4PP1C

The crystal structure of der p 1 allergen complexed with fab fragment of mab 5h8
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
210
structure length
210
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDITNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGKTLPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase 1
publication title Structural Analysis of Der p 1-Antibody Complexes and Comparison with Complexes of Proteins or Peptides with Monoclonal Antibodies.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 51
structure length 210
sequence length 210
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pp1C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pp1C01
5ALCL 2WWMC 4OI7A 3M8OL 3T77B 1S9XA 1O7SA 3B2UC 4OLZL 2V9QA 3DPBA 3MCKA 1YYLH 1ZSDA 1VEPA 2Y06H 5SWZE 5I8OH 1G7IB 4QHUB 1BFOA 1FGVH 3UCRA 2XPGB 3FT4A 3DTXB 3FT3A 4HC1H 5J9PA 3ZHKA 5CWSB 3RGHA 3HE6B 1KFAH 3JWDL 4NYLA 3HHRB 3GMNA 2EEAA 1TZHB 3GBNH 1JPTL 4OCRL 5EO9B 2FYYA 2EE3A 1IILE 3WFDH 3QUXA 1BQUA 3ZL4L 4PY8J 3UTTA 1A1OB 3WNLA 2EYTA 2WBJC 4YLQT 4QRQB 4L9LB 4PYGA 4X7TB 1RK0A 5EOQL 1RULL 3VDCA 4ZD3H 3C5SB 4ZG1A 5F21B 1N0LA 4G6MH 1D9KA 5JR1H 3KPRA 2EXYD 5JORB 2AV1B 4QT5B 1VFAB 3UDWC 3RVXC 4HPOH 2JF1A 4JO1L 4UTAL 2FR4A 4CKVX 3B9KB 1FL6A 1WIUA 3MZGB 3C2SA 5IMOA 4AEIH 2EYRA 3I02A 4KDWA 4LRIA 2HG5B 5EC2B 5C1MB 2H3NB 5KAQF 4WGVB 3KYAA 2XNAA 5FKAA 5KSBB 4ZDHB 2AK4D 4YC2C 4M1GL 1IC7H 1BZ9B 1GHFL 1AHWB 5F3BA 5DWUL 1D5XB 4I1NB 3FO1A 5IBLD 3MRRA 3W0WB 2AQ3A 2A9ML 1KSRA 1IAMA 1WZKA 4FFYH 3PQYB 5DRZA 2VLKE 3MRMA 2GITB 2NR6C 4HLZH 4BZ2L 3IXAA 1H8NA 4M5ZL 4JG0L 3T0DA 4MHHG 1FFNB 4G7YL 2FJGB 1IGTB 1JNHB 2LE9A 2B2XL 3HCVB 4PJGB 1U95A 1T6VN 3VG9C 3S37X 3ARPA 3G04B 3VFNA 1KCSH 2EKSA 5I1GH 4WDIB 1AD0B 4XI5C 5E5MB 5ACZB 2OCFD 1BMGA 2EO9A 2GTZA 2K9UA 3UTSD 1XR8B 5K59E 3QCUH 4ZXBB 4R90H 2GK0B 4MNGE 3FMGL 3IJYA 1YEGL 4PGEA 3MFFA 2DKSA 3V0VB 2DBLH 1ZHKA 5TDNA 4L1HA 1WWAX 1XEDA 2VXVL 1MHHA 2JCCF 3OKYA 4JDTL 1IGIH 4FZEL 1U93B 4EUPB 2NLJB 1OP5K 5CD3A 5T3XE 5JHDA 4OB5H 2YUVA 5HDBF 4K55A 5E0QA 5MEND 3BD4A 1QR4A 4RA3A 2DTSA 3WS3B 2YC1B 1GGUA 3KNBB 4GBXA 4XNYL 5J6HA 1CICA 4G6KL 4KI5F 1MY5A 2R69H 2DYPA 4OZ4B 3I6LE 1TQCC 2R0ZH 3IJHA 5DQ9B 5EZOL 5GIRA 4ZS6D 3BZEB 4PD4J 2YWYA 1ACYL 3GSWA 1CDHA 3MXWL 3MBEB 4G5ZL 1TLKA 3MUJA 4HKBA 5F9OH 5C0EA 3ROLA 5KTEL 3UYRH 3D39B 1RIUL 4HXBL 4QRTB 3JV4B 4JREB 1OW0C 3ECBB 3T77A 3U4AA 3OXRB 1EMTL 3TWCH 1XF5B 5DFTA 5JMRA 1NSNH 1G7IA 2XFXB 2NTFB 1JCKA 4QHUA 5I18H 4N68A 1DVFC 3DTXA 2WIMA 5LBSL 5CWSA 4DK3A 4N0CC 1TENA 3HE6A 5HYEA 1LEIB 1TZHA 3S98A 2DWDA 1AGDB 2OR9H 3BRGC 1ZKAA 1INDH 3N0PB 5EO9A 5EOTB 4UINL 4OZIF 1XGTB 2DQJL 3MNZB 2YD5A 1A1OA 4KUZL 3T0ED 2B1AL 2B7DT 4G42B 1FORH 4XAWH 5TE7H 4L9LA 5KW9H 4X7TA 3TA3C 4LPVA 5MHSD 1JTTA 1PQZB 3QDGB 5D7IB 3C5SA 3WXVL 5FYKE 1I1AB 3OJVC 3R0NA 2A83B 1EEYB 2ZUTA 3NCMA 5D2LB 1OWRM 5JORA 2A6DB 2AV1A 4QT5A 2DLFH 3A0OA 1M05B 5CINH 4YEEA 5F7KC 1UH2A 3FQWB 4Z7VA 4RAUB 4TNVK 3S35X 1NAKL 4LSPL 3B9KA 5C09B 2AW2A 2HG5A 4KK5D 5EC2A 2H3NA 1EO7A 2ESVA 2A2QT 5KSBA 4ZDHA 1YECL 1BZ9A 4P2OD 1GIGH 1ZGLA 1AHWA 2HVKA 4I18B 5I8KH 1D5XA 3AVEA 4YFEA 4WI4A 2P8MB 4FNLL 5IOPB 3W0WA 1KGCD 1MRFL 1K2DB 5IESL 4JN1H 4NO5B 2D7NA 2GITA 3K8LA 3JWOC 5EU4B 3HAEG 3BWAB 3LIZL 5DF0A 5E2WL 2P5WB 3WIHA 2DM7A 1PG7L 3DMMC 4U2ZA 3RWEB 1FFNA 2FECL 3LH2H 4OIIL 1NGQH 1KNOB 3VWKD 3PG2A 1IGTA 1JNHA 3U1SH 5HPMB 4PJGA 2B5IC 4EI5D 1AGEB 4PJ7B 1ADQH 3G04A 2Y36L 1CI5A 3KLHD 4WDIA 1AD0A 2YD1A 3QQ9D 2VLLB 5H37G 2VAJA 1I1YB 4ZUUB 5E5MA 5ACZA 1XR8A 2CIKB 4WTZG 3AC0A 4ZXBA 2GK0A 5HGDB 2YD7A 5GJSH 5B21A 1C5CL 1IJ9A 2HKFL 3V0VA 3SE9H 4J2XA 2OK0L 2QSQA 2WUCH 3GHEL 4GRLB 2Z8RA 3DGCR 1U93A 4EUPA 1PEWA 2NLJA 1M6OB 4Y4FD 2R29L 3O3EA 3D9AL 4HT1H 3S34H 1YMMB 3QAZC 2YC1A 3WS3A 3F5WB 4YHMH 3BMVA 3NGBB 3MV7D 2D2OA 4OFIA 4D9LL 2PYEE 3L1OH 4OZ4A 4WRLA 1QSFE 5GS3A 3HKFA 1MCSA 5DQ9A 1TTGA 3BZEA 1DANT 1YYML 1J1XH 1RFDL 3B3IB 1TITA 3BE1L 5IWLA 5D72H 1CLZH 1FLTX 3PHQB 1BZQK 3AS1A 3D39A 3VMOA 1S7TB 4LNRB 4QRTA 2V7HB 5ADOL 3JV4A 4DW2H 1NL0L 3ECBA 3GNMH 3LQAC 3OXRA 2DQGH 3GBLA 1XF5A 2P47B 1PFCA 1RURH 1T83A 2XFXA 4NOBA 4YDVB 1RZIB 2BHYA 5IFHH 3QUZC 3OAZK 2RBLA 1K3IA 3AREB 2D4DA 1HCFX 4KVCH 1K8IB 4YBQC 2EDWA 1LEIA 3MC0A 1AGDA 1TZGL 5EOTA 3QI9C 5DURD 3PWPB 4WTWA 5F7HA 5I19H 3RKDC 3BP5B 4JM2C 1J1OH 1XGTA 2Y7QB 3MNZA 2E6QA 1G9EA 4OAWB 3K1DA 4UILH 5KS9E 3H0TB 5FO9A 3VDBA 2FBJH 4WI8A 2CDEB 2RCSH 2VISB 2IQ9H 3WL9B 3QDGA 1PQZA 4PLOB 2X4TB 3DI2B 1I1AA 4TOYL 2A83A 1EEYA 3MO1A 5D2LA 1HCVA 4WFFD 3MR9B 1WC7B 2A6DA 2B0SL 1M05A 2FGWH 3FQWA 1T22B 3LDBC 5C09A 1KBGL 5TF1H 5TQ0H 4K7PX 4HUKB 4N0UE 3ARXA 4JFED 1U9KA 3TEUA 2W9EH 3C9NA 2VDLH 4I18A 4O9HH 1T2QH 5C2UB 2P8MA 4IRSB 5IOPA 4G6FD 1Y18B 3RIFK 1K2DA 4NO5A 2AJVH 3HUJE 2APBA 3BWAA 1OLLA 4DOHB 2XXCB 4XNQB 2P5WA 3DUHA 3RWEA 3QZWG 4EN3D 1HINH 5GGVL 1KNOA 3QJFB 4F15C 5HPMA 5FHBL 1AGEA 4PJ7A 1BBDH 1DBAH 3B4NA 5GGQH 1HH6B 2IEPA 2BVQB 3PGDA 4LCUB 3LHPH 4DEPB 5A2FA 1I1YA 4ZUUA 1IAKB 4YWGH 3W2DH 4KK9C 1MIMH 4XAKE 2VXSH 4MB4A 4HZLB 3NFPB 2YZ1A 5C0AD 1LEGA 2GHWB 1INEL 1S7RB 4FQHA 