4PP1C

The crystal structure of der p 1 allergen complexed with fab fragment of mab 5h8
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
210
structure length
210
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDITNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGKTLPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Peptidase 1
publication title Structural Analysis of Der p 1-Antibody Complexes and Comparison with Complexes of Proteins or Peptides with Monoclonal Antibodies.
pubmed doi rcsb
source organism Mus musculus
total genus 51
structure length 210
sequence length 210
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pp1C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pp1C01
5AUMA 3OF6D 4WWID 2EDEA 5KVFH 1NLBL 1E6OH 3HE7A 3QO1A 4M1GH 5HHOA 2ADJA 1BBJA 1MJ7H 1YEKL 5JNYA 2ITCB 4H8WH 5D1XA 1J1PL 2EIEA 4QWWD 4J4PC 4KRPB 4E5XB 3L7EB 1IVLA 4AIOA 3DROA 4H88H 5D7KD 2C5DC 5CHNA 3TEUA 5MEPA 2G5BA 1MAKA 1AP2A 4PGEB 2NY4B 4RDQG 5GZOD 3BGMB 3E6FA 4YPGA 5DTFA 3D0VA 1HOCA 5E99H 3X3GL 3T77B 1N6VA 4BFIB 1E4WL 3U1SH 5HHPB 3MLVL 3IB4A 4OT1H 1PFCA 3QQNA 1MRCL 3VXPB 3VD7A 4M7JL 3DSNA 4TNWK 2VQUA 3E6HA 2VDOH 2HFFB 4IRZH 3VFNA 2X4RA 3EYFA 4EXKA 2XN9B 2DLEA 3MJ9H 4APQA 3RWFB 4OKVB 5EBLA 1JZ3A 5JR1H 4J3WA 1MHEA 3AM8A 4GSDH 4WHTB 5B39A 1RUQH 1KB5L 3ARGD 3UJTL 5IMOB 4X6CB 4HPYL 4HCRA 3TZVD 1Q0XH 5E7FA 1INDL 1EPFA 4YBLB 1G7LA 4ZNCD 3O41B 2MOVA 1G0DA 2R4RH 3OKLB 1BREA 2XG5A 4GRLB 3UP1A 1YMME 4HF5H 2OL3B 1JP5A 4R7NB 5HHOD 3JWOL 1A1NB 5TJWK 3QA3B 1MQKH 4NRZA 3DETD 1N5AB 3AS2A 4QXUH 3QUML 1BFOA 1ED3A 5IFJA 2GSIB 1YNTA 3D5OF 1R24B 5D2LE 3AS0A 3ILQC 1KEML 1NDGB 4TVPL 1P7QB 3SCMD 2AP2A 3C5SA 4JB9H 4AEIH 2NXZB 2ARJB 5IBLD 4PJAA 3UMTA 4O9HL 1A3LH 3CFEB 3LIZL 3QZWA 3QQ3B 4PJCB 4ZSOB 3V4VL 1MFBL 4IIQB 5F1NA 1A3QA 3DUSB 4LFHG 1I7TA 2X4PA 