3N1GC

Crystal structure of dhhn bound to bocfn3
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
ERPVAGPYITFTDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDKYWHSISHLQPETSYDIKMQCFNEGGESEFSNVMICETKARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title All mammalian hedgehog proteins interact with CDO and BOC in a conserved manner.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Desert hedgehog protein
total genus 21
structure length 104
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3n1gC01
4PJEF 1LP9A 3LPWA 1CLOH 3B9DA 5FGBA 4IRJC 2Z35B 4JFED 3S35X 2FX7L 4N90D 3MCLH 4CMHB 4EOWH 3NACH 3CH1A 3THML 1XF2B 3LEVL 3O4LA 1IQDB 4YE4L 3JV4B 4N68A 4G8GA 4K8RL 3PXJA 1I8IB 2ZCHL 1K8DB 4PB0L 4HEME 1OD9A 3WIFB 3MJ9L 3HNTH 4R96A 5EO1B 2V17L 4KUCD 1BIHA 2AXJA 2JTDA 4XMPL 1G9MH 4TSAH 1Z6JT 2VXUH 2NY0D 3QXDA 1P84K 1J11A 3KYNB 3T1WA 5C7XL 3W9DA 3KLHD 4OCYL 4QF1A 4I48A 5CJBA 1KIUA 2FB4H 3V5DA 3LHPL 1QP1A 1T3FA 3N06B 3ZKQD 3GSNB 2MJWA 5DVLA 3U9PL 4JM2C 1BX2B 4GKSB 3A6BL 3GJEA 1A3RH 2DOCA 3LKPA 3RUGB 2R0KL 5B3NA 5DRNB 3L3HB 4NSKB 4LSVL 4YHMH 1BGXL 4J4PD 4PJIF 3RNQA 5L9DL 1RIHH 5ALCL 1ZE3C 5J3HC 3MSPA 1SVZA 4NWUH 1M7XA 2C3HA 5L7XH 3P4OB 4ETYA 4CADB 4HJJH 4GMSL 2R2EA 3VI3E 1HZHH 4MX7A 3ARQA 1RUPH 5D7IF 4FFYH 2YWYA 1EJOH 1CTOA 2V7HB 3ZKMD 4IOIB 1DVFD 4FQLH 2FZ3A 2X1WL 3OKEA 5C09A 1K6QL 4JFFA 3VFOB 2VE6A 3O41A 1U3HC 5EUKB 5JUEL 4IMLB 4L3EE 3TPKA 5E8OA 1KPRB 3ZT5A 1A8JH 1NGPL 1QD0A 5DC0A 2GIYA 3PHSA 5L0QC 3HRZB 1KIRA 3GSQA 3H0TB 3RVTD 4W4OC 5F7DB 5IK3A 2D9CA 3AS0A 3OXSB 4LCYB 3MREA 4PRID 4F9PA 5JOFB 3QZWB 4N5ED 1X44A 1I8MB 4OZ4A 4OV5B 4OD2A 3I6KA 3TJHD 4P4KC 1IAOB 1JHKL 2BXZA 2HN7A 1FZKA 3OKNA 3HI6L 3UYPA 1I7UA 5EOTB 2M1KA 2E8YA 3OKMA 4LHUG 1YEDA 4FXKA 2NW3A 5CS7A 1HKLH 2DIAA 2JB6A 2E7LC 1UB6B 3IF1A 4LASH 3T2OA 4WI8A 4LCCB 5E9DE 4YFLF 1U8JB 1J7VR 4RGOL 2AV7A 1IKFH 4AL8H 2GFBB 4OM0H 5KSBA 1DN0A 3MA7A 4XCNB 2AJZB 2GK2A 1B3JA 5DDHB 3PWPB 3PGDA 2VDPL 4MNGE 5DWUH 4MJ4A 5DD1L 1PSKH 2R0WL 1XR8B 3N1GC 1G7QB 3S3SA 3LHPH 3G9AB 1P1ZB 4Y4FA 3VGFA 2JKXA 1FIEA 4Y8DC 2R0KH 4P3WA 1JTPA 1QRNE 4KH2A 1JGEA 1AGCA 4YJZL 5CEXB 2YZ1A 2WZPD 4OBSA 4DGIH 4Y4KD 2VH5H 5F1SA 4NWUL 1VKXB 4PP1C 5T3XL 3MUGA 3PE9A 1QYGL 5FYJL 4I3GA 1WCQA 1U8IA 2VLKA 1MRCL 1ZEAH 1EAPA 5AYUH 1JK8A 3QEGH 4MA1B 1TJIL 3CVHB 25C8L 1G7JA 3HI1A 3F6IA 7FABL 2ZSVB 2Y6SC 1L9NA 1MRDH 1P9MC 3EO0A 4S0SD 4G9DA 4GW4A 1NGPH 4LFHG 3TYGH 3JTTA 5CJ5A 5HHOD 1QSFD 2EH7H 3BEVB 1CF8H 4KMQA 4KI1A 2Y5TB 5HHNA 2BZDA 3I2CH 2X1OA 4LLAA 3OR7A 5DJ0A 4XCYB 2IWGA 4BUHA 1HI6B 1WVZA 4S2SB 3T0EE 3LEYL 3MOAH 5JR1H 4NO5B 3ULVL 5TE7H 4NJAH 5TFSL 2V2XB 5I75B 4HFUH 2Q86A 4R7DA 1GCFA 2Y6SD 4PJCE 3BPOC 2VZUA 3RVXC 3BGFC 1CICC 1PGRB 4HFWA 3WJLA 4NN5C 1ZLSL 1F90L 3JXAA 4IIQB 4GG6E 3OL2A 1KCRH 1S7RB 4IRZH 4C56D 4XNQA 3VFTB 2ESVD 3MQIA 2W1NA 3VG9C 5GIRA 3VFUB 1YYML 3B3IA 4IHOA 4XP4H 3VXMA 3B2VL 5AWNH 5AD0A 2JK5B 1J18A 4JFOA 3DIFB 5IVNA 3QQNA 5IKCA 4HK3N 4O4YH 1QBMH 4UBDD 4Z0BH 2I25N 2OSLA 5DMGC 3RUGF 4ZNEA 2QTEA 3KVQA 4M7ZB 5GRVL 5HDQL 3KXFE 1NCAH 4OZFG 4HF5L 4J3SA 5DQJA 3FO9B 5E5RB 1CLOL 1BOGA 5FF6B 5DD1H 4LSPL 4D9LL 1AQKL 4Z7UB 4GRWH 1HYSC 3BAEL 1F4WH 3KWWA 3TC9A 2CR3A 4BFIB 2H8PA 3O9WB 4PJAF 1P7KA 1LK3L 4MCYA 3MXWH 2JB5L 5FYLD 2ITDA 3BZFA 4LVOB 3VDBA 1MFAL 1P5VA 3Q3GB 4QLRA 4UV4L 3ILQC 2VB5A 2XKSA 1TVBA 1R5VB 4QRSA 2QJDA 4C58B 3P0VL 3FN3A 1I1CA 1I1AA 4NCDA 1KNOB 4A6YA 5CJQL 1J1OH 1YY8B 3IAQA 5M95B 5IW1A 4KZEH 5IFAH 5F7NC 7FABH 3BYTA 2C3VA 3MRPA 3P4MA 4PRBB 4HD9A 3TO2A 5FECB 3RRQA 2XNAA 4M5YL 1NJ9B 1N6VA 2PTUA 1CBVH 5F72S 1N5AB 5C2BH 5IJKC 3HAEH 4R7NA 3DYPA 4KI5F 4LARH 2VDNH 5ERWB 4X6DE 3R8BB 1J12A 2D7NA 1JNJA 4MD4B 2HMID 4NQDE 2J8UB 3T4AB 5IROA 1AD9B 2NY0C 2OTWA 3B6SB 4ZO6A 5TJWK 1T1WA 3ALWA 3ZDXE 4Z7NE 4HFUL 1K6QH 3LKSA 3D9AH 3T2NH 4GUPA 2XXMB 2EXWD 1FO0B 43CAB 3S36L 3L3IA 1KENL 4Z77B 4JY4A 1HHIA 1FCGA 3RWEB 2R1YB 5AWNL 5T3ZL 4YHYB 1KELH 1I1RA 2X70B 1OT1A 1QVOA 3X3GL 4LIQL 1UM4H 1QRKA 1KFAH 5DD5L 1T6WA 4KRNA 2YPLB 5J3HD 3A67L 1NLBL 1HSAA 1CGWA 3DV4A 5ITFA 3CFEA 4OFIA 1QR4A 1IT9H 3WFDH 5C0CA 1X7QA 2XICA 2Z31B 4FXGB 2CJUH 4LSPH 3HNSL 3K4AA 3SGEH 1AQKH 4JY5H 1ZGLM 5KS9F 4WI2A 1CIUA 2GK0B 5D7JA 5HBBA 1YUHB 3QUKB 1AGFB 3NCJL 3FOMB 3MRBA 4U1HB 3ZMRA 1LK3H 3T3PF 3TZVA 1UWGH 5FO9A 4QRUB 3KR3H 1BJ8A 4JQVC 4PJCA 3L9RA 4JY6A 3MJ7B 1P7QA 1T03H 3X3FH 1N4XH 2WW8A 1YNLH 4UNTA 4X6BA 2HTLC 5DRWB 4QGYA 5J12B 5DMYA 4JFEE 4XMKL 4WU5B 2VISB 4QHKI 3VWJB 2R0WH 3LN4A 1KEGH 1FYHB 2DLTA 4PJ7B 1BIIA 3S7GA 5K9QI 2PYFB 1GVIA 4UQ3B 4MB3A 2Z91B 1EEZB 4L9LC 1FNEB 3QUZB 5EOCL 4WW2B 3HMXH 1XGYL 1ORSA 4CVZB 4G9FA 4UOW1 1M7DA 4TRPL 4A2LA 2BY2A 4G8EB 3UCRA 4U6VH 5D70H 2NLJB 3W82A 1OP3K 2DL2A 5E8DH 2IJ0C 3M17A 5SWQB 2KPNA 2CKNA 1XIWB 4QWWD 3WFCH 3U7YL 4P2QE 4YHLL 1F4YL 1Q94A 5MEQB 3VG9B 4FG6D 2P49B 4NZUH 4ZAKD 3VXPB 3HFMH 2YRPA 1JV5A 4GBXA 1MRDL 4PY7A 3S36H 1JWUB 3MLZH 1JFQH 4PJHA 3VFSA 1M7IA 5ESAB 4F9LC 1HH9A 2YK1H 5FA4B 1IEHA 4K7PY 3OKDA 2R23B 3MBED 3RZCC 3TP4A 3GMPA 5I16A 1ITCA 2GKIA 4Z7VA 1MCNA 3ULVH 3VFNA 3WHXB 4E5XB 4I3SL 5JA9A 1EEYA 3QNZA 3VD3A 4PG2C 