3N1GC

Crystal structure of dhhn bound to bocfn3
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
ERPVAGPYITFTDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDKYWHSISHLQPETSYDIKMQCFNEGGESEFSNVMICETKARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Desert hedgehog protein
publication title All mammalian hedgehog proteins interact with CDO and BOC in a conserved manner.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 21
structure length 104
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3n1gC01
3CFBA 4WTZG 4YGVA 3ROOB 5CILL 4HPOH 1AGCA 5JOEA 2PCPB 3EYVB 3HRPA 2NY3C 3VXSD 5E6ZA 3JV4A 4JFFA 3E6HA 4YHLH 5I1DA 4XC3L 3HC3H 3QT2A 5DMGC 3IU3B 4QWWD 5T1KB 1RUML 1MFCL 3UC0H 2P44B 2R0WH 2VITA 5EU4A 1YYLL 1S7RB 1PYWA 5EU6A 1O0VA 2X4OB 2W38A 1M7DA 4XVSL 2O5XH 4KJYB 2FIKA 3BZ4A 1TZHB 2X4TA 4XCCL 3VXRE 3B2UD 1EFQA 4XMLH 2WMPA 4G6AD 5EO1A 1NAML 3O41B 1XGPA 4DZ8A 1KPRA 1LP9E 2EZ0D 2VDKL 3H6JA 3MV7A 5JW4R 2AJSH 3QIWB 3AGVA 1PG7X 1YY8B 3CZFB 3EHBD 2MPAH 4P48A 1A6UH 3DVGB 3BHBB 1NCDH 4IOSD 4ONOA 3Q3GB 4Q9QH 3N1GC 2A6DB 3MOAH 1A64A 1LO4H 1YYMH 4XP6L 4YHYC 2UWEF 4P4RA 3WJJA 2JKXA 1ITCA 1KELH 2NY4C 4V1DB 3JVGC 4BK5A 2EDHA 2WUBL 1EDQA 4IS6A 3B3IA 3BKCL 3EYUH 4U3CA 1M4KA 4TN9A 1E28A 3OXSA 1V3JA 5SX5K 4LHQB 4FABL 1D9KD 1NAMA 3EOAB 1Q9KB 1HCFX 3TC9A 2XA8H 1F2XK 1EUTA 3F7RA 3KAAA 4L9LC 3MBEB 5SWZA 2A9NL 3H7LA 3U4BL 1R3JB 3SJVA 1CG9B 1XF2A 2VLMD 4J7RA 2R2BB 4HS6B 3ZE2F 1BECA 4APQB 2NYYD 3O3UN 5I71C 5FAAA 4G6FB 3VDAA 3VG0L 2CPCA 3DRQA 2OR7A 2Y5TA 5B39G 2E7LA 3CFBB 4YGVB 4WJ5A 1DBMH 1MCQA 4DGIH 4NRYA 1MRCH 7CGTA 3JV4B 4LSQH 2UZYB 1IGYA 1ZT1A 4M7KH 4ZAKA 1MAMH 4O2EB 5INCB 2W59A 4FQCH 4OCNC 4M61B 4G9FE 4GMTH 5EU4B 3VXNB 3QDMD 1FLRH 3G6JF 3QIUC 3HPJA 1ZHBA 4H20L 1M7DB 2WWMC 4LPYA 1QBMH 5TF1H 3BJLA 3BZ4B 1QFWL 2X4TB 3JTSB 3UTSB 1DBAH 1HCVA 1ZANH 3SKUD 1KIPA 1AFVL 2AXJA 5EZLB 1PVHA 1BVLB 1Z0MA 2G60L 5IVZA 1XGPB 4LMQE 5GS0H 1BEYH 1CLYL 4I77L 3E8UH 5HXMA 4S1SH 4XPTH 1MFEH 4Z76B 2OL3B 2BFVH 5DR5L 3KNBB 3L3DA 4M7ZC 3REVA 1LEGB 1FIGL 4DCQB 3PL6B 4JFEE 4P2OA 1F00I 5GGTL 4HLJA 2ARWA 1E4KA 4ENED 3P77B 3FZUD 4IS6B 5IJVB 3P0YL 5FGRA 4LVHC 4CN4A 2LTQB 3HE7A 3PQYE 4P3DB 3U7AA 4JQXC 1QEWA 4OF8A 2ARJA 1T1XA 3KYKH 1PG7W 1NAMB 2Z93A 4DVRL 5IEKA 5D2LF 3QUXC 3RUGA 2ESVB 4XP5L 2BC4B 3SJVB 5HY9A 4WW2C 4JLRB 4JFDB 3BAEH 1I7RB 4WI2A 1INQA 4OFDA 5GGTA 1OP5K 4YFLF 2DQEH 2X70B 5I1CH 4WHYH 5DQ9A 4M62L 3MCLH 4IRJC 2FD6H 4WJ5B 4NKDA 4G8GB 3CMOH 2VDOL 4JKMA 3T0VA 4XXCA 4K07A 1KJVB 2OYPA 4PS4L 5DJ2B 1TDQA 5E2VH 1IGYB 3ROLB 3K2MC 1WBZA 3DI3B 3X17A 2E9WA 3S34L 4PJ5D 4ALAL 3D3VD 4X98A 3VXTA 3GMNB 4L8BB 1LE9A 1JZ4A 2EYRB 3BKYL 3HAEH 1Z0NA 2AJUL 4MXWL 1NC2A 1MJUH 3IDMA 1NLDH 1CLZL 3HPJB 1HNGA 2XXMB 3U0TB 1ZHBB 4K9EC 4KFZC 2NW2A 2VAJA 3OAYK 4O9HL 1FIEA 1I1AA 3U36A 1K5NA 5DZOA 1MY7A 1BZQK 3PHQA 1U92A 5IV2A 3REVB 2B4CC 1IT9H 4IHOB 4I3RH 2GTWA 3FHAA 4P2OB 4ZG1A 1JPGA 3B2VL 4PJEA 4B41A 2GEEA 4D9LH 2BRRH 3LMJH 1KLGB 3DSNA 3D0LA 2BP3A 4G8IB 3HE7B 3GM0A 4KJQD 4OD3L 2DYPA 1T1XB 1N64H 5F3HA 2ZPKH 2HLFD 4MHHG 1J1OH 1KB9K 4HIEA 4YH6A 3OKEA 3RUGB 1P4LA 3KS0J 5JHLH 5HYSB 2JJUA 4BH7A 1RURH 1VFUA 3MREA 1CFQA 5HY9B 4MAUL 3ZYOA 4HC1L 4J12A 5ENWA 4K3GA 2AJVH 4NO2A 3SKNB 1YMHA 4F15C 2M2DA 4ERSH 1EFXD 4GMSH 1H8SA 4OQTH 5DK3A 4QRQA 1CVSC 4NO5A 3PWLA 4NKDB 2APVA 5F9AC 3PHSA 1U8KA 3C09C 4N0CD 4ORGA 1WBZB 4PRHE 1BREA 5DA0B 4KQ3H 3KYOB 5I75B 3QCTL 3VFPA 3QXDA 3VXTB 5KSBE 1LE9B 2EC8A 1J05A 4JFPA 1N59A 1ZHLA 5GS2H 1NC2B 5EUOE 4HC1A 2OS7A 2D31A 4JGUA 4KHTL 4Y2OA 4PJDA 4HXBL 3EDEA 1EUUA 1C7SA 1RUKH 4UV4H 1FP5A 4LHUA 4HZLA 1X4YA 2NW2B 4G8EA 4PGEA 3PNWB 3U36B 3BJ91 1FFNB 3FFDB 2VERN 4PJFA 1CI5A 1DE4B 1F4YH 1U92B 4NWTH 5IV2B 4M6NL 2J5LB 4YE4L 3OKOB 2F74A 3U2SA 2J8UE 5ACMA 4FQ1L 3ZKXB 2ADFL 3LVEA 4PJ8C 5GRJL 4JDTL 1JPGB 4JPKH 1HK6A 2G75B 4PJEB 5ISZB 3LKPA 1IRAY 4R7NB 4ZFGL 4WUUE 4XVTL 5FYLL 5BXFB 3D2UA 2IFFL 2C4FU 2ZNWA 2VDRL 1FYTE 1FG2A 5C0GA 5IMLB 4PB0H 5HVWA 5D1ZB 2IPTL 3A6OA 2ADIB 1DQLL 2PO6B 3BXNA 4U7MA 1LD9B 2BCKA 4GLRH 2Y72A 1AP2B 1CGSL 4XP1L 4O5LL 1MQKH 1FFPA 2QSCL 3BP5A 4BH7B 2UVFA 1BWMA 3FO2B 1CFQB 4NFDA 5C1MB 3WMSA 5D7JC 2XZQH 5B8CC 2I5YL 4NO2B 2DLHA 5CEYA 1YMHB 3HZKB 5EZOH 3DVFA 3QR2A 2IPUG 5AD0A 1JZ7A 2YA0A 1R0AH 2H32A 2DMBA 4FNLL 4HT1H 4QRQB 5MEPB 1OCWL 3SGDI 4WCYL 5BJTA 1U8KB 3QWRD 5HDOA 3QHZL 4ORGB 5HHMD 3CXHK 1ZGLM 5LGHL 3LQMA 4QOKA 2YUXA 3GIZL 3P30H 3VFPB 3QXDB 1A9EA 3MYJA 1FZMB 2WLYA 1JGVH 3ZYJA 1J05B 3QI9A 4NQCE 1XGQA 1ZHLB 5IB5B 5EU3A 5C07E 5L2KA 5FCSH 3TT1L 2AJZB 1L6ZA 2RFXA 1MIML 4Z8FH 2APBA 2EDQA 4PD4K 2ERJB 3BPLC 4HZLB 1NCBH 1UZ6E 4G8EB 4NQDA 4PGEB 4K3DL 5D7IE 3BGMA 5E6IC 4X6EB 4KV5F 4D9QE 4PJFB 4KI5D 1A8JH 1TQBB 1NSNH 4X7DC 4P46B 4A6YH 1FAIL 3N9GL 1INDH 1CS6A 5IW6A 4Z95H 5HHOE 1KLFA 2F74B 4OLEA 2ZSVA 3LKNB 5CJBA 3TN0C 3TO4B 1RUPH 4XMKL 4KAQL 3VXRD 3LKPB 5D2NB 4Y4FC 3NGBC 2QQKL 4GW1B 3D2UB 2FSEB 2GK0B 3RVWD 1WZMA 2EXYD 1FG2B 1A2YA 3MRFA 3X14A 1EO7A 5ITBH 4P4KC 1KJ2H 4LLAA 4GQPH 3VFMA 4YDIH 3BDXA 1X5GA 2BCKB 1NGQL 3V9FA 3KJ6H 1T4KA 4FQXB 4NO0A 4AG4L 5IG7A 1KTRL 4G43A 5GJSL 4V1DE 4RMQA 