3N1GC

Crystal structure of dhhn bound to bocfn3
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
ERPVAGPYITFTDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDKYWHSISHLQPETSYDIKMQCFNEGGESEFSNVMICETKARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Desert hedgehog protein
publication title All mammalian hedgehog proteins interact with CDO and BOC in a conserved manner.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 21
structure length 104
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3n1gC01
3U9UB 2VYRE 3MBED 4GAGL 4R8WL 2FLBT 4WJ5B 4OZGE 5ITBL 5I1JL 4M6NH 4MJ4A 3BN9C 1FGVH 1SYVB 2M1KA 4L8SA 3RI5K 3CUPB 3REWB 5JZ7C 1CDHA 4AK1A 4APQA 3ROOA 2DJSA 4N0RA 4LLMB 5DD3H 1CK0L 3VGAB 4QHNA 4JG0H 2BRRH 1D6VH 2PXYC 4DJMA 3QO0B 5DUBB 1BPVA 1MQKH 1A47A 5ID0B 4TRPH 1SBBA 3ARVA 3X3FH 5C6TL 3PL6C 4Q97A 5FO7B 5IV2A 1U8PA 2EDOA 4BQ6A 2V5TA 1D5IL 2QHRL 4X7DC 3LH2H 5KJRL 5D71L 4N1HB 5CILH 7FABL 4U2YA 5I16A 1HXMA 3BGFB 3SGKA 1MAJA 5E70A 3WXVL 1FG9C 2R1WA 5C0BD 3KAAA 3RY6C 4EBQH 5DURB 3VG0L 2BVUA 5GGVY 5CFHA 2C7UB 1YEFL 1OAXL 1QSEA 5CGYD 4LHJB 4PS4L 3EO0B 3WNOA 2JLLA 3E8UL 5I66B 3S37L 2ID5A 3OB8A 1DLHB 4RIRA 4JY6B 1OTSC 2W07A 1IEBB 1NAMB 1RZJC 1I3RB 1M05A 1G9NH 3D2UB 3HE7B 4ONGH 4NOBA 5T1DL 4QHMA 3DMMD 3EYUH 1KCVL 3QIWA 5TF0A 4WJ5A 4V1DE 1S7XB 4NWTL 3UBXA 4NDMA 5DMKB 3PWPA 2XZCH 4NC1E 4PV9A 3MSPA 1JHTB 3KLAB 1I8LC 3T3PF 3REWA 3SDAC 1EEQA 3CXHK 3JV4B 5CKGA 3J7HA 4JRYA 1CICB 4HV8B 4OF5A 1Q72L 3NACH 1JPFB 1Q0XH 3S36X 3DHMA 3PGDA 4K9EC 4NN6C 1URLA 5CP3A 1T5XB 4HAFA 4CRPA 3DXAB 3QIUB 3JWDC 4HCRL 4LEXL 5ID0A 4P5TB 2XWBB 4Q6YA 4YLQT 3O2DA 1ZT4B 4ERSH 2G2RB 2Y36H 2XKSA 3MRRA 5B39G 2VXVH 3VFVA 4IRJB 5HSFA 2COQA 3D25A 3KYMA 1RZKH 2HVJA 4XVUD 1B0RA 5F71A 5HVGB 4TNVF 2ZP0T 4RFEB 4JQVC 3KPMB 3U30B 5I1EH 2MKWA 2XWTA 2HT4C 3MXWH 4YWGL 4NZTH 1NCCH 5FYKU 1DQJA 2CMRL 4YDIL 1FFNB 4BUHA 1RJLB 1SJEB 2VTFA 3KR3H 1KNOA 3EO0A 4OM0L 1A3QA 3FKUS 1I9RH 4OV5B 4N0CD 1OSPH 1IEBA 1I8IB 3T0ED 3PIQB 5BO1L 3STLB 2P46B 4P46B 2DYPB 1QNZL 4ZAKB 4PV8B 3QQ3A 5GIRA 1FAIH 5HHVL 1I8MA 3FN0L 2N56A 4NPYB 5D7SH 1J10A 1JHTA 2PYEB 1CIUA 4WTWA 1V7ML 3B2VL 3QRFM 4L29B 3NCJL 1MRCH 3L5XL 2R23B 2Z8WC 3JV4A 5BV7L 5D72L 1I75A 1CICA 3D39D 4NZJA 4KKAC 1RJYB 5FYKD 1IMHC 5F89A 2B0SL 1JPFA 3O3AA 2B1AH 2D7PA 3DXAA 3U0WH 2OXGA 1KCKA 1A14L 3BFOA 3CC5B 1DVFB 4OCWL 4P5TA 3BKCH 4RISH 2JIXB 2OTUA 2ATPB 2GIYA 1U2HA 3WEXB 2P8MB 2G2RA 4JQIH 3TYGH 1ODAA 3HN3A 3LEXB 3WXWH 4F9PA 4KTDH 2KZ1B 1XCTA 1HYSC 3ZHKA 4IRJA 4WO4D 1A6AB 4Y4KA 5EBWA 1J18A 4K94L 1FFPA 4LPXA 3NZHH 2YSSB 5KTEH 4LSPH 1K8IB 1RJLA 1BQSA 1SJEA 1K4DB 5GJTH 5C0BE 4A2LA 3JTTB 4G9DA 4KY1L 5FGCB 1MCKA 1FFRA 4W6YB 3T1WA 2X2YA 2B1HH 3ZDZF 5GRXG 5B3JF 5T5FL 1UWEH 5DVKA 4PJ9D 3O2VH 2AJ3B 2BVPB 1CLYL 3ARPA 4ZAKA 4PV8A 5EO1B 1DUYB 2FB4L 1JGVH 4NPYA 1FH5L 2FD6H 4RNRA 4MCZA 4YK4C 4PJAF 4LCIH 3ULUD 4HEPG 2R23A 2VZTA 4CAGA 5IHZB 2E7LC 1P7QA 2CLZA 1TPXB 1MJ7H 1N6VA 5D1ZB 4P3WA 1R24B 5HHOE 1LO5B 1JMZA 4KZDL 5F96L 4FQ2H 1IQWL 2JIXA 5TDPB 3UP1A 4XMLL 4IRZL 1KXVC 3WEXA 3V52H 1XR9B 5CJQH 2EDJA 2YUZA 4TSCL 4X6DF 3HAEG 2GW5A 2R69L 1U8HB 1A6AA 4C59B 1II4E 1UWXK 3LD8C 3U82B 3HI5L 4PD4K 2YSSA 4PJHE 4RA0C 4LPWA 1KN2H 5T33H 5D7LD 5JZ7D 1A3LH 1NCTA 1UKSA 3D69B 3N85L 4TTGA 3TVMB 1ZKAA 3TO2A 2PXYD 2ZPKL 3WBDA 5JMOC 4DUWA 4JPWH 5ERWA 2VLKB 3CVHB 4O5LH 2FR4B 5DRZB 2AJ3A 3PL6D 4GMTH 5LBSH 2ZCKH 4MJ6B 3KXFE 2BVPA 4XBEH 5E6ZA 2X4UB 5EFIB 2DL9A 3HI1B 4D0BB 5KVMC 3E6FB 3VI4F 1OM3H 4PJGB 2H2PC 4IHOA 4KVCH 2CKBA 4S1QH 3RGVC 1X5FA 1DJSA 4KKBC 5CUSL 1IC7L 4OF3A 43C9A 5IBLC 4LASH 4HWBA 5FK9B 3GNMH 4Y89A 5KVDL 4ZFOA 1FNLA 4HXBL 1JHKL 1OTSD 5GGUA 1FVCB 5IBTH 1RV6X 4NZUH 5TE6H 3NZ8A 5B4MC 2IANB 4QXUL 5H94B 4F7EB 1ZSDB 3LIZH 1LDPH 2HN7B 1OLLA 2D9QB 4XVJL 1F4AA 3MV7A 2XKNA 3BP7B 5ICZB 3VRLE 3BRFA 1K5NB 1KJ2B 1A7BA 5F7EL 4LLAA 2D7NA 5GQBA 5CEYB 2VE6B 3GIVA 3L3IB 4XPGH 4OI8A 2QSVA 3SDAD 3DRTA 4RFNB 5GISL 3D69A 5F1SA 5ACZB 2IQ9H 3TVMA 5M94B 1IGYB 4EIGB 2BY1A 2DMBA 1J1XL 1U6AH 1CR9H 3WL9B 4AYFA 2VDQL 2Y9RT 1IZKA 1K2DB 2R2HB 2WQRA 3QG6B 5EFIA 4NUJA 3M45A 3NFNA 3OKOA 1H8NA 3L5HA 4D0BA 1KGCE 4LK4A 4LAJH 4ODWB 4N8CL 1PZ5B 3U79A 3IDGB 1W72A 3E6HA 4PJGA 5DVLA 1N8ZB 1JF1A 4ODUB 4PG2C 1NGQH 2HT4D 3QPXL 5KSAC 2ZUTA 1OGAD 5HGAB 4IMKA 3T4YB 1DQDH 1IAMA 3WHXB 1G7HB 5CSZA 1PX4A 5FK9A 4EDXB 3O9WD 5AZEL 4MCYB 5KZCD 2E27L 1X5AA 1U95B 2DQFA 4X4MA 4NCC2 5JQ6H 5I2IB 1FVCA 3MR9A 1PG7H 4JVWA 2VAAA 2IANA 4PJDA 3STBA 4QYOB 5H94A 2CJUL 4F7EA 1ZSDA 1WQVT 3QFJE 3E3QC 3X17A 2HN7A 1QFWM 4NC2B 3T8XA 1NFDE 4EUPB 4QOKB 2E9IA 1SY6A 1Q1JL 1YMMD 2VE6A 3RL1B 2HKHH 4RQQA 4XRCB 3BQUB 1NCWL 2PTUA 4KDWA 5CJBA 3VD5A 3RIFK 1I1FA 3NCBB 5CD3A 4KKAD 4FQIH 4NQCD 1A5FH 1RIVH 3EZ8A 2OX5A 5C9KA 5SWQB 5D7JA 5D7LE 4WFHE 4MA7H 4ELMF 1CL7L 2H3NB 4HZLB 1U8MB 1UM5H 1OAQH 4B41A 3BP4B 4MA3B 5L2KD 4WI2A 1K2DA 1TQCB 3NABL 4U1IB 4WIQA 2B39A 2OJEA 3AM8C 2VL5B 3OBAA 1HYSD 2YPKA 4LRNL 4YHLL 4FNLL 1KTRL 1EO8H 4HUXA 5FYLE 1EEZB 2DQDL 2VZ1A 5FF6B 1K8DA 1YEIH 4O2FB 2DQHH 5K59E 4OZGF 2HVKA 1FYHB 4PD4J 2V2TA 1VGEH 2VLMD 1DBMH 2IALB 2JTDA 3FQWB 3T4YA 