3N1GC

Crystal structure of dhhn bound to bocfn3
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
ERPVAGPYITFTDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDKYWHSISHLQPETSYDIKMQCFNEGGESEFSNVMICETKARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Desert hedgehog protein
publication title All mammalian hedgehog proteins interact with CDO and BOC in a conserved manner.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 104
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3n1gC01
1GC1H 4P46A 1WCBB 4PJFE 4NQDB 4KAQH 1E27B 4JVUA 2E7LA 2LU4A 1MI5E 2O5XH 3DV6B 3I6GB 5CBAA 5I2IA 3CFDA 2XY1A 3RVWC 1JTPA 4PREA 1S7QA 3MOQA 5BQ7B 1JF6A 4TRPL 2W9EH 1JF1A 3BZ4B 1HN1A 3ZKXC 5ISZD 4I0KA 4Z7UA 1O7SA 3N85H 1CN4A 4QHMB 5ELIA 3QJHB 4KJYB 2R9HD 4QY8B 5TF0A 4M7LL 2P47B 1GZQA 2CLVA 1FO0B 2DICA 1C5DA 4DCQB 4HIJA 2C1OA 3G5ZA 3OGOE 4IHOA 5C0JB 2VLKE 4F57L 2X4OB 3CMGA 3DRQA 4QKXB 4MGXA 4PRBB 5DRWB 3BGAA 4U0QB 5E8NB 5JDSB 2R9HC 3ARZA 1I7TA 4HKJA 3A6CL 3FT3A 5HYQB 3ARED 3EYUL 1EEYB 2AV1A 4B50A 5DO2D 3PHQB 2K1MA 4QT5A 2GKIA 2BVOB 1B4RA 3P4NB 1J8HE 4OF6A 4R2GB 5IG7B 2F58H 3D2UA 3GSQA 3MA9H 2EDBA 1CXEA 3MRPA 5CLTA 3TH3T 2FWOB 1BJMA 3L7FB 1NEZA 2XG4A 4PJBE 3AREC 3N06B 4PJFB 3F58H 3B4NA 5DO2C 1I8LC 1U93B 1Q94B 4UDUA 1HI6B 1PZ5A 4PJIA 2WBWB 2VDMH 3BOVA 2B1HL 2X4QA 5SWZE 3ARGB 4LARL 4M9OA 3CCHA 3D6GA 5DD3L 4XP1L 1T03H 1G0XA 1BFTA 3V9FA 3E6HA 5HYSG 2CXKA 3QQ4B 2VWEE 1V8HA 3RTQB 3LS4H 4OFIA 2ZUQC 4YHIB 4FFYH 5K33A 5BS0B 3U0WL 3CVIL 2VLKB 4XC1L 4XVSH 1TCMA 5C6WH 2OTWA 3WMSA 1QNZH 2FB4H 1N3NA 1UJ3A 5HHNA 4KHTH 4UIMA 1H0DA 5EZJA 1BQHG 5JHDD 4YDKL 1FLTX 5IVXA 1HH6B 3SKOB 1HHJA 1YYML 2DM3A 2Q6WA 5JPNA 4PJAB 4X9GA 1I8IB 1XCQB 4JJ5B 4PJBB 1QSFA 4LSVH 2K7PA 4Y2DD 1T1ZB 4NKQB 4G6ML 1DQJB 5E5RB 3OB0K 5SWZB 1FL3B 4Y4KA 3KHOA 4DKDC 2AJZA 1JZ8A 1SY6A 5GRZA 3L3HB 5E4EB 2P8MA 1JPTH 3KYMA 4Y2DC 5FDYA 5HHXH 5F1IB 4HWEL 4ZFOA 5D9SB 4G8GD 5ENWA 1OCWH 2Y1VA 3QI9B 1ZANH 3QEQA 3QNYA 3Q6FB 1NKRA 1Y0LA 3BMVA 2YZ1A 1JPST 3X3FH 3V52H 2JE8A 3O2DL 2P49B 4KRPD 3TVMD 5FOBA 1HYRC 3F6LA 4YFLI 4JFQB 5I0ZA 4IIQC 1KJMA 5T3XL 5A40E 5DZLA 4D8PA 3IU3B 3RKPA 4LGRB 1U8MB 1F3DJ 2XNAB 2ZUYA 3RQ3A 4OFPA 1MWAA 1EEQA 1BVLA 4JQXC 4KRPC 3IDYC 4NZJA 4Q6IB 3TVMC 3KVQA 4PRNB 4LLDB 3VFPA 1SEQH 1V7MH 4MA8H 5DXWA 5DMIH 1H8NA 1KJVA 2Q87A 1TZIB 4K7FA 1N6VA 1NBYB 1XEDA 5J56B 3L3JA 4AZ8A 2AK4E 2YD1A 2R2BB 4PUBH 4JFDB 2D7PA 3PWJA 4N0FA 4P3WA 1J1PL 1AP2B 2R29H 2KL6A 1WTLA 2FX7L 2ZCLH 5DC9B 3GMNA 4OD1H 4FQJL 1EH9A 2GYSA 3SOBL 4NRXB 2APXA 3GMMB 1XR8B 4KDTC 1CCZA 3BFOA 3MBED 2YMXL 4NP4L 4C55A 4XBPA 1V7NH 2ENSA 4R3SA 4N8CH 1NAML 4UUJB 1HSBA 2AKRB 3MNWA 5J8OA 1NLDH 5I75C 1D5BA 4NQXA 5CP7A 4LBEA 2E27H 5C09B 4WTXA 2GSIA 3QWRD 4PG9A 3I02A 1U8QB 1V3MA 5JXAH 5ICZA 1WITA 3MBEC 5JOEA 5IK3A 3LOWA 4GAFB 1KJ2H 4HUVA 3NAAH 5GGVH 2IANE 3BAEL 4MHHG 1OWWA 1PQZB 4P57A 4QXUH 2L0DA 3VGFA 3BP7A 2OI9B 5HHMD 3J8F7 2RBLA 3O2VH 1GJIA 5M7QA 4I48B 5T5FH 2B4CH 4NJAH 4W6YB 1W0WA 4XP5L 5GS0H 5BO1H 5IFAH 1KCSL 4UDTA 4UTBL 4IDJH 4IEFB 1FZOB 4OCRL 5DT1L 5B39A 4HIHB 4LEXH 3TIEA 4DKFL 1NL0H 2VDLL 3CXHK 5FHBH 5FB8B 5FDWB 2G75B 4KY1H 4P2RA 1G7PB 2EDRA 3S35X 5LBSL 3LKNA 3ZZ1A 2G5RA 1JV5A 5EO9B 1KT2A 4HUKB 3RWJB 1BGXL 3RGVA 1NCTA 2Y7QA 4M8QB 4NKDA 4UIKL 3V6ZA 5LXGL 5MI0B 4LDLB 3HE7A 1JI2A 3L5IA 2PETA 3WUWA 1CF8H 1SHMA 4QF1B 3D69B 3H0TB 4ZO6A 3L5WA 1IBGL 1VCAA 4F9LC 3RWGA 4MA3A 1Q72L 1C8PA 1UG9A 3I6KA 4WUUD 1NFDF 3HAEH 5J13C 5FF6A 2B8OT 3MUGB 1HWHB 4M6AA 2YWYA 1DUZB 3VE0A 3E2HC 4JEGB 5I1CH 3QP3A 2IANB 1LO5B 5JW4Q 3RNQA 4YPGA 3IFPA 3RBGA 1OOAA 5F96L 2PXYA 3VCLB 2WBJB 4YX2H 1CTNA 3VI4F 1KGCD 4JREB 1Z0MA 1ROWA 2VDQL 2EYSB 4QRQB 3H3PL 1WIPA 3FN3A 2J7LA 2ZG2A 4FQPA 4TUOB 2P5ED 1QA9A 1V3KA 4Y5YC 5C07A 1FL5B 2VISA 3TIDB 3PWNB 3K4DA 1EEZB 5AZ2H 2QSCH 2IMNA 3HHRB 3NCJL 1IGTB 4OIIL 2VRAA 1U8KB 2DDQL 4N5ED 3QCUH 1R3LB 3IAQA 1ZHNB 3ULSA 3KPMA 3B9AA 5AUMA 3O81A 3HNVH 2IMMA 1GH7A 1L6ZA 5I71C 3GSNB 1KUMA 5IB2A 1A6AB 3QG7H 4IRSD 3DGCR 2QBWA 5D7IE 1DQLL 4X8XA 2HKHL 2YWZA 4N5EC 5H94A 3LZFL 2HFGH 5D7SL 4R9HA 4YDIH 2H26A 3IFLH 1YN6A 2V5TA 3L3KB 2IPUG 3RY6C 1BD2D 3LQAC 1U3HA 1YNKL 2G5BA 5CZXD 4IRSC 2PR4H 1U3YA 3TBYA 3WFDH 1K4DB 4R7DA 3U9PH 5F97E 1XGUA 3MUJA 3SKUD 5ISZE 3CDGB 4I13B 1PG7H 4U6HB 4BZYA 2N1KA 4R0LC 1FE8H 4OZHF 3EO9L 4HV8A 4S1QL 2ERJB 5CZXC 1XF1A 3ARDA 4JG0L 4QHNA 5GXBB 4PJHE 4HLZG 1SY6H 4XMPH 1F11A 3BQUB 5E6IB 3W11D 1E4XH 3SDDB 1CZ8L 1J86A 2BRQA 4LSPH 3DGGA 1DCLA 1Z9LA 1E4KC 1C16B 4OGZA 4ZS7H 3D0VA 3VFRB 2BCKB 1HHIB 3UROR 5ICXA 3NA9L 4MLIA 1BLNA 5HYFA 2XWTA 4M5ZH 4FABL 4O2FB 2AJ3A 1FQ9C 2ICEA 3OAYH 4EOWL 3BRGC 1FNGA 3ARPA 3W11C 3RKDD 4BFBD 5D7IB 3FQRB 1CD1B 5FAAA 5JOFA 3ZKXB 1CDGA 2CLZB 4GUPB 3FONA 4RGOL 1AH1A 3NACH 4RRPG 5F93C 2I60L 4MDIB 3RKDC 5ABDE 3HPJA 4L29B 2EDXA 2HA1A 5I30L 4HFUL 1NANH 4Z5RB 3EZ8A 2CMRL 1HQ4B 2X9YA 1T2QL 4BZ2L 1R5WA 3OR6A 2LAGB 1SYSB 4POUB 1DEEA 2NY4D 4MJIA 1UXWA 3VW3H 3EW3B 4MJ5A 3EJJX 1KPRB 4PJHB 1CD8A 2BK8A 4YHML 1A64A 4MB5A 4ORGA 3GHEH 5CZVL 3T3MF 4LASH 3QCTH 4NZRL 2P5WE 5D2NC 2FD6H 4JFED 2NY4C 2EICA 2DOCA 2VIRB 3OKKA 4OB5H 