4PP1C

The crystal structure of der p 1 allergen complexed with fab fragment of mab 5h8
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
210
structure length
210
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDITNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGKTLPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase 1
publication title Structural Analysis of Der p 1-Antibody Complexes and Comparison with Complexes of Proteins or Peptides with Monoclonal Antibodies.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 51
structure length 210
sequence length 210
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pp1C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pp1C01
3TT3L 1YNLH 2OMNA 4HZLB 2IANA 1KELL 4LCUA 4KJQC 4G8IA 3VXUE 2XICA 1SJEA 5A1AA 5EOTB 5KVGL 3MA9L 1T1WB 2LE9A 4LLUA 3T09A 3BRDA 1BGXH 4P9ML 3ZT5A 2DKUA 4HLZH 3VFTB 3AGVA 5BJTA 3TIDA 2HWZH 5ALBL 3HE7A 3QPQD 5KG9B 3FFDB 5I1HL 5CKGA 4W4OA 3REWA 2QR0B 4KJPD 3K0WA 1XR9A 4ISVA 1C1EL 8FABB 3DHMA 5C0AB 4LEXH 1QBML 4ZTPL 1FPTH 5CILL 2LQRA 5D93B 3GO1H 3ILPB 3MC0A 1EBAA 1NCTA 2D0HA 1C5DB 4BFGA 3HPLB 5D1QC 1JTOA 4MXWL 5C9JB 2C3HA 1U3HC 2VXUH 1QFOA 3DI2B 1BFVL 1ZA3B 4WFHE 3U4EA 1ORQB 3VRIA 4DK3A 3WJLA 1R24A 1R3IL 1B4JH 1U36A 4OLWL 1CWVA 2A9ML 3V6BR 3QQ9D 1NGPH 4OFYA 1FE8L 4HS6A 5FF6B 1I8IA 3PP4H 5I1AA 3WNLA 2A1WL 1YY9D 1W0WA 1IT9H 2VXQL 4C56D 2Q7YA 4X99A 3BX7C 5EUOB 1KJ2H 5IESL 3CLFL 5JIHA 4NQXB 4N8CH 3NFPB 3QXDB 1UCTA 1A0QH 3QIWA 3VGGA 4CMHC 5EOCH 1YN7A 2XNAB 3CZFB 5I1EH 4PJBE 1HIMH 4D0DB 2EE9A 3QUMA 3RWGB 4DVBB 2YD8A 1WTLA 1I1FA 3KYMA 4IMLA 3QWQB 1HILB 3GSQA 3RIFK 4J3WA 2AKRA 4O58H 1K8IB 5GGUB 5EO1A 1EEZB 1FFQA 1UM4H 2WUCL 1MCNA 1T0NB 4HWBH 1T0PB 1K4CA 4OLXH 4LVHC 1J1XH 4Y4HA 2OX5A 1LD9B 4E5XB 2PR4L 2RFXA 5HDBE 1UFUA 2HN7B 3GJFA 3IGAA 5FYJU 4HS3A 1HQRA 2IEPA 4UV7L 1J05B 2W60A 4BQ8A 1IGFH 2VAJA 2H9GB 4X6EA 3MUGA 3PWNA 4L3EB 3DVGA 4ZD3H 1NBYA 1N3NB 4H8WH 3EYFB 5GRUH 4KAQH 4MNGE 5SWQA 3D0LB 3TBSB 4N9OB 1G7LA 3OJDA 2YSSA 1RZFH 4ZQKA 5HHME 4PJEF 2XN9B 2DM4A 3FB7A 4KROB 3KPPB 4HG4K 3WFHB 5JHDB 1IGTB 2VL4A 3H8NA 3OR6A 5E4EB 4YDVA 5FYKD 3IJHA 2YD7A 1YNTB 4G42B 5IHUH 4O2CB 5DVMA 4LSQL 3TNMA 1L0YA 2EXWC 2OZ4A 5FYKE 3MLWL 4WW1A 3O9WB 3OKNB 1F4XH 2XWBA 1I3RA 1IMHC 3TH4T 2PTTB 5JUEH 2XRAL 5JOEA 1RZKC 4KJQD 4YC2C 2X44D 4JLRA 3KS0J 1A02N 3HZMB 3PHOB 3CVHL 5EWIL 2HTLC 4QHUB 5L8LB 4F57H 5MERA 1UEMA 3AU1A 1EK3A 4TTDC 2X4SB 4W81A 1KN4H 1UCBL 5EO9A 3RL2A 2HKFH 3B6SB 1KB5A 4NRZA 4WHDA 1NAKH 4P2QA 3B9VA 4XPBL 4PJFA 4C55A 3DJ9A 4E0RA 3WYRA 1L7IH 1HHKA 4ZFFA 2YPVL 2CPCA 3MRLA 4XP1H 4ELMA 2C7UA 3SDYL 1TTGA 3H9ZA 1P7HL 5T1DL 3FAXA 1E4KC 1RHHB 3B8SA 4X4ME 2OSLB 4GUPB 4ZPVB 1QPPA 4OT1L 1U3HD 2B4CH 2VDLL 5GGRA 3G08A 1MIEH 1IZJA 3BD5A 2XZCH 3OF6A 4WFFD 5LQBL 5KBNC 5DJ8B 4JZNB 5HHNB 3C09B 5IHLB 4OIAA 3WFEH 4FQJH 5DURD 1P4IH 2P43B 2GUOB 4PJIA 2ATKA 2ARJA 5H94B 2BDNL 3NIGF 1NFDB 4OCSH 4HWNA 2EIDA 2JIXB 2UV3A 4NM4L 3TJHC 1KPUB 1LMKA 1A7BA 5DC0A 3KPSD 4D3CL 3FRPG 1VA9A 1GRWA 5EUKA 2OL3A 2MPAL 1MY7A 4RX4D 1DBBH 3CFEB 4NNYA 4BUGA 3ARGB 3D48R 1KCVL 4LLYB 1BM3L 3NACL 5E2WH 5GZNC 1FLTX 3L3JA 5KJRL 3FB6B 4K3HA 2QKIA 3PL6B 1A6UH 2I60H 5IB1B 3EO1B 4HUVA 1QYGL 1FVCB 5DUBB 3D18A 1VGEH 2ZUTA 3BUYB 2KH2B 2YA2A 4FQXA 4JO4L 3V4VL 3WS3A 1BD2E 5L0QC 2IANB 1XF5A 4I3SH 4LCUB 3ZKXC 5D7LD 2W0KA 4G8IB 4HFUL 4LSRH 5DMGC 4F7TA 1KIQA 1SJEB 4MXVE 3C2SA 3B8YA 4LLUB 1UB6A 2B2XL 5BJTB 3TIDB 5ABDE 3HE7B 4P46C 1J7VR 5I0ZA 3RIFF 1M7DA 3REWB 1JUFA 2VE6A 5EBGA 3MLRL 1XR9B 4ISVB 3N1FC 1FDLH 2W65A 3T3ME 2Y6SC 4GRWH 4Y4KB 1BJMA 4YEFA 1DVFD 1IGCH 4LASL 1JZ4A 2F53E 1AY1L 5E8PA 3SGEI 1D6VL 4ALAH 5D9SA 3PWPA 4PJ7F 5FYLE 3GDBA 3S36X 5TDPA 1BREA 3CXDL 3G5ZA 4FQIH 1EEUA 2J88H 4Y5XC 3W2DH 3FQXA 1P6FA 3S3SA 4ZUVA 4NN6C 3J7HA 5J57B 5DUPL 3VRIB 1R24B 3I3EA 2J4WL 3QNZA 3QO1A 3LS5H 4M7KL 3VG9B 3BJLA 3HI5H 4YHML 2X89D 1N6UA 4HS6B 5D2LE 3RTQA 3U82B 1I8IB 4WHCA 4TTDD 5I1AB 4BSWA 4G7YH 1A1OA 3OWEA 3B5GA 1W0WB 4GSDH 3KLHC 4K2UL 2Q7YB 4X99B 2H2PC 1DQMH 3TYGH 1A1MA 1CXFA 2DM7A 3L7FA 5CIPA 1BFTA 3QIWB 3WS6A 3VMPA 4TTGA 5CD5C 1QA9A 1YN7B 4JKMA 2YD4A 4LCCA 1DZBA 2VZOA 3DX7A 1G0XA 4HT1H 5ADOL 1MVFA 2NY5C 3QUMB 2JELH 4JVPA 1I1FB 3KYMB 3QCVL 4IMLB 3GSQB 5MEOA 2AKRB 4CBPA 3JBG7 3ZTNH 5EO1B 1Q1JL 3CLEH 1K4CB 4FQCL 4JGUA 4Y4HB 3GSWA 3L6FA 4ODSH 2RFXB 2AI0H 3D1MC 3KYAA 4H1LA 1GL4B 1G9ML 2GHWB 4PGZA 3WN5C 5DO2D 3VFWA 5DI8A 1I9JL 5E08L 4EDWH 3IGAB 4R96A 4HS3B 1HQRB 2CDGA 5I74B 1MAKA 2W60B 3I2CL 2E8YA 4P3CH 4X6EB 3TJHD 3MUGB 4RMTA 5E56A 3GI8H 1OAUH 1OM3L 3R1GH 3RX5A 3DSFL 4X0KA 4X4YA 5HDQH 3PWNB 4Y4FC 3DVGB 1CDUA 2CJUL 1A14L 1NBYB 3GFUA 1FNEA 5SWQB 2Q8BH 1G7LB 3OJDB 2YSSB 1CLOL 4P5TA 4ZQKB 3UTTE 3FB7B 4HCRA 4R6UA 4F9PA 5GZND 4K8RD 1WCBA 4P5MA 1YMMA 3OR6B 4MHHI 3SE8H 4LSTL 4YDVB 3TZVD 3JV6A 3IJHB 2HG5A 2B5IC 5GGVH 1CE6A 1B2WH 4NUJA 3U4BL 3TNMB 3BDBA 5DJCA 2HKHL 2HMIC 4I18C 1CXEA 4M1GH 4WW1B 4NWUH 1MNUH 3MXVH 4PRNA 4OD3L 4BK4A 2NQCA 2XWBB 1I3RB 1ZLVK 1TQBC 4V2BA 4HULB 5ID0A 4XB7A 5HYJE 2LU3A 4JLRB 5DMGD 2ZJSH 2J6EA 1AGCA 2ZCHH 1ES0A 1U9KA 3SJVD 3UMTA 4ONFL 4CU8A 4FFZL 