4CDHA 1VGKB 1XGUB 2ED7A 3PP4L 4Z7NF 4HJGB 3D2UB 3CU1A 5HI5D 1KXVC 3RA7L 5KZCB 4HKJB 1X5IA 1KJMB 4AQOA 3I84A 1HSBB 4JREC 4PJBF 1CR9H 2D2OA 3V6BR 5TDOB 2DDQH 5J12C 1U8NB 3S9DB 4NRXA 3VE0B 3ETBF 4EI6A 3IJHB 4WGWB 2HLAB 1LE9A 4G6JL 3WNNA 5DSCA 1K8DA 5C6PB 1WTLA 5L2KB 4EI5C 2XA8H 1S7WB 3D0VB 3T8XA 2AXHA 3CFIC 5D71L 1HHGB 1J8HB 1MCIA 4QHNA 5BMFH 1XH3A 5D5MB 4UNVA 3DI3B 1S3KH 2H26A 2NYYD 3GMRA 1HWGB 5D96C 4GRLA 2UWEF 3NN8B 4X6DB 5IQ7H 5JPNA 4ETQB 3G5YB 3PG2A 1R3LB 4G8IA 4JG1H 3JSSA 3QFDB 2HJLA 1I9JH 4L3EA 2BHYA 5CD3B 3SJVA 4ZD3H 3BQUA 1Q9KB 5SWSA 3P9MA 4HPOH 2Q1EA 3P4OA 1CL7I 5AZEL 4Z78B 1G9NH 5EUOE 1U93B 1LMKA 2I60L 2QSVA 5B39G 1DUYA 1CZ8L 2YEZB 1NCBL 1C1EH 4TUOA 1KGCD 4NZTH 4DTGL 2QL1A 1OVZA 2ICWB 1FL3A 1Z9OA 3G6JE 2NXYB 3VXRB 3TT3H 4NCC1 2JE8A 4LBEB 3A6OA 5I71C 2BNQE 3TT1L 3O41B 2DMCA 3AC0A 3MR9B 1H5BA 2Q8BL 5ANMA 1IC1A 2LV4A 4HWZA 3N1MC 4DKFL 3GKWH 2I26N 4PTUB 1XF5B 1MAKA 1KJ2A 2NX5E 4M62L 1L6XA 2G75B 1MH5B 4U6YB 4HK0B 4JRXA 4LLWA 3U0WL 1I1YB 4HUVB 3AY4A 4XPTL 3CFCH 5DJZA 2H32H 2HH0H 5L2JA 3SKJH 5IBTH 3NFNA 1QPXA 2HJFB 4I18C 4XHJC 1A4JA 1NUDA 4ODTL 4D0DA 3EYQD 4QXTA 4OD2B 5DQDH 2BK8A 4GKNB 4U6XB 5DK2A 2Q20A 2CRZA 4QHUB 3MV7B 3RA7H 3D39D 3I75A 4GQ9H 4ZUVB 1XR9A 1MJUL 2VABA 5F6HJ 4NN5B 1ZLWH 3BGAA 4Y5VC 2YD3A 4M6OH 2X4NA 4YXLL 5D7LE 1S7SA 1WFTA 1YEDB 2NW3B 4FXKB 5TPWH 3LRSA 4LLMA 3X14A 3HPJA 2H6PA 2LAAA 3MRHA 3CLEL 3MROA 2FO4B 1G6RB 5DD5H 3RX7A 2IQ9H 3BWAA 2IBZY 5FK9B 3C6LA 4OKVB 1PJ9A 3L3JB 2OCFD 3PGDB 2HJKA 4JY5L 4X6EB 3VD7A 4HQQH 4BK4A 3IDGB 3EAKA 3EYFB 3N1PC 4P9HH 2X41A 4NDMA 3ZT6A 5HYJB 2DQUL 3SDDA 2IH3A 4K3EL 3SDAB 3RVXD 1JPFA 1JGEB 4TVPH 5C0EA 3KPRA 3JV6B 4UB0H 2QQLL 3X3FL 1SQ2N 1Q9WB 5CJXC 3OSKA 4D0BB 1ND0B 1RFDH 3QUMH 2OXHA 5KSUA 3TA3B 5IOPA 4NRZA 4X6CB 2O5ZL 4YZFE 3L5XH 1YMHB 3C5ZA 4X5LA 1N8ZA 1SMAA 1IL1A 4MDIA 4PPTA 4E9LA 4PLNC 4G6ML 4NZTL 1JK8B 3IDNB 1E6JH 3DI2B 1KEGL 4G5ZH 1TVHA 4YEEA 5KVDH 3QHTC 3MBEA 2XKNB 3KPSA 3MRRA 2X9WA 1LEGA 3BGFB 4FQ1H 2ZSVA 3M45A 1UM5L 4NKMA 3VWKB 2R4SH 1F3JB 3MLYH 4OGXH 4URTB 3ZKNC 2YZ8A 3UMTA 1YC8A 4OUUB 1F6LL 2EDLA 3PGFH 3UJTH 5HYSA 4V1DE 4GBXD 3U0WH 5FM8A 1KB5B 1NCDH 3NZ8A 3F58L 5DJ0B 5JHLL 4XCYA 5IHBA 5HGAB 5IBTL 2EEAA 1T89C 3I85A 3U7YH 1NMCC 3VGAC 4NBYB 2X1PA 3NBNA 4TUKH 2FX7H 5DTFA 3ZDYE 4I3RH 4ZFZB 1CT8B 1QKZL 5D1QC 4LCWA 3QI9C 3BPLC 1BEYL 3I02A 2BY1A 2O61B 1JNHB 1AI1L 4FZEH 4U3CA 4R8WH 5D5MF 2ARJB 3N85H 4XAKD 4J3WA 1OAYL 1WTGT 3I50H 3B3IB 3WJLC 5IEKB 4Q2ZA 2ARWA 4RX4D 5HDBF 1D9KB 5HI4C 4FQHA 2X89D 3CFDB 5FYKD 5ISZB 1AXSB 3QIBA 3RGVA 3DETC 5DQ9A 4EN3B 5HXMA 3PP4H 2PW1B 1HEZA 2ORBL 4HKBA 4QOKD 4DKDC 4L9LA 5JO5B 3O9WD 1I1FB 1T66C 1G1CA 3UJIH 1YMMD 3T0DA 2IPTL 4GRWE 5F3HB 2CDEB 5L7XL 5KVGH 5HD8C 4UBDC 1QFWL 1AKJD 2DWDB 4AEIL 1GGIL 1P7KB 3RVUD 4MCYB 2VDKL 3FQNB 4Q6YA 1CN4A 3A6BH 4XCCL 3MXVL 4GQPH 1TJGL 3BMVA 2MKLC 2NQCA 1BGXH 3FQTB 4LLUA 5CWSB 1TVBB 4AIOA 5C0CD 5L9DH 3JTSB 2FJGA 4OLYH 3QUML 3CDCA 3ZHKA 2WBJB 5K9KB 2FEDD 4HJJL 4K7PL 3HN3A 5DUBB 2OX5A 3GMNA 3K4DA 2CKBA 4GAJL 1FJ1B 3R4DA 4G5ZL 5EO9A 4ELME 3QIUC 4R4NC 3VWJC 5H37H 2OMNA 3STZA 3QDJE 4BSWA 1DBBL 3S34H 1YEJL 4NKDA 3JWOL 5ID0B 2YBRA 3ARSA 4JO1H 4BH8B 5FECA 4CGTA 2AXFA 1N5AA 3QXAB 4NQEE 3U4BL 4R7NB 4NZDA 1A0QL 1G7PB 1G9EA 3K81A 1WZ1L 2CMRL 1LO3L 1JTOA 3TA3D 2DWEB 1NDGA 4P2RA 2FD6H 4WW2C 2VN4A 3GSOB 4JAMA 3JWOC 3O8XC 2QQQA 2QHRL 2ZG1A 3RDTD 2FECL 4Q7DA 1OAUH 3CLFH 4LKCA 4LF3B 4ZFOL 3ULUL 4F37K 4I0PA 1BEYH 1HQRB 3C8KA 4DKFH 2W65A 1IARB 2VITA 4S10A 5FOJA 1AI1H 3TVMA 1UVQB 3O2WL 4H5SB 5EZIH 1S7VA 3ARWA 5GS1B 4P23C 3DGGB 4AL8L 2WQ8A 3EUUA 3GK8H 4DN3H 5KVEL 2VZTA 3D18A 4JZOA 4WEBL 3KYMB 4NN7C 4N5EC 4ODTH 5DK3A 2HYMA 5CEZD 2E6PA 4PRPE 1BZ7B 3GSRB 1JJUA 1RJYB 1ZT4B 2XTLA 3BIAX 4PP2B 2VXSL 4AJ0A 4F9PC 3QUXD 1UKSA 1VFMA 2Z31A 4ZUUB 3KPPB 3WKML 1P4BL 1D6EA 1C16A 5HYQA 3QG7L 3FFDB 4DAGL 3RFZC 3KPRE 5H94B 4ZFGL 5FKAA 2HRPH 3L95B 2VDOL 4IRJD 5FGSA 3S3JA 1G7MB 3QDGE 5D2LE 3H7BA 4MWFB 5E08L 4CDGC 4L1DA 1W0WB 3B5HA 3KJ4B 3BZDA 4DKEL 1EFXA 5BV7B 2V7NB 2LU3A 1KB9J 4OFYA 1IQWL 2XN9A 3S97C 5JW4Q 5BOPA 4JGJA 3ZTNH 4GG6A 1U41A 2BVOA 3HC0B 5A2KH 1Z2KA 4R90H 5C0CE 4MXQD 4X4YB 5J1AA 5EIVA 4Y89A 1A3LL 2WLYA 4F7EB 2NXZB 1NCCH 1MFBH 4XP9H 5DGQA 3FB6A 3SO3B 5I74C 1BIIB 5ALCH 1KT2A 2V5YA 3ARFA 3DSNA 2WLZA 4P9HL 4GMSH 3VU2A 25C8H 4EI5A 1FNEA 3QI9A 3O3UN 2EE3A 5EZJA 3GI9H 4KI5D 2R2HB 3KS0H 4JO1L 4G9FB 4EJ1C 4ZXBD 4LEOA 3I6LE 4FTVE 3BMWA 5TE7L 3V5KB 3QUXC 5CSZB 2EH7L 2FX9L 4J8RB 4JDTL 3TBYA 3VD5A 5FUOL 1CF8L 2O5ZH 2HKFH 2O26U 3MGOB 2FD6L 5GS0L 4KKAD 3M1BB 3LQZB 1G6RH 3CMGA 5TFSH 3V4PL 1JL8A 5C8JA 3ZKSD 1A6TB 5EORH 5D7KD 1UM5H 5HY9A 4U4BA 3O2WH 3IXTA 5D72H 1T1XB 3CMOL 2NX5A 2Y07L 3GSXA 3QRGH 5C0IA 4I9WD 4LGSB 1IGYB 3WV0A 4K3DH 4HXAL 3NVQA 3ZYJA 3UTPE 1ERNA 2DQFA 4D94A 1DBKH 1EZVY 1BQUA 1QR1A 4D9LH 4E5XA 5IW6B 5ICXB 3CX5J 4Z0BL 2LVEA 1N6QH 3F8UB 1UB5A 1T5WB 3D2UA 3V4VL 1I7RA 1E0OB 3ECBA 3UBXA 1H3PL 2QHLA 1KJMA 3O4OB 4NP4L 1TCRA 4FQCL 2APBA 3CH8A 1IKFL 3KDMB 2BSRA 2P5EE 5EU6E 3VA2C 3OB0K 2O5XH 5DJXB 3QUZD 1LE9B 5FYKL 3QCUH 4HSQA 4DKEH 3D0LA 4DZ8A 2VDPH 4P3DB 1J1OL 5C0FA 