1CFNB 2WW8A 4U49A 4WO4A 3D39A 1VDGA 5F89A 2DQHL 5GS0H 4PJ8C 1H5BC 1YJDH 2VXVL 1FFOB 1FJ1A 3NN8B 4IMKC 3C5ZC 4MHHI 4MXVE 2IQAA 3REVA 3SE4A 3C08H 4C83B 3DRTB 4LPUA 1H3VA 1S9YA 2XQBH 3V7MA 3N06B 4ZDHA 4ODVL 2W0PA 4QCIA 3R8BB 2MHAA 2IPTL 4QOKD 3UJJL 4GW4A 4JFQA 1D3CA 4DN3L 4UT9H 1U2HA 3WE6A 1I1RA 4UAOC 3T3MF 4PTUA 1K6QL 2XZAH 3DVGB 1ONQA 5DS8B 1G7PA 3QDMD 2AERT 4P2OA 2VWEE 1CR9H 2P8MB 2BVUA 5JXAH 4WFFE 1WWCA 1MI5A 2VLJA 4HXAH 3CMOL 1OCWH 2VXQL 1CE6B 4PY7A 1DL7L 1J12A 4CMHB 2Y25A 3BSZH 3SDXA 3EZJB 1FG2B 2WLYA 2EE9A 4D0DA 2EE6A 3RVTD 1G7QB 4FXKA 3BOVA 1IBGH 2NX5D 4JO1H 5DD0L 3S35X 4Z7UF 1AY1H 4NUJA 5D6CB 2DL9A 2JCCF 4RDQF 1MAJA 4RWYH 3WHE0 3BWAB 4YZFF 2A2QT 2V2XB 1TTFA 1B88A 2V9RA 2WIMA 2CK2A 3MMEB 3K8MA 1OTSC 5GRXG 5EN2A 4ZOEA 4HUMB 2PW1B 4G8EA 3ARQA 5K9JH 4HH9B 2NR6C 4KDTC 4RIRA 3VJ6B 4I4WB 3GHEH 1KJ3L 2YD5A 5BOZG 2PKDA 1EHLH 3AS3A 4OZFG 4FQJH 2HN7A 3CXHK 4OZGF 4P2OD 4ZXBC 2CLZA 5D8JL 3UTZB 4F37F 5CZVL 1BJMA 4Z7OF 2QQNL 3MRLB 1MI5D 4J23A 2IJ0C 4U7MA 4NJ9L 1RZ8A 2MKWA 3WFCH 2Q7YB 4QRRB 2NPLX 4LHUB 5DEFA 4PRHD 4MJ2A 2GJZA 5EOQL 4X7EC 4PP1C 1EBPA 3RDTC 2AJYL 2PNDA 4D3CL 4MJID 1ZVSB 5C07A 5T3ZE 2DQJH 2PTTA 2E7LA 4K94H 1JGEA 3BQUC 5DMGD 3RX5A 4X9HA 1ORSA 1A7NH 1BQSA 2NY0C 4S11A 4ZFOA 4N90D 3P4OB 3LKNA 2BRRH 3ROLB 3QG7H 4HC1L 5EC1A 1HSAB 5KSAA 1OP5K 1CICA 3RTQA 3TBTA 2NLJA 5J6GB 3C09C 4KHXH 3WNLA 1MHPL 4UT7H 3RWGA 3TIEB 3PABB 5IHLB 4P46D 2HMID 4WHDA 5IVXF 5BJTA 3NPSB 1NGPL 1S7SB 1NQBA 1EGJA 2VLRE 1JPTH 4LSUL 1XR9A 2BSED 4K3HA 3B5TA 1C1EH 3WXWL 3D3VB 2VN4A 5DO2D 4Y19A 1I8MB 2P8LA 1OWWA 2AXHA 5GGUB 5GGQH 1IFHL 2VWEC 2MTPA 1J0JA 4NN6C 4AENB 1I3RB 3QFDA 2DQEL 5DJXB 4HAGA 3V5HA 3SKNB 3TBVB 2JK5A 4Y8AA 1S9VB 2X10A 3KGRA 1RZFH 3MRCA 3NVQA 2DMCA 1QFWH 1F97A 1IAKA 1T3FB 5GS3A 5CCKL 1WFNA 3KYNA 4PJ7F 4MNHB 2HTKC 1HDMA 5KVDL 1DQJB 4E0RB 1G7MA 2E5EA 2J4WL 