1A6ZA 4RCAA 4X6DE 1OAZL 1ZHBA 2GK0A 4F8TA 3HE6C 4P4KD 4AIOA 4FMKA 5MERB 5D7IE 3AU1B 3C2AH 4JHAL 4XTRC 5KVMC 3IDYB 3SJVE 2COQA 1QSFA 5EO9B 3RL2B 1KB5B 2LU7A 3B2UC 1N59A 4NRZB 1JF6A 3LQAH 4P2QB 4K23H 2BNQD 4KUZL 4PJFB 2HJKA 4E0RB 4HKZA 1A6AB 2CGRL 1HHKB 4ZFFB 1GIGL 1ND0A 3MRLB 2OYPA 1W0VA 2BHYA 1BFSA 2C7UB 2ZUVA 3MRHA 3OAYK 4ELMB 4OD2A 2NY2C 3TVMC 5EUOF 2OK0L 5D7KD 1JGVL 3NCBB 2OCFD 5TGBA 5GGRB 3G08B 3VXMA 4PY8I 1AJ7H 1KN2L 1WWCA 3D85D 4IRJD 4MA8H 4NP4H 1UACH 1N6VA 1HKLH 3ZLQC 1WFNA 2IPUK 1T4KA 3FO0H 4KHXL 3BZDA 4PJIB 2ARJB 3WLBA 1MCJA 3H2WA 4UV4H 5H8DA 2H32H 2R2CA 1Z3GH 4NUGL 4XC3L 3KLHD 2BNRD 2H2PD 1MHHA 4IOFC 3EJZD 3IDGA 1DQLL 2YOCA 5EUKB 4XP5L 2OL3B 2BNRE 5CD5D 4YE4L 4Q58C 4AG4L 3CJJA 5AG8A 4NNYB 2AXHA 3M45A 1CU4H 2Z8SA 3L3JB 5AWNL 2MHAA 2QKIB 2JJWA 3D2UA 1SBBA 2E6PA 1S5IH 2ZUWA 2VR4A 4BZ2H 4NN5C 3VJ6A 5KVDH 3MLVH 2EYRA 2CIKA 3D18B 1XIWD 4FQXB 2VUYA 3WS3B 1FFOA 4KZDH 5KOMC 3BGFC 1XF5B 3JVGA 5F21B 4M1CD 1RJYA 4F7TB 1KIQB 4MJIA 4NJ9L 1J1PL 3IF1A 2VN4A 3I85A 4S11A 4CMMA 4KDTA 3BXNA 1GVIA 1LK3H 4EOWH 1FNHA 1M7DB 4Y4FD 1JUFB 2VE6B 1F00I 1RVFL 3BE1L 4ODVL 1LE9A 3UAJC 1R0AH 1IC4H 3U79A 4QF1A 2W65B 1EVTC 3RP1A 4ESKA 1ZE3C 1YC8A 1NGXA 5A43C 3KR3L 5E8PB 4MNQE 3S8WA 1I85A 2VDNL 1G6VK 5D9SB 2BSTA 3BW9A 3PWPB 4J8RA 4M8QB 1OGAE 1IAOA 3TO4A 3G5VA 2E7LC 2FO4A 3G5ZB 3JUZA 4XZUA 3WFBL 1IGMH 3FT3A 4XWGL 4DWHA 2XV6B 3MUJA 3TPUB 3FQXB 3OKKA 4NGHH 3GJFK 4LQFH 4ZUVB 1JHKH 3EYQC 1MPAH 4GBXA 3QNZB 3QO1B 5F6IB 3JUYA 3RTQB 3CX5J 4XTRD 1FGNH 1A1OB 4OZFH 2RQ8A 3B2UD 1YYLL 1LDSA 1OGTA 1A1MB 4JQIH 1J0KA 3L7FB 5JQHC 5CIPB 5I6XC 3GIZL 1MCKA 2CK2A 4NWTH 3B5HA 5HHOD 1QA9B 1XH3A 4LCCB 5E5RB 2PCPA 3ME0A 2CDEA 2DQJL 3DX7B 4HBCL 4JFZL 3IS1X 2VXSL 4L4TE 5T33L 1NFDF 2NY2D 2NW2A 1T1XA 5MEOB 1OARH 5AYUL 3QI9C 4K94L 1U6AH 4X7TA 2PNDA 2W9EL 3BGMB 4XCNA 5GS1A 2IC2A 1OW0C 4XAWH 1CYGA 5MENA 3GSWB 3L6FB 4Y88A 1UWGH 4H1LB 4Y1AD 3VGFA 3K4AA 4JR9H 4U2YA 4JM4L 3VFWB 1FC2D 1UZ8A 4Y2DA 1OAYL 4R96B 2CDGB 3UTPE 4YAQA 1A9BA 2DLTA 3ISWA 2H8PA 2D7QA 4IOFD 1CGWA 4JO2L 4JRYD 4X4YB 3GM0A 4H20H 4P2OC 3SE4C 2AJYL 1F97A 1FNEB 4XMKL 1HCFX 4LCWA 4G9FA 3DARA 1Z9LA 4P5TB 2HTKC 2ITCA 1IQWH 5CZXD 3LPWA 4K3EL 1L6XA 1T66D 1WCBB 4P5MB 1YMMB 1AC6A 1BHGA 2XXCB 3WFDL 4F8QA 1JI2A 1RZ8A 3JV6B 2HG5B 3HNSL 1CE6B 1JPTL 3QHFL 3GHBL 4NUJB 4NOBA 4ZAKA 3A0OA 4MDIA 1RZ7H 2X1XR 1JFQH 5DJCB 3IS0X 4DAGH 2YD5A 1BIHA 1GOFA 4PRNB 4GRMA 4QLRA 3GI9L 4NBXB 4MLIA 5ID0B 1F6FB 5C2UB 4GMTH 1H3VA 1NDGA 5FDYA 1AGCB 4F3FA 4KMTL 4ZYKA 1ES0B 4G6JL 4HJGA 1A6ZB 1ZHBB 2GK0B 4HPOL 5CSGA 4PJXA 4NQDD 1CTNA 3S88H 5FHBH 5H37G 1REIA 1FFPA 1QSFB 2I07A 3BYYA 4KVCH 1D9KC 1MAMH 2Q8AH 1N59B 4JDVA 5C3LD 3IJYA 1GAFH 3LY6A 1DUYA 4UQ3A 4AYFA 5JPNA 4M1DH 4OLUH 4DGIH 2HJKB 3E6HB 4HKZB 4Y16C 4OGXH 3U30B 5DFWH 1G7QA 1ND0B 2P1YA 3DLQR 3GMQA 1W0VB 4Y8AA 4PS4H 3MRHB 4FS0A 4OD2B 1IKFL 1M6OA 2EEBA 2YBRA 3WKNA 2EH7H 1F11A 4HPYH 4EN3A 5E8OA 3VXMB 1JYNA 1JPST 3EYQD 2OL3L 1S7VA 2A6JA 3L7EA 2D0FA 2Z8RA 1W72L 3D3VD 5MP6H 1WT5A 1N4XL 4M62H 4XNQA 3WLBB 5K33A 5KVGH 4GXUM 4P9MH 4U6YA 1GHFH 1X44A 1MHHB 1EUUA 3JTTB 1FNSH 4G7VH 3H9SA 3KPRD 1AO7A 3RVXC 3IDGB 4HW6A 4ZSOA 2D4FA 1IARB 5D7JC 2KDGA 2EH8L 2WAHA 1VFBA 3DO3A 2Z35A 5JA8B 1M05A 1M1SA 3BDXA 1S9WA 5EU3A 4MVBC 2GJZA 4H8WC 4ZTPH 3ZHKA 1MFDL 2QSCL 2MHAB 3MUY1 2NCMA 2Y07H 3D2UB 3QI9D 3MACH 5GGSY 4WW2A 5HVHB 5CILH 1YN6A 3ZE0E 3DVFA 4YHKL 4EJ1C 3QCTL 3VJ6B 8CGTA 3OKYA 2EYRB 2CIKB 3BAEL 3ZE1F 5C09D 4XC1L 3P73A 1IKNC 2G5BA 5ECJE 3T0ED 1FFOB 4X5WA 2Z31A 1BFVH 1F3JA 1SJVA 3LDBB 4DGYL 1RJYB 3Q0HA 1HHGA 4OLWH 4MJIB 2A9MH 1CD0A 1PSKL 3IF1B 4M3JA 4CMMB 4YHPA 2WLYA 1V7NL 3OKDA 1MJJA 2VLJD 5DDHA 5JW5A 4PRPD 4FN0A 4ZPTB 2A1WH 5EBMA 5IB4A 1JMZA 4CDHA 1J8HD 2BERA 2EYTA 1LE9B 2EDWA 2NY0B 5IESH 3CLFH 2HTKD 4QF1B 4KTEL 2JJSC 5F9WC 1QO3A 4M48L 1LE5A 1NGXB 1J8HE 4XXCC 3C9NA 5AAMA 5JQ6H 4LKXA 3ARSA 3VA6A 3RX7A 1C5CH 2BSTB 3BW9B 4J8RB 5E2TL 1M7XA 3VFOA 3MLPA 5IGXL 3TO4B 3G5VB 3ZKNC 2FO4B 5CBAB 4J12A 4XZUB 1UG9A 4LSPH 3FT3B 4PJFF 5IFJA 1VCAA 3GKWL 2WUCH 3OKKB 4KKCC 4M6OL 5GJTL 3PQYD 4NHCH 4TNWK 2PR4H 2X4RB 3EYUL 4GBXB 4Q0XH 3FOMA 2B4CC 1VFAA 5GISL 1JPFA 4XNXH 2DQHL 2R23A 1F4YL 1QLEL 4U1SA 4UV7H 4MA7L 4JFPA 2OI9B 3Q1SL 4UT7L 2F54A 5CGYC 1H3TA 2A0LC 1IL1A 1OGTB 4I9WD 4BK5A 2P42B 4JZJA 4Q9BA 3QFDA 1XEDA 5F1NA 4Y16D 5CLTA 4EQ2A 1XH3B 2PCPB 1Z9SA 2CDEB 4YZFE 3K1DA 4MB4A 4PJIF 1MFBL 1JI1A 1GH7A 1Y18A 2NW2B 1T1XB 1BMGA 5I1JL 2MMXA 1IC5H 1NCDL 4X7TB 4M03A 4LSQH 3VD3A 4XCNB 5GS1B 4OFKA 2ZG3A 3G9VA 3HRZA 3ZE2E 2J5LC 2NY3C 5MENB 2MQCA 1HNFA 4OGAC 1KF9B 4WEBL 3RJDA 1UJTA 1RIUL 2XRAH 2GFBA 3M8OL 4HCRL 1UZ8B 4Y2DB 2CMRH 4HHAA 1D7FA 5SWZD 4QHKI 4YAQB 1A9BB 1ZVSA 2WV3A 3BZ4A 5FKPA 5EWIH 3D9AL 1AH1A 1XGTA 4PG2C 2H8PB 4TVPH 4J1UB 3NPSC 5SWZE 1MCFA 2R15A 3GMRA 4HC1H 5KSBF 4LCWB 1T03L 4G9FB 4UINH 2ITCB 2F74A 4ZO6A 3LAFA 4XPBH 4Q6IA 3LOWA 3RVTC 5AG9A 3LQMA 4PJ8C 1A6VL 1H15A 1HSBA 1SJXA 2BVQA 1VEPA 4YHLL 5C92A 2E27L 4WWID 3PWJA 1H5BA 1RZ8B 1P9MC 4HJ0D 2PO6C 4Y5YC 3SDYH 5T1DH 1DBAL 1D5XA 1OAKL 3LVEA 4ZAKB 1BJ1H 4MDIB 3ZKMC 3WO3B 1S7TA 2FB4L 4DFIA 1CGXA 4GRMB 3U2SA 1AHWC 4G9DA 2VDLH 