3ZDXE 5FCSH 3AREB 5JLZB 2V9RA 2YXFA 1AIFA 5JHDE 3INUH 1O5DT 3BD3A 2IBZX 1MCWM 1WEJH 4KK6D 4KQ3H 4LFHG 2VUOA 2LU3A 1B9ZA 1NMAL 1MQ8A 1AQDA 1FL6A 4MQSB 1VSCA 3TN0D 3QFDA 4K8RL 4WHYH 3TT1H 1BP3B 3PDOB 5TF1L 4HAGA 1KC5H 4KK6C 1UM5H 4ZFZB 3EOTH 1OP9A 1GGCL 4XWGH 5D2LA 2JB5H 1C5BL 4JDVB 2VZ1A 4OV6F 1DQQB 3O6FD 3TN0C 5FA4A 3C5SA 3V0WH 4I3RL 1OB1A 5ECJE 3VXRA 4XPFH 1S7TA 4WCYH 1RIUH 4ALAL 1BZ9B 5F71A 3HFMH 3AUVA 3IDJB 1FFPB 1NLBH 1UWGH 4J3VA 5C0CA 1EJOL 1HZHH 4G8GE 3RHWF 4K9EH 3X14B 3MPCA 4PJIF 1LHZA 3S5LB 5JIHA 2HLAA 1QR1B 2YUZA 3O6FC 1OM3L 4AEHH 3O3DA 2IBBA 3SQOH 1M4KA 4U1NA 4NKOA 1S3KH 3ARFA 4XGZA 2ICCA 2DQHL 4G43B 2D0FA 2XZCH 3O4OC 5ITFA 3BP5A 3OR7B 4I77L 4EN3A 1H8SA 1E28B 5JHDB 4UTAL 4PJCF 3FO1B 1Y6KR 3VA6A 1F5WA 4F7PA 1KACB 4JGJA 1BWWA 4U33A 3RHWK 2JB6A 4Y2DB 1CE6A 1OP3K 3DX6A 5LCVL 5J06A 3U0PB 1AXTL 2OQJB 4PJEF 5KVDL 3VFMA 4NRZB 3WLBA 3FO2B 4HUUB 5TDNB 3G5XB 3O8XA 1AGFB 4P59H 4P9MH 5GISL 2R0KL 3HUJE 3FOMA 4XCNB 2GUOB 2JJWA 5JOPE 3VXUE 1K8IB 3GMPB 1UQSB 1CXLA 1NFIB 4G8GB 4LU5L 4OCWL 1CGWA 1URLA 4Z7WF 1KIQB 3DBXB 3U48A 3MBXL 1F8TL 1U8JB 3DOSA 3AMKA 4QXWA 5HHPA 4IIQB 1RZGB 5ACMA 5TQ0H 4BQ9A 1G0YR 1FVDA 1G6VK 1I1AA 1ZA3A 2BHUA 2C3VA 5I76A 4Z8FL 3F7RA 2RGSA 5ERWA 3SGDI 2Y36L 3IDYB 3TVMB 3H9SD 5F9DC 1IAOA 2EZ0D 5GIRA 1WF5A 1YMHB 3C5JA 1IGYA 3HR5B 5JW4M 3IAGC 5E7FA 2BNQA 3V95A 4QRRD 5DLMH 4PJ7E 1NGXA 1I3RA 4HS6A 4CADA 4NJ9H 3LEXA 4NC2B 2Z9TA 5B8CB 1U91A 2EZ0C 1QFWH 5M94B 3DVFA 4MNQD 4OTXL 5D1QD 3DVNB 1F3JB 1F4XL 3H42L 4Q97A 3UDWA 5HHME 3VXTB 3PGFH 5GGVY 1ZT1B 4IS6A 4XP6L 5T1KA 1EEUA 2MHAB 4Y16D 3HUJB 4FZEH 4ERSL 1U41A 3V7AG 4R4ND 2R2EA 2IAMA 1ORSA 4XMLL 1PEWA 1T4KA 3C5ZA 3CLEH 4K23H 1MHHB 4MLSA 2AVGA 4WI8A 5D1QC 2FL5A 3BP4A 4D3CH 2DTMH 5C2BL 4OGYL 3TNMA 3AAZB 2D31B 4QCIB 5KJRL 5I75B 5F8RC 2EDNA 3O2WL 2NW3B 1FAKT 4Y16C 1VEMA 1OAYL 2H32A 1I3UA 4M03A 1XCTB 4LPYA 1NGWB 4R4NC 5DD0H 2AS5M 3MBEB 2MQ3A 5TH2A 4KZEH 4ODUB 3IGAA 1FGVL 1UA6L 3FKUS 5C9JA 1MH5A 1JNLH 1W72B 2C5DC 4U1JA 1FV1A 5GSRB 1ZLUK 3NN8B 1BBJA 4LIQE 4PJ7B 3EYFA 4IOIB 1FORH 2EDLA 4LSUL 1SM3L 3V8OA 5B3JF 3ZKSD 4NO2A 4F2MA 4WUUE 4URTB 1MHEB 4MDJA 1WTGT 3D3VE 3C2AL 3K4AA 4U1SB 1OPGH 2YD6A 3VFOB 1T66D 4R4FH 4BUGA 1P7KA 4P46D 3O9WD 2QQKL 3B83A 2AJXH 3WNOA 5I15L 5E0QA 3WLWD 2JK5B 4DAGL 5HHMB 3BKML 3KLAB 5IBUB 5I1DB 1JHLH 2M26A 2MQ0A 5CLWA 4PJ5D 4ISVA 1T66C 2ZUUA 4KKCD 5IOPB 5DJYB 2P5EE 2MFNA 2VZSA 1IEBB 4P46C 4PJGA 4PV9A 3O9WC 5FO7B 5GJSH 5ID1A 2F5BL 1K8DA 3L5XH 3GBNL 5DQDL 4ODXB 3WLWC 4EUPH 2R56L 2LE9A 1T0PB 2QQLH 2E7LC 4D0CB 1UM4L 4P4RA 3RNKA 1ODAA 3P77B 2Z4QB 2V2TB 1KTDB 2KKQA 1Z5LB 2MQCA 1GZPA 1BJ8A 3T4AA 1CT8A 4KKCC 5J13B 4X4XA 2ZCKH 4KC3B 1D5XB 1QRKA 3E2HB 1BIIB 4HQQH 4K2UL 1QSEE 3DO3A 4JHAL 2H2PD 4I2XA 2FX8H 4XAWH 4M61A 1FCCA 5CGMA 2H8PB 4WUUB 1I85C 1PW3A 4OCLC 3X13B 3CFJB 4MB3A 4YDVB 1BD2E 3EOBA 2XZAL 3C60A 5LGHL 3STLA 2OTUA 4LLUB 4G6FB 3ZE2E 1D6VH 3HZVB 4Y5YB 1CBVL 4W6WB 4YDLC 2H2PC 1MJJB 3T3PF 1A7OL 3MLVH 2XQBH 2Y5EA 4HK3N 2EH7H 3MZGB 2XTJD 3KPOB 4G9DB 2EIEA 1RJLA 2P48B 5HHVH 1W2KT 5FYLH 4HZLB 3WEXA 2P5EB 2X70B 5I71B 1X5KA 1U42A 3UZQA 1AQKH 2JKXA 3EDKA 3MRMA 1UB6B 2XTJC 5HPOA 3VRIA 3CSPA 5IP4A 3THML 4Z95H 1IZJA 1TCRB 5IHUL 5MHSD 2HRLA 6CGTA 3REVB 3DUSA 5EZLA 3MREA 9CGTA 5HYSA 4IRSB 4EUPG 3MV9E 1AXIB 3CMOH 3FRUA 4XRCA 3TNNA 2W92A 2EO9A 2B20A 2NCMA 1NMCC 4MJ4A 2EKJA 2IBZY 4RQQA 4KQ4L 4AEIH 3VU2A 5T33H 3NFPB 1X5LA 2V2WA 4R0LB 4RWYH 5KTEH 4TNVF 3IU4L 5HDBE 1BD2B 3EGSB 1WFNA 4K3EH 3MLZL 2OX5A 4JFXA 1UJ3C 2YA1A 4M9PA 1QO3B 4NIKB 1QFHA 4NC0B 1BQHA 3CDCA 4WUKH 1N5YH 3GSVB 3MYJB 1G7IA 4BZ1L 5D2NE 2YS4A 1RMFH 1ZS8B 5DS8B 3NCFB 4X9IA 3V4PH 4EQ3A 4UT7L 4Y4KD 1NSNH 4OV5B 3R06B 5JORB 5IF0B 1U8LA 2X89D 4YXKL 1BFOA 3QIUB 1CDUA 4PP2A 5EN2B 4U1IB 4WEMB 3G04A 1DBKL 1ETZA 4M6NL 3K2UH 5DMJB 5DUBB 3UXFA 5L88H 4D94A 4LLWA 4LRIA 4JFEE 4Z77A 4NFDA 4LCCA 4UILH 4Y4KC 4ZUUB 3QEQD 5H35B 4QRUB 7FABH 4X4ZA 1YPZF 3BD4A 2NY7L 4HS3B 1VACA 4NM8H 2O93L 1MELA 2NY5H 4ODTL 4ELKB 1S7XA 5FO8A 5L2KA 1RUQH 1H3VA 2ZSWB 4KKLD 2V7NA 4XPTH 4OD3H 2C3GA 4J8RA 5F7EH 3S88L 4M3JA 1FVEB 3BUYB 4ONGH 5ACZB 4MCYA 5HJ3A 3LRHA 4L4TA 5IHLB 4FQHA 3VGAC 3OKNA 4GQ9H 5D2NB 4KKLC 1NUGA 3FQTB 5D4QA 4X4YA 4GMTL 4M6OL 2NY4B 3B5GA 5ILTH 3VRLE 2EIDA 5CEZL 4HXAH 3P30L 4MNHA 4K3JL 1MRCH 4NHUA 1WWWX 3PXHA 1JGDB 1KB5B 3TPUA 1B2WL 2OR9L 1MFEH 25C8L 2VABA 4ZXBA 2BDNL 4GH7B 2X05A 1WWAX 2VXSH 3GIVA 4HFWB 5D5MF 3DO7A 4JFEB 5HGDB 1T2JA 1V3LA 5K9QI 1G6RA 4BH7B 4GRWE 5F9AC 2UZIL 3LQZA 3EDJA 5I19H 2VLRA 3MC0A 2NMSA 1TJGL 3GI9L 1A7PH 2ARJB 5EH1A 1QPPA 3D5OF 4OLVL 4EBQH 5FKPA 2Z93A 3KR3L 1HIML 3TN0B 2ESVA 4O2EB 1XGYH 2X9XA 1ZVYA 3MRRA 2XKSA 4TSAH 2VMFA 1FFOA 4CL7A 3QUMB 3RU8L 5GZOD 4ELMA 5D71H 2X2YA 1AKJA 1RIHH 4LKXA 4WI2A 5GQBA 1U36A 1A3QA 2V17L 3JBG7 3DROA 5D1XD 2VDOL 3O6FB 3DSFH 1CFSA 2Z35B 3TYFB 4K55A 1KB9J 4XVJH 4KI5F 3O4OB 3WCYA 1MCIA 3FTGA 5GZOC 2B2XH 2OK0L 1C12A 2NW2B 3C2SA 2ZOKA 1BOGB 5D1XC 2BNUB 5FHAL 4R6UA 3RI5K 3CIQA 4YHKH 4AH2B 1A6UH 4GS7C 4PJDA 3UYRL 5K9OB 2X44D 3A6OA 3CK0H 4GRWB 3W9EA 4X7TA 1C08A 2BRRL 1OARH 3H9SE 1YEEH 4P2RD 4HGWA 5IB3A 4U1LB 