4G8GD 4FZEH 1G7HA 4MNGE 4MCYA 4NCC1 2B2XL 2ZCLH 3FT4A 3S96A 4MQSB 5I2IA 2RCSH 1NL0H 1YNLH 1BBDL 1N6UA 1G7IA 1CLZL 1RU9H 2ADFL 3U83A 3CU1A 3VGGA 3RUGF 1H15B 3JVGC 3U6RB 4EUPA 4QOKA 3RA7H 5CHNB 2GJZB 1NH6A 2H6PA 1RHFA 1EO7A 5IEKA 4TSAL 1LEGA 5DQ9B 3UTTA 3MLUL 4H26B 4LGRB 1NEUA 1RIHH 3P0GB 4BZ2L 1RK1B 2CDEB 1OTTC 2BP3A 1QO3A 2YD7A 4PGEB 5TQ2H 2H3NA 4HZLA 4FP8L 1U8MA 5FOBB 4MA3A 4GT7A 4EN3A 3GSVA 3KYKH 4DKEH 1ND0B 2IPKA 4O00A 1NCUA 4JDZB 2VL5A 4OUUB 3SOBL 3FN3A 4X99B 3RBSA 1CF8H 4DW2L 2DWEA 4A6YB 2R1XB 1QPPA 3OKLA 3TT1H 4PRIE 1J0KA 1AFVH 3MROA 3MJGX 5IKCB 1KFAL 2OBGA 4HG4J 4JFFA 2IALA 4FTVB 2K3TA 5HD8D 2LU7A 5SWZD 2WWKT 1LK2A 4XHJC 4XCFL 5IVXF 1OGAE 4PGBB 1RJZB 1T89C 2XZAL 3IFPB 2DBLL 1HNGA 3TA3B 3JWOH 1G7PA 4YX2H 5TH2B 4YO0A 2AK4D 3P3YA 5MEND 4DGYH 1FL5B 4OQTA 1MCEA 1KN4L 2BFVH 2C3VB 1H15A 5MHSD 3OJDB 4WI8A 2GJZA 1EO5A 5LQBH 3QIUC 3TBWB 4H26A 1G9EA 2B4CC 4OD3H 5T3ZE 5EH1A 4UTBH 1R6VA 2H2PD 3KPRE 5F6IB 2EH7L 1HDMB 4O02H 1YMME 3RGVD 5ANMB 3TJHC 4P3DA 3KPLB 1IGML 1QYGH 4X7SL 1QVOA 1LD9B 4KKBD 4PGEA 1I7RA 4DKDC 5IBLD 1IFHH 2DIJA 3VD3A 3MLZH 4U0QB 3U9PH 4RMWA 3VXMB 3U30C 1RHHB 5MEOB 4G6FD 1JHLL 2X5PA 4G6AC 1H3GA 3WFHB 4TYUA 2HJKB 3GSQB 4OUUA 5B4MD 1SJXA 4X99A 2JCCA 1ZLVH 1XIWB 4JZNB 1F90L 3RU8H 4G9FA 4WV1C 3RVVC 2VWEE 1FGVL 4WW2F 1NC4D 4HK0B 3MRPB 5IKCA 4U1MA 1BP3B 3KYNB 2YBRB 4P46C 3F5WB 4NYLB 1NKOA 1QSFB 5F9WB 4DEPB 4HKJB 1BFSA 3LN4B 4PGBA 4JEGB 1D6VL 1WWBX 3IFPA 3O3DB 1GZPB 1MCPH 3X3FL 3RL2A 3FCTB 3MA9L 2ADJB 4YDVA 4Y2DC 3T0DA 2UWEE 5DRWB 2VIRA 5F3BB 2IPTH 3LH2L 2AKRB 3MV01 1HZHH 4R90H 3OX8B 3TBWA 1IGJB 1DVFC 4GH7B 1UXWB 1DL7L 2AEPH 5C0GB 3FQNB 4EBQL 1UM6H 5HGBB 5KSAD 4ZTPL 1S7WB 5E24E 4PJBB 1MUJB 3MLYH 3W9DA 2AEQL 1OAZH 3FOMB 3EO9H 3OB0H 4JJHA 3BOVA 3OKEA 1J1OH 1W8OA 5ETUB 2ITDA 3IRZA 1BVLA 4NGHH 1BBJB 5DZLA 2Y06H 4PYGA 3WLBB 4JKKA 1A1OB 1OSZA 3GSOB 3HKFA 3EYUL 4JZNA 5F8RC 1ES0A 5E5RB 3V6ZA 4KMLB 2XZCL 5L88L 3VXPA 2VKWA 5CAYB 4LQFH 1UB5A 2P8PB 4X0KA 1OAKL 2W9DH 4LGPB 3VWKC 1YC8A 5E2WL 1XF4A 4KXZH 3HG1E 3F5WA 3VXQA 3ESUF 3NACL 4L9LB 3WLWC 3CVIH 3BIAX 1C1EH 1JI2A 3OXSB 4LVOB 5IBUB 5EO0A 3LN4A 1QD0A 3O3DA 1XH3A 3PP4H 4P5MA 1GZPA 3HA0A 4EVNA 3OWEA 4HCRA 1J8HB 3CIQA 5DC4B 1FYTA 1IEAB 4OJFH 4ODVL 4PJIE 4DVBB 1MFDL 4ERSL 1VFOA 5DRWA 3BUYB 4RDQG 5F3BA 1CDYA 4JM2A 1PGRB 4L4VE 2DQTH 5J13C 2UVFA 4U1KB 4UNTA 1CFQA 3LRHA 5FYJH 5C0JB 2AK4E 5DQDH 5IVZB 1ZHNB 5ID1B 2H26B 3E0GA 1GAFL 1WJ3A 3BPCB 3FQNA 1U8QB 5JOPE 4NZTL 5HGBA 1XF1A 1AIFB 3LQAH 1S7WA 5DSCA 3U1SL 4XAWH 4PJBA 3ZYIA 1WBZA 4LCCC 1T0NB 5ETUA 5C0AD 1GZQB 2PR4H 1NCBH 4NRZA 1U3HB 2X1XR 5EOTB 4Q9RL 1D7FA 4Q9QH 4MNHA 1A1OA 3V4UL 3JXAA 2XYCA 2VXQL 3MV9B 1CD1B 4F7TB 5HVHC 1QFWH 4JVUA 1HSBB 2Y07H 1FAIL 3PWJA 4UUJB 4DN4H 5KW9H 2WP3T 2IAMB 4R7DA 5D7SL 4I0PD 1SMAA 2EEAA 4B7LA 2GSGA 1VDGA 4L9LA 2AXHA 1X3DA 3EFDH 3OXSA 5GRVK 2ADIB 3FB7A 2EDYA 2Q76A 1T2JA 4S10A 4QNPF 3KNBA 1VB9A 1J8HA 4J23A 1MI5B 1JIBA 2G5BA 5TE4H 4ONHB 5D1QB 5DURD 3BUYA 3WXWL 4LDEB 1EXUB 4OIAA 4U1KA 3VFNB 4AIZB 4GG6E 1QLFB 3LCYA 4OZFH 5IVZA 4Z7UA 4YXHL 4EJ1C 3EDKA 1KOAA 2QQKL 3GK8H 1F6AB 3BPCA 3INUL 4HGKC 3OAYK 4G6KL 5KTEL 4BH7B 3MOQA 3TPKA 7CGTA 1QBMH 1B3JA 2VERN 4WRLA 5CSBA 3F6IA 3GMNB 3TNNB 4XHJD 1H3PH 4HH8A 1VESA 5I30L 2WIMA 4NKOA 5CGMA 4X6BA 5EOTA 3KPNA 2B1HL 5DTFB 1Q9OB 4AEHH 2J88H 4L3AA 1A7RL 3VXUB 2YA1A 2X4TA 4PPTA 1ZV5A 4YDJA 2BVOA 3HC0A 1HSBA 1T0MB 3GSNH 5E94B 4U1SA 3MGTA 2IAMA 4I8DA 5EZIH 5TFSH 5C8JB 5IOPA 1F4WL 2DQUH 5BS0D 2VISB 3E3QE 3K80A 2HJLA 2J5LB 4XCEB 5CEXA 2YK1H 5D2NA 1CDIA 5J9PB 4OB5H 1DEDA 2R39A 4K8RC 3TYFB 3TJHD 2ICCA 3ULUF 3TIDB 3SJVB 1GPOH 3UAJD 1UVQB 1FVDB 1JWMB 3F12B 2AI0H 1FDLH 1OQOA 4CN1A 4MAUH 5EOCJ 3CU7A 4KJYB 5MI0B 1MCHA 4OGZA 1UCTA 4N0UB 3V52L 5FECB 1KSRA 1IM3B 3BN3B 5D1QA 3H3KA 4G6AD 3VFNA 4AIZA 1QLFA 4PGJA 5A2JH 3DJ9A 4JDTL 3TV3L 3F7PC 2NPLX 3RVVD 1CG9A 1F6AA 3O4LE 1FZOA 4UBDC 1ZOXA 5T33L 1OD7A 1OAUH 1S7SB 4P46D 5DJZA 2KQMA 35C8H 4LHUB 5C86A 5CLWA 2GTWB 3GMNA 2ZG1A 5DJXA 3VW3L 4LIQH 3PP3H 1CXLA 4G8FB 3VFOB 4LCYA 1Q9OA 1FORH 1OL0A 4NO3A 4O5LL 4F33B 3DNKA 2AJZB 5HYSB 3BQUC 4GMTL 4Y2DD 2BOCA 4S1SL 4I3SL 4RMQA 2BC4B 3THMH 5DFWH 3MLVH 1Z5LB 4Z7WB 3X12A 2BNQD 4JFED 5C6PB 1EHNA 5K59F 4XCEA 3CSPA 2BY0A 3MCKB 2R0WL 4S1QL 1S7UB 1HE7A 1VFBB 2F53B 4FQCL 4JKPH 3D9AL 5EU5B 5FYKH 1IAII 4LASL 2FX7L 4ZUTB 3GNML 4KGJA 5E6IB 5AUMB 5B8CA 1UWGL 3F12A 3VXOA 4HX1A 4CVXA 1V7NH 5FECA 4N0UA 1IM3A 1OP3H 1VEPA 2YUVA 5CBAA 1ZVHA 4EDWH 3UJJH 1UYWH 5I6XC 1EHLL 2AW2A 3S88H 2VQUA 3QEQB 4WFFE 5E5UB 4P3CH 5DUML 3Q6GL 3WFCH 1AGCA 2Q8BL 3LB6C 2IEPA 3D3VB 5CJ5A 1F2XK 3VWKD 2I9TA 2ARJQ 2BCKB 1S7SA 1INDL 4OUOA 2GTWA 1AQKL 3SHSA 4EOWL 2Q87A 5HXMA 3B9DA 3WLWD 2OR9H 3JWNC 2IQ9L 4X83A 3JV6A 1JGDA 1U6AL 4HAGA 1CR9L 4R0LB 3VFOA 4KFZC 5CJ8A 2W1NA 4F33A 1GSMA 2AJZA 1X5JA 5ESQB 5AYQA 1HCVA 4UV4L 4LCWB 2DWDB 4F7PB 1CDJA 3V4VH 2YA0A 1LE5B 1U91A 4U6VH 4WI9A 2BC4A 4XHQA 3DGGA 1ZT1A 3S4SA 3G04A 1JGUH 3QI9B 1JBJA 1NGQL 3B9KA 3GI8L 3TO4B 1J0YA 1OWRM 1TVBB 3DXAE 1N4XH 1QRKA 1HXYB 4KI1A 2F53A 5CZVH 2QSCH 3L5WB 1NMCC 3FT2A 1QFUL 5E6IA 2FIKA 2YD4A 1WT5A 2L4OA 