4MXQD 3X3GL 3BP5B 3ZYIA 4OZGF 5FOJA 3QDHA 1VERA 2IPUK 2F54A 5CEYB 1VFAA 1NGWB 5B39B 4LCCC 1AO7A 5EIQA 1RK0A 5DI8B 2LU4A 2H32B 4HV8A 5EO9A 3ZKMD 5C9JA 1QSVA 1LO0H 1OM3H 3KPNA 4Y4HA 5I1IL 4OGXH 4Q9RH 1MWAB 5SWSE 4DVBB 4JRYD 1JV5A 4RQQA 2XWTB 5D1XB 1OGAD 2DM4A 4QOKB 1RZ7H 2MCPL 4EOWL 2O5ZH 2XQBH 1F42A 1DVFB 1QYGL 5F7DB 1A9EB 3MYJB 4OT1H 3UJJH 3QI9B 2NY1C 1AXTH 3BN9C 2HMIC 3D85B 3MOBL 4M7LT 3B9KA 3G08A 3BP4A 4ONGL 1JHLH 4JHAL 4MNQA 4U1MA 4EZMA 3VWKC 3QULA 3BGMB 5TPWH 2ZCLH 5DA4A 2EXWD 5C0CE 1UM6H 2DM7A 5A43C 4KK6D 3P9MB 4CU6A 4JPVH 2VDQH 3MRLA 4UV7L 5DJCA 5IW6B 4G9FD 1R3LB 1UEYA 4LSRH 1TZIA 2ZSVB 4YBQD 4HH9A 3MRBA 2BHZA 4KUCF 4L8SC 4RGOH 3VG9C 2ZCHL 4ODTH 4UT7H 2XKNB 4JPWL 4KY1H 5C92A 3JWDC 4U0RB 1A5FH 1HHGA 3SBWA 3WIIL 4EN3C 1WT5A 4HGMA 1CGTA 2BXZA 3VFGL 3DMMA 4G8FA 3JV6A 4BSVA 3AS2A 4A2LA 1T0PB 3ULUF 4UTBH 2RIKA 3WFDH 3V7AE 4L4TE 5JIIA 2EE6A 3LB6C 4JFED 3FRUB 4X7SL 5KAQG 2C4XA 4XAWH 4JJ5B 4ODWB 3RL2B 4PJ9A 2CDEB 4WUKL 4G43B 5IR1B 4J2XA 3GZKA 43CAA 5TE7L 1T2QH 4NHCL 4PTUB 3N85H 2XG5A 4K3EH 1QRNE 1FBIH 3SQBA 4ONFL 3OR6A 5K9QI 4Z0XA 3NVQA 4E0RB 5I1EL 3T1FA 1AO7B 4S1RL 4X8JB 1G0YR 4HV8B 2AI0L 5EO9B 4MGXA 1Y18A 3TA3A 2ESVE 3MGAA 3V6OE 1QD0A 3KPNB 3TNMA 2ZUUA 1SJHB 5FHAH 3KS0H 5JPMA 1N3NA 2Q76A 3B5GA 2ATKA 5MP6H 4DW2L 1JJUA 5D7KE 2R29H 3X12A 1HEZA 4U1KA 4G8GE 2R0LL 4OZHF 3VJ6B 3TYGH 1BBJA 2FEDC 5CSBA 3B9KB 3SN6N 2BVTA 5I16A 3VGAB 1KIUA 5FM4A 4CJ0A 1NKRA 5C0ND 4MNQB 4R4ND 1H9VA 4YDLC 1P6AB 3QULB 5JHDA 2NX5D 5H94A 3VRJA 2CMRL 3D0VB 3DX8B 3MRLB 5J13C 5IQ7L 1CDBA 5J1TC 1D6VH 3MRBB 5FDWB 5DJDA 1N6QH 2HYMA 3K4AA 3RVXD 2R1YB 3ZKND 4KK5C 4C58B 4NKIL 3BIBX 3C60D 2UYLB 4BSVB 4MZ2A 3GIVA 1G7HB 5DJ8A 3G6JE 4LCWD 1G7PB 2BK8A 1EMTL 2W9EL 1Q1JH 4JRWA 4ZPVA 1LO2L 1JTPA 4HQQL 3ULVF 1TNNA 4JQVC 4PJ9B 3K4DA 3ARFC 5TDOA 1I1RA 3UYOD 2DQGH 3TNNA 2IAMD 1YEEL 5IEHA 5HPMB 1R3KA 4QLRA 2ED8A 5M95B 4X6FB 5AZEH 3EO0B 5HVGB 1IKNC 5CZVL 3T1FB 3NFPB 5FF6A 5I9QB 1IEAB 2GK2A 4HW6A 1Q9OB 1KTKE 1Y18B 1DQJB 2XNAA 1CGWA 1AGFA 3K81A 4HMCA 2W9LA 3NACH 3FFCD 4I8DA 3TNMB 3CCHB 4FP8L 4ZUWA 3U1SH 3T0EC 3ZE0F 3L95A 1N3NB 1WQVT 4TULH 2Q76B 4PIRF 4Z7WB 5FO7B 1JZ5A 4E41E 1MREL 3O3AB 3DUSB 1T1ZA 5E08L 4FFZL 3X12B 4HJJH 1HEZB 3LN4A 4U1KB 1X5FA 3PWVB 4K8RD 1X6LA 4F7MA 5IMMA 1YNTB 4L3EB 5FUCC 3T3PF 1BPVA 4NM8H 2V17H 5DHVA 2CLVA 5CD3B 5I16B 2AV1B 3VE0A 4Z7QF 4YXLH 3I6LE 4K7FA 3PV6A 1N8ZA 4L9LA 2GCYB 1ES0B 5BZWA 3WLWC 5JHDB 4WEBH 3LEVH 1CQKA 2NY6C 3O6FC 5B21A 5AAWA 1AC6A 5AZ2L 2KQNA 3RQ3A 3RWHB 4OBSA 3FQNB 2ZOLB 3RVTD 3UJIH 1LNUA 3X3FL 3B8YA 1HQ4A 1A7OH 2WQRA 4FFVD 4U1JA 1JMZA 4Y16C 1P2CA 5DRWB 4P5TC 5EULV 1RSFA 1H15A 2Y06L 3GSUB 2WZPD 3QJHB 1R24B 1G6RL 5FB8B 5CBEA 5BOZG 2BSED 1IKFL 5B3JF 4HBCL 2NY5H 1MHCA 3KPSE 1JNHB 1RHHA 4ZQKB 3GIVB 1GC1C 5DJ8B 4H8WH 2R4RL 3I02A 4Z78B 1QUNA 3HS0A 4LSPH 5EDXA 5ISZE 5DTFA 5E8OA 5HI5D 2KPNA 2VLJE 2Q8AL 3QIUA 4H26B 5CMAA 5ADPL 5TDOB 5HYFA 2O5YH 1A0QL 1AHWC 4U6HB 3PDOA 1FO0L 2V2TA 1XAUA 3WFBH 1JI1A 1K6QL 2GUOA 35C8H 3EJJX 2VZUA 3C2SA 3K2UH 1WITA 5FF6B 1PW3A 1G6RA 3MXVH 4F37F 3T2OA 5AG9A 4I1NB 2XNAB 4JREB 1MCPH 1AGFB 4ELMA 1DP0A 2DQUH 4YUEH 4HAGA 3S35H 3FB7A 1AXSA 12E8L 4YHYB 4YFDB 2OTUB 3VFTA 3SE9L 2QQLL 3WUWG 2BNQA 5KSBA 2NY4B 3BZFB 4GS7C 3K4ZA 4OKDA 3UTTA 4Z7VF 3VFRB 3FN0H 4F7MB 5IMMB 1D5BA 3VGGA 5EUOA 1NDGA 1FO0A 3VRIA 3MBXL 3RI5F 3GSNB 3D9AL 3J7HA 4U0QB 5DD5H 4AEHL 3QQ9C 5CGYC 1D3CA 1J9CT 4MS8C 4XP9H 5LWYH 3QUXA 4FZ8L 4K7FB 1A6AA 4GRMB 5BZWB 3QFDA 5ABDE 4WW2A 2KZWA 5C0JA 3GSQB 5FM5O 2EDTA 5E1AB 1LNUB 4K9EL 5CZKA 3S8WA 1HQ4B 2BVOA 2XA3A 2Y6SC 4QXUL 2J8UA 3L5XH 5IB1B 4KXZH 1JTOA 4PLJC 2YWYA 1P2CB 4G5ZH 1H15B 1MHEA 4TUJA 1VFOA 2FR4A 1RJCA 3L3GB 1P5UA 4POZD 5E94A 3L3KB 4O02H 1I9IL 3T0EE 3A67L 5T1KD 4QEGA 2HRPL 2VXSL 4D9QD 6CGTA 3I3DA 1RHHB 3WFEL 1T5WA 4WHDA 3QUYA 1CDHA 5LBSH 4K2UH 4HJ0D 1YDPA 3BKJL 4JR9H 5HHOD 2EDKA 4N9GA 5E8OB 2IH3B 5D2NE 5FUCE 2DDQL 5D93C 1NBVH 4R4BA 2Q8BH 1NC4B 4OTXL 4ZO8A 3GSOB 4EUPH 4UAOB 2VXQH 3PDOB 1KGCE 1NBQA 3EYQD 3ARDA 1AGDA 5I1GH 2YMXL 4Q9BA 3RY4A 3F62A 1JPSL 3KXFE 2GUOB 1EGJH 1IARB 4KH2A 4XH2A 2P5EE 3AB0C 3MUGA 5I1HL 2Z92A 3UTQA 1LK2B 1JYXA 1KIRB 4IRSC 4Y0GA 4KUZH 3MJ6A 4ELMB 5EFIA 1RD6A 1FORL 4FQPA 4JRXA 4V1DD 5I30L 1AXSB 4PY8J 3T1WA 2XIDA 3SGKC 5DLMH 1ZWIA 3VFTB 1MPAH 5MI0B 1HH6B 2BNQB 4ZUVA 1F02I 4Z0BL 4HJGB 5KSAC 1S9YB 2JJWA 1CGXA 4RFEB 3F6IA 2WQ8A 5C07A 1D5BB 5EBMA 2HP4A 3MBED 5DS8A 5BO1H 1DUZB 1NBYA 2NQCA 4P59L 1TVBA 4XNYL 1G9MC 5SWSD 1A6AB 4LMQI 4S1QH 5GS1C 1H3WM 3WL9A 2EECA 4PRAA 4QCIA 4P57B 2N7BA 1BZ7A 1P4BH 1VGEH 5TE6H 4HWBL 2HT2D 4O4YH 4ZTOL 3BPNC 1EJOL 5DK2B 5CBAA 5D72L 5ID0B 1UVQB 3WS6C 2PUQT 4P23C 2VIRA 3RJQB 4ETYA 1RHFA 1F4XL 1MHEB 1GGIH 5C0AE 3ULUC 2DD8L 3MV9A 2VWEC 3FQRB 5TJWK 3Q1SH 5E94B 1X44A 3KLAB 2MKLC 1L0QA 4Z7OF 4LSSL 1GIGL 1EVUA 5ESAB 3DX7A 3ALXA 3LSOA 3NIDF 5INDA 4X9IA 3S88L 1ZS8A 3BDYH 3QUYB 4YHIA 5DD6A 2L7UA 1BQSA 2R39A 3ZO0A 4OZFG 4QRSB 3UTSD 1IGIH 2VDLH 2GSGB 3B4NA 4R4BB 3IDNB 4RGMC 4BM7A 4HWBA 1H3XA 4IJ3B 3ARDB 1J0HA 3MXWL 2OJZL 3VD4A 4OUOA 4NKMA 1JGUH 2VDNH 1YC7A 1RJYA 3PL6D 2W9DH 5CCKL 5J12B 1JGEA 