSCH 1H8OA 4XC3H 1KF9B 2XFGB 2V4LA 4ELMA 1N6UA 3NSJA 2LHAA 2EDTA 1UCBH 4IBWA 2HG5A 1QUNA 2J55A 4ZFOA 2NY6D 4S1SL 3PUCA 2G2RA 2ZUYA 1T89C 2YJQA 2H9GB 1BIHA 2IVFC 4P04A 4MGXA 3WUWA 1UYWL 2EH8H 1HWWA 4MQSB 1AKJA 4YMPA 2MOVA 4S10A 5IW6A 5IM7B 2V17L 4X8JA 5IMLA 1D5RA 3FQXB 2IAMB 2NY3B 3NEEA 2XWBB 3PPSA 4YFDB 4XHQA 3UBXA 5KAQG 1RZFH 4RMUA 3CVBA 3NJJA 3NRFA 2Z4QA 5F97E 1K5NB 4K8RD 1GY1A 1I53A 1P0SE 2FD6L 2XN2A 2B59B 1AI1H 3GBDA 1Q1PA 3BRFA 3GI9H 3IU3B 3ZZ1A 4KVNL 1D9KB 1GPOH 4G7VL 4BZYA 4K2UH 4KQ3H 1U8OB 4ADGA 1HHJB 4OZHA 5L8KB 4PG9B 4XNQA 5AB1A 5CIPA 5DJ2A 1YDPB 4I3SL 1JK9B 3QJZA 4KNSA 4TLSA 2D7OA 5L2KE 4N2KA 5L2KD 1DQIA 1JRHH 1ZLWK 3T0BA 5HGBA 2CUHA 4PRHB 5F7MC 4LLUA 1UQSA 4DUVA 2X7LB 2P49B 3HR5A 2H2SC 2NW3A 2E59A 5BVJB 4YC2C 4JFEE 4BDVB 5IJVA 1F8TL 4H40A 2F8XC 4ALAH 3OJMB 2WYZA 4A39A 3QHZL 2J5LC 1F6AA 1G87A 2A38A 1T03L 1CIUA 2XN9D 2C1PB 5MI0C 2IGLA 4QXTB 2IOMA 2O6EA 1NEZA 3MCLL 5IEKA 4NS0A 4KTDL 3D0VA 1X9LA 3HNTL 1XGQB 4OCMC 1IGFH 4XN9A 3RU8L 2N0MA 1FCCA 1VFAA 2BY1A 4XN5A 2R1XB 5I0DA 1FL3A 1W6WA 3DX8A 1TZHB 4ETYA 3O9WA 4DGWC 4TSCL 3K6SB 3E2HB 1E2ZA 5LQBL 4KMQA 4N2MA 2DMGA 1AGEB 1M56B 1UT2A 3ARBA 3DJZA 3CXFA 3WDHA 4LSTH 2B77A 5IFJB 1H15A 5CCKH 1DFBL 2Y5TA 4QOKA 4TPRH 3VXTB 4QCIA 2RBLA 4OCXL 3WXVL 4U1GC 4TUKH 3R4DA 3V0VB 5FIEA 4A7UA 5CM1A 2OZ4A 5L2JA 4Q0XL 4MJ6B 1Q0EA 4OAWB 5ID1A 4BH8A 4WI6A 1F58L 2ENJA 5EWIH 4EN3C 4ELMF 1PG7W 1MH5B 1WRFA 3UZQA 2BFVL 4P0DA 5LWYH 5C0AE 3GUTA 5C0AD 1OGAA 3FO1B 3KJ4B 3P9LB 5DZVA 5E2VH 3UEQA 1INQB 3AQZA 4UOW1 4DAGH 2D3NA 2YSSB 3TU6A 4HWNA 5DDHA 1X7SA 1BQHG 1HC1A 4JCWA 4IJ3C 4XZUA 3WL9A 5I0WA 4I4WA 3ZXAC 3MOAH 1U8CA 1IQDA 1OAUL 1JGIA 4XR8C 3SZKC 4XCFL 3B9KD 1JNLH 3V0IA 2AV7A 5DK2B 5ACZA 3FHAA 1A6AA 2NNXA 1DQTA 4XMKH 4DP8X 5FOJA 3NIDB 4A7VA 2ZP8A 3C5SA 5HJDA 5C0CA 5KBDA 3WS3B 3NSYA 4UB0H 2O5ZL 1MNUL 4XPTH 3QRBA 4MAUH 2E86A 1L9QA 4GI9A 4M5YH 4UTAH 1M6OA 1TFPA 1LQSR 1OGTA 4OZHF 3MOBH 4EMZA 7PCYA 5FUCC 3QIWC 5D1ZA 5KJ7E 2V3DA 5HGHA 1R3LA 3P3YA 3TWCL 1OB1A 3VWJB 4DETA 1EJ8A 1GH7A 3WGVB 4NQEB 3C08L 1WZKA 3G9VA 2WKOA 2O5XH 4U1NB 1GGIL 1Z3RA 4A2EA 3NCXA 5TDNB 1OD9A 1HHKA 2P8MB 5ECJE 1IGTB 3QUGA 4UZSA 3GNMH 3M45A 3EH5B 4XI5C 2XDHA 5HVHB 1AG0A 2XG4B 2AJZA 3QNFA 4KO9A 4AM0A 3MBWA 4WY7L 2W65B 5KVDE 5D93C 4ZMAT 3O4OB 1U8KB 3QJHA 4W68A 2ZAGA 1D6EA 3OXSA 4XBGA 2W80C 4YSPA 1F13A 1BVKB 1IAIL 3I9GH 5DEGA 2E7BA 3WEOA 4WU5B 5ES4B 1ONQB 1O6TA 1F6FB 3JWNC 2IADB 4W93A 1HCFX 4X6DB 4Y4HC 1ZJAA 3EJTA 3QCUH 2EKSA 4FNQA 2D0FA 3I02B 1MLCB 4JHWH 2ADJA 1HXMB 4IMKC 3KPSB 2IXQA 5CN3A 4PJDE 4WO4A 5LGKA 3N41B 1H6TA 4N8VB 4P5MB 5HYJA 3UJTH 5GRUH 5SWSB 2WXOA 2CXKA 5EF1A 2Q6WA 4QF1B 3ECQA 1RZ8B 4HJGB 4R4FL 3TV3L 3ZKSD 5SWQB 2X9XA 3MJ6A 2EE0A 2EDHA 2OJZL 4PS3A 4YSSA 4IBVA 2I26N 3ZRFC 4KJYB 2I60L 4B97A 3ZE1F 1NLDH 1SBSL 1GGBH 5I1IL 1R46A 1V7ML 3VO0A 3LTVA 1KY6A 1NA8A 3CZEA 3JWDL 3MUUA 4LP4A 2FWOB 5HJ3B 4L1DA 2XFXA 1I3RA 3MBEB 2NY0C 2V9QA 4XCYA 1OIOA 2YA1A 1MJ8L 1S9VB 4XMVA 5CFAA 