1WUNT 3UZQA 5EU5A 5LQBH 3MLSL 1NDGB 4GRLC 4ZYKB 2XQBH 1XMWA 4HJGB 3FJTA 1ERNA 5E6IA 4PJXB 1MCBA 4RFNB 4QOKD 5DC9B 4XWOC 3NGBB 1PBYA 2BDNH 1FFPB 2I07B 25C8H 4HWEH 4XPGL 1MI5A 1JGDA 2R0ZL 3FB5A 4JDVB 1HSAA 4NM8H 1I3GL 4DKAA 3IJYB 5C0IA 5JPNB 1DUYB 1PKQE 1P53A 4L8BA 4OZGE 3IAQA 4LLVA 4UTAL 4O02H 3VGDA 1G7QB 4DN4L 4YXLL 3GMQB 2CLZA 4MD0A 3NACH 4YQXL 5IQ9B 3L3DA 5KJRH 3RPKA 2AQ1A 1M6OB 3A67L 4QTIL 2YBRB 3ZKND 4L29A 1BVZA 2QEJA 3O6FA 5IJKA 3SDCC 1F11B 4ZXBA 1IEBA 3QXUA 4EN3B 3TV3H 5E8OB 1N0LA 1KACB 4UNTA 1S7VB 2A6JB 3L7EB 2AEIT 1IBGH 3FO2A 4GKZA 3E3QC 1KB9J 4HFUH 1WSST 4GQ9H 3IETA 4XNQB 4WJ5A 5GS2D 2CK0L 4U6YB 2CLVA 2B2XH 4CRPA 2NY6C 2A0LD 5I1CH 3MNWA 1C16A 3GHEL 5C0BA 1WICA 3H9SB 3MRBA 1AO7B 2Y1VA 4ZSOB 4Z7VE 5IB2A 1HQ4A 4J4PA 1VFBB 2Z35B 2DQTH 1M05B 1S9WB 5EU3B 1A4KA 4TNWF 5FM4A 2EDDA 2DRUA 1BECA 2GJZB 5C70A 4LASH 2QSQA 2PN5A 1AY1H 2P8PA 3TA3C 1SY6A 1FO0A 1D6VH 1YN6B 5E5MA 3SGEH 4U1GB 1EO8L 4FFVD 2HJLA 1I3VA 1A7NL 2YK1L 2NY3D 5EZIH 3P73B 2G5BB 4OGAD 3T1FA 4J7RA 5E95B 5CEXA 1FHGA 3R0MA 4X5WB 2Z31B 1F3JB 3I9GL 1ZLSL 5BVJA 2OTUB 2FIRT 2PXYC 5DUPH 1HHGB 5D7SL 1LEIA 5HPMA 5ICXA 2DQEL 4OLEA 3GSVA 4YHPB 4YHMH 4Y4KD 3OKDB 1MJJB 1EMTL 5DDHB 5JW5B 3HAEG 3MBED 5EBMB 4NZTH 5IB4B 4WI8A 2EEDA 2VSCA 1BP3B 4RMQA 2GQHA 3DGCR 1EFXA 2Z91A 4UNUA 4KJWD 1F8TL 1NCNA 4R90L 5A3IC 3RVTD 3TN0A 4PJ8D 1QO3B 3NA4A 3BKCH 4L8DA 1LE5B 1IEHA 2CXKA 2AABL 3TCLA 2NY4C 3C9NB 3LEXA 1F3DH 1J1OH 4LKXB 2PO6D 3HRPA 1ZVYA 3P4MA 1YQVH 3QCVH 4JZOB 3VFOB 3ZKMD 4RZCA 1QG3A 4GRWE 3AXLA 5IFJB 1Q1JH 2WMPA 4N90E 1INDL 1NGQH 3P30L 4HK0A 3DX9A 4R8WL 5IQ7L 1DBJL 5L6YL 2IPTL 3SGJC 3OZ9L 1G9MH 3FOMB 3NIFF 1VFAB 3L5JA 1JPFB 1I9JH 5E08H 3TFKC 2R23B 1LO4L 4MXQD 2AK4D 4XWOD 4U1SB 1X4XA 4MB5A 1CT8A 4JFPB 2VDML 3S5LG 5LVEA 2F54B 3KYOA 1C8PA 1IL1B 3CXHJ 3DSFH 5C0RL 4JZJB 4GOSA 3QIBC 4PBWD 3QFDB 1CLCA 3MLYH 4AH2A 5F1NB 1LHZA 4CADA 3E2HB 4OD1L 2VLKE 1CLOH 5IMMA 3S98A 4CKVX 1HEZA 4S1RL 4X6CE 1Y18B 1M4KA 3CGTA 3PJSB 3K8KA 4LSTH 3PWVA 3SDCD 2XYCA 5JR1L 3U4BH 3BVNA 2ZSWA 4JFXA 5AZ2L 3HRZB 2MCPH 4WU7B 1VFUA 3IKKA 3FO1A 4HAGA 4OD3H 4YH6A 4ZS6C 3WEXA 1G6RA 4I0CC 1G9NL 2GFBB 1EZVX 1YUHA 1E4XL 3I50L 4HHAB 1TZHA 3QPXH 3WJJA 4R7DA 3P9WB 4ONFH 1ZVSB 3BZ4B 4FFZH 5MHSE 3MBXL 5FKPB 1XGTB 3C6SA 1GC1H 2YZ1A 1UB5A 1YNKH 4JHAH 2WNGA 3QUYA 1OB1A 2QADB 3P40A 4Y19A 2AEQL 3GMRB 4LPYA 1TVBA 4OTXL 4AQ1B 2F74B 3NVQA 4KUZH 4P2RE 4Q6IB 4R97B 5JXAL 2EDLA 2WK2A 1H15B 1HSBB 2VKXA 4GMSL 2CGRH 1EHNA 2BVQB 1IVLA 3MV7D 3FONA 3TA3D 3PWJB 1H5BB 4XBEL 1NCUA 2LTQC 1D5XB 4OM0H 1FIEA 3CDFA 4G6AC 3IDUA 2K3TA 4GXUN 4S1SL 2OK0H 2XT1B 1JGVH 1S7TB 5GRWA 4DN3L 5KS9A 2YD1A 4Y89A 5CWSA 3U2SB 5CEZD 3QUXC 4G9DB 5HVGB 5EU5B 5CJXA 1KN2H 2PXYD 4KRMB 4XAKE 3SDDC 1GXEA 4DKEL 1MQKL 4NQTA 5CEZE 5E6IB 1FZKA 3C08L 3DWTA 3MOAL 3PHQA 2HFGL 2E8ZA 3UYOD 2DS4A 3GEWB 4KPHL 4NUGH 4XC3H 4ZFGL 4J3TA 1MI5B 5GGQL 3OAYH 1JGDB 3FB5B 4Z7NF 1HSAB 5C0IB 4XBPA 2EO9A 1DQLH 4FZ8H 3FFCE 4L8BB 5J11C 4XP5H 3EDDA 4LLVB 1GSMA 4JG1H 5DF0A 4PJAE 3MOBL 1OSZA 1Q0YH 2CLZB 3AREC 2ZPKL 4MD0B 1PVHA 4EIZC 3FRPA 3L3DB 1HOCA 3ETBF 5IMLA 5JDJA 3JWDC 1BQUA 2BY2A 4J3SA 4L29B 1A7OL 4HWZA 3O6FB 3DI3B 5F8QC 1P7QA 4XCCH 5D1XA 4ZXBB 5SWSA 2OJEA 4MA1B 1IEBB 1MCPL 3QEHA 2DLGA 3O3BA 4KTYA 3MGOA 4PB0L 3LKOA 3JWOH 5DMYA 3FO2B 3HMWL 2Y06L 2EO1A 4FZEL 4GKZB 3INUH 5BS0A 3TFKD 5DD5L 1OCWL 3LEVL 3IETB 1G7JA 4XNUL 2W91A 1BZ7A 1J1PH 4ZUWA 4WJ5B 3I6LE 4UAOB 5FUZL 2CLVB 1UQSB 3HHRB 3QG7L 3MNWB 1C16B 1ORSA 3DPBA 1RZJL 5C0BB 3MRBB 3SY0A 2ARWA 3HFMH 1S7UA 2V5RA 1UJ3C 3BPLB 5IB2B 1HQ4B 1VERA 2AJ3A 5EIVA 2O5XL 5D2NA 2ZOKA 5I2IA 1A4KB 2LU4A 3SEPA 4WUUD 3K4ZA 3KR3H 1JVKA 5JLZA 2P8PB 1MFEL 3IFNL 4D2NA 5I75C 1TZIA 2R29H 1FO0B 2EE3A 5FXCH 4XHQA 5I18L 2VDNH 5E5MB 4XVUC 2VZVA 2C3XA 4WUUE 4JPVL 2HJLB 1FFRA 1BBDL 3BFOA 4O9HH 3WFBH 2P5WD 3T1FB 1AXTH 1YDPA 4XWGH 4NDMA 4ZS6D 5CEXB 1GCFA 1T5XA 1QEWA 4OZIE 5BVJB 1Z0MA 3VXPA 1PD6A 3SN6N 1LEIB 5HPMB 2ENYA 5ICXB 3UJJH 1FVDB 3GSVB 3QUMH 5ANMA 3SE9H 5C6TL 5ITBH 1B0GA 5KANI 4XCFL 2FATL 4BQBA 4TVSa 1EFXB 1UADC 4P59L 2Z91B 1CICA 4UIKH 2F58L 1CGTA 1DQTA 5INCA 3TN0B 4L8DB 3V6OC 1A3LL 3BQUB 3TCLB 4PBXA 4PJXF 3RAJL 5I30L 3LEXB 2DQJH 4HBCH 4JFZH 5JIPA 2VZ3A 4OCYL 5T5NF 3IYLW 3GJFH 2VXSH 3P4MB 2P8MA 2JJUA 4G6AD 2DTML 5JNYA 1W8NA 4RZCB 4YHIA 5AYUH 4K94H 3IDXL 3K81A 5CBEA 4WWKA 4M8VA 3AXLB 4QHLA 4FG6D 3OAUL 3QUXD 4EI6A 5E1AA 5M95B 5HGGS 3BIAX 1I1AA 4HK0B 5I1IL 3V4UL 3DX9B 5IBUG 1AFVL 1MJUL 3SDDD 2M1KA 5EG6C 1B4RA 2EDFA 3N1QC 3HLAA 4O51A 2BOCA 1A22B 2A38A 1DANT 1CT8B 5IVXA 5I0DA 1VSCA 3KYOB 1F02I 2HP4A 4NPYA 2OZ4H 4XPHL 1SMOA 3D39E 4AH2B 2AJYH 3QWRA 4CADB 5DQ9A 3IJSA 4PJDA 4HEPG 4EI5A 5IMMB 4WEUD 3OPZL 3ARED 5FA4A 5L88L 3O4LA 1HEZB 1ZT4A 4IRSA 3KXFD 4LMQE 2CRIA 4EBQL 5GGSA 3QFJD 3WO4C 3MJ9L 3T65A 3TCXA 4K71B 3PWVB 3QHFH 3GHBH 2NYYC 4HXBH 5D96C 4L9LC 3BVNB 3QFJE 5DJ6A 2ZSWB 4JFXB 2APWA 2OTWA 3WXVH 1KB5H 5DK2A 3FO1B 1DLHA 1E0OB 2CKBA 4U7KA 3GI9H 3WEXB 1G6RB 2ATPA 4KH2A 4XMPH 4XCYA 5B39G 1LO2L 1ZLWK 3MJGX 3SDAA 3QXTA 1YUHB 2NLJA 3IRZA 5I8OL 4WW2F 1TZHB 3D5OF 4KMTH 3JTSA 4G6JH 2DOCA 4R7DB 5FO8A 4BELD 3TYFA 3C6SB 