4XH2B 2AEQL 3K8MA 4NQSB 1DL7H 4O2FA 1IE5A 2YD2A 4WO4B 5EFIB 1OAZL 4PJ8A 2W0FA 4FXGB 1XGYH 5T1LA 2C1OB 4N0RA 1CD1A 4ZUVB 5AUMB 3QUKA 1GGBH 5DQJA 4JY6B 5CUSL 5EUKA 1M6OB 4PRPB 3ILQC 2QL1A 3IDIA 5DS8B 1MRFL 3RIAF 1FDLL 3LKQA 5DO2D 1OT2A 2ESVD 4EIZC 4R96A 2P46B 4HFUH 5T3ZE 3SJVD 5D7SL 1KTDA 3UTPE 3R8QA 4JFDD 1TVBB 3BRDA 2FX8H 3SEPA 2EDXA 5C0CA 4I48B 3C87A 1AJ7L 1QNZL 1Z5LA 1KG0A 2YS4A 3G6AA 5D7JA 4KK9D 5D7KD 5B8CA 4JZJC 4G8GD 4NWUH 1U8LB 4F7PB 1BQUA 5CD5C 2VIRB 5J3HC 1TJHH 5HGBA 5I1AA 2P43B 4AK1A 1ORSB 4ODSH 2DJSA 3MV9B 3QRGH 3BE1L 3QFJB 2HG5A 1BFVL 3CVHB 3AROA 3RWFB 3MLRH 3UO1L 3ULVC 3LSOB 1R3IL 4JE4B 2NR6C 5HI4C 1DBBL 5DGQA 5EOTB 4D0BA 4LVNB 1HHJA 4L4TA 5I74C 4MQXC 1MCFA 5E00B 1S7VA 3AMLA 3FRPA 1FJ1B 5IHUH 1VB9A 5TQ2H 2JJTC 2H1PH 2P48B 4X4ZA 1ZGLA 5C0BB 1K4DA 1QRNA 4X7EC 2VNCA 4F3FA 3CVIL 1YEGL 4WRLA 1WICA 3BGAA 4HWZB 4JVUA 4NKMB 5A2JH 1RJYB 4GAGL 4Y5XC 1LILA 2GKIA 4WIQA 1K8DA 3TFKD 2UWEA 4LLYB 5JXED 2WP3O 1NL0L 3DV4B 3LD8C 2D0FA 2EH8H 1F4WH 4ZDHA 4P2RE 4DUXA 1U8HA 5FO8A 2W0FB 3BT2L 3TN0A 4DN3H 2FDBP 3WUWA 3HPLB 2EIZA 1N0XL 3WIHH 4N5UA 5T1LB 1S7QA 4UB0H 3W11C 3HE7D 4Y4FA 2X89D 1ITBB 1I7UA 3GI8H 4PJAF 3IFLH 4FG6C 4GXVH 2ZNXA 3ZE1E 5EUKB 1DBJL 1A1OB 2FL5B 5E8DH 4P4KA 5F88A 5EBWB 4NYLA 4WFGE 1NGPL 4KDTA 4RISL 4RMUA 1KTDB 2H2PD 4Z7WE 1JHTB 4PRIA 1S5IH 3L6FB 3VA2C 4HPYL 5D6DC 3LEYH 2R15A 1N5AB 1Z5LB 4TOYH 2K1MA 1WTGT 4L3EE 5BVJA 3G6AB 2UZXB 1A14H 2ITDB 5D7JB 5E5MB 1KN2L 1F58L 5ILTL 2VQ1B 4JKKA 2I60L 3HG1E 4LCCA 3SE4C 2LQRA 1UT9A 3WHE1 2YRLA 2AW2A 5I1AB 2RJMA 1NFIA 1EH9A 4GG6F 3I6LD 5D71H 1SM3L 3HC0A 1F13A 3C5JB 4G9DA 5FUZL 4OZHE 4X9HA 2FATH 5KANG 1W2KT 1CQYA 2A83B 2D4FA 5H37G 4AL8L 4FQ2L 3CFKB 1KENL 1UQSB 3BFOA 3T2PA 1B4JL 2IALB 1PZ5A 4XT1C 1MJ7H 3BVNA 1ZOXA 3VXME 1F4AA 2AABH 1E4XL 4X5XB 1K4DB 4WHCA 4K3JH 5BRZA 4JY5H 4F3FB 3VWKA 5ERWB 1BF2A 1KFAL 1FSKC 5HDQH 4EQ2A 1HI6A 4JM2B 1K8DB 2HFEA 2ZG3A 4G3YL 4LPTA 5ISZD 5HHQA 1T20A 2O61A 4GRWE 2D7PA 4KKNA 5FO8B 4HG4J 3FQTA 3WUWB 4ELKA 2EIZB 2GJJA 1S7UB 2DTML 2NY2C 4I2XA 1S7QB 5D1ZD 4AENB 5JW3H 1HHIB 1I7UB 4P99A 2X40A 4HUKB 2PO6D 2IBBA 3HMWH 4WENB 5I8CA 5D2LA 3QG7H 4HHAB 1P7HL 1CFTB 5F6IC 5F7EL 1JGDB 4UDTB 1NKOA 5F7WC 4IBLT 3C8KB 1F6AA 1EERB 3CXDH 3WSQH 4PRIB 2E8ZA 2W0LA 2C7UA 2DBLL 3FB8A 1RZ8A 3F12B 1CU4L 4HUXA 2YKLL 4YDKH 5BVJB 2I9LA 2OMNA 1EX0A 1JNNL 5CILH 5ANMA 5DYOA 3T08A 2AEPL 3GMLB 4WU5A 4KU1A 4NC1C 4KJPC 3E1F1 4LCCB 1KF9B 2ENSA 3ZE0E 3WYRA 3QNZA 3WBDA 4XC3H 2AXGB 3ARGC 3RX5A 4KKLC 1NFIB 1K85A 4LCIL 3A0OA 3D18A 1J1PL 1RUMH 1MFCH 1IGFL 4G9DB 4OF0A 3HUJB 3T3PE 1YYLH 4PJXF 2IPKB 1DANT 2VE6B 3L7FA 3HI1B 4HAFA 1DN2A 4TQEL 4OZFA 4XVSH 4DQOL 5CHNB 3BN3B 4JQIL 4XCCH 4YDJB 4Z7QE 5LXGL 1NAMH 3DRTA 4WHYG 2AXFA 3RKDD 2VL5A 5D9SA 1OW0C 3VFNA 3LPWA 3FO9B 4LLMA 4J3UA 2VDKH 1TJIL 4P46D 5FGSA 2VLRB 3KR3L 3L5WA 2FBJL 3JTTB 5BRZB 5HDLA 5DUPL 3VWKB 1TITA 1R6VA 4K94C 1Y6KR 4K7PY 3JZ7A 3PIQA 3TO4D 3NCMA 1N2RA 2OM5A 5HHQB 1DQDL 4B53A 1GJIA 3FQTB 5C2BL 2WUBH 2PN5A 3D2UD 3BKCH 2HTKD 3FQUA 3OR7A 3WKNA 3V6BR 1KGCD 4K7PL 4FABH 2ICWB 1FNAA 1Q9WA 1N0LA 2G5BA 5D2LB 1MCNA 4FQXD 4BH8A 5DFVC 2A9NH 3BRGC 3U4BH 4OGYH 4O58L 3QH3A 1F6AB 3OL2A 1RZGB 1NMCC 1RK1A 4NUGL 4R4FL 1ZLWH 4YHZL 4M3KB 2J12B 2C7UB 3ARFA 1RZ8B 4LLVA 4MJIB 3PWNB 4YX2L 3VG0H 4QRPB 2WBWB 2I9LB 1UWXH 4DFHA 3OKLB 1IKNA 1JWSA 2P24B 2AK4A 3F7YA 2BMKA 4KWUA 3FL7A 4KI1A 5D1XD 4HS8L 4I13B 5HYQA 4QOKD 2XZAL 4F9LC 4NKOA 1EO8L 1W0YT 4XBEL 1DVFD 4Y5VC 3TLRA 3D18B 3T0EA 4OFKA 4DGYL 2MMXA 3QI9D 4LCUB 4M9OA 2JCCE 3BD4A 3KPOA 2CXKA 3D85D 3UAJC 4H20H 2YXFA 1PY4A 4OZFB 4PFEA 5K9KB 3CFDA 1QFWH 2IFGA 4NJAL 1AFVH 4X6CF 1IC4L 2ZSWB 1A1NB 4BA8A 2G60H 4KPHL 4EBQL 2VL5B 1XZ0A 5D9SB 2CK0L 3VFNB 4I77H 4KKCD 2GITB 4LLMB 1GC1L 1NDMB 2R1WA 1Z6JT 3O6KL 4NZRL 5DR5H 3L5WB 3L9RB 1A6UL 1FNEB 2BY1A 1FIGH 1RZJC 3CUPA 4X4YA 3O3EA 3NN8A 4KTDH 4LIQE 2LE9A 5E5RB 5GGTH 2FEEL 4DUWA 2Q7YA 3PIQB 3IXTB 1EJ6A 1N2RB 4NC1E 1C5BL 5JIPA 1DR9A 4Y16A 3EYUL 4P5TA 2YPLA 2QTEA 3OR7B 1GOHA 3STLB 4L29B 1KACB 1CFBA 4NN6C 3IJSA 3MLSL 2XA8L 4DVRH 3OKMA 3SDAB 5HPOA 1Q9WB 2KDGA 3ILPA 5I73B 4R7DA 4XP5H 3E6FA 3KG5A 4QRRB 2HT4C 1Q72L 1ZVYA 5JPNA 2HFTA 4U6TA 3VD9A 1QLFA 3V6ZA 4UQ3A 5CJXC 1RK1B 4GSDL 5ESVA 1WWCA 3HNSL 3IAQA 4LLVB 1AHWA 3KPRB 1AO7D 4PRPE 4M62H 5EH1A 4MB5A 1MRCL 3O81A 2VDOH 1U2HA 2PW1B 1I1YB 2DWDB 4JG1L 3S5LA 4PS4H 1S9WA 2AK4B 3IU4L 3OAUL 2BMKB 1G0XA 3PWPA 5DT1L 3S34H 4Y8DC 4ALAH 3GNMH 5HYQB 1VGKA 4PGBA 5EZJA 2P8PA 5E4EC 2OZ4L 3W39A 3VCLB 2XWJB 2BNUB 3BKYH 3T0AA 1CD9B 2FBOJ 2P5WE 1SVCP 1UH2A 2J3SA 1M7IA 1NBZB 4MXWH 1EZVX 4TVPL 1BFTA 1CLZH 2WBJB 1J0IA 3B9KD 1RMFL 4M7LL 5DRNA 3EBAA 3ME0A 4YZFF 1JNLL 2VTFA 3CFDB 1WAAE 2BVEA 4MNQD 4O9HH 4WU7A 5D8JL 1TENA 3OKYA 4BFIB 2B2XL 3MRNA 3GBML 2FLRT 5C09A 5GS0L 1XZ0B 1NJ9B 2R1WB 3B9AA 5DC4B 1FV1A 3T0XA 5F7NC 4GKSB 1W0VA 2DB8A 1HWHB 5T3ZL 3DECA 2J8OA 2NY6B 3P4NB 3RGVC 4U1NB 1U8PA 4DJMA 5JXAL 3P73A 2OZ4A 2P7TA 4OLZL 1U3HB 2Q7YB 3RP1A 1F45A 5IFAL 4BQ9A 5F9DC 1KEML 3B2VH 3T0DA 4P9HC 3KGRA 2DMCA 3DUHA 5C0BE 1CL7I 3MACL 4Z7OE 1H3PL 3ZDYE 3FTGA 4PD4J 3IF1A 3EYSL 2FECL 4OD3H 4QY8A 5FO9A 