1OT4A 2NY4C 5EBGA 1JTOA 5BS0E 5BS0D 1EJOL 1JGLL 5AW4B 1UB5B 3ROOB 2WNXA 5ENWA 2WZPA 3UTZB 5FGSA 3VE0A 2GY5A 4IHOA 1YNKH 4U4BA 3HE6D 1XGTB 4WSGA 2LE9A 5GSRB 2H45A 2MTPA 5I24A 3LIUA 4FLQA 2Z35A 1NAMB 1GC1L 2FJSA 1G7LA 1EPFA 4Y5YB 5HBBA 2K3HA 5JOEA 4F91B 1EVUA 2R83A 3H9HA 4DKFH 5A7BA 3PCYA 5HD8D 1IC7L 4UV4H 2OTPA 1U8NA 3ZJAA 3KW7A 3FN9A 2Y6SC 4Y16C 5I17B 4PSRA 2ZXCA 5DZNA 2WVSA 3ML8A 3V55A 5T1MA 1E4HA 5B3JE 1QFWI 2BS9A 1HHIA 4H88L 3G5VB 2X1QA 4P3DB 4HSAC 4LEOA 2EYTA 4GO6B 4G9FB 4AL8C 5IOPB 3C6SA 4KX9A 5AAMC 1H9VA 1UFGA 4MCYA 4TL5A 2FQGA 2ZG2A 2WKOF 3QDMD 3FW6A 3BAYA 2OJEA 3EHBC 3T3MB 1AG6A 4K73A 4P5RA 3RX7A 4AJVA 4E5XB 4YFEA 4DNLA 1KCSH 5A2CA 3UIZA 1ZTXH 1XF5B 2HKFL 4L4TE 2H6OA 4YUEH 4L4TD 4FHKA 2D31B 2DQGH 4FFYL 4UWQB 1RZJC 4M3JA 2F7IA 4G42A 4XODA 1QD0A 3GSQA 4NJAL 2ENQA 2FL5B 3PL6A 1UXWB 4L9LC 4GG6B 2ENSA 2CXGA 1CFQB 4DCQB 3BQUC 4TVUA 3L95B 2IDUA 1VCAA 1UM6L 2Z65C 3CWGA 4BZ1H 3Q05A 2F5BL 1IKOP 5BV7B 1E27B 1YMHB 5HYFA 3G5WA 3Q6FA 1MCLA 4DF9A 3HUJE 3N04A 3BPLC 4G8IB 2E6QA 3TIEB 3NA9H 1DO5A 3L45A 2VC2B 1NCDH 5KBMA 4PEEA 4IKJA 4C59B 1JNHB 4HF5H 4U7MA 2QQKL 5LBVA 5IQOA 3HKZA 3KH3A 4MB1A 3BISA 1J5OH 2F8OA 2CGRH 1QBBA 4DK3A 5IMMB 5CEZL 4F9PA 1TG8A 2HA1A 5DLML 5F1IB 3D85A 4WWKA 2VR7A 2EILB 4JFPB 2YKKA 1V7NH 5FF6A 4KKLD 1TQVA 5C0JB 1Z9LA 1NFDE 3WFDL 3CU7A 1KN4L 3U6RA 1R4XA 2MNJB 1S6NA 3U30C 3QQ3A 4K94L 2YK1L 1E5AA 4POZC 1VEPA 3LSOB 4F5CE 4JQIH 1ADQL 2XWJA 4FYQA 1OAQH 2Y1ZA 1KJMA 5AVXB 2DJ4A 2AP2A 3D05A 2IH1A 1MJUH 1RFDH 1OD7A 2C8NA 4GRWF 4IU2A 5C9KA 2WQUA 1WTLA 1SJXA 4AG4H 4FLSA 1G94A 3T77A 3WSQL 3WNOA 1G4MA 3MJ8B 2XJKA 1KTDA 1S9WB 4N0UE 4X4XA 1YEGH 2V7NA 2WLLA 5FUOH 4KITB 1UOVA 1C1EL 4LIQE 4LOEA 4DP5X 4R90H 4QO1A 3ULVL 4XP6H 1XF4B 2J2ZA 3VTTA 3GBMH 5MERA 2I32A 1CTOA 1X5JA 3LKQA 4GW4B 3PIQA 2WTPA 3ZE0B 1FYTE 3PHQB 1VZIA 1FYTD 5IVZB 5AVVB 5EU6B 5K39B 3UAFA 3H0TB 2CLRA 1CJYA 1K8DA 3A6BL 4ILDA 5ADOH 2QV4A 2PWEA 3UERA 1EUUA 2CKBB 4IM8A 3RPKA 3TGXA 1XCXA 1N70A 3UTTE 3UTTD 1G7QB 4PBVC 1OALA 1PQZA 2QPDB 3B5HA 1VEOA 3RVVC 2IH3A 2VXQA 4IRJC 3QRGH 3NH7H 2R69A 4S11A 4Z7UB 2UUDH 1PZAA 4HALA 3PV7A 3IDGB 2BCKA 4WHCA 3QYNA 2V7HA 1ZHBA 2A6DA 4ADJA 2R0KL 5BRPA 4NQSA 4J3XA 1M3JA 3L5HA 3RILA 5DS2A 4WAFA 4ZRGA 3LHPH 4LDEB 4WUUB 3SY0B 5LNGA 4OF3A 2VDOB 2XPYA 3R7QA 4FTVE 4YHZH 5JIIA 2PW1B 2J73A 1WYJA 1XV8A 3MAWA 3D6GA 1OOWA 1BBJA 3D0LB 3DOSB 3SDAA 1S3KL 4OKVB 3PGCB 3IJSB 1S7WA 3O45A 1VZGA 2YD9A 3ZPDA 4XP4L 4H26B 1ROWA 3VXOB 4F80A 5LGHH 2VJ0A 5E8OA 4AJ0A 5F9AC 4JN2A 4HXAL 4R7VA 5B38A 3MI6A 1OARL 1KJ2B 1NCAH 1X9QA 1RZGB 4Q14A 5JW5B 2WZ5A 1HJCA 4O02H 4JFOB 4WEBH 3TCLB 3AFLA 2YFNA 1NCUA 2APFA 4M48H 3ARQA 1ZWIB 2XJLA 4Z1PA 4I1RA 1YUHA 2X2YA 4ONHA 3QQNA 4LE8A 1WT5C 2V5YA 3OZ9H 3SY6A 3ES6A 2DI9A 4Y1AA 5EF2A 1SY6H 4QT5A 3ZHFA 5AFAA 5FYJH 5H4YA 1MFUA 1NICA 4AYFB 4MXWH 1DBJL 1I9JH 5EBMB 5JW4M 4Y2OB 1S7QB 4LPYA 3WLWC 4I77H 1CE6B 4HFWB 2GK2A 1S7UA 3PWUB 2EDFA 1YECH 5K9JL 1IAOB 3LNIA 4Y8DC 4LSUH 4DKEL 