5DEFB 2BOCB 3BUTA 1S7UA 3GJFH 4JRXA 4UU9B 4GKNB 1X44A 4QRRE 3RGVD 4KTEL 3P0VL 3QQNA 5KW9H 5FIEA 4XT1C 1A3RL 1I7UA 4PJXE 2Y5TB 2C7UB 1DP0A 1VGEL 3L95B 1F02I 1CLYL 4GW4A 4L5FH 4FP8H 5F88B 5AAMA 4F33B 3CLFH 1GC1L 1S78D 5IEHA 5HVGB 3MRQA 4KAQL 4NPYB 1ZA6B 2HFTA 3EYVB 1ZLSH 3P9WB 3UZVB 2O5XL 4TTGA 3M1BA 3RGVC 1R24B 3FB8B 4JO2H 5IV2B 2VC2H 2AJUH 3IFOA 3L3GA 2W9EL 3N85L 1S78C 5KVGH 1FZJB 1D5ZB 2PXYD 1R3JA 3OJDB 3CVHA 1CL7I 1M7DA 4KROD 1RK0A 4J4PA 3EFDH 2H6PA 3VFUB 1VDGA 3LEYL 3WSQH 1KIRA 1OF2B 1DVFA 5C07D 3LS5H 1AHWA 1P9MA 2PXYC 2BVUA 2CH8A 3H9SB 4KROC 1QLFA 2CR3A 2XN9A 4QRRB 3S3JA 1RZJL 3MA9L 5C86A 5DVNA 2EH8H 4PJXB 2VITB 3ARQA 5ACLA 3IETA 2JJVA 1J05A 5DJZA 3VH8G 4R96B 4WEBH 3WO4C 4PR5A 3F58L 5CJ8A 4MNQB 5D1QB 1O0VA 5DK2B 2VDML 2BXYA 1R3KB 4XB8A 1U3HD 2XXMB 5J4MA 1QR4A 3L3OA 4Y16B 4PJ5E 2BERA 5HYIA 3IS0X 1CWVA 2EEAA 4MWFB 3H2WA 3HCVB 1DLHA 1ZE3C 1IKNA 3NIGF 1LWRA 4L4JA 2V7HB 1T03L 2CKBA 3OWEA 4WHTA 5IB1A 1KLUA 2WUBH 3LS4L 1U3HC 3ARDD 1ZAGA 3EYSL 5FYKU 4EI6B 2PW1A 5EO1A 5HDLA 3NBNA 4XVSL 3ECBB 1C7SA 35C8H 2G2RB 3NFNA 4EDWH 1QNZL 4X8JA 1H5BC 2FB4L 4X7DC 4QRTB 3GRWL 3SGJA 3BPOC 5FUZH 1I4FA 1M6OA 4JE4B 4O00A 4PD4K 3RL1B 2HT4D 5J7CC 5F9WC 1EHXA 3CZJA 4I18C 1QUNA 5CILH 3KPLA 4HGKC 1CQKA 4UBDD 2XKUA 2DQDH 2DWDB 1NBZB 1MIMH 3RDTD 3BZFB 2CRZA 2VAJA 4LSVL 3RPIA 4GG8A 4YK4C 5DD5L 5LKNA 4P46B 5CP3H 3O9WB 2HT4C 4JO1H 4MSWA 2XTJE 5CBAB 3CFDB 4PRAA 5TDOA 4UBDC 4PJ5B 4PREB 4TYUA 1TQBC 1Q0YH 4LQFH 3RDTC 5IMKA 1JPTL 1FYTD 3BN3B 3NGBC 2FEDC 1IJ9A 4Z7UB 4RRPA 5HHXL 4NCDA 4NBYB 3MNZA 4FOMA 4Z7VE 5D7KD 2CLVB 4U7MA 1C5DB 1NAMB 2C1OB 3G5ZB 1ZANL 2J6EA 3BIAX 4XX1E 1KIPB 2O61A 4ZQKB 4IHOB 2Q8AH 3OF6D 5MHSE 4ZFFA 1A2YA 1JVKA 3X3FL 3V52L 1BF8A 3DRQB 3S96B 1VGKB 2FJGA 3FB5B 3ILPA 4CW1A 3KLDA 2NNAA 3LSOA 1WAAF 1QFUH 3QA3A 4PJGF 3FT3B 4YDLB 4RSVA 2AV1B 1JMXA 4QT5B 3MCLH 4L9LC 3BPLC 5IVXE 1MCBA 3ZKQD 3UO1L 4EXPX 3GSQB 1GSMA 3VFSB 1JK8A 1EMTH 4EEEA 3U2SA 3MRPB 3ROLA 1A9EA 2A2QT 4Y19D 4Q9QL 3ULUD 1NEZB 4HMDA 5EZIH 3I6LD 3ZKND 3GO1H 3V7MA 3RFZC 2XTJB 1SEQL 4UDUB 1VENA 1PZ5B 4MA8L 3RL2B 3HNTH 3CCHB 4GRMA 3HMXL 4RNRA 1WISA 3ULUC 1JWSA 5EORH 2QSTA 3L9RA 5CGYD 4PUBL 4M62H 3ZKNC 2VYRE 5J9PB 3GEWB 3VXRD 4Z7VB 3DI3B 2R29L 1NC4A 2Y4SA 3PDGA 1NMCB 4OFVA 3P3YA 1Z9MA 2Q7YB 4FQIL 4YBQD 3MJ7A 4OD1L 4APQD 3KGRA 4MX7B 5ANMA 5FYJH 5HI5D 1U58A 5JMOC 4M48H 2XWJB 2FEEI 3QEQE 5CGYC 3K4ZA 1V7NL 5IJVA 5DK0A 4N8CL 4L8DB 1G0DA 1UJ3B 3TF7C 4YBQC 3QRFM 1NLDL 5IB4A 1MOEA 5EZJB 4APQC 4EVNB 5HI5C 4P3DA 4WGWB 5IVXB 4RIRB 4NQCA 5JXAL 4HWBL 2Q6WB 5JPNB 4O51B 4LP4A 1KJ2L 5INDA 3BMWA 3NAAL 5GGVL 4WHDA 3LN5A 5DR5H 4J3TA 3O2VL 4JLRA 4Y4KB 1U8PA 5T5FL 2B4CL 4NJAL 3NZ8B 3B5TA 5GS0L 2AJZB 1XMWA 4ONHB 3O8XD 5BO1L 5IFAL 4X4MA 4IDJL 1DN2A 2P8MB 5GGSB 3KYMB 4M7KL 3PQYA 3OKOA 4ZFOB 3KPRD 4GLRI 5C3TA 4HD9A 1NL0L 3CVHH 1QBBA 5FHBL 1OAZH 1KELH 3QYCA 2EEBA 4KY1L 2JCCE 4CU7A 2ICWJ 1JYWA 3BP6B 3O8XC 3QEQB 4JKPH 3QNYB 3F7YA 1Y0LB 3PWLA 2N7AA 4LPWA 2IH3B 1OT2A 2HVKB 4H26A 1CD0A 5K9QG 3JTSA 4NN7C 1I9RH 1CF8L 5I1AB 3VGAB 2JJTA 4XNYH 2WWMD 4S0SD 4D8PB 2BNQD 3AMLA 4H88H 1U0QA 1Q9OA 4DK6A 2NTFA 4I0CC 3WS3A 1HOCA 5I1CL 1MWAB 4LCYB 1BVLB 4AIZB 4YDJB 1S9WA 3P73A 1SBBA 2WWMC 2IGFH 3KS0J 3VFPB 2P45B 3RZWA 1GGUA 4YX2L 3TCLB 1UT9A 5SWSA 5EBLB 1PFCA 1KJVB 3CC5A 5T1KD 2W65B 4FQXA 4AT6B 3DIFA 1GGTA 4LHUA 2IAMD 3L3JB 3C5ZD 5AZ2L 2YD7A 3PWJB 4N0FB 4X6DA 1IAMA 3HRPA 2P44B 3WIIH 2JCCB 4ZSOE 2J5LB 3UDWC 1T3FA 3CD4A 3DARA 3GMNB 5FUOH 1YN7B 2GITB 4P2RE 3HNVL 5E2TH 3CFKB 5I8CA 4P2QA 2EC8A 2IAMC 3GFUA 3QG7L 3C5ZC 3V5KA 3SO5A 2YPVH 3SY0A 4MD5A 2HFGL 3PNWA 4YDIL 1D5BB 3IFLL 1T1XA 5CP7B 4KVNH 4HIIB 3WFCH 4PG9B 1LEGB 3EOYG 2DN7A 3QHFL 2YR3A 2PR4L 5CEZD 3WFDL 5H37G 5IK3B 3U9PL 5D1XB 5EU3A 4HUVB 1PG7L 5SV3A 2XY2A 2CK0H 4P57B 4GS7B 1H3WM 1FE8L 1TNNA 5I17A 3CFCH 5I1HH 1PKQA 4JPWH 3JXAA 1LK2B 1SY6L 5ADPL 5I8OH 1DQMH 4JO4H 1E4XL 4UDTB 3ALWA 4LSPL 5F1OB 1SJXA 1UYWH 4OZFA 5C07E 3TIEB 4X6FB 1EVUA 2DLGA 4P2RB 2J8HA 1ZEAH 1LP9F 5IW1A 1MLBB 1KT2B 4JZNB 4G6KH 2OXGA 4GJTB 4DGYH 3RGVB 4RFOL 1EFXA 1HNGA 4UQ2A 1FH5H 5I8EA 3WUWB 1H3TA 5E8PA 3KPNA 4RDQG 3V4UH 4KKBD 4PJDF 3QFJA 3NACL 4FQQA 3L5WB 4MZ3A 4FTVA 3RWGB 4MA3B 3SDYH 3O3BA 3CFBA 5FF6B 3L7EA 5C7XH 3CFEB 3C60D 3H7LA 3RNQB 5JTWA 3PP4H 4KKBC 2ITCA 3P9MA 4U1HA 1BBDL 2PXYB 3VW3L 3FAXA 2NXZD 4MQTB 3RWDA 4KROB 4U0RC 5E00A 1B0RA 4KDWA 4FXKA 4H20H 3GHEL 3C60C 4LASL 5SWQB 3QCTL 5IKCA 1NBQA 2D4FA 5C07B 4ZPVA 5DHYA 3NCBB 2X4RA 1IL1B 3T09A 2NXZC 3Q5OA 4OB5L 4MYWB 3WO4B 4NQEA 1J0KA 4HIEA 1RULH 1EV2E 3AU1A 1JPFA 3HG1D 2LQRA 3INUL 3GSUA 4PB0H 3BPNC 1WEJL 4XP4L 2ID5A 1A4KA 4P49A 5IB2B 5KVEH 1OAKH 2R1XA 3H7BA 3TESA 3QG6A 4W4OA 2F8VA 3TT1L 2GAZA 1EAJA 5A2FA 1UWXH 3O11B 3FCTA 1GC1C 1KC5L 4Y89A 1UM5L 4OZIE 1U3HB 2G5BB 4OLWH 4QTIH 3MRFA 5C0FA 4XWGL 3TBYB 4ZYKB 4FHBD 3VDCA 2JB5L 4R7DB 1ZLWK 5DD6A 3KPSA 3O3UN 1XGUB 3V0WL 3AM8A 1RZ8A 1VEOA 1FYTE 4P4KA 2C26A 4WCYL 4D9LH 1RIUL 4IMKC 1H5BB 5TE4L 3RAJH 3HFML 2F54A 5T1MA 5E9DE 1UWGL 5DWUH 3ULVD 1HZHL 1I1CA 2YEZB 4Z78A 3ARDB 1J88A 4QHNB 4K9EL 2W0PA 5F9WB 1VFAA 3DNKA 1F11B 4IRJD 5CBEB 2ZZUT 