4M7ZB 5MEQA 3MRJA 3FCTB 4J7RA 4P2QA 5L2JA 4Y4KC 5HDBF 4QRQA 3S6CA 4YHNB 2JJSC 5C86A 4U1KB 3EGSB 1UWEH 2AQ2A 4E42B 2VL5A 5FGSA 4NT6A 4P23A 3S36X 3T0WA 1UYWL 1BEYH 1DLHA 2W65B 3I6GB 2EE2A 4X7SL 4Q58C 2YOCA 1BVZA 1CICD 3G5ZA 2BOCB 5BMFH 1P5UA 1QTYT 5GJSL 3FHAA 1IAOA 1AC6A 3CUPB 1VERA 3PIQB 5MHSD 5T1KD 4ZUSA 1X4XA 3ARBB 5CBEA 1B4RA 1LDSA 3RVVC 4KUZL 3GSNH 2EEDA 3VI4F 1KTDB 3LDBC 3MACH 2R15A 4FZEL 4JKMA 4Z7WA 3BPOC 4Y19D 4WFED 4XP4L 2XZQL 1S5IL 5F9DC 3VXNB 4XCCH 3LN4A 4O2FB 1J0IA 3VFGH 4YHYC 2HVJA 5ADOL 3W11D 1QBLL 2OP4L 3WFEH 4XWGH 5DFVD 1TZHA 3CX2A 1E6JL 1MCKA 2AJUH 2VITA 4IOFD 3DHMA 1BM3H 5I8KH 2MWCA 2VB5A 2EO1A 4DUXA 4IRSA 4I8DA 1N8ZA 4RGOH 3TH2T 4L5FL 2FEDC 4ONFH 5FB8B 3UXFA 1SJVA 3G9AB 2FX8L 2CUIA 1WZLA 5CINH 4AMKL 5IK3B 3OZ9L 4B41A 3DPBA 4YHKH 3Q6GL 4KWUA 3F8UB 4NPYA 4WWKA 4L29A 4PJDA 1D5XB 3QIWB 1ZVYA 4JHWL 3P4MB 3BKYL 4JO3L 4M4RA 4JFXA 3N1QC 4PJEE 1EJOL 1WAAF 1YN7A 4RAVB 4WW2C 4A2MA 3Q6FA 4YC2B 5I66B 4UIKH 1LE5B 3IDNB 3SKJH 4NUGH 1U8HB 1FL6A 1FORH 3I2CH 4PJ8D 3WN5C 4BM7A 4AT6A 3V6BR 3GSNB 1LD9A 1KPRA 3B5HA 4K7PH 5J57B 3GMNA 5C0AB 1R3JB 1EDQA 3LS5L 2Z92B 4QT5A 3U0WH 1BIIB 1MEXH 2XPGA 5ICYA 2FECL 3LVEA 1KLFA 3UDWA 4WHCA 2AXFB 3C2AH 1AFVH 3W81A 2NMSA 1UXWB 3LEYL 1FNLA 1CF8H 1FAIL 2PR4L 3V6ZB 3HRZA 5FYLL 4P57B 4I5BA 4NNYA 2PW2B 2R1WA 2YZ8A 5D2LA 3G6JF 5HPMB 4Q7DA 5ERWB 4M03A 2FJGB 1DSFH 1WF5A 2X44D 5HD8C 1CN4A 4PRAA 2F74A 4P4KD 2DJ4A 1MCLA 3EDJA 3FB7A 5A16B 4KQ4L 1OSPH 1LEIA 2YR3A 4AL8H 2R2CA 3QPXL 2ZNWA 2WK2A 1J88A 1MFEL 4KZDL 4U4BA 4LEXL 5J9PA 4M6OL 3FN9A 5TE7H 3TGXA 1IAMA 1U58B 3E1F1 3MPCA 1M05A 4UZGA 2VR9A 3D85A 2DIAA 1TJIL 3TT3H 1VFAB 2ADIA 2FATL 1UZ8B 3QR2A 4HULB 2X40A 1OGAB 1UWXK 3A6BH 4BH7B 1OP3H 1YMMD 4PRIA 5CKGA 3QI9C 5M95B 4OZ4A 4HG4K 4L1HA 4MDIA 2NW2B 1Z9LA 3S8WA 3PWJB 3P30H 5E9DB 3WJJA 5CILL 3S96B 1Q8MA 4YBQC 1S5HA 3EZ8A 