4XGZA 1XO8A 3BZEA 4XCCL 2YD8A 3TEWA 2RGSA 4HA1A 1A65A 2YD3A 4HIEA 2JI1A 3T65B 4GAYA 2FYYA 2C4XA 1R3IH 5DEFB 5EO1A 3DX0A 2G3NA 2GBAA 4WJG3 4BFJA 2F58H 2B1AL 1A7PH 3WO4B 3I6SA 3ULUH 4TSAL 1H5BC 3BAIA 5FYJU 2EO1A 3GXIA 4OVVA 1FO0B 1KJ3L 3LNHA 5HHMD 3ATFA 5HYQB 5JLZB 2F19L 3C60D 4DZBA 1ZHLA 1ACCA 2YPVH 1XR9B 1KB9K 1F45A 3NEXA 2OXHB 2X9ZA 2Y1AA 1NBZB 4WRLA 3VWKB 4LCVA 4YQXL 1LWHA 2PO6B 2V8LA 2Q86B 1FDLH 2DQUH 2XWRA 3RP1A 2JIXD 4NJ9L 4XMLL 1GGUA 2QQNH 3RWCA 1DSWA 1I1AD 5AZ2L 3Q8EA 1TTFA 5I66B 3OB0K 5EEVA 1U2YA 3FMGH 4EI5C 1I8KB 4Z0XB 2ZXGA 2GW5A 3TH4T 1MAML 3QZWG 5DU7A 4MSWB 4KHTH 4MDIB 4NKIH 3HNVH 4MD5A 2X4QA 3GD1C 4EOWL 5I16A 1PGRB 4LRIC 1A02N 3BIKA 3PHSA 4J5VA 1PEWA 4X4YB 2YXWA 1ZRUA 4EKXA 3GRWH 3HZVB 2V2WB 4TQ8A 3BGFB 5ICXA 5EZOH 4CRPA 5GJSH 5HVWA 1U91A 4IRSD 1N64H 4I48A 3UADA 3HHSA 5IHZA 1MFEL 2JCCA 2VN4A 3LQAH 1DUYB 2FB4H 2ZX9A 2F74A 4ZMXA 3OJ2C 1EZLA 4DIXA 4FQXC 5TH2A 4XBPB 3TEXA 1G5GA 1YEWA 5E23A 3RNKA 4ZXBC 1IC5L 3E8UL 3PUUA 5F89A 4DTGH 2CDFA 4O2FB 5DJZB 4CSPA 5SWZB 2YAMA 3VXME 2AEPL 3QK0A 1HXYB 2MWCA 3VXMD 3FTGA 2B0SL 4PJ6A 3UAAA 1AHWC 4BWUA 5GZOD 3GINA 4ZAKA 5ERWA 2CHZA 3QIBB 4DEPC 2F08A 3HN3A 4LVNB 5DHDA 1PY4A 1RL1A 5CLWA 5ISZE 5ISZD 3TN0C 3RVTD 2UZXB 4TTDC 3QEQD 3E6FB 5GJTL 1DJIA 3S2CA 5J57B 5AL0A 4WGWB 4UANA 4E9YA 1WVZA 1A1OB 3HB3B 3RGVA 5KSBE 2GTQA 5MENA 1F4XH 5ESQB 4XN4A 5IMKA 4PLJD 4X8XA 4PJGA 4Y1TA 3HG2A 4B0MB 3SJVA 1Z9MA 4E9RA 5EEUA 2DM4A 4QNPF 3QORD 4NUJB 5EMYA 3IE4A 1LO5A 3SKJL 4PD4K 3WOVA 4RFOL 3PAVA 1H19A 4IRZH 2W0LA 5FGBC 4TSBL 4BJLA 3MRRB 4JFFD 2E27H 5A1AA 1LWJA 2WVVB 1S7TA 3G5YB 1BREA 2W95A 1AO7D 1T3FA 4WQOA 4U6VH 5CSGA 2A77L 5IK3A 1ZOXA 4YLBA 4YSOA 1MCFA 5GZND 4HKJB 3RIFK 3DBXB 2RFXA 2YQ3A 1JZ7A 2VISA 2YAPA 5C08B 3DUUB 4G6KH 3BH9A 2KC0A 5FYLL 4B7IA 4YDVA 4I2XE 4ES9A 2OZNA 1ZJBA 1OF2B 1EEYA 3CJJA 5EHFA 1FFNB 2EIMB 1C08A 1T2XA 4L3EB 3EYSH 1WG3A 3D25A 3SBPA 3UTSB 1S7VA 3U9PL 4XVOA 4CDGC 1HZKA 3VD0A 4HUXA 3N40P 3QH3B 2XPGA 1JHTA 1XF2A 1GZHC 3JWNG 4KK8C 2VDRH 4YHNA 5IF0B 4N0FA 4UIMB 2DS4A 3V4PH 5E8PB 2QLVB 3SQOL 1ZGLP 3V0WH 3BI9X 4NQVA 1JZDC 4OCYL 2WXNA 43C9B 4G6JL 2WVUA 3FZUC 3AREB 5EBLA 1J0HA 1M1XA 1BVLA 4PJBB 3L3JB 2Q1EA 2G2NA 3UO8B 1G7MB 4ZS7L 2BRRL 3KYNB 4GRMB 2CIIA 3T0VA 1M05B 5D7JA 3NJIA 4KK5D 3ZGHA 3UPRB 4QRSA 4MNGE 2EUVA 3IXAB 2G4EA 3GSUA 2F5AL 1XTLA 4OUUB 2AK1L 3VD9A 2VDNH 3HN8A 3HPLA 2BC4A 3RDJA 3IN2A 2M1KA 4NFCA 4GXVL 3FRUA 4PRPE 5BQDA 4G7YL 4Y4FC 2VABA 1MZZA 1GSKA 2WXIA 5F1NA 1TKWB 5C9JA 1TVBA 4F27A 4R0LC 3FQTB 3NFSL 3AM8C 4FNLL 4BE6A 1CD1B 3P2DA 5CP7A 3NJMA 5FGCE 4C8XA 4QXGH 5D1QB 1IUZA 3BPCB 3OJDB 2NW2A 3FF7A 1N6QH 1MAKA 4BHUI 2XZAL 4I0KA 3CDZA 5FO7A 4XP1L 5IBTH 2EDLA 3BWZA 2VXUH 4W9HC 3DX7B 3A21A 4AW4A 3EDEA 2ILLA 1BX2A 3KPQB 1WCBB 2MEJB 3CFCL 1PSKL 4WI3A 1RJCA 4ZPVB 1MDAA 2ICEC 2ZSVA 2Q8BH 4PJGF 4MRCA 3ZDZF 5E99L 1KGYE 5FYKH 5JHDA 2XVBA 3IJYA 4OJFL 4OZIF 4H20L 5I1KH 4KBPA 1QA9A 4AUJA 1REIA 2UY6B 5D9SA 1MHEB 5B8CC 2VR6A 2X4OB 3KLLA 