3L3HA 3BD3A 1UB5B 4M5YL 3QUYB 1NANI 4UT6L 1HZHL 1OB1B 2UVEA 2Z92A 4U4BA 2X4UA 4Y19B 3VU2A 1TVBB 2NX5D 4UOW1 5DR5L 4U3CA 3S97C 3CSYA 4G6ML 4RMWA 3FONB 1GGIL 2X41A 1KCKA 4XVUD 4YK4B 1J10A 5CKAA 3V5KA 3VA2C 4PGJA 4JM2D 5J3HC 5KS9B 5CWSB 1FZOA 1LP9F 3DVNA 4PRHB 5BV7B 1FSKC 5T5FL 4YGAB 2OL3H 1C7TA 4XVTL 2BRQA 3IKCA 3BI9X 4PJGF 4OGZA 4XBGA 1OAQL 1FZKB 2NXYC 3KJ4B 4R4NC 2DQGL 1N4XH 5GHWH 3NABH 3MRIA 1A7RH 4NQSA 3PHQB 3ZTJH 4N68A 3MODL 4S0TD 3UJTL 4J3VA 3VXQA 4JRXD 3UO1L 2VZ1A 4KTDL 2KQNA 2R69L 1CFVL 4HWUA 2M8XA 2XTJC 2BVTA 1OWRM 3TH2T 1OTTD 3CUPA 2VH5L 1OSZB 4YDIH 4AENA 2QQNH 1MH5A 4F7EA 1MFDH 1HOCB 1T2QH 5IMLB 5F7MC 1MLBA 4HWZB 3FN0L 2X4TA 4M61A 1P7QB 4S0SD 4YHKH 1CBVL 5D1XB 3CMOH 5SWSB 2OJEB 2PYEE 3ESUF 3QEHB 5IMKA 1K2DA 3O3BB 1YA5A 3MGOB 4XC1H 4YDLB 3RZCB 3LKOB 2A6DA 4CVUA 5ISZD 4DGYH 5BS0B 1MJ8L 3MGAA 4J3XA 5ITFA 1G7JB 1EHXA 2VLME 1PSKH 1BZ7B 1GOGA 4ZUWB 1RUQL 4FP8L 3ULVF 1TNMA 1ORSB 4S10A 3SCMD 3F6IA 2D4DA 2QJDA 3SY0B 5C08E 2Z4QA 1DN0A 4Z5RA 4MCZA 2AJ3B 5D2NB 4KTEH 2ZOKB 4M93B 4IBLT 5JXEC 4M48H 3WNOA 3GK8H 2XWTA 1RJCA 1KC5L 2WIMA 4QNPF 2UY7A 4AMKL 1TZIB 5KSAC 1NC2D 1YPZA 2NYYD 3CSBA 4D9QE 3F7YA 5DEFA 4PLKC 3G6DL 4NQED 3SGDI 5IGXH 3DRTA 5GS0H 4C56A 5I71B 4V1DE 2ERJB 2K7QA 4PJBA 1TPXB 2CKNA 1YDPB 5L9DL 4NDMB 5DVNA 1NBVH 2VLRB 3NH7L 4NQEE 3UDWA 1X5JA 1T5XB 1QEWB 5CIPH 4L5FH 2EDQA 3QEUA 2Q86B 5JW4Q 3X3FL 3N85L 4R4FL 4EXPX 3L3OA 5GISH 5ANMB 4YHYC 1F4YH 2FJHB 1YC7A 4IIQA 1B0GB 4DZBA 2VRAA 4MA7H 1RD6A 3I84A 3M07A 3RY4A 1CICB 2FBOJ 2XFXB 5INCB 4JEGB 5FKAA 5JMOC 4X9BA 3O6ML 2B1HH 4H1LH 3QULA 5SV4A 1NSNH 1F42A 5FYJL 3ARWA 3GM8A 1MWAL 3BMWA 5TF1L 2P8MB 1N0XL 3QIUD 5JNYB 2FX7H 3NIGE 4YHIB 3CPLA 1D5IL 5B4MD 2GSIA 4MNGA 1CG9A 4TUKH 5CBEB 4WWKB 4QHLB 4EI6B 5E1AB 4DKDC 4NFDA 1I1AB 4A6YL 3VD4A 4LCYA 3EJYD 1MCHA 2KKQA 5F1IA 3VW3H 4QT5A 3P0GB 1PFCA 1RIUH 4TQEL 3M8OH 4HCRH 2NXYD 4R4ND 3U6RA 3HLAB 4O51B 4G6KL 3DBXA 4NKOA 1ZHNA 2D7OA 4I8DA 1LILA 2X70A 4FOMA 4GG8A 3WSQL 2KZ1B 5IVXB 4OUUA 2YMXL 3S4SG 2BSSA 4NPYB 4YHZL 1Q9KA 4WI7A 5DQ9B 4EI5B 4OKDA 5D93C 5FA4B 1G6RL 1A6VH 1ZT4B 1F4AA 4IRSB 5GGSB 2XTJE 2I5YL 2J6EH 4JFFE 2E27H 3T65B 4MSWB 3QDMB 4EVNA 3KJ6L 4QWWD 1SEQL 4H0GA 5B3JF 1IC7L 4DZ8A 4BZ1L 5DJ6B 1XFPA 3UJIL 2OTWB 3RFZC 1EJOH 4LBEA 2DLFL 5DK2B 3RGHA 1DLHB 3CCHA 2ATPB 4XCYB 3SDAB 1AI1L 5L2KE 2NLJB 4X4MA 1I9RH 4QRPD 3JTSB 5FO8B 3QDGD 5T3ZD 3TYFB 4K9EH 4R9HA 1KYOJ 3L3HB 4MMZC 3MREA 3STBA 1B9ZA 4PJ7E 5TDOA 1Z2KA 3TC9A 4X9FA 2YRPA 2Z92B 4WCYL 2X4UB 1U3HA 4LSVL 4XPGH 5LGJA 4I4WA 2R0ZH 35C8L 3X13A 3DOSA 1KCSL 4PJCB 1CQYA 5KSUA 5JXED 2GJJA 4KGLA 2RIKA 4M7JL 4OI7A 2GJ6D 3CSYB 3AB0C 5MEPA 5KSAD 4TVPE 4NO0D 4OZHA 1Q38A 1Z0NA 3K8MA 2JCCA 3V5KB 1TLKA 3BYTA 3ZYIA 4ONGH 5EO0A 4ENED 3KPSA 1O0VA 3DVNB 4WTZG 1Q9LA 2UYLA 4YDKL 5DQDL 1I8LC 2FD6H 4RX4A 5HGAA 1GJIA 2W0FA 3IKCB 3KG5A 1GGCL 4XBGB 1HHIA 5EU6D 5FGBC 2B7DT 3MRIB 5GRJH 2CK0H 1G9MC 1RIVL 2J8UA 1I7TA 4L3CA 5GZOD 4P9HC 3VXQB 5EU6E 3GHEH 5JZ7C 4XNZC 3OG4B 1N5AA 3PGCA 5T1MA 1FH5L 3MNVA 3K2UH 2IH1A 4MYWB 2I25N 1UWXK 4RMVA 3CUPB 5FB8A 1S3KL 4LPWA 4AENB 2YHGA 5D7LA 1I7RA 1MH5B 3PGFL 5IOPA 4F7EB 4OF3A 2DMKA 3NZHH 1CF8L 3S36L 1MLBB 1X5YA 2X4TB 4M61B 3VXRE 4NCC2 5ILTL 1KULA 1OP3K 5EC2A 1BJ8A 4NKMA 1A7NH 2XXMB 4HQQL 5IMKB 1K2DB 4NOFA 4I0PC 2YXFA 2F5BL 1MHCA 3Q3GA 2A6DB 2B39A 5TFSH 5T3XD 1DVFA 1HN1A 1ZLSH 3T0XA 4GW5A 4BFIA 3J8F7 5E9DD 1MRCH 1RURH 5ITFB 4CN1A 3CMGA 3BJ91 1YNLL 1T22A 2H26A 3D6GA 4N8PA 1V3JA 1EMTH 2YUWA 3BPOB 1QRND 2JB6A 3B2VH 2R39A 5IVOA 2XA3A 1TZGH 2Z4QB 3RUGE 3TBVA 1DN0B 4Z5RB 2ZG1A 1BGXL 4MCZB 2A74A 2RAMA 4R90H 4ZO9A 3QA3A 4MQXC 5D2LA 2XWTB 2AABH 1NUFA 4FRWA 3LPGA 3AS2A 1YEGL 2FSEA 2DLIA 2X89A 3EOTH 1YPZB 1WLHA 3F7YB 4LLQA 5DEFB 3BP6A 2QQLL 1MOEA 1CDBA 1Y6KR 1F6AA 3C09C 3DRTB 4K7PX 3DO7A 4NKIL 4C56B 4HGKC 5SX5K 1FPTL 5TPWH 4PJBB 1ZLUK 1INDH 1CFTA 3P30H 4GAJL 4R8WH 4WI5A 5IQ7H 3ARFC 3QEUB 3PABB 5L6YH 5FCSH 3OZ9H 1U95A 3OG6B 4PGEA 2VXUL 4UUJA 3L3OB 2FCBA 5ESVA 2VERN 5HI4C 1E4KA 4GS7B 1LO4H 4IIQB 5KS9F 4DZBB 4M4PA 1T1YA 5EUOE 2VDMH 1B4JL 4OBSA 3KWWA 4Q74A 4U33A 3C5JA 1R5IA 3A6BH 3BISA 1NGPL 2YD3A 5C0RH 4PJ5A 4L8CA 5FKAB 1CLZH 4OD1H 1E6JL 3STZA 1K3ZA 5CLWA 3QULB 1KJ2L 2P49B 2ZCLH 4P3DA 1TCMA 4S1RH 2VXTH 4XP9H 2R0KH 1A0QL 3LHPL 1I9IL 3LS4L 3IDIA 4UOW0 4LDOB 3CPLB 4P0DA 5I1EL 2GSIB 4MNGB 1HIML 1DL7L 1CG9B 2XQYG 5JR1H 5CJOH 5HHMB 2PW1A 2APBA 1TTUA 4LCYB 4CJ1A 3E8UL 5F1IB 5HHPA 4QT5B 1U3JA 2APXA 1L4IA 1XT5A 1G9NH 4MAUH 3U6RB 1E4XH 2VDOH 3OR7A 3DBXB 1J1XL 3I50H 4DVRH 4NKOB 2UWEA 1ZHNB 3TZVA 2X70B 3UBXG 4GG8B 1TQCB 4L3EE 3EYOA 3WV0A 4OUUB 1ACYH 4OLYH 4OLVL 1S8DA 5F7HA 1Q9KB 4OTXH 1SEBA 3QNYA 4PR5A 2H1PH 3P4NA 3F7VA 5JHDE 2CKBL 2EDTA 4FXGA 4YBLC 5JXAH 3FMGH 5D5MA 4GMSH 4ZD3L 1JHTA 1R3LA 1LGVA 4EVNB 3NAAH 1YEIL 4XBEH 4P4KA 1Y6MR 4TSAH 4DZ8B 1RFDH 5E2JA 4S1SH 4JHZA 2YZ8A 1X5FA 4M3KB 4LBEB 4I0PD 2HT4C 3VG9C 2BNQA 2EDNA 3WNKA 3CCHB 2WANA 4GKSA 5EU7C 2RHEA 5I1DA 5HYSG 1OTUD 1NL0H 3GSXA 1KIRA 1H3XA 5BZWA 3C08H 3MOAH 3MREB 1CIUA 5TDOB 3EDJA 2VQ1A 3GSNA 2HFGH 4KPHH 1U3HB 5LGJB 4Y5XA 2VSDA 5GGQH 3C5SA 4I4WB 4C57C 5ESQA 2FJGA 4AEIL 4JFHD 3C8HA 