4OF7A 5IQ9B 4ZQKB 1J8HB 1NLBL 5CJOL 4GRLA 4TSBH 2V5YA 3F65A 4OKVB 3EYQC 4F33B 1UVQA 1M6OA 2O5ZL 5LCVL 5CEZD 2X9WA 1IGML 4F9LC 3NFNB 1WTGT 1YMMA 1AH1A 3F5WA 2CKBB 4P4KD 3QH3B 1G7HB 2H45A 5BVPH 1MUJB 4GG6F 5AWNH 2Y06L 3P77B 2E6JA 3BXNB 2QQNH 5DC9B 5BCAA 5GSVB 4TVPH 4F7CB 1G0YR 2AJUL 5DHVB 3B3IA 5C0BE 4TNWK 3PHQA 1S7TA 4LNRA 2V7HA 5FECB 4TPRH 3SDXE 4HLZG 3OBAA 3GKWL 4GRWB 4OT1L 4M61B 3SEPA 1NMBL 1KCRL 3B5GA 5B38G 4MD5B 5JIHA 2G9HB 4YDVA 4JPIB 1RZIA 1B0GB 3NTCH 3AREA 3DECA 3P30H 1KUMA 1K8IA 1N64H 1R24B 2AP2A 1CD1B 1HHKB 2FEDC 4F2MB 1JTPA 3PWPA 1P9MC 5ILTL 2Y7QA 4AEIL 2CUIA 3PXJA 4OAWA 4W4OC 3RGVB 1AE6L 1QRNB 4J3SA 3H0TA 1NCWL 1IC7L 1XGQB 2H9GB 1DQDL 3NABL 1T5XB 4PJEB 2CDEA 3GM0A 2VISA 3S36X 3WL9A 2X4TA 4LPXA 4F9PA 5F7LB 2R4SL 1X5YA 3VXSB 4M48H 3MR9A 1WC7A 4FFYL 1F6LL 2APVA 1T22A 5JUEH 4MA8H 4OLUH 2XTJE 1LO0H 1A6PA 4CADB 4POZD 3AS0A 3TPKA 4NN7C 4OFKA 5I1GL 4DKFL 4IRSA 1FYTB 1Y18A 2FHFA 2EH8H 4XMPH 3I50L 1R3LB 4KZEH 1J1PH 4NBZB 3DHMA 3QCUL 3F8UB 5SX5H 4H25B 1CQYA 4JGMA 4XNQA 5ISZE 4PREA 4TYUA 4K3JL 2ID5A 1WLHA 2R1WB 3ET9F 4KJYB 3RWHA 3RU8H 3BUTA 1IGIL 3G6JB 2VWEE 3VFUB 3BSZH 4YFLI 5ALBL 5E6IB 1UT9A 1HH6A 3TLRA 3KJ6H 4HCRA 2BVQA 4LCUA 5CLTA 4LP5A 4PJ5B 1IAKA 3D85D 3NCCB 1NANH 1DBKH 1ZA6B 3SE8L 4HZLA 4HUVB 3NFPA 2ZZUT 5IQ9A 1S7RA 3EJYC 5KBNC 4ZQKA 1J8HA 1L4IA 4R26H 2NY6C 3SGDI 4OKVA 5D7JC 4F33A 5F9OL 4PJ8A 3F7YB 2FB4H 5HHQB 3UYRL 2RB8A 3NFNA 4XRCB 3IDGB 3O2WL 3TVMB 2CKBA 4OI9A 3QH3A 4MXQC 2A9NL 1G7HA 3QUXD 1MUJA 3ALWA 3P9LB 1NSNL 3UTTD 5JXAH 4DVBB 1NEZB 2J1KA 1REIA 4MCZB 3VD5A 4RDQG 3BXNA 4U2YA 4ZSOB 4TTDD 4PRDB 3DETD 5GSVA 1DBML 4O2CB 4F7CA 4FP8H 3TT1L 3CVHL 2N7AA 5HI4C 4G6AC 4YXLH 5DHVA 2D9QB 4HJ0C 1OAZL 4QGYA 3VFOB 1M7DB 1CXKA 2OBGA 5T3XH 4UU9B 1BFVL 1H5BC 5K9JL 4H0IA 3IDYC 3KPRD 4IOFC 1MAJA 5FECA 3QG7H 2JCCE 4M4RA 1DSFL 2H32B 4M61A 3Q5YA 4MD5A 3MLTB 1FORL 5TE7L 5HJ3B 1Q0YL 1JYNA 5KW9L 4PRNB 5IJKC 2G9HA 3PP4H 3QJHB 3GB7B 2QQLH 4OF0A 4JPIA 1FSKC 1B0GA 1L0YA 3S37H 1X9QA 3HNVH 4XCFL 4GLRH 1IRAY 4O02L 2FECI 3JWOL 1MHEB 3ZLQC 4N0YH 1R24A 1CD1A 1HHKA 5CINL 4F2MA 3VXMB 1MWAL 4QNPF 1ZLSH 1NGWB 5JMOC 4K94C 3KG5A 3UBXB 5E2TL 3L3JB 4FQLH 3RGVA 3MA9H 5AG8A 1QRNA 2H9GA 1XGQA 1T5XA 4PJEA 4PUBL 4HUMB 4MJ4A 5A16B 1KYOK 3VXSA 1T04B 1SEBB 4P48A 2VDRH 35C8H 4MXWH 4JN1L 1D9KC 4X4YB 5C0DB 2BOBB 2AK4E 2NTSP 3UAJC 4ONFH 1FO0H 1NFKA 4ONHA 2NXZC 2FD6L 2H2SC 1F5WA 1NGQL 4CADA 3EJJX 4U0RB 4I5BB 1KB5L 2X2YA 2OI9B 1DL7H 5C0NC 1LO2H 1N5YL 4OZIE 5FYKH 1FYTA 5JHDD 2YPKA 1R3LA 4UZGA 3SDYL 5FDWB 4GBXD 1ZXQA 4H25A 5GJSL 2CRZA 1ORSB 5I2IA 1CICD 3SE9L 4K3DH 4GW4B 3H6JA 2R1WA 3KJ4B 4URTB 4IIQB 2DYPD 4KJYA 3O9WB 3CLFH 4L1DA 4YPJA 1N2RB 3G6JA 3QEUB 4U1GB 3VFUA 1I9JL 3UTSE 5MEPB 3MTRA 5E6IA 2N1KA 3LQAL 4ELKB 1MF2L 4HT1L 4OJFH 4RMRA 4PJ5A 3RVUC 1EXUA 5IHBA 5GS1C 2ZKHH 1ZA6A 3VFWB 3GJFH 1XGPB 2B4CH 3QIBC 4HUVA 3PV6B 4AENB 5KJRL 3RNKB 2F8OA 1BM3L 4W6XB 1W0WB 5L6YL 5MENE 4QXGH 4FFVD 1CYGA 2FATH 3F7YA 1D6EB 1CLZL 5HHQA 5CD5C 5IGXL 3D0LB 4IOIB 4XRCA 2ILLA 3HE6D 3IDGA 1U8NB 1B4RA 1YJDH 4DW2L 4NHUB 3GNML 4PJXB 4UIMB 2Y25A 1N8ZA 5FUCC 3BN9C 5D6DC 3S35H 4JQVC 1LDPH 1TETH 3WBDA 3MYZA 4Q2ZB 2JLLA 3P9LA 5EBMB 4E9LA 2X42A 4DVBA 1NEZA 4MCZA 4ZPTB 3QDMB 4ZSOA 1QACA 4PRDA 4KKBD 1FG2B 1N59B 1F8TL 4O2CA 3VWJB 1MPAL 3VE0B 3VFOA 1M7DA 4UU9A 3BPLB 1MI5B 2D3VA 2C4FU 5FCSH 5I19L 1WAAE 4G8EB 3FB6B 1DN0B 2A6KB 5I74C 3B9KD 1R5VB 3WFBL 3MLTA 3F12B 5HJ3A 1J88A 2ESVD 2NY3B 3P11L 2NY1B 3NCJL 5I1AB 3GB7A 1U6AL 1FFOB 1P6FA 4O2FB 1MHEA 1PKQE 4S1DC 1A7BA 3W0WD 4BH8B 1LP9E 3T0EE 3VXMA 1NGWA 4KVNH 1YEEH 5TF1L 3L3JA 5MHSE 3HN3A 1QSEB 5CIPA 5HHNB 4DKEL 1X44A 4MVBD 5CBAB 5JW5B 1EEZB 5A16A 1T2QL 3EOAB 1T04A 1FGNH 4YHYC 1PLGL 1SEBA 5JW4M 15C8H 1WFUA 2AJVL 3CFEB 3BWUC 4YDLC 4X4YA 2HJKB 2BOBA 4EDXB 4PB0L 1YZZA 4ZXBD 3HI5L 2DIBA 1NBZB 2WSKA 1PYWB 4RZCB 2Y6SD 3GRWA 2V17H 1HINL 4FQQB 1H3XA 4OCSH 3GI8H 5CZXC 3C08H 1KGCE 4UIKL 4I5BA 1IQWH 2C3XA 2EDEA 1DBAL 2GIYA 3O11A 3QA3B 2EDRA 1CE1L 4XBPB 2NY2B 3W2DL 1WBYB 4YWGL 1PZUB 1MIML 5CKAA 2VXSL 1JWUB 4YK4B 3NN8B 5CP3H 5FDWA 3O8XC 1NDGB 3VU2A 1ORSA 3Q3GB 4P5KB 3TCLB 1SY6A 2JKXA 4GW4A 3JSSA 1F3DJ 4NNPH 1U91B 3O9WA 4HWBH 4NC1E 7FABH 3V6BR 1N2RA 4Y2DB 4K71B 3QEUA 4GAFB 3FB8B 4POUB 5MEPA 1NC4B 5E5UB 4ELKA 3E6HB 1IKFH 3ULVF 3D39D 3QB7C 3E2HC 3GJEB 3VFWA 1IGJB 1XGPA 2BSTB 5A2IH 1CGSH 1FL3A 4BFEA 3PV6A 4AENA 3RNKA 2YD2A 2KUTA 3BW9B 3THMH 1RJCA 1W0WA 2QQNL 2CXGA 1CTOA 3DX9B 2DQUL 1A14L 4LAJH 4KJWC 3MV7E 5ID1B 1D6EA 5EBWB 3R4DA 4P5TB 3D0LA 3BT2H 5J12B 5ECJE 1U8NA 4NHUA 4MXVF 3IDUA 4PJFE 4PJXA 4UIMA 1JZ3A 4L3ED 2YRZA 2ICWB 4XC3L 1F02I 1W0YT 4X9FA 4M7KH 4K7PH 4Q2ZA 5EBMA 4KAQL 5T5FH 3KLSA 4M1CC 1MRCH 4ZPTA 3QDMA 2ZOKB 2F54A 3MJ9H 1RHFA 2XN9B 1WEJH 1UADC 3B83A 1FG2A 1N59A 4YPGB 3O3DB 5HHMB 3NTCL 3MRIB 3VWJA 3P30L 3QDGD 3BFOA 2H41A 1N64L 1UA6H 2OQJB 4XMKL 1I1AD 3QFJB 3ABZA 4WW1B 3U83A 3MBEC 4PJBE 1GGCL 1MI5A 1NFDE 3MRGB 4NNXB 1LILA 4LHUB 3FB6A 1DN0A 4KJPC 2A6KA 1CFNB 5C09D 1EO8H 1R5VA 3AS2A 1HZHH 2VDPL 3F12A 1NPUA 3L5HA 4AEEA 3OF6A 5TE6L 5I1AA 4LLMB 1VB9A 3WIFA 2DQTH 2VE6B 1IM3B 5EU3B 1FFOA 3LEVL 5CMAB 3MOBH 