3VXQA 1RJZB 4IOSD 3G08B 4OD2B 4KNQA 4LOFA 4LNRA 4FOMA 4OZGE 1K8IA 3KDPB 4BSVB 1YEKL 4NO0B 4Z3EA 1WISA 3V4VB 4JFDB 3H9ZA 3RWJB 5IV2A 5B1JA 3OMAB 3QDJB 1IGYB 2D4DA 4GRLA 4HCRL 4FZEL 4LMQI 4TQIA 4D0DB 3DO7B 2WV3A 4U6YA 5H35A 1JZFA 2YZ1A 2J44A 4OKDA 4WKZB 1RIVH 3D52A 4M02A 5FYKU 2FRGP 1HH6B 1ZANH 1DVTA 3M07A 4RMVA 2NNRA 1RD6A 2B9BA 3F7VA 1UD5A 3F7YB 4AEIL 4P23C 4F3FA 2JB6A 5EORL 3RWDB 3UZVA 3RZCA 3WN5A 1NGXA 4E9SA 4OH2A 4HUUA 3RJOA 2DMCA 2OMTB 5K9OB 2DQHL 3MGOA 3BKML 5E00B 3CCHB 6CGTA 4KTGA 2Y24A 4J3UA 1SRDA 4XVJH 2GY7B 4MJIA 1VGEH 5ID0A 1URIA 2APWA 4JDVB 4RAUB 1KLGA 2WPGA 4Z7AA 3H9SE 2UWEA 4KUCF 3VG9B 3EJJX 3D3VB 3H9SD 4LKCB 1MELA 4U1LB 1N0XL 2ZOKB 1A66A 1FORL 3GWJA 4LLWA 3LRSB 4L8SC 3GHBH 2QTVA 1IIIA 3AJ7A 4CC0A 4HUCA 5DMGC 2LU4A 3UC0L 4HS6B 1KB9J 4HH9A 2QSTA 2DEWX 1MWAB 3N06B 4K7PX 4QYOA 3LXBA 1TUPA 1FFOB 1MFBH 5FUCE 4E9VA 3E7JA 4KQ4L 2UXGA 3P30L 3QIWD 5CLZA 4JO4L 1ZLUH 1AJ7L 5GS0H 4M62L 3KVQA 5DURB 4NOFA 3V4UL 5TDOB 2L7QA 4KROB 4MMYB 5DUPH 1HWGB 3NG5A 4WW1A 2L0DA 5TQ2H 3HRZA 5E5RB 3FUFA 1Y07A 3K8LA 4UIKH 4H8PA 1MFCL 2BVYA 4LLVA 1R19A 1Y6KR 4ZI8A 1ZT7A 5E95B 1OP3H 3K6FA 4G8GE 5FECB 4G8GD 1FVEA 1RUAH 4L1LA 2W9EH 3T6XA 4XI5D 4GBXC 1FPTH 2G4GA 3CFDB 3EO1A 3NIFB 2ZG3A 3V4LA 1B4LA 3CNKA 4IIQA 2ZWLT 1QSZA 1TU2B 3RY6A 4YHIB 3UDWA 2VMJA 5FCUL 5IJDC 2I9TA 1U95B 2K7QA 3NK3A 3OQRA 1NIAA 2X6UA 3NABL 4YE4L 2HN7B 2NXYD 3LYRA 4LLUB 1IM3B 4ZW6A 4EO5A 3SDDB 3JWNE 3LKOB 2J72A 4KRLB 4QEGA 2KZ1B 3S96B 3T1FA 2QELA 3LS4H 1AGCA 5CBAB 4AI7A 2Z93A 1MLBA 2VQUA 3LEYH 3KPRB 4A2HA 5C0FA 2K8MA 2L04A 1J0KA 1KTLA 3LZLA 1HH9A 1NEZB 4EPSA 3N2JA 1NCBH 3M88A 2FQDA 3KYMA 4K8RL 1QO3A 4ODSL 4P4KC 2N4IA 5I8OL 3WI9A 3IDMA 4F33A 3O2DL 1S9KC 5JHMA 1PFOA 1FJ1B 1DBMH 1FL3B 2I5YL 4YSCA 5ICYA 1VB9A 2X4RA 4R7NA 4KC3B 4PI0A 4PIBA 1NC2A 5D6CB 1P7QB 2QQLL 4OD1L 4M5ZH 2EC8A 3DC0A 5F8QC 1J12A 2BNUA 2BZDA 2P8PA 5DC9B 2W81C 2KPNA 3HC3L 5D2LE 2EDQA 2C4FU 1P6WA 2YD0A 2WMPA 2DN7A 5DD6A 3ZE1B 1MFNA 1B0WA 3AWFA 3CQFA 3GIZH 3VSUA 4YZFF 3W5NA 4FKHA 2UY7A 2WQRA 2NZIA 2UWEF 2AJVL 4NCC2 3LNGA 2CLZA 4W70A 1PY9A 2R2BA 4P46D 5JIHA 4YHKH 3S98A 1K6QL 3KPMA 4AMWA 3VXRA 3PV6A 1G7PA 1FCGA 1A3LH 2Y3AA 1E4XH 5I1GL 5DMJB 1C9SA 4U2YA 4O5LH 4V2CB 4YXKL 4ORGB 3ZL1A 2Y6SD 3F7KA 1H3PL 4Y16D 5EDXA 1W72L 1U8QA 4I5BA 1DVFB 3O3BA 4KI5F 5DGRA 1N4XH 3NCJL 5GGTL 4L37A 3LCYA 4GEIA 3INUH 1N8ZA 5ESAA 4N3TA 2QPEB 1EWHA 5JW3L 1F00I 1AXSB 3KPLB 3RX5A 3ARVA 4ZSOE 2Z91B 2C3GA 3C5SB 3PGDB 2VOTA 3S8FB 2ODIA 1QFHA 1XH3B 3MN8A 4FLHA 1H0DA 1BYPA 1MI5B 5CMAB 1X5GA 5F9OH 1CDGA 4U6XB 1Q9WA 4AYEC 1WHOA 4R97C 4YEEA 2YARA 3P1VA 4KTEL 1JXKA 4K55A 4Z7WA 5F3FA 2AF2A 3GHEH 3MRPA 3DECA 1AS6A 2XYCA 1R3LB 1OB1B 32C2A 5DVPA 1KPUB 3FO9A 2IO5A 3AY2A 1UADC 5LNEA 3DGCR 3MGTA 2R7EB 2XIIA 4OGXH 1MCQA 1XAKA 3DTXA 5I6NA 3OPUA 1MQ8A 12E8H 1DJXA 1QI5A 4BELD 2IH8A 3KWWB 3DTDA 3D18A 3O8XC 1ET8A 1UEYA 4PVNA 2YD5A 4MAYB 4F1ZA 3JV4B 4JG0L 1EZUA 5I2IB 4QRRA 1AACA 3GLAA 1XAUA 3B2VL 4V1DD 3U2IA 