4I18B 4XNXH 2EEDA 2AEPL 4AEHL 3DGGB 3SQOL 4NQDA 1S3KL 1E27A 3MRHA 3I6GA 2XZCL 2NQCA 3D0VB 3DV6A 4KI1A 3ULVC 3S8WA 5J0BA 1C1EH 4HXBH 3GIZH 1TJHH 4YK4B 2XWTB 4YXHH 2WK2A 1ORQA 2ICEB 2AXGA 3BZ4A 4IRJC 3DMMD 3N1PC 3KYNA 2X6MA 3GBMH 4RDQF 4QY8A 4LGSB 4H1LB 3U6RB 1TQBB 1RZJC 2HT3D 1EJ6A 3RDTB 5L2KD 4DCQA 4LCCC 3NGBB 3Q5YA 3LKPA 4Y19E 3ULUE 4NO3A 4YFDB 3FONB 3I6LE 5C0JA 4OZIB 2CK2A 2OZ4L 3MROA 3DMMC 4BKLA 5KVMC 1YUHB 2NY3D 4JN1H 5DRWA 3RVUD 1A14H 3HPJB 5JDSA 3WIHH 3UPRA 2H9GA 2HT3C 4P59L 1W0VB 4L4TD 4P9ML 3ZL4H 4G8IA 5HYQA 1FYTB 1EHAA 1EEYA 2IPUK 5BV7C 4HGMA 2LTQC 1R5WB 1CLYH 3P4NA 3AS3A 5DVMA 1DEEB 4WFHD 1UXWB 5IG7A 3VXRE 2CLRB 5HVWA 4HJGA 1CLZH 2NY3C 4FQCL 4OGXH 5EOTA 3RVUC 4ORGB 1LD9A 5TQ0L 1FNLA 4G80B 1MCEA 5CIPA 3C9NB 5D8JH 4XPBL 4PJFA 3BPLB 2L7JA 1A6PA 5DVKA 3U0TA 1MI5A 1Q94A 1HI6A 1FFNA 1RQ5A 2R15A 3U36A 1H8OA 1GXEA 2YRPA 2A83B 2COQA 2FHCA 5I1GH 1KOAA 3GZKA 4FQ1H 5BW7C 2CQVA 5GS2D 2VLRD 3MX0A 3FQXB 3CFIC 2VDNH 5DLML 2CDFA 4NJ9L 3VGEA 3QQ4A 1CXKA 4FZ8H 3RTQA 4Y19B 1AQDB 4U6XA 1FL6B 1RD6A 5CS7A 4YHIA 3QFDB 1QFWL 4JFPA 5FEBA 5FKAA 3TBTA 3PGFL 1LO3H 3TYGH 4OZGE 1ZWIB 4JFZL 4FZEL 4OQ1A 4WVRA 5D2LB 4M43H 5HXMA 3CLEL 4K23L 1U6AH 1OB1B 1J8HA 1HH6A 2PTVA 3VXRB 1TQCC 1S7TB 2APVA 5FECA 4D3CL 2DTML 4DKEH 3KPRE 2EXYD 3SDXF 3IS1X 4UV4H 4WI4A 2ZG1A 2EE2A 2DLIA 3MACH 4APQB 4NUJB 1I8IA 1ZVSB 3JWNC 3WNMA 5E8OA 4KJQD 3W5NA 5DD0L 3MRIB 1TNMA 5JQHC 1Z2KA 3O3DB 5DRNB 4KZEL 4U1NB 4NKOB 1F45A 4XGZB 2E7BA 1FL3A 4Y5VC 1JNLL 4WTZA 2EXYC 2Q86A 3UPCA 3SE3A 4FA8A 2IG2H 2WV3A 1HILB 4KJQC 1FORL 5EOCJ 5F7UA 5D9SA 1KENH 4V2BA 4OKVB 1OPGL 3RUGE 4NDMA 4R4FL 3QI9A 3T0DA 4MQ7A 3ET9F 4OCXH 1CE6B 3DX6B 2KUTA 2AJXL 3U7WH 2XZZA 3HNSL 3VFMB 1JHLL 1I75A 3RZCA 1J0JA 1OL0A 4OZGB 4Y8AA 3O8XB 2I9LB 4DFIA 2EIBA 4NUGH 2HG5B 4JFQA 4PFEA 2ENYA 5GJSL 3KPRB 3GSOA 3L5XL 5IMLB 1T7XA 1UB5A 1RZFH 3DHJA 2QQLL 4LSSL 4X9FA 4NN7B 1N4XH 3S4SA 3JSSA 2WIIB 2C3HA 4C59B 4GO6B 4OSUH 1KN4H 1JRHH 2JJSC 4PRNA 4IOFD 1WIUA 2VB5A 5I76B 1DBMH 3V79C 2ZCKL 1INEL 5JXEA 5ERWB 2WLZA 3QRGL 3IDMB 4HQQL 1TZIA 1CVRA 2FX8L 3QAZC 5GIRB 4XAWL 1YQVL 3C5JB 4MXQD 4BSVA 2L4OA 4F7EA 5J12C 2BNQB 2XN9D 3Q48A 4IOFC 2R2BA 4YZFF 3H9ZA 1P84K 4KTDL 4TULH 1L0QA 1I3RB 4O58L 3RUGB 1AP2A 2JIXD 5F6IC 5CEZE 4UOW1 4LSDA 3LEXB 1D6VL 1WZ1H 3WD5H 4OM1H 3IDNB 3MLVL 4NRXA 2XQBL 4AY0A 3GMMA 2EH7L 4PRID 4MXQC 1SEBB 5HHVL 5FYLL 1QBLH 4UUJA 4IS6B 4WIQA 5HI4D 1Z3GH 5T1KB 4UV7H 2AKRA 5CEXB 1JGLH 3LMJH 4RX4A 2IAMB 4R97C 3ZSSA 4DQOH 2DS4A 3C5ZB 4KMQA 5T1LD 1U8QA 2WP3O 2GK0B 3B2UD 2DB8A 3S98A 1RFDH 4RMUA 4Z95L 2B7DT 1IEHA 2YA0A 4NCC2 1KBGH 1IQWL 5HI4C 3VXOB 3TO4A 1IE5A 1FGNH 3NH7H 2H32B 3U4BH 1PQZA 4HPYH 5TH2B 1KXQE 1RUKH 3MR9A 5HY9B 3CMOL 3BH8A 3BVNB 4A6YA 1MH5B 3B2UC 4L8SC 4OLXH 5IESH 4I48A 4AEIL 4JPVH 3LQMA 4U1JB 1FV1B 5C0DA 4KGLA 3FRPA 5T33L 2Z92A 2AK4A 1BBJB 3D0LA 1FG9C 4DVRH 4RWYL 5KTEL 2V5RA 1UWEH 3PV7A 4NO2B 1HHKB 4M3KB 4JDZB 5IFHL 4K3EL 3BXNB 1HQRB 4MDJB 1FO0H 2DLFH 1FHGA 2ZWLT 3MCG1 4JY4A 5FB8A 4JRWA 5FDWA 5E1AB 2G75A 3ARBD 3OX8A 1A1NB 4BJLA 3ARYA 5GGRY 1RMFL 3MOAH 2CD0A 1NEUA 2VXTH 3V4PL 1JZ5A 1FYHB 1Z6JT 1YEGH 3V5DA 1NSNL 1SJEB 3EHBD 1J1XH 4ISVB 1UCBH 4M00A 5C6PB 4UB0H 1JNHA 2PYED 3ARBC 3D69A 4TSBH 2UY6A 3K2UL 5KSUA 4PV9B 1EUTA 5L88L 4Z7QF 3AFLA 1K8DB 1KYOK 5CJ5A 2EE9A 4K94H 3MUGA 4EDXB 3EHBC 1DUZA 2UZXB 3CAFA 2W9DH 2IANA 3HG1E 1LO5A 7FABL 2D7TH 2VUYA 1GZPB 3IKKA 3MUZ1 1T89A 2NY5L 3VCLA 1MRFL 2QQQA 4CN4A 5SX5K 2W0FB 4JM4L 4H5SB 3BRDA 1VKXB 2DWEA 5EC1B 3D39D 4QRQA 2ZNXA 2ORBL 4I2XB 4OD3L 4NSKA 1AR2A 5F7EL 3TIDA 4U0RB 2DJSA 1A6ZA 3CU7A 4ONGL 1GGBH 2Z31D 1IGIH 2DQIH 3OL2A 4PPTA 1U8KA 3C60B 3STLB 4NHCH 5F7HA 3S97C 1R3LA 1CFQA 2P8PB 4GQ9L 4H8WH 5ILTL 4E5XA 1LO4H 2NXZB 4HXAL 3T0AA 4LFHD 1MRCL 1MAMH 2Z31C 5F9OH 1MFEL 3BPNB 2BHYA 1YJDH 3JWDC 3QDGD 3RIFF 2VXSL 4P0DA 2QV2A 3MRMB 5H2BA 5BZWA 4KU1A 3VRIB 3MGAA 4HKBA 4X7FC 1PSKH 5KOMC 2OXHA 3HG1B 4JPIA 5ALBL 5I19L 2UUDH 1K3ZA 3CDGA 1A7PL 4U6HA 1YY9D 3DUSB 5HYSB 3MREB 2FRGP 4EBQL 2NTSP 4PTUB 4XRCB 1UADC 4PG2C 4QOKD 3VFTA 4RQQB 5L2KE 4OJFH 5E6IA 3BQUA 4W4NA 3ESUF 5A1AA 3ME0A 4AMKH 4HSQA 1UXSB 1XGYL 2KH2B 2V2WB 3BJ91 4TSAL 3WFEH 1YY9C 5D71L 1RIHL 3WDHA 4DK3A 4X80H 4L4TE 3DSFL 1BQHB 4HDIA 5EUOA 1DANT 1MJ8H 4MA1C 4X98B 2GEEA 1TENA 5HYJD 1G7IB 2FH8A 1XGTB 1ADQH 4WFHE 5D7IA 2PF6A 2B2XL 4OCNC 3E0GA 4IRJB 2CLZA 4PP2B 4GKZB 1FAIH 5BXFB 1ETZB 5HDQH 2AGJL 4YHKL 1A6UL 1IAKA 2W60B 3CK0L 4LLWB 4Z77B 5J11C 4LCCB 3ZDYF 4I4WB 1D5IL 1OARL 1YEEL 3LN9A 5ISZA 3DMMB 4X6BB 3NCEB 1VACB 2VLRE 2WSKA 2NLJB 1SYSA 5KW9L 5BOZG 1UACH 1D6EA 5AD0B 4PJHA 4L5FL 5L2KB 1CDIA 4FP8L 4KV5E 1AXSA 1FCGA 1II4E 5BV7B 2LTQB 4N68A 1F4YH 1ZLSL 1X4ZA 3UAJD 4U3XA 3T0EE 2YK1H 2NY3B 1RAMA 4LVNC 4JO2L 2VC2L 2AJUL 2VIRA 3MMEA 5HJ3B 4L4TB 1ZTXH 3QHZH 4NWUH 1I8LA 4NFCA 5DUPH 2EC9T 4NQSA 4MNGE 1BAFH 3OZ9H 3UAJC 4MNHB 3EFDL 3WSQL 2KQNA 2VTFA 3QQ3A 1JF5A 4YHPA 1UVQA 2X10A 2XT1B 3RJDA 3PDOA 3GIVB 2DLTA 1TVDA 5JQ6L 1TZHA 4ZFZA 4AEFA 5DUMH 2DD8H 3VD7A 1Z9OA 2YOCA 1ZLVH 4Q7DA 1UKSA 2HJKB 3MRJB 3LQZB 1KPUB 5MERB 2VLRB 5JIPA 1T1WB 4P2QD 2EH8L 4P9HH 5EU7C 2DM4A 