1HHJA 3G04A 3FCTA 3U82B 1SYVA 2PO6C 4IJ3C 1ZHNB 3JVGC 1EEQA 1J8HA 4NQCA 1B2WL 3S4SA 2V2TA 4QHNB 1NQBA 5KJRH 4KY1H 3ZTJH 1SY6H 5E5MB 3V6FB 2JIXB 4X9FA 2H26B 1I9IH 2PETA 4JFZH 3L7EA 3UJIL 3NN8A 5JPNB 2EH8L 1CE1H 1EO8L 1YEKL 2VZSA 4WUKL 2LE9A 2OR9L 4MD5B 3W0WB 4FHBD 5DA0B 2E7MA 1VA9A 1F58H 5JZ7D 3SJVB 3VFVB 2EDTA 3CFJB 1N5YH 1Q9KA 4Z7WF 3QEGL 5KANG 4AT6A 4LSTH 2RHEA 1P4LA 3P0GB 4OZIF 3RBSA 3SE8L 4X6FA 2VXTH 4F2MA 4KKBD 2D0FA 4I2XA 4OFKA 4GOSA 3N9GH 1T2JA 5GS0H 3U0PA 3QJHA 4GAJH 3VFWB 4UT9L 4W70A 3QR2A 1KLUB 2ICWA 1JYNA 4Q58C 3WN5C 3WFHB 1G6RL 1O7SA 4R4ND 4LBEA 1YEJH 1P4IH 4D0CB 3MR9A 4KROD 2A1WH 3G6AA 5CBAA 1JP5A 2P46B 1IEBB 1R0AL 1OM3L 1H5BC 3E3QE 2IBGA 2Y9RT 1ZHKA 3QZWG 4JRXB 2E6QA 5E56A 3X13B 4RCAA 4XH2A 2LVCA 2BRQA 3KPNB 4L4VD 1FH5L 1QQDB 4XPAL 5L2JB 1RV6X 5DVKA 3MRGB 3PV6A 2K1MA 3X3GH 1FNHA 3EFDH 1J8HE 4LOUD 2QSCH 4OLXL 5F6IC 3O9WC 1TZGH 2X4PB 1KG0B 2VZOA 1PX3A 3ARYA 4ZUVA 2CO6B 1MEXL 4JFXB 1YN6B 4JKKA 4NP4H 5HHME 4CAGA 1MCCA 2QEJA 2X4NB 3EDEA 1CDHA 5I8CB 1ORQB 3X14B 3HPJB 3X11A 3G9VA 4M7LH 4HHAB 4NO0D 2PYEB 2BOCB 1MELA 4XT1C 3O3BB 4YLQT 2A6JA 2NPLX 3C9NB 5BRZE 5HTSA 3DTXB 1T03L 5D7SL 3LB6D 3RVUC 1Z9LA 1BM3L 4ZPVB 3X12A 3UAJC 1EUUA 4QRPA 3IU3B 2OJZH 4JFZL 5TGBB 4G8GD 1NGZA 2EH8H 4QGTA 5CP7A 3HZMA 1ONQB 5HYFA 5IGXH 1C12B 2OR9H 4K3GA 2NZ9D 1T0NB 4NDMB 5F89B 4HAFA 4NC1C 2MSPA 5JOEA 1IJ9A 2DIBA 2EKSB 1CD0A 1FVEB 1JPFB 4MAYA 4ZUWB 2HMIC 3JV6A 5IB1A 4OCXH 3P9LB 5B3JE 3K0WA 1MWAA 4E42B 5D2LA 2FSEA 2WM0A 5D1XC 4MA3B 4P3CL 1RU9H 4JDZA 4H88L 3QHZH 3IDNA 2B4CH 3SDAC 5D96B 4M8QA 2R1WA 4XZUA 2XKNA 5FUCE 5DJ6A 2EDKA 1P4IL 3QI9D 3T1FA 2F9BT 3L3GA 1ETZA 2HWZL 4UI2A 3VWKA 2CLZB 1UJ3B 4TULH 2O5YH 4Q0XL 1Y0LA 4NRYB 4YBLB 4JFPA 3ULUC 2NXZD 1UQSB 1A14L 2RAMA 3DLQR 4M1CD 4GFTB 3D9AL 3T2NL 2GY7B 5DYOA 1FIGL 4ERSH 4K7PX 5IEHA 1ZHLB 1TENA 1I7ZB 1A7NL 3HC3L 4Y19A 5FO7A 2GJ6D 2YD4A 4NQDB 3ZKND 5EC1A 4OLXH 5HDBE 4UU9B 5BV7L 2Q6WB 4BQ8A 1AIFA 3E0GA 4NWTL 1OD7A 1PVHA 4LAQL 4L29A 5B22A 3L5IA 1F13A 1AGEA 1FCCA 1MIMH 5IEKA 3F7VB 1Z3GL 2LTQB 4UAOB 2DDQL 1IT9L 4WTWA 3WFDL 4ONFL 2KDGA 4OT1H 4AZ8A 3DX9B 3MJ6A 4OLZL 4NQEA 3H9SD 3RKDC 3UPRA 3NGBC 4G6JH 4LPXA 5ISZA 4F15B 4NQCD 4Y5XA 3H9SE 3ISWA 4U1MB 5I8KL 1J1XL 4GSDL 5D7SH 4BQBA 3QWOA 4JG1L 4X98A 4R3SA 4KUZL 5F9DC 4LP5A 3OJ2C 4XNZB 1XGPA 5MENE 2G5RA 1XF3A 1YJDC 1UH4A 4PB9L 3CJJA 3SKUD 5FUZH 5DJ8A 3N50A 4TUJB 3RWFA 4UUJB 2DWDA 3LVEA 4OZHB 3STLA 1BECA 3RWCB 4O00A 2DQIH 1V05A 2RJMA 2XQBL 3B9VA 1FYTD 2K3TA 4JANA 1SBSH 2FJGB 4M6NH 3ZE0F 4HLZG 3H3BC 1YY9C 3CVIL 2R0LL 2ZNXA 5EOCH 1G9NL 1U58B 4LVEA 5KG9A 1S9WA 4TRPH 3TO4B 3BH9A 1BZQK 5MENB 5C0BB 1NCBH 3FT2B 3MOQA 4QTIH 5IMMA 5EFIA 4PJCF 5BQ7A 2EE6A 3QNYB 4NKDB 4FQIH 1RK0B 5EH1A 5GGSY 1V3KA 5B8CC 4PJFE 3SY0A 5MEPA 1C08A 1ES0A 3MLVH 3QNXB 4PJDF 2Q8BH 1ZKAA 4X7TA 4J1UA 2JJTC 3WFCL 3GKWL 1FLTX 4M9PA 2YD2A 5DT1L 2ZOLA 4F33A 4X5WA 1YEIH 5LGKA 1X9QA 2F8XC 3UDWA 5FO8B 3LH2L 1MCQA 4XWOD 3NFPA 4G6KH 5IIEA 2EDOA 5IHZB 3MACH 5C0RL 3CFCL 1OWRM 2HH0L 4O2EB 3P73B 1VEOA 3ARGD 3V8CA 3PABA 2P5EA 5GSRA 3TBSA 1MLBB 4EUPH 5DUPL 2BSED 3IDMA 5IJKA 4DGYH 1MI5B 3SGKC 1U8QB 5JLZA 5GJSL 5C6TH 4GAGL 4Z0XA 2WINB 3TVMB 3KNBB 1KJ2H 4LVHC 2GAZA 2N56A 4N0UB 2DYPA 5IVXA 1RAMA 2ZUVA 1N64L 2FNBA 1D5MB 1JHLL 1H8NA 5KSVB 1MIML 5GS1A 3IDXH 4LNRA 4MZ3A 1GHFH 4YH6A 2YD7A 3KYOA 1AGDB 1G9ML 4TSAL 1KN4L 2ED8A 1E4WL 3KYMA 1U8OB 3EFDL 4MAUH 5B39B 4QWWC 3OKYA 2QSCL 1BZ7A 1I9RH 5FFLA 5MEND 5DUMH 1KCSL 1R3HA 4KRMB 3BKCH 5DRXA 5I9QC 2W0FB 5DS8B 2LTQC 4KDTA 1A3RL 1MEXH 3MMEB 3MV9D 5I1AA 4LSVH 4YHML 5H94A 2J12B 4X6CE 4PRAB 1LEKB 3FO2B 3OGOE 2QR0B 1QFWM 2VLRB 1OY3B 4Y5XC 1G7MA 2BFVH 2IG2L 2DJ4A 4QRPD 1FAIL 1OP3H 3TPUB 1ZSDA 3G5ZA 3C60C 2I27N 4LCWE 1EJOL 3CSGA 4FQXC 2KL6A 4YDJB 3GMOB 1RZ7H 2MFNA 1SBSL 2H2SD 4XBPA 4XNYH 4C59B 2F5AH 5HYJE 2FJHA 4HWEL 1VFAA 4Y88A 3RBGA 2GUOB 3QAZB 3VRIB 4RISL 3EFFB 2ZOKA 2I5YH 1NGQH 1ZV5A 3FRUB 3GGWB 4X9BA 4TTDD 1KT2B 4NGHL 4V2BA 3T0AA 1ROWA 4TTDC 3BP4B 3VD9A 4N0YL 2I9TB 4LEOB 1NCWH 3OB0H 3SKNB 4Y4FD 1X5LA 4PJDA 1W2KT 2VLRE 2GEEA 4HUKB 4I3RL 1I8IA 4J8RA 1LDPH 1OAZL 4YHNA 4P3CH 1AR2A 1MOEA 1RU9L 4H0HB 4XBEL 3QWQB 4OCWL 1CIDA 5T3ZE 2Y7QB 1TZIB 4RFEB 1HNFA 1YEHL 5CD5C 3LQZA 4R8WL 2LFGA 3BPLB 1XAUA 4BJLA 3F7YB 5IMKB 5KS9E 4MGXA 4M00A 1HKLL 1OW0C 1RK1A 2AJXL 4PGJA 5T33L 5FAAA 1TQCC 2UZIH 4AH2A 3RY4A 4LASL 3L3HA 2DQEL 5L88H 5DQDL 1OAYH 5BS0D 4P59L 3SKOA 5F7UA 5C08A 1BJ1J 2DQFB 4JRXE 4OZHE 3U46A 4U0RB 2R2EB 1XCTB 4NNYB 1NH6A 3U4EA 3KYKL 4FA8A 5F9AC 5J9PB 1QBLL 5E9DB 4IOIA 2ZUSA 1QFOA 1QFWH 4X4MA 1T1ZB 5C3LD 2FZ3B 3JV4A 3B8SA 3UBXB 4U7SA 1T89A 1UA6L 1H15B 1OQOA 3RKPA 1AKJA 2B7DT 1O0VA 2OR7A 3WIFA 1FL6A 4R96B 3RL2B 3QUZC 4IOFD 2EKJA 2DKSA 2BY0A 3D0LB 3LS5L 5L8LB 4P2RE 1V8HA 4P3DA 3W9DB 3JUYA 2GHWB 4QF1B 2FYYA 2F5AL 3OF6D 4P5MB 4YDKL 2OTPA 5HHMD 4PJFF 4X5XB 4Y4HA 1WSST 3D69B 1T5XB 3MRFA 3MV8B 4NSKA 4BZ2H 2XWTB 4B7LA 3RNQB 1WC7A 2EC9U 3MRKB 4PB9H 1X5GA 2NTSP 3M07A 4QRTB 2P4AB 1FZKB 4IS6A 5D7KE 5B38B 4N1EA 1EAJA 3W0WA 1WF5A 2YD1A 1WZ1H 3T04D 5IF0A 1DBBH 1LO5B 3R06B 4JFYB 4GG6F 3CFJA 1JUFB 4TQEL 1E6JL 1CGXA 1BAFH 