1BJ1J 3DHMA 4F80A 3WO4C 2D7TL 2YD9A 4LARL 3OKMB 2MOVA 3HZYA 1FZOA 2B8OT 3ILPB 4PJ9D 5KVDL 3FO1A 3S35X 2J6EL 2ZUQC 3Q6FA 3E6FB 3D25B 5J1AA 3FONA 3BP6A 3S98A 5GZNC 3BAEL 4MAUH 5JPNB 4HC1H 4OZGA 2AS5M 4UQ3B 1VFBA 1JZ3A 3S4SG 4Q97A 2JLLA 1UJ3A 4Y88A 3C8DA 5ESVB 2DQEL 2KZ1B 4JDZA 1XGTB 5IBLC 3SDDB 1AQKL 3KLSA 5JDJA 4ZO9A 1CXKA 4RMWA 1VKXA 2HVJA 1J7VR 5GJTL 2VUYA 4LPXA 3MNWA 1BOYA 3QIBB 3PWPB 2LVEA 2R23B 4XI5C 4PGBB 3QCTH 4IRSA 5MEQA 2P8PB 2DKSA 3EFFA 3W39B 3IKKA 1YNKL 2J6EA 3SGKA 2HRLA 1BMGA 2Q3AA 4L3ED 1A7NL 1M7IB 1P1ZB 4KHTH 3U46B 4HXBH 3ULUL 2NNAA 4ZO6A 5KSAA 3LKRA 1I9JL 4ZNEA 2X4RA 5GRVL 3MRNB 1PQZA 3LH2L 2F9BT 5JHDD 1HN1A 5A3IC 3S96B 1FV1B 5C08A 2CO6B 1W0VB 4M6NH 2IBZX 4YE4H 5CEZL 1P7QA 5GS1A 1EO5A 4FQ1H 1HDMA 1U8PB 2ADFH 4P2CG 3P73B 5GRJH 5EU5A 2NXZC 4JDTH 1EAPA 3P4MB 2YPVL 2CH8A 2AERT 5KBNC 2DICA 2A73B 3NTCL 2FX7L 2H32H 4ZFGH 3WS6A 5FYLH 4XVTH 4P23A 2IFFH 4MLIA 3FTGB 3DO7B 4NBYB 1VSCA 1HXYA 3IF1B 2IPTH 1DQLH 4QY8B 1G7MA 1CDYA 2JIXB 1GYAA 4L4JA 3HZYB 1CGSH 4XP1H 4DOHB 1FZOB 5TGBA 4O5LH 1SBSL 3Q6FB 2QSCH 2P8LB 4Z77B 5J1AB 5DJYA 2UV3A 4TNWK 5GGSA 1MJJB 2I5YH 4AIXA 3EJZC 1UJ3B 4FQHA 5C70A 2VB5A 5D5MB 4K3HA 3OAYH 1J8HA 2XZZA 3ARTA 1MLCB 4RAVA 5HBBA 1WWAX 5KSVA 1OCWH 1RZIA 4WCYH 4Q6IC 4PJBB 3QHZH 3HG1A 1QOKA 3W5NA 1KNOB 5LGHH 3QBTB 3WXVL 4UIKL 1HQRA 3GIZH 5MEQB 5EBLB 5T3XE 1R5VA 5DVLA 3QCVL 2UY6A 1XR8A 3GJFK 4OZHA 3THML 3TT1H 1A7RL 1JUFA 1KLUA 1T0NA 3KJ4C 1MIMH 2NNAB 3C6LB 4XP4L 1F3DJ 2QQNL 1GGUA 1ZHKA 4K3DH 4MDJA 5JW4N 1PQZB 3ULVL 3LDBC 2YPKA 4ODUB 2IGFL 4Q9CA 3N9GH 2E9JA 5C08B 4BSJA 1OSPL 3HZMB 1QLRB 1XF4A 1P7QB 1UG9A 3DHJA 3GGWA 3OKNA 1UM4L 4U3HA 5DRZA 4CAGA 1HDMB 3OG6B 1CCZA 4CMHB 4RSVA 1EAPB 4XMKH 4JZJA 4PRBA 3EJYD 1NFDE 4KAQH 2WSKA 1G7LA 3BPNB 3BWAB 4UOJA 3S6CA 2QQKH 3SO5A 5HI3D 2BNRA 2VLRE 4M5YL 5KW9L 2RB8A 4U1IB 1HXYB 4AIZA 2BJML 1MCSA 3BGFB 4B7IA 3RDTC 4HIXL 4MMXC 3EUUA 1NGQH 5TDNA 4DAGL 5D1QA 4AG4H 5GJSH 1CTNA 5TGBB 5CIPA 1NC4D 4OFYA 1NEZA 3X3GH 2YBRA 4XMPL 3QJFA 5DJYB 1FQ9C 4Y2DB 4CU8A 1T7VA 4H0GA 4MJ5A 5C7XL 5GGSB 3ZDZF 2JJTA 1P6FA 5CKGA 1J8HB 1UCTA 4R2GC 3ZT6A 2X4NB 2FO4A 5E2UL 2DS4A 4R0LC 3NAAL 2Z31C 5T1MA 1QSEE 1L0XA 2ZOKA 1AIFB 4XXDA 1B0RA 1S9XB 5I1IH 2UVEA 3CNKA 3VGEA 4Z6AT 3G6DL 1BX2A 2PTVA 1JN6B 5ID1B 2MCPH 3MRJB 4MJIE 3D39A 4EOWH 5I1LB 1QYGH 4QRPE 2BNQD 4WWKB 4W81A 4GBXC 3QAZC 5BV7C 2G2RA 3P9LA 4TSBL 2N7AA 1PSKL 1YEIL 2R0ZL 3MOBH 3DV6B 4FFWC 1BOGA 3DUUA 3QEQE 4ONGH 2W07A 1AI1L 1KLUB 3VFSA 3QPQC 4JHAH 5GGRY 4PP1D 3TV3L 5MERB 1E6OL 2EEBA 4WNQA 3GMQA 3FOMA 1INDL 1R5WA 4UV7H 4GXUN 4ZSOB 1QBLL 5D6DA 4XHJC 1D6EA 1NMAL 4X99A 3GGWB 3T77A 3GJEA 3BW9A 1EEYA 2ZCHH 2E7BA 1IM9A 4JPWH 3IS1X 3I6GA 2QR0B 4PRBB 4CGTA 1IAMA 1A4JA 3O2DL 2DMKA 1G7LB 3SE4A 3WIIH 1MFAL 3GB7A 1OQOA 2BNRB 5IB2B 1C08B 2X4PA 2NPLX 3VFGH 4ZFZA 3NPZB 3RPIA 4YK4B 3BH9A 1KJ2L 5BVPL 1RZKH 4AIZB 5C3LD 3KPMA 3QUYD 3BQUC 4X4ME 2DWEB 4LGPB 2Z4QA 4X7SH 4JM4H 2CRYA 1FCCA 2H26B 3LEXB 3R0MA 5D1QB 1A6TA 3IVKB 4WUKH 3CH8A 3TZVC 2XOTA 2BSRA 5TE7H 1TXKA 1LMKA 4NHCH 3G04A 3S4SA 3SCMC 4R6UA 3ARDD 3IJHA 5GGRA 5I1EH 2Y23A 4HIJA 3MRCA 3O2DA 4Z7UB 2VDML 4LKXA 4S1RH 4DTGL 3KLHC 2Q86B 2AI0H 1BJ1H 3RA7L 3TO2B 5KS9F 4H0HB 5I19L 4QRRE 3VXPA 4WO4D 4OGXL 4Y4KC 3UXFA 4P9ML 4LIQL 2CJUL 1QSFE 1BX2B 3OG4B 4Z9KB 4DW2H 5L2JA 3UMTA 3OAZH 4JFOB 4Z7VA 3GJFA 1TCRB 4BELD 5DMKB 2R0LH 3I50L 5HDBF 5KN5A 4PRPD 3MRPA 1PJ9A 2IH1A 4WEMB 3WV0A 3RIAK 1C1EL 5AWNL 4XBPA 2CIKA 4LSUL 5CJOL 5EORL 3JUZA 3MNZB 4G7VL 1FVCA 1D5IL 5HVHC 1RPQA 4N0UB 3QDGE 2HVKA 4YC2B 3PABB 1OP9A 4Y5YC 3AAZB 2VABA 4RGNE 3AS1A 3PJSB 1R5WB 2DLIA 3LN5A 2CMRH 5CZXD 3OGOE 3C5SA 4M6AA 4MHHI 3O6LH 3IRPX 2XKUA 4LP5A 2VZSA 2P5WD 3FO0L 5IQ7H 1D6EB 4DK3A 1N5YL 1WF5A 3T77B 4FQJL 4UTAL 1IM9B 1A5FL 4MA1C 3TBYB 2FHFA 1A4JB 2OI9B 3FT3A 3MV9D 5D7LE 4NKIH 5DDHA 5CP7B 3GB7B 3QFJD 5KG9B 2X4PB 3MGTA 4RNRA 4ZFZB 4NQEE 4K94L 4YBHA 4AT6B 5EC1B 4KGJA 5EZIH 3ARGA 4M1CD 3DOSA 4QF1A 1EMTH 1XH3A 1CIUA 2W9EH 1OARH 3KPMB 1B0WA 1LO2H 3JWNC 4HQQH 2Z4QB 4YHKL 3WD5L 1U3YA 3QPXL 4PRNA 3Q48A 4A6YB 1A6TB 1Q94A 3U30C 4MCYB 3N85L 1YEEH 3G04B 1NMBL 3S4SB 1FBIL 5C0BD 5GRZA 5DHVH 4HLZH 2VXVL 2Y9RT 3IJHB 4CVZB 4OM0L 1TZGL 4TNVF 2GHWB 2DLGA 5HGGS 4KKBC 1OW0A 5CZVH 4NO3A 3MRCB 1KTLB 2VZOA 5CINL 2J88L 4ODVL 3VXPB 2IANE 3WNKA 4FP8H 2C3GA 4KTYA 1KJ2B 1QBBA 3CFJB 4PJGF 3W5MA 4RMTA 1FVEA 3VXQA 5T1LD 3QQ4A 5JO5A 1EA9C 1MREH 3RPKA 5A2LH 3RL1A 5L7XH 5E08H 4FFZH 4TUKL 1MI5A 3D1MC 3U82B 4Z7VB 3DNKA 1TPXC 4AQ1B 4JN1H 5KN5B 2X5PA 5BS0E 3TVMC 4EUPG 4XCEA 3KWWA 5DJAB 3H9SA 1CLCA 4XBPB 3PWJA 2A6KB 2NXYC 5DEFA 2G5RA 1SMOA 4KRLB 3P0GB 1JRHL 3TBVB 2HVKB 4LLUA 5F3BA 5F70A 5AZ2H 2W91A 3DBXA 5D7JD 3X3FH 2R1XA 4X8XA 3C5SB 3SGJC 5F7KC 4OFVA 2PW2A 4OM1L 5F7UA 2XN9A 3H3BC 3MGOB 1N6QL 1ZT4A 4XVUC 4ZXBA 4M1GL 3QDJE 4H88L 4L1DA 2Y06H 3SQOH 1VCAA 1KCLA 1PKQB 1G6RH 4R97B 1F3DH 3BDBA 2H8PA 4OD2B 5E5UB 4HBCH 3MGTB 5IK3A 4C56E 4RNRB 2VXUL 1RZJL 3M07A 4FMFA 3RY6A 5FYKL 43C9A 5ICZA 1XH3B 1A21A 4N0YL 4F9LA 2R4RH 4JO2L 4U1GB 2V9TA 1IAII 1QPPA 4Y5VA 4PBXA 4YZFE 1AGEA 3AREB 2D2OA 3ZMRA 1ZEAL 5F7MC 1SYVA 4QWWC 2Q8AH 