1BZ9A 3I3DA 3I3BA 2R39A 1FFPA 4PJFF 2B39A 5FKPB 2Z93B 4WEBL 4Y7MA 3X14A 4AIOA 3S5LA 3SBWC 4H0HB 1BF2A 1TQCB 2P5WA 4YNYB 1QR1A 2HTKD 2X1OA 4QHLA 3BIKB 3MRRB 4GOSA 3UMTA 3QDHA 3ZMRA 2X4PB 4LVOC 1N2RB 3K3QA 4ELMB 4G43A 2YRZA 3OR7A 4LKXB 5JHDA 4MD4A 1F6AA 3MZTA 5D7LA 2X1QA 2OYPA 4NRYA 3A67L 2HTKC 1D5MA 4Y5VB 3GSXB 2Y6SD 3F62A 3F7VA 5DRZB 4W6XB 4BUHA 2WUBL 3MLSL 4BQCA 5I73C 5DMGD 1NCDH 1P4BH 1C12B 3U82B 35C8L 4Y2DA 2ZOKB 3MUY1 8FABA 3IYLW 1U8HA 3VD3A 3U0PA 4EDWL 5BVJB 2OQJA 2GHWB 2Y6SC 4NRZA 4ZODA 3FO2A 5TDNA 3W9EB 4X7TB 4DKAA 3G5XA 4KVCH 5DMGC 1AGFA 4FN0A 4DZBA 4HGWB 2VLJA 3QULA 3FO9B 2YD3A 3V6FA 2D7QA 4JO3H 4BK4A 1S7UB 4PJAF 1YECH 2XN9E 4PJBF 5CILL 1UQSA 3X12A 2DQDL 5CSBA 5GJTH 2ICWI 4G8GA 1I7UB 5IQ7H 1MIML 1FNAA 3DBXA 3FFDB 1U8JA 4GW4B 5EPMA 4IIQA 3DX7A 3QUYA 1U8NA 4JO1L 1KLFA 1PX3A 4ODWB 4KRMB 3HC4H 2WWKT 4FTVD 4PRIE 1X5XA 3IKCA 1INDH 2K9UA 3M1BB 3CX5K 3L3DA 4JQXA 1Q0YL 4LQFL 4XCFH 4BFEA 3IFOB 2VAAB 5GRYA 2YN5A 4LCWD 1KEGH 4ZOAA 2AXFA 3WXVH 1YMHA 3HR5A 3RWHA 1NCCH 2OLDA 3FN9A 4F7MA 3GSNH 5TE7H 5GGTL 1R3JB 4J1UA 1VFMA 2VDRH 4XBGB 1RK0B 2KQMA 3QAZB 2H6PB 5T1DH 2C1PA 5J1AA 5J12B 2Q8AL 5DMKB 1IC7H 5HGGS 1QP1A 3DVNA 4BYHA 3JV4A 1F3JA 1A7QH 1QLRB 5F6IB 2QHLA 1QFUL 1OTUD 1P5UA 1ZT1A 2MKWA 1TLKA 1QLFB 2MHAA 3HUJA 3NCCB 4O02L 1FP5A 3MCLL 4KDTA 3BGFC 3VXUA 1UJTA 2XN9B 2BVQA 3B3IA 5MP6H 1IKFL 1FSKC 4YAQA 1EMTL 2JIXB 4L1HA 5HSFA 1J05B 1IGFH 1MAKA 1OTUC 3AAZA 2D31A 4FRWA 4QCIA 5EZIL 4R97B 4PR5B 2NW3A 3GO1L 1X6LA 4PRIB 1JGVH 1XCTA 5F3BA 1NGWA 2NX5E 5HHQA 3B9KA 4ODUA 2FIKB 5E2UH 5J6GA 4L8BA 4PJCE 4HWNA 3L3OB 1W72A 3O6LL 5EORL 5GSRA 5JZ7D 3KPSD 4CMMA 4M62L 2PYEE 4P4KD 2MNUA 4JCMA 4PJ7A 5T1LB 2UZYB 3QWRA 4U3HA 4IOIA 4WHTB 1N7MH 4L8SB 1KLUB 4PGZA 3QO1A 1YEKH 5FYJL 1LE9B 3ZTJH 4M48L 2PW1B 4J2XA 2P1YA 5EO1B 4PJEE 3S34H 2X4UB 5JZ7C 5T5NF 4P4KC 4TUJA 2JK5A 2Q7NA 3VG9C 3Q6GH 3KLAA 3QXAB 3C8KB 5I1DA 1SQ2N 4C83B 1NGQL 3O4LA 1MHCB 1M6OB 2ZSVB 3D39E 2UWEA 1AFVH 1QSZA 3BPCA 4LDEB 5DJYA 4Z7WE 5EOQH 4WI7A 1IEBA 1YC7A 4RFNB 5L0QC 2P24B 4ODXA 1JYXA 2F5AH 4D0CA 5FYLD 1Q1JL 3ARBB 3RPIB 5DR5L 1Z5LA 3U30C 3NFSL 1QHPA 2XV6B 3ZYIA 2GT9A 4PRAB 1D5XA 5C0RL 1BIIA 2EDFA 5DJ6A 3C87A 4KUCF 1TETH 4JFOA 4LCUA 2PYEB 1CE1H 4HCRH 3QDGE 3D1MC 1N64H 5I8KH 4KKAC 4R8WH 4HHAA 4WUUA 3CVHL 3FJTA 3MNZB 3X13A 4BQ8A 3CFJA 1OAZL 1KELL 4YDVA 3D3VA 3AS1A 4NO0A 1MVUA 4JKPL 3HZVA 4Y5YA 2O61B 1AY1H 1MJJA 3WHE1 1MI5D 3OJVC 2FJGB 4CW1B 5DVOA 3D39B 3P0YH 4ZOEA 4XNYL 4QOKE 1JBJA 1XGPB 2XG5A 3H9HA 4CVZA 4DVBA 4H88L 3C6SB 1I7RB 5LGKA 2Z31B 4OLZH 1JK8B 3E6FB 4Y2OA 3FHAA 4N0RA 1FG2A 3EJZC 1EXUA 2IGFL 1QQDB 5E2JA 1ZSDB 1JYVA 1X5AA 4U6YA 4UINH 5IT2H 3RY6A 5HYJE 3P0GB 1L4IA 5E95B 4E9LA 3IFNH 3QB7C 1QSEA 3VWJD 4GRMB 3DURA 3UTQA 5IVZB 4C54A 3QDGB 1JWSB 5HGBB 5B3JE 3STZB 5I18H 4IDLA 1J8HD 1BD2A 1J0ZA 3EGSA 2P46B 3MJ7B 5FUOL 4OIAA 3SKNB 3VWJC 1U58B 5E2TL 1QBMH 3CXDH 3DX8B 3GSVA 3KYAA 5D70L 1E4KA 1I9IH 4WV1A 1AO7A 1YZZA 3H8NA 5IJVB 5DK0B 5DS8A 1AD0B 2YPVL 4EIGB 4QOKB 1FNEA 3R06A 5JORA 4PV8A 5IF0A 4MA1B 5IB4B 4KJPD 4YGVB 1T7VA 4P3DB 4U1IA 2CO6B 4BQBA 3WFCL 4OT1H 5DUBA 4L4VD 5DFTA 5INCA 5IW3A 1BZ7B 3PGCA 4RFEB 1KCKA 1MIEH 3ARSA 1DBAH 3LN5B 4KJPC 3SE3C 3FQUB 5H35A 1BFVH 2CK0L 3UX9B 4QRUA 5HYJB 3RIAK 5IEKB 5J11B 3MV9A 5I1HL 3JWOC 1QD0A 4JPWL 4ELKA 3RZCD 4U6VH 5I8OL 4Q74A 1DQML 1EO8L 5CINH 1J7VR 4JO4L 3RP1A 4YQXH 1PBYA 3E8UH 1S9VA 2H3NB 3ABZA 4GG6E 1RZIB 3F12B 4NC1E 1UYWL 5EU7E 5FA3B 1OY3B 5CAYB 1A6VH 4O4YH 2I07A 1DL7H 5F1SA 5BJTB 1XF3B 4N5UA 3JTTA 5ACZA 2X4NB 3RZCC 2VXUH 3KWWA 3O6KL 5D7IF 3WFHB 3F7YB 4XPHH 2EE6A 3PWLB 3V7AE 4E41D 5D2NA 2R1YB 3FQTA 4G6KL 4DGYL 5GPRA 2OL3A 3STBA 4P2QE 4LVNB 3G6JE 2D0HA 2DF3A 2APFA 4H26B 4P48A 1J0YA 3V4UL 1JGDA 1KB5A 3ISWA 1F42A 1ZGLM 2YHGA 4HFWA 3SDYL 3FB6B 1CTOA 3A6BH 1BECA 3KPPA 3OKEA 4RZCA 4XP9H 1S9YB 1G7QB 1Q9OB 3WS3B 2GIYA 5C7XL 1HOCB 1IFHH 2A77H 1DE4B 1UH4A 1KSRA 1S9WB 2X42A 3PP4L 5IR1B 3PJSA 1OSPH 3W39B 3SKJH 2EYRB 4PJHF 4OCSH 3V0VB 1R3IH 1HXMA 4OQTH 3BZDA 5SWSB 4D0BB 3ETBF 1PLGH 3QEGH 4U3CA 3CC5B 2DMKA 2VNCA 3ZE0E 3KS0H 4GG6B 3TN0A 3MGOA 4KWUA 1A1MA 3DIFB 4RX4D 5HYEA 1DANU 1UC6A 1UZ6E 4KKNA 4X6DB 3EYOA 1RULL 3I3EA 5JW3H 1XGQA 5FGCE 1CS6A 1QOKA 2AXJA 1BX2B 3HI6H 3ARXA 4PB0L 5CUSH 3TO4D 2DIBA 3T0VA 5KSAA 4P2QB 3TYFA 4LVOB 4WFFD 4TSCH 3G6JB 4OLUH 3W0WD 2YBRA 4PLOB 4QNPE 3ILQD 3V5KB 5E8EB 3VGGA 3SY0B 2I5YH 4MD5B 4HLJA 4HS8H 3S37H 1T22A 3LPGA 3TH4T 3PNWB 4MXVE 3QXVA 2AK4D 1BOGA 3MJGX 3G9VA 3TO4C 4FTVE 4IOSD 5I73B 4TUKH 4QTIL 3U1SH 4AH2A 1WSST 2BZDA 4HF5H 4OLYH 3ILQC 4PP1D 4WU5A 1YPZE 4X9HA 3GSRB 4V1DD 1JNNH 4LCWE 5DEFA 2BOCA 4D9LL 3RAJL 5KSBA 4I3SH 5DWUL 4GKNA 5EIVA 5EU5B 2Y5TA 2C7UA 1Y18B 2Q20A 3MLXH 4PP1C 2DL9A 1YNLH 5F88A 2PKDA 2FEEL 5C6TH 2PTTB 4UT6L 2ZP0T 4LIQH 1FVCA 3NIFE 4XNXL 3ZDXF 5CJXA 4HK3J 2DMBA 3MJ9H 3U79A 3EYVA 2EC9U 3N9GH 4OZFB 4I0PA 2Q76A 5FV1L 1P1ZA 1C1EL 5HPMA 1TJHL 3FB8A 3T65A 2VXVH 4YXHL 3MRNA 3VJ6A 3CPLB 1ITBB 5IW1B 2R4SL 1IAII 4UQ2B 3WUZA 15C8H 5I8EB 4HW6A 3OB0H 4ZUVA 3T1FA 3VFUA 3KPNB 4M7LT 4PGCA 5I9QC 1OF2A 4LKCA 1IEAB 4FQQB 4FTVB 3O3BB 4JN1L 5IBUG 3WIHL 