2OS7A 1TXKA 3LEYH 2GITA 1Y6KR 43C9B 4LCCA 4F2MB 4XBEH 1K3ZA 4OCWH 4RX4A 1KACB 2AV7B 2AJVH 3L3KB 2DQJH 1TMCB 2G9HA 3OQ3B 1RZIB 5EZIL 2GTWB 2XPGB 4KROB 1P6FA 1M6OB 3I3DA 2HLFC 2XXCB 2IMNA 4NO2A 2FH8A 2Z9TA 3GBMH 5F71A 1NFIA 4OZIB 1Q9OA 1GAFL 2XIDA 2B1HL 5I0ZA 4H20L 4Y4FB 4QT5A 4P2YA 1EGJA 2VWEE 4F7MA 1WGOA 4PJBB 4OZ4B 4OGZA 4OV5A 5KS9A 5I15L 1BZ9B 1QKZH 35C8L 3QULB 1IAOA 4PJ9C 1CFVL 3QA3B 5IMOA 2HN7B 3PV6B 1EHLH 3DURB 3G08B 3VA6A 2VLKB 4JO2H 3PWVB 4QNPE 4DAGH 1B0GB 1J0ZA 4HS6A 3Q5TA 4M03A 3RIAK 1T1YA 2ITCA 3PHQB 5JW4R 3LSOB 1UB6A 3IF1B 1YQVL 2BERA 3SDAD 3WKMH 3EYOA 3VXNB 3O6FB 4UV4H 5I75C 1OARH 4M6MH 3BJLA 3X11B 4PRHA 3UTQA 2FEDC 4JKLA 4R90L 2HRPL 2ORBH 3BEVA 4OZGE 4X99A 3QIUA 1A3LH 1DQMH 3K74B 2OZ4H 3V6OE 4NUJA 3NCFB 1U8KA 2ICWJ 4TNWF 1G7QA 1H8OA 4JO4H 2PCPA 4HK3J 1BFOA 1J88A 4XBGA 4IBLT 3IVKB 1MJ8H 3MUY1 1T83A 2NY2B 3O8XD 4NO5A 2NZ9C 3FO1A 3FQRB 5E6ID 2CSPA 4WU7B 4ONGL 1PLGL 4RSVA 4PRDA 3PQYA 1AGCB 2AV1A 4NQTA 4KHXH 2XOTA 2X6MA 4JVUA 1C5DA 2VLKE 3T2QA 3MUGB 4HZLA 5JW3H 1C12A 5I17A 4M1GL 4APQA 1I7TA 2X1QA 3U9UA 5D7LA 5GPRA 4XC1L 5CEYA 5IB1B 5AD0B 3D1MC 5A2FA 3P9LA 1EH9A 1WICA 2H3NA 1NBQA 2F15A 1I9EA 4Z7QF 3N1QC 2ZPKH 4ELKA 1G7JB 3HI1B 4LIQE 2Z4QA 5H2BA 3VWJD 1JYVA 1CICA 2FX9H 3KLAA 4JDTH 5DMJB 3CK0L 3JWOH 1UFUA 1JF5A 3VGDA 4G9DB 5DQJB 2ZUXA 2AJVL 4XPHH 4MS8D 4Y2DA 3KAAA 3QRGL 3Q1SL 4MS8C 3V5HB 1SM3H 3OR7B 4KJQD 1GAFH 5ACZA 3QEQB 1G84A 2CLZA 3EGSB 1EPFA 1I75A 3TNNA 3IYLW 4IIQC 2P5WE 2P47B 4XVSH 3D87B 4N9OB 4F3FB 4PP1D 4ZS6D 2NR6D 3Q3GA 2C26A 4R7DB 3IFPB 4K3DL 3B8YA 5DYOB 5JMRA 1N3NB 5HYSG 1CFVH 1CGSL 1ZHLA 3FRPG 3VCLB 4HFWB 4WEMB 5IV2A 1NUFA 3L3OA 5F93C 2VMFA 3S5LB 3TNMB 2C9AA 1DBKL 4IIQA 4YK4B 4XNQB 1UH3A 3VFTA 1CDBA 3Q5OA 5EC1B 5GIRB 3VFUA 5KBNC 3GJFB 4EOWL 1RY7B 2DD8L 4S1DC 3D6GA 4OD3L 1ZLWK 3LEVH 4BFBD 2O5XL 4ZDHB 2BX5A 2B8OT 1KGCE 1O7VA 3MX0A 1UWGL 4LSRL 2DB8A 1YPZA 2NR6C 3EZ8A 4PRBA 1A47A 1A6ZB 1OARL 4KKBC 4M6ML 4N0CC 4ODBD 3FHAA 3M8OL 3MJ9H 5JQHC 3RI5K 4WI6A 2E9WA 5DFVD 4XI5D 1EVTC 5HVGB 3RTQD 2K7QA 5FF6A 3E6FB 3DUUA 5ERWA 2J7LA 3D85B 1KCLA 3T0EC 5D1ZC 5BZWA 4YNYB 1I3UA 1CE1L 3T4AA 4O02H 1XZ0B 3KWWB 4ODWA 4ZFGH 3DVNB 4X98B 4WFED 4NZJA 5DHXB 1F58L 4LMQE 1IGML 5E08H 3HMXL 4AK1A 3H2WA 4FFZL 2DM2A 1ZT1B 1G0YR 4UUJA 3I6GB 1CGYA 4Y5VB 1HHIB 4WUKH 3RWDB 1S9XB 1I1AB 1Q38A 4DFIA 3GSWA 3EO1B 1GZQB 4FFYL 3QEUA 4P46A 3CSBA 1RSFA 4Z7UE 4YDKH 1X5AA 5E7FA 5HGGS 5I30H 1I4FA 3ARBB 3WLWC 3TBWB 3V7AG 5JUEH 2A9NL 2XTJD 5JIIA 3TO2B 4F7CA 5DK0A 1NJ9A 1MCEA 4LDOB 3ZL4H 3T2PA 2BC4B 1QSVA 1VEPA 4R9HA 1TETH 1RK0A 3UZEA 4Q6IB 5BW7C 3SY0B 5MERA 1KIQB 4O2CA 6FABH 2J8UA 3WIHA 1A4KB 2X9XA 2OTWB 1WWCA 3B6SA 2ZOLB 3TZVB 4F33B 4PJ9A 4QXGH 3GI8L 3D85D 3G5VA 2Q7NA 5A3IC 2L7JA 3NFSL 4PJCB 5IHZA 43CAA 3LZFH 5F97E 5JHDB 5DXWA 4KGLA 2MQ0A 2Y07H 3HI6H 5FM5M 1JGDA 3BESR 3EDKA 2X2YA 4WU5A 5IROC 1MI5A 5ACMA 1U3HD 3C8DA 5CUSL 4OD3H 2X4RB 4DK3A 3NCEB 3PV7A 5BS0A 2JJUA 5IW3A 4P2QD 5INDB 4LSRH 4WW2A 3WE6B 1WIOA 5KSVA 3QEHA 5DF0A 3DV4B 4MA8L 5ITFB 5I15H 1N6QL 3CFEB 2HG5B 3M8OH 5DZNA 4NT6A 3FT3A 3ZKXB 5D71H 3QUYC 2E7CA 3GBLA 4FXGA 2EDJA 2OJZL 2VO5A 2BSSA 1FZJB 4HJ0C 4L4JA 3E6HA 4CNIA 1YUHA 3ARGB 3ZHDA 4KVNL 3L5JA 4ISVA 3HHRB 3VMNA 4DEPC 3CXHJ 4U1HA 3IETA 4LVNC 3PL6A 1HH6A 2Z92A 2E9BA 2P7TA 2VC2L 5IB5B 4U2YA 4NUGL 5TF0A 3QCUL 4YPGA 3VXSB 3NPSB 3CDGA 3BW9B 1G9MC 1P7QB 3R0NA 4PGDA 4QRPE 3CCHB 1QFHA 2QV2A 5IGXL 3FO2A 1LEKA 2A73A 3BN9D 5DEGB 5C0GB 2W9DH 3TPUA 3L5WB 2HFTA 5EBLA 2R23A 1PQZA 3GMOA 2XZAL 4XAKE 1C1EL 1BQHG 1M71A 1FNGA 4UQ3A 5I30L 4G42A 5IR1A 3OTTA 4CVZA 4KRPD 4H88H 5F1NB 3QCTL 2DBJA 3BGMA 3GGWA 5FGRA 3QHZL 1QACA 5DFTA 1CGVA 4F7TB 1JF1A 5EB9A 4XPBH 4LSTL 4L4VB 1UXSA 1J8KA 4QEGA 2VKWA 2WIIB 5HVHC 2MKWA 5TDOA 5T1KB 2HWZH 2N7AA 2DJSA 2FJFA 4RNRA 4UDTA 5T3XE 3WDIA 2VLJB 1S7WA 4RMVA 1HHGA 4HKXB 4GKZB 4ERSL 1JWUA 4HC1A 3ZE2E 2ZG2A 5K59E 1EGJH 1A7NH 1XH3B 1SYSA 5FA4A 1KCRL 5EULV 5FOBA 3S37L 3RU8L 2FL5B 3QJFA 4HJ0D 4XNZC 1FZMB 1FH5H 3FFCE 4XPAH 3G5YA 1CE6B 4DVBA 3AS3A 4XVSL 1QLRA 1IRAY 5GGUA 4Y4FC 5SX5H 3C5ZD 2DQTL 2Y72A 4XCEB 3VXME 4MA8H 4L3EB 4JO3H 1XGTA 3DMMC 4XAWH 5HDQH 1FYTA 4HJGA 3NGBB 1TZGL 3P9MB 2GW5A 1OPGH 4FQJL 3U46B 1KIPB 5CGYC 4HKJA 3D3VE 3FRPA 1CXFA 4NNYA 3U4EB 1MHPL 5HHQB 3IDUA 1SBBA 3HR6A 5JMOC 1F4WL 4NRXB 5J6GB 3VH8B 4RFNC 4M7LL 3VXRA 2HT4D 1MHHA 1H15A 2DQUH 3LY6A 5SX4H 4ZMAT 1RJZA 2FIKB 4TVPL 1AY1H 5GZND 4HWZB 4Y5YC 2HT2C 2ZKHL 3SPVA 3EO9L 1FAKT 5D5MA 5C08E 1PKQB 3WL9A 3P0VH 5C0DB 5CJQH 5FGCB 2A6KA 4QTIL 4ETQA 4O02L 4PY8J 1OSPL 1S5IL 4JQVA 4G8IB 1ZLUK 3D69A 4N1CA 4LAJH 4OF5A 3MRFB 4ZUTB 5DI8B 4ELMB 4JRYE 2XWTA 2XZCL 4I13B 3T77B 2Z93B 3E3QC 4U6XA 3BIKA 3LRGA 1SEQH 1WC7B 4N90E 3MV7A 1F6AB 3TN0B 4IS6B 4YHYC 3ARED 1CBVL 5M7QA 1T22A 2AK4E 3MLWH 4X7CC 3VXUD 4TNVF 4DEPB 4OB5H 5IB2A 1U93A 2VABB 1LO5A 1MFCL 5L6YL 1KPUB 4AG4H 1NCDL 2YEZA 2IAMD 4KK9C 1X6LA 3WSQH 1JUFA 4NN6C 4S1SH 4J3UA 3REWA 3S3PA 4X4ME 4TUKL 5LGHL 1XCQA 3MRQA 4DGYL 4MSWA 3VFMA 3EYVB 3HI5H 5FK9A 5I1KH 2A9NH 3L3KA 5J7CC 3HR5B 3IAGC 1KENH 1MH5A 4U6YA 2GJZA 1A14H 4NO2B 3IDXL 3H9SA 3QUYB 3I50L 4LLQB 4JHWL 