3NIFF 4I4WA 1Q94B 4BJLA 3V0WL 4ZUUB 1A0QH 1CDIA 1NGZA 1PX4A 4TTGA 1G9NC 5C0DB 4X7CC 3T4YA 4J3XA 1FO0H 4XCNB 4XGZA 3MRKA 3T0WA 4X6DB 3AMKA 1ZAGA 1K6QH 3W9DA 1I4FA 3B2UC 3AS0A 4G6AC 3GSRA 3VXUA 4JM2D 2A2QT 2DTSA 4JZNA 4GH7B 1U58A 2BVPA 5J9PA 1A1MB 2EZ0C 3ALWA 5LQBL 3LS4L 3EHBC 12E8H 5D5ME 4WFFE 3VXQB 4KI5F 4Q58C 3SE9H 1A9BB 3VD5A 5DVKA 1YEKL 4HIHB 3QQ4B 5JO5B 3C2AL 4HXAL 4HZAA 2DIJA 4M5ZH 3TH2T 3W9EA 1MI5B 4P3CL 1JYVA 4F57L 5CEXA 4KVCL 4HBQA 1LDPL 3KWWB 3QUML 3MBXH 3D9AH 5HYJA 5F1SA 1FL5B 3MRDA 4AEHH 3PWJB 4MNHB 4NQXA 1D9KC 4FZ8H 4PRID 2VC2L 4H25A 2P8MA 1HH9A 4OCWL 3TP4A 4CRPA 5E99L 3QZWA 1LP9F 5CJXA 2VR9A 1CZ8H 1NMCB 2H2SD 4K9EH 5MEOA 4MWFB 2CR6A 1F5WA 3LCYA 2LU3A 5HTSA 4YHNB 3DYPA 3W0WE 4QXUH 4IOFD 4QHLA 3VXOA 4XNXL 2ZUWA 4KRPB 1F6LL 2NYYC 4X9FA 4ZXBB 5EC2B 1BLNA 3HCVA 2B0SL 3EYFA 4WI8A 4FS0A 1ZK9A 4EQ3A 4LU5L 1I9IH 1KCVH 3A67H 2B4CH 1G0DA 1UZ8A 1J11A 5D6CA 2HRPH 5CGTA 3QUMA 3FKUS 3WE6A 1OPGL 3O9WA 3DROA 3V5DB 5HVFB 3WFEH 1MELA 2Z8SA 3IKCB 3L7EB 3BKJH 4LSPL 1AGEB 2OSLA 4P9HL 2E5EA 5DK0B 5T3XL 2B5IC 4RWYH 5IMOA 4I4WB 4X6BA 4OTXH 1JL8A 1NGZB 3K7UA 4F7TB 5FA3A 2VLRD 2YMXH 1S78D 3C5ZB 2D9CA 3MRKB 4XGZB 5BRZD 1JF1A 4FTVA 3VWKD 1JPSH 5KOVC 5IB3A 3OHXA 2BX5A 3GSRB 4EI5D 3VXUB 5I1HH 3WHXA 1U58B 1B2WL 3H9YA 5J9PB 1XGUA 4J6RL 1ZLUH 1FORH 3OGCA 5FKAA 2QADB 5I30H 2DL2A 2F5BL 1BD2B 2M8XA 4U7SA 1H3VA 4G6KL 3EGSA 3SDCB 3AU1B 1NCAL 4DZBA 3HKFA 4MQ7B 1AC0A 4PJAA 4ZPTB 4Z0BH 4ENEC 5T33L 5A1AA 2E3VA 1Z2KA 3HFML 3FZUC 4P5MA 3GHBL 4CNIA 1AY1L 2RQ8A 1MLBB 4NN6B 5HYJB 4XAKE 4JGJA 5EO0A 4P59H 4XNYH 1URLA 4H25B 1Z3GL 2P8MB 3DVNA 1UXSB 1IC5L 4N1CA 5D70L 1HH9B 4LOUD 1CXLA 4I3GA 4MJID 3QUZD 3BEWB 4QRPD 1YY9D 5F9OH 4HWBH 5ETUB 5MEOB 3A6BL 2BSSB 2Q87A 1EJOH 5D72H 3SO3B 3VXOB 1M1SA 5L0QC 3ARXA 4G42A 3QEQD 1F4XH 2DD8H 3EYFB 4GG6A 1XMWA 5D96C 5DURB 4JAMA 4OB5L 1UZ8B 5SX4I 4LSSH 5CWSA 1A3LL 3O9WB 3BPOC 3PV7A 3S88H 1O7SA 1YECH 5FGCE 3FN3A 3O4LA 1V7ML 3V52L 5GGVL 2V7HA 2YA2A 1KC5L 4TTDD 5ALCL 4XTRD 2L0DA 2Q8BL 1DQTA 1ODAA 2VXQL 4MXVF 4NCC2 4PJ7A 3PG2A 1IBGL 4OIAA 4YHOL 2X09A 2B20A 5CJ8A 3MXWH 2OJZH 1JF1B 4FTVB 1Z9OA 1Q0YH 4N5ED 5CCKH 1K4CB 2PTTA 3NCCB 2OJEA 2VLME 2Z35B 4OLXL 4XNZC 2CKBL 3VGDA 4XHQA 2LFGA 4WY7H 1OAZH 2V5YA 1HWGB 2P1YA 4I5BA 4LLDA 3N0PB 3RAJL 4RX4D 4Z7UE 4YR6A 1VPOL 4OIIL 4PJAB 3JWOC 2CD0A 4MJ6B 5CUSH 3GRWL 1A6ZA 4EUPA 3SDAD 3WDJA 2EDRA 1BIIA 4Y19E 4GKZA 1FDLH 3O8XB 2A0LD 5KVMC 3WO4B 2KBGA 4QRRD 2EYSA 3MMEA 5D7SH 3DX9B 4L4VA 4KJQC 3HB3D 3Q2CA 1AKJA 3N1MC 3DVNB 2HLFC 5IWLC 1AJ7H 1QNZH 1QSFD 1Q9LB 3QDME 2MQCA 5TE6L 2CKBA 3KPRD 5DGRA 5I2IB 4O4YL 6FABL 4HK0A 3C9NA 4PUBL 4JCMA 1K9TA 2AEIT 1WIUA 2AK4D 4UUJA 5MENA 4ZO7A 3OF6A 5F1IA 3GRWA 3PE9A 1BFVH 4OGAC 4CW1B 4W70A 4NZJA 4N0CC 3UO1H 5E9DA 4RGND 4PJXA 1GZQA 2JE8A 1XGRA 1DBBH 2WBJD 2V7HB 3INUL 4L3AA 1D5ZA 5GIRB 3QXTA 2VDLL 1RJLB 3WNPA 5IT2L 1MHHB 1QLEH 2OR9L 3CK0L 4PJ7B 5D7LD 1SJEA 3MV8A 3CVIH 1YEGH 4GUPA 4IDJL 3V5KB 4GAGH 2BSTA 5FYKU 1NGXA 4AEEA 2PTTB 1U3HD 1NL0H 5F89B 4NRZA 5TDPB 3QO1B 5LAXB 3WDIA 4UQ2B 5AAMA 4EI6B 5C0FA 1PKOA 2XQYG 2HJFA 3IXAA 3BT2H 3PXHA 1YEDA 5K59E 1N0XH 1OB1B 2BOCA 2OLDA 4FQIL 1FN4A 4LLDB 4HD9A 3VFWA 4GW4B 4OZIB 4YR6B 1DDHA 2F53A 2V9RA 1U42A 4MD4A 4OD1L 4XRCB 4M4RA 4EUPB 1DBJH 1YPZA 2Y7QA 1BIIB 3RDTA 3QHTC 1XF5A 1NGPH 4I0PA 4RISH 1MVUA 2G9HA 2HFGL 2EYSB 4UZGA 2MTPA 3ECBA 2FX8L 1CXHA 1OAUL 2FGWL 3CU7A 3QXVA 5FYJL 1JE6A 4HPYH 5BV7L 4YBLC 1BJMA 4TUOA 2B1AL 3SDDD 2A77L 2W1NA 2CKBB 4YPGB 5KS9E 1KN2H 1I8MA 1UH4A 3RNKB 1F58H 2R2CA 3S9DB 5ILTH 1EAJA 1CE1L 4OF5A 1NCNA 2I60H 2PYEA 3QIBD 4QXGL 4U6YA 4UUJB 4MD0B 1H8OA 1BM3L 4UT6L 1VADA 3PWPD 4KRNA 4Y1AB 4ODSL 3S3PA 4HWNA 2Z31A 1SHMA 2IQAA 2AQ2A 5F1IB 4U1SB 1YJDC 2EH7L 4FHBD 2HT3D 3WLBA 1A7PL 2HKHL 1SM3H 2VLKB 4NQEA 3IDJA 4F8QA 5FUZH 5F1NA 2BHUA 4PJXB 2D4DA 3IDGA 4M7JL 1GZQB 4P2QA 4LVOB 3DXAA 3JWDH 4AL8H 4FQ2H 2PXYB 4GBXA 2F15A 1D5ZB 1CVRA 4X6CA 1B4JH 1PKQE 4QKXB 3ARPA 5K9OB 1DSFL 3KJ4B 4PGDA 5CGYD 1WFTA 4C56D 4WHTA 5FUOL 3SDXE 1J10A 4QNPE 1U8MB 1KFAH 1H8NA 1IL1A 3OJDB 1HSBB 5HGDA 4G3YH 1KYOJ 4KI5C 3HI6L 1RUAL 4LCYB 5CSGA 3IRZA 2XQYK 5C0FB 5C0EB 5DUBB 3GO1L 2HJFB 3IXAB 2EDYA 3HE6B 3KPTA 2EDEA 4NBZB 1OSZA 1YEDB 1RIUL 4GRLB 4X6DE 3WNOA 4PP2A 1FN4B 4ETQA 3P0VL 3O3DB 3RHWF 1ZVHA 2F53B 1QA9A 1H5BC 5LGKA 3GMPA 2JIXD 5IROC 5GS0D 4MZ3A 5F7EH 3OTTA 1U8NB 2ED9A 2XT1B 1YPZB 3GHEH 2FH6A 3RVWC 2EXYC 1XF5B 4I0PB 2IG2L 4PJIE 1B6DA 2YRZA 4LNRA 3ECBB 1UZ6F 2WINA 5DEZA 1J8KA 4OZFH 4YNYA 1MAJA 4E42A 5IUSA 3TZVA 2DBLH 2WAHA 1OAKH 4TOYL 4LAQL 4QRUA 1CU4H 2D7MA 5TQ0H 3QWQB 4TUOB 2J8HA 2YKLH 4LQ1A 4MXQC 4QGYA 1UKSA 2OMBA 2ZUYA 4HULB 3GK8L 2CDFB 4J3VA 3WFHB 2V7NA 4JB9L 4PR5B 3TPKA 4R2GB 1GGYA 4PJGE 4CMMB 4GKNB 4U6YB 3MZGB 4C57C 1XIWA 3X11A 4HFWA 2VXTH 1LEIB 1C12A 2XTJE 1MAKA 2NTSP 3BEVA 4LCIH 3ZKMC 1ZSDB 3TCXA 5IHZB 4Y4KA 4X7TB 3WLBB 1J1PH 3WNMA 1IGFH 4NNPL 2EEAA 3TBTA 2EDOA 3IDJB 5JQ6L 4RDQG 5FGBC 3LRGA 1ZLWK 3DXAB 4TQEH 1IGJB 4DQOH 5ADOL 4JQIH 4J23A 5LXGH 3C6LD 5GS3A 5IVNA 1BJ8A 1WEJL 1BBDL 3TH4T 2HJLB 4XX1G 4HKJA 1TJIH 3KR3H 5C08D 2ICWI 2FBJH 4WTWA 5DUPH 2FX9L 3L5HA 3RZCA 