1A14L 3CFBB 1T89C 3L7EB 2EXWD 3ZL4L 3H9SA 1VFBB 4LCWB 2AQ3A 1KCRL 2V5YA 3T0XA 2ZJSH 4QRRA 3LQAH 1CXFA 2VITA 1CLZL 4OGXL 4KHXH 4U6TA 5E00B 1B0RB 4FXKB 2EXWC 4R96A 5D8JL 3ZO0A 3BGFB 3HR6A 1N59A 1FSKB 5D1QA 3UBXI 3OB8A 4PRPD 2X4RB 5IM7B 1R3KA 2R23A 4JG1L 1WZMA 4JM2A 4XNZC 4Y16A 3AU1B 5I1GL 4HKZA 4M6MH 2J3SA 2J8UA 3HCVA 4X0KA 4NZDA 2VDNL 4LPUA 2J88H 3MRBB 3OAZK 5BRZE 1JE6A 3V0AC 2R1XB 4FZ8L 3H7BB 2BOBB 3QG6B 4Q0XL 4RMWA 5FYLE 1OAXH 2GAZB 3DX9A 3ECBA 3OKDA 3FCTB 1GIGH 1LO0H 2KZ1B 1RZKC 2Z0BA 2G2RA 4WJ5B 3HUJF 1LO3L 4QRTA 1IM3A 4S1DD 1D3CA 3MRFB 4YR6B 5C0FB 4PS4H 1RUMH 3NTCH 4LHJB 3VRJA 1XFPA 4M43L 3KPSB 3RL1A 1XR9A 4P4KB 3BISA 1K6QH 3VG9B 1Q0XL 4DKEL 3MO1B 4UV4L 1JP5A 5DSCB 3MACL 2DWDA 1NBZA 1SMAA 5ID0B 4S1DC 3BZFA 2MPAL 2E8ZA 2VH5L 3L5JA 1GRWA 3G08B 3O9WA 5L0QB 4JFYA 3BKCH 1X5JA 2A1WL 3MRHB 4ZNEA 3IJSA 4PJ5A 4J3XA 4PJ7F 5F7YC 2IG2L 1ORQB 2AXGB 2BVYA 3U30B 2NPLX 2ZUTA 3KYNB 5E5UB 5L8JB 1KENL 4LGPB 1PGRB 1EO5A 2V2XB 3GMLA 1NAMA 3WXWH 1KB5H 2DIAA 3LKPB 4OCXL 3TBWB 2O5YH 5I1IH 4NO3B 1KIPA 3U7WL 2ADJA 3ROOB 1G7HA 4ZQKA 1I85A 3I9GH 4MCZB 3GI8H 3MROB 4M02A 4BKLB 5ESQB 1S8DB 3S96A 2WZPD 1VGKA 1YEJH 3FB5A 1RJZA 2FR4A 3UPRB 4C4KO 1VFUA 2H9GB 4CUCA 1X3DA 4J3OC 4NUGL 4OAWB 2E8YA 4G8IB 5FYJD 4YHLH 3OAUL 1IC5H 4R4BB 3EO1B 5F9JA 3JZ7A 5IVOA 3DYMA 1RZFL 3TM6A 5BZDA 5A2JH 4HJGB 1N4XL 3VFSA 5EOTB 1KPVB 4RMTA 1KN4L 1LD9B 1JRHL 3UTTD 1JN6B 4P99A 5CIPB 1DBML 3P4MA 4QXTA 3U0TB 1MI5B 4UNTA 1FFNB 3QUMH 3RL2A 5K59E 3HZKA 4ZD3H 4WFED 2E6JA 3U36B 3MXWH 3E1F1 4L3CA 2QL1A 3I2CH 4HMCA 1ONQB 4F58L 5F89A 2BNRA 5FGSA 5J9PA 4TULL 3B9DA 4Z7VA 1SMOA 2CDFB 4L4VE 4ONFL 4BQ6A 1CGYA 4F37F 1JWMB 2Q7YA 1WZ1L 3WD5L 4U6XB 1A3LH 2ADFH 4MX7A 1CGVA 4O2CA 4JFPB 3EYUH 2XWJA 1E4XI 2C4XA 2P5WD 3UTPD 2R2CA 3QUZA 2XICA 5FKAB 3TBTB 1QBLL 2XA8L 4L8DA 1Z3GL 4UV7L 4GRWH 5DDHA 3VWJB 4X6CA 1JGLL 3N1FC 3LMJL 4EVNA 2YKLH 1L9NA 4RGMC 5D7LD 1J8HB 1MCNA 4RIRA 2VZOA 5FECB 4P5TD 1EGJH 1YY8A 2R8SL 4O51A 4KRLB 4F37K 1LEIA 5CJOH 5E8OB 3U4BL 5A43C 3C6LA 5DHVB 5GSVA 4HPYL 4E41E 5DD3H 2YD4A 3FL7A 3T0WA 2YC1A 3NABH 4OLXL 4P5TC 5IESL 4JPVL 3NZ8A 2Q86B 4TN9A 2X89A 4ONHA 3K1DA 1JHTA 1NANI 4DVRL 4ZUSA 2VLJD 5GGSA 1XF2B 5E03A 4R7NA 3ZE2F 4AG4H 4L4VB 1FO0L 2DLFL 4RA3A 5IMMB 3OHXA 3O0RL 1D9KA 2AJVH 4NDMB 3SDAA 4KMTH 2ED8A 2PO6D 2WQ8A 4JHZA 3BP6A 4DUVA 2VLLA 5EOCH 4MQ7B 3QUYD 1WICA 1XF4A 4UNVA 1JPGA 3MOAL 5CEYB 2VXTL 2Y07H 1MCHA 1WAAE 3AXLB 5KBNC 1YEGL 4NBZB 3RVXD 2CGRH 2IH3A 3RZCB 1J1XL 2CO7B 2HVKA 3L1OH 1UCBL 3CUPB 4K71C 4UB0L 5BMFL 1UM6H 4CRPA 3K2MC 4TVPD 5I1AA 1NKOA 4LAQH 4TSBL 2PO6C 5CZKA 1PYWA 3MRKB 3QUYC 4PBWD 1MRDH 3S6CA 1T21B 3VXPB 5K9KB 3GSOB 1UB5B 5JIKA 1CFVH 4M4RA 4P5MA 3RVXC 3S4SB 5ADOL 2QR0A 2W9DL 4LCYA 1R3HA 4AIZA 2D7TL 4YDJA 4OF3A 4LOUD 3WNLA 4E41B 1IAIH 5CKGA 4JANB 1WC7A 3TCLA 4WFFE 5EBLA 2ATPB 3W0WE 1RUAL 2C4FT 2W65A 3BD5A 1KCLA 4XHJD 4AT6A 4BSVB 4F7EB 4LOUC 5JOPD 3VXUD 1P5VA 5A2KH 4H0GA 1GGBL 1IGIL 2DQIL 4UOJA 2JCCA 3LKQA 4NHCL 2XZQL 4DN4H 8CGTA 4H8WL 1YN7A 2GITA 4V1DE 3EDEA 5LVEA 3CFKA 1LO4L 3CU1A 4XHJC 1B88A 5IROC 4G9FD 1MAML 1ZT4B 3IF1A 5AAWA 2QJDA 3B9KD 1QACA 5F9OL 3VH8B 1A6WH 2R0LL 1YJDL 1CDJA 5EUKB 1TPXC 3TO2B 1CI5A 3OG6B 4WI9A 4N0YH 5IJKC 1YEDB 4HIIA 3GJFB 1FNSH 4JDTH 1LEGA 1PSKL 3B9KC 2X09A 4LPTA 4CU8A 3MCKA 5AZEH 5GGUB 4V2CB 5D1XA 5E6YA 3TO4B 1W0YT 4PLKD 4XNQA 3RWCA 3V6OC 1RVFH 3W0WB 2BY1A 3MR9B 1QBAA 3BH8B 2HFEB 4A6YB 1NUFA 2HWZL 1LK2A 3O4LD 1HKLL 3UJJH 4OJFL 4AMKL 1S7RB 5C0DB 2Z92B 4CN6A 2AK4B 3D0LB 5GS3A 4PLKC 1XH3B 2VR9A 3WFEL 3HC3H 4PJ9D 1EPFA 4N8VG 1E4WL 4ZSOA 1T20B 4NP4H 4X6FA 5EU4B 3MOBH 4JY4B 4X80L 1GGYA 3VRLF 1CD9B 5E24E 4V1DB 3D85A 1MJ8L 3OX8B 4NFBA 4ZUTB 1MLBA 2NY6D 4JZNA 1ADQL 4LF3B 1EHLH 3HPLB 3MTRA 4PJ9C 4OF8A 3V5DB 5DJ2A 1KN2H 2YZ8A 2HN7B 3BEWA 5HGHB 1JNHB 1MCRA 1XGRB 5HDQL 5KSUB 4GRWF 4RAUA 4PRPE 2NY6C 4XTRD 4RBPK 2IPKB 1RJYB 1T0MA 2FGWH 3DUUA 2DQCH 4NZUH 1JCKA 3D3VD 5C08A 3CH1A 5I9QB 4BFIA 3CFEA 4NO0D 1LVEA 5J6HA 1QFWI 3UBXG 1AGCA 5DT1H 1OP3H 1UACL 3DUHA 1HCFX 4HKXA 4XTRC 1R0AH 2DWEB 5KS9E 3AS0A 1F6FB 1U8OB 5SWQA 1F4YL 2ADIA 2YA2A 4NSKB 1JPSH 5EO0B 2YK1L 3SE9L 5ITBH 1A6ZB 1IL1A 2KPNA 4RWHA 1BGXH 4LVEA 2BXZA 4UIKH 1QRNA 4WTWA 1YA5A 1ZTXL 4RCAA 1N26A 3LRGA 4NWUL 1CFQB 1HH9A 4JGMA 3K80A 5DUPL 5EUOE 1RK1A 2AXHA 4E5XB 3OZ9L 3VI3E 1Q72H 4LK4A 3D9AH 5FFLA 3HZMA 1JHKH 4WDIA 1QSED 2NZ9D 2GTZA 2PUQT 1X6NA 5F6HJ 1P84J 3DXAD 4MMXC 3O11A 7CGTA 1G7LB 4PRPB 3ARRA 5BZWB 5H2BB 5F96H 2D03H 5F7MC 1U92A 2DJ4A 5DUML 3H6JA 2DD8L 4HKBB 3IT8D 4ZYKA 2CRIA 4JPIB 3DHMA 4E0RB 2NZ9C 4PJXF 3FN0L 4OUUA 4MJ6A 4P9HL 1H5BA 4OKDA 5DJXA 4LVHC 1AO7D 2AAVA 2DQGH 5FXCH 3QUXD 2WANA 1G1CA 2YEZA 2FJHA 3HAEG 3K1KC 4R26L 5KS9B 3MLYH 3M17A 3VFTB 3WL9A 3MXVH 2OMBA 3TA3A 2VZVA 5CBEA 3LH2H 1FIGH 1J0IA 4I18A 1U8IA 3N1QC 3MUHL 2RHEA 4WV1C 1AGBA 3HLAA 5DK3A 1MJ7L 3QUXC 3V8CA 2W59A 1I8KA 3SE8H 4HDIB 5EUOB 5FYJE 5TPWH 3MV7E 4KPHH 2DBJA 3MV9D 4Q9BA 3U6RA 1ES0A 4H1LA 1ED3B 1NCDL 4W70A 1YNKH 4PBVC 3RDTA 5ETUA 1P4BL 4Y1AA 3P11H 4XCEB 3ARUA 3UTTE 1PZUB 4OZIA 1ZLUH 1JWUB 1IAKB 2L7UA 5JIIA 4ZOBA 1YUHA 2NXYD 3NIDF 4LHQB 3EO9H 