4C56D 15C8H 3CH1B 4KJPC 4R7NA 5JQ6L 4WTZG 2QBWA 2BERA 3IVKB 4LAQH 1ORSB 3H0TA 4YR6B 3HCVB 2D7TL 3TN0B 1CXIA 1JGLL 3WFBH 4P59H 2YUWA 3MACH 4FZ8H 1QR1B 2APXA 3QEQA 1C12B 2VMFA 1RZ7H 1LP9B 2KL6A 4KRPD 3D3VA 3MOAH 1LO3L 4OI7A 3DVFA 1VFMA 4NM8L 4OKVA 4ODTL 5E00A 1C08A 3EYSL 3IDNB 1A5FL 1RIVL 4WW1B 4U6XB 5IMLA 4MA7L 4IRSD 3D6GA 4R0LA 2FECL 4Z78B 1OAQL 4FXKB 5IIEA 1AO7D 3KPSB 3BUTA 4QGYA 2HRPH 3IJHA 5F6IC 4LCWA 1AXTL 5D1XA 3B6SB 4F7PA 2PYEE 3I9GH 3FRPA 4UILL 4WGWB 4GW1B 2HT2C 4AM0A 3NIGF 5JO5B 2VUOA 3G9VA 5ECJE 4KZEH 1G7MB 2DQHL 3FTGA 2ED7A 3OXRB 4PRNB 3K1DA 4I3GA 8CGTA 4CW1A 1VGEL 1KBGL 1HXYA 1DBML 1AD9A 1MCQA 4FZEL 3RI5F 1X5LA 1OW0C 4MXVF 3ZE0F 1XIWC 2XA8L 2CRYA 2ZCLL 2OL3L 5ACLA 4LRIA 4X5LA 2NY4B 4PUBH 1AD0B 4WUKH 1ORSA 3B5HA 5EZJB 2FATH 1H5BB 3HE6A 3X3GH 4ZPTA 1NL0L 1YNLL 3TN0A 1J12A 5DEGB 1RZJH 1KIPA 2UWEF 5I0DA 2P7TB 1RU9L 5F9WC 4KK5C 5T3XH 2Z0BA 1BQHB 4NQDB 2CGRL 3ARYA 5CIPH 1M7XA 5MP6H 3STZA 3V4PL 4KKNA 3IDNA 3D0VB 5FGCE 3M8OL 4C57C 2EE2A 5JPMB 1ADQH 2XRAH 4K8RD 1XF2B 1NFKA 5EWIH 3I2CL 1GCFA 2IFFH 3IDXH 3HPLA 1V3MA 1UKTA 3R8BB 5IFJA 1TJGH 32C2A 4TVPE 3KYKL 3QCTL 2GSIA 1F4YH 4PP2B 4XT1C 5HGHB 2Q7YB 2NYYC 2E7BA 3V5DB 1KB9K 2KH2B 3O6FC 1G0DA 1IT9L 3SE8H 3SKUD 3Q1SL 3T65B 4D9QE 5JO5A 3DGCR 4I9WE 1NGYB 2OR8A 5HYEA 5D93B 3RP1A 3WS6A 5DDHB 4PRNA 1AFVL 1X9QA 1HHIB 3S34H 3U4EB 4R4NC 3WKMH 3RX8A 3FO9B 3GMMB 4X5XB 1AHWB 2V5RA 5DJ2A 4Y88A 3FMGL 2CRIA 4X6FB 4OM1H 5FGBA 1HEZB 5CEZL 1HYRC 1MJ8H 4QRPD 1B4RA 2DLIA 1CU4H 4YX2L 1A1NB 3LN5A 1ZE3C 3P0YH 2MCPL 4XPBL 1H5BA 1B2WH 5DEGA 3SE9L 1HQ4B 3BQUD 4P49A 2CKNA 4MD4B 1HHGB 2BFVL 5KANI 4LVOC 5HI4C 2B7DT 5B22A 3T2NH 1KPUA 2I07A 4CVZB 1LEKB 4OD3L 4MQ7B 2R29H 5F6HJ 4XCYB 3D0VA 5KSBB 3BP6A 4JG1H 4MYWB 1QYGL 2VLKE 1RZIB 4RGMB 4BSWB 3ARTA 2ORBH 3O3BA 2VZUA 3KYOB 5DZOA 1M7DB 1OY3B 1SM3L 3U9PL 4PP2A 3UEZA 3V5KA 4X6EB 3D1MC 5HGHA 4ZYKA 4M5ZH 3VMOA 3CFIC 4BYHA 1S8DB 4PJGE 3T65A 3GIZL 1NGYA 3U4BH 3LB6D 5I1IL 1KEGL 2DD8L 2DI8A 4AENA 4MB3A 3FO9A 4XZUB 4X5XA 4MAYB 4XXCA 1IAOB 4ACPA 2MQCA 2D03L 3EJYD 3JUYA 1HEZA 4JRXA 4L3ED 4X4ME 3MNZB 1F11A 2X1PA 4Y5XB 4YDLB 1XGQB 2W9LA 3HUJB 4XNUH 1C16B 3CDFA 2IANE 4NBXB 5FAAA 3BEWA 4G43B 3SKJH 4F57H 1KT2B 3CX5K 2J8OA 5IFAL 1LO0H 1Q0YL 1HQ4A 2NZIA 1TTUA 2VDOL 1HH6B 5TQ0H 1DN0B 4PJXA 4ETYA 2W38A 3QHFH 1G7JA 1HZHL 4R90L 3QPQC 2WWKO 3W2DH 5BMFL 3U46A 4CVZA 1K3IA 1KJMB 2YPLD 4MQ7A 3L1OH 4XCYA 2Z8RA 1UM6L 5KSBA 1GXEA 1C5DB 1CXHA 5B38B 2WBJC 1IL1B 1FJ1B 3MLYL 3N1QC 3QDMB 2GT9B 4F58L 1OAZL 5B3NA 4UQ2B 3VCLA 2DM4A 3EO9L 4RGOH 3KYOA 4M62H 4NIKB 3C09C 5E2UL 2NCMA 2AJSH 2YUXA 3HR6A 3UJTL 3PWVA 1M7DA 5JIIA 2IPUK 1ZLUK 4I2XB 1MQ8A 2H32H 1MFAH 4H88H 4NWUH 2HH0L 4KJPD 1EJ6A 1MREL 2QADB 5J1SC 2LAAA 2Y06L 3BJLA 5KVEL 3GMOB 4M7LL 1Y6NR 3BWAB 3PNWA 5ICYB 4PTTB 4UMGA 4D3CH 1MIML 3IU4H 5HVWA 5HYIA 2FH8A 3EOYG 4NBYB 2PTTB 3CSGA 2Z4QA 4NZDA 1HSAB 3QWOB 4QTIL 1KB5H 4XZUA 1HNFA 4AZ8A 2NLJA 3QDJD 4NBZB 3CVIL 1C1EL 2Z92B 4Y5XA 2P1YA 4PY7B 3PWNA 5E8PB 4QHKJ 1KJVA 4M02A 3NFPB 1KT2A 2HFTA 3D85D 4OJFL 2J5LC 4ONFH 4QY8B 5A16A 4NNPH 4PRHB 1DQLH 1OLZA 4Q58C 1B90A 1HH6A 4FG6C 4QOKE 3BSZL 3QEGL 3MXVH 3DO7B 3DTXB 4YAQB 1MCNA 5CBEA 3MOBH 3P4NB 2BNRB 1KJMA 3TCLA 2QV2A 3QUZB 3V6OC 1T1YB 5KSVA 4WWID 3VXMD 2DLEA 4MD0B 4D9RD 3U0PA 2P49B 2YN3A 4O4YL 4RRPA 1YDPA 1PZUB 3QDMA 2GT9A 4RMRA 3IS0X 3NGBB 1U93B 2M8XA 4MA1C 3NIDE 3AY4A 4ZO6A 4N9OB 3MA7B 4AIXA 1AI1H 3S98A 3S3PA 1IE5A 4Q9QL 3WIIH 4Y1AB 3GMOA 4KAQH 2QKIA 4UINH 5ICYA 1DE4B 1QFWL 2Y07L 2K1MA 3S3SA 5KW9L 4NHUB 2W0FA 5IM7B 2PTTA 3GBNL 4HEME 3RWCB 5IB1A 4X6CA 1ZK9A 1HSAA 3BPNB 3QWOA 1AC6A 1BLNB 4H1LH 4M3JA 5DF0A 2IBBA 5D8JH 4EI5C 3FB6B 2D7QA 4PTUB 1JL8A 4PJ5B 4U6HB 4Z95H 3CZFA 1XCQB 3GGWB 5IMOA 3K7UA 5E5MA 2VITB 1FO0H 5KAQG 1S78C 2YRPA 3HZKB 3QJFB 3EDJA 1PSKH 1OAYH 3RPIB 2VDNL 5IHUH 1UKQA 1IGCH 4JO1H 3WDIA 1MWAH 2NYYD 4J4PC 4U1JB 2WZPD 3CX2A 5D7IA 3O6FD 2NY3C 1OCWH 1CFTB 3EDFA 3DTXA 4YAQA 1NAKL 5C0CA 3DO3A 4HLZG 3EYQC 5ISZA 4KKCC 1NANI 1T1YA 3LKOB 4QRRA 4Z7QE 4R4ND 5LCVL 4TSBL 1B0GA 4AJ0A 1I1AC 3WIHH 3DUSA 5ITFB 2ZKHH 1L7TH 2JJSC 1YZZA 1AR2A 1G6RA 2CH8A 5EU3B 2Z91A 4JHAL 1Z3GH 2C1OB 4AEHL 4P9MH 4Z7VB 4IIQB 3PDOB 2EKSB 1DE4A 3EOBA 3GSNL 1S7RB 4BQBA 1NCDH 4RWHA 5HI4D 2VDKH 3VRJB 5TFSL 5IM7A 5IT2H 3FFCA 3B9AA 2P44B 3OKDA 2W9EH 4FTVE 2E6QA 2DQUL 1WIUA 3ULVC 2DQCH 3QXTA 5CP7A 3CXDH 5I15H 1REIA 1XCQA 1H3UA 3GGWA 3MO1B 3N1PC 3C8KB 3IKKA 1MVUB 3UTQA 2GY7B 2XFXB 4RX4A 5JPNB 2WP3O 3WV0A 2HKFH 5E8DL 4J3VA 4X80H 5JR1H 3I84A 3V0WH 3OR7A 3UTZB 4LSUL 3PJSA 1BF2A 5JXEC 2ICEB 1QQDB 3UTPD 4NQED 3M07A 4U1JA 5KANG 1G9MH 4AL8L 3ILPB 1NBYB 2F74B 4MB4A 1VFAB 1YEJL 5ANME 3BXNB 1W0WA 3C2SA 3PHOB 5B21A 5EU6A 4JQXA 3FQTB 1T6VN 3QUXD 3G5VB 1EEYA 2H8PA 1ZHKB 5DMIL 5J6GA 3MLXL 5IROC 2C1OA 4ORGA 2AGJL 1KIUA 3VFUA 3CH8A 3FRUA 5DMGD 2BY2A 3AREC 3T0XA 2VB5A 1JNLL 1KTLB 3I3EA 1U8KA 3I6KB 2M26A 3SO3C 3QIWC 1S7RA 4HFUH 1E6JH 4H8WC 4M4RA 2XQBL 1ZANH 3VRJA 3QPQD 3QDGA 1NDMA 2NY6C 4K3JH 3S37X 1QSFE 3K2UH 1EZVX 3MO1A 3LSOB 4PBWD 3C8KA 3NAAL 2P8LB 2WLZA 2IGFL 5J1TC 2WBJD 5DEFB 5FYKL 4ALAH 5DJDB 4PJ7A 1E4XL 4HC1H 3E2HC 