3X13B 4F57L 5IFAH 4K3DH 3D85A 4LRIC 4MQXD 5J06A 4IRJA 5KSUB 5CMAA 1SBSH 1KN4L 4PRID 2EDXA 2FHCA 5MEPB 2HKFL 3MOBH 4RIRA 5F7NC 5DURB 4OZHB 5BRZD 1V3LA 2ZNXA 3MZTA 3MRNA 2Q3ZA 4PRIE 2JCCB 4QYOA 1EDQA 1L7IL 1PY9A 5M94B 2ZKHL 5DXWA 2BNRA 5EO0B 1NCCH 3KPSB 4NO3A 4TN9A 1EPFA 3V7AE 1Q9LB 2UYLB 2JJTC 4RMRA 4CMHB 4YDJA 1HNGA 3ARFD 4Z18A 4K94C 5HGAB 2DQIL 1MHPH 4KRLB 2W0FB 2XY1A 5IT2L 4FZEH 5CSBA 5HI4D 1R3JA 5DD5H 1S9XA 1NFDE 3EZJB 4PIRF 2LAAA 4WHYH 4LFHD 4XNUH 3VFGL 4TULH 4ODTH 5ESAA 1CDIA 2J8UB 1I7TB 3TH3T 4L3CB 1WWAX 3QG7H 5HGDA 4FQJL 1N64H 1N5AB 1UKQA 3PGCB 4LVHB 5T1MB 3MNVB 1XIWA 5A2KH 2IH1B 1U8JA 1JNJA 1T7XA 5FB8B 5LGKA 3WN5A 4L9DA 4O5LL 5D7LB 4PLOB 1I7RB 4ODXA 5IOPB 2FH6A 5FM5O 5IVXF 4ZUTA 5T1KD 3IFNH 1QFPA 4E41D 2RJMA 5JHLH 3WBDA 3DTXA 4N0UA 1CD9B 4Y4FA 4JPVH 1F3RB 1PEWA 1DR9A 1IGYA 4HS8L 4NKMB 4U31A 5EC2B 3HG1D 5JW3L 1CGSL 3GIVA 3NA9H 2QSVA 4PJDF 5DTFA 4W6XB 2HRPL 4LIQH 1A6UL 2IANE 2YWZA 2I60L 3Q3GB 1MHCB 2D7TL 1TJIL 1DVFB 4GW5B 4BFIB 1I8MA 4QHNA 5J0BA 2J7LA 4Q9CA 2DWDA 1T22B 4WV1C 2H26B 2ED7A 4L8SC 2O5ZH 5C6TH 2JB6B 4LSRL 4I18A 1U8IA 3TBVB 4X9HA 4XCFH 2HLFD 3LEYH 2FATH 1FL5A 3ZT6A 1KPRA 2A74B 2HVKA 5K9KA 5A2LH 5C0ND 2GTZA 1T3FA 1WTGT 3QA3B 5D2LB 4YC2B 2JJVA 3W0WD 1N2RA 3HAEA 1A3LH 2FEDC 4HH9A 5I30H 2YC1A 4NIKB 2FSEB 1TTFA 3MV9D 1RPQA 3MCKA 4OCYH 2EEAA 4LLQB 1IGCL 2DTMH 3BP6B 3ZYOA 4U6VL 4AIZA 1F6AB 3PE9A 3DO7B 3IDXH 4G8EA 3E1F1 5CZKA 3OAUH 2XG5A 4ALAL 4JHWH 2WQ8A 2MSPA 1CFTB 4N5ED 5I1IH 1X3DA 4YHOH 3V4UH 1FAKT 5HHOA 1JGLL 5BOZG 1MJUH 2GY7B 1U95B 4PGEB 1CIDA 1FQ9C 2J88L 4UUJB 4BQCA 5EU7E 2JK5A 4R0LC 5EBLA 4IRZH 5ESVB 4NCDA 2V2WA 1T1YB 1OAXL 2XG4A 1DEEB 1ZEAL 3KWWB 1FYTD 1R5IB 2DIAA 1BOGA 3O81A 5KW9H 4JFYA 3CFJA 1DBKL 3UYRL 1PDKA 3ULVH 1XGPA 4L8CB 2W0LA 4G7YL 3S5LA 4Y1AA 3I02A 3STZB 4GSDL 2NZIA 1DQML 3OPZH 3TYGL 3CK0H 4P3DB 4X7CC 4EBQH 5HI3D 5FGRA 5E6YA 5I19H 4FQXC 3OKLA 4YIQA 3IDIB 1T7VA 1EUTA 1RSFA 4OIIH 4HT1L 2ILLA 4JRYA 4BH7A 2NY1C 5BXFA 1A64A 1CD8A 1QHOA 5HHPB 2EDEA 1IZKA 3ZDXF 3MXWH 1JNLL 1LO2H 4NC1C 3OR7B 5I8OH 4WI6A 1B90A 3BH8A 2UWEB 3TZVB 3SKUD 1XGUA 1QUNA 3BEVA 3K3QA 4ZODA 3A6OA 1XF1A 4X5LA 3S9DB 3EYOB 1AGFA 2Y5TA 4HG4J 4EDWL 2X10A 4M5YH 4K7PY 1S8DB 1HZHH 4UB0H 1NANH 1RUAH 3CDYA 3ZE1E 2CRMA 4NCC1 1SEBB 4PR5B 4X6DB 4P3CL 1MCIA 5DR5H 3P4NB 3F7VB 5L0QB 1NMBH 4TNVK 1HK6A 3GI8L 1OAUL 1PX4A 4FXGB 3R1GL 5HDQL 5D5MB 1JHTB 1R3LB 3K46A 3SJVB 5C0JA 1NLDL 2Q8BL 4BZYA 2O93L 4P4KB 4NQDA 4BSVB 32C2A 4DW2L 4QRSA 1QP1A 3E6FA 5EB9A 1FL3A 3PIQA 2BNQB 2VUOA 4NO5A 3OJMB 5I1DB 5A16A 4M1GL 5KZCD 4XVTH 1HINL 1MNUL 1JPSH 1YPZF 1SYVA 3GSXB 4D9RD 1KIRB 4M43L 1NGWA 1OAQH 5BZWB 2DQGH 5CHNA 2X4OA 2VQ1B 3GSNB 1QBAA 3VI3F 4U1NA 2ZCHL 3MODH 4OV5A 3UJTH 5LWYH 4Y5XB 4FNLL 4PJFE 3C5SB 3ZO0A 4KTDH 5ESQB 2FJGB 2ED8A 2R69H 2VYRE 1ZGLM 4NN6B 3O41A 3V7MA 3D85B 4IRJB 3UCRA 5CMAB 4ZOBA 3D3VA 2VH5H 4RIRB 1EAPA 1OQOA 3LQAL 1MUJA 4K23L 1GYAA 4RDQG 3B4NA 3MRNB 4QYOB 3SKOA 1UZ6F 2BNRB 3FN0H 3RWFA 2CSPA 4NO3B 3KPRA 3OGOE 4B50A 1ZGLP 1T6VN 2VKWA 4YDJB 3BO8A 4IHOA 2LABA 5DFTA 4PRDA 2A77L 5ERWA 4PJIE 4LAQL 1MJ8H 1TJHL 1S9XB 1OF2A 4NP4L 3QI9A 1Q94A 1WF5A 3OKMA 1SY6H 1FO0H 3MRFA 5ESAB 5GPRA 4UIMA 3VXSD 1RUQH 5HGDB 1E4WL 3BP5A 2L7UA 4KUCD 4F9PC 3FO0L 4L4VD 1XIWB 4LARL 3QWOA 2FHBA 3DROA 5C09A 1U8JB 1Z3GL 3T0EA 4A2MA 3WN5B 3KPNA 2ADJA 5DK3A 4ODXB 1EHLH 1L6ZA 3SKMA 4ZUTB 2VISA 4AMKH 1IC1A 2BSED 3JV0A 1DQQA 3EKCA 3DTXB 4N0UB 2VLJA 4EKXA 5L8JB 3G6DH 2NY1D 4PRPA 4Y4FB 2ORBH 1IGYB 1HYSC 3SE4A 3GIVB 1J8HA 2HYMA 4M7ZB 5DTFB 3RQ3A 2VJXA 5KSBE 1S5IL 5L9DH 3NH7H 1J88A 2JKXA 3UC0H 3C87A 1ADQA 1S7WA 3MLVL 3HPLA 7FABL 1I8MB 1NFIA 4QHNB 4B0MM 4BKLA 1H3GA 3X3FH 3O2VL 2B5IB 4YHNA 2DWDB 4KRNA 3MLZH 1ZA3A 3AM8C 2WWKT 1XGQB 2XKSA 4I18B 1U8IB 3UEZA 3QQ4A 3QDJD 4JVWA 1A6WL 3HB3C 1FL5B 1KPRB 2HVKB 3BT2H 5K9KB 2X1PA 3RL1A 2GTZB 1LK3L 1T3FB 1VDGA 3EZ8A 3PQYA 5DRWA 1S5HA 4EOWL 1N2RB 5JW4N 3HAEB 2CUHA 3QDJE 1H3WM 2CR6A 4HH9B 2YC1B 3PWPE 4OF5A 5FYJH 1IC4L 1NFKA 3EOAA 5TF1H 5IV2A 1KXTB 1N0XH 3RJQB 4PTTA 1MCWM 4AIZB 1WBYA 1D5IH 2R9HC 5I66A 4G8EB 1NCWL 4ZFOA 3QHTC 3G6JA 3RWDB 5DFVD 4ODUA 5HHOB 1RZGA 2XA8L 4OZHF 1ZXQA 3S6CA 1IGML 1MIMH 5DHXB 4TQEH 2P8LA 2JCCF 4NGHL 2JK5B 4U05A 4LQFL 4LNRB 2NY2B 2HRLA 4G6KH 3TBWA 2V2WB 4WY7H 1T5WA 1MPAL 3H7LA 5EIQA 2KL6A 3WSQH 1EEYA 5CCKH 2YMXH 2RR3A 1BOGB 4JFYB 3CFJB 5HYQA 1ZA6A 1XGPB 1FGNL 1DN2A 4JQVC 4HEME 1BLNA 5HVHC 3S5LB 3TBYB 4Y1AB 3I02B 2KQMA 2QTEA 1SJHA 2IBZY 1G6RH 4Q6YA 4K8RL 5SWZA 2J8UF 3OKLB 4YIQB 1LDPH 2JTDA 3PF2A 4NWTL 1SEQH 4YXHH 4UMGA 3JVGC 3VDCA 4JRYB 4BH7B 4JFED 3HR5A 3NN8A 4OF8A 5BXFB 4QRUA 3UJIH 4NQCD 1OARL 2DLFH 2N56A 1OT1A 5HDOA 4BYHA 1FBIH 4R4BB 2HA1A 5IROC 1CL7I 4Q9RL 1AI1H 1CL7L 4MHHG 4KQ3L 3H0TA 1FAIH 4XAWL 2R0WL 3BH8B 5J6HA 1XGUB 1UWGL 3BEVB 3DV4A 2ESVD 1KCUH 5EOQL 3MV8D 1AGFB 2Y5TB 1H0DA 5B39A 1MHEA 3WMSA 4PP1C 3CVIH 4XB8A 4NNXA 5JIKA 5DHVA 4KI5D 4QHUA 1I85C 35C8H 3IFLH 5BV7H 3BGFB 1YEHL 3EW3B 5HHVL 5GRYA 3VWJC 3UPAA 4H20L 4CVZA 3TO4C 2UY6A 4NC0B 5C0JB 2JLLA 4L4JA 4HXAH 5IHBA 2C4XA 4NQDB 4LF3A 1T04A 4QOKA 1KJVA 2XTLA 32C2B 3H3KA 4PY7A 4NN7B 3GSNL 3H9HA 4QRSB 