3CLEH 4M48L 3IU4H 3KYMB 4BUGA 1NEUA 5EULV 5HXMA 2CRYA 4MA8L 4PBVC 3KYKH 4NPYB 3LQMA 1DQQB 1LVEA 4OLUL 1B4JH 3LKOB 4J6RH 2FHBA 5I17B 1Q0XL 1QSEA 3S4SB 2P5WD 5HHNA 2IBZX 5C0IB 1DQJB 4WFFE 4LLDB 2Z8VC 5CBAA 1T3FB 4OFPA 4PJHF 5JW5A 1EEZA 2GW5A 2IG2H 3KHOA 5ANME 3CVIH 3S96B 3EOAA 3CFCH 2EH8L 4MD4B 4XMPL 1KEML 4KZEL 1J1PL 3CFEA 4P9ML 4P59L 5DMIH 2HJKA 4BSVB 4JFEE 2OP4H 2VC2L 4YHZH 1NBZA 1PYWA 4RZCA 4XNZC 1KF9B 3RL1B 4MAUH 1BOYA 3RU8L 4FQQA 5DQDH 3C8DA 3CJJA 3L3HB 3X14B 1I7ZB 4GRLD 3FO2B 3DV4B 1KN2H 4RRPG 4U31A 4Y4HB 4XBPA 1FRGH 1WBYA 2EH7L 4HFUL 4Z77A 1JWUA 4QEGA 5EZJB 3NN8A 1YMMD 3ZSTA 1NDGA 4TUJB 3Q3GA 4P5KA 4QWWD 1NGXB 1U58B 5KSAB 1U91A 3ILQD 3W9DB 3OX8A 4UOW0 4NT6B 1K3ZA 4Y2DA 4Q6IB 1KOAA 3FB8A 3JUZA 3TJEH 2E6PA 1NC4A 2HJFB 5F9AC 1D5BB 3FQNB 3E6HA 5C0AE 3GJEA 3OKDB 3V5HB 1U8OB 2JTDA 1IGJA 2BSTA 1I9IH 1TVDA 1P4BL 5JXAL 3BISA 3SO3B 4OCLC 3BW9A 5CEZE 4PJDE 4R0LA 5F7MC 3DX9A 3VXRA 1A3QA 4X6CE 1YEFH 4YX2H 3S36H 2VZ3A 5T3XL 5ID1A 5EBWA 3ARED 3RUGF 4YNYB 3ZHDA 4AIOA 25C8H 4K94L 4P5TA 4M1DH 5IW1B 5C0GB 2WWKO 5DUBB 3QUKB 4U33A 4HF5L 4HS8L 2ICWA 1PG7W 5JIKA 1EPFA 3PWPD 5DVMA 1G6RH 1R5IB 4CN1A 2ZOKA 3RP1A 2QQLL 2XN9A 4JY5H 3Q6FB 3MRIA 3UZQA 2X89A 4WEBH 1MVUB 2OQJA 2CLZB 3E3QC 3QFJA 4A6YH 1YQ2A 1FE8H 5DZLA 3MRGA 4NNXA 4LHUA 4ODVH 1EH9A 4FQLL 5IIEB 3OR7B 4OM0L 3SDCC 3T08A 3OKMB 1QBAA 3NAAH 2O5XH 4LLMA 2VE6A 1IM3A 1QP1A 1LNUA 3NACL 5CMAA 5EZIL 4DQOH 4BQ8A 3EHBD 4KTDL 3WNMA 4WUKH 3IXTB 4IRSD 3KYMA 3X3GH 3A67H 4MXWL 4H5SB 5IB5B 1UKTA 4OSUL 4Z0XB 5JIIA 1UCTA 4NPYA 3JV5A 1DQQA 1GRWA 1B0RB 1NAMH 5I17A 4I0PC 4X6DB 3S4SA 2CK0L 5C0IA 4EZMA 1DQJA 5F93C 1IFHH 2W1NA 1UWXH 3MCLH 1LO2L 2VZTA 1G1CA 2DQCL 3S96A 1J0JA 4JRYB 4MD4A 4JE4B 3ESVF 4Q0XH 3P73B 4FQIH 4BSVA 4ELMB 3RNQB 1RVFL 4Z7UF 1RZFH 1YC8A 4HHAB 3WCYA 3RL1A 1RMFH 1YEJH 1X5GA 1NCCH 1J8HD 3INUL 3L3HA 3H3PL 3RVTD 1I7ZA 3X14A 5FAAA 3FO2A 3DV4A 5DRNA 1EX0A 4Y4HA 3LRGA 4EJ1C 5IKCB 4N8CL 1TTUA 4PJ8D 4OJFL 1RZ7L 3RI5F 2FX8L 5D9SB 5F7UA 5EZJA 2PTVA 4NBYB 4KI5C 4GSDH 4TUJA 2C1OB 2LU4A 3OAUL 1NGXA 5DK0B 1S7UB 2WINB 3TZVC 2G60H 1U58A 5KSAA 1IKNA 3W9DA 4KDTA 1B90A 4NT6A 4RGNC 5F7EL 4QXGL 4Q6IA 3K4ZA 3T2NL 2LU7A 3QIUC 5FYLD 3QRGH 1VACB 2HJFA 4OFVA 1D5BA 3FQNA 3QNZB 3MLZH 3LEYH 1OCWL 3OKDA 4R8WL 3V5HA 2EE9A 1U8OA 4DEPC 1TETL 3H42H 4G9FB 5HPOA 5IV2B 2UZXB 4ERSL 2ENSA 5DD5H 5JXEC 1BJMA 4P0DA 2K3TA 4RMUA 1BVLB 3HZVB 4DTGL 5KVEH 4YNYA 1VGKB 5LG1A 4EQ3A 1ZLWH 5A3IC 3BP6B 1P4IH 5IW1A 1BFTA 4YFDB 1N4XH 4ZUTA 5DUBA 3UTTE 3EJZC 1JGUL 3AY4A 2KZWA 1MEXH 1W72H 1CVSC 1TXKA 4P3WA 2VOTA 4TTGA 4TUKL 4PJHB 1R5IA 3LVEA 3PHSA 2XKSA 3RGVD 1MHPL 1QRND 3AM8A 3KPRE 5FEBA 2OJEB 3Q6FA 4XWGH 1CZ8H 1MVUA 1F45A 2CLZA 4MMXC 3VXSD 1X5AA 4WTXA 4KVNL 3ARQA 2J6EH 2LV4A 5IIEA 3OR7A 4ZS7L 3MV01 5J1SC 5FM5O 4KRPB 1QHPA 4PR5B 4LL9A 3BDBA 3OKMA 4FTVB 2ADFL 4FG6D 5GHWH 2PNDA 2PXYC 1FZOB 2AK1H 1A02N 3BP4B 3IXTA 2NNAB 1FYTD 2DKUA 2HTKD 4YJZL 4H5SA 1I8MB 5IB5A 2GI7A 4Z0XA 3G5XB 1H3GA 4LAQH 1BOGA 3HMXA 5BW7A 3MZTA 4ZO7A 3WO3B 1NGPL 4QHMB 4X6DA 4OCSL 3GI8L 3CFKA 3C08L 5CKGA 1CBVL 1ZLVK 2VAAB 1IQWL 2Z31B 3MRLB 1I3GH 4A2MA 1R5WB 4K23H 4LLVB 2VR9A 1QLEH 5HYJB 4JRYA 5E6ID 3ZE2F 3NOIA 5ESVB 1XGRB 1DBJH 1OHQA 3F7VB 3WO4B 1XF4B 4HUNB 4PJ5D 4QHKI 4PJAF 3P73A 4ELMA 3RNQA 3KPQB 3ESUF 3GDBA 4HHAA 2YEZA 1E28B 1SEQL 3BPOB 5I1HH 1HXYB 2VB5A 5JHDE 2BVPB 1A6ZA 2HVJB 1PY4A 4NNYB 4XPTL 3LAFA 4D9QD 5IKCA 1NBVH 1CK0H 2BP3A 5D9SA 5IB2B 1CIUA 4NM4L 4MAYB 3WHE1 4RWYL 1CGSL 2C1OA 2A1WH 5EORH 1S7UA 3THML 1KN4L 2HH0H 1YY9C 3EOTH 4OGXL 5INCA 1HH9B 1D3CA 1A6VH 4U3XA 3WN5C 5C8JB 4WO4C 3KAAA 3TH2T 4JVPA 4G8IB 5J06A 2W65B 4W6YB 2ORBL 4M7KL 4G9FA 4WW2F 5IV2A 4LCYB 2AAVA 1F3RB 4QRUB 4S1QH 1G9MC 1F4HA 3MJ9L 4FQXB 1BVLA 3HZVA 5E03A 1AJ7L 1JP5A 3NIGF 4XVSL 1UA6L 1NGZA 1VGKA 5MEQB 3BP6A 1F4WH 1FIEA 3VXMD 4UT6L 4KV5F 3TVMC 2ZUWA 5EU6B 3GKZA 4AM0B 4I8DA 3SE4A 3SQBA 3A6BH 3JV6B 3VI4F 5HDLA 4BJLA 4DFHA 2OJEA 2DQTL 2NY0C 5JDSA 2DM4A 4Z7VE 2OR8A 3MOBL 3QR2A 5HI5D 3C60B 4NQTA 3IU4L 4NJAH 5C7XH 3CD4A 3BGFB 4YE4H 3Q5OA 4M43H 3E6FB 3MRPB 2ESVE 1IE5A 3KYKL 1FP5A 5KSBE 4E0RB 2ZCHH 2D9CA 2VTFA 2YZ8A 2J8UF 4ZTPL 2EDXA 4PR5A 2VLJB 4FTVA 4O5LL 4Y0GA 3QDJB 3W0WE 4MXVE 1KJMB 1FZOA 3VXOB 4APQB 4LASH 2CIIB 2E9WA 3BP4A 3B9VA 2Q6WB 1XCTB 2NNAA 3UX9B 1I8MA 5DMIL 4P2QB 3G5XA 3FO0H 4YHZL 4DN3H 2AKRB 4PJGE 4GG8B 4MAUL 4J4PA 4QHMA 2VQTA 1NBQA 4KKAD 3O9WD 2VAAA 2Z31A 3MRLA 5C0RH 2PW2B 4UMGA 1D5MA 1Q72H 4HIJB 3RIAK 4V2BA 4LLVA 4H8WH 2UZIH 3WJLA 5HYJA 4PG2A 1KPRA 5ESVA 1XGRA 2ZUQB 1E4XH 4K8RD 5HI5C 1D6VL 3F7VA 5F7NC 1XF4A 1QBBA 2XWTB 3SGKA 5KAQG 2XWJB 5DFVC 3WKMH 3NIFF 1CD8A 3KPQA 4LVOB 3D5OF 1E28A 3BP7B 4XB8A 5FGBA 1HXYA 2YD8A 2BVPA 5DD0L 2BOCB 2HVJA 4NNYA 1JJUA 4X7FC 4U0RC 1ZANH 5KVFH 2UUDK 1HSAB 1C1EL 4F7EB 1KIUA 5IB2A 1LDSA 4LLWB 4MAYA 4M93B 4MYWB 4JGJA 2RGSA 1RUKH 3DARA 3BRDA 3NA9H 1HH9A 3KJ4C 3QDMD 4FQCL 4IIQC 5F9WB 2F54D 1X7QB 1I8LA 5C8JA 3VWJD 3WNOA 3QIWC 4M1DL 4G8IA 4AIXA 2W65A 2EDHA 3CH1B 3OAYH 4PD4K 4B50A 2VXQH 1MI5D 3QUMB 2A77H 4LCYA 4QRUA 3OB8A 2HFFB 4O2EB 5ITBH 4LVHC 3CXDL 2MCG1 3NBNA 4FQXA 4JY5L 3OF6D 2NY1D 4JZJC 3BPNB 