2Y5EA 3BMVA 5D9SB 5HHPB 3UPRB 2A83B 2JELL 3VFSB 3UTZA 1V7NL 4LVHC 1OARL 1S9KC 5TJWK 12E8H 3RIAF 4EDWL 4MMXC 4ZFGH 2Z9TA 3UJJL 1UYWL 4PRPA 3BJ91 4ZFZB 2AVGA 4P3CL 3ARDD 2CIIB 1I3GH 3DRQB 3GSUB 1H3XA 4J8RB 3VXSD 4PJBE 3BXNA 4LPUA 1IM9B 2L7UA 4ZUWB 5HJ3B 3FAXA 1FFQA 5AWNH 3ARBB 5SWSB 3VXUD 3G5VA 4XNQB 4XAKD 2BVQB 3QR2A 1ZTXH 1CL7I 4AQOA 5K9QI 2NY2B 4R3SB 5ESAB 5I8EA 4YJZL 3RDTA 3BKJH 1GOFA 5E95B 4FA8A 3FB8B 3SO5A 3HFML 1NGWA 4IOIB 3VG9B 5DXWA 4FG6D 4Y5VA 4KDTA 4PJAA 2R2BA 3OAUH 4R97C 2N7AA 5E8EB 1JGUL 5E9DD 1NUDA 3BGMA 4Z7NF 3B8YA 2P8LA 3O8XC 4FQHB 3ULUL 1U8NB 2B4CH 3OTTA 5IBUG 5CZVL 1BJMA 2QSCL 3V8OA 3QDAA 3EZJB 1J8HE 5DJDA 3MODL 1BWMA 1YJDL 3O45B 5CINL 3ZE2F 1SJHB 5D93C 2A83A 2HFFA 3VFSA 1KENL 2Q3AA 2C4FT 2LQRA 4X6DA 5D70H 2PF6A 4NT6B 4LAQL 4BA8A 4OFVA 3BPOB 1T20B 1AHWC 3ARSA 4F9PC 4OKDA 4KQ4H 3WFBL 3V5HB 2C9AA 3MV8D 2OP4H 3DSNA 2CIIA 2XN9A 3PHQA 3VD7A 4J8RA 1JFQL 1Q94B 3MOAL 1HILA 2AXFB 5IHBA 1KULA 2CUIA 1G0XA 2WW8A 5HJ3A 4EI5D 2XPGB 3QCVL 3ARFC 5EBMB 3WFZA 2HFGH 4HKZA 2E8ZA 1S78D 5IJVB 4KROC 3L7FA 1GL4B 3UTSB 2LU3A 3MRCB 3MV9E 4M5YL 5C07B 1FIGH 4DZ8A 1MHHB 2HRPL 5C71A 1LILA 3LRSB 1U8JB 1DTUA 5FYLL 4R26H 1YEHL 3G6DL 2VZ3A 4J4PD 3BE1L 3L3HB 4RGMC 2NY3D 3MQIA 3GBLA 3IFNL 3ILQC 4GRWF 3RTQC 2H9GA 5DT1H 3HZYB 1FG2A 1NUFA 2EYRB 2J4WL 3L3OB 3EYQD 4OCLC 4PJ8C 2XNAB 5E8EA 4KKCD 5JW4R 1MF2H 1YEKL 2ADGA 2MOVA 4FQHA 1MSPA 2RHEA 1G9NC 3AS1A 4HUUB 1I1AD 3JTSB 1NJ9B 1MI5E 2J8UB 5HYJA 3P40A 5EU7C 3O45A 4OCRH 4OFPA 1SJHA 2OL3A 4WU7B 1YMHB 3CZJA 1OP5H 4TNVK 1MCLA 4HIIA 3LV3B 2A9ML 3X3GL 4ZQKA 4MAYC 3W0WD 3LKPA 4NN5C 1RZJL 2FEDC 5KN5B 4BFEA 5DK3A 3RWFB 4I77H 1CBVH 4NZRH 2CQVA 3S36H 4XB7A 1F8TH 3CFBA 4YDLC 5FXCH 1VEOA 5J3HC 3L9RB 1NEZA 2WBWB 1PDKA 5I8KH 2J12B 1LE9B 1N5YL 3ULVD 5E2TH 5AD0B 3SQOH 1J0JA 4GXVL 4ELMB 3CFCL 2YXFA 4E41B 4JJ5B 1ADQL 2FHBA 2XRAL 3VXRD 5EBLB 5EWIL 5TPWL 1JNHA 3VXUE 1HWHB 2BJML 4OLZH 3VGBA 1RZKC 1U3YA 4O58H 3AC0A 4K9EL 5JW5B 5C07A 1WZMA 4DVRH 1F4YL 4GBXA 3JWDL 3LRSA 1V3LA 4YFDB 1U8JA 5JXED 2JJUA 3QYCA 4XNXL 4DKFH 3BD3A 5EZOH 3L3HA 1ZWIA 1WLHA 1K6QL 3DYPA 4U1LB 4QRSB 2EH8H 3HZYA 3L3OA 4G5ZL 4D94A 5F44A 5IF0B 3ARGA 3CLEL 4PB0H 4BK5A 4OLYH 5JHLL 1A6UH 3L6FB 4HK3N 3WKML 4OIIH 2QADC 3SJVE 1BQLH 1MAMH 3JTSA 1NJ9A 2VXTH 3QDHA 2Z31B 1I9JL 1WWCA 5DYOA 4YEEA 2V17L 3U36B 3AMLA 3UPAA 4N0UE 3X14A 1QR4A 4WU7A 1YMHA 5C0DB 3TM6A 3ZKMC 3TZVA 3UROR 1ERNA 4K23H 4J12A 1CU4L 4YHOL 3LV3A 5C09B 3P0YL 4GAJH 3ARED 1BIIB 1T4KB 1QKZL 3B43A 3RUGB 1NCAH 1RUQH 4HKXB 4NHCL 2ZCHL 4J1UA 3VE0A 3QIWD 1JK8A 3IXAB 3VD9A 4HS6B 3C2AH 3RVXC 1L0QA 3PWPD 2O5YL 1MCCA 2NY6D 1VACB 1LE9A 1DQQA 5AD0A 1B0WA 4LHUG 4Z0XB 2W59A 4C4KT 4P2YA 3SGJC 5FDYA 4JRYD 3MGOA 4JJ5A 1Y6MR 5EBLA 4R96A 4QWWC 3VRIB 2UYLB 2FJFB 1DEEB 2ORBL 2R2CA 5FCUL 4L3CA 5JW5A 2AJXH 5HYSG 3WS3B 2I26N 1BMGA 2D0FA 3QUZC 4OGXL 4JFDA 4GRWH 4M5ZL 5H35A 1N0XL 3KS0H 4LSTH 2VDPH 4Z7WE 4Z77B 4OZGA 5KVGH 3GO1H 4QRSA 3NGBC 4Y2OA 1FZMB 2F53E 4OAWB 3QQ9C 5IWLA 3V9FA 1X5IA 4HDIB 3UCRA 2BSRB 2YPVL 3VXTB 4U33A 2Z31A 5IVXB 1AY1L 4P48A 1X5XA 1Z9SA 1QUNA 4I18B 2NR6C 5ALCH 3QNXB 1C5BH 5C0DA 2VXUH 1PYWA 3W39B 1A7OH 4MWFB 4DQOH 4YGAB 3SKJL 4OLVH 3QEQE 4L4JA 4U6TA 3RUGA 4BFIB 2APWA 2X89A 5E56A 1CDBA 1I3UA 5TQ0L 3D3VE 1S7QA 4HPOH 2EDFA 2LTQB 2PCPA 2ITCB 3W2DL 4KI5C 4XC1H 3KG5A 3MRFA 2W65B 3QB7C 2GJ6D 4BSVB 3GSWB 3ESVF 4GKZB 3K0WA 3IDJA 5K9JH 1NCNA 3IETB 2UY6A 5E8NB 1A6WL 3I02B 3O8XD 1HHJA 4K3GA 4OCSL 3PXHA 4LNRA 2NY1B 3RWEB 2UYLA 4JPIB 4QRTB 1TVHA 4K8RH 4LCWE 3SE4C 3LPGA 2AAVA 4H88L 3CMGA 5GS0L 2IPUG 4YHMH 5GPRA 3BW9B 5BRZD 3GJFH 4W4OC 3NA9H 4Z77A 1CFNA 1FNEA 4Y4HC 4Y4KD 1P1ZA 4P57A 3DVGA 1MFCH 1R5WA 3GEWB 3WE6A 3QEHA 3MBEB 1M71A 4OSUH 5DRXA 2ZUYA 4OAWA 4IDJL 4K3DH 4HDIA 3WYRA 4DFIA 2A6DB 2EDBA 2BSRA 5JXAL 2F5AH 3GKWH 4KK9C 4WHYG 4JFYB 5IVXA 4IIQC 3SN6N 1X5KA 2F19L 3GZKA 5IJKC 3ARFD 1R5VA 4WCYH 3QNXA 3SE3A 4KROD 1TZGL 2UZIH 3X11B 1WZ1H 3OKMB 4R4BB 3N1GC 4YNYB 1AXIB 4P4RB 3QULA 2UZXB 1ED3B 3WJLA 4WU5A 5D7KD 2ZZUT 3QISA 4WNQA 5SX5H 5C3LD 1LP9E 1R3KA 3MXVL 3OPZL 3MFFB 3U7WL 4U4BA 3LQMA 3RTQD 3ILQD 4OZFB 4BKLA 1X44A 4M4PA 2PO6C 4PJ8D 3RX5A 4ZXBB 3J8F7 3B5GA 4Q9CA 4GKZA 4G8EA 4L9DA 5GHWH 4U3XA 5E8NA 1G0YR 3AMKA 3E1F1 2GFBB 1P7QD 2O61A 4J6RL 4CGTA 3RWEA 2DN7A 3KPSE 2VR4A 4ZUVB 4QRTA 43CAB 4D2NA 1MNUH 4ZFFA 2YHGA 1TJHL 4D0DB 4FFWC 4EN3C 4JKLA 2R1YB 1AI1L 4QXGH 3EIFA 1KEMH 4K2UL 3V0AC 4KAQL 2YD9A 2V5MA 4MAYD 1V3JA 3RNKA 1HIML 4UINL 2FEDD 4YQXH 4WW2A 3EJJX 1MLBB 3GSNB 3WSQL 3AS2A 4FFVC 4NSKA 4EI6B 3MBEA 4NO5A 3WMSA 5J3HD 4ENEC 2OI9C 3LS5L 3RAJH 2A6DA 1A1MA 2O26U 1MH5B 5D8JL 5CZXC 4PP1D 2FYYA 3BKYL 4Y5YC 4Z95L 2X4NB 4O2CB 4PJFF 4OLXH 3JV5A 3BVNB 5KSUA 5BQ7B 4MD5B 2FHCA 3OKMA 1MIEL 3NCCB 5IHUL 2IMNA 5KS9F 1PKQB 2ICWA 4P4RA 3BT2H 1CVRA 4XPTH 5HHMB 1CS6A 2V5SA 3O6KH 4NQDE 4BFBD 4TULH 2ZUWA 3Q3GB 1BQHG 3H9SB 5GJSL 3Q6FB 3MFFA 4L5FH 2SEBB 5FM5O 4OZFA 5F1NB 2CK0H 2G75A 1XT5A 2VLLB 4FHBD 5E4EB 1CTOA 5DR5H 5A1AA 1ITBB 5C0BA 2GFBA 1RK0B 2QADD 2W92A 5HHXH 1JNJA 2ZKHL 43CAA 4LLVB 2V2XB 2VDML 4E42A 3ZE1F 3ZKMD 2R1YA 5FB8B 4XH2A 1ZLVK 2PW2B 4JFXA 3LKNB 