4F33A 1MCOL 1XCTB 1GXEA 1IEHA 1E4XI 2EXWC 4UNUA 1DANU 3UCRA 5HGDB 3TM6A 4KK6C 2VISA 4F9PC 4JY4A 3GM8A 4XCFL 5TE4H 1DQDH 2X4UB 2IF7A 5C2BH 1WV7T 1S9VB 2JELL 4YBQC 1OSZB 5IVXA 4PP2B 3FB6A 1IGTA 4ETQB 1YMMA 4K7PH 5JLZA 4M6ML 1YN7A 2F8OA 4POUB 2NZ9C 3GMPB 3ARBB 5HHME 3VWJD 3NIFE 4NUJA 1ZA3A 5GRUL 3TIEB 1BQLL 4O58H 3V95A 5CEZD 4Y2DD 5DSCA 4NUGH 4YHZH 1RY7B 1SVZA 2E6QA 1AD9B 3WEXA 4E42B 1WBXA 1FL3A 2AJYL 3NOIA 5IIEA 3I9GL 1CXIA 4AH2B 1TQCB 4YX2H 4QT5A 1I85C 1J8HD 3V2AR 4HUVB 4AM0B 3CC5A 4M43L 1NANH 1U0QA 2CRZA 2PYFA 3RWEA 1I8LC 3JUYA 4NC2B 1YC8A 3F7QA 3QNXA 3OJMB 4LPWA 3OXRA 1W72A 4TYUA 4J3WA 4X7FC 3BKMH 1XIWB 1YUHB 5IW1A 4UDUB 4XAKD 4HS8H 4KI5E 4HFWB 3KYMA 3L3IA 2XZAH 2NLJB 3R0NA 4JANB 1EO8H 4XBEH 5EN2A 3BEVB 2VRAA 4WWKD 4RZCA 4Y4KB 2E7CA 4DGYH 1P4IL 4NFCA 3D48R 3TBTB 1FZKB 2C1PB 3HNTL 4HX1A 3V0AC 2R69L 2WIIA 2APFA 2N1KA 4MNGA 4D3CL 5LGJA 4NJAH 3CD4A 1IC4H 3NFSL 4LHUG 3TVMA 1EVTC 4EBQH 1JIBA 1N6UA 3NA9L 4KPHH 3SGEI 2CK0H 1GC1H 1MUJB 3O6KH 4HKJB 4NZRH 3H8NA 4GQ9L 3QA3A 4WI7A 4PV8A 5HVHB 5J6GA 1U91A 3MFFB 1T3FA 4BZ2H 1D7FA 3MRMA 5I1JH 3RZCB 4XWOD 5C0NC 7FABL 4R4NC 4WV1C 4FRWA 4PJCA 4ISVB 3WNNA 5LJYH 1AQDA 1KJMA 1G9NL 5T5NF 5GS2D 1C5BH 5C0IA 4UT9L 2BNRD 3L3HA 2YD8A 1J87A 3WN5A 4JN2A 4OCXL 5IVXB 4MA1B 2XFXB 3BO8B 3FB6B 1YMMB 5JLZB 2VLLB 1YN7B 3MLSH 3CDGB 4J4PD 5DJ0B 3VXSA 4TSCH 3ZKNC 3RIFF 1TTGA 1AD0A 3RTQB 4JO4L 5D1QD 3C60C 1QO3B 4JRYE 3VH8A 3IFOA 4OGYL 3SDYL 5E24E 1OGAE 1Q72H 5DD3L 5H37H 1ED3B 1J5OL 4GSDH 3WEXB 1HXMB 8FABA 1WBXB 3HNSH 5IIEB 4JZOA 2WLZA 5DJZA 2CGRL 3CC5B 4R90L 1AGCB 5B4MD 1T1YA 2IAMC 4B0MM 1H0DA 4M6OL 4OLYL 4JFFB 4JG1H 5DWUL 1DN0A 1EEZA 3OXRB 2EDNA 4AIOA 2MNUA 4Y19D 3IU4H 4RAHA 5JUEL 3OAUH 3SY0A 5DT1H 3E6HB 2FJFA 5I1DB 5IW1B 5JIHA 3VDCA 3RWJA 3KYMB 1RU9L 1T83C 2OZ4H 1H3GA 1CFSA 5EN2B 4RZCB 5FYJU 2D3VA 4NGHL 3CSPA 2VITB 4K71C 1PYWB 5EU6B 1IVLA 2VQTA 4TVPH 2WIIB 4HG4K 1RMFH 4M7LH 2FIKB 1L7TL 4MNGB 1JNLH 5LGJB 4D9RE 3WXWL 5EO1B 1J12A 4CVUA 3KPLA 5D8JH 2OX5A 2B2XH 3QXWA 4K8RC 3TVMB 3GBMH 3MRGA 4NFBA 2F19L 4DZ8B 1KPRB 3MV7B 2K7PA 2MQ3A 4AZ8A 1D9KA 5T3ZH 4KTDL 3LRSA 5IW3A 2GSIA 5HHVL 5JXAH 2NY0B 4P4RB 3H0TA 4OLZH 3RUGF 4MA8L 5IFAH 4PJCB 5HHNA 1INEL 1KEMH 2DQIH 1C7TA 4QHUA 5EOCL 1RJZA 2WANA 2YOCA 3MACH 3B3IB 1H3PH 4WW1A 2VKWA 4W68A 3WN5B 1E28B 3OXSB 2M1KA 3EYSH 4RA0C 4PJHA 3UROR 2D7TH 4EDWL 1L6XA 4LARH 5KJRL 1Y0LA 2GFBA 1IC7L 5SWZB 1WCBA 4KK8D 5KVDH 3IFOB 5F7YC 2J6EH 1MCWM 4UI2A 4MXVE 1XF2B 3QHFL 3P4OA 1UYWL 4O00A 1AR1D 4OZIE 1PZUB 2WK2A 3H3PH 8FABB 5HI5C 3QDMA 3DRQB 3KPQA 5KANI 1AQKH 1O7VA 2Y5TB 5IQ9A 2RR3A 4NOFA 5DJZB 3FHQA 2BDNL 1T1YB 4NRYB 3TF7C 1OVZA 4JGMA 3O3BA 5GJTH 1EEZB 1G9MH 5JA9A 2E7MA 1N4XL 1ZT1B 2VKXA 5J7CC 3GNML 2FJFB 2NX5E 5ICXA 4U49A 4ZAKB 1KCRL 1W8NA 5GRWA 5EU7E 3OKKA 3MLUL 1JZ8A 3RWIA 1YNKH 2Y36L 3V4VL 3MLZL 5C2UB 1A7NH 3QNYA 2X44D 1ULVA 1KOAA 4Y1AE 3HRZA 3ULUH 1I9JH 5DQDL 1KIPB 4L8DA 1XF3A 5IVZB 3LH2H 2VLKE 4PLKD 3QXUA 3K80A 4LCWE 1X6NA 4N8CL 3L3DB 2FB4L 3FB5A 4KRMB 5CEZH 3K1KC 3MCKA 1AGBA 4AQOA 4NC0B 5EWIL 5JW4Q 3H0TB 1KN4L 2YPVH 5HHNB 3NTCH 4QHUB 2FX7H 3GSWA 5GGUA 1JK8A 1GPOL 4YO0A 4LRNL 1NH6A 3RWGA 4WW1B 1QEWB 2DQHL 4XPAL 2ARJB 2ADJA 1QKZL 1LWRA 1CTOA 1XCQA 3KPPA 5GISL 1HNFA 2Z93B 4PJHB 1ND0A 4MDIA 4OCMC 3ARED 4QHKI 5IEKB 3FFCE 4POZC 1RV6X 1WCBB 1A7BA 1SBSH 2DM2A 4PJ5A 4LKCA 3ZL4L 3D3VA 1VEOA 1INQB 4HJ0C 3JWOL 4ONHA 5SV4A 1SMAA 1FRGL 5DEGA 1OAYL 3UP1A 4G6ML 3G5ZA 5DQ9B 5IQ9B 3PWUA 4S1DC 3EYQC 3O3BB 5JDSA 5I15L 4B7LA 5J8OA 3WXVH 4PJFF 4UIKH 5IMKA 4X98B 4MAYA 1GZPA 3QQNA 1MI5D 3QCVH 5JORA 4KKAD 1YA5A 3IDMB 1CDUA 3THMH 1FFOA 5GSVA 5F9WB 4X80L 1DFBL 2VZVA 1A7RH 3ZDXF 2Q1EA 2ZCKL 1WZ1H 4NZDA 4XP4H 1KCUL 1I1AB 1XF3B 2QQNH 1K5NB 1HINL 4XB8A 5LCVL 3QO0A 5IKCA 3ULVH 3ZHDA 2XTJD 5SV3A 2XG4A 2IGFH 5LG1A 3PHQB 3MBEC 3QCUL 3TGXA 5CIPH 5J11B 1OSPH 1WFNA 5L88L 2GTWB 4H1LG 5IWLA 1X3DA 3ZLQC 1AGBB 1UM4H 1H3TA 2WWKO 4KRPD 3T8XA 5JZ7D 4ZXBD 2C3HA 3ZHLA 4BK4A 3AVEA 4M93B 3P11L 2R2EA 4YO0B 3L3JA 2HT2C 3D0LB 4M5YH 2ORBL 3RWGB 5JOFA 5KW9H 1LO3L 2YWZA 3NCFB 5FHBL 2BJMH 2DYPB 5F3HB 4HIXH 1XCQB 4M02A 1X7QA 1MCKA 2QLVB 1CLOL 3DETD 4DAGH 4HIEB 3OKEB 1P4LB 1GRWA 3MREB 1HHKA 3B5HA 3D3VB 1OF2A 4XMPH 3ORJA 1IGML 5ENWB 2YD3A 3WO3B 5C7XH 2YN3A 2APXA 3S97C 5J0BA 4KGLA 3C5ZD 3TH3T 5ALBL 3RVUD 2CSPA 1PBYA 3IAGC 4RMRA 5E2UH 3VXUD 4NO5B 3PWLB 1T66D 3NAAH 2A1WL 3SKMA 4DWHA 2AJ3A 5ICYA 5FYKD 4EKXA 2QADD 4LP4A 1BD2D 3PL6C 3G6DH 2ICEA 5IMKB 3C6SA 5GGQL 4MAYB 1A3RL 3SDCD 1FZJA 5DVOA 1GZPB 1EEUA 3RNQA 4JFPB 2AK1L 1N59B 4DEPB 1KB5L 4TSBH 1CDJA 1UM5L 2FJGA 3SOBL 1PSKH 2D31B 1MIEL 1YEIH 2R0ZH 4PJDB 4HH8A 4HLZG 1AI1H 2LTQC 4LHUB 4MLSA 1YJDL 4C55A 4O51A 3REWA 3TV3H 2O93L 3ARRA 1E6OH 4TRPL 3QG6A 3V5HA 4BUHA 5DO2C 2X4QA 3V6OC 1QBLH 4ZUSA 2UY7A 3U2SB 1NMAH 1UADC 2R56H 5L6YH 2KKQA 3T8XB 3OAZK 3VFVA 2GJ6A 2NMSA 3E2HB 3H9HA 1BQHA 3O2DH 1KB5A 2CIIA 1QZ1A 4KK9C 2JJVA 1O5DT 1MFAH 3VU2A 2R2EB 4QHNA 1G6VK 4S0SD 1FVDA 5C0GB 3A6CL 1WBYA 5JOFB 3BD3A 1CFNA 4Z5RA 3O9WD 3BIAX 5BVPH 3TT3L 3WIFA 1ZA6A 2YA1A 3BXNB 2QSTA 4RMSA 1X7QB 1KCSL 3QWRA 4OKVA 2GT9A 25C8L 2PNDA 5HD8D 