3SGKA 4GBXC 1S7RA 2EC9U 4XI5C 2B8OT 3E6FB 1FL3B 3PIQB 3DURA 2DBLL 5TF0A 1J0JA 5A2FA 4FQ2L 2B0SH 4NO5B 3PWUA 5DQDH 4GXVL 1RZ7L 3EJJX 5L2JA 1BEYL 4P23C 3UTQB 5A16B 1A6PA 4UILL 3KGRA 1SYVB 3QHZH 3GJEA 1NGWB 2XWJA 4O4YH 1GGCH 2HLAA 3REVA 1QSFE 4ZMAT 3U7YL 1N26A 5TDNA 3EYSH 2X4OB 4GMTL 1DLFH 4KKNA 1TJGL 4U1NB 3MYJA 2O61A 4OV5B 1RHFA 1B3JA 4JPWL 2P45B 3S88L 5FHBL 4LFHG 3O41B 1WQVT 1FH5H 2WSKA 1RUMH 1FIGL 5DJYA 3Q5YA 3HKFA 4LVNB 3VGBA 1AD9A 4KVCL 1KPUA 3D3VB 2Q8AL 5CJQL 5A40E 3NIFE 5GS1C 1MUJB 1GAFL 3ARZA 1NEZA 4M1DL 1QRKA 3QNXA 1CF8H 1GGUA 4OFDA 3SKOB 4MX7B 1SMAA 3RWFB 1F90L 4PS4L 1AQKL 4ETYA 4Y2DC 5ILTH 2FO1A 3KPRB 2D0GA 5EZOL 4Q2ZA 3X14A 5I6XB 1L7TL 3BO8B 3H42L 4IHOB 4MJ4A 3V95A 5IUSA 3GNML 4OSUH 1PG7H 5F7WC 5IB1A 4PRDB 3ZSSA 4C4KT 5E24E 4HPYL 5ERWB 1RMFH 3TBTA 4ZTOL 4HIXL 4EZMA 3RU8H 1OF2B 1PX3A 3VXUD 4DFHA 1P4LA 5FUOL 3BWUC 3QI9B 1Q94B 3OKMB 3U7WH 3RA7H 5T1LD 1UWXH 3MRFB 4UIMB 4POZC 3BPNC 1UGNA 3BP5B 4IDJL 2VDQH 4JPKH 4M62L 5MP6L 2C3GA 2VIRA 2VDKL 3QWOB 5C0GA 3DROB 5C09B 4JCLA 3T0EB 4AEEA 4XMLH 1GHFL 1KIPA 3CIQA 3U4AA 4F7MA 3VGAC 1FNSL 4ZAKC 3KPNB 2OQJA 1E6OL 2ADJB 4G7VL 4V2CB 2UWEF 1OP3H 4DOHE 4Z76A 1X5HA 2LV4A 3F8UB 3SKJL 2DD8L 3SKMB 1JCKA 2VISB 2K7PA 4KQ4L 1YEGH 1DQQB 4PG2A 4Y4KA 2VLJB 4QXUL 2V17H 3ARYA 4PRPB 3MBEA 2QQLH 1N7MH 4NKIH 1J8HB 4PJ9D 3DIFA 2Y07L 3MACL 4KXZH 2MQ3A 4RFNC 1SM3H 5D5MF 3O45A 5FAAA 1OLLA 1A7PL 4PJ8A 1S7WB 4GAJH 4MJIE 4WFHD 2X42A 1NFIB 1HHHA 4BKLB 4WGVB 1P9MA 4WRLA 2PO6A 4Y5YA 4YHNB 1YEKH 4FQPA 1HDMA 2AJZA 3ULUL 4LSSL 5JOPD 3CSGA 3GRWA 4PP1D 1VACB 3QQ4B 3BP7A 4K07A 5F3BA 3RL1B 3HZYA 2ED9A 5IW3A 5BVPH 5JOPE 2DF3A 3PQYB 5DRWB 3VWJD 1S5HB 3CFCL 3WIFA 1E6JH 5ALCL 3VRJA 5SX5H 4Z77A 2IAMD 1ZLUH 1V3MA 1QLRA 3OJ2C 3EOAB 5L7XL 2DKSA 2AK4A 5IV2B 4PTTB 3LHPH 1I9IH 4AEHL 3LS4H 2DTSA 3T77A 1WBYB 2CRZA 4XI5D 1QBLH 5I66B 2CD0A 1DL7H 5JQ6L 1BFOA 2AXJA 3C6LC 3CH1A 1C5CL 1JV5A 2J3SA 4ZFOB 4Z7NE 1WT5C 2G60L 1KV3A 3G6JB 3X17A 4L1HA 1ROWA 3BESR 4ODUB 4Y16B 3W9EA 4P23D 1RZGB 5HJ3A 3E8UH 1WWBX 4LSPL 1KXVC 4UT9L 3GSOB 2P8LB 2VZTA 4CGTA 1CXIA 3HMXA 3LV3A 4NHCL 3TBWB 3KHQA 2WBJD 1T5WB 5IBUB 4GFTB 1QFHA 4Q0XL 5MI0B 1EEYB 3SDCA 2D03H 3NTCH 4MA3A 4KKLC 4XNXL 4W4NA 4OLVH 5HYQB 1ZA6B 1BLNB 4WW2C 2CKBH 1SJHB 1RZJC 5HHMD 3S4SA 4O2EA 2MJWA 2AGJL 2X1QA 5SWZB 4PLJD 5IHZA 1CE1L 1YEIH 1LEGA 3TNNA 1YQ2A 4OIBA 3TT1H 1YEJL 5KVFL 3HR5B 1DQDL 3NN8B 4OM1L 2C5DC 4QRUB 5TJWK 3EAKA 2Q87A 4NNPH 4ODHH 2FIKA 2NXZC 1IC5L 1I4FA 4U7SA 1J11A 1KUMA 3PXJA 5DGQA 4M6ML 3QUZC 3VFSA 2Y7QA 3MV7A 3TA3A 3H0TB 2WBWB 5J6HB 4GT7A 1J9CT 2VR5A 5DD6A 3DV4B 1JZ5A 1H0DB 3LD8C 5B39B 2CMRL 1MHEB 1V3KA 4LCWE 2XIDA 4G9FE 4HIHA 4NNXB 1KSRA 4LGPB 5DHVB 4AEIH 4RAVA 2F19H 1CXHA 4TVPL 4WEMB 2PXYA 4CVZB 1KCLA 1QD0A 4HC1L 3EO0A 2O26U 3DSNA 4UINL 4OAWA 4LF3B 1T04B 4QOKB 3UX9B 5J1SC 1KJVB 4PY7B 1HH6A 1A6AA 3KLAA 3H9HB 2QV2A 2ZKHH 4MS8C 1WAAA 1S7RB 4PJAA 3FB8A 3AROA 3DURB 2ZUSA 4MCYA 5F9WB 3PWUB 4XRCA 4OCLC 4OQTA 5D1QD 5L2JB 1T83C 3UXFA 2DQIH 3ZHLA 1FL6A 5IT2H 3ULUF 3GJEB 2XWJB 4WTZA 2HLAB 2N7AA 2E3VA 3AS3A 2D2OA 3FL7A 3REVB 1RAMA 2DJSA 5TDNB 3VFGH 4G8FA 1FRGH 5F1OB 3KPTA 2XQBL 3MYJB 5DT1L 2O61B 3N1GC 4XCEA 2UUDH 2XKUA 5J1AA 1QSVA 4RMUA 5DMJB 5F96H 1EV2E 5DJYB 5DRXA 3WUZA 4QRRD 1U2CA 1AD9B 4X7DC 25C8L 4HWEL 2CR3A 3FKUS 4O5LH 3ARUA 4NM8L 1NEZB 5I8KH 3TJEL 4QRRE 3QNXB 4XP4L 4O02L 5H35A 4GH7B 1A3RL 3C6LD 3HZKA 2AJVL 1NLBL 5E7BA 4HS8H 4Q2ZB 3X14B 4ZNEA 5JW3H 1CGSH 1X9QA 2HRPH 5F9DC 5DD0L 1IE5A 1ZT7B 2D7TH 1TJIH 4TSBH 4X9IA 1KEML 3LN4A 1BD2D 1QVOA 2DDQL 2YKLH 3TBTB 4WUUA 3TV3L 1J0IA 1XCTA 1P4LB 3FQUA 1IM9D 1HI6A 2R2EA 2V2TB 3G9AB 1IBGL 4JN1H 4Q6IC 1AO7E 4R97C 4KKLD 4ZSOE 5FGSA 4MQ7A 4GQ9L 4NRXA 2J5LB 2NY3B 4Y8DC 1EGJA 4XH2A 4CVXB 2VIRB 5C0GB 4PBVC 2P5WA 3TPKA 1UH4A 5IK3A 1KIPB 4F7MB 5I1CL 2OQJB 1ADQL 3TM6A 4Z76B 1Q8MA 1KGCE 1NAMA 1VADA 5BZDA 1QNZH 3ARQA 2WIIA 2F53D 2EYSA 3F12A 2DQTL 1J0ZA 4AT6A 4OQ1A 5FYLD 3MBEB 4U6VH 3RVWC 1MCDA 3DIFB 2NXZD 1CFNA 5F6HJ 3AC0A 3MRCA 4R7NA 3O45B 2NR6C 4M8QA 4PJ8B 3NCFB 2J8OA 3QUZD 2EXWD 1JGLH 1G9EA 1HHHB 4JY4A 4AY0A 3HNTH 4OCRH 5EZIL 5IWLA 2PO6B 4Y5YB 3GMPA 3TPUA 2G9HA 4CDGC 1HDMB 2AJZB 3RKPA 1PG7X 1OAXH 2YN5A 4N9GA 1MREL 1ZEAH 3DECA 1HWHB 3BP7B 1DFBL 1WZMA 2HTLD 1LP9E 3QUXA 5F3BB 4ZFOL 3HZYB 1DBKH 3UYRH 4XX1G 1BOYA 1KT2A 5GGTA 3VFMA 4NZTL 4LVOC 3SDDA 3WIFB 4APQC 5C3TA 3VRJB 5IJKC 4Z77B 4JDZA 5E8DH 4PJGE 1QLRB 1OP5K 4LL9A 1X5KA 2AK4B 2FBJH 2ZUYA 3BKCL 5FYKH 2C1OA 1X5GA 1RV6X 3T77B 4MS8D 3PG2A 2GITA 1J1OL 1BFOB 3S7GA 3CH1B 1JV5B 4N0FA 1TXKA 3TF7C 1YQVL 1U8NA 3HC4H 3W9EB 3QAZB 5HJ3B 3AREA 1FLRH 2BC4A 3OB8A 3BGMA 3MX0A 1JNLH 3KXFA 1NGQL 4IOSD 2BVPA 3WD5L 3FQTA 3LV3B 3V0AC 3A6CL 4J4PC 4QHKJ 4LLMA 3SDCB 5C0EA 2J2ZA 4MQSB 5FGCE 1P69B 3QZWG 1QFUL 2AS5M 3ILQC 3T04D 4MA3B 1KFAL 3L1OH 4U1LA 3FRUB 2FHFA 3UBXA 1YJDL 3C60C 3EFFA 3U46A 3UTTD 3S4SB 4O2EB 2F5AH 4J3UA 5HGBA 3MLYL 5IHZB 2QHRH 1NLDH 2AK1L 4KC3B 1LEGB 3TNNB 3O2WH 3ULVE 3IDMA 2AQ3A 1T2JA 4DW2H 3IXTA 4FXKA 1QSED 2VL5A 5TQ2L 1UJ3A 4MD5A 3VRLF 2NX5A 2FIKB 4NBYB 2YD9A 5CSZA 1MSPA 4LAJH 1BQLL 1I4FB 1A7QL 4XHJC 2ZUUA 1QSEE 2ZOLA 5H37H 3VFSB 