4LPCA 3ARBC 2PW1B 5TE7H 3T0EB 4X5WB 5GS1C 4JFHD 3GSNA 4G8IB 4H5SA 2WQ8A 5C0EA 4PIRF 3DMMA 2VDKL 4EI6A 1FGNH 3MV7D 1L6XA 3RVXD 2R2EB 4YEFA 1KXQE 4G42A 5DMYA 4FXGA 5ENWA 1MH5A 2DQCL 4OF8A 3CXDL 4I0CC 5I15L 3MJ8B 2X4NA 3VG9C 1ZVSA 2YOCA 2J3SA 5HHOA 4O2CA 3D39B 1FBIH 4MXWL 4QWWD 3HC3L 5I1CH 4JY4A 1PKQA 2XZQH 4WTXA 3HAEA 5DD0H 3V0WL 4E5XB 4X9FA 2PN5A 4WEMB 3UDWC 4HMCA 8FABB 5KVFH 1IVLA 2YA2A 4EXKA 3MBXH 2VJXA 4M1GH 4HZAA 4N90E 1MCDA 4U0RC 3P9LB 4Z76A 4D8PB 2VKXA 5D7KE 2IG2H 4WO4B 2L7JA 2VLLA 5KSBE 4X9HA 4LFHG 1FNGB 4TTDC 1X5GA 3IGAB 5EOQL 3OB0K 3QQ9D 3H8NA 3C5ZB 1MRFH 5CJXA 5F9JB 5I1DA 4OF0A 4U31A 1RUKL 1FP5A 3MRBB 4LLVA 4ODSL 2ATKB 2V2XA 3EJZC 2NR6D 5D96B 3F7QA 2BDNH 4GS7B 1YEDB 3H9YA 3HI6H 3KXFA 5EU7E 1CGTA 4UIKH 2PW1A 3QNZB 3NIFE 4PJ5D 2VLRD 5GZND 3MJ7A 1IC5L 4HFUL 4G8IA 4OZHF 4PJ9B 2D7OA 5IB3A 2Z35A 1DN2A 4RZCB 4KI5D 4ESKA 2R2EA 3AB0B 5EORL 4ZNCD 4GFTB 1AR1C 4F9LA 3GB7A 4LGSB 3QUMH 3NCEB 3HUJE 3TH4T 1VGKB 1UH2A 2BSSA 4QCIB 3S35X 4ALAL 1EDQA 3EYOA 4HC1L 3W5MA 5D7JD 1X7QB 2AK1H 2NXYC 2VH5L 5JIPA 1YPZB 4OD1H 1F13A 4N9GB 1WISA 4XVTL 5DUPL 5ELIA 4XWGH 3LPFA 4OFIA 1MRDH 4CBPA 4OT1H 3WIFA 4ZFGL 1AP2A 5HDOA 5JW3H 2XTJE 3P9LA 5CLTA 4D8PA 5BJTA 4Y4HD 1S9XA 4TPRL 3BPLB 5HGDB 3QO1A 3RQ3A 1OGTB 1Y0LB 3IGAA 4QHUA 4M93C 3QDME 5JUEL 3JWOC 5B38G 3SDYH 5AWNL 2G60H 2VO5A 4KK9D 1NAML 4QRUB 1QFOA 3BDXA 4ODXA 3IJSB 3NBNA 3SDCA 5EO9B 2FECI 3TESA 2DQJL 5IB2A 2J6EH 2NY7H 3BKJL 2IH3B 2Y25A 3BDYL 4M6OL 4UIMB 3NPSB 1SQ2N 2PXYB 5KBNC 4XI5C 1PLGL 4YHPB 2GTZB 2X41A 3QNZA 3WDHA 2DQEL 3ME0A 4XCNB 3C9NB 2XTLA 3PL6B 3MRHA 4Q74A 2OXHA 4RZCA 2VDRH 3ZMRA 1YNKH 3SY0B 3BH8B 3OJ2C 2PO6D 1CE1H 2EYSA 4JFHE 3UTTD 4AEFA 4U05A 5BV7C 2W0KA 1PG7W 2B4CL 2NNAB 1VGKA 4JZOA 4BSJA 1G7QB 5DJ8B 2V2WA 1EEUA 4LP4A 3RWGB 4PRHE 1EERB 5I18H 1JWUB 4N9GA 4FFWD 1TXKA 3WUZA 4EN3D 5CWSB 1P6FA 5D6CA 1TLKA 2BNRE 3BYTA 4J7RA 1D5ZA 3LZFH 1A9EA 5TDNB 2OP4L 3VXNB 5EIIA 1P5UA 1DSFH 5FV2A 1KCLA 4JFQB 4FFVD 4QGTA 5HGDA 2I60L 1KUMA 5CIPB 1P6AB 1Y0LA 4ZODA 4JZJC 4ENED 2IWGA 1F3RB 5INCA 1TJIL 5DHVA 5CZXD 3QRGH 3EAKA 4JFFD 4QRUA 1CD9B 5D7LA 3SDAB 1LO4H 2M2DA 5I76B 1J0ZA 1U8OB 1Z9LA 3U4AA 4Y1AE 3F7VB 3OGCB 1JTOA 2BMKA 1UH4A 4UDTA 4UIMA 3V7AE 3QFDB 2PXYA 3FO1B 5M7QA 3V7AG 3IDIB 4YHPA 4AH2A 3T3PE 4I5BB 4XCNA 1U2CA 2FWOA 4ODBD 4GG8B 1CLOH 3MX0A 3PL6A 3GHBH 5EU4B 4P2RD 5MERB 4MNQD 3SY0A 5DT1L 3AS0A 1E4WH 4AEIH 4PJ5E 3WNNA 3U48A 1QBLH 3NVQA 1DZBA 2EC8A 4KI5E 4JN1H 1N5AB 5D2NC 3V0VA 4MNGA 4M6AA 3RY6A 4PY8J 4PG9B 2WANA 1G7QA 5DJ8A 4OCRL 3DETC 5DJAA 5GGRA 4HXAH 3ARXA 3O9WB 3DURA 4FQLL 4XPAH 3C8DA 3I3DA 5CWSA 4HGWA 3CFDB 1CI5A 5EUOF 1RUMH 3ARBD 1AKJA 4D0CA 5H8DA 4MJ5B 5TDNA 5DHYA 1T04B 2HWZL 4I18C 5FUOH 3S36L 3EYVB 1AQDB 3HNVH 3ZL4H 5DVOA 3U0TA 2MTPA 3AU1A 5I8KL 4KK8C 1PVHA 5BZWA 5JLZB 3PP3K 3TC9A 2NTFB 4KVNL 1GGCH 5I1AA 3SDAA 4GRLC 5DO2C 3ZTNH 1IRAY 1CWVA 1U8OA 4NQCB 1P7KA 3ULVF 4XPHH 4MX7B 1A6VL 3FT3A 1MCSA 3FO1A 3IKCB 4NUGL 4I5BA 4G80B 4K07A 2V7HB 4Z0BH 5L2KB 3LOWA 3LQAC 4Z8FH 1BHGA 4UTAL 1A7PH 4WWKC 5MERA 4ZMAT 4DGVH 2MPAL 3BISA 2EDNA 4FQJL 1PY4A 3CFJA 4OLYL 3C5SA 2QJDA 1A6UL 4LSRH 1N64L 1PQZA 4GO6B 5F1IA 3WUWB 4BH8B 5LAXA 4JQVA 4U7MA 1BQLL 1RVFH 2A9NL 3GI9L 1ZLWH 1MAML 1J5OH 2CDGA 5LKNA 1OGAA 3WJJA 1RZGB 1C8PA 4G8GB 1OP3K 1ACZA 4HIJB 3EJZD 4JO2H 1KIRA 5DI8B 1KYOK 2VABB 4WENB 4F7CB 4HWZA 4PRBB 1MHEB 2EO1A 2XOTA 5EDXA 3VFRB 3CFDA 2I25N 3ZT6A 5JDSB 4FFYL 4B7IA 1T04A 3C2AL 4Y4FC 5HHQA 4JHWH 3KPRA 4IS6B 2DQGH 1AR1D 3L7EB 4GQPH 2QQLH 4LARH 4GSDH 1CDCA 4KMTH 5JLZA 3ZDZE 4YK4B 1YMMA 4F15B 3FO2B 3DIFA 5C0IB 2P5EB 5INDB 2X4PB 4NQCA 4YPGA 2DLFL 2NXYD 5EZLA 2A6KB 5J1AB 2WINB 2E9WA 4ZXBC 4LLQA 3FOLB 2H32B 4HS3B 4LLWB 1LHZA 1MJJB 4PJAE 4JVPA 4LCUB 1WWAX 3HLAA 1D5XA 4G80A 3DUHA 2VDPL 1XGPA 2V6HA 4R4FH 3BX7C 1XGYL 3LEVL 1I1YA 4LEOB 1FNSH 1KB5B 3QNYA 1T7VA 3LD8B 1A7QL 1ZVYA 1ZHLB 4ISVA 2A73B 4U7KA 1UXSA 5AYUH 2AXGA 3T04D 2YC1B 4X8JB 5GGQH 5GGTL 4G8GA 5F72S 3LHPL 5F9OH 5SWZB 1BJ1H 1WT5C 1MCFA 4ZPVA 1T22B 1F58H 3HNSL 1T1ZA 2VABA 4NQTA 1AGDA 1VA9A 2OQJB 4DQOL 1QRNB 2UWEA 3VFRA 3VFMB 1FV1A 1KJ2L 4TUKH 4XI5D 5JDSA 5EA0L 4Y16C 1S9WB 1AJ7L 5IW3A 4HPOL 5MENB 2E3VA 1E6OH 4XC1L 2ILLA 4L8CB 4OF6A 1IGIL 5E6YA 1E4KA 5SWSE 5TF1H 5J7CC 2FBJL 3L7EA 1UEMA 1KACB 5I9QC 3ZSSA 5ILTH 2YD2A 1A64A 2P24B 3GRWH 5LXGL 1SVCP 5C0IA 3ULVH 1M6OA 2EZ0C 2E7LA 3BAEL 3RJDA 3RGVB 5EOCL 3QHZL 4JLRB 5J1AA 4PJCB 2ZNXA 2EECA 4NOFA 5E4EC 1MJJA 4HT1H 2ZSWA 2OTWB 4LCUA 3VI4E 4YHML 2APBA 5D1XC 4OTXH 1QFWI 3NA9L 4XBPB 4C4KO 1UB6A 4G6FB 1SVZA 4S11A 2NX5B 2R4RL 3K4AA 3P73B 3KJ6H 1JUFB 1ORQB 4H1LB 3KPPB 4NRXA 3QQ4A 4YXKH 5JTWA 5I1GL 2A73A 2P4AB 1NC4B 2GUOA 4X8JA 4S1RL 3S5LB 3VMNA 3VFWA 5IMMB 5SWZA 3O0RL 1FO0B 1F97A 2AJYH 5FHAL 2WMPA 4MLIA 2ICWI 2BNUA 5JW4Q 2OQJA 5AZ2H 4NO0D 1QSVA 2EEDA 5L9DH 3WO4C 4WDIA 4GOSA 4ZS7L 1LVEA 1S9WA 2AK4A 5CCKH 1YYML 1KG0A 4H8WH 1QFPA 3EOTH 1M7IB 2D31A 3F8UB 1BM3H 1EK3A 4JN2B 5FCSH 2P24A 2BSED 3GM8A 4PRAB 3FB5A 4LLUB 3UTSE 3OZ9H 3QCUL 5C07E 2DQIL 4K71C 1CT8B 5KSAB 1H3VA 4DFHA 1EGJL 1P4LB 1MNUL 1UJ3B 2HG5B 1HHHA 1ZEAL 2EC9T 3DETD 4JKMA 4WO4C 3DBXB 3OAZK 