1GS7A 5KW9L 1ROCA 2HH0H 4PLOB 1I3UA 3IJEB 3FRPA 4CJ1A 2DZEA 3E3QC 2R23A 3OKMA 2P8LB 3OXSB 1JE6A 3WKML 4LFHD 4U7SA 3I6LE 1PVHA 4OIAA 5HGHB 3FT4B 3MV7E 3MV7D 2GHWB 4POZD 2N56A 1EVTC 1KYDA 2CJUH 3UTPE 1T7WA 3UTPD 2BSCA 5FKAA 2J8UE 1DEEA 1OP5K 5HYJB 2XPZA 5A2LH 2Q6WB 5A2KH 1P5UA 5DJAB 3KZ8A 4R4BA 1WBYB 4LLMB 1F97A 4GSDL 5LAXA 4OR1A 4LVOC 3B4NA 3S0PA 4XNXL 5DEZA 5JPMB 3EBAA 4HAKA 2H2PC 4PUBH 3V5KA 2ERJC 3KDMA 3SGJA 4AXWA 5JPNC 5DC0A 1S9XB 1SEBA 4U1HA 4YDMA 4CBZA 3CFQA 3BHBB 2W0FB 3O2DA 1PZUB 1QBAA 1FZMA 3F6LA 4XCYB 4GRWB 4HYTB 5JDSA 25C8L 1SYSB 1CGYA 4PJ9B 3RIAF 3X3GL 3VXPB 3AGVA 2Z31B 4DKTA 1BMZA 3P4OB 4AMKL 1G43A 2ARWA 3S4SA 1P7KA 2BW4A 4FFVC 4MVBC 4OB5L 4CVWA 1XH0A 2SEBB 5ENWB 3K2UH 2OMXB 2ED9A 2WXRA 5L2KA 1VFMA 3NTCL 4LKXA 5JA8B 5JW4N 5ILTH 3RVVD 5CN2A 4H8WC 4IRJD 3MLVL 5C7XH 5J1AB 5J11B 5CINH 3O11A 3PWJA 4JFEA 1FQ9C 3H9HB 1QTSA 3RDTB 1KIUA 2YD1A 2CNYA 4ONGL 1VENA 5DRXA 5HDBB 1KCRL 4M1CC 1C12A 1MW3A 4FZ8H 4L4VB 3HG1E 1SXBA 5DTFB 4EXKA 1HHIB 1D6VL 3JTTA 3KVPA 4WI8A 4K9EC 3NFNA 3SE8L 1ZT4B 4CILA 1FZJB 3PJSB 4LEOB 3S5LA 2EYTB 2QR0B 2A6KA 1CLOH 4J6RH 1LM8V 3BAEH 3TVMC 4K9JA 3PYCA 3GSRB 1CUOA 2XQYA 3QGVA 2YN5A 2J6EL 3QFJE 15C8L 4F7MB 3QFJD 4JG1H 4RQQA 5I75C 2VAAA 1URZA 3D09A 4K7PL 5D6DA 1IBZA 1J9TA 3BDYL 3PAZA 5FO9A 4ZO8A 2WN3A 2OMVA 5TE6L 1KIPB 4QHKJ 3AXLA 4UAOC 1TYEB 4DOHB 4EF3A 1RUQL 4G3YL 4A63A 1QRNE 3ZYOA 1JPSH 3DMMD 1YLBB 1KSRA 4PRIE 2H7WA 4JKKA 1JP5A 4H0IA 4PRID 5E1AA 5KYUB 3U9UA 4DP6X 5A6LA 2IMMA 1FH5H 2FNBA 3VU2A 1UGKA 5FO8A 3QUMH 1XBDA 2VJ8A 4KFZC 2OI9B 4DZ8A 2YZ8A 2KH2B 3OHXC 4ZDHA 5KSVB 2DWYA 2IANB 4K7FA 1I8LA 2AJ3B 4KX8A 3WLWD 3FB5A 5JR1L 4DEWA 5C0AA 3U7YL 2YRZA 5IOKA 1PDKB 1EGJL 2P47B 4UNVA 2XTJC 3RKPA 2NSMA 2F7RA 4ZZKA 4HPOL 1LE5A 2XWTA 2LOEA 2PXYA 4S0HA 1ZVNA 5TTRA 1YN7B 2X4TA 1SN5A 2KBGA 2Y0SA 5HY9A 1WA2X 4HBQA 4PJXE 4Z78A 1A4JA 2D3LA 5FOBA 4NQUA 3U6RB 1AS7A 4GMSH 4R8WL 2KZBA 3QQ3B 2HUHA 4JHAH 3B9KA 4N8PA 4X98A 3P4MA 2QPFA 4LSPL 1R5IB 1I9IL 3RTQC 2HWZH 5MEOB 4NQCB 1KJMB 1CFSA 2B20A 2IH1B 2HRPL 4YS4A 2Q76A 2NSXA 3ELQA 3IBEA 1TZOA 4FX5A 4AQ1C 4G70B 2Z7YA 2PWDA 1KTDB 4X4XB 2COQA 3ME0A 3GYRA 4IK7A 5F71A 4OVUA 5L6YH 3UC2A 4WTZA 1MVUB 3OPZH 4LRNH 4EI5D 3ATAA 4HHGA 4JGNA 5EC2A 3H7BA 1CK0H 2Y7OA 1IKNA 2ZKYA 3QJRB 4ICWA 1NOAA 4XNZB 3Q06A 3FCUB 4IIZA 3MA7B 2VLRD 4NGHH 2NY5C 3PIQB 3ARZA 5E1IA 3GEFA 5HGGS 1FVCA 3TPUA 1BFOA 1WLHA 3OX8B 3S36H 1L6PA 1KC5L 2CDEB 2AJYH 3T2LA 3MRHA 5DJ0A 4BFGA 3DRTA 4XPBH 1HCYA 4NDMA 4OM0H 4PG2C 4RLDA 4WEUD 4YDNA 2MCG1 4LVEA 3BE1L 2L7JA 4JFZH 4GH7B 2OFQA 5JXEC 1PQZB 4TULH 3M1OA 4I9WE 5ALBH 4E68A 5J12C 3M17B 4D9LH 5CUSH 1LO3L 1ND0A 2CKBH 5AEAA 4ABQA 5F7EL 2P80D 3MZGB 4FQXD 4YL9A 4NC1C 2H1PH 4XO3A 1TEFA 2EH7H 2XQYK 4GAJL 4OM1H 1ZLSH 1VFBB 4ZXBD 5AWNH 2VDPL 3OKOB 1ZGLM 4LLAA 3EGDB 1DZBA 4LCWE 4LP8A 2HXAA 4LCWD 4P07A 4PJDA 1HINH 3VGAC 4C56B 4F58H 4GAFB 3HE7D 2KS0A 2B9AA 1BPVA 2FX8H 4Y0GA 1JZ2A 4Y9EA 4TF4A 1UWEL 4L05A 1IAIM 3IGLA 4TTDD 