5DT1H 2VH5L 4HKBA 1I8LA 4NBXB 5FAAA 4D0BB 3WKML 4QXTB 5I19H 3R1GL 4RNRA 4XCNB 3RL1A 1M6OB 25C8H 3ZHLA 4R2GD 2DM2A 4ZXBD 3GO1H 1A6VL 3DYOA 3MBEA 1ADQA 5F9OH 1N0XH 2BRQA 4ZAKD 2GJ6E 2HYMA 3GMMA 4L3CA 5C0BE 3UC0H 3QAZB 5KZCD 4P59H 4PGJA 4PJBB 3S35H 4OZIB 2IPKA 4LAQH 2QSVA 4XC1H 5K9QG 3TN0B 2RCSL 2J8OA 5T1LB 5DC4B 2AJSL 3K3QA 4I3RH 3VXSA 3KPTA 3RDTD 1KCVL 1A8JH 1WBZA 4NO3A 1QBMH 4XAKE 1EO5A 1ZSDA 3MXWH 1DEDA 4HW6A 3HUJA 4PJIF 1KSRA 2VDKH 5BV7L 3QXVA 2NXYD 3HNVH 4RGNC 3QCTL 2DYPA 1SQ2N 4HJ0D 2ZCHH 3QRGL 4U0RB 2HRLA 4Q9RH 1CFSA 2GUOA 1TQCB 3L3DB 5E2TL 1F42A 1I9EA 5DUMH 5IKCA 4MA7H 1NFDB 3CFBB 4YXKH 3LEXA 4JZJB 3EJZC 4NNPH 1V3JA 4HJJH 5D1QD 4CKVX 2PUQT 4YAQA 3FT2B 5DEGB 4OI9A 4RRPG 1BFVH 1RVFL 3PE9A 2P8PA 3LD8B 4LU5L 1XAUA 1ZGLA 4X9BA 5EUOF 4GO6B 1HH9B 4HV8B 2HG5A 3IDXH 4O00A 3JWDL 3MBED 4MJ6B 2HT4C 5D1ZC 3HR5A 2OI9B 5CS7A 1DQMH 2EE3A 4WU7A 4N8VB 1R3HA 4GXVH 1HQRA 3BJ91 1FVCB 3QWQB 1XF5B 3VXSD 1FNSH 4WEUD 1MOEA 4EKXA 4YHLH 5I71C 1ZT7B 1NPUA 3M17A 2O5YH 3U7WH 1B3JA 3BIAX 3MLZL 1CGSH 1BAFH 2C1PB 4QLRA 4YDKH 5DJAA 4AM0B 2IANE 1AXTL 2O5XH 1LE9A 4Z7QF 1I85A 3FQWA 3DI3B 1WBXB 4LLWA 2NCMA 2MCG1 1PX3A 1WVZA 5EU3A 4TSAL 4GH7B 2XKUA 3O4LB 4N0CC 5J56B 5IB1A 2X4QB 3QUYA 5FFLA 5FDWB 3MCG1 3DV6A 2CIKB 1T1WB 4PJXE 3MRHA 4WJ5B 1EFXA 5GISL 3QSKB 4WW2F 3F62A 3GB7A 5K33A 1C16B 3GI8L 1ACZA 1ITBB 5J11B 1YDPA 2H3NB 4CNIA 4NKIL 4PG9B 2GAZB 2AEWA 2DDQL 4Z7VE 4GAYB 2R29H 2UY7A 3RGVA 2EDHA 4P5TD 2YPVH 3QH3A 1WV7T 1YEDB 1MAML 1RUKL 1M7XA 3MRMB 1NC4A 3DX9B 5DHYA 1YA5A 5IM7A 4JGMA 4M00A 2CDGA 2P44B 1OARL 3PF2A 2IH1A 2D4FA 4UQ3B 5EDXA 3N9GL 3WL9A 5T3ZD 4AY0A 4ETYA 1KYOJ 3BGFC 4YUEL 1MCPH 4YGVB 3DUUA 1A7OL 5JW4M 1RUPL 4HGMA 1ZLSH 1TETH 3OKYA 4HCRH 4FZ8H 4ODUB 1Y0LA 1GIGL 2OTUB 3LQAC 5IMKA 2A77L 3ARGB 4Q6IC 2VSDA 1GSMA 1R6VA 2Z8SA 3GMPB 1XMWA 2ILLA 3HE6A 1UM6H 4UIMA 