5CP3H 2OTWA 1J7VR 1Z0NA 1WUNT 4EXPX 1N3NB 1P9MC 1N6QH 3HR5B 4WY7H 3C5ZC 1KEML 1WZLA 3BRGC 3O2DH 1LEIA 3OV6A 1BGXL 3FQRB 3UJIL 2GI7A 3Q5TA 3UC0L 2P5WD 3RZWA 3P73A 1V5JA 5F8QC 5GSVB 2WUBL 1SHMA 1CFVH 3WS6C 1V05A 1DBAH 2EDDA 4K3EL 4GS7C 4H1LA 3KPPA 3RAJL 3TBVB 5FO9B 2J8UE 1JZ8A 4KK8D 4P4KB 4UT6L 2DTSA 3HZVB 1RUAH 4AG4H 3WFEH 2AERT 5FGBC 2HT3D 3R1GL 4KJQC 4GRLD 4PJ9C 5DRNB 5DO2D 4OLXL 3AB0C 4OZ4B 5L2JB 1AE6L 3Q2CA 4HJ0C 1DQML 3BT2L 4MA8L 3F7RA 4TULL 4TNWF 3I50L 4I13B 4L5FL 1MELA 5IQ7L 3V95A 1L7IH 4WWKD 4YHIB 3RNQB 5BXFB 1RAMA 2A77H 4JO3L 1IC4L 1XF5B 1NGXB 4ELME 4E41E 2R9HC 5K33A 5DR5L 3K3QA 2YMXH 1RY7B 4PRAA 3VFPA 3DUUA 2DDQL 4LLUA 5C0FB 3HNTL 5EUKB 4X4XA 2MQ0A 3CCHA 1F45A 3OKYA 1KTDB 4XP5H 1A6TB 1CT8A 5KSAA 3MUZ1 1P4LA 2HG5A 4FQQB 4JFDE 3MNWB 3DBXA 1BFOB 5TGBB 3BPLC 4FQ1H 4A6YL 5GRJL 4ELKA 1IBGH 1FZKA 3T4AB 3BDBA 4OLEA 2MJWA 5C0AB 3MLTB 3EO1A 2E9JA 2FCBA 4CMHB 4XP4H 1FZJA 6FABH 3LKRA 3FQRA 1QLRB 4J3SA 2KZWA 4J3OC 5GSVA 3EYFB 2LAGB 1FGNL 1WCBB 4Y4FD 5DD5L 3SGDI 1KLGB 3TBVA 1HINH 4OFDA 5FO9A 1EBPA 1I9EA 1S9YB 3NPSC 4HW6A 4XXCC 1KPRB 2DOCA 4I0PB 2FZ3B 1BJ8A 5FKPB 1E4XI 5DRNA 1CD0A 4P2CG 3MCG1 2QQNL 5C09E 5HI3D 3RUGE 1YC7A 3W11C 1Q9WB 1GHFL 4ZXBD 3OJMB 1VADB 4X9BA 5ICXA 4M43L 3ZKQD 1YUHB 5MEPA 3ARQA 3O4LA 3KJ4B 1VCAA 1KF9B 1NGXA 3QXAB 4NM4L 3MNVA 1GIGH 4ZUSA 3K8KA 2G9HB 2VC2L 5EUKA 1I7ZB 4XP1L 2FX8H 1KTDA 2EKJA 2PYFB 1VEMA 4UB0L 2Q86B 3EFFB 3VD4A 4URTB 1HKFA 3D18A 2I5YL 3P4LA 3MNWA 2X4SA 5ESVB 3U9UA 1BX2B 1WZKA 5EC1B 1MCBA 1I8KB 2AQ1A 3HI6L 1QHPA 1MFEH 5C0AA 4WVRA 4Q0XL 1SYVA 4UIKL 3L3GB 5HVFB 2NZ9C 4Y16D 3CUPA 5FUZH 2LE9A 3O2WH 3DI3B 5LGJB 1WCBA 4IM8A 4LLMA 4OCXH 2NY5H 5EULV 5FHBL 1WBXB 5IVXE 3V2AR 3JVGA 4PJDF 4R9HA 2AQ2A 3QO0A 4LNVA 5DUBA 1R3JB 5GRUH 1XGTB 5BS0B 5HHMD 25C8L 5FKPA 4KI5F 1FN4B 2Y23A 3TH2T 4YXLL 4IJ3C 3H9SD 1KTKE 5FO7A 1BIHA 2EZ0D 4HC1A 2X1OA 1ACYH 1DFBH 1MCOL 1NPUA 2WV3A 1Q9WA 3TWCH 1UACL 3MRDB 1ZA3B 1LGVA 1MRDL 4JGUA 5FYJE 2WUCL 4WFED 5D1XD 5JW3L 2C7UA 4TVPH 1BD2D 4JFZL 3CFKB 2BSTB 5AEAA 3H9HB 5F7MC 4LSSH 3O9WC 5I66A 4X9IA 4WV1B 1DLHA 3PG2A 4JY6A 1EFXD 3SDYL 5IFHH 4Q2ZB 3RZCC 1NAMA 1I3RA 2CKBH 2NW3B 3D2UA 3HE7A 2D0HA 3TT3L 5A40E 3QP3A 4HIHB 3RHWF 4P9HH 4HQQL 4Z7VF 1XFPA 2J6EL 2NY7L 4HWBH 1I8KA 1S7XA 5HDQH 5DMKA 4GAYB 1T89A 4NKQB 2GK0B 4WFGE 1FSKC 3L3GA 3KLAA 3SCMC 2CIKB 4I3RL 1S5HB 4Y2DB 4L1DA 1FPTH 4HV8A 1J0HA 1WBXA 3O11B 3I3BA 1YN6B 1T5XA 1XGTA 3QIUA 5BS0A 4HULB 2BNQB 4JFEB 2XWBA 5SV4A 5JMRA 1NBVH 3JSSA 1ZT4A 4TQEL 5MEQB 3BZEB 4WTZA 4YHZH 3MRDA 2LVEA 1NLBH 2HJFB 4RMUA 2ZJSL 3F65A 1A7NH 3WKNA 4RFEA 3C5ZD 3FONB 4M9PA 3KPMA 5I71C 5E08L 4U7SA 4OZFG 1SMOA 3LZFL 3LMJH 4J3WA 4WI7A 1OP9A 1FFNA 4JM4L 3CFKA 5DS8B 5E0QA 1BEYH 4PJEB 4P23C 4ZD3L 4GRMB 1AGBB 4MS8C 1RULH 1W72H 3NFSH 4CN4A 4OV5A 4Q2ZA 3DX6B 4KPHH 1I8IA 4V1DB 3HMWH 3VWKB 3WN5C 3PIQA 1C5CH 4WUUB 3STLA 5F7UA 4P46A 2CO6B 4KJQD 4RGNB 4JFOB 4HIHA 2DYPA 1T7ZA 1IAIH 4HJ0D 2GK0A 1P4IH 2PYEA 4OCYH 1KCSL 4M7KL 4KH2A 1N7ML 2CIKA 4F15C 2B8OT 1JRHL 1KJ3H 1S5HA 4L29A 4UOW0 2OZ4L 1T2QH 4C83B 4JPVH 3GHBL 1R3IH 4XPFL 1RJYA 4XP9H 3DOSA 1HQRB 1I9IH 1QFHA 4AEIL 2AV7B 5J13B 1MHPH 4YHKH 4DOHB 2R9HD 1QBLL 1SY6H 2JJTA 3D0LB 4M61B 3CC5A 4JFEA 1DVFA 1Z9MA 2FGWH 3DECA 2ATPA 1TIUA 1PKQE 2P8MA 3C6LC 5C08D 3LEXA 5HHME 1W0VB 2VN7A 4K3HA 4NKMB 4HXAL 5JHDD 2J1KA 3H9SE 4PLJC 2X44D 1YN7B 2HJFA 4C56B 4LCCB 1X6NA 2F8OA 2YD5A 4CVWA 3ROLB 5IW6B 1X5YA 1RUML 3GM0A 2APFA 3DX9B 4KJWC 1K8IA 3OQ3B 5FUOL 5HD8C 1K4DA 2HTKC 4XNYH 5IQ9B 1GGBH 5HVHB 3JTTA 3B9EA 3O6MH 3REVB 3MTRA 3KPOB 3C08L 4HJJH 4KRPB 2JCCF 1YEGH 3DX6A 4JQXC 4KTEL 3IF1B 4HUVB 1JGEB 4LIQE 1HKLL 5GGVH 4JRXD 1N26A 1MFBL 1I3VA 1JZ2A 1KV3A 4G7YH 3C5JB 5ADOH 2VDLH 3SPVB 5EO1A 3G5XB 1DUYA 3T0EE 3W11D 4IRSB 1RFDL 4YDKH 1GGYA 1QLEL 1AO7B 1EJOH 2YR3A 4GRWB 2CR3A 5F21B 4C83A 5IHZA 3GSXB 1RUPH 1HQRA 3P11L 2EYTB 4DGVL 1IKFH 5D1ZA 2ZUQB 3LKSB 1R24A 4QNPE 4GLRI 1LO5A 2IADB 4EUPH 2Z93B 3RWDB 3D39E 1MPAH 4M61A 5FYKE 3UYRH 2CRMA 1CXKA 1RVFL 3N9GL 5IGXL 5TDPA 1J5OL 1A2YB 1XR9A 3ZDYF 1CYGA 3G5YB 3RKDC 1W0VA 3QG7L 4DAGH 1WF5A 5DJ6B 5T3XD 1U8HA 3K74B 5EN2B 4OGYH 1KELH 4C56A 3H2WA 4LCCA 4TVSa 5IB4B 4Z7OF 3PQYD 3F58L 3LPWA 3ROLA 3PV6B 4POZD 1TFHA 4UT7H 4HG4K 2NZ9D 3S97C 1T83C 5E2VH 3VH8B 1YQVH 2DTML 5L6YL 3REVA 1P4BH 4PYHA 4JANB 1GRWA 2QQLL 3BP5B 4LARL 4GSDL 4KMTL 5I8CB 3IF1A 1YEEH 4L4TD 1GGUA 4TOYH 2VLKA 3CVHA 1E28B 5LVEA 2FR4A 5HDBF 3WFDH 5DRZA 2CD0A 4MJ6A 1CGWA 4NJ9L 3T0BA 3G5XA 4AMKH 2X4UA 3QAZC 4Y8AA 4LOUC 5I19H 3HI1A 3NTCH 1RZ8B 3OHXB 2JK5B 3U7AA 3FQXB 4K55A 4F3FB 3E6FA 2DF3A 3MZTA 1AO7A 5L8LB 4BZ1L 3BZFB 5HYQB 2EYTA 4OQTH 1UJ3C 3LKSA 4R4FL 3ULUE 2IADA 1CVSC 2ZUVA 2Z93A 1FNSL 2HFEB 4NQSB 1G1CA 2J8UF 3C8HA 5CJOH 1A2YA 1YPZE 4HWUA 4ZDHB 3RZCD 5FO8B 3T08A 5GGTA 5FA3B 5I1KH 1IILE 1DANT 1F58L 3HHRB 2YD6A 4U1HB 2XKUA 3BP7A 4QRPB 5ICZA 3N1FC 1K5NA 1KJ2A 2D7MA 2MFNA 3QEUB 4P4KC 3SCMD 1OPGH 5CEYA 2A0LC 5DC0A 3L3IA 2ESVD 1S3KL 3UPCA 4HUWB 1JPTL 1TITA 4GAGH 5ACZA 1DLFL 2Y7QB 4R8WH 3H7BB 4JANA 5I1JH 5ADPL 1IGYA 5I8CA 2YKLL 5ILTL 4R6UA 3GRWL 4X7EC 3WL9A 4G6JL 3FJTA 2WNGA 3L5JA 