4L3EE 3DSFH 3MGAA 4F37K 4L4TB 5CZVH 5MEQA 1FE8L 3PGCA 2ZSVB 1Z0NA 3TYGH 1YQVL 4ODVL 4ZO8A 3S88H 1OF2B 4WHYH 3CZJA 3MOAL 1FNFA 3MRFB 3QDGE 3SBWC 1QNZL 1QSED 3JV6A 2RJMA 3UJTL 2O5XL 3QXAB 2LAGB 5D2LE 4L3CB 1JI1A 3RX8A 3FCTB 3C60A 4WUKL 2FIKB 4I3SL 3X3GL 4Z8FH 5C09E 1Z6JT 5KVGH 4PRPB 1U8HB 3FZUC 3MRPA 3MGOB 5E2JA 3BPLC 4E0RA 2GSIB 1SYVB 4OLWL 3O6FB 1OAKH 5CGTA 3RKPA 5FUOH 1AI1H 2G75B 2VLJA 1IFHL 4BSJA 3QDJA 3CDGB 1FLRL 1QLRB 1KJMA 3MCLL 3T3MF 2NY3C 2ZNXA 3VXOA 4APQA 2CIIA 4PLJD 2Q6WA 1XCTA 2ERJC 3GIZL 4KQ3H 2P5WE 5DC0A 3QP3A 4P2QA 5GRUH 1GH7A 3MLSL 3I75B 2AKRA 3BIAX 5D6CA 1KULA 4GG8A 3MREB 4PJ7E 4L3AA 4O00A 1NCCL 3ARYA 1OAYH 5L9DL 2FJHB 2PW2A 4Y2DD 1FZMA 3SDAC 4HIJA 4X0KB 1NC4D 1BZ7B 4WW2B 4UTBH 1ZHNB 2XWTA 1T0MA 2XWJA 4QHLA 3U6RB 3O6KL 5HHPA 3PL6C 3BRFA 2G60L 3BAEH 3BO8B 3ZKNC 3BP7A 3SKJH 4CBPA 2BNRB 4XWOC 2EDTA 2Q86B 2BOCA 3T4YB 3D3VD 3FN0L 3VXRD 4LBEB 1YMME 2ZCLL 4WWKC 3O45B 1KXTB 2OZ4A 3QEGH 5FA4B 5GSRB 3MLZL 3UPAA 1HSAA 3LEYL 4F7EA 4P5TD 43C9B 4LLWA 2NY2C 5DUPH 3B6SB 3H42L 2IPKA 4XPBL 2EXWC 4YDKL 4BQCA 1YEHH 2H1PL 2IQAB 2E9BA 3VGDA 4OZFH 1QZ1A 1RZKH 2HRLA 1X7QA 2XN9D 5HHMD 3ARDC 3ORJA 4JR9H 3J7HA 2J2ZA 4UAOB 3QFJD 5GZND 3CMGA 3CH1A 2AJSL 3EDJA 4BUHA 3QUMA 2IFFH 3J8F7 4HH8A 4Z7OF 2VZUA 2X9XA 5ADPH 2C4XA 2HFFA 1UEMA 3CU1A 4OZGB 3PV7A 4O2EA 2W07A 3HB3C 3L3GB 2LQRA 4XWGL 3DX6A 4GRMA 2HT3D 2KKQA 3QWQB 1H3VA 4FZ8L 4JRWA 3CDYA 4NZUH 3FAWA 4L4TA 2VQUA 1UJ3B 2ZSVA 2HLAB 4Z7NF 3LZFH 3L5WB 1T1WB 2Y4SA 4RQQB 3SJVB 4K3EH 4NQUA 1UM4H 3IS0X 3MRFA 1MJ7H 1K4CB 4FXKB 1B6DA 4FABL 3LS4H 3QXAA 4L3CA 2LAAA 5GRVK 1FH5H 2VUYA 3FCTA 4Q9RH 2EDBA 1QQDB 2FIKA 3EOBB 2IAMC 2XZZA 4PRPA 2QQKL 5ESAB 2Q8BL 4J7RA 4X7SH 3V8CA 4LAQL 1N7MH 1QFPA 2Y07H 2GSIA 3GZKA 1SYVA 2BRRL 4Q9CA 3O6FA 1WGOA 4IOSD 4HZAA 3FTGB 3P4OB 2G75A 4U05A 4JVWA 4OGAD 5B3NA 1I3GL 3CDGA 1QLRA 4P3CH 4D3CH 4BFGA 4Y4HD 1NMCB 4DOHE 5CJQL 4HBCL 1MFNA 3FOLB 1HNFA 1ZLVH 4XVJL 3I75A 2XACC 1M71B 4Y5YC 4CVUA 5IVXF 4C59B 5KSAD 4AG4H 1FCCA 4L29B 2EC9T 1MFEL 2FJHA 3ZT5A 1DQLH 3VXPB 3RJQB 1NBVL 2P43B 2CLRB 4X0KA 1IL1B 1YNLH 2X70B 5FM4A 1BZ7A 4WW2A 5HYSG 3UTPD 3V4VL 2BX5A 4R2GC 3ARFB 1ZHNA 1BECA 4Z7QF 3U6RA 1J8HE 5KZCB 5EORL 1VKXB 3NVQA 4BA8A 1G9ML 3KPMB 1S9WB 2MKWA 4FMFA 3WFHB 3BO8A 3EOTL 2BNRA 2Q86A 1B2WH 4XCCH 3T4YA 2MWCA 5FYKU 4LBEA 4I48B 2CRMA 4OGAC 5DD1H 3MODL 1OPGH 5FA4A 5GSRA 1N0XH 3W9EB 1L6ZA 6CGTA 1F4YL 2UWEA 4M5YH 4M7ZB 5J3HC 4JDVB 3OZ9L 4KTYA 4LVNC 1X5LA 1PX3A 43C9A 2LVEA 1L9NA 2BXZA 3KXFB 3B6SA 1J87A 1XT5A 5FYLE 2IQAA 3N1PC 4PP1D 1DP0A 4NWTL 4L8DB 2UVEA 1ZK9A 2EZ0D 3BVNA 4PRIB 4GRWE 5C9KA 1F11B 3OJDB 3H3BC 4JANB 2ZSWB 1V7NL 5F72S 1KEGL 5IMKB 2ZPKL 4Y16B 2WLYA 3A6BL 4K9EH 4OZGA 4NJ9L 4TRPL 5FOBA 3L3GA 3HZMB 1BVKB 3OWEA 1JFQH 2WQ8A 5GS2D 3ES6B 3FQXB 2FIRT 1UJ3A 2HLAA 1XF3B 1YEKH 3QUYC 5BOZG 5KN5B 3EYUH 5C08B 4CVZB 3U9PL 1QRNE 1T1WA 3L5WA 4RQQA 3SJVA 3V6FB 5GRXG 4KK6C 4MA7L 4MNQB 3HAEB 4PJEE 5C0FB 4JKPL 4MQXC 4P2RB 4GFTB 4NN6C 1K4CA 5D1QD 4K9EC 4YZFE 1JF6A 2GEEA 3RJDA 3K3QA 4XX1E 1YEIH 4PJCF 4PY7B 3HTLX 4LASL 1A21A 1QQDA 3BESR 5JW4Q 3EOBA 4U49A 4JRYD 3TNNB 4F57H 5ESAA 1AC0A 1KJ2L 3FO0L 4X80L 4XVUC 3DUSB 3UJJL 3FTGA 1A9BB 3P4OA 4CVWA 1F42A 1FYTE 2I60H 1Q72L 5DYOB 1GZQB 5HTSA 4KV5E 5LGHL 3L3OB 1FNGB 3FOLA 3WKML 3UTQB 1R3HB 4R96B 1EHLL 1QKZL 5T1DL 5CGYC 1M71A 4ZNEA 3G6JE 4Z76B 2IFGA 2NY7H 2V5SA 5CILL 2ZOLB 3QCVH 4KJQD 4L29A 1J05B 5EU7E 5D1ZC 4PJ5E 2GJ6A 2VZSA 1ZANL 3VXPA 1T7ZA 2X4QB 5KVFL 2CLRA 3ULVC 1IL1A 4KWUA 2X70A 3SGEH 5C3LD 3ARFA 2J8UE 5CS7A 4N1CA 4LSRH 1NQBA 4X5XB 1VKXA 2DMKA 2R56L 4MZ3A 1S9WA 2MQCA 1QSVA 4WHYG 4G9FD 2YPVL 3WFHA 3C6LC 1RUKL 4D9QE 1MFBL 2Y5TB 2IBGA 2ED9A 1MQ8A 2ZUUA 3U0WL 4XC1H 4I48A 1TJIL 2D0HA 5DZNA 2APWA 4WV1C 3W9EA 3TT3H 2J4WH 2VDOL 4JDVA 4P46B 2VXQL 3KXFA 4ZSOE 4UI2A 3BKJH 1VESA 4IBLT 4N8PA 4M62L 4EUPH 1QFOA 4TSAL 3B9AA 1HILB 4PRIA 1H9VA 4PGBB 2CUHA 5CZVL 4RDQF 4XP4H 1F11A 3OJDA 1LD9A 4JANA 3LSOB 3RX5A 5F70A 2ZSWA 3TYGL 3T1FB 1MCEA 5IMKA 3DYPA 4WNQB 4Y16A 1KTLB 1J18A 4RGMC 3VFPA 2BERA 5I1EL 3T2PA 3IDIB 3HZMA 4FTVD 1BVKA 2F58L 3VXME 2YUWA 3ES6A 4UV7H 2D7PA 3VGEA 1QUNA 3ARVA 2EDKA 2EDYA 1XF3A 4FHBD 2XKNB 5KN5A 1EJOH 5C08A 5AAWA 4CVZA 1GGBH 1OVZA 3L6FB 3T0BA 3V6FA 3G6AA 5JPMB 2EO1A 4MNQA 2WBJB 3HAEA 1Z3GH 3IKCB 3MYJB 5C0FA 2KL6A 1DCLA 2XICA 5FUOL 1H3TA 4P2RA 4J4PD 4X5WB 4JKMA 1PZ5B 2Z31D 4OLXL 1JPFB 4PY7A 4RGOH 2HFGL 3IGAB 2PO6C 3ZTNH 4NKOB 4MLIA 2WQRA 5HYJD 1H0DB 3TNNA 1P69B 1S7XB 4GQ9H 5DTFB 4XP1H 3C8KB 4WTZA 5E2UH 1N5AB 3RVWC 4OZFG 1L7TH 4YC2B 5DJ2B 1OAYL 2HLFC 4C56B 1FNEB 4MQSB 5EUOA 4KRPC 5DYOA 1GZQA 1AXSB 1VHPA 1AY1H 1KIPB 3EO9L 4UTBL 5D70L 2VITA 3L3OA 3T65B 4NIKB 3LKQB 1FNGA 2F5BL 2MQ3A 3UTQA 1R3HA 3ZKMC 4R96A 4MAYD 3BZFB 3GK8H 4Z76A 3SKJL 1FPTL 1T0NB 4M6OL 5DLMH 2ZOLA 3VG9B 4LCIL 4XPGL 5EG6C 1Z2KA 2G5BB 3QPQD 1J05A 4Q9BA 4B5EA 5HHOB 3OKEA 3OGCB 3AGVA 5DC4B 2AEQH 2X4QA 4U1IB 4DN4H 2YBRB 3REWB 3KDMB 1NCAL 5DUPL 4R7DB 4X9IA 5D7SL 4HGKC 4X5XA 5AG9A 4MNHB 3LKSB 3D25B 5F97E 3WO4C 3LOWA 1YEHL 3GIVB 5DMGC 3ARGC 1DJSA 1FAKT 2Y5TA 1MOEA 5B38B 4ODUB 4JO2H 1MCBA 4FQXD 1FNSH 5E8EA 1R0AH 4U6HB 4JR9L 