1U6AL 3TBYA 5BO1H 5T3ZH 1BBJB 5JOFA 4LIQL 2R1YA 2KDGA 3ETBJ 2VDOH 4ZD3L 1BEYL 3IF1B 2DQIL 1I82A 2JXMB 4LOUD 2A1WL 2DQJH 4H0HB 1IILE 3U1SL 1GAFH 4RNRB 3VX0A 4M7LL 3RPBA 1OT1A 2QSQA 4KXZH 5JIPA 2DLFL 5A2AA 1HT6A 2QKIB 3BH4A 1E7VA 3KG5A 5CHNB 5FV1L 43CAA 4M8VA 4PCYA 3C5ZB 4AC2A 4DGIH 5ITBL 3S97C 4Z95L 3TTYA 5BS0A 4Y2NA 1G7HA 4FXKC 4NZRH 4IBZA 3TYGL 3FFCE 3HE6A 1OSZA 5G5DA 4UQBA 1TF4A 1JF5A 4JPVH 1DQJA 2ITCA 5DO2D 4K5OA 5IREA 1P7HL 2VE6A 2HKHH 1IB5A 3EBIA 4POUB 3ZYJA 1KCLA 2J1XA 2EJ1A 3ENEA 3FKUS 3O2VL 3HZMB 3PWNA 1S7UB 3DX9A 3SZ6A 2LT9A 1MCOH 2I9LB 4BIKA 4FQHB 5DQDL 4OQTA 3WNNA 3PQYE 4H0GA 3FB7B 3MXVL 2YKLL 1T5WB 3HBGA 5KVFL 3D4YA 1NUDA 4EAEA 1Z9SB 3F2LA 1RUKL 4MWFA 2R2EA 5E4OA 2WLNA 5HI3D 1WPCA 3WYRA 4XMWA 3GMNA 1QSFE 1CTNA 1ZHLB 3WS6C 4LHUD 4NRXB 2ZNWA 3D39E 4Y5VC 4N2AA 4NFDA 3GMMB 1MPAH 4L4TA 3PXJA 2ZXEB 4X7TA 4IBYA 5IR1A 4L1HA 2D2OA 5HHPB 2NY2B 1JV5A 3QNYB 2Z8RA 3NGBC 1BIIB 4KKBC 2BO0A 4UNUA 1FN4A 2HFGL 4UQAA 4GP4B 2FK9A 1SYVB 5I1AB 1JGDA 4OGAD 1UM5H 4N1HB 4JE4B 3VMPA 1AMYA 3L5XL 3KGRA 4GSQA 4JFYB 5IQ9A 1H3GA 1BQHA 1KACB 1QW8A 4GINA 3HUJA 3TZVA 1HX0A 3U2SA 1J86A 2PW2A 4MD5B 4YDIH 5D4IA 4EVNA 1UOWA 3ARYA 5I16B 1ED3A 3EZ8A 5KAQF 4Y4KB 2F54B 2CBMA 1KJVA 4BZ2H 3BN3B 4OT1H 4L2LA 1X4ZA 1A1NA 1E6JH 3WJJC 1GW0A 3Q8FA 3D9AL 5D7SL 3RX9A 1JWMB 2FIKA 1CGSL 1NFDA 3VD7A 2DQCL 3UBHA 4DP9X 2OV0A 1XL4A 2GJZB 1L7TL 2WXKA 3QPXH 3VACA 4JO2H 2L8AA 1YYLL 4F5CA 4TOYL 1BHGA 1G9NH 1J18A 1WF5A 2BSED 3FTGB 2R56L 1E9QA 3EOTH 4YR6A 1ZLVH 4QDGA 4J4PC 5DHYB 3IM1A 4ZAKB 3ESOA 3VCLA 2GITA 4OTXH 5E8DH 1RIUL 2RTTA 2YGVA 3I3DA 5T5NG 3BH8B 1UVQA 2H8PA 3RJQB 3CLFH 5BZDB 1AP2A 4OFYA 4XC3L 4N0UA 2ZXBA 5LBSL 1KEGH 1U9KA 5H4ZA 3WD5H 3FONA 1UCBL 1DQLL 5CNHA 3X11A 3GZKA 1KGJA 1EEZA 3VFTB 5EA0L 4PJGB 2OSYA 1JN6B 1PIGA 3RG1C 5KBNC 5IROC 3MUGA 3SJVB 1RPKA 3TJEH 2Y2TA 1FYTA 5C07E 1CDCA 1JF1A 1MRFH 3ZOAA 4LMQE 5IEHA 4FI7A 3GSNB 4GKSA 1JNNL 2V9TA 3DX6A 1J0YA 1TOXA 3UTQA 4JANA 1BQUA 1OCZB 5B3JF 1E90A 1OF0A 1JDCA 3RL1B 3LZFH 3RL2A 3TFKD 3UTTA 5AOJA 2OP4H 1P9MC 5EZJA 5CP3A 4Z7VE 1JF6A 1GPOL 2WLMA 4C47A 4JRXB 1FC1A 3ZTCC 1NGZA 1T22A 4HJSA 5B39G 3TCTA 2VISB 4XMUA 3FPXA 1WUZA 2R4SL 5HPMA 4AWJC 3NSFA 4YDVB 2AV1A 5C0RL 4RMRA 3O4LD 1E3XA 3VFWB 1C08B 2N1KA 5E1QA 4BXSV 1OTTC 4PLKD 1C5DA 5AOLA 3CSTA 5C92A 3VJ6B 2DOCA 2ICWI 2X6MA 4FTVA 1TVHB 3VFMB 1EDYA 3B2PA 3HBPA 1OZUA 2QGDA 1D7CA 4RGNC 4YHNB 3RHWF 2VL5A 4MCZB 4QD2E 1PNDA 4N0FB 4WFEE 4BBWA 4WFED 3HUJF 1DVUA 1AD9B 1U4FA 2EP6A 3TJHC 1KCVH 5AD0B 2IWKA 1IM9D 2CLVB 1IGFL 3CFUA 1XX9C 1K4DA 4NZUL 1VACA 2VDML 3GBEA 1ES0A 2G0LA 4BFRA 1R5WB 4FQIH 4QRSB 2ARJA 1BZ9A 3PPEA 1NFDF 4KJPC 4Q2ZB 2W38A 4N5ED 5JQIB 2XLLA 4P2RB 3V0HA 1FAKT 3FJTA 1RZKC 1QMUA 1GXEA 3FRUB 2OMZB 3NESA 2NYKA 1HCZA 3BSHA 3DV4B 4LSTL 4FXGA 3LRMA 1HEJC 1RCYA 2DKUA 4NQDB 1PLBA 3ZYIA 1CF1A 3QI9C 2CGZA 1YG9A 4PB0H 3SOTA 1UA6H 4YAQB 1VDGA 1QHQA 3M8OL 2Z3FA 3OGCA 4X6FA 4CC4C 3CDZB 3HS0A 1D5ZA 3BSZH 3UBXI 1AXIB 5F3HB 2VO8A 