4N9GA 3EYFA 3BE1L 3NFNB 5J11B 4CVXB 1KJ2L 4XI5C 4BH7B 3OAZH 4KJYA 2DQTH 3KJ6L 4FFVC 4MAUL 5A43C 4QXGL 1FV1B 3WN5B 4JFHD 5C0EB 1YNKH 3PL6D 1BZ9A 1JHLH 5EU6D 4QOKA 3K7UA 3NFSH 5DVOA 1KCSH 3TLRA 5F3BA 4LLDA 1GHFL 2Q8AH 3MLTA 4JHBA 1RZ8A 2CRIA 3RPIB 4I4WB 5J89A 4NRZB 1DQLL 4KKCC 1MCOH 5A1AA 3D3VD 4K9EC 2UVFA 4HS6B 4GAFB 3MNWA 5GGVH 3GIZL 1AGBA 4NQSB 4R2GD 2BFVL 4OT1L 5EZOH 4WV1C 2IGFH 3SDDD 5D8JH 4WJ5B 3RWHA 1TJGH 3KR3L 3O6FA 3BWAB 1FO0H 1IGIH 3FT4B 3ZYZA 4AENB 4WIQA 2R29L 2WQRA 1LP9E 4NUJB 3O11B 4HIEA 4XNMA 1J5OL 1FG9C 1TVDA 3IDGA 1RZ7L 1GOHA 4POUB 3QIBC 1DTUA 3FO1B 4YHPA 1RURH 4LHJB 4R0LC 5HYJA 3S34L 3SDXA 4BZ1L 4RISH 3PQYB 1DUZB 2X4QB 2AXGB 3TZVD 3VXSE 2P8MA 2NY5C 4EBQL 5SX4I 5JNYB 1C5DB 4OI8A 3LKRB 1PEZA 3IKCB 1JNHA 1ND0A 2YUXA 4GH7B 1CS6A 4X6CA 2IMMA 3EOAB 5EIIA 3CVIH 3LEXB 2W9DL 3HNVH 2P24B 4M3JA 2CO7B 3IS1X 3UXFA 4XRCA 1FLRH 5A40E 3KPTA 4RA3A 4F9LA 2C1OA 3ARXA 5C70A 3B2UC 2Z4QB 5H2BB 4IOSD 5LGHH 3EYSH 1BQHA 2RQ8A 2XTJC 3KLAB 4Y5YA 2ZJSH 3HI5L 3TN0C 1F3JA 3D2UD 4HWNA 1U42A 2PW1A 2UY6A 4H8WL 1F4XH 3MLZL 5GGTH 1JFQL 3VGEA 5DT1H 1NGYA 5HYSB 4PGEB 3V5HA 2DLIA 2NY6D 1UYWL 4U49A 2CDEA 1TTGA 2AGJH 3QDMA 2AJYH 5FYKU 4LSSL 3O4LE 3KJ6H 4FFWD 4WEBH 1ZLVK 4H0GA 2YD9A 1JIBA 4JREB 3V95A 5C6TL 3KG5A 2RB8A 2AK4A 5TQ0H 2Q8AL 2WBJA 6CGTA 1CG9B 5FB8B 3S5LA 1T7YA 1MCOL 3QFJD 3WO4C 5DUBA 4TPRH 1KB5H 3S8WA 1T7WA 5EC2A 3O3AA 3QG7H 3GFUA 1S7UB 5DMGD 3UAJD 3W0WE 3MRIA 4NBZB 3MBXH 3ULUF 3LS5H 3GMQA 1IC7L 1E4WH 1QFWI 4FQHB 2ADJB 1YZZA 1WQVT 5D93C 2HVKA 3QO0A 5ALBH 1HEZB 1A9EA 2NXZC 3QB7C 1U3YA 2D7MA 3ZTNL 4NNXB 1HXYB 1RZKL 1OTSC 1HQ4A 1KV3A 5EOCJ 5SWZA 2JJSC 1F3DH 5IMLB 1XZ0A 1YEEL 4XVUD 4JFQA 3NCYS 3Q0HA 3IDYC 5E8PA 4DN4L 4LKCB 1J0IA 3FOLA 5ISZD 2EICA 4JEGB 4BZ2L 1I9JL 3NPSC 4WFFE 4XP1L 5CWSA 2W65B 3I6GA 2B0SL 3JV0A 4PJGF 5K9KA 1H0DB 2ERJB 1S9XA 3HE7C 1INEH 1UJ3C 4XXCC 1WIPA 3TZVC 3O81A 2I5YL 4HZAA 2CKBB 1H3VA 2I60H 3DGGA 4J6RH 1MLCB 4EXPX 5I18L 5I71B 1CWVA 4N8PA 4P23A 2WWMD 1NFDE 1NAKL 5TF1L 5I8EA 5HYIA 5ID0A 1JI2A 2EO9A 3V4PH 4BH8A 5J11C 3HTLX 3MRDA 3WS3A 1QSFE 3V7MA 4F7CB 4LOUC 4IM8A 1NCWL 4PP2A 2AXFB 1SEQL 1GGTA 1F4XL 4X8JA 3QXAA 1OAKH 4YR6A 4ZUUA 4P2QB 2DQHH 4ORGA 1C16B 35C8H 3T0VA 3RAJH 2X4TA 1KIQA 4OV6F 1NUGA 4CN6A 3IRPX 4MQ7B 5FKAB 3WSQL 4V1DD 1A4KA 4LSSH 2Q7YA 3O6FC 3TH2T 5B8CA 4XGZB 3H7BB 4PJ9B 1A9BA 2DKUA 2OP4L 1FZOA 3EJZC 3CD4A 1IAKA 3SHSA 1EHLL 1RMFH 3GB7B 5J1AB 3PNWB 1S7VB 5DJAB 2ZCHH 4WGVB 3QEQE 3DYMA 2R2BB 4ZFOA 3PWPE 3GNMH 3HNTL 1IBGL 4XNXH 3WS6A 5J6HB 1T2QH 1LD9B 3D18B 4IRSD 3T0EB 4WI4A 3UZQA 1DVFC 4NQDD 1YQVH 2VUOA 3QEHB 1UM6L 4OCYH 2IQ9L 3GSUA 4U1LA 3UC0L 1R6VA 3QO1B 4MNHB 4KK8D 5E00A 5B38G 5DLMH 3OV6A 5I1GL 3GZKA 1NKRA 1UXWA 3Q6GL 1IM9D 2AAVA 1BOYA 1SY6L 1DQLH 3U36A 2XN9E 4H1LG 3MGOA 2OK0L 1RI8A 1PG7W 4U7MA 3WNKA 1CGUA 1AQDB 4JO4L 1MJ7H 4Z9KB 1C8PA 1HH6B 1MJ8L 5JOPD 5A16B 5IFJA 4DWHA 1JYWA 4K3EH 4CRPA 2OJEA 3BW9A 1A6TA 2LABA 4PRNB 3BVNB 2P42B 3GM8A 4M61A 3PQYE 2HTLD 3CPLA 1FO0L 3O4OC 1WFUA 2V5TA 1N5YL 1NBVL 4JDVA 2A73B 4WENB 5JW3L 1ITBB 1T1XA 4G7VH 1TJHL 1SVCP 2I24N 4F57L 3PUCA 2CDGB 2VDLL 1X4XA 4F7EA 4UQ2B 2SEBB 4D3CL 5FDWB 2G2RB 1LP9B 3TGXA 4YBHA 4PRIE 1WWBX 5HI5C 5FA3B 3QI9B 4WO4B 4MD0B 5TF1H 4LPYA 4H1LH 5T5NG 1T5WA 4KQ3L 3P2TA 3VXQA 2Y1VA 3FB5A 3IXAA 4TVPD 3RL1A 4DVRH 3VD4A 3KPSE 4G8GB 3S5LG 5KSBE 5CSZA 4L4VA 1VB9A 2VDRH 3TBYB 5CGTA 4P4RA 5C6WH 5GZNC 5I1CH 4YXHL 3MODL 5ADOH 1CGSH 2J1KA 2EYRB 5H35B 1UZ8B 3MRCB 3SE9L 3PDOB 4LLVA 3KYNA 2D7TL 5C0FB 2VLJA 3GBML 4POZC 2E9IA 3IB4A 3FCTB 4OQTA 1ZHNA 1PFCA 4PJBE 1AO7E 3KLDA 5J1TC 5CGYD 4N5UA 5A2JH 1KYOK 1ZK9A 5F7HA 1CVRA 4OZFA 1D7FA 1DQJA 4UIMB 4LSUH 3EZJB 1A02N 3QDAA 2QLVB 5GGUB 4LMQI 5ICXA 2VKXA 4HX1A 1PSKL 2V7HA 4OF8A 3Q48A 12E8L 4FMKA 2RCSL 4AT6B 3RX5A 1EV2E 1AC0A 3HB3C 2XT1B 4I0KA 4K94C 4DGIL 5IB3B 1IC5H 2BMKB 1U6AL 4JKWA 1U3ZA 2H1PL 3U0PB 3PHOB 4MXQC 5KVGL 2B1AH 3RGHA 5INCA 4AEIH 1QYGH 1GGIH 2IADA 1MHHB 4JKMA 1KIRB 2J8UE 1X5ZA 5F7DA 4RDQF 5IK3B 1UKQA 1HHJB 3UJJH 3MXVH 4LVHB 3OXSA 5CBAB 4KDTC 2DTSA 5MI0C 4WWID 1RJLB 2HFEB 3BT2H 4NQCB 3G5XB 4PJHE 1I8MA 1QLEH 1TJHH 5E5MA 4LCIH 1NKOA 3AXLB 2JIXA 1RZKH 1PAMA 4K7PH 5C0DA 3VW3H 1RVFL 3G6JF 3KPNA 2A6KB 2B4CL 2WAHA 3RUGE 4PREB 3U7WL 5DD6A 4RZCA 4WFGE 1PDKA 2IANE 5EOQL 4XC1H 3OKMB 5A3ID 4KQ3H 1H9VA 1KG0A 4TULL 3P40A 1HXMB 2APWA 4XWGH 1CLZL 1YN6A 1A0QH 1VERA 5IB2B 3SGKA 1N59A 1CQYA 1FDLL 4ENEC 4QKXB 4I2XB 4GLRI 1LO3H 4JRWA 3DVGB 4G3YL 4PLOB 1QZ1A 4XPHL 6FABL 3WDHA 1IGFH 3SE9H 5KSBB 3REWB 3HUJA 1WWAX 5FYJE 4Z7VE 3HC3H 5DDHA 4IDLA 3GUTA 3Q1SH 5GSVA 2MQ3A 1HILB 3IGAA 3ILQD 3LKQA 4JG0L 5DD3H 4QXWA 1YYMH 4XP4L 4WCYH 1FVCA 3SOBL 4WV1B 3RDTC 1D3CA 3LZFL 2ZSWA 5GRUH 3RWIA 4JZNA 2JJTA 4ZPVA 3SO5A 3X12B 5JW4N 2KQMA 1FGVL 2NY1C 4QRPB 1R5WB 5CEXA 4FQXD 3AMKA 4IMKA 1UT9A 5TGBA 1Q8MA 1X5HA 2VXQL 5DO2D 5IP4A 4LVOC 4U05A 3MRGA 2B20A 5CAYB 3PGCA 4KRPB 5KVEH 2YN3A 4XXDA 3JWNC 1XF4B 3WFEH 3JWDC 3O3DA 4JPVL 2C7UB 4JE4B 1JI1A 1QRNB 2VR5A 2UV3A 3OKOA 5CZVH 2AP2A 2VC2H 3MLTB 2X4SA 5JORA 1S7XA 2P1YA 5HD8D 2VQTA 4H8WC 3S98A 2COQA 4JLRA 1BQSA 1D9KD 3C2SA 5GS2D 3RTQC 3BX7C 