4PJXE 1BX2B 2HRPL 4GXVH 4N5ED 4WHCA 4ZNCD 1M4KA 5IW6B 3HS0B 3QDME 1TQCB 2F54E 5J57B 2I5YL 1RPQA 2F15A 1FNHA 3QG6B 2VXUH 4BM7A 4UUJB 1HILA 1MI5E 1ZA3B 4PGBA 3CDCA 5DD3H 3P0YH 4Y4KC 2ZJSL 3QEQA 3C60D 3VD9A 4G3YL 3LSOA 1DR9A 2DDQL 4IDLA 2WZPD 5TDPB 2QR0B 1J0IA 1UZ6E 1MJ7L 3F7QA 3ULUD 5DVOA 1JZ8A 5BO1H 5L0QB 3IDIA 2VLJD 3QDJD 4Q9RL 5KANG 3FQRB 4XPHH 4Y1AB 4AIZB 1JUFB 3QWRA 2FO4B 3ZT6A 5GRJH 3S9DB 2XKNA 1QSEE 2YRLA 1N7ML 5F88B 3VXUB 4P2QD 3E8UL 3L6FA 1KTRL 5GXBB 2WBJA 3MYJA 1S78D 3IKCA 5BZDB 1VPOH 2P4AB 3DX8B 5DGQA 2QQQA 4FQ1H 3WLWC 3TA3B 4X5WA 3WS6C 5J89A 4D3CL 1PZ5A 5E2VL 4I13B 4YHNB 1C08B 4H1LB 3IGAA 1FVDA 3CVHB 3WD5H 1RUAH 4NKOA 3UDWA 1PW3A 1H0DA 5DO2D 3G5VB 4LKXA 5DTFA 3VXQB 5BQ7B 3C8KA 3ZE0E 3BGFC 5HGBB 1S7SB 1N5AA 5FHAH 3QHFL 2DJSA 5DJ2A 3LQZA 3SKNB 2DQIL 4AG4L 4C56A 1RHHB 1G0XA 1FNEA 2MTPA 1DQLL 2FSEB 1AXSA 4XTRC 2E3VA 4CMHC 1J10A 1OGAB 4APQC 3T65A 2FLBT 3LKQA 1RAMA 1BAFH 1MWAB 5HI3D 3DMMB 3BZFA 1IC5L 3X12B 1T0NA 4KKCD 2AERT 5TPWH 5FOJA 5IROC 4OFDA 4UT7H 1UH3A 1XAUA 4EOWH 5DD1L 5HHOA 3MLVL 3OGCA 1AFVH 3NIDF 1OPGL 4U1IA 1N0XL 4W70A 3VRLF 5LXGL 2YBRA 3GMQB 1AC6A 5DQJB 3REWA 2HT2D 3GMPB 3KDMA 5SV4A 4R7DA 4JPKH 2QSCH 2DD8H 4KY1H 3LKSA 4MNHA 3VXRE 3D3VE 3NPSB 1RSFA 3GIVA 1CXIA 5B38A 3ZSSA 4TQEH 4ODUA 2R1YB 3F6LA 3IT8D 1E6OL 4JPWH 3Q6GH 1FN4A 4HCRH 3LKPB 4M6NL 1KB5B 4U6HA 1IVLA 1BX2A 3TN0C 3W5MA 2JB5H 4RAVB 4L4TD 4W68A 5IW6A 3FB7B 3VW3L 1WFTA 4ZFOL 3HS0A 4KUCF 1A7NH 2OSLB 1MQKL 4KRNA 2E27H 2XN9E 4K9EL 1T66D 1CGVA 5HHME 1OTTD 5ESQB 5AEAA 3QG6A 4IRJC 3QFJE 5DT1H 5ICZB 3U30C 4UUJA 1ZA3A 5F9WC 4ETQB 3MNWB 4I2XB 1OW0A 1G7PA 1YEKL 4XPAL 4PRPD 5TFSH 5TDPA 1S5IH 2N7BA 2QR0A 3DVGA 1VCAA 5FYLH 4MJ5A 3FJTA 5IFJA 1DVFA 3GSNL 4F80A 5JNYB 1H8SA 3QUZB 1SJXA 1KLGA 4C57C 3FQRA 2MFNA 4Y1AA 4AIZA 2XWBB 2VXTL 3DURB 1CFBA 1IBGL 1JUFA 3QI9B 2E9IA 3HPJB 4GRWH 2FO4A 4LU5H 4LIQL 4F57L 3KPSB 4ENED 3RDTC 5F88A 3VXUA 1GAFL 3GM8A 1J5OL 1S3KL 5B39A 5BZDA 5F8QC 2JJTC 1OD9A 3BQUC 2EC8A 3DX8A 3NFSH 2EEBA 3TA3A 4LLAA 5F8RC 1CXFA 1ZEAH 1A7PH 5L2KB 3ULVL 4YHNA 1C08A 3MXVL 1UM6H 4H1LA 4DAGH 5E9DB 3CVHA 4J8RB 4ZFFA 5C2BL 3LDBB 3G5VA 5E4IA 3UYPA 3VXQA 1JPGB 5BQ7A 5LGKA 3CFDB 5HGBA 1S7SA 2NY7L 3GSRB 4KK8D 3SKNA 3V4UH 1RHHA 4FN0A 2DF3A 5K59F 3O6FC 2BNRD 3F58L 2D4FA 2FSEA 4XPFL 2A0LC 3V4PH 2HTLD 2A73B 5DEFB 3O2VH 2XT1B 4PB9H 3QCTH 4HKZB 4LSRL 1XGUB 4N5UA 4IM8A 1MWAA 3WNPA 3DMMA 3JWDC 4NQEB 1X4XA 3X12A 2HKHH 2VDMH 1CU4H 4F15B 4R4NC 3O3UN 1RI8A 4ZPVB 3UTPE 1MJ8H 2BJMH 3B5TA 3IFLH 4ZYKB 1GCFA 1RIVH 2Q8AH 2WUBL 3TT3L 2J4WL 5F1KC 2XQBH 5DQJA 3GMQA 3GMPA 3ARBC 2VR4A 2WM0A 5E1HB 2R2EB 2XZCH 4WW2C 5LWYH 3BKJL 3TF7C 1ZHBB 2ZG1A 3HFML 4MDJB 2B8OT 5D5MB 1QO3B 4JY4B 4KMLB 2R1YA 1QOKA 1VFUA 3LKPA 1OM3H 5JA9A 3GMRB 1KB5A 2XQYG 4U6YB 4XP4L 1MSPA 1BJ8A 4RAVA 1YY8A 3FB7A 3TBTB 4G6JL 3MLYH 5TH2B 3CFIC 1I9RL 2OSLA 3IFPA 4TNVF 3G9AB 4WI6A 3SJVD 5CP7B 4R97C 2JJSC 1F90L 1ZVSA 4DVRH 5ESQA 1S9YB 3RWGB 3VFTB 4HFWB 5ICZA 2BNQB 5K9QG 1UM5H 1XF1A 1OAUH 4ETQA 3MNWA 1BWMA 4I2XA 3RVVD 5DDHB 5JW4R 1EJOL 1OP9A 1OGTB 3W81A 3ZKSD 5HYQB 3SHSA 3OXSB 2FX9H 1TNMA 4JM4L 3I6GB 4WU5B 5E56A 1LO4H 4LARL 1RJLB 1K5NB 5JNYA 5GGTL 3QUZA 2BVYA 4JG1L 2X10A 1SJEB 2E8ZA 4AK1A 3ZTNL 1XF2B 2XWBA 4B0MM 3DURA 4Z5RB 5JHLH 5L7XH 3QI9A 3HPJA 4GQ9L 4JM2A 2E9JA 3KPSA 4X6DE 4XP1L 3OPZL 4HMEA 3SE3C 4KHXH 5I30H 4QHKJ 3ALXA 4AZ8A 4EVNB 3WEXB 4JRYE 5L2KA 2QSTA 1K4DB 2EICA 3BHBB 1E4WH 2X7LB 1GGTA 2XKUA 2GJ6D 1AY1L 1DEEB 5E9DA 4ELME 3V2AR 4J8RA 1EDQA 5IEKB 4FFWC 1LHZA 4QY8B 1JPGA 5CIPH 5KZCD 3CU7A 3CFDA 4PV9B 3GK8L 1CL7H 4MSWB 2WW8A 2I07B 4P23C 3ZO0A 1II4E 4NN7B 4LEOA 1GL4B 1Z9LA 4MGXA 5J11C 2AEQL 5I8EB 4NZRL 5LGJA 4N0RA 1HE7A 1QVOB 3LB6D 2R0WH 1MRDH 5DEFA 3BZDA 4YO0B 4WGWB 2VYRE 4K7PY 3UC0H 4FA8A 4HKZA 1XGUA 1A4KB 2UYLB 3KXFD 1EFXD 5IM7B 1UB6B 1QRKA 4LOUC 4NQEA 3P0VL 3N9GL 4KROC 1QTYT 1LO3H 3LRHA 4WWID 4JEGB 3DWTA 2NYYC 4OLVH 5C86A 1JRHH 4GAGL 1F3JB 4ZPVA 5DA4A 3U46B 2FWOB 2JELL 2NXYD 1R0AL 4ZYKA 4KU1A 1SVCP 2NX5B 1AXIB 4PRID 3T3PE 1JHLH 4JKKA 3W39B 4G9FE 3BKYH 3V6OA 4ACPA 2R2EA 4ZAKB 1F2XK 2J7LA 2OXGA 1BEYH 3ARFC 4DJMA 3MOQA 3KR3H 4GXUM 4HWZB 2AJYH 3A6CH 1ZHBA 4MDJA 3MNVB 4PS4H 4Y16D 5D5MA 1QO3A 2NY6B 5D1XB 2VXUL 3GSVB 4JY4A 5D7JB 4JZNB 2VABB 1FNLA 4K8RH 3GMRA 5ACLA 2DQDL 5AZEH 1XIWB 3QPXL 2X1XR 4F9LA 3P0YL 4U6YA 1DE4A 4M6AA 2MCPH 2P49B 4OD1H 3TCXA 1A6AB 3TBTA 4BFBD 1JNLH 3RZCB 2OTPA 4OIAA 5TH2A 1I85C 1BF2A 4M7ZC 2IMMA 4YAQB 5C08D 4YDIH 3MROB 4K3HA 4HEPG 4MNQD 5CP7A 4BELD 3FO9B 1H3PL 4P2RD 1FDLH 1JGVH 3BKCL 1MCOH 1S9YA 3RWGA 4HFWA 1FFRA 2YS4A 2YA1A 4I3GA 2VH5L 3VCLB 1H5BB 3IDYB 5I1JH 1B6UA 3OKKB 2A74B 4OV6F 4LHQB 5DDHA 5CSZB 3REVB 5KS9F 3RIFF 2VDKH 3H7BB 4M4PA 1OGTA 2P46B 1IEAB 3OXSA 5KANI 3K46A 2R4RH 4FTVE 1NMAL 3I6GA 1VPOL 4WU5A 4MNGB 4LPUA 4LEXL 2BMKB 4R4FL 1RJLA 1K5NA 4Z18A 4POYA 3O3AB 4HQQH 4MZ2A 2HMIC 1MCNA 1AR1C 1SJEA 1FFQA 1K6QH 3WD5L 1XF2A 1S9VB 5FCUH 5KVDL 1NKRA 4Z5RA 3CFJB 1TJGH 4CMMB 2LTQB 1P9MA 1MAKA 5KSUB 4ETYA 3RPKA 5EBLB 2Z35B 4PP2B 5BV7H 4W4OA 4XP9H 4O58H 1GC1C 5HYJE 4EVNA 3CK0L 4U1HB 3WEXA 3HUJF 1K4DA 3CNKA 2FEEL 3BHBA 4WJ5B 4YXKH 