4WFEE 5L8LB 4EI5D 4KVCL 3L6FB 1MWAH 1W0VA 3FZUD 4QRPE 2W9LA 1CG9A 3MRDA 1FYTA 5ISZB 4JO3L 4NT6A 1YECL 1PG7X 5E9DA 3PHSA 4XBEH 5HBBA 5GJTL 4YLQT 3IDXL 2CLRA 5IQ7L 1D6EB 3ZTNH 2DBLH 1L6XA 2NXYC 1AXSB 1TTGA 4EI5C 4G80A 4POYA 3FZUC 2XKNB 4RA0C 4LLAA 1KYOJ 3C9NA 3HC4L 3OF6A 4L9LA 2PTUA 3UTPE 1INDL 2D7OA 4MMZC 5EDXA 1N0XL 1OAQH 4PGBA 1E4JA 4XCFL 1M05B 4Z7UF 3MMEB 3QBTB 4I5BB 1KEGL 2A83A 3W2DH 3WXVL 1JGUH 3LHPL 4HH8A 1NCCL 1KG0A 3GSNL 4NQSB 5TE7L 5LWYH 3FQXA 3OV6A 5D7LE 3VFNA 3VMOA 4CU6A 1PY9A 5J57B 3KJ4C 3QO0B 4HUMB 5T1DL 3QQ3B 4Y19A 1Y6MR 3UTTB 5B38A 4YHPB 5HI3D 1UVQB 1IC7L 3UP1A 2CMRH 4R90H 1A7QL 4BZ2H 1TZHB 1LEKB 3DVGA 1L7IH 1EIBA 2ZUQB 5B21A 4LNRA 3D48R 3G6AA 1ZWIA 4MXWH 3MLRH 1NCUA 5HI3C 2Z91A 4YC2C 2VLJE 4JAMB 5KSAD 3KNBA 2YPLD 4NZRH 3KPQB 1F90H 2CRYA 1PG7W 1IGFL 4Z0XB 2CRMA 1PD6A 2GSGB 4APQA 1HWGB 1NCBH 4NUJA 4RGMB 4MVBD 1ZVSA 3DJ9A 2X7LA 1JGVL 2P5WB 2IPTH 3MRIA 5GRVL 4B53A 4QHLB 3UJTH 5DRNA 5KSAC 2A9ML 5E2UL 1MHPH 1R5VB 4AM0A 1UKQA 1DFBH 4IRZH 3QDMD 1NQBA 2IADB 4HWUA 4Z7VF 5JW4N 4TVPE 4MD4B 1F6AB 4MVBC 1HILA 5D7LB 5E08H 4NRYB 4XC3H 1N7ML 1D5MB 4P5TB 3UTSD 3F7VB 2ICWA 1YEKL 4OKVA 4ZPTA 1GGCH 2EDQA 3S34L 3F8UB 1MCOH 2V9QA 8FABB 5CFHA 1U8HB 1A5FH 4CKVX 4ONOA 5B22A 3UC0L 4IMLA 3VFVA 2Z8VC 4I0PD 3QUKA 3IRZA 4PRDA 5FO9A 4ALAH 2BSED 4EQ2A 4OZGA 5IVXF 4OI8A 2I9LA 4GXUM 4DZBB 2HG5A 3MRLA 1OAUH 2VLJB 3QULB 3V6FB 2A74A 3G5VA 5EOQL 4WHYG 2X40A 1A8JH 5J1SC 2P7TA 3KPRA 5CJXC 5IMLA 2DYPA 4GSDH 4KUZH 3X12B 4DW2L 2F5AL 4K71B 3PP3K 4I0PC 4NKIH 1UZ8A 1K4CA 5E7BA 2WIIA 5EPMB 4I9WD 2PO6B 5JMRA 3DX7B 2WMPA 3QUYB 1U8NB 2UY7A 5IW6A 1T5XA 3HN3A 3IKCB 2OCFD 4LNVA 4G9FE 1OTSD 2A38A 3IDMA 3L3DB 1HE7A 4HK0B 4KRPB 5DGRA 3ARTA 1CE1L 3I50H 4HCRL 2QSVA 2AXFB 1N64L 5I8KL 3RWHB 3V6OE 1PKOA 4R8WL 5B39G 4F7MB 3V5HA 4KTYA 4JRYD 4J1UB 2J8OA 3RUGA 1OTSC 2GJZB 4CNIA 2V9TA 2ARJQ 2C1PB 5J1AB 1AY1L 3TJHD 4DFHA 3IDNA 5JHLH 2GI7A 2EECA 3JV4B 2EYTB 1SEBA 3P0YL 12E8H 4JM2D 3OGCB 5E5MB 4QYOB 1F8TH 3O4LE 5CEXA 2JLLA 4ZOCA 4WGVB 2Z8SA 2UWEE 2BVPA 3SDXE 3TJHC 4XCCH 3VXUB 2BVQB 3B3IB 4OLZL 3BRFA 4Z8FH 4YAQB 2GK0A 2Q8BH 1TPXB 2QHRH 2Y36H 2V5MA 4JM2C 4LQ1A 3VXOA 2ZOLB 4UINL 1H3PH 5IT2L 4DN3L 5I1JH 5DGQA 5F3BB 4G9FB 5HHQB 5T3XD 3B9KB 4MJ2A 1INQA 5LQBH 5HY9A 3OPZH 5J6GB 3BVNA 3DLQR 4OCMC 1NC2A 4L8BB 2EDKA 4NNYB 5I18L 4CVXB 2YUXA 1NAKH 4CMMB 2HJFA 3ORJA 3LVEA 1CGSH 2JCCF 3LN4B 3H42H 4H1LH 1HHKA 4JDZA 1OLZA 3BXNA 1HQRA 3QO1B 4S2SB 4YHZH 1NBVH 5E1AA 4LSRH 3SGKC 1QBML 4P2CG 2GJJA 5SX4H 1A1NA 3SCMA 1I9IL 1EBAA 4BSWA 4F3FB 4TUJB 4F9PA 2E9JA 2I26N 4J7RA 3PABB 3WKNA 1SYVA 1SJEA 1S9KC 3S3SA 3O4LB 3VMPA 4OGYH 3MV11 4XVTH 2BJMH 5KJRH 2UWEB 1BPVA 4TTDD 1RJCA 3AGVA 3BPCB 2MCPH 2H2SD 4OT1L 2OR8A 3VXQA 1ZVHA 4PJ9B 4Y5XA 4D9QD 3KDMA 1UA6H 1MIEL 2NR6D 1MCSA 4XVUD 3VA2C 4EDXA 2C4FU 4TPRH 4G6AD 1DBAL 2HVJA 1BFVL 3IDGB 2QADD 1HXYB 5E4IA 2NY6B 4TTDC 1GOGA 4UMGA 2H2SC 4JFHD 4LSUH 4U6VL 2GT9B 3EBAA 2C3WA 2W0FA 5CINL 4H5SA 1VKXA 5KN5A 4XNMA 4YQXL 5EC1A 5E56A 5DJ6B 4X7EC 2NR6C 4XVUC 2GY5A 2H41A 4JFOB 4LCUB 4G6AC 1NGPH 3DXAE 4GBXD 1YJDC 2QADC 1A6VL 4O4YL 4HHAB 1DL7L 5FYKH 1S9XA 3D3VB 3DRTA 4WW2C 3BKYH 3U9UB 1L0XA 3ULUH 4NO0B 3K7UA 1MVUB 4XPHL 5D6CB 2P8PA 4PRHA 1S5HA 3PXJA 3CX5J 3T77A 1HYSC 1F00I 5C0EB 5F3HA 1MREH 4GBXC 3TH2T 4GRLD 4YO0A 1AO7E 2YUWA 3GGWA 3MJ6A 2CDGB 2DQTL 3HMWH 1J87A 3VFWB 1CFNB 3H9HB 4CVZB 4DVBB 2ZCHH 3A6BL 2ZUSA 2VQ1A 2BNRD 4XP9L 4CDGC 1IFHL 4GRLC 4KXZH 2A77L 3DSNA 1FG2B 4OD2B 5GGSY 5DJ0A 1EXUB 3VD5A 3HG1A 2Q1EA 4KGJA 1OSPL 3WKML 4OCSL 4U6YB 1R3IL 4OQTL 5F7WC 3M07A 5EIIA 1PLGL 3O3EA 3QEGL 3QUZD 4OZ4B 4PB9H 4PTUA 5L9DH 4J12A 3MQIA 1QSEB 3DURB 3DYOA 1M71A 3UTQB 1GGIH 2APTA 3DXAB 2N56A 4NCC1 5IBLD 1CBVH 4IMKA 1UXSA 4LVHB 5H8DA 5DJAB 2GJ6D 4FMKA 2FCBA 5ALCH 5JW3L 3QUZC 1I9EA 5JW4R 4C56D 5GRXG 3HI6L 4YEFA 2FGZA 5CUSL 3FO0H 5AYUH 1E6OL 3UTOA 4X98A 2ITDA 4TSCL 3C6LD 3DYPA 5IBLC 4WNQB 4OLUL 4WV1B 1AO7B 5I0DA 1XGTA 2F9BT 2HYMA 3QUXB 3I75A 1S5IH 2QKIB 2I5YL 1FNEB 4HS8L 1NPUA 2X1PA 3THMH 1T1YB 4PV8B 4Z7QE 4IRJA 4GKZA 4YFEA 5IHUH 3C08L 1LDPH 2VOTA 4FFWD 1SBSH 4LSQH 2BSSB 5BXFA 3C6LC 3U1SL 1RPQA 2ADGA 2W60A 4LMQI 3CZFB 5INCB 4HF5L 4OLYL 2E9BA 3GMQA 4Z7OE 3PGCB 4LEOB 4I4WA 1D9KD 2GTWA 3SDAD 4G6JH 1PJ9A 3DMMA 4X6BA 4I3SL 4UI2A 3GNMH 3VXSA 4FFWC 2NLJA 3MV9B 3V2AR 2EDWA 5AD0A 1A9BA 3TT3H 3MLXL 1RHHB 3P40A 3EUUA 1YNLL 5C6TL 1D9KC 1S9VB 1VPOH 4LIQL 1B4JH 3SDAC 3MJ9L 2LABA 3N9GL 5D7JA 2XRAH 2I07B 2NXYB 3VXNA 3JTTB 4EI5B 4UT7H 2VXVL 4UT9L 1LILA 1YEHL 3I85A 4OBRA 1B3JA 3WJJC 2AQ2A 3DI2B 4HJJH 3KWWB 4YXKH 2X5PA 2OL3B 2YPLE 15C8L 5L8KB 1WBXB 4OZIF 3GRWA 5LG1A 1X5ZA 2P8LB 5BW7A 5MEQA 2R4RH 4JHBA 5DYOB 5DQ9A 3R0NA 4Y0GA 1OHQA 3KJ4B 3KPPB 3OKEB 4RZCB 4X83A 2WIMA 2M8XA 5KAQF 3QDME 4XH2B 1FN4A 4YWGH 2N4IA 1JZ3A 3ES6A 3PJSB 2HJKA 3MRJA 4N9OB 1KPUA 2ZJSL 2H32H 3MJ8B 4G8EB 5MERA 3LQAL 1G7JB 3LDBC 4S0TD 1T1WA 1HXMB 5KSBE 3VD9A 4KHXL 3UTSE 1V5JA 3HA0A 2DQFA 3OJ2C 4RAVA 3QH3B 2MMXA 2ARWA 4JGUA 3MGOB 4YC2B 1A1MB 3RI5F 1DN0B 1NDGA 4YNYA 1ZV5A 3RVTD 2ZPKH 3T0EA 3BIKA 4M6OH 5CD5D 1A22B 2X4PA 1N2RA 3EYOB 1X4YA 3M8OH 3QXWA 1XGQB 