4HHAA 4M8QB 4PRHE 4XNXL 2VDOH 1J0HA 4WHTB 5HGDB 4K3JL 2EDXA 2FLRT 3MGTA 4NUGH 2ESVA 4WJ5A 3L3GB 3DOSA 2A6JB 2DQIL 3GHEL 1UJ3A 3ZSTA 3VXTA 2WSKA 3LKOA 4WHYG 1Y0LB 3FT4A 3QWRA 5JDSB 3V9FA 5DLML 5IUSA 1MQ8A 5I74B 2R0LH 1X4ZA 4G6FB 2Q86B 2OM5A 4FFZH 2JCCA 4LEXL 2OK0H 1AD0B 3HZVB 2NY6B 5GISH 5FO7B 3UBXG 5C2BL 3K2UL 4YQXL 2UYLB 5IG7A 2EKSA 3UTPD 2ZCLL 3QHFL 4IHOB 4KFZC 4OZGF 5DJYA 5MP6L 2Q3ZA 4I9WE 4JFOB 1A7OL 3IKCA 3MV7E 4Y16A 2FSEB 3C8HA 1YN7A 2ATPB 4MA3A 4G7VL 4QRRA 1YEIL 2W9LA 4RIRB 4LL9A 1SHMA 4NQED 4QY8B 3MLSL 4D3CH 2C1OB 2WWMC 4DZBA 4RAUA 5C86A 4Y16C 3S37H 3ROLA 3RU8H 1LE5B 5FGBC 4U1MA 4OLWL 4HULB 1CFBA 4OCLC 4DUWA 3KYAA 4FOMA 5EU4A 5F9OL 3F65A 2Q3AA 4DVRL 1FGVH 4PGEA 1KFAL 2FH6A 2VDRL 1ZVSB 1MVUA 5F7EH 3H7LA 4XAWL 1BFTA 5I1CL 4DQOL 3QBTB 1OPGL 1QG3A 3NIFE 5IEHB 4R2GB 5C71A 1H3TA 4QRSB 3ARPA 5I1HL 1MY5A 5DO2C 2CJUL 3TBVA 4NQDA 1UCBL 4PJ8A 2VDML 3HRPA 5CKGA 4ZTPH 4UU9A 1YY8A 2IANB 1RHHA 1A7QL 4HH8A 5DUML 3V4VH 4U1GC 5L2KD 1NC4B 3DUSB 1CG9A 2BVTA 5JDJA 3MRLA 2C3VB 3NIDE 3MRPB 4L29B 3P4MB 1AY1L 1U58A 1MHPH 1S9WB 4FQCH 3TO4A 1S7UA 4X0KB 1NEZG 5IMMB 2R56L 1QSEB 2QQNH 4MNQB 3WBDA 3UPRB 1MCKA 5FYKH 1WISA 1K5NB 2AABL 3R1GH 4L8DB 4MHHG 3MLPA 4X7TB 4QNPF 1OF2A 5D5ME 12E8H 5F6IB 2OL3L 1AD9A 2RCSH 2Y06L 1B2WH 1Q1JL 4NC0B 4KZDL 1WIUA 1W72B 2VIRB 3GHBL 3DXAD 2KUTA 4GUPB 3QDMD 1MAJA 3E8UH 1PY9A 4FQPA 1FFNA 5IIEB 5IMLA 3RY6C 5GISL 3L3IB 3P73A 3WFBL 4LHUD 4WUUD 1YEKH 2ICWI 2B1AL 2P5EB 4NGHH 4NM4L 4OZHA 5GSRB 4Z77A 3TBSB 3RWEA 2AERT 1EVUA 4RQQB 1HHHA 4JHZA 4GG8B 4KQ4L 3ZO0A 3P4LA 4N0YH 2XZCH 5F7MC 4C83A 1A7OH 2XZAH 1QVOB 5I76B 1EZVX 3CU7A 1IFHL 4L4TA 4E41E 2MTPA 1ZMYA 2DYPB 1H0DA 1OAZH 1LDPL 4PIRF 4YAQA 1J0YA 3TVMC 1MFCH 5KG9B 1RVFH 5L6YH 2FR4A 3BH9B 5C0CB 2HVJB 3OJDB 1R3KB 3LD8C 5E6IC 1KCUH 1V3MA 5EFIB 1R3IH 4UT9H 5BJTA 1MWAL 5BQ7B 2P44B 4X8XA 4G80A 2GK0A 5D7JB 1KEML 3BPNC 4OF0A 5MEPB 2KQNA 5ESQB 1AGFA 3OBAA 1D5IH 1NFKA 4QRRE 4J1UB 4OM1H 3RVWC 1JGVH 4P9ML 1FFQA 2GSGB 2AJXH 4YR6B 1OM3H 1R0AH 4Z7UF 2YA2A 5DS8A 4QRUA 3QAZC 5FO8A 3CDFA 4HUXA 5J13C 5L88L 3MJ7A 2X4TB 2X5PA 3IJSB 1JCKA 4CU6A 4P59H 3ZYOA 2QR0A 3LS4L 2VLRA 4HIIB 4OFYD 5LAXB 4XGZA 1UCBH 5BRZA 4GMTL 1RZGB 4OZHF 5GGVL 3VWJA 2DI8A 4Z0XB 4MVBD 1WZMA 3IFOA 3BZEA 2AEQH 2D0HA 3BH8A 2Z91A 1ZGLB 3UTTE 4KK5D 1UA6H 1M7DB 1TITA 2ILLA 4D8PA 2CIIB 1S8DB 2OR8A 2OL3A 4FQJH 4DJMA 5EPMA 4GAYB 1U8OA 3BP4A 5FCSH 4FS0A 4KXZH 5SWQA 4KTDH 5B39A 2I9TA 3O8XB 2CDFA 4JFEA 1Z9MA 1LO4H 2E9JA 2XQYG 4HIXL 1PX4A 1HINL 4P57B 5IQ7L 1B4JH 4PJDB 3A0OA 2Y06H 3AAZB 5HGBA 1JPGA 3VXPA 4BZ1H 3DV6A 4GBXB 4YHNB 3MMEA 1DEDA 5JOPE 5HSFA 4NO0A 5F9WC 1TFHA 3D39E 3KLHC 2ZUWA 1QA9B 1FGNL 5KSAB 3SCMA 4NM4H 3SEPA 3FO0L 1QSED 1VEMA 3N1FC 3W2DH 1RURL 4TOYH 1N0XL 3WXVH 3LCYA 3FZUD 4KDVA 5EBWB 3BVNA 3CPLB 4UDUB 4V1DB 4N8VA 5DD0H 2GUOA 3VFNB 3WHXA 2F19H 4J7RA 1UACL 1INDH 1U91A 4HG4J 3HNVL 4YBLC 2X1XR 2SEBA 5ACLA 2IAND 2G2RA 3WYRA 5GGTL 2DQJL 4RMWA 1DDHA 3ARZA 4M62H 5LXGH 5FA3A 3LAFA 3VXUA 1HSBA 5E6ZA 1PEWA 1OGAD 4PJ5D 4KK9D 2FGWH 1IAIH 2IFFL 1D5IL 2DICA 2ZCLH 2AQ3A 4OM1L 1BHGA 2VQ1A 4GRLD 3CUPB 5D2NC 5MP6H 4PJEA 3VE0A 3IJHA 3O3EA 4P46D 3VJ6B 2B2XH 1X5FA 1J10A 3FHQA 4P4RB 5MHSE 5JZ7C 2DN7A 1DQQB 1J05B 1MNUH 2AGJL 2AJYL 5DHYB 4JN1H 4WDIA 4GMTH 2AEWA 3W5NA 2E8ZA 3K8LA 2R0ZL 3F7YA 3SE4C 4X6DA 2E5EA 5TPWL 3KPQA 2Y23A 5E1AA 1R3LA 4ZXBA 4X5XA 5F9OH 2APFA 3K1DA 1UWXK 1J0JA 2A83B 3QCVH 2QKIB 2V9TA 3NAAH 3GSVB 1TQBB 5F7EL 3SKOB 3MRKA 5C08B 1Z3GH 2AKRA 5GRJL 2MMXA 4ONFH 2EE9A 4YHZL 5EU3B 1DQML 5J9PA 2NYYC 4JFYA 2VDMH 3SCMC 4LHUA 1TCMA 5E9DA 1HINH 3BKMH 4JHAL 4TUOB 5J1SC 4GSDH 3UBXI 1FL3B 1U8LA 2XZQH 2FHFA 3HS0B 5CFHA 4ODUB 1F6FB 4KHXL 5IB3A 3C5ZC 4OCNC 5C0ND 1FL6B 1FGNH 4J3TA 3RL2A 1XF5A 3DUHA 5EBMA 3FO0H 5INCB 1YEEH 3EOBB 3CX2A 1V7NH 1INEL 4TOYL 4HK0A 1CDYA 1F02I 4LLWB 2EIBA 1RUQH 5E2UL 1I1YA 4J3OC 4GRWB 5F7LB 4AYFA 4QHMA 2FYYB 4DK6A 5D1XA 3AMLA 3VRJA 1NBYB 2OL3H 4F7MB 2B0SH 4PJBA 1UACH 3AXLA 1J87A 3CK0H 2E7LA 4M7JL 2NTFB 3MLYL 2VDQL 4OGXL 3K80A 2XY2A 1DZBA 3ARGC 4KKAC 4CJ0A 1F8TL 1MHEA 4S0TD 4OJFL 3RAJL 5KTEL 3DROA 3WIIH 3UTOA 1E4JA 3EOTH 1FQ9C 2A6IA 4LLMB 2ITCB 3PHQA 4P4KA 1HXMA 1OT2A 5I6XC 2GI7A 3BKJH 2FEEI 4TYUA 2GITB 2FO4A 4B50A 2IPKA 1N59B 2OP4H 1M4KA 2ZJSL 4YIQA 1KCKA 4PRHB 3UTQB 3L3JA 3HAEA 1KCUL 4XXCA 4RA0C 4CVWA 4X99B 3HPLB 2R0ZH 5DJCB 4OZIA 1NFIB 1Q9OB 3RTQB 1KEMH 1X5JA 5E6IA 5DUPH 2PCPB 5I1EL 5D2NE 3GNML 1FVCB 3BN9C 4QT5B 2ENYA 2J5LB 1JGVL 3RWIB 2XWBA 2W0LA 3JVGA 3BRDA 1RMFL 4Z7QE 5KS9B 2AV1B 4E41D 2EDEA 2FEEL 1ZOXA 2C3GA 3QA3A 2R69H 1CFTB 2JJSA 3WDJA 5IMOB 3PGCB 1FORH 2GCYA 3DURA 5KSUB 1OHQA 1VFBB 3FQUB 3PWPD 5EU6A 3G08A 3TA3A 3ILPB 4JQIL 5CEYB 3FQXA 1N8ZB 4L9DA 4M1CC 5HGHA 1DBAH 3AVEA 3DVIA 3P3YA 3OKOB 2M2DA 1YA5A 1YJDH 4K23L 1LHZA 3BKCL 3MBEB 2VR4A 1S7XB 4UT7H 4P99A 4FTVB 1IGMH 4M8VA 3BXNA 3EYOB 4ODXB 4NKMB 3TCLB 4ZOEA 4OUUA 2FWOB 4OLYL 3ULSB 1FFRA 3F6LA 5FHBH 3QIUB 1IGCL 1T4KA 1QUNA 3SDCA 2ESVB 2VDLH 3U2SB 2NXYC 5DHVA 2VWEC 4EUPB 3QEQA 1BBJA 1K4DB 4NYLA 4QO1A 2YC1A 3EGSA 1LO4L 2Z8RA 1EK3A 1JTTA 4EIZC 1NBZB 4PJIA 3VXOB 4WU7A 5IBLD 2LAGB 