2X7LA 3WFCH 4U3HA 4DZBB 1DEEA 5B4MD 4P9HH 5IEKA 1VENA 5GS0C 1UYWH 4IS6B 3ARWA 3GI9H 1LK3L 5FB8B 2OLDA 1BAFL 1HI6B 2NXZB 4MA3B 3D18B 4PV9A 4MSWA 1KIQB 5BV7C 2I07A 4CAGA 1EAPB 2BHUA 1NH6A 1AFVL 5I8EA 3RY6C 1QVOA 2ZG3A 4YR6B 2IALB 3DVIA 3WKNA 3I2CH 3WIIL 4IRZL 4YO0A 5D2NE 4HMCA 1L9MA 2YMXH 2UYLA 4JPKL 4BH7B 1OTSD 2DD8L 2QSCL 1JV5B 5IM7A 2EDJA 1UB6A 4GKSB 2L4OA 2P48B 4D8PB 5TE4L 1O7VA 1F3JA 1OB1B 3BIKB 3HNSH 5JIPA 4JPWL 3VD7A 3U46A 3EW3B 4HCRL 3WHXB 2FWOA 1LK2B 1P1ZB 2NX5A 3RHWK 4GJTB 3W82A 2EE6A 2JB5L 4LSSH 4OCWL 3W39A 2WWMD 4NQVB 5GS1B 3QEQD 2AJXH 3QIBB 3B2UD 5F96H 2YA2A 5JQ6H 5DR5H 3OKLB 3L3KB 4HWZA 1R3JB 5GGSY 1G9NH 3SDDB 3MNVA 5D1XA 3GSVA 1MCIA 5D7JA 3SDXF 4JZNA 2VABA 5DT1L 5FDYA 2D0GA 2NY4C 1XIWA 3CFBA 1T03H 3V7MA 3MBXH 3PWLB 4EDWL 3X3FL 3N85L 1I7UA 1LGVA 4NUGH 3RWDB 1K9TA 1ONQB 3QWRD 5TFSL 4Z7WB 4YAQA 3GJFB 3FKUS 3PHOB 4P46C 1X4ZA 2WBJD 5FYLL 2C5DC 3PWNB 1PJ9A 1CVRA 3AXLB 1TJHL 3FO9A 4ONOA 4RMSA 1S7QB 2AGJH 3O6LH 3U7YH 2B39A 4ZUWB 2GJZB 4C58B 1NCDL 3KPPB 4XX1G 3VCLA 4FQ2H 1H5BA 3SGJC 3ELAT 3OKKA 2A74A 4LU5L 5CSZA 3REVA 3RVXD 1GPOH 3H7BA 4JHBA 3ULUE 1YPZB 4EI6B 4LLQB 3MJ6A 3D2UB 4HXAH 5I74B 1IEAA 3MLWH 3HRZB 4JB9H 3PDGA 2VLJE 3QDJE 2D7TL 3SGEI 2BMKA 5IJKA 2GCYB 3MV9A 4N8VB 1ZEAL 1YNKH 4JGUA 4C56D 3O3AA 3VFRB 1DUZB 3PWUB 4OTXH 4ZMAT 5E7FA 4PJIB 3OV6A 4P2QE 4RRPA 4YHPB 1S9VA 4NKDB 2HT4C 4RBPH 2L7UA 2QHRH 3CFJA 1UEYA 3EDDA 3T8XB 4CMMA 2NR6D 4YBLC 5KSUA 2BC4B 2VZOA 1G7LB 4QXUH 5EBLA 2DIJA 2Z35A 4PP2A 4UBDC 5ACMA 3ALPA 1UCBH 5LKNA 1AR2A 2J8HA 1A3LH 3B2VH 1MFAH 2ENYA 4Y19B 4KZDH 4BZYA 1HKLL 4QRRB 4M7LH 4U1HA 3VFGL 2FRGP 4WJ5A 4M7JH 1GGIH 4YHYB 3HE7C 4OIBA 1WWBX 4XI5D 5K93A 5GGRA 3OJ2C 3HMWH 4YDLB 4PB9L 4WEMB 3G6DH 4IS6A 3QCTL 4XNUH 5FF6B 1ZHLB 4HEME 4JFXB 4EEEA 1EZVX 4XH2B 5FB8A 5ICYB 4OD3H 3KHQA 4MA3A 3D18A 2BVOB 5DEGB 2HKHL 4JN2B 2VDML 4LSVL 1KIQA 3RTQC 2VL4A 4W4NA 5E95B 3ARTA 1EAPA 2BJML 1BP3B 4MLSA 1KTDB 2OJZH 5A43C 1CFTB 2MHAB 2Q8AL 2F19H 4XBGB 2VN4A 2XQBL 4YR6A 3QBTB 4WHDA 2IALA 5DJXB 3O8XB 3TJHC 1IAIH 1NCNA 4EKXA 2XZCL 4OGYL 4BH7A 1KT2B 1JV5A 1A7OH 2DN7A 2NY5H 4EXKA 4EQ2A 1OQOA 1XH3B 3TO4C 1OB1A 3BIKA 4WCYL 6FABH 2W9DH 4I9WD 4QGTA 3WHXA 4LQ1A 3JXAA 1LK2A 1A7RH 1P1ZA 5GZOC 4G7VH 3OHXB 1ZAGA 3VD4A 5T1MB 3E2HB 5GS1A 4NQVA 1T21B 5F1NB 3QIBA 4NQDB 2APFA 5E99H 1EVUA 1X6LA 4AMKH 2ATKB 3OKLA 3L3KA 2NQCA 1R3JA 5F6HI 1SM3H 1DVFD 4HG4J 1RUPL 1KXVC 4CDHA 5CJ5A 2O5YH 4N0CD 1Q1JL 1JWMB 3PWLA 4MMZC 1ONQA 3QHZH 5D6DA 2CQVA 4JQVA 5K9QI 3CSBA 1NJ9A 1IT9H 4Z7WA 3QQ4B 3PHOA 3HUJB 4E41B 4YHIB 5IQ7L 2BSRB 3PWNA 1TPXC 3AXLA 1S7QA 2MPAL 3TA3D 4ZUWA 2PR4H 3RAJL 3BEWB 4PRPE 3KPPA 4UT9L 3O41B 4L5FL 3N1GC 5EOCH 3DVNB 4HIHB 4XCNB 2K1MA 5D93C 3MJGX 4LGPB 1YPZA 2Z9TA 4LLQA 4EI6A 3D2UA 3HRZA 4KHXL 2CGRL 5I30L 4AYFA 3BN3B 4GQPH 2GCYA 4HK3N 4N8VA 4OZHB 5JTWA 2I24N 1U0QA 1LE5B 3VFRA 1DUZA 2XPGA 4PJIA 5L0QC 1MREL 4NKDA 3VH8G 3T8XA 5E24E 1DBBL 3WUZA 5HD8C 4PRAB 1MFDH 4H20H 1NCBL 2BC4A 1G7LA 1RJYB 4NP4L 3ROOB 1CL7L 4JO3H 1UH4A 4Y19A 1KCLA 3DMMD 5EDXA 2AQ1A 3T0XA 1QBLH 2ICCA 4QRRA 5C6WH 5GS2H 5KSVB 1K85A 4KXZH 4QRQA 3WDHA 2AXHA 1E27B 4U3CA 4YXHH 3O3BB 4KKLC 1BIHA 4P2YA 3HMXH 1CIDA 5FF6A 1ZHLA 1RUQH 2XIDA 3TP4A 1VFAA 5ICYA 5HSFA 4XNZB 2BNRE 3SDXB 4JFZH 2BVOA 5A40E 1LO3L 5DEGA 4JN2A 1YMHB 5I71C 1T1YB 1JNJA 1KTDA 2UWEE 1P2CB 1CFTA 2MHAA 3UJIH 2Q20A 4XBGA 1DLFH 2XZAL 5DJXA 3O8XA 5CSGA 1QR1B 3NA4A 3EO1B 3EYFB 1ZOXA 3PQYA 1QFWH 2XA8H 2UY7A 3U79A 2EDOA 4AL8H 3QO0B 4HWNA 2KPNA 2VQ1B 4I0KA 4PS4L 5I1KH 4I4WB 1XH3A 3K8MA 1J8KA 2FJGA 1I3VA 4O4YH 3HCVA 1I4FB 1IEHA 1MCQA 3OHXA 2MCPL 4OD1L 5T1MA 4C55A 1FVEB 2V9RA 1JNLL 1CXLA 4OLYL 5F1NA 2R8SL 4PGDB 4ESKA 3EDEA 4NQDA 4OZGE 3HG1B 1W8OA 2ATKA 5C07B 1VADB 5FGSA 1FDLL 4NKQB 1IGCH 3NPSC 2XRAH 2ZUYA 4WVRA 3OB0K 3QUZD 1WAAF 2VO5A 5EPMB 3SY0B 2CMRH 5M94B 5I1JL 12E8L 1G7MB 1JWMA 4YBQD 1I7RB 5I15H 1ZVYA 2C7UB 3SJVE 4ALAL 5EU5B 5E70A 3BKML 3QI9D 1X4YA 2FEEI 3GSUB 4N1HB 3KNBA 3RKDD 3IAPA 4JM2D 1GC1L 3KPSD 2DL2A 3DYMA 3QQ4A 4E41A 2CK2A 4YHIA 2BSRA 1EEUA 5JZ7C 4Q9QL 1LP9F 1F58H 2B1HH 3N06B 4YH6A 3VG0H 4HQQL 5L2KD 4Z0BH 5GS0L 3QQNA 2JB6B 3O41A 3MBEA 3DVNA 4BSWB 4HIHA 4XCNA 2NCMA 4TSCL 1OSPH 5E9DD 1TJGL 4MCYB 4XHJC 1Q9WB 3RA7H 4DGYH 5BV7L 2OL3L 3VMNA 3SDCB 5A2JH 1QA9B 4LCCC 1OP3H 3QXDB 3G5YB 4OZHA 2DB8A 2NTFA 1LE5A 3MJ9A 1CCZA 1W0VB 4YXKL 1V8HA 3WFCL 3CX2A 2YK1L 2V5MA 2BK8A 5F7WC 5HGGS 2DS4A 5GPRA 4ZNEE 3IRPX 3LN5B 5DVNA 1ETZB 1P84J 1HN1A 1RJYA 1DQMH 3ROOA 4I0PB 1PG7X 2WV3A 3FRPG 1RZJH 1WIOA 4NQED 5DA0B 4C54A 2FX7H 2GJ6E 2R1XB 2V5RA 1IGFL 4G42A 5KSVA 1E27A 3IFNH 3DV6B 4BQBA 5D7IA 3CSGA 4KK9D 3FQTB 1BD2B 2YMXL 1C5BL 5HHVL 3WJJC 4Q6YA 2IBZY 1IAOB 5IB3B 1VGEH 4RAUA 4M8QB 2JCCB 3H3KA 1YMHA 4WHTB 5EH1A 1Y6MR 5DK3A 1ACZA 1T1YA 1SQ2N 1J0HA 4Z78B 1P2CA 3EYQD 2VRAA 3KXFE 2AJZB 1EGJL 5GQBA 5JQ6L 3EYFA 4LFHG 5GISL 1KYOJ 3TZVB 2A6JB 4DGVH 5EU4A 1MNUL 3QO0A 2VQ1A 4RGNB 4PRIE 4HJGB 4U7KA 3UPCA 2R2BB 4PJFF 3QIUB 3F7PC 5DHXB 1KCVH 1I4FA 1EBAA 5I1CH 1U41A 1T03L 5F9JB 2W0FB 2WBWB 4X98B 1FVEA 2VLLA 1L7IL 2XV6B 3EBAA 4K7FB 2CIKA 3HG1A 5HGDA 3V6OC 5C07A 1VADA 3EYSL 4HLJA 2GT9B 1MCPL 