2A6IB 4M6ML 2J88L 4WENB 5KSAB 2YPLB 2FO4B 5I1LA 2CIIB 4MNGA 4PYGA 3ULUF 3RVTC 4M1DH 4Y5VA 2YBRB 3GSXA 5D1ZA 5DRZA 3AC0A 3Q2CA 5CD5C 5F7FA 4D0DB 3LKOA 1MFNA 1OAXL 1T22B 4I9WE 1GIGL 1LO0L 2G9HB 3QXDB 3HI1B 4M5YH 5EFIB 5BVJA 5CGTA 5D2LF 5GGQH 4DZ8B 1RY7B 3QDMB 1RUML 2KZWA 3QCVH 5FGBC 3NTCL 4G7VH 1TIUA 4WU5B 5L2JB 2R1WB 1NGZB 1GPOH 1JGEA 4OZHA 4ETQA 3D85D 1K6QL 3FO9A 4K8RD 3ZE1E 3HI5H 3SDCD 5KSBB 3UTSB 2D2OA 4N8VA 3BYYA 4JRYE 2IQ9H 2QTEA 3FMGL 4HG4J 2MSPA 2DJUA 3FFDA 4Y4FA 1NUNB 5L6YH 2GCYA 3HMXA 4MQXD 1FVCB 4ODWA 2VDOH 3BKCL 4Z7NF 1L0YA 4K8RC 3ZT7A 4I0PB 3SDCC 2Q76B 2LU7A 1P1ZB 4LPCA 5HPMB 5C08D 3TCXA 2I24N 3BI9X 3T65B 3MRNB 2JJSA 2VAAA 3LKRB 5F44A 3VJ6B 3PWUB 2OJEA 5L7XH 2J8UE 2X1XR 4MQXC 2MJWA 1IC4H 1U95A 2IFFH 32C2A 4XBGA 3FAWA 1KXVC 3RY5A 2FYYB 4ZUVB 2AK1H 1KB5L 1ZHKB 4QLRA 3T1FB 3WXWL 2O5YL 4PGCB 3T2NH 1VHPA 1CR9H 4LKCB 3I9GL 5DMKA 1S7WB 4OZGF 3GI8L 3UBXA 1TMCB 1QYGH 1AD9B 1YEJL 1QLRA 5T3XE 3ZDZE 1QRND 3QWOB 4HWBA 2BMKA 1VGEH 3MLUH 4YHLL 1KJ2A 4GT7A 1A4JA 2FDBP 3WDJA 3OXRB 4QGTA 4NN5C 1CDYA 4JRYB 2F58L 2FZ3A 2HFFB 2JIXA 2LFGA 4B7IA 2DLEA 1MCDA 2SEBA 1IAIM 5JUEH 5JDJA 1IC1A 1N59B 3X11B 4PRIA 3PG2A 4U31A 3QUML 4ZD3L 4DWHA 5C0BD 1N8ZA 2R23B 3MXWL 2FIKA 4ZNEE 2FLRT 4JM2B 3I2CL 4HX1B 3TBVA 4HKZB 3LEYH 2J8UB 5BS0E 4X0KB 3RUGF 2PNDA 2XYCA 2QLVB 5DC4B 2YD5A 5T1LA 1GL4B 5GRWA 3ULVH 2CDEA 2A6KB 4L8SA 1MFBH 4D9QE 4ZUWA 1A3LL 2ADFL 1LE9A 4FFYL 4HMEA 3ALPA 3DX9B 3TA3D 3OKDB 4ZFGH 2X4UA 4JB9H 4KZDH 3A0OA 1A47A 4HWZB 4RMRA 1RZJH 1EZVX 4JFHE 3QXAA 1OSZA 3HAEA 1IM3B 3C8KA 4KHTL 4YH6A 4C83A 3GSWA 4X7CC 5C0AD 1MHCA 2ZSVA 5MEOA 3VRJB 4PJAE 2YKLL 5CSZB 1BQLH 1XR9B 2AERT 1AC6A 3W9DB 5IQ9B 4BM7A 3IJHB 1K2DB 3TA3C 3DTXA 3OSKA 4CN1A 1AE6H 4NNXA 1QTYT 1OP5K 4MA7H 1EGJL 3KAAA 1T6WA 2AW2A 2P24A 4G3YH 4LLVB 5LAXB 4PY8J 3RA7H 4Y1AD 5BV7H 3ARBA 5CJOL 1J10A 4N90D 2VE6A 2FEDD 5DTFA 1J1OH 1ZMYA 4JZOA 1MEXH 2NX5A 4JFYB 3NABL 4XMKH 3TFKD 2A6DA 5JW5B 1W8NA 3QZWG 1REIA 4XZUA 3NPSC 3IJSB 4PJCA 2X9WA 3BO8A 2NY1D 3EYSH 2PYEA 5CWSB 4YHNA 4FFVD 2BFVH 1P6FA 4AG4L 2BNRE 5E9DD 1E6JH 3TFKC 3SGEI 2AJVL 3GRWH 3K74B 1OCWL 2MTPA 3GMLB 4GMSH 4KMTL 5KG9B 2FO1A 5EOCL 4L3ED 4PJEA 2QADB 2NY1C 2ADJB 4ZTOH 1G7HB 1VA9A 2Y07L 3KLSA 3LD8C 4FFVC 2EDEA 3B43A 3SJVD 2CGRL 4WW2B 5HTSA 3L1OL 1RJZB 4JFFD 2FR4B 1I1FA 1UM6L 3D39A 1G6RH 1HKFA 4LAQL 4OI9A 4X6CE 1XGPA 1G9MH 5GS2H 1X4XA 1XIWA 3VXMD 4Z7WA 1MRDL 4GBXB 5DD5H 3SKMA 5F9JB 4Z76A 3RJQB 1U2HA 1CFVL 1QG3A 3C6SA 2GJ6E 5BZDB 1I7RA 2Z31A 1IQDB 3E6FA 4C56E 1QPXA 3BX7C 1IAIL 3BZEA 1QQDA 1ZSDA 3P4MB 4QXTB 4LP5A 4TOYH 2AEQH 4GRLB 4ZAKD 4JFDE 1V7ML 3HZKB 3WS6A 5DMIL 4L3CB 5HVHC 5F6HI 4JKMA 1J11A 3LV3B 5IVZA 3QDGA 4I3GA 5HGBA 3STZA 5F89B 3WIFA 2BNRB 1T5WA 1EX0A 3BH9B 1X7QB 4PG2A 5DD1H 4ZAKC 4PTTA 2DI7A 1QKZH 2ZCLL 4DN4L 2M1KA 3B9EA 2BY0A 4Y88A 2K3TA 3SKNA 4O2CB 3DX8A 1EDQA 5A16A 1N5AA 5C09E 3QUZB 5DQJB 3UO1H 1AD0A 1CYGA 1A6WL 4QOKA 5DDHB 4X6CB 4D2NA 3PF2A 3CX2A 4OI7A 4Q9QH 4N0YL 4YGVA 2FECI 4JR9H 1MUJB 1ULVA 2E27L 5JA9A 3JV6A 1FNSL 2GJ6B 4JDTL 1NCNA 5C0GA 1BZ7A 1YY8B 5AZEL 5EWIH 4RFEA 4C56B 1DDHA 3VGDA 4ZTPH 1LEIB 3HMXH 3X3GH 1RVFL 1J0HA 3C6LB 3FQUA 1OWRM 5B8CC 2UYLA 4QXUL 5GSVB 4DUXA 5HYJA 5IEKA 3CGTA 1LK3H 4YIQB 2YC1B 4G42A 5EBMA 3UJJL 4FQIH 1C5CH 2YD8A 1JHTB 2H3NA 4ZUSB 3S35H 1RZIA 5HGAB 3F12A 3BESR 4NZTH 1ZLWH 3TBSA 3HC3L 4H25A 4R7NB 2A73B 4LEXL 4DUWA 5FA3A 43CAA 2Y06H 4J6RH 4AENB 3R0MA 2DYPD 1ND0B 5BJTA 3MOBL 5KVFH 1XF3A 3OHXB 2X4NA 1D9KB 3PWPA 3SDAB 4BH8B 2VLLB 5C0IB 1T83A 3GUTA 3ULVF 4HBCH 1XF4B 3WFHA 1JPGB 2R1YA 1EHLL 2J4WH 3TJEH 4J3SA 1A7BA 3Q1SH 1KN2L 3QEUA 4HWBH 5T3ZH 1K5NA 1HNFA 1P7HL 3LEVH 1MLCA 4MB4A 2CUMA 3CSYA 3QWQB 1PYWB 3KXFD 1YEFH 4AK1A 3FB6A 1YDPA 1NDMB 5IFJA 2D7MA 3EKCA 4EKXA 2FGWL 2DQCL 1S9YA 4GAJH 4NZUL 1G7QA 4P5MB 4F8QA 1CU4H 2QR0B 4N9GA 1DE4A 1MNUH 1R3HB 1F2XK 5IR1A 2EDDA 1L9MA 3W39A 2EYRA 2BVTA 3V0VA 3ZYZA 4M7KH 1WC7B 1T80A 2MKLC 1MY7A 1R0AL 4A2MA 4D0BA 3PGDA 2KDGA 1CIDA 4NM4H 1FJ1B 3GM8A 5ESAA 4GG6A 1JPSL 5AYQA 3LDBB 2EE3A 5ITBL 2CKBH 2QSCL 3SE4A 4JZJC 1FLRH 1TTUA 1NMBH 1WT5A 1DUYB 2Z8WC 4WFGD 1G9NH 3FT2A 5AWNH 3LKQB 3QCUL 4JN2B 1HEZA 5FM5M 3SBWA 1P53A 3F7PC 1BX2A 2XPGB 4HC1A 3G6JA 5I6XC 2OZ4A 3D9AL 3IF1B 3BEVA 3PHOA 1WQVT 5KOVC 1JHKL 5HD8D 1FFRA 2AJYH 4OF5A 1NC2D 5E8EA 4HLZH 4DGVH 4G6FD 4Q9RH 5EZOH 2NYYD 2NZIA 5I16B 2DKSA 4QEGA 2D03L 4E42A 3WV0A 5E2WH 3WFBH 3MCKB 5IB5B 5HD8C 5E94B 5C08E 2QQNH 3GSRA 4ODVH 4JVPA 1HHGA 4KV5F 4XNQB 3RWCB 2NYYC 3LRSB 3SCMD 1VADB 2DQGL 2DKUA 3MLYL 3JV0A 5EU5A 4N0UA 1NCWH 1Y18A 3MXVL 3V4VH 4XMPL 1H3GA 1ZT7B 1AGEA 1AR1D 3D25B 3LH2L 1FIGL 2PTTA 4ELMF 3F65A 4ZFOL 2NY2D 4ZS7L 2D4DA 3SCMC 3KYOA 2BSTA 4F9PC 4ZSOB 1S7VB 2DQEH 1QRNE 4M5ZL 5EBWA 4M93C 3SE8L 3D85B 2J6EH 5TPWL 3B5HA 3CPLA 3OMZA 3UTZA 4DGIH 1EZVY 1AR1C 1JRHI 5CJBA 3FFCA 1HDMB 2ICES 3C8HA 3QNXA 4JQIH 4KPHL 3SDCB 4ODHH 3HRZA 2NY2C 5HHOD 5DJ2B 4Y5XC 3QHFH 4GQPH 4EZMA 3P11L 3BEWB 1IEAA 1IGCH 4RAUB 4UAOC 1T0MB 3DUUB 5C0BE 4Y4HA 4MAUH 1YPZA 5C08B 1MWAL 3CH1B 1J5OH 4BFIB 3JWDH 5TDPA 4X5XB 5ADPH 4L8CA 1VFBA 4LCWA 5IHZB 3MRCB 3QIUD 5J6HB 1BEYH 4NO5B