1UEMA 4DN4H 1MPAH 2XA3A 4WUUE 1JZ7A 3C6SB 2CQVA 4WNQA 2WBWB 1NGQL 4LCWB 2JCCB 1N3NA 3MV9A 3I02B 4HZLB 3HZVA 1GPOH 1EJ6A 2O61A 3L3OB 3VGBA 1E6OH 2UYLA 4OJFH 3W2DL 1WZLA 3U9UB 3MODH 3GJFA 5D7LB 3WIIL 5ADOL 2N4IA 3WXVL 2OBGA 4Q2ZB 3CZFB 1KB9K 2H3NB 5LBSH 2PKDA 4PYGA 1JBJA 4ZDHA 3LPGA 1D9KA 4Y16B 1NLDH 2ATPA 1CICB 3GI8H 2F19L 4PRPB 4MMXC 3RGVB 3ULUH 4QY8A 4UT6H 4X80L 4DZBB 4TNVK 4OZGB 4OIAA 1OAKL 1YEHH 3FONB 3SGDH 5IQ9B 4LQ1A 4U3XA 3U0TB 3DUUB 1I1FA 5L2KE 5C92A 5F3HA 3FJTA 4KKCD 5CUSH 1CFSB 3GK8L 4DN3L 3HUJE 3CSPA 3DVNA 5T33H 4NKOA 2B2XL 2UZIL 1MVUB 3ZT7A 2P8PA 4FFVD 5C0BD 1FORL 1UWEL 4EVNA 3ABZA 4ZQKA 4H0IA 1DFBL 2V5RA 1P4BH 3GMNB 4ZS7L 3K46A 1T7ZA 3S35H 3EO1A 2W9EH 2AK4D 1T66D 4JRYB 1GZQA 4P46B 2H1PH 3ARDD 5SWSD 1AXTH 2D31B 4EEEA 4KTYA 5CZXD 5AG9A 5J57B 1RD6A 3LOWA 2D4DA 4JN2B 1ZTXL 3KPLB 4ZO9A 3TBWA 3CIQA 1A3QA 1UM6H 4Z18A 4XC3L 5JHDD 1IC5L 5LCVL 2UWEB 4X0KA 3NTCH 4G9FD 5ID1B 2X10A 2EDNA 3ULUD 5I1GH 1RULL 1G7PA 4MNQA 4ZFFA 5LJYH 1OL0A 2WANA 4YNYA 4XTRC 4J3VA 3BKML 3HA0A 4JHAH 1S9KC 3VWKC 4Z76B 3BT2L 2GYSA 4A6YL 2XTJE 3LQAC 1IAMA 3B5TA 3H42L 1JN6B 3O6MH 3RVVC 2FLBT 4OFPA 1OAQL 4H5SA 5CCKL 4WY7L 1HHHB 4DW2L 1MAML 3MLXH 3VFRA 5SWZE 3QEUB 4KJQC 2APXA 5I76A 5IHUL 1BJ1H 3KPOB 3N0PB 2X4RA 4TQEH 4L3CA 2BNRA 4D9RD 3DX8A 3ARBA 3BI9X 2BSTA 4G8FB 1VADA 5E8EB 1KCVH 1RJYA 1ZT4A 3V52L 1KJ3L 5DK0B 5FYJU 1ZA3B 3AB0C 3NCYP 5T1MB 1IGFL 3F7RA 3VFPB 4EDXA 3QPXL 1MCDA 2BSSB 1IVLA 4Q6IA 3E6HB 5D6CA 4JKPH 4YXHH 1NMAL 4OFVA 4WCYL 3SOBH 3BRFA 1KUMA 5JW5B 4JPIA 2OTUA 4PTTB 3MV8D 3ZE1F 1VHPA 4U1NA 1EFXB 2XV6B 4UINL 2D7TH 1XFPA 2PR4H 4PGDB 5CZVL 2NZIA 1R24A 4YWGH 4PJDE 2R2CA 3MJ8B 1BWMA 4X4YA 1HNGA 5BRZB 2CLVB 3BJ91 3L5WA 1JGDB 1KXQE 3QXWA 4TSBH 1JE6A 3FB6B 2BVPB 3DHJA 4LSUL 3IFOB 3BZEB 1GGBL 3BH8B 5BS0B 5SV3A 5D6DA 1ZTXH 1JGLH 4M93B 4Y4HC 2NY3C 2HP4A 2DS4A 5LCVH 3B9KA 3FT3B 3IDYB 3MNZA 4F7TA 2QSTA 5KJRL 2B39A 2M26A 2X7LB 3U7AA 2OXGA 4CNIB 4R6UA 1G7HB 5T1KA 1AE6H 1I9IL 2CDFB 4JFEB 3BEWB 3BN3B 1B88A 1DBAL 1D6VH 3PL6B 1JWMB 3L3DB 3AAZA 1U3HB 1JPGB 3SDXF 3DV6B 3WNOA 4KV5F 4HG4K 3AS2A 4ONGH 4ZXBC 4DGVL 3OJMB 3NA4A 4JQXA 4NO0B 4HKXA 4EQ2A 4ONHB 1QEWB 2Q76B 5C0GA 4DW2H 5FHBL 4Y1AD 4LCIL 1LGVA 4H1LA 3VW3L 2NY4B 4AG4L 2FL5A 3QJFB 5IHUH 2ESVE 1FZMA 4UDUA 4ZUSA 4N8VB 2ZPKL 1QR1B 1GYAA 3W81A 3ZHLA 1N0LA 2QBWA 1UB5B 1FYTB 3BGMB 4JZJA 3SE3A 3MLSH 1MRFH 1JF1B 4LU5H 1DDHB 2EIDA 4B53A 4XWGL 1SJHA 3GMLA 2WNGA 1TCRB 4AMKL 4YGAB 1FBIH 1IMHC 1F00I 3KDMA 3ZDZF 5K9OB 5J6GA 4N8CL 3BE1H 1NEUA 3MV11 5DJXA 3VJ6A 1TTUA 4DZ8B 3BUYB 3U30B 4ZTPL 4JG0H 4PJAB 4P48A 1QHOA 1IILE 4I8DA 3JWDH 4UT6L 2QSQA 4HC1H 1BJMA 5E94B 3S4SB 5GRUL 1JGUH 2IBBA 2G5BA 1LDSA 3BKYH 5I1HH 4JFDA 3QRFM 4P23D 3GRWA 2VXQH 3STBA 1UWXH 1QLRB 1ZA6A 4MD5A 1L6ZA 2CPCA 2IGFL 3WFEL 4JPVH 1NCTA 3GSVA 3ULVF 1NMBL 3LMJH 2F53A 4K55A 4EI5D 3VFVA 2L0DA 4QHLB 5I73C 4MJ2A 2AKRB 4X83A 3MYZA 4ZTOH 3VXRE 2DQDH 3TN0A 1Q1JH 3C60A 1P4LB 1UWEH 2R29H 2FCBA 1BM3H 1V5JA 3S35L 5I1IH 3TV3L 1OB1A 2V2WA 2R8SL 3TYFA 1A6WL 1CDGA 3UTTD 1UGNA 4JRYD 1TQBC 3HS0A 3WUZA 2ICES 1KPVA 4CMMA 5SWSE 1UG9A 4OIIH 1RJZB 2FIKA 3VFMB 1YC7A 5F88B 3MOBH 3GHEH 5J4MA 1T0PB 3SPVB 1QFUL 2YMXH 3WFBH 5IFHL 1ZHKB 1OP5H 1RULH 3X13A 4PV9B 3H9YA 2P8LA 1AR1C 5FM4A 1WAAA 4QHMB 4KQ4H 4U0RC 2AJ3A 1AHWA 1QQDA 1DVFA 1OAXL 3HMWL 5D1XB 1R3IL 2IALB 5DMIL 1MWAH 3F7QA 3VRJB 3MUHL 1B4RA 1W8OA 4ZUTA 3CGTA 4MXVE 3T77A 3QHFH 2YPVH 4QOKB 4KI5E 3DPBA 4WW1B 1INQB 4K7FA 1F6AA 3EIFA 4KTEL 3WCYA 3MV9E 1T22B 4H8WH 5GGRB 3ZL4L 4I4WA 1MHEB 3RVVD 1QO3B 3T4YA 1KPUA 1MAMH 3MLXL 3BPCB 1UYWH 1FIGH 3GJFK 3AM8C 5IBUB 4Y19E 2EC9T 1HE7A 4I0PD 3BQUC 1T7XA 3SQBA 1HHKA 1JZ4A 2RR3A 4MSWB 3RWHB 3EYVA 2JJVA 3C9NA 4KWUA 3HR5A 3I3BA 1KN2H 4AENA 1JGUL 3LS4H 2MHAB 5EWIL 3V0WH 4NHCH 1QLFB 5DJCA 2Z31C 2YPKA 3QUYA 5EU7E 5T5FL 3ES6A 4GRMA 4FQ2L 1WK0A 5F9WB 2D7OA 2F54D 2XWBB 4YHPB 2ENSA 3C08H 5LQBH 3SDXB 4PD4J 1A6UH 3WN5A 3A6CH 1EBPA 1XGRB 4HXBL 4U1JB 4WI9A 2ADIA 3IDIB 1PY4A 4E42A 3MYJB 1RUMH 2BRRL 1AHWC 4JDZB 3DX7A 4OTXL 3FQXB 4KTDL 5AG8A 4O2FB 5HGHB 3MNWB 4KVNH 3OF6A 3EHBC 1A6WH 1BREA 1GOFA 3V79C 5D4QA 3PIQB 4A2MA 1AGBB 5FUZL 1EBAA 2R1WB 4XZUB 4OGYH 1N0XH 5DJ6B 5IVZA 5I73B 1BQHB 3ARRA 1GZPB 2RFXA 4CU8A 3ULUE 3DO3A 3R1GL 5EBGA 2DBLH 3HE7D 3TEUA 3ZTJG 4JFDE 4XP1H 1QFUH 4YDVA 4JFPB 1JNNH 4ZNCD 2OLDA 4M6NL 3DRQB 1TLKA 4YGVA 1A6PA 4QTHA 3B4NA 3U2SA 4PFEA 4L8CA 5DC4B 3E8UL 2VLJE 5A2IH 3HMWH 1A7BA 3MC0A 5I18H 1I7ZA 1XGQB 3QDMB 4ALAH 4HS3A 1ZS8B 5HVHB 2QADC 1U0QA 4I0CC 3ME0A 5IM7B 4FQIL 3TO4C 2YPVL 4WNQB 5FCUH 2P8MB 1OTSD 3QCTH 3VH8G 4DUVA 5I1LA 4XPBL 1OTUD 5EIIB 1M1SA 3LH2H 4PJHF 1NMCB 3KLSA 4HBCL 2NY1B 4GT7A 3MACL 3DX9A 2J88H 4KJWD 2YN5A 3H3PL 5C09D 3K8MA 2NNAB 3HCVA 1I8LC 4Y5XB 3LKNB 3G6DL 4K8RC 4AM0B 4Z7WA 4Y8AA 5GJSH 4GAGH 3QWOB 4XVJL 4XX1G 1NGYB 4NNXA 3QCVL 4NHCL 4C57C 2IH1B 3MO1B 4C56B 1XGPB 1H3GA 1SEBB 4YDIH 4RFNB 3OZ9H 5SWZB 1UKTA 2WBJC 3V0AC 1XF3B 5HHXH 3OR6A 5GRJH 2J4WH 5DJ8B 5HHMB 5I66B 4YHZH 1IBGH 1XIWC 4Z7OE 4FABH 5LQBL 3FOLB 3MTRA 2X40A 3AREA 5GRZA 5HVFB 2P8PB 2PTTA 4QYOB 5EUOA 3UC0H 3WLBA 3SQOH 2AK4B 2XZQL 5I1DA 