1FLRH 1T5XA 4LQFH 4WIQA 1F4YL 1FGNH 3HG5A 3GO1L 2OK0L 4HK0B 4NZTH 3IGUA 3C60A 4XXDB 1FIGL 4PV1C 5E2VL 1L9NA 4KTYA 2NRDA 3TA3C 2ZSVB 4DAGL 1AQKL 1QSEE 5KSAD 2JTDA 1QSED 3QEGL 4ZFFA 3QYMA 1T6VN 5ACMA 4E42B 1TYRA 3EOAA 3MOAL 5J13B 1KIRA 5IB3A 2BJML 5F7FA 1KGXA 2JIXA 4MA8H 4Q4IA 4PS8A 3EFFA 1IJNA 1I1AA 2J43A 4XMKL 3KLAA 4HIXL 5H2BA 2BS71 4TVPD 4C4BA 4IGBB 3PJLA 2F2HA 5D7HA 5LBSA 1U92A 4YSQA 3MYJA 5IV2B 4MQTB 5BO0D 3US1A 5HDQH 4P2OB 5GGUB 3W9EB 3QPQD 4LK4A 2ICCA 2CU9A 5H35B 2AJUL 1OPGH 2FX7H 4TMPA 1D5XB 3V4VH 4FQ1H 1SMDA 4X0KB 4MHHI 3F7VB 4UT7L 1MY7A 5AKSA 1NDGB 1N6VA 1R47A 4AUYA 5I1HL 5E08L 2O5XL 3ZDXE 4OZFG 2YD4A 3RZCB 1DJGA 1ZLEA 4EBQH 1J1XL 3HAEG 4MNHB 1MZYA 3O41A 4FA8A 1X44A 2C5DC 1IGCL 1SFHA 1Z9PA 3ZLQC 3UH8A 4WW2C 2BRQA 2WAHA 5D96C 5CD3B 4P2QE 5DVMA 2UWEB 3ARXA 3OTTA 4OFDA 1NFKA 1ZGLA 3VXMA 2BSDA 2H0PA 5F96H 3W0WE 4NO3A 5GZOA 1XGZA 3HZKA 4KY2A 1JUFB 2IEPA 5AL8A 3ZRSA 5BOJA 1VSCA 4DGYH 1ZT1A 3H3KA 5ISZA 1QBMH 1E4JA 1TSRA 2BNRE 1UZ8A 4XN1A 4IOIA 4LF3A 2OYLA 3FTVA 4AT6B 2V2TB 4OI7A 5FK9A 4PJ5E 1NH6A 1LK3L 4PJ5D 4YK4C 1S8DA 2VNCA 5KSBA 1IC4L 3G5ZB 3QIUC 4MZRA 2RR3A 2YC1A 2OAAA 2HZHA 4XMZA 2R0LL 2L3BA 3BFQG 1E3FA 5D1XB 4NBYB 4PJFB 5FKPA 3WJMA 2ZICA 1TETH 1NOFA 5C7XL 1LO0H 2KL6A 3OJVC 3TBWB 1ORQB 3MACH 3O8XD 4PGDB 3HZYA 1QLEH 3CIAA 2OMYB 3B83A 5FHBL 1JPGA 2MKLC 2D03H 1NPNA 2A6JA 1PX4A 3UG4A 3B9AA 1P4LA 4F8QA 3E3QE 4OY9A 1YY9D 2ALWA 2QTEA 2IDSA 2D0HA 4WTWA 2BERA 2EZ0C 1BYOA 2BP8A 5IFHH 3B9DA 3LZRA 3NPZB 4EDWL 1AD0A 3L1OH 1U30A 4I2XA 3ESPA 1L0YA 1NDMA 3H85A 1YNKL 3D69A 2O6PA 3Q1EA 5DZ9A 2XG5A 1AGCB 1TJGH 3AQXA 4YPGA 3F58H 1T89A 2GCYB 2WZ0A 5C0FB 1AY1H 2N1TE 1JYWA 3P2BA 2QHRH 5KTEL 5KYXB 1RJYA 1OCCB 1ZK5A 5EUOF 1A4KA 3SDCB 4HOWA 2YAFA 4I87A 1FZOA 5DRNB 3T4AB 4KJWC 5CWSB 4JVUA 3VGGA 3QO1B 2X4RB 4ZW8A 5F6IB 1MVYA 1OZTG 3MYZA 3ECWA 3QUYB 2AGJL 1NMBH 2APVA 3KCPA 2IV9A 2X9WA 4OD3H 4JPKL 2HT3C 3D4GA 1ZEAL 1T7XA 4CN6A 3LXCA 4P4RB 3NCYP 4MJHA 4MNGA 2FEJA 1UTDA 4APQC 1BV8A 3KL5A 3OGOE 4DP2X 2WMPB 5GGSA 3HG3A 4R5TA 4QRBA 5DWUH 4JK0D 5HHXL 2JF1A 5DVNA 4OSUL 4L1TA 4PRPA 1IL1B 1QLFB 2UY7B 3G6AB 1E5YA 3ZE2B 4NM8L 4A04A 4O51B 2A73A 3RY5A 2CLZB 2DI7A 1JFQH 4BZ1L 3CDGB 4RZCA 5LDUA 2NXZC 3VXRB 3PV6B 3CXDL 1UA7A 2DL9A 1X5KA 3MDJA 4F37F 5JOPE 2J25A 4PW4A 2ZXAA 1DQMH 2E3VA 2N7SA 2DQDH 4M1CD 1I3GH 4HKBB 3BSGA 3KHQA 2N59A 1LDPH 4A38A 2FATH 2A74B 3OAUL 3O3BB 4Z3FA 4X6CE 5JHAA 4OZ4B 3AWEA 2X3BA 2CGYA 4S1QL 4FP8L 2FGWL 1PZ5A 3V6BR 5KSBF 4MJ2A 4OFKA 5K9KB 3CN4A 1CVRA 3RVWC 2F0CA 2F53E 5GHWL 3GJEB 4M8RA 3QZWA 2WTOA 3IMRA 1PZ3A 4HJ1A 1KBGH 1R5VA 1TQCB 5F7AA 3VDBA 4N2NA 2FAUA 1KIQA 1T0OA 4YLCA 2EIZA 3IMWA 2JH2A 1MSPA 2R9HC 2CUAA 4JJ5A 4JQIL 4Z3IA 2HLAA 1EEQA 3FBKA 1PYWB 4AH2A 2VLKA 3MRPB 3VGDA 4OZGA 1N2RB 2BSBA 2Z6FA 2EO9A 2VLJB 2AMGA 4S1SH 2OTWA 2QEJA 3K81A 4KRPD 2HRGA 3L5WB 3SKOA 3EJZC 1MFDL 2A6IA 3ZHDA 4ZMQA 5LGJA 3SPGA 2VN5A 2V17H 3D18B 4EN3A 1MWOA 3EDDA 3D0AA 1NDTA 3F64A 2IDTA 4AZ8A 3NQIA 