5AUMB 1CDUA 1F8TL 3T1WA 5DWUH 4OLXH 2Q87A 3BH9A 3HE7B 3QO1B 5HHOB 2DIBA 1TZGH 1L6XA 1EFXD 3M45A 5ANMA 2HTLD 2VLRD 1FNFA 3AROA 1CE1H 3OWEA 2O93L 4ZUTA 3DROB 1MHCA 3FRUA 5CHNB 2YEZA 1EZVY 4FQXD 5MEPB 2G5BB 1AP2B 2DBJA 4XWOC 2VDRH 1UFUA 3RA7L 3PV6A 3E6FB 4YPGB 5DTFB 3D0VB 3SCMB 5L6YL 1HYSC 4FXGA 2FZ3A 1FPTH 1NC4D 1JJUA 3OL2A 5DA4A 4JFFA 3OXRA 5HGAB 2J8HA 1C12B 3E6HB 3HPJA 3ARFC 1GGCL 3F7PC 3BVNA 5B3NA 3QXTA 4TSBL 1YNLH 3EYFB 1A6UH 1S78D 4APQB 4JFZH 5I73C 5EBLB 5FKAA 4HFWA 1PG7X 3BN9C 4CW1B 3O6FC 4JHAL 5FYKH 2XZZA 5B39B 3OAZH 5BXFA 1MRFH 3ALWA 5CIPA 3OQ3B 2J1KA 3SO5A 2FECI 4NM8L 3MOQA 1I1AA 1T2QL 3KPRE 3BP7A 2YRPA 5D2NA 1YEEL 4KKAD 2J7LA 3EYUL 5SV3A 1HH6A 3VGAC 4XTRC 3RY4A 3NPZB 4WEBH 4OJFL 4JKPH 1SYSB 5DXWA 3U46B 5KS9E 2IBZY 3OG4B 4LPYA 4NRZB 3D0LA 4FQLH 4Q9QL 4UTAH 2X1PA 4LKCB 4ZS6C 3TCLB 1BFOB 3NIDE 1ED3B 1HQ4A 3KPSE 2CMRH 1SMAA 4HIIA 1AD9B 5T5FH 4QOKB 1YNTB 1OP5H 3GSRA 4QNPF 2O5ZL 4CU8A 2CR3A 3T0VA 3C5SB 4X8XA 3S7GA 2XA8L 5KSBE 1ZT4B 5L2KE 4G6JL 3WDHA 1MCSA 4PJAB 4XMPH 3TVMD 3LKOA 1X5JA 1A6WL 3P0YH 5E94A 3QZWB 3SDYH 3PWNA 4KV5E 2P47B 1VFOA 1RZGB 5GSRA 2X6MA 3L7FA 5F1NB 1MPAH 4QHLA 1AQKH 1KENH 4MD5A 2X4PB 3L1OH 4K7FB 1L6ZA 3IDYB 4WO4B 3VCLA 5KW9H 3D39B 4Y5YA 5F89B 5JXEC 1T0MA 1E28A 2VTFA 4PGDB 1DUZA 1I1AD 2OK0H 1X6NA 2DLFL 1VPOH 2NX5B 5CSGA 2W60A 4UTBH 3PWUA 3DECA 3U0PA 5DD6A 2DQDH 1FJ1B 2IQAB 3RRQA 1YEGL 3REVB 1G7JA 2UWEF 43CAA 1S9YB 3IS1X 3O6ML 5K93A 2APWA 4ZDHB 3ZTJG 5FM5O 5I17A 3NCMA 2ICWA 5FGBA 4QCIB 2H1PH 2MHAB 5DC9B 2BOBB 3BAEH 3C2SA 1IAIH 1YYML 4JFQB 3RIFF 1RJYA 1P84K 4XAWH 4FTVA 4PJFA 3WE6B 4LP4A 3EOAA 3ME0A 4TRPL 3VA6A 4KRNA 3K1KC 1JPFA 3TPUA 3HN3A 1EHNA 1ONQB 4WFHE 1G7PB 1I1YA 1MFCH 5F71A 3HB3D 4ZTOL 2BFVL 5TPWL 1F4XH 4P2OB 3WD5H 3WNMA 3G08A 4OM0H 4KMQA 4L4TA 1ZEAL 1I9RH 2DMBA 1MI5B 2VLJB 4D8PA 2E7MA 4OCSH 2P7TA 1PGRB 3T0EA 