5C0RL 3TJEL 3GJFH 1FFPB 3VFOA 1HHKB 3T65A 3L5IA 2IADA 4GLRI 1KJ3L 1UEMA 3OZ9L 2AXHA 4FTVD 5AD0B 4ZOEA 1LO5A 5EPMA 4OQ1A 2ZUTA 2VDMH 4DTGH 1IZKA 4ZFFA 3RA7H 2IC2A 5BJTB 5I19H 3SKMB 2X1QA 2AJ3B 4WFEE 2XZCL 3O4OB 4UOW1 1S9KC 4P9MH 4LIQH 2CJUH 2ICEB 3P3YA 5GZOD 4G80A 5IFJA 3BESR 3TFKC 4LASL 4F7EA 5JXEC 3MQIA 1XGQB 1E4KC 1G7QA 1RIVL 3Q5TA 5EU3B 4JFFE 5L2KB 3I50H 2FJGB 3O2WL 2CXGA 3BH8A 3WJLC 4QGTA 1L9MA 1C1EH 3O8XD 5AWNH 1V7NL 2Z8WC 3R8BB 2RFXB 1H5BA 4LSUH 3VXRA 2BVQA 3RWDA 2EIDA 1DQML 3HE7C 4HMEA 5CJOH 5EORH 5IROA 3MLTA 4NQDB 4O51B 4G7VH 2NTFA 1D5IH 1EV2E 5DD1L 3M45A 3SE3C 3QG6B 1LP9A 3S36L 1MH5A 4KJWD 3JXAA 5EU6E 2HWZH 1I3GL 2X4QB 4MX7A 4ZUSB 1MFBL 2H2PC 3FO0H 2LAGB 2ZWLT 3UTSE 1N5YH 2YR3A 3U0PA 4FQJH 4UTAH 3VFVB 1WUNT 2GJ6B 4XNQA 1RQ5A 4D9RD 4CVXA 4GW5A 4XPGL 4OLVL 1V8HA 3MYZA 1FVDB 1UACL 4K94H 3MRFB 1A2YB 3X14B 1MEXL 1RZKL 2HJKA 4Z5RB 3U83A 1BP3B 2FNBA 3VFMB 3PDDA 2ITCA 5I75C 2DBJA 4JM4L 3ZE1F 4OKVB 4YHKH 1T4KB 4NO0B 1P84J 3WD5H 3QPXH 4FQQA 2GT9B 2O26U 3CX5K 5IG7B 5E7FA 5KSUA 5E8NA 3BPCA 2H6PA 1OGAA 1NMBH 4XCYA 1UENA 2IADB 3DTXA 4Z7WF 1HSAA 1Y6MR 2VXVH 1IM3A 4OM0H 1TZGH 2F54B 4J1UA 1VFAB 5BOPA 3IDYB 3B8SA 2MSPA 2PKDA 1RK0B 5B3NA 5EPMB 2GAZA 2JB5L 5SWZE 5CINH 4ZFFB 2J88H 5C9JB 5CJQL 4ODVH 3SJVE 4XC1L 4Y4HB 4HCRL 4JFDE 2J5LC 1OGTA 1JV5B 4RQQB 5FV1L 3ZKXC 4F9PA 5IFJB 4F7EB 1CICD 4G9FA 4TUKH 1QR1A 3NPSB 4PRDA 1U6AL 2AAVA 4KTEL 1NGYA 3BH8B 3BP4B 1UWGL 3E3QE 1I7TA 3G08B 4IIQA 3FMGL 5EB9A 5JNYA 3FCTA 3VXRB 3F5WA 5D1ZC 4B50A 3MLTB 5IOPA 4U1MB 2PO6C 2CKNA 1JRHH 1YQVL 4FFYL 1JWUA 2ADGA 1DLHA 3MLWL 4HCRA 5DJCB 4H1LA 3O6LL 4JFEA 3N06B 4OM1H 1TZIB 4HH9B 1I85A 1E6JL 1DQQA 3IETA 3U0PB 2EE3A 4M1GH 4H88H 4Y1AD 4JVPA 1HHGB 2R2HA 4YAQA 4GRWF 1CT8A 4GW5B 3DMMB 4G8FB 3JV6B 2VXUH 1RZJH 2VLKD 5EZIL 4HF5L 4PGZA 3PQYA 5FYKH 5J4MA 4W6XB 4BQBA 1OARL 4N0YH 4JO2H 1CE6A 1OTTD 1X5AA 1JCKA 4Q7DA 1EEQA 5KVFL 3P4LA 2ITCB 4JHWL 4KMLB 2PXYD 4NJ9L 2C9AA 1T89C 1ZEAH 4FQQB 4IOIA 2Y25A 1F6FB 1MQ8A 43CAB 2XICA 3HI5L 3V0WH 3BPCB 5DVMA 2H6PB 4QYOA 4HKZA 1KEGL 1HSAB 3R06A 1JZ2A 3O11A 1PEZA 2VH5L 3BZEA 4K7PX 3OR6B 2D03L 4Z0XB 3T3ME 4UU9A 3V0VA 3RKDC 2ZP0T 3RUGE 3TA3B 3L1OL 2APWA 1SYSA 5E8PA 4P46C 5LQBH 4WV1A 1ZTXL 1OLLA 3LS4H 5JPMB 2A6JA 3HE6D 2A9ML 3S3JA 2ATKB 2V2XA 4LDOB 4GRLD 1GGCL 1QFHA 1YEKH 3MNVA 4LEXL 3TO4C 5L7XL 3C2AH 2YEZA 3JVGA 4HXAH 4G9FB 2F53D 3WCYA 4P3CH 4JN1L 4PRDB 5D2NC 4AEIL 1BBJB 2R9HD 3IS0X 4F57H 4KVCH 2HTKC 1LDPH 3QUMH 4IIQB 4C59B 4I0PD 3FCTB 3RZWA 1OL0A 4OLWL 5IOPB 3C60A 2VC2H 4JFYA 4OCWH 1KSRA 4JG0L 1JWUB 1YQ2A 4FQXC 4LCWA 5H94B 4OI9A 5E99H 3VRJB 3FT4A 3TYFA 4PBVC 4NN7B 1FGNL 1ZLUK 4H1LB 1CIDA 4NN5B 4JFEB 4CN6A 2VMFA 4XNXH 4JVWA 1TCMA 2GYSA 5DJDB 4K8RL 4HUWA 3SQOL 1CXFA 2VO5A 2IAMA 2B0SH 2NY3B 4LPVA 2R2HB 4U6XA 3OKDA 4YAQB 5JW5A 4LU5H 4Y89A 2CRIA 2XRAL 3M1BA 3GSVA 1OPGH 3PQYB 2I24N 4GOSA 1T83A 4ZPVB 2DLFL 5DUML 2ZUSA 4NNXA 4KHXL 4R8WL 4HIIA 5D1XC 1WCQA 5FYJD 4W6WB 4PJEE 3V7AG 4P9HH 1DVFC 2W0KA 5T3XH 4JDVA 4IOIB 3FRPG 4MVBD 4NPYA 3G9AB 5I18L 3QI9C 3NMEA 3TNNB 5IEHB 4QYOB 4HKZB 1QG3A 4WTXA 1R3KB 1WFOA 2AQ3A 5HJ3A 3R06B 1I75A 3O11B 2CUIA 3BZEB 4D8PA 3FN9A 3G9VA 4UBDD 4UU9B 3U7YL 3DIFA 1SBBA 3LV3A 4KKCC 5JR1H 1B2WH 5E2WL 4UMGA 2EICA 3IGAA 4JKPL 4ZUWB 5H8DA 4J6RH 4Z7NE 4PRHA 3L95B 2F5BH 3HLAA 2XPGA 4L5FL 1IQDA 4G6KH 5I8EA 3OX8A 1LQSR 3MNVB 3SKOA 1NCAH 1JZ6A 1T1ZB 4M5ZL 3LN4B 5DF0A 5T33H 4IRZL 2JCCF 2QHRL 3HFMH 3ARBD 3GHBH 1N7ML 4JQXA 1AY1H 5FA4A 2C5DC 5KOMC 5DHVB 2CLVB 3GSXA 3AUVA 1QQDA 3VE0B 2XACC 1ADQA 4NOBA 3PV6B 1MFDL 1N8ZB 4L9LB 4XVJL 4JFYB 1Z3GH 1IC5H 5D70H 2H41A 1CZ8L 1HYRC 3G5VA 4PJDE 5L9DL 3A6BH 5KAQF 5I71B 4U1JB 2EDFA 3IB4A 3ISWA 1CYGA 1K8IA 4IRJA 4YJZL 3KLHD 2X4SA 2AVGA 1J0YA 1XIWD 4PJFE 4V2CB 4QHKJ 5CBEB 5IJKC 1C5CH 4WUUA 4U6XB 3DPBA 1KCVL 4OFPA 2B4CL 1MHCB 4OB5H 5LVEA 1FYTA 3SE8L 3RRQA 3M1BB 1A3LH 4ZUTA 3OQ3B 3I02B 4NNXB 3V52H 1V7MH 1UB5A 4HIIB 5GGVH 3ZDXE 3HS0B 1KC5H 5DHYA 3KDMA 5DTFB 3CFEA 4RWYL 4Q74A 5ALCH 3WHE0 4PTTA 3QIUB 5CMAB 3IJYA 3ZYZA 1UXWA 2FHBA 1IBGH 4YHOH 1LE5A 3B9KC 3QIWD 2V2TB 3VGAC 4MSWA 4D8PB 1KIQA 5J6HA 3RZCD 5A16A 5IBTL 4DKEL 4FA8A 1T1WA 3V6FA 1FC2D 1G6RB 1U8OA 3DIFB 4M7ZB 4LBEA 1G84A 1R3HA 1TLKA 3DYMA 3L3OA 4OLXH 1J18A 2CKBH 3IGAB 4RBPH 4A2MA 3FB7B 3PGCA 4PRHB 3HLAB 2QSQA 1IQDB 3RAJH 3SKOB 5KSBB 1VPOH 4OIIH 3ROOA 1YMMD 4NQCA 5FYLE 3UTTB 2PCPA 2AP2A 3GRWH 4RA3A 1JMXA 1MFNA 4LVHB 5EUOB 3RTQD 1NDGB 3UJTL 4HWEL 1FO0B 5FA4B 3VRIB 1IFHL 5HYIA 4QOKE 4OCRL 2DQDL 1QQDB 1WAAF 3BI9X 3QUXB 1U95A 4WFED 5D7IA 3IU3A 4APQD 4NIKB 3QFDB 4WI5A 4G6FD 4WW2B 5C0JB 5L2KE 1S7RA 4HKBA 2X4OA 5F9OL 4PG9A 3B43A 3L5JA 5HHOA 6FABH 2BVOB 3RJDA 5DMYA 2J8UB 4PUBH 4JFFD 4JFZL 3MRHA 3VGFA 4IRJB 5GSRA 3O41A 2X4SB 4TUJB 1XEDA 1MCDA 2FR4B 5I9QC 3O0RL 4KXZI 4WUUB 5FM8A 5KZCB 2D0GA 1YY8A 1UWEL 2VR4A 1IJ9A 3DVGA 3KHQA 1FYTB 3BHBA 3ZDYF 5F7HA 5AYUL 1T5WB 1YECL 4ZUTB 4LGRB 5EU6D 4NZUL 5M94B 4LDEB 1YDPB 1J1XL 4ODXA 3INUH 5DHYB 4N9GB 1JFQH 1T6VN 2EE2A 2LV4A 4J3SA 2AKRA 4V1DA 4PTTB 5EG6C 5IT2H 3TJHD 2OR9H 4PPTA 1IGCL 1NUFA 1TFHA 3CK0H 3MV7D 5FK9A 2WWKT 1AGDB 1LE5B 1OD9A 