2Y7QB 4Z6AT 5HYJD 3MV7B 1IAKA 3EO9L 1U8KA 2MCPL 3TA3B 2Z9TA 3Q48A 4QNPE 1HINH 4TPRL 1I3UA 2JF1A 5DD6B 4M43H 1WBXA 4X5XA 2EIEA 4YPJA 3TN0C 4YR6A 4JM2A 3VI4F 3PP3K 5HYSA 3QPXL 5CINH 3KPLA 4HIHB 4FNLH 1GC1L 4RAVB 4P46D 5JOFA 3VXTA 1ZMYA 1YNKL 2VB5A 2PXYB 4POUB 2GK2A 3OB0H 4ZOCA 1PGRB 3EO0B 4OKVA 2Y6SD 4OAWB 2X4PA 3DUHA 1ZOXA 1NCBH 1HH6B 3E6HA 1ZTXL 3KLAB 3MFGB 3RVWD 1U8QA 1T80A 4PJAB 4JRXA 3RZWA 3FB8B 1FNLA 4X6BA 3GSRA 4MCYB 2NR6D 4OM0L 1L0QA 2AQ2A 4XRCB 5SX4H 3V6OA 1VENA 1BBJA 3I6GA 1BPVA 3X12A 1FL6B 2A77H 4LSUL 4LAQH 1TJHH 3K4DA 4Z7OE 4U1HA 4G8FB 3SO3C 3V9FA 5C07D 4XCEB 5DS8B 2Q1EA 3G6JF 5J1AB 1E4WH 4JKWA 4DKFH 2FZ3A 4TUOA 1J12A 2DIJA 3CFBA 3G5XA 4LARH 3S35H 3V52L 5DRXB 3LB6C 5C07E 5K59F 4APQD 4JRWA 5ISZA 1Q0XH 3JTTA 1I9EA 3MOQA 4FZ8L 1KTDA 4IEFB 4JG1L 2O5YH 1G0YR 5H35B 2HAZA 4N0YH 4KY1H 3HZKB 1Q0YL 4KRPC 4K7FA 4GQPH 3U0TA 3SCMA 4DUWA 3QIBB 3WJJC 4YFDB 4Z78A 3I3BA 3UTOA 4RGNC 4XCCL 3LN4B 1QVOB 3QUYC 1ZT1A 4WUUB 5DA4A 7FABH 4YFLF 1B0WA 1XCTB 3FQUB 1RJZA 3O2VH 1NC2A 1HI6B 2R2EB 2CUMA 5C0BE 3JWOL 4LP5A 5GQBA 5JTWA 3INUL 4NQEA 5B3JE 3F5WA 2IG2L 4MQ7B 3VFRA 4NRXB 4XH2B 5B38G 1A6WH 3P2TA 2P5WB 1NMAH 4RRPG 5IK3B 3C60D 4ZPTA 1NAMB 1VADB 3HFML 5BZDB 4F80A 2IBGA 4X4XA 2WIIB 1UM6L 2EYSB 3N1MC 4MNQD 3V8OA 1GPOH 3F12B 3L3IA 5CJXC 4AT6B 1OGAD 1FJ1A 4W6YB 4Z7QF 4KGJA 2VDRH 5L8KB 2IQAA 4NYLA 5ICYA 2HFFA 2R29L 1CFNB 4AM0A 1NCWH 3MRCB 4R7NB 3MA7A 4XHJD 4Z7UA 1S9VA 2HMID 2P5ED 3F58L 2OTPA 2XA8H 5CBAA 1UA6L 4JY4B 4O9HL 5LCVH 3B9KC 3DHJA 1AXTL 3GMPB 4FQ1H 2LTQB 2R8SL 2G9HB 3QIUA 2P5EE 3BGAA 1JYVA 5GGRY 2X4RA 4HD9A 5JDSA 4LOUC 4N9GB 1CLYH 3UJJL 1BZQK 3PV6A 3TWCL 3HE6D 3QUXB 1OT2A 3QUML 3NIDF 1T1ZA 3SE9L 4XPAL 5ITBL 2PUQT 1KT2B 1MRFH 1MRDH 3VFMB 3SDDB 5K93A 5LAXA 1AP2A 2ZSVA 5D1XC 4JDZB 4UIKL 1M7IA 3MRQA 5I73B 4K8RH 1HHJA 3BIBX 4GJTB 4L4TD 3HPJA 5F8RC 1U93B 2C1OB 5EBWB 4KKAC 2PW2A 2GITB 2BXYA 4DJMA 4HUNB 1UH2A 3RDTC 4N0FB 1ZS8A 1U8NB 2E9IA 3TVMD 2HVJA 5FYJE 2R56L 2YUXA 1ZAGA 3AREB 4EEEA 2BC4B 3KXFB 4Q9RH 1DANU 1WJ3A 2BVPB 1CL7H 3QFJB 3FQTB 4KQ3H 1JIBA 2R0WH 3QDAA 4E42A 43CAA 3UTPD 5D2NC 4LLMB 2V5MA 2MCG1 5C0EB 1RIHL 3PUCA 4NC2B 5EOQH 4TSCL 1K8DA 4U1LB 3PWLA 3UBXB 3V5HA 4HLJA 3L5XL 1BQHG 5FYKU 2IADA 2W1NA 1YEHH 3EFFB 3U46B 1LQSR 5HHVH 4J1UA 3ZYZA 2OZ4L 1N5YL 3QJHA 4QRPA 5HGBB 3QDGA 2ERJC 1TPXC 4HKJA 4WNQA 1KYOK 4FHBD 3WNNA 2R2BA 4KRPD 2CQVA 3IDMB 1F45A 5BW7C 3GSNH 3IXTB 1KEGL 1FZMA 4FXKB 4KWUA 5E0QA 2VL5B 1UJ3B 3CVHA 4MD5B 3JZ7A 5JIIA 2NX5B 4I3GA 5CSZB 5I76A 2DBLH 4Z95L 4FQ2H 4RGND 4HXBL 5JXEA 2IPKA 4LQ1A 4XGZA 4GXVH 2ZOLB 1BEYH 2DL9A 2GJ6A 4KFZC 1IAKB 1U8KB 1ODAA 3GMLA 4UILH 4YUEH 4RAHA 5I75B 5KSAA 3WXVL 2X7LA 1KB5L 1EA9C 4NO0A 2BP3A 4RGNE 4LVEA 1WBXB 2EC9T 1LNUA 4X5XB 3U9PH 2P48B 3GSUA 4XMPL 5T5NG 2MOVA 3ULSA 3UZVB 3U7YH 4Y19E 4YR6B 4JM2B 1TJGH 1TCRA 5HYSB 5DA0B 1YECL 3KPLB 3MGTA 4JPWH 5JOFB 3VXTB 3MR9A 3HUJA 1AXSA 1FIGH 1T7YA 2EE2A 3MMEA 4OQTL 1E4JA 1IM3B 4HV8A 1GZPA 4NKDA 5LBSH 3UAJD 5CJQH 4LPVA 2NY5H 4OKVB 3EFDH 3LSOA 5EU6A 2X4PB 3BIKB 1I1AC 5KS9E 4KMQA 5I1KH 4OFVA 1U8QB 4O2FA 1NH6A 4JRXB 1F90H 4WI3A 1AQKH 4FQLL 1CXKA 1MF2H 3MRPA 4HK3N 4X6BB 3GSRB 5EZOH 5IQ9A 1L7TH 5DEGB 2DAVA 1BBJB 4N1HB 3I6GB 3H42H 3GNMH 2EKJA 3X12B 3B9KD 2ICWJ 1NJ9A 2E9WA 4ZTOH 4HIXH 5DGRA 3QXWA 5FUOH 4U1HB 3DUUA 2H45A 4LOUD 5FUCC 3N9GH 3RNQB 4C83A 3MLXL 3Q2CA 5EU4A 4IRSC 2DLEA 4IDJH 4PYGA 4J23A 1MJ7H 2FZ3B 5GHWL 5HHQA 4TUOB 3NABL 5CS7A 4HUUA 1A7RL 3VD7A 3CFBB 3G5XB 2VDKH 3ARVA 3GGWA 1G84A 5E2VH 5ISZB 2F15A 2VNCA 3EBAA 1E6OH 1OVZA 1K5NB 4U49A 4DUVA 5E9DA 3SKJH 3BP4A 2DD8H 1KTDB 3RUGA 4KQ4H 4KKAD 3KNBA 5SWSE 1ZANL 3EYVA 4GAGL 4K7PL 1U92A 4K7FB 4YDIL 4QXUH 2QQNL 1QRNA 2V6HA 3SCMB 3U0TB 2PKDA 3RDTD 1YEEL 3SDAC 2I9LA 2M2DA 3H9YA 1T2QL 4GG6A 3KVQA 4Z78B 5BS0E 4N5UA 1QR4A 1A7PH 3CMOL 2HT3C 5FM5M 3WDJA 4RISL 1ZT1B 5F70A 3HAEH 1NAML 5CEYA 1NPUA 1WV7T 2V9RA 3SE3C 4FABL 1NBQA 1RJZB 1NC2B 2ICCA 4QRQA 4I0KA 4JO1L 5D96B 3ULUH 2IJ0C 4NQEB 2OTUA 3F5WB 4LSSH 2WP3T 3VFRB 4CNIA 3RGVC 5D2NE 3LH2L 4LNVA 1NC4D 1FYHB 2VQTA 4ZUSA 2EE6A 2RBLA 4UI2A 1BF8A 4UQ2A 3U9UA 2D31A 4Z9KB 1EAJA 3CFCH 2NZ9C 1LO3L 4P2OD 4HUWA 3RNKA 5ALCH 2WW8A 4X4XB 1PY4A 4JB9L 3L3IB 3V0VA 3ZSTA 3S35X 1VHPA 4RA0C 5L7XH 3GK8L 4AEHH 2CO7B 1FJ1B 4Y2OA 5KANG 2IQAB 4NYLB 5ICYB 2HFFB 4OFPA 4AM0B 5AYQA 2G60H 3WUWG 1P6AB 3MA7B 5K9JH 4Z7UB 4JZOA 2YWYA 2DQUH 4PG9A 4JY6A 5GGTL 1S9VB 5B21A 5GS0L 3EOYG 5ANME 2N1KA 2GIYA 4UT9H 2EDJA 1NBVL 2GKIA 1L9MA 3QIUB 1WAAF 4L5FL 4U6XB 4X6FA 1DE4A 5JDSB 4ELMF 5E6ZA 1J86A 1SYSA 2EICA 5IVZA 1BZ9A 3ARTA 2YR3A 3PV6B 3ALWA 4NO2A 4PV9A 1FSKB 1ZSDA 1T1ZB 3FTGA 3GMOA 3DXAD 4ZS7H 2AW2A 1F58H 1S78C 1NCAH 4G80A 3BKJL 2WUBH 1D9KD 5LAXB 2GI7A 3PNWA 1AP2B 2ZSVB 3EDKA 2NXYB 1M7IB 3MRQB 1OHQA 3DXAE 2AGJH 1HCVA 1HHJB 3HPJB 3QXVA 3Q6GL 1A47A 1CE1H 2B1HL 5D4QA 2EC8A 2PW2B 3U0WL 1NSNL 1YEJH 3BOVA 5KVFH 4NFCA 1ZVHA 1DQDH 4JREC 1ZS8B 4OM1H 1LO0L 2XTJB 2FX7L 3PJSA 3UBXI 4HDIA 2HVJB 1PG7W 5F93C 3RBGA 2X1OA 4XVJL 4TUKL 4YEEA 3VGEA 4M6MH 4I3RH 2IQ9L 4WU7A 1Q72H 2XI9A 4KMLB 5IVXE 4E42B 43CAB 3ZMRA 4XP6L 3VW3L 4LRNH 3SQBA 1EFQA 2BVEA 2FX8L 2Y25A 