1SBSL 2HJFB 5BVPH 3FO0L 4PY7B 4U1JA 4X9GA 3FTGA 3SDXB 1F90H 3L3HA 3WIFA 3DGGA 2FX7H 2HKFH 5C08E 3REWB 4D0DB 3MLSH 3ZHDA 4GS7B 3SGJC 4B50A 1J7VR 1NCCL 3H8NA 4PBWD 5C0BA 4ALAH 3HI5H 5DVMA 5HGGS 4QRTA 1RZKH 1IGCH 1ODAA 1C7TA 3VGGA 3B3IA 2I24N 1ZHLA 5J1AA 3HI1B 5HI5D 3QEQE 1FN4A 1WEJL 3P4LA 1LP9F 3T2PA 2XKNB 1M1SA 1T6WA 4YJZL 3OPZH 4M6NH 1S9WA 4KAQH 1TVBA 4X4YA 4JFPA 5EN2B 1NSNH 2WBJA 3H0TA 4LDEB 5ISZE 1E0OB 4G8EB 4XH2A 4WCYH 2OQJA 5DJ8A 5I6XB 2AV1B 1FFPB 5FYLE 2H2PD 4LLDB 1EGJH 3SDAA 3VH8B 4WY7H 3BGAA 5DJ2A 3CFCH 5C6TL 2DBLL 5JOPE 5D5MA 2CLZB 3SJVE 4F9LA 3QDJE 4XX1G 4YXLH 2MCPH 3PJSB 7FABL 1NGZB 2YD8A 1T66C 1T7WA 4XBEH 1NMBH 1DQTA 4YFEA 4M6AA 3ZT6A 2WLZA 4PTTA 2C26A 1I8IA 4ELME 2GJZB 1FGVL 1P1ZA 2GJ6D 4PY8J 5F6IC 1FFQA 5C0BD 1HXMB 1UKSA 2PTTB 5C0RL 5IQ9A 1JGEB 1ORSB 4FP8H 4MZ2A 4P5MA 3HC0A 1TNNA 4HUVA 4XAKD 4ZFOB 2FR4A 3LKNB 1L0XA 2JKXA 2M26A 4F7MB 5GS2D 5EC1B 1OQXA 2NY5H 4ZTPL 3TO2A 3U6RA 4EJ1C 5KSAB 1CICB 3NTCL 3ZL4L 3RTQB 1MCDA 3TBTB 2NLJB 1CGVA 1HINL 5GGTL 3ULVC 3D69A 3ZKMD 1P7HL 3RWGB 2G60H 4HIEA 2DWEA 1N26A 5BJTB 2WM0A 1FE8L 3RWDA 3ALXA 4UDUB 2CLVB 3NCYP 4CMMA 4S1DC 3ZTNL 1WQVT 4HZAA 2FD6H 4Y19B 3LZFH 2P8LB 2VOTA 1BZQK 5JA8B 5BRZE 1UWXH 1MELA 2BDNH 3V5HB 5FO8B 4XPFL 1CLOH 2JK5B 5IROC 5H2BA 3KYMA 4FQPA 3MRCB 5C0CE 3WDJA 1JI1A 1IAKB 4IOIB 3TJHD 3KYNB 1HDMB 4JQIL 4PS4H 3WJLC 5MEQB 3MRJB 4OD3H 5LJYH 4QRQB 1MWAL 3FRPG 3R4DA 4FABL 4WENB 2OS7A 4Z7VF 2VL5B 4I3GA 3V4PL 1X7QA 2EH7L 3QHFL 2NQCA 4CGTA 2HRPL 1QLEH 2DTMH 1DLHB 4Y16C 4TNVF 1MIMH 1DVFC 1C5CH 1NGQL 2VDMH 5JW5A 4OCYH 4HS6B 3RVXC 2W9DH 2IAND 4DKFH 1IAOB 3O6FD 2CH8A 1K85A 2CRMA 2FJHB 2EYTA 2ICES 1S9XA 4ZUSB 4YR6A 2B7DT 3TA3A 2YMXH 5CBEB 2Y06H 2FSEA 1U9KA 2VRAA 4LHQB 3VXSB 1T2JA 4F57L 3MGAA 4OKDA 2RFXA 1ZHNA 3VRIB 4XTRD 4OSUL 4Z7WB 1L4IA 1CWVA 4KJPD 1JNLH 5DRZB 3LN4B 4MCYB 1W8OA 