1G9MC 1VKXB 2R0KH 2R2HA 1CK0H 3MRGB 3FQUB 3QG6A 1RZ8A 5HPOA 2F5BL 1K3ZA 4ODWA 3P30L 1PZ5A 3A6OA 4XNMB 3IDGA 5D5MB 4LBEB 5JA8B 3C60C 5A3IC 1N8ZA 4N0YL 4ODUA 1KC5H 3H7LA 1D5IH 2QHRH 3M17B 2IH1B 5HGAA 4XXDB 1FIEA 5C0CD 5I6XB 1TQBC 5D71H 1N2RB 3WHXA 3LEYH 1U3ZA 7FABH 4EDXA 4P23D 4YXKL 1XEDA 4MS8D 4QRRD 1U95A 3CMOL 4WEBH 3WXVH 4CU8A 3ARWA 1GC1C 3RIAK 4CMHC 1JP5A 1NC2B 4ZDHA 1TNNA 1LO2H 4Z7UF 1U41A 1OP5K 3V6BR 1CGXA 3VG0H 2LABA 3DSFL 1BVKB 4QYOA 4L3EB 4ZTOL 3S37H 2PETA 3B83A 1DBJL 3V8CA 5T3XE 1W0YT 4I0PC 3RL1A 3VWJC 4XRCA 3BQUA 3MRKB 4LF3B 2P5ED 4S2SB 2XY2A 1KCVH 4CJ0A 4H8WL 3ES6B 3FFCD 1Z9OA 3H7BA 4NWTH 5SWQA 5HPMB 3UMTA 1QA9B 4B5EA 3FFDB 1QHOA 2YPLB 3BP4A 1FE8L 2YN5A 3OZ9L 4DGIL 4KUZL 1O5DT 2H2SC 1D5MB 4U1IA 2WAHA 4XP6L 1KIQB 3C6LD 1EGJA 1Q72H 1WIPA 3FQUA 3KJ4C 1NMCB 4RX4D 2A2QT 1EEZA 1G6VK 5SX4I 1FC1A 4PLJD 4GBXC 4XNMA 3ZO0A 5FF6A 1JWSB 4HCRH 3KDMB 4O2FA 4LEXH 1N6QL 3T0VA 4NNXB 1I4FB 3O2DL 3IFLL 1A4JB 1AGFB 4KJWD 1RURL 2Q6WB 1BAFL 3FQWA 2C1PB 1J87A 1LNUB 2HTKD 1DBAL 4QRQB 4L8BB 5I17B 3ZTJH 1MCJA 2A6IB 1DDHB 1QRND 4U3HA 3OKKB 3IAQA 4XNZC 5EU6D 3QA3B 4AG4L 3WFEL 4P0DA 1FFOB 4NNYB 5F7HA 2NMSA 1BVKA 4JPKH 1ZHBB 3A67L 2GQHA 2C4FU 3QDJB 2D4DA 5I1HL 3IS1X 4EZMA 3TZVC 1QOKA 3U6RA 1BZ7B 3DV4B 5CHNA 5IESL 5DQ9A 3D85B 4XCCL 3QWRD 1NBQA 1Y18B 4KRMB 4CMMB 4LF3A 1EAPB 4OZIB 1L7IL 1RK1A 2BHZA 1QNZH 2CDEA 3QIBB 3TH3T 1BFVL 3GMLB 4RCAA 5HHVH 5HPMA 1F4XL 2F8VA 3FN0H 3RY4A 1QBAA 1QA9A 3UAJC 2R56H 4NQCE 2YPLA 1CFSB 5FOBA 3B2VH 1D5MA 1ND0A 4XP5L 5BV7H 4JDZA 2CK2A 3NIGE 2Q1EA 3RKDD 2NX5D 4YBHA 5L2KE 1KXTB 4A6YA 1IBGL 2R1XA 2GEEA 1A14H 1JWSA 1UEYA 3KDMA 2F54D 4M6NL 3TFKC 1EX0A 1DCLA 6FABL 4HF5H 4NKDB 3GMPB 5J6HB 4KDVA 4PRPD 4FTVA 4Y19B 4MXVE 4F2MB 1U36A 3ZE0E 4L8BA 2E7CA 3OF6D 5DD3L 1AC0A 3WUWG 4MQTB 4JG0L 2A6IA 2BRRL 2GKIA 5IWLC 1U92B 1DDHA 2VLME 1RJZA 4K94H 2RR3A 4PJFB 2X9XA 4G8GE 2YEZB 3QUMB 3QA3A 4MJID 3TA3A 3ISWA 1MQKL 4HGMA 1F02I 3C6SB 4TRPL 5TH2A 5AAMA 5HDLA 5KS9B 1ZHBA 3B4NA 1FL5A 2VSCA 2Z8SA 4GKNB 3DVIA 2C3VA 3RDTD 4LOUD 5CILL 3OJDA 3DV4A 5T1LD 2ZOLB 3D85A 5T5FH 2VQ1B 4CMMA 3RX7A 4MSWB 4HPYH 1CLYH 1HDMA 2XACC 3GMLA 5ANMA 2G5RA 2FB4H 3KPLA 3O6FB 1GIGL 1LD9A 5D6DC 1CFSA 5IR1B 1O0VA 3VXMA 1RHHA 5MEOA 3TGXA 1P2CB 1G9NL 4MZ2A 3WFHA 3EW3B 2HJKA 3GSQA 4U2ZA 5IMKB 4ONGL 1VENA 2Q8AH 1CD8A 4ZUUB 2DAVA 1XIWA 4KZDH 5F96H 1D3CA 1MFEL 1T7WA 5IUSA 2R0ZH 4LKCB 4JY5H 4P4KD 4XMLH 2DLHA 4IRZH 2VQTA 4HK0A 3GMPA 3MRPA 3GKZA 2FNBA 4NKDA 3KYNA 3R06B 4QF1B 2A0LD 4NC1C 1F6LL 2YBRA 3DV6B 4RGNC 2XQYK 2DMCA 2OMBA 2R69H 4NYLA 4F2MA 5A2FA 1QSFA 1NGZB 2XN9D 5FKAB 4DUXA 1Q0XL 4HKJA 1U92A 1X6LA 1HK6A 1T1XB 5GRUL 5SWZE 3QXDB 1TDQA 1NANH 3C6SA 2OS7A 4WI4A 3FCTA 2ADJA 1G7LB 5KS9A 3I6LD 2FEEL 1QRNE 3T2OA 5FM5M 5SX5K 2Y36L 2VXVL 2AKRA 3DROB 1JN6B 2AABH 3OX8A 3TWCL 1RZKL 2ZPKH 2VUYA 1T7YA 1IGJA 5HY9B 5MENE 2ZOLA 1UXWA 4JKWA 5I1EL 3C60D 5A3ID 2FJGB 5C0GA 1HI6B 1YY9D 5MHSE 3MXWL 4QT5B 4MSWA 4NQEB 1NCCL 3ZYOA 1BQUA 1MUJA 5JIHA 2MNUA 3FOMA 3KR3L 4LSSL 2RIKA 5IR1A 1I9RL 5IFHL 1OSPL 4HWNA 4AT6B 4PJCE 1BBJA 1BFTA 3EOAB 3QUXB 3WLBA 1E0OB 3GSOA 2VNCA 4S1DC 1IC7H 3AGVA 2J6EA 5J06A 4KTYA 3MCLH 4ZFOL 4OZHB 4KRPC 4HXBH 2NX5E 1JHKH 1IAKB 3FO0H 2P8PA 5JOFB 4XWOC 3VGEA 3WNMA 3VWJD 1YY8B 1MRCL 3DV6A 2D3VA 4ZO9A 5D2LF 1FPTL 4QXUH 4H1LG 1NGZA 2CR6A 5FA4B 2KDGA 5JORB 4BUGA 5IEHB 2B1AL 3LY6A 4XVJH 4IRSC 4P2QD 3S5LG 3U0WL 3QXDA 4ZOAA 5F7EH 4EIZC 3HPJB 3BKCL 3MREB 1IEAA 4RISL 1X5HA 1NBVL 4DVBA 4ETQB 3VDCA 2H2SD 4HUNB 5GSRB 4JQIL 3TYGL 5GISH 4KTDL 2WBJB 1JN6A 4N0FB 1T21B 2ZUQC 3KS0J 5C0JA 3C09B 1FL6B 3QUYC 4ZO7A 1J1XH 1NLBL 1ZHNA 4GBXD 1A7NL 2H26A 5ID1A 2EIBA 2V7NB 2VDQH 4OD2B 3NZHL 2FJGA 1HI6A 1U8QA 4QT5A 2NY0B 1CGYA 1AIFA 4CU7A 4LSPL 5GJTL 3QHTC 3ARGD 4FOMA 3ARDB 2Y5TB 3TLRA 1RULL 4CJ1A 3NFSL 1T0NA 4NN7B 3VXSB 1GZQA 1U3HA 4KPHL 3MPCA 4HIXH 1UWEL 5H2BB 3O2VL 1JNNH 3MV9A 1CD1A 4F7TA 5CEZD 1UC6A 1X4ZA 4UUJA 3TZVD 5AZEH 1JGVL 2E27H 3P77B 3QXWA 4OZHA 3KGRA 2FD6L 3MRLB 5JOFA 4LCIL 1YY8A 5DHXB 2OZ4A 5K9KB 1R3IL 2GITB 1W8NA 2CJUH 4UI2A 5FA4A 1MJ7L 1L4IA 5D4QA 1DUZB 1I9IL 5DWUH 5IEHA 4PJIB 2ADIA 3PGFH 3MJ9H 1Q1JH 3BIKB 4RSVA 5EBGA 3HPJA 4FQ2L 1MI5A 5E9DB 4HJGB 3P9MB 1NCWH 4BZYA 4NRYB 4ONHA 1PX3A 2VLJD 1YPZF 3MGAA 5CJQL 2WBJA 3VU2A 4N0FA 4Z9KB 1EXUA 1T21A 4GW4B 3QSKB 2DM2A 2X4OB 1CL7H 4HFWB 5I1LB 4MA1B 2VSDA 2OJZH 3WHE1 3TFKD 4BQ8A 1GGTA 1KN2L 1IKNC 3RVUC 3X13B 4BH7A 3GJEB 1A3LL 4WI5A 1ZLUH 1CFBA 3TBTB 4XNYL 4LRNH 1GGBL 3MV8B 3O6ML 2DQDH 5F9DC 3TNNA 1WFUA 5I73C 4HJJL 1A0QH 3VXSA 2ZOKB 5EPMB 2X42A 5BW7C 4JPWL 5DTFA 4M8QB 3Q5YA 4MXQC 4PGDB 3DVNB 4EI5B 3VXUA 4MVBC 3DWTA 5LBSL 2ZCKL 5C0AE 2VDLL 4WHYH 4XBEL 1T0MA 5E94A 1T1WB 4B50A 3P77A 3ZT5A 1B6DA 2JB6B 4LP5A 3GMRB 5C8JA 4CADB 2APVA 2VISA 1JPGB 2JB5H 1OM3L 2X89D 3BO8B 3B8SA 5LWYH 4KVCL 1HHKB 1BBDH 2ERJB 5J9PA 3U2SB 3NCMA 4PBXA 3TYFA 1CLZH 1CQKA 2ADFH 4RAVB 2NY3B 4OFYA 4WEUD 3CLFH 3TIDA 3SJVA 4GKOA 4JCLA 1UVQA 1FVDA 4PJXF 4BQ9A 1JWMA 1R3HB 2ZNWA 2X05A 3MLUH 3V6OA 4KJYA 4JHBA 4FQXB 5F7KC 5IBTL 1I1CA 4BZ2H 4NZUL 5TE6L 1I1AB 3VGHA 4YZFF 1IZJA 3SBWA 1PKOA 3LIZL 1KELL 1LDPL 