4PJBF 1RUMH 4KQ4H 2AGJL 4QO1A 3U7YL 3KS0H 4CJ1A 1NFDF 1RK1B 5D7KD 2XG5A 2IC2A 4UNVA 5E08H 5EPMA 5IBTH 3SY0A 4I0CC 1GGYA 1G7MA 5C08E 1I7RA 3LN4B 5MP6L 2C7UA 1GOHA 3VFSB 2PTTB 3CX5J 4RSVA 4OZIB 2FEDD 4MNQE 5EU5A 5HDOA 1G7QB 3GSUA 3MLWL 1D5IH 4P2RE 4JB9L 5LVEA 2IADB 4X9GA 32C2B 1HXMB 3MLXH 1JZ6A 1YYLL 1QG3A 3H9HB 4QTHB 4M03A 5I8OL 1A6UH 4F7MB 1KC5H 1FGVL 4DKDC 4JFPB 3VJ6B 1J12A 4PGJA 2C9AA 2JB6A 3PXHA 4HC1L 5E8PB 4UOJA 3UTSB 4BSWA 2QHRL 4MCYA 1KFAL 2Y5EA 1CS6A 1Q9WA 3GBNL 3MRJB 3WFDL 1A3LL 1HQRB 3B2VL 3C6SB 5ETUB 3SDCA 5EUOE 3U48A 5IP4A 1CLYH 4KZDL 4AQOA 1QA9A 4FFZH 2OTUB 3IRZA 3PWJB 3QXDA 3G5YA 1GOFA 4M7LL 3Q5TA 1S7WB 2PXYB 4JDZB 1XMWA 1W0VA 1JYVA 1FV1B 4ZD3L 3MRHB 1TQBC 4G6ML 5L8KB 3HMWL 5JR1L 2OX5A 3ZKQD 3G6DL 5IMMB 4RFOH 1EA9C 3LN5A 1ETZA 4HPOL 2VKXA 1OTUC 4OD3L 3ULUH 1J7VR 4I0PA 3BP5A 4ODBD 3GHBH 2R1XA 1JMZA 2QADB 2G5RA 2BCKB 2OJZL 3EFDH 1WBXB 2F19L 3DV6A 4M02A 3VGAC 4S0SD 2NX5D 3VXTB 5H8DA 2CD0A 4ZO9A 4GW5B 4G9DB 3FQTA 1IAIL 1BD2A 2MKLC 1B3JA 3O0RH 3SQOH 2OR7A 1IAOA 5DVKA 1A7OL 4M8QA 2JCCA 3EJYD 2E8YA 4WHTA 2FBOJ 2AJ3B 4ODHH 2E7LC 4QXTB 6FABL 1WWCA 1PSKH 4Y5VC 2NY6D 5D1XD 4XP5H 5AZ2H 5D7JD 4Z78A 1A7RL 2FJFB 4NC2B 1CF8H 2AJZA 5SX4I 1KCSL 4MHHI 3PF2A 4XCEB 4PJDF 4IJ3B 4MXQD 4X6CF 5E99L 4R90L 4AMKL 3TZVA 4KDVA 3Q1SH 4KHTH 1OAXH 5H94B 4ZOAA 2C3HA 2DBLL 4HJGA 3WN5B 3QIUA 2OZ4H 4WO4B 5HGAB 3QJFA 3QEQE 2WAHA 2DTMH 5HI4D 4G6AD 2O5YL 4HJ0D 4MX7B 4J1UB 5F9JA 2W0FA 3I6KB 3K4DA 4OB5L 1R3IH 4X98A 1BWWA 3R1GH 4IOFD 4MA1B 3WDIA 5HGHB 4YUEH 4Q74A 1HWGB 4AEHH 4JO4H 3IDMB 4Z6AT 5GGRY 5JXEA 4JFFB 5FO7B 2R69L 4ZAKC 1WT5A 4P2OB 2GT9A 4HPYH 2X05A 2R0ZL 1RK1A 3MV9D 1OP5H 1KPVB 1CL7I 3ZHLA 1YC7A 5D1XC 3WNNA 3U0PB 1QD0A 3HC3H 3LN4A 3VFSA 2PTTA 4OZIA 1XIWC 3ILPB 5T33H 2NZIA 1G7QA 3NMEA 2IADA 3TFKC 2IH3B 32C2A 1HXMA 1JHKH 2VDQH 3RZCC 3M1BB 3TWCL 3H9HA 4IDJH 1ZMYA 4QTHA 3TO2B 4HS6B 2NY0B 4F7MA 3P77A 4PJ9C 5I18L 4NN5C 4JFPA 5E8PA 3UO1H 5DMYA 3JV0A 4XBEH 1JRHI 5D71H 5HYSB 1D9KD 3FRUB 1AP2B 4H20L 2OR9L 2Z91B 1INDL 3MRJA 5FGCB 3UAJD 1KELH 1HQRA 3C6SA 5ETUA 5GRYA 2NXZD 2H2SD 1CDCA 2OTUA 3K1KC 3E1F1 3BD3A 3PWJA 3BYTA 1XZ0B 1S7WA 2M26A 2PXYA 4XAWL 3GSOB 4NDMB 1FV1A 5DEZA 4IEFB 5C0ND 1F4AA 1G1YA 1OSZB 2V2WB 4OM1H 4EXPX 5J0BA 3MRHA 4ODTH 5ALCH 2BY3A 3S3SA 4OGZA 3TNMB 3HC4H 2VDNH 5IMMA 5E1AB 2DLFL 2ADJB 1JGDB 4OLZH 2LTQC 2R39A 1T7VA 2R2CA 3AFLA 4RISH 5FYJU 3HRPA 1XCQB 1CN4A 4RMTA 5L88H 1GIGL 1WBXA 2OMNA 3IAQA 5I8KL 4ZO6A 1JPTH 4PLKD 2HAZA 4GW5A 4G9DA 4OCRH 3RVUD 3SKMB 3NH7H 5FXCH 3EYOB 3CC5B 1JZ2A 1J0YA 1QFWL 3HLAB 3QIBD 1KJ2B 5I1KL 2AJ3A 1WIPA 1C7TA 3LH2L 5EOQH 4Z9KB 2XOTA 5IT2H 3U1SL 2FJFA 1ADQL 5CD5D 1PDKA 4NC0B 4X6EB 1G6VK 4XCEA 4DZ8B 1EO5A 2XY1A 4JO1H 5INDB 4R3SB 4GG6B 4UTAH 2K7QA 3BN9D 3GMOB 2N56A 4I9WE 2ATPB 5CJXC 3FN9A 4D0DB 5H94A 4FS0A 3K2UH 3DOSA 2XRAL 3WN5A 2WUCL 4WO4A 5HGAA 5DWUH 2CMRL 3QIWB 4MX7A 3V52H 4J1UA 2R9HC 5I15L 4FMKA 4LMQI 3I6KA 4PBWD 3V5KB 2A9MH 5I1DB 3S34L 4PLKC 4F7PB 4YHML 4M5ZH 3EZJB 4JG0H 3IDMA 5E94B 3D2UD 3MUGB 3OB0H 4JFFA 4HAFA 5FO7A 4LPYA 4G7YH 4LVHB 3L1OL 4P2OA 1F58L 2B2XH 4JZJB 1CFSB 1N6VA 3SDDC 1KPVA 4Z0BL 4G6FB 1MIEH 1J1XL 3U0PA 1G7JB 4S1DD 4GMSH 1OSPL 5JO5B 5D72L 1UFUA 2P7TB 3RA7L 3ILPA 2KQMA 2E7MA 3TVMA 4E42B 3FMGH 5IHZB 1YEGH 3VFMB 2IH3A 2BRQA 2DQGL 3M1BA 3TM6A 2VXVH 4QRSB 4Y19D 4JDTH 2B4CC 1RURL 4HS6A 2WP3O 3L7FB 4QRRD 4LSTH 5C0JB 2DJ4A 2F5AH 2CDFB 5IFHL 5F3HB 1LEKB 2F9BT 4JQXA 4KVCL 4OQ1A 4XNYH 5HYSA 3FRUA 4AY0A 1AP2A 2W0KA 3G5ZB 2Z91A 4G6KH 1DQML 1J1OL 1PVHA 1RZJL 1YJDC 2H32A 3SCMC 1TTFA 2FO1A 5EZOH 2H2PC 5CZXD 3OAZH 4NCC1 1ACYH 1XZ0A 3GSOA 3MXWH 4UILL 2FBJL 4PRNA 4NDMA 3QJHA 3IFNL 2RCSL 2IQ9L 1AGCB 5CEYB 4AJ0A 2V2WA 1OSZA 2ERJB 3TESA 1QLFB 2P24B 1F00I 1RIUH 3BIBX 4HXBH 3D87B 4M8VA 1BLNB 4MQ7B 3TNMA 4MS8C 2GY7B 3O8XD 5E1AA 5TDOB 2ADJA 1JGDA 2FGWL 4S1RH 5MI0C 3PQYD 5TQ0L 3UBXA 4AEFA 2OXHA 1WWWX 1XCQA 3SDAB 2W9EL 2AABH 1KCKA 5LBSH 4CNIB 1Q9LB 4MJ2A 2VDLL 4U6VH 4O9HL 4DKAA 1A22B 3SKMA 3EYOA 3CC5A 4UINH 3PL6B 3HLAA 1ZT1B 4PFEA 1T80A 2DQJH 5C0DA 1KJ2A 4UV4H 4NQDD 2ICWI 1YDPB 3DRQB 4J23A 4OBSA 1AQKH 1I3UA 3GGWB 5T5NF 3P3YA 1XR9B 1KCVL 4WWKB 2AV7B 2HWZH 4KJWD 3WXVH 3U36B 4OUUB 4XMLH 1BBDL 3CSYB 5ABDE 5GGQL 4M6MH 4X6EA 1A1MB 3LHPL 4DZ8A 4R3SA 4GG6A 1NAKH 4JHWH 4LSPH 3RWCB 1J0KA 3GMOA 2ATPA 5IB1B 1ZWIB 4D0DA 3C87A 4M1CD 4E41D 1YECH 4IIQA 3OKOB 4TSBL 4I2XE 3C5ZC 3ARDB 3QIWA 4FNLH 4DUXA 1MRFH 3V5KA 2Q3AA 3MBED 5I1DA 2KDGA 4FXGB 4F7PA 1UC6A 3GBMH 5E94A 3MLXL 4KJPD 3IF1B 4Y2OA 5E2WH 4Z7VF 1PG7H 4WI3A 1P4LB 3MUGA 5BVPL 1AGBB 1XGYH 4HS3B 5AWNL 3PWVB 2GUOB 4ZOBA 4JZJA 1I1FB 2YSSB 1CFSA 2NPLX 3L7EB 5KSBF 4TVPL 3KPSE 3ZYIA 1G7JA 5F89B 5JO5A 1CGYA 1INQB 3ARRA 1KJVB 5C6TH 2P7TA 4IOIA 3T04D 1WITA 2Z92B 4TPRL 1C5CH 5IHZA 3RWJB 3SBWA 2G2RB 5L2KE 4U1LB 4FFZL 2OK0H 3MV8B 1CR9H 3D6GA 1IAII 4QRSA 5H35B 2YHGA 5E9DE 3L7FA 4HAGA 5C0JA 5B3JE 2CDFA 5F3HA 1LEKA 4PJGF 3D9AH 3VE0A 2IAMB 3ARSA 4EBQH 3IYLW 3HAEH 3G5ZA 4OV5B 3ZDXE 4D9LH 1QEWB 4AH2B 4X4ZA 5DI8B 4G8EA 5KG9B 1T7WA 3O4LB 4J3UA 3LMJH 3L3IB 3K8KA 3AMLA 3EFDL 2P8PB 1U8QB 5CEYA 1AGCA 1Y0LB 4KMQA 5H37H 1QLFA 1BFSA 