4HWUA 4L3CA 2KZKA 3T3PE 4DP4X 1K85A 2DQFA 2XTJE 3MV11 1HHHA 2XTJD 4LLQA 1FZKA 2WIIA 4AJWA 3O3AB 1H6EA 1DVQA 3HLAA 4AL8L 4NN7C 5J6GA 4HWZB 1T04B 5ADOL 4G7VH 4X7FC 1SN0A 1YPZB 1I7RA 3IFOB 3H9SA 2EXYC 4QHLB 5K1JA 4HC1L 1TCRB 4XPFH 4HCIA 3RTQD 2AHIA 4I3SH 3RFRA 3O6FC 3BWUC 2WOBA 3JV6B 3DHJA 5FKAB 3GFUA 4KK6C 3WGUB 1NIDA 3NRPA 1RZJL 2PTTB 5I18L 3NH7L 3AQYA 1NM4A 1JMZA 1XMEB 5DD3L 1JTPA 3PNWB 2YSTA 5KJ4A 2NTFA 4R4BB 5IJBC 3NZ8B 1JAEA 1RLWA 4BCZA 2R1WA 3QIWA 4W9DC 3RNQA 1F8TH 2E5EA 4JDEB 4YSUA 4IBUA 3BIBX 4MLIA 3KDMB 5BOZG 2FWSA 2DPKA 3GJFB 3QHZH 4ZUWA 2X1PA 1MCPH 2BXZA 4MA1C 2YWYA 4OJAA 1F02I 4HT1L 4U1HB 5EPMB 1T03H 3OKKA 4U3SA 1HEZB 3TT1L 2O4EA 3UJJH 4G8GA 2EVIA 4KTDH 5I8CB 2JSFA 1KV7A 3HNTH 2X89D 3GBNL 1HESA 3NSDA 2P5EB 1DFXA 3RU8H 4HGKC 3ZGIA 2JKTM 1CTMA 2AEIT 4NZDA 2Y7QA 5ICZA 3FFDB 1P7KB 3LN5B 1ASPA 5IQ7L 3WHXA 4GRWH 5D2NB 5GS1C 2E46A 3ARPA 4TSCH 5JXED 2IOOA 2O6FA 4O02L 3D4ZA 4WEBL 5LQBH 2ZYSA 4M48L 3FH7A 4KPHL 2E7MA 3VXSB 1MHHB 5C6TL 3CX2A 4Y4HA 3FOMB 3O11B 4I18C 4TUJB 4NC1E 3NAAH 4NO2A 1JWSA 4QRTB 3L6FA 1DFBH 4K7PY 1VAHA 2K9FB 3GPSA 2V2XB 4IMKA 4NZJA 5EOQH 3RWFB 4OCXH 4W6WB 1CE1L 5EIIB 1Q94B 2GAZB 4JDZA 1BF5A 2XNAA 4YDKL 2XN9B 4BQCA 2R59A 1NBYB 1W0WB 3TBSB 2WXLA 1E3ZA 2P42B 3NFNB 1F58H 4L8DB 4OZGF 1W72B 4P5TB 1Q9LA 2EDBA 1T6WA 1YECL 2FDBP 4U4IA 5L4JA 2WVTA 1LO4L 1BJ1H 2BFVH 3GGWB 1L6XA 3GM0A 2JQZA 2Y06L 1SUHA 3Q9QA 3L2LA 2GSGA 2GFBB 2NDGA 3NZHL 3T6ZA 2E9BA 3BX7C 4RQQB 5DYFA 5FLVA 2VAAB 1CB4A 2F58L 5EZLA 3SKMA 4MTMA 4Z7NB 1SDDB 4BQ6A 4GFTB 4HDIA 1DJWA 2XOTA 2OYPA 1LEGB 3LQZA 4GUQA 1OAUH 1A7NL 5GRYA 1T1YB 2E9GA 4XCFH 2VQTA 3Q48A 2OMUA 4IKIA 5D2LA 1CD9B 5I5MA 4ZOEA 2A5UA 4H44C 1WAEA 2O5ZH 4LAQL 1MNUH 1BZOA 3CH1A 4NKOA 5DQ9A 4WNQA 4DZ8B 2Q7YA 4I0CC 4W1TA 4RBPK 1IU1A 1ORSA 1SHSA 4NNXA 4XAWH 3VSQA 4UM9D 2BVQB 4HWEH 3KYKL 3FB6B 2B08A 5TGBB 3CQPA 1UCTA 1HHGB 2FZ3B 2DWEA 2GSIB 3NJLA 3C08H 1KUMA 2KUTA 4NKIL 1IKFL 1RHFA 1GGIH 4Y16A 3PP3K 4UQCA 5E6IC 1ZSHA 4AKPA 1EJ6A 2EVJA 5A2FA 1JZJA 3NSCA 4GQRA 4M61A 3TC9A 4Z78B 3L3KA 3NDZE 4YDJA 3R1GL 4PRBA 5AAMA 3B9KB 4X98B 5GJSL 3P4MB 1FSKB 4WY7H 2BVEA 2YQ2A 5IG7A 4ZSOA 2IBBA 4OU3A 1PZSA 3DARA 4N2LA 1CFSB 3A4EA 1CFNB 5DYOA 5HJBA 4QLWA 5KBPA 4PRAA 1J05A 1LQBC 4B9FA 4BCYA 1OTUC 4KDWA 1HQRB 2B1OA 3K72A 4RISL 2PCFA 2WAQA 1AGDB 1KZYA 4KKBD 4L9LA 2P3YA 1ADWA 1KBBA 3APCA 5ALCL 2WQWA 3BQUA 4PJAB 4JRLA 5F8RC 1BCIA 3EJPA 1D9KC 4PY7A 4JHUA 4PLNC 3K3QA 5DLLA 1II4E 5EOCL 4JE0A 5EC1B 5GS3A 1KZQA 4TUOA 3TV3H 5M7QA 2DRUA 2OMWB 3EH4B 3WY1A 1NAKL 2V3EA 3AS1A 4AITA 1A6ZA 3AS3A 2I60H 2JMRA 5BXFB 1A6PA 5L7XL 3QVAA 2CHXA 2HRHA 3DRTB 1SBSH 1QOKA 2NYZA 5I1IH 4EZKA 4CNIA 1WP6A 1V7MH 1NC4D 4PYGA 4Q4EA 3CIQA 3JWDH 4U1IB 4H8QA 4MQ7B 4QAMB 4YNYA 3SO3B 4F2EA 4O58L 1UUSA 4EUPB 1MJ8H 3QJFA 1XQ4A 3MV7A 2DWDA 4PJ7B 2NCMA 2D73A 2HTLC 4UQEA 1L9OA 3QT2A 4Y5XB 1EJOH 1JGLH 5T1LD 3WY4A 4MHHG 4ODXB 2VXQH 2J8UA 2BWIA 3BVNA 4J4PD 3QQ9D 2EIKB 1A6TB 3X1NA 4ZO6A 4BA8A 1GC1H 5HI5D