5EUOB 4NP4H 3EDDA 5A2LH 3TBYB 4UT7L 3PGCB 4V1DD 4XPGL 3W0WB 1WBYB 4WUUD 3SOBH 4RGND 4XX1G 1YQVL 4O2EB 4LHUA 3VI3F 3EJYC 1P4BL 4DW2H 1YQ2A 1SBSH 3SDDC 1RIUH 3CDGB 2ZOKA 2E8YA 4NQVB 3O6LH 4G8FA 1YEEL 4TOYL 4M8QA 4PGDA 1A6ZB 4EI5A 4HKBB 5HYSA 3SDCC 3ROOB 2V9TA 1CLCA 2XV6B 1T1WA 3VXRB 4NO2B 3NTCL 3GMRA 4KV5F 4CADA 1Z5LA 4Z7WA 2W0LA 1J1PH 2J2ZA 5I75C 3BO8A 3AFLA 3G6JF 3MCKA 5IV2B 4RWYH 4G7VH 1BOGB 1S7UA 1VFBA 1U0QA 4J4PA 1UZ6F 5BS0E 1DQDL 1KN4H 5EU5A 5FM8A 3S8WA 5I16B 4ZUTA 5AUMA 5L8JB 3AROA 4OIBA 2R1WB 3O81A 3HC4H 1PG7L 1I1AA 1YJDC 1QSEB 2P42B 4JAMB 3HMXH 2E5EA 1YECH 4S1DD 5EUOA 1MJUH 4RIRB 3SKOB 3TBYA 4XWOD 1M05B 3AREB 2HKHL 2BCKA 1WBYA 2EDLA 4FQIL 4QHMB 1KLUB 1KCRH 3QIWB 3SO3B 3DYMA 3PXJA 1F90H 3CDGA 3UBXB 4NDMB 3PWPB 4NQVA 4PV9B 3TNMB 2NY6B 2XXCB 3RFZC 1T0PB 1UM5L 3GRWA 1A6ZA 4X7TB 4FMFA 3WNKA 5DJ0B 4HBQA 4HKBA 2NW2B 4PREB 4X6CF 5ESQA 3F62A 4JRYB 5IW1B 2R0KL 2CPCA 2DWDA 1CN4A 2FIRT 4U49A 3QIBC 4DKAA 3VXRA 3RPKA 5DVNA 4NO2A 1LE5A 3PGDB 1EO8L 3E2HB 3QUYD 1YEIL 4CU6A 3TJEH 3QI9A 4C55A 5E7FA 3MA9H 5JXEA 4LVHB 1KC5L 4V2BA 3TO4A 1TVBA 1BOGA 2EICA 3MRRB 3DHJA 3L5WA 2BNQE 1ZLSH 4JFEE 3LEYL 3VFVB 1WV7T 4J3UA 3D25B 3KYMB 2BVEA 2HVJB 2ED9A 3GFUA 1B0RB 4WEBL 3DLQR 3CH1A 5D7IF 1DL7H 5T1KD 2XWTB 2RCSL 1LO2L 5F1OB 3IVKA 4YR6A 4ZTPH 3BZDA 3HCVA 1DQJB 4HHAB 4JAMA 2AEQH 2F58H 1QR1A 1KNOB 4JGMA 1C12A 1G1YA 3IDYC 3ARRA 4RBPH 1KCUH 3IXTB 1LP9A 5IROA 3S9DB 3RA7L 3RVWC 3SKOA 3AREA 3KLDA 4PJEE 3ZT7A 1J11A 1JI1A 1RIHL 3S35H 4WW1A 1KPVB 1KLUA 4U6XA 5C0RH 3QQ3B 4MDIB 5GIRB 1I8MB 5L88H 3TNMA 4WUUE 4RGNE 5TQ2L 4R97B 4Z78A 2GJ6B 1JZ6A 1OAKH 4FXKA 3Q0HA 4X7TA 3KPSA 5DJ0A 2NXZC 4DKEL 1AXSB 5E2WH 2NW2A 4PREA 5HHOD 1PAMA 2EDQA 5IW1A 3O8XB 3B6SA 5F89B 4GW1A 3O3AB 2C3XA 1CF8L 1E4JA 3ALWA 3NA4A 3PABB 1ZGLM 4FABH 3TT1L 2YXMA 1G7MA 4IEFB 1MLCB 4Z7NE 3OXRA 4ODVH 1MFDH 2OTUB 4POYA 2AS5M 4JR9H 5BRZB 4DOHE 3RVUD 4RAUB 5C2BH 1XCTB 1ZLWK 4Y4KB 3ZE2E 3OJVC 5EBWB 1FFPB 5EC2B 1GAFH 5DMJB 1AD0A 3JWOL 4MXQD 5EZJA 4K7PX 3WJJC 3AVEA 3U1SH 4JPKL 4MVBD 4UAOC 4HHAA 3T77B 4C56E 3T2QA 4DGYL 3ARFB 3O3UN 2P7TA 2N4IA 4G9DB 3IXTA 1MCIA 2Q7NA 2Q3ZA 1BQHA 4KROB 4NQDA 3KXFD 2B5IC 4P2OC 4JO4H 5LQBL 4Q9RH 1NUGA 2X1QA 2D0GA 4UTBL 3V4UH 2VXQH 4XGZB 5CSGA 1KPVA 1OOAA 3ETBF 4O02L 5H37H 4MDIA 5JPMA 1D9KC 1XF2A 3RTQB 4RNRB 3RBGA 4PJ8B 2R56L 4MCZB 1IFHL 2GJ6A 3MLZL 2BX5A 1D6EB 1AXSA 3CD4A 4OBSA 2Q7YA 3O8XA 4PJCF 1P7QB 4MZ3A 1H8SA 1WAAF 2CLZB 3KLHC 1TCMA 2ZG2A 4L8DB 3V5DA 1AO7E 2Y4SA 4GRWE 4XBGB 3PABA 2I24N 3RU8L 1MLCA 5DDHA 5C1MB 4OLWH 4PJ7F 4RMTA 5C6WH 5LGKA 1HHIA 3U4EA 4HF5L 1NC2D 2UY7A 5BRZA 3GMMA 1F00I 1AHWA 2VWEC 4RAUA 3QUXC 4NN5B 1MCRA 4X6FA 4LDOB 4DN3H 1FNFA 4YXHH 3SDDD 1A22B 1WITA 1UZ8B 4LVNC 5EC2A 2QQKH 3INUH 5DMGC 1A1NA 4G6KH 1MCPL 1TCRB 3T77A 1T80A 3SDCD 3ARFA 4MD4A 1HHGA 3SQBA 2IPTL 2IBZY 1G6RH 5I30H 4UDUB 3TO2B 3FL7A 2OK0H 1U8IB 1LEKA 5ERWB 5J12C 5FM4A 5JA9A 1A7RH 2AEPL 1KGCD 3VH8G 4RAHA 4XGZA 4HPYL 1DR9A 4U1NB 1E4KC 4HD9A 4UOW1 1RZIA 3RTQA 4BSWA 1HN1A 2RBLA 4PJ8A 2YWYA 1J1OL 1I1RA 4LPTA 1F4WH 1D6EA 2EDKA 4IHOB 4X6EA 4NGHL 2CKBB 2NY0C 2PKDA 5BVPH 4L8DA 1CGSH 2Q8AL 4XBGA 4ORZC 1S8DA 43C9B 5GS0C 1PEWA 3ARDC 4ZFOB 4NN7C 2R0ZL 4LQFL 4JY5L 3PWUB 1EZVY 3QFJD 3MUY1 5GGUB 1ZXQA 2W9DL 4MAYA 2GK2A 9CGTA 1IAOA 1FNHA 3NZ8B 2XA3A 5F6HI 3MNZA 2XQYG 2EIDA 4JDTH 2IJ0C 3TV3H 1UZ8A 1XGQA 3HUJA 3MV7B 2XKNB 3PP4L 3BN9D 5FV1L 1C16A 4G43A 5CGTA 3GIVB 1TCRA 4HUMB 4WFHD 1V8HA 3U7YH 3CXHJ 3DRTB 2OTPA 4QRPE 1DN0A 4Q6IC 2E6JA 3QIBD 2X09A 2AABL 3VW3H 2DQTL 4UDUA 5FYJL 5DQDL 2NTSP 5L0QC 1U8IA 3SDXF 4FFZH 3RKPA 5FYLD 4U1NA 3LQAL 1C5DA 4XAWL 3CSYB 4S1SH 5B38A 1IL1A 1FJ1A 3P0VH 4NUJB 3NFNB 3OKOB 4UQ2A 4I3SH 2P47B 1W72B 2QSQA 3C87A 3E6HB 3BRDA 4I2XA 4BQCA 2PR4L 1NCBL 1JF1B 1CXFA 2R0WH 5DK0B 1NSNH 4FQCH 1QACA 2CSPA 3BWAA 3D9AH 4Y19D 5D5ME 4PTTA 5CSZB 5F3HB 2FX7H 3MCLL 4DN4L 1UWGH 2DQFB 2C3GA 3PWUA 1JRHI 3FO0L 4XMKH 3RVWD 5F7NC 5CMAB 3S6CA 1AKJD 2H41A 3MR9B 2VAAB 1FCGA 2GYSA 1UFUA 2VLRB 4PJDB 1EHLH 2Y6SC 1JJUA 1FVEB 2Z92A 3EFDL 4PY7A 5DUMH 5E8PA 3QXVA 3Q6GH 3K46A 3T8XB 2Q8BH 3CDCA 2DBJA 4L3EE 3ULSB 3NFPA 4RQQB 2NXZD 3ZDXF 4QY8A 1INDH 4PRHA 1M1SA 2BY3A 5TE4L 3SGJA 1I1FB 5CD3B 2ERJC 1AQKH 1L0YA 4EOWH 2X9YA 3DO7A 1N59B 1EAJA 3CK0H 5D7JB 2CXGA 3P4NA 2F8XC 2BNRA 2VRAA 4AY0A 1T5WB 3GK8L 3QUZA 4FQXC 4MD0A 4UV4H 3RGHA 3QWQB 3CSYA 4PRID 2OJEB 3ZYJA 2YPLE 1QBML 2YPKB 5I74C 4Y4HB 1U93A 4HUXB 4MMZC 1GH7A 1H3PL 1K8DB 1XMWA 4YC2C 4CDGC 2HVKB 4LDLB 1BJ1J 3MA7A 2V2TB 4HIXL 2J88L 4QHKI 3GI8H 4Y1AA 4PRDB 5DK0A 4NQXB 1JNNL 5FGSA 2BRQA 5K9OB 1QFUH 5F3HA 1BF8A 5AAWA 4NHUA 2V9RA 5EZIL 3FT4B 1XGUB 4M7ZC 3RWCA 3S96B 4P2OD 1BLNA 1U42A 4C58B 5CMAA 4L8SC 3FB6A 4PTUA 2YK1L 4U6HA 2D7TH 1NLDH 2VLRA 4PJ5A 1JGLH 2R4SH 4APQC 1FRGH 1FVEA 1G7IB 5DWUL 4OB5L 2VITA 5T3ZD 1BECA 1D9KD 3PGFL 3HZKA 3KPRD 2EIZB 3QJFA 3MJ9L 1GPOL 1AGEB 2PO6B 3RPIA 1Y6KR 5IEKB 1LO3H 2H6PB 1LEGB 2AI0L 1FDLL 3QDJE 3ULSA 3UTTB 4MAUL 4NM8H 4ODTH 3EYSH 3KLHD 1N59A 1EVTC 1T66C 5A43C 1QO3B 1CFTA 3ZKNC 4Q7DA 4S0TD 4OZIE 1T5WA 3SGKC 1QPXA 2OJZL 3SE4A 4EN3B 3GSVB 3LKOA 2IPKB 2EE3A 1AXTH 4M1CC 3UZVB