2P24A 5ADOH 1JPSH 2J88H 4MQ7A 1BLNA 4NQEE 1NL0H 4O2FA 4WFED 5EIIB 5TDOA 4BH8A 4WU7B 2IBBA 2IGFH 4Y5YB 5JUEL 1ZGLP 2EYTB 2BY0A 5GJTH 4ODHL 1LO0L 3GMMB 1PSKL 3SDAA 1BVZA 4CNIA 5LQBH 1Q9LA 4J3WA 2CPCA 5KOVC 4UDUB 4R2GB 4U1NB 3W11C 3K81A 1FL6B 3PL6A 5D5ME 1ZT1A 3CGTA 4EDXA 3Q1SL 4KHTL 3HG1D 1PD6A 1YDPA 5C07D 3DRQA 4Y5XC 1HYSD 3GGWA 1XR9A 3VI3E 2MOVA 3WLBB 2DTML 4QF1B 4WWKA 3BSZL 3U36A 4OUUA 1QHOA 1U3HC 3MRRB 5F71A 1T2JA 3STBA 3CSYA 3FONB 1R3IL 2B0SH 2DM2A 3KJ6L 3QA3A 3R1GL 4LDLB 4LVNB 1DDHB 3EGSB 3VDAA 1KLUB 1CWVA 4JO4L 1DBKL 3RWCA 1KBGH 1OAQH 1ZWIA 1X5IA 3TCLA 1U36A 5IVOA 4LP4A 4HPYL 3BGAA 3OKOA 2VSCA 3ARDA 3DXAB 3ZYOA 4R26L 2M1KA 2YD4A 2EKSB 3HC3L 2FB4L 2P1YA 4KXZI 1DANU 5T33L 4HV8B 4OI8A 4NUJB 4FXGA 8CGTA 5D2LF 1WSST 2FLRT 5D7KE 3IF1A 1JWSB 2VDQL 1P4LA 1AGBA 5GGVH 3SDCD 4NO0B 4HS3A 4ZOCA 5T1LB 1O0VA 3PWVA 2GUOA 5FHBH 2YSSA 1HYSC 4UOW1 1JF1B 5CD3B 3L7EA 1WQVT 5JHDB 2XTJC 3UO1L 4FP8L 5I73C 1DZBA 3RWFB 4XBEL 3NZ8B 4YXLL 5BOPA 2MNUA 3QUYB 5HYFA 1KJVA 1YN6B 1WF5A 3MLPA 3QG7L 5E4EC 2DYPB 3RWJA 1INEH 2G2RA 4J3VA 4ZFOB 4U1LA 4NN6B 4JFYB 1AIFB 5C92A 4I0PD 3MV8A 5CJOH 1UENA 5H35A 1QFWI 4Y7MA 3PP4L 2NZ9C 3LKRB 2O5ZH 5LCVH 1ODAA 4OF6A 4YPGA 3WUWG 2EKJA 3O3DA 4ODTL 3S37L 1IGMH 3HNVL 2IAMA 3Q0HA 4PJ7F 3HC4L 2VDNL 4N0YL 2VWEC 4WW1A 3RBGA 2EIDA 1BD2D 4I3RH 1ZLSL 4OV5A 3D48R 1QEWA 4AH2A 3STLB 3LCYA 5DI8A 5KG9A 3O4LA 1CFNA 2JK5B 3MA9L 4RISL 5E6YA 3L3IA 1WTLA 2ADGB 2Z8SA 3BGMB 5DJZB 5L88L 2AJUH 3GSNB 2P8PA 1U8QA 3OKNB 1CDJA 1Y0LA 2D7QA 2N4IA 4P4RB 5EU3A 2APTA 1MCFA 2DWDB 3NH7L 5EIIA 2VDRL 35C8L 3GKWH 4WU7A 2GY5A 4KI5D 4OT1H 4Y5YA 4Q58C 1NMBH 1JE6A 4ONFL 1KCRH 1FO0L 3DROB 3TZVD 1UKQA 3LKOA 2VNCA 4GXUN 2NX5E 4RGND 5IT2L 3GMMA 5D1ZB 2Z0BA 3QIUD 2C4FT 4LLDA 1MCWW 1T3FA 1DL7L 4UDUA 4HW6A 4U1NA 5FYKL 4Z7VB 4TVSa 3I3EA 1G84A 1Y6NR 5ILTH 3X13B 3C6LB 2UZYB 2J5LC 2ESVB 1OT1A 4K3DL 1AE6H 5JXED 1FVCB 3K2UL 3T2QA 1NCWH 4NO3B 1MCCA 1DQDH 3NABH 3CLFL 4L4VB 1ZGLB 4G43B 3WLBA 2HVKB 2X4OB 4QF1A 3TPUB 4WV1B 5C3TA 2R4SH 3V52L 3FONA 2XXMB 1OD7A 5A3ID 2GAZB 3O81A 3KPNB 5HDQH 1DDHA 3EGSA 3EJZD 1A7QH 1KLUA 2ZKHL 5I0DA 2B4CL 5SX5K 5I75C 1V3JA 3HI6H 2W59A 2I9LB 5EUKB 3DXAA 4ORZC 1MIEL 2ADIB 4DKFH 4NGHH 4GMSL 2FATL 1FNAA 2EXYC 3I50H 4L9DA 4HV8A 4NUJA 1YJDL 3MV9E 1JWSA 4X83A 4K3JH 3S35L 5A2LH 3IB4A 1LDPL 2XY2A 4RGMB 4NO0A 5T1LA 3UZEA 4NRXB 1H8OA 1X3DA 5ALBH 4LSTL 1WT5C 1JF1A 2F5AL 2PXYD 4GS7C 3O3EB 5F6IC 2QBWA 1U3JA 3RWFA 3NZ8A 5IBLC 1A2YB 3MJ8B 3QUYA 4QHNB 1YN6A 1UXSB 5C0GA 3SE8H 5FYJD 2AI0H 3QUKA 4ZFOA 2EIZB 4JFYA 1AIFA 1VEOA 2P5EB 5CSBA 2QADD 4J3TA 2A6IB 4BFIB 2PO6B 3LKRA 4RMWA 3FFCB 5HVHC 4HWEH 3O2WH 2A9NH 3F6IA 4S1RL 4C4KO 5TQ2H 1YEEL 3STLA 3JVGC 3FHQA 2X4PB 1KIRB 2JK5A 4YQXH 3HI1B 2ADGA 1DBMH 3BGMA 2AABL 4H1LH 3GSNA 5DJZA 3TT1H 3CVHH 1OAZH 4U6VL 2GFBB 3OKNA 2V5TA 4P4RA 4JRXB 1BFVH 1UWGH 5K9JH 4L3EB 4HSQA 1FGNL 2Z8WC 15C8L 5IHUH 1DSFH 4OCYH 4UV4L 2Q76B 4PRBB 3DROA 1B0RA 2ZWLT 1Q0YH 1NDMB 1AQKL 5FO9B 1YY9D 3BH9B 2V17L 4WFGD 5D1ZA 4ZS6C 1H3UA 2HWZL 2DQEH 4XCFH 5JDJA 4WO4D 4XMLL 2QADC 2EE2A 3MO1B 4JQIH 4O02H 5F6HJ 3JWOH 4M6ML 5JOPD 2FGZA 1MWAH 2W38A 3I9GH 4GAJH 4JHWL 1P5VA 1RD6A 3X13A 5E2TH 5AYUH 5FFLA 3C6LA 3ARGB 4RCAA 2UV3A 1PKOA 4CW1B 1NUGA 4GRWF 1J86A 4JFFD 1FVCA 3C9NB 4NNPL 4NO3A 4HWBL 4L4VA 4PUBH 3F7RA 7FABL 4G43A 1A3RH 2X4OA 3RUGB 3MGTB 3TPUA 1R6VA 4WV1A 5FUCE 3T0WA 2GAZA 3UTOA 3JZ7A 3KPNA 1NKOA 4I77H 4Z7WE 1KLFA 1IKFL 3QQ3B 1EJ6A 3GBML 1Q94B 2J3SA 5EWIH 2WLZA 4S1SH 3TVMD 4G8FB 2QEJA 1TNNA 2FD6H 4IJ3C 1XGYL 1SYSB 5BS0B 2RIKA 5DK0A 3T0EC 3SKUD 5LJYH 2WINA 5FKPB 1MVFA 2I9LA 1KB5H 5EUKA 3OGOE 4RAHA 2NY0D 1OLZA 2YWZA 2ADIA 1N5YH 3MRKB 3PGDB 4Y4KB 5BRZB 1TMCB 4PJEF 1YPZE 1VACA 2IMNA 1SHMA 1U8IB 5C6TL 3QNZA 4OCXH 1NUNB 2ICEB 3BT2L 4LPCA 3SDYH 4YZFF 5LAXB 4MA1C 1LEGB 4Y89A 4FQHB 3S5LG 3SKOB 3C09C 3GJFK 4K7PL 1CR9L 4KK5C 4GW1B 5T5FL 2VLRB 3ZKXB 4PJIE 1MRCL 3EZ8A 4NRXA 1M7IB 1I9JH 3BD5A 4TULH 4P2OC 1UVQB 1WEJL 3LQAH 1MF2H 1A2YA 3MJ8A 4QHNA 4EBQL 1U2HA 3JTSB 1UXSA 4Y19E 1KB9J 2X41A 4QRRE 5KJRH 2EIZA 3PNWB 2P5EA 1BM3H 1EO8L 4PJHA 3LMJL 5L6YH 3VWKC 1HZHL 1AO7B 1RY7B 4NQSB 8FABB 3MRQB 2A6IA 4BFIA 4EI5C 2PO6A 3B9EA 3FFCA 1NUFA 3G6JF 1NUDA 5DD6B 2YRPA 5IGXH 3KLHC 4NC1C 1JPSL 2J88L 3QQ9C 3CLEL 4Z7UB 5DFVD 1JGEB 2IGFL 4JQXC 3T0AA 4X4MA 1B4JL 2X4PA 3PE9A 5GJTL 4R9HA 1KIRA 4J6RL 3BOVA 5DRWB 1NANI 3D0VB 3HI1A 3UTZB 1F8TH 1WK0A 1MPAH 5LQBL 5GGTA 4CMHB 2GFBA 2IG2L 4JRXA 4Y4FC 3CVIL 2X6MA 3PQYE 5CBEB 4L3EA 3CFCL 4LGSB 3N1FC 5JA8B 1MFCH 3TV3H 5SWSB 4LGRB 4LSUH 2OP4L 2Q76A 4PRBA 4Y8DC 3WFBH 4XXCC 1NDMA 3BH9A 1E6JH 1ED3B 3P11H 3NCJH 3DNKA 5DQDL 1U6AH 2CXKA 3G08B 1BGXH 1VDGA 5AYQA 2F74B 1BIIB 1KN2L 1R5WA 3QIWD 3H7LA 4XNMB 4NQDE 1FRGL 3LKNB 4PGZA 4LCWB 4OCNC 1OAQL 1ZT7B 1VEMA 5DUMH 2WANA 3ARGA 4CW1A 5HYIA 3BPCB 4DKEH 2P8LB 4U1JB 5E6ZA 2Z4QB 3RUGA 3MGTA 3CMOH 3TJEL 3TN0B 3ZDYE 1D5ZB 5DMKB 1CXHA 4H26B 1PLGH 4LHJB 4M7LT 1S8DB 4E41E 3QQ3A 4HG4K 4H8WC 1Q94A 4PB0H 3HI5H 4PREB 4RWHA 4G8FA 3DJ9A 1WVZA 1I9IL 1MAMH 4GLRI 1SYSA 3RWHB 5BS0A 3V79C 4NFBA 1UWEH 2UVFA 1L0QA 4UIKH 5FKPA 4IRJB 2DLIA 4YGVB 3U30B 5IB4B 3L9RB 5TGBB