4ZQKB 1NL0H 2YUWA 3Q6GH 5CMAA 4BQ6A 3S88H 4JRYA 4FQQB 4JJ5B 3VG0H 1MLCA 3TFKD 4JGUA 5ADPH 2HTKD 2HLFD 3FT2A 5C0BA 5I9QB 15C8L 4FQXA 5D1QA 3QIBD 2VL5A 3PDGA 4M7KL 4R4BA 1RUQL 4HIHA 3QXTA 2IG2H 5I8EB 1P69B 1NMBH 3LMJL 1N6UA 3DHMA 2XFXA 3GRWH 1FVDB 2VYRE 2UWEA 4XNYL 1A9EB 1JNNL 1ZLVH 5BO1L 4ACPA 3V8OA 4ZTOL 3EO9H 4P2QA 1RZJH 4X5WB 5CJXA 1E28A 5ICYA 2ZUTA 1K2DB 4QRQB 5CHNB 2VDQH 1VSCA 5ICZB 4MQ7A 4O2EA 4BA8A 4Y4KB 4Z76A 3PABB 3W11C 1WWWX 3ZKXC 1CICD 1E27B 1A9BB 3WEXA 5E24E 3OKLA 1JRHI 5FCUL 1IAII 3L6FA 2CK2A 5IHLB 5CBEA 4CBPA 3MOBL 5BVJB 2WINA 4G8GE 3BKJL 1L7IH 3BP5A 5DD0L 5IVXB 5HVWA 4X4XB 1K9TA 3PNWA 4ZSOB 1D5MA 5DJAA 5T5NF 1FE8L 4LPWA 1QSFA 4JM4H 3PL6C 2H9GB 1INDL 3EOTL 3KPOA 1KSRA 3SGJC 4L3CB 5GGSA 2BNRB 5J6HA 2VLLA 2EYSB 5T1LA 3OX8A 1MUJA 2A9ML 3G6DH 3QWRD 1BVLA 1DE4B 2OQJB 3MRDB 4IRSB 5E1HB 3VI4F 3WS3B 4U1LB 5EUOF 1NFDB 4KV5E 5I1KL 3IFLL 3FB7B 2C5DC 4Q74A 4KJWC 4MCZA 3VFPA 4EDXB 3QFJB 3SGJA 3IJYA 3K8KA 2MCPL 3U36B 5I1AB 2IC2A 1GXEA 4Z6AT 4DCQB 1I85A 5T1DL 4JHWH 4PRAA 2Q7YB 1MCJA 2NMSA 2YHGA 5JW5A 2OTUB 2A74A 1RUAL 4JN1L 4ZOCA 4PBVC 4U1NB 1ZSDB 3G5ZB 2R15A 4O9HL 3KPSD 1QBLH 2VLRD 4M61B 5AZ2L 2DAVA 4YBQC 1VFAB 4LCUB 4BSVB 1SJXA 2CH8A 5EU5A 1DR9A 3BIBX 3UTSA 3ARVA 5EWIH 1GRWA 3OKKB 2GJ6E 2CGRL 1U6AH 3GIZH 1RHFA 5CD5D 1DL7L 4U3HA 1YJDL 4XHJD 4K23H 1LD9A 4S11A 2ICEA 5DURB 4M48H 4MD0A 3OG4B 4Y1AB 2R1XB 4PJXF 4UT7L 4JM2A 3EDDA 3UJJL 4KMLB 4HXBH 3SKNA 3ZE1E 3MNZB 4W81A 3OAYK 4CMHC 1RIVH 1EFQA 1MPAL 4M02A 1DQDH 2XRAH 3WKNA 5IT2H 2G60L 4OLVH 4OTXH 3D48R 2Y7QA 5E2VL 1Z5LA 1AQDA 2EYRA 1J5OH 3HLAA 4OCRH 1JWMA 3L3DA 3QUMB 3K3QA 3RIFK 1FFOB 4LLVB 2PXYD 3QXUA 1AO7D 1REIA 2NY5H 2YKLL 2YRLA 3C5SA 3V6ZA 4RGNC 1AC6A 3BD4A 4FN0A 4J3XA 1F4HA 4PRNA 2BNQD 4UTAL 1OSZB 4YFEA 4EBQH 4UNUA 4CN4A 1Q0XL 1RK1B 5GGTA 4OCSH 2Q76A 3VXSD 2CLRB 3FAXA 4PRHD 3LN5A 1Q0YL 4OZFB 2CDGA 4HGWB 2DLEA 1QBAA 4MNGB 5FDWA 4M7JH 3RY5A 3OAUL 1FLRL 1WLHA 1K8IA 1FG2B 1XCTA 2XG5A 1KJVB 4WO4A 1K3IA 3IDJA 3ZE2F 1AFVH 1C7TA 5EZLB 4RGND 3IFLH 5E7BA 3VXQB 4X80H 1T1ZA 4YUEL 4FG6C 3DBXA 2E6JA 2X4OB 3NCBB 1NGWA 4V2CB 5BCAA 3GMLB 1AKJB 1EXUA 2LU7A 4L4TD 2O93L 5GQBA 4APQD 5BXFB 2FX8L 1P2CA 5D7IE 4U6HA 1H3XA 1J1PH 5CEZH 3IKKA 3MRCA 1ZVYA 2IADB 1IM9A 4ZS7H 2A38A 4JO2L 5HI3C 5HHOA 1CCZA 1U92A 4O9HH 3SJVE 3GIVA 5BZDA 3RWGA 4P5MA 4XNUH 1G7LB 5ETUB 1RJLA 2HFEA 4KK6C 3LN9A 4M93C 4XVJH 4Y4HB 1T5XA 2KKQA 4KKLC 1YPZF 1JPST 1DFBH 5J0BA 3RNKA 5C0JB 5EA0L 3S96B 1H3UA 3MRNB 5FV1L 2W9EL 4KK5C 4QRTA 4PREA 4RZCB 1BLNB 4YFDB 1BD2D 1L0QA 5IF0B 5F7YC 1U8MA 4HX1B 4JQIH 4XWOC 4L8SB 1PG7L 5DFWH 2BNQA 2Y36L 5ALBL 1RIVL 3NTCL 3DO7B 1S9YA 4OBRA 1YECL 5IVXF 43C9A 5CLWA 1FNAA 4KDWA 3WS6C 3DVGA 5I1JL 4WWKA 3VG0L 3PHOA 1OAQH 5B21A 1RZIA 1GGCL 2GTWA 2XPGA 4M1GH 3J7HA 1F97A 3K2UH 1ZXQA 4YQXH 1IGCH 1JWSA 1WFNA 5GSVB 4A6YH 3IGAB 4H26A 1A1MA 5LWYL 1PD6A 1JHTA 4PJFA 4OF7A 1OGTB 1NFDF 2C4FU 3QXVA 3QDJB 3G5XA 3EDFA 5BO1H 1TDQA 5GXBB 4JZNB 5HJ3B 4WY7H 1B6DA 1Q0YH 4PR5A 4MMZC 2BNRD 4PJGA 1AHWB 3OAUH 2C3XA 2GSIB 5DD6B 4L3ED 3SBWA 3BYYA 1EEUA 2D3VA 2P5WD 2ZUUA 3PWVA 2H41A 1A7RL 4S1QH 2EXWC 4RMQA 1XF2A 3TH3T 1GC1H 1VPOH 4R97B 4JQXC 3LSOA 5DJDA 5HYJD 5JORB 5K9JL 5F9JB 1QO3A 2F58H 3B43A 4X7SL 4UINH 4G7YL 4AIZA 1A1OB 4HDIB 3H6JA 3VXNA 1WBZA 4DQOH 5EO1A 2HA1A 1E4XI 2EYTA 4B41A 5B4MC 1P5UA 1TNMA 4WHTA 5HGDA 9CGTA 3GUTB 3HG1A 2W60A 1N7MH 3B9AA 4TSBL 1U8KB 1MFEH 4Y4HD 4Q6IC 5DR5H 5ISZE 1KXTB 1QPPA 2PXYC 3IVKA 2DD8H 4GW5A 2ZSWB 3GSNA 2APTA 5JDSA 5ABDE 3IS0X 2VRAA 3FQRA 1BX2A 1JGLL 4GKSA 3GJEB 4MLIA 3RUGA 5GS0C 1R5WA 1QLFA 5CJ8A 2YPKB 8FABA 3UDWC 1Z0MA 3RHWF 1AD0A 5T3ZD 4CADA 2R56H 4APQB 1XF4A 3AGVA 1F2XK 2C7UA 2QQNL 1BF8A 4JCMA 4XTRD 5CZKA 1AE6L 1GOGA 1PG7H 2AABH 5C0AA 5F6HI 4Z7OF 4PS4H 1UC6A 5AZ2H 1ODAA 4ELKB 4MA7L 2IAMB 3QDME 4XMLH 1YN7B 3UROR 5F1IB 4JFFB 3VFOA 4ZO8A 4M4PA 3RY6A 5JW4M 4KZDH 5EUKA 2P48B 4WFEE 3PP3H 4E0RA 1FC2D 3BDYH 2EDQA 2YRZA 3ROOB 3PIQA 2AW2A 3I9GL 3LQAL 2W07A 2A2QT 3HRZA 2AVGA 4M48L 3QPQD 3ROLB 3OMZA 5ACZB 3QZWA 5KANI 2B5IC 3VXTB 4YDVB 5E95B 5EU4B 4JR9L 1NBVH 5EO0A 3UO1H 3F5WA 3IU4L 4FTVD 3FFCB 4N0CD 1DQDL 2XRAL 3T3ME 3IFPA 4F57H 3RIFF 3H42H 1BF2A 3O6ML 3VCLA 4EXKA 4RDQG 3TNMA 5C7XH 5IG7B 5CCKH 1TETL 3W39A 4MJIA 3BFOA 2YKLH 4YHOH 3F12A 4HKZB 3SDXE 2DRUA 4HWBA 2VERN 4UTAH 3U9PH 1U8PB 1NC4A 3VWKD 4P9MH 4PJIE 1ZT7B 1RQ5A 4QRRB 2GJ6B 1YPZB 2W91A 3H9HA 4LSQH 1HYRC 4AMKH 5DURD 3JWDL 1A6ZA 2J6EA 1YEGH 3GDBA 4P2OD 4Y2OA 1T21B 3SE4A 3MA7B 1DN0B 4L4VE 4RAUB 4XCNA 1J9CT 4NFBA 1QSEA 1RUPL 4S1DD 1S78C 5FGCE 3U83A 1LILA 1HYSD 1G0DA 1K4CA 1LE5A 2DF3A 4YX2H 1CQKA 1OF2B 1P1ZA 4ODWB 2FATH 4JJHA 1DEEB 4OQ1A 3VI4E 3MFGB 2I9LA 1HIML 2CK0H 2IH1A 3MO1A 3SN6N 3ULVC 1T20B 1MCFA 1FFNB 1ZT1A 4KKNA 4ZS6C 5EN2A 5TH2A 4QHKJ 3OJVC 3QDGA 4R26H 4FZ8L 3BDBA 3REVB 3FN0H 3RWDA 3WXWH 3TBVB 4JB9H 3GSWB 1CXKA 2ZCKH 5IJVB 1NC4D 4WFHD 2AEPH 1EAPB 2R8SH 1RHHB 2C1PA 1I3RB 4GBXC 1WCBA 3WLBB 5I1DB 5JQ6L 5B4MD 3DUSA 1GGBH 5DZLA 1I4FB 3DETD 4I5BA 2UVEA 4J2XA 3JZ7A 4TVSa 1JHKH 2FR4B 2BCKA 3HG1E 4PYHA 3ZDYF 3JTTB 2HVJA 1R3KA 3DMMB 2YMXL 4XX1E 4GO6B 3HZYA 1OLLA 2VL5B 3C09B