3JV4A 3WNPA 5FUCE 1K8DB 4I0PA 4PJDE 3PWLB 2UVFA 3V5HB 2IADB 2EDOA 3O4LE 1TETL 4PJ7B 3RVXD 4XPFH 1Q9WA 5D7JD 3QJHB 4QRPB 4PJHA 3QDGB 5J12C 1FNAA 3MNZB 1AGEB 4HKJB 4WNQB 1ETZA 2R2BB 3UDWC 3V5DA 2FJFA 4MVBD 5FK9A 1FZMB 2J6EL 3CVHB 3U36A 4QEGA 2FL5A 3QH3A 4RGOH 1U8PA 4JE4B 5I76B 4GS7C 4U0QB 2E7HA 2IPKB 4IIQC 2HT3D 4XGZB 4PRIA 2GJ6B 1EJOL 3GMLB 4UDTA 5KSAB 1MY5A 1EERB 1QQDA 2X7LB 4NFBA 4NO0B 3WKMH 5B22A 3L5IA 5IMOA 1LNUB 5BRZA 5IEKA 3GSUB 2ENSA 3ULSB 4KK5C 3RGVD 1TCRB 4C54A 1I9RL 1I1RA 5DT1H 4WI2A 2XZAL 3MGTB 15C8L 3O4OB 4K9EL 5F88A 1OD9A 4NZJA 3MR9B 3HUJB 1AXSB 3ARFA 4FFYL 3MMEB 4JN2A 4HV8B 2VXVH 1GZPB 4NKDB 4I5BA 5F7UA 3LSOB 5EU6B 1U8MA 2DKMA 5D72H 3TJEH 4D8PA 2XZQL 4XP4H 1BX2A 4O2FB 1JBJA 3MCG1 1A3RH 4H88L 5E03A 2AJVH 2FNBA 1NLBH 5DZNA 2YPLD 3MRPB 2C9AA 1MCSA 4FFWC 3SBWC 4UBDC 4Z7WA 5DD0H 5HI5C 4U1KA 4ONGL 4OCMC 2OBGA 2YPLE 1KEMH 1NJ9B 2DDQH 4ZFZA 4KKCD 3RRQA 5T1KA 5EULV 2FD6L 3DUUB 3PDDA 4C83B 4E41A 1OSPL 1VGKA 4PREA 5EU4B 3GMMA 1Z6JT 5F1SA 4OI9A 1OL0A 5I8CA 5HHQB 3HG1A 4HUUB 5GRJL 2NMSA 2QL1A 1WWWX 1S78D 3GGWB 1UQSA 5CGYD 1Z5LA 4Z0XA 2BOBB 1ZWIA 3ZDXE 3NOIA 1ADQH 5D8JH 5E9DB 3O2DA 3BP4B 5I1LA 4FQQA 3K2UL 2BK8A 3UTSD 3RUGB 5DMIH 3KNBB 3EYVB 4HMEA 1U92B 2JB5H 1QRNB 1FORH 2HFEA 1P7KA 3ZKQD 2I9LB 3UTSE 2X9XA 3NZHL 4U0RC 4GG6B 4GKNA 2C1PA 3MZGB 3FN9A 1JL8A 4EUPG 4O00A 3W0WA 4WHTA 5CEYB 4X4ZA 2ZG2A 3MV9A 1CK0H 5TFSL 4QRQB 1JWSA 3LRHA 4CNIB 1MRCL 1RURL 1MREH 1DFBH 1FVDA 4ZUSB 1Q9OA 1S9YA 4UQ2B 4M6NL 1RQ5A 3U9UB 3T0AA 5E99L 2D31B 3B2VL 1TZGL 3F65A 4HUWB 3RNKB 4K55A 5J56B 4LEOA 1YPZE 2VZUA 4PD4K 5IP4A 3T2NH 3V0VB 4R26L 4JM2F 1WK0A 4HMDA 3QXAA 4C56E 3BQUA 3VI3E 3PXHA 2OS7A 1FYTA 1QBBA 3LQAC 7CGTA 3EOTL 4LRIA 1T2XA 4N90D 4PG9B 3AS0A 4JY6B 4UOJA 3AB0B 5IIEA 3IFPA 4PV8A 1T89A 1JZ7A 5TPWL 5K9QI 4Y5VC 4P2CG 4ODWA 4QKXB 3WD5H 4S1QL 4X6FB 4JFOA 3NCEB 1DE4B 3A6CH 4G5ZL 4KK5D 4X7EC 4GRLD 1A4JB 1UZ6E 1SYSB 5IVZB 1BZ9B 3G6AA 3MQIA 1QFUH 4NO2B 2NTSP 3ET9F 4PV9B 1ZSDB 1KFAH 2JJTA 1L9NA 3B83A 1OP5H 2ADFH 3FTGB 3GMOB 3MRJA 4N0RA 4G80B 1CVRA 3WL9A 1YJDH 1LK2A 3PNWB 3A6BL 2OXGA 2VLKD 3P9LA 5D1ZC 4B53A 5HVWA 5FM8A 2ZNWA 4JGMA 1CLZL 2AK1H 5IKCA 4DEPB 3T0VA 1DVFC 2ZCLL 4XNZB 2VXTL 3F7QA 4XP9L 2R0KL 1EJ6A 4FA8A 4FFWD 2FLBT 5TQ2H 4UBDD 4HDIB 3O6KH 4E9LA 1RUPH 5DHVH 5HI5D 3S37H 5IW6A 5LXGL 1BQLH 5CJOL 1A7QH 4KV5F 5C0FA 3ARBC 3ESVF 3EO9H 2CLRA 4KHTL 4TPRH 5T3ZL 1AR2A 4JFDD 1J87A 5MHSD 4MAYC 4MAUL 1E4XI 2BY0A 5CJBA 2VDOL 3JV4B 2N4IA 2B1AH 4DVRL 1TITA 3B43A 4JFDE 4I0PB 4GAYB 1NMCC 1K6QH 1UEYA 2NY6D 1JNHB 1JK8A 2AXFB 2BVUA 4N8VG 5TQ0H 1ACYL 4OLYL 4P2RD 1XGYL 4WU5A 1Q9WB 3WXWL 2LFGA 4I1NB 4PJHB 4OLZH 4WV1A 2H1PL 1ETZB 3V5DB 2FJFB 4L8SA 3D69A 3FMGL 2H41A 3MRMA 1ZTXH 5FK9B 1LVEA 3FT4A 3U36B 4HGWA 1UC6A 4OBRA 2FL5B 3QH3B 1I1CA 3NAAL 1U8PB 3SDXA 2AEPL 4TSAL 1RJLA 1RFDL 4OCWL 3BKMH 3PP3H 4PRIB 3GBLA 1CDHA 4M7LT 4UDTB 4XAKD 3L5WB 1QQDB 3TLRA 4PRHA 4LSUH 5BRZB 3T8XA 5IEKB 5IMOB 2OR9L 2C3VA 1EXUB 4JJHA 4NJAH 5HXMA 2DJ4A 3W9DA 4Z0BL 4F15B 5CP3A 5GS2H 1NL0L 4XPTH 3GMNA 5DO2C 3QCUL 4Z7UF 4WFFE 5F88B 5E2UH 3ZT7A 1T7ZA 2PTUA 3V52H 3ARFB 3FFCD 3N0PB 4JN2B 4OZHE 4H5SA 1W0YT 4I5BB 4R0LA 2JCCE 3MJ7A 5IFAL 5A3ID 4K3DL 1U8MB 4ZUUA 1SBSL 4D8PB 3KPSE 1W72A 3ZL4H 1BX2B 2NY4D 3VXSA 1RULL 2W92A 4K8RC 4L4VA 2BMKA 5EFIA 3TZVC 1B0RA 3R4DA 4Z7WB 1CCZA 5IBLC 4U1KB 4JKPL 1NCCL 5T3XL 2W0PA 4QRTB 3SQOH 4ZFZB 2YPKA 2L4OA 5T1KB 4HIEA 2J8UE 1ZHLA 3NCYP 4WENB 4E41B 5AUMA 3RZCA 1VGKB 3I6LD 1MHPL 4PREB 5KSBA 3GMMB 4DUXA 2IG2H 5I8CB 3HG1B 2VN7A 4TULL 1C5BL 5BO1H 4IMKC 3OXSA 4ELKA 4ODTL 4HUMB 1E28A 1GGBH 4P4KC 3T08A 5D7LE 1Z5LB 4Z0XB 5DD3H 3MYZA 1ZWIB 1N64L 5D1ZD 3B9EA 1VFMA 4F2MA 5JPMA 3QIBD 4HF5L 2A83A 5DRZA 5I1LB 4FQQB 2IALA 3X3GH 1UM6H 5DZLA 3FQRA 2YUZA 2Y36L 1MFAL 2HFEB 2ADGA 1P7KB 1S7XA 4OF6A 1IAIH 3GRWH 5KAQG 3WE6A 3BPCA 5J1TC 3QDJA 4HLZG 4QCIA 4JQXA 4GKNB 4RAUA 2IMMA 2C1PB 2NY7H 3PHSA 5JHLL 4YXKH 4YBLB 3ES6A 4U1MA 4MWFA 4HUXA 3W0WB 4WHTB 3ARBD 3F58H 3NA9L 1UA6H 2W07A 4XNYH 4LIQL 1UVQA 3VWKC 3MV9B 2BY1A 2VLRA 2R8SH 1HXMA 4MAYD 3U4EB 1JWSB 4IRJC 5I9QC 3MRGA 4G8GD 4HFWA 1QKZL 3VFUA 2Q86A 4FTVD 4YX2L 1A3QA 4XT1C 3TWCH 4OB5L 1Q9OB 1S9YB 2W9DH 4G8GE 2FJHA 5J7CC 2O5ZL 3KPQA 4XPAH 4FTVE 5J8OA 3FN3A 1I7UA 3LPFA 3LEYL 2VABA 4LEOB 2DYPD 3EJZC 2XFXA 4M02A 3QEGH 3O3DA 2LVEA 3HMXH 1EH9A 1JHLL 3N50A 3QXAB 5EOCJ 1FYTB 5GRZA 4G6FD 1EO5A 3HUJF 3FHAA 3ARDC 3MO1A 5IIEB 3IFPB 3ZDZE 2R56H 4PV8B 4I2XA 3U48A 2PYFA 4ODWB 3FQNA 3L9RA 4JHWL 4PJ5D 1XIWC 3THMH 4PGBA 2ZUQC 4YHOL 4JFOB 5C6PB 5E1HB 4RSVA 1XF2A 3G6AB 2C26A 4P9HL 4RDQF 1RIHH 2IF7A 3GJFB 4JFEA 4PJ5E 2OJZL 4IRZL 4M1CC 4TSCH 1II4E 4AQOA 4NQCA 3MRJB 4RBPH 3D39D 3WL9B 3L5XH 5DMKA 1LK2B 4RWYH 4YO0A 4NZUH 3QZWA 3P9LB 4TUJA 3P0VL 4MGXA 5KW9L 1N5YH 2P44B 3ULVL 2C4FT 4M7ZC 2D3VA 2GSGA 5IKCB 5C7XL 2SEBA 3MFFA 2ESVA 3MV8A 2IFFL 3CK0L 2D9CA 1KEGH 5I19L 2P4AB 4MSWA 1K85A 3QDMA 4KK6C 3DUSA 4JCMA 5IBLD 1XGRA 5IW6B 4OIIL 5CEZH 4Z95H 4RGMC 2FGZA 4YWGL 2UWEE 5C0FB 3RUGF 4BQ9A 2CLRB 1CDCA 2DICA 3QBTB 4H26A 4B41A 2DB8A 4U3XA 5GIRA 3MXWL 3DYMA 2BCKA 1P1ZA 4GG6F 1QFWH 1YECH 2R4RH 1MCCA 1VPOL 1JK8B 1RK0A