4Q2ZA 3EOAA 4MSWB 4CVWA 4IDJH 1Q0YL 5J6HB 3ZTNL 1WWBX 1G9EA 3MUGB 3MBEA 1U8OB 2NY0D 2Z92B 3UTQB 2YD4A 4ZS6D 3ET9F 1CG9A 3FT2A 2H45A 1T7WA 3L3OB 3MRRA 5FKPA 3TEUA 1A4KA 2R2BA 4WY7L 1CR9L 4JRXB 4HS6A 5SWSA 3OBAA 1Z9MA 4ZS7L 4B5EA 4KZDL 2F54E 4XVUD 1ZWIB 2XYCA 4FQIH 1AO7E 1CF8L 4NQCB 3AM8C 4OD1H 2OL3L 3HNVL 3LS5L 4HKXA 5C07B 1P53A 5EBMB 3MC0A 5TFSL 5SWZD 3TWCL 3LQAC 4AEFA 1SY6L 3MUY1 3MLYL 1NBYB 3IFNL 2HFGH 4O2EA 1PEWA 3MR9A 2FGWH 1OAUH 5INCA 1U95B 5D7IB 4PGJA 5FYJH 4M61A 5EOQL 1PX3A 3QQ3A 1IAIM 3EYOA 5BV7H 3WL9B 4PRAB 4QCIB 2B1AH 3VXNA 4LRIC 5H35A 1BZ7B 2A77H 4HKBB 4PG9B 5HHOB 2HAZA 4F15B 5CBAB 1CE1H 2CO7B 3JTSA 3UTSA 4MNQE 3MRHB 1B6UA 5EZLA 4QXGH 5GSRB 1BVLA 2J2ZA 1BM3H 4QTIL 4UT6H 4ZAKD 3C09B 4Z76A 2OL3A 4YHML 1FNHA 3KNBA 1R5IA 3UBXI 2EH7H 4LK4A 1A7PH 2HKHH 4XPBH 4JREC 1LEGA 4DCQA 4LPCA 3BMWA 3PL6A 3DX7B 3U9PL 1SY6A 4M7JH 3DWTA 5INDB 1ZS8B 4YHIB 5DD6B 1TTFA 2ED7A 3PXJA 2VL4A 4JM2F 4BZYA 2FRGP 5E8EA 4ODXB 2FCBA 5EOCJ 5C8JA 3P77A 1RULL 2AKRB 3HZVA 1QLEL 3GMMA 1DSFH 3LRHA 5IJVA 1IQWL 4P3DA 5FK9B 4Q2ZB 5E6IA 5FUOH 4KVNL 3VI3E 1DLFL 1I1CA 4P2OD 4ZOCA 3STBA 1JGEB 3WFCH 4BFBD 2DI9A 5I76A 2FHCA 4KROC 2VAAA 2ESVA 4O2FB 3V6OA 3HI6H 1RUAH 2BC4A 3FT2B 2AGJL 3MRRB 4JLRA 4JFDA 4OBRA 5FKPB 1A4KB 1I7RA 4PJ8B 3GO1H 3Q6GL 5SWSB 5F96L 4ESKA 3R4DA 2X70A 1RIUH 3G5XA 2JTDA 3PP3H 1CD1B 3P0VH 4HGKC 3MODL 3QUKB 3MV11 3EJYC 4G8GA 5DQJB 2EC9T 1KJVA 2DJ4A 3NCJL 4HKXB 4MJ4A 3TCLA 3IDIB 5DJ2A 5HI3C 3ROLA 3LKQB 4R96B 3PHOA 2IG2H 2WUCL 1VENA 3B6SA 3MR9B 4JKWA 3WS3A 1T04A 3BOVA 3VRLF 3GMNA 4L8BA 5C0CB 3QQ3B 2EYRA 3EYOB 4LAQH 1KG0B 3HUJF 3CMGA 5H35B 4X83A 4S0TD 2ZZUT 5B8CB 3U0TA 2F58L 3GK8H 4UAOC 4XPHL 1FAKT 4JB9H 2OQJA 1I3UA 2QQQA 3S5LG 5HGBB 5JHDE 5F44A 4HMDA 4OJFL 1NFDF 1ZLVH 2HG5B 3I75A 1R5IB 3OJ2C 4IHOA 3VD3A 4NNPH 3G6JA 1NC2D 2DKMA 1CL7L 5JQ6H 4D0BB 1HHJB 3JWDL 15C8L 1U9KA 5CP3A 5JXEA 4YLQT 4NQVA 1S7TA 4L4TB 5E8EB 1S7VB 5ADOH 5MI0C 5C8JB 1A6WL 1KLGA 1I1AD 1WEJH 2IMNA 2R0KL 2MCG1 3HZVB 4WEUD 3WJLA 3GMMB 1JWMA 1BBDH 1X5HA 4W6YB 4G8IA 1ZGLB 2X89A 3BPLB 1QRNB 4IMKC 1A47A 5E6IB 2FX9H 3K74B 3EAKA 4PP1C 3SE3A 1MCOH 4U1HA 2UWEB 5I76B 2VDPL 2DN7A 2VAAB 5HYSA 4ZDHB 1MOEA 4FQLL 3CH1A 4XCFH 1U8HB 4L8SA 3B9DA 3TN0B 3SKNA 3NIGF 1U8IA 2JELH 1UC6A 5F71A 3G5XB 4E41A 1W72H 4Y4FB 3U4AA 3NGBB 4EN3A 4M6MH 2DYPD 2ZJSL 1NCWL 4KMQA 4E9LA 1RAMA 4C4KT 3TCLB 4P4KB 3GHEL 5F88B 1JPFA 4NYLB 5GRUH 3SKJL 3MUHL 1I9EA 5GHWH 2EDJA 3NH7L 3PHOB 1BQLH 3K46A 3RVVD 3KYOA 2X1PA 3B6SB 3QUYC 3WS3B 3PP4L 1T04B 4OUUA 1GH7A 1OAKL 4DN4H 2AJYH 5TQ0L 3I9GH 4PREA 3MOQA 3QRFM 2DIAA 4M43H 3CGTA 1MHPL 3C8HA 3ZSTA 4IJ3C 2OQJB 3ARDC 3PNWA 1TIUA 2WV3A 3FFDA 1FFNA 2VXTL 4XB7A 1DE4A 5J12C 1OY3B 4P5KA 4MAYD 3VA6A 2DQCL 1GGTA 3IT8D 3I75B 3HC0B 3KPSA 3OKOA 2V9QA 1P4IH 4WO4C 3ESVF 3G6JB 1GAFL 3HNTH 4LPUA 1CFVL 2R69H 2W0PA 4NQVB 2NY1B 1S7TB 4D3CH 1EHLL 2G75A 5ISZA 3ZSSA 4LHUD 4RFNC 2VLJA 4R7NA 1PZ5B 4EXKA 2F8XC 3NFSH 2FGZA 5BXFA 3BVNB 3NA9H 2CQVA 1JWMB 2P49B 4FXKA 3STZA 2CK2A 1AE6L 5IMLA 1X4ZA 9CGTA 2QEJA 3FJTA 5D1ZA 1U8JA 2MHAA 4LF3A 4GQ9H 2ADIA 2I07A 3BX7C 4MYWB 2PO6A 4JFXA 3UYRL 5JA8B 1LD9A 3LHPL 4DUVA 3CFIC 3H42L 7FABH 1AP2A 1HI6B 4U1HB 3T04D 2B7DT 4BFGA 2HFEB 4XNMA 1BFSA 3FO2A 1G9NH 1T20B 1JYNA 5TE4L 3CH1B 2O61B 5CZXC 4L8SB 3VG9B 3SGDH 4UT9H 3UZVB 1ETZA 3HZKA 4NBXB 4ELKB 1U8IB 3LY6A 4OCXH 4X5LA 4I2XB 4WTZA 4E41B 4EN3B 5MEPA 5MHSE 1BAFH 3LKSA 1MCBA 4OGAD 4YXHL 5I8CB 4ELME 2B39A 4BUGA 2VYRE 4JO4H 5IESL 3QXAA 2AV7A 1MCRA 1JPFB 3SDYH 3ARYA 4M1CC 1OD7A 5DD3H 3S37L 2BNQE 4JQVA 1T89A 4LVNC 1J5OH 1FZMA 1T22A 4OUUB 3FB8B 3UTTE 4YQXL 4HUXB 5IB5A 4PREB 3AFLA 4X9BA 1OTSD 2CGRH 2ID5A 4R90H 1JVKA 5H2BA 5FYLD 5ANMB 5DYOB 4AYFA 5M7QA 2AJZA 4PY8I 4WU5B 4M6OH 4OLYH 4EDXA 3NFNA 1X5ZA 4CADA 4JO3L 5DWUH 2QV2A 4FZEL 2X2YA 3BKML 5JUEH 4X6EA 3QNZB 2XY2A 1JPTL 1DJSA 1RU9H 2H3NA 4P46A 4P5KB 1YEJL 3KPSB 1JF6A 4NGHH 1KYOK 5C3TA 1MCEA 3ARUA 5L2KD 1EBAA 4U2YA 3L7FB 3LKNA 3TO4A 1U8QA 1QFOA 1WSST 4KQ4L 1L7TH 2EDWA 5D2NA 2E9IA 3WXWH 2VLJB 2OK0L 1JGLL 3DRTB 4NQDD 3GKWL 2AXFB 4GW1A 3U7WL 5JMOC 2FSEA 2F19H 2GK0A 2FO1A 5IBUG 5J56B 5K33A 4FXKB 5C6TL 3STZB 5K9JL 1MWAL 1U8JB 2MHAB 4LF3B 4JHBA 2Q7NA 4YDLB 2I07B 4BZ2L 5T5FL 5I1JL 3KXFA 4JFXB 3O6FA 5LKNA 4FQXA 2P5EA 5HHVH 3PDGA 1WFUA 3QWOA 4M48L 5J13B 4MA8H 1INEH 2GJ6D 4XNMB 5EOCH 1WVZA 4U6VH 4NM4L 2BY3A 1MJ8L 3FQUB 1ETZB 1NGWA 1IILE 5B39A 5DI8A 3LIZL 5GRVK 2JJSC 4TSAL 4BQ8A 3NZHL 4TSCL 3UPCA 3LKSB 3ARVA 4EDWH 5KJRH 2G5BB 2WW8A 4YXKL 1IC7H 4NO0D 3VGHA 4BH8B 3QXAB 2AV7B 4JRXE 1MWAA 4DVBA 1RVFL 2XWTA 1LGVA 5D1XA 3WFZA 3QH3B 1TJGL 4ZOBA 1NEZG 3QHFH 1DVFA 1UYWH 3EFDL 5F7DA 1D5XA 1T22B 2LVCA 1GOFA 3ARFB 2F54D 3D85A 5H2BB 2OBGA 2BDNH 2X9XA 5GPRA 1C16A 4EDXB 3NFNB 1JWSB 4Y4HD 4CADB 1WLHA 5IHLB 5J57B 3F7YB 1KULA 1N4XH 3DSFL 3EZ8A 5C0AA 1VDGA 1KCRH 3T2QA 3P9MA 4NKOB 3KHOA 4JM2C 2H3NB 2NW3A 3T0EB 1R3LA 3MLUH 1ONQA 3RX7A 4D2NA 2Y36H 3V4VH 3KPOB 3MLZH 5E0QA 2NCMA 2XKNA 1Q0XH 1U8QB 3DJ9A 4JHZA 1OTUD 3MV9E 1N6VA 4JO1L 2AJXL 4LSDA 5DQDH 3QFJE 2H9GA 2P45B 1FH5H 1QFWI 5ACZA 4N8CH 2KH2B 2FB4H 4KDTC 3X13A 1GHFL 3KXFB 1L7IL 3CUPB