1KCRH 4YDLB 1HEZA 2VDNH 2ZUTA 1U3YA 2P43B 5JDJA 3PQYE 4KU1A 4V1DE 4Q2ZA 2F5AL 3V7AG 1LO0H 3TFKD 5TQ0L 4JY4B 1TZHB 1X5HA 2VITB 3ZDYE 2CK0L 5IFHH 1D9KA 3CVHA 4OGAD 1ZVHA 3QNYA 1XGQA 2I27N 4BQ8A 3T09A 4R4NC 4IRSB 1WUNT 4X8JA 1N8ZB 3H3PH 1A7RH 1UACH 2H32A 3CNKA 1JYVA 1LK2A 4NQDE 5E8DH 5K9OA 4LSTL 4FFVC 3VWJA 4M3KB 4P99A 5C9KA 1NCUA 4O4YL 1XGYL 4NPYB 4J3OC 4WWKB 4L29B 3LQZA 4XP1L 4PJDB 4PPTA 2YUZA 3FO2A 3VRLE 3QNZA 1F3DH 3O3AA 4JFXB 1YN7B 5CD5C 2QV2A 3QUZA 3P9WB 3Q6FB 3F7QA 4M48L 3NZHH 4Z95L 1FL6B 3D9AL 3FOMB 5GHWL 1V8HA 3X3FH 3VDBA 4AT6B 3GSOB 1LD9B 2HT3C 4FNLH 1KPRB 4GMTH 4CJ0A 4POYA 2ZUWA 3GMNB 2VZ3A 3C6LD 5FCUL 1YQ2A 2NY6D 4QT5B 2HJLA 1YMMB 1U6AH 2XPGB 3OKOA 5I9QB 1BPVA 5ICYB 4CBPA 5DD5H 4R4BB 1P4IL 3OKEB 5E1HB 2V9QA 3WLWC 3CC5A 3U30C 1MCQA 3DTXA 5I30H 1T1XA 3HRZB 1YPZF 3KPSA 4OFPA 4I5BB 5DUPL 1EERB 4NNYB 3HMWL 1D9KD 2R1WB 3NCCB 5D2LB 1IGFL 5KTEL 1AGDA 4JCLA 1ADQH 4AJ0A 4NHCL 3BE1H 4R2GB 4KDVA 3FB7B 1QFHA 2VXUL 2DQGL 1YY9C 3EOBA 2AXGA 5ADPL 3WXVL 4HWZB 5KSBA 2F19L 4WV1C 3IJHA 4LVOC 3I85A 1PLGL 2UZIH 3MRKA 3NGBC 2R2HA 5FHAH 1RU9L 1XF2B 2B5IB 1WBYA 2F54E 5DZOA 1KC5L 1M05B 2AEQL 5CLTA 1A14L 1LMKA 4NZTL 3D85B 2NXYB 1U3JA 5DVLA 3KPRD 4O02H 5K59E 2ADIB 2ZOKB 4R0LB 5EO0A 1HWGB 5D96B 1ACYL 4JPWH 2OM5A 4TULL 5LVEA 1CU4L 4OZ4B 3V95A 4MDIB 4Z5RB 1X5XA 3MBXL 2AK4A 4TQEH 2M1KA 5F88A 3LKRA 1BQHG 4MQ7A 4XCEA 5KVFL 1AGBA 1E6OL 2RQ8A 2FCBA 3KPSD 1CLYL 1OAUH 5B38G 1B9ZA 4HKBB 1MJ7L 1D7FA 5D1QB 3CLEH 2NZ9D 1JNNH 4UINH 5I15L 4LCWE 3FMGL 1MUJA 1FC1A 3JUZA 3RL1B 4OIIL 4Y7MA 5F6HI 5F96L 1RULL 3HI6H 1GZPB 5GS1B 1R5IA 3VG9B 3ULVF 3I75A 3BP6B 2YZ1A 3MBEB 1G9NH 5L2KD 1IGIH 1VFBA 4L3CB 2OCFD 5DJ6A 1CBVL 1U8IA 3QCUL 4Z7UA 2ESVE 3U1SL 1NCBH 4G3YH 4GRWE 2JCCA 5K9QI 1GGBH 4OT1L 4BH8B 2A6DA 2BSTA 2QHLA 1QSFE 4JPIB 2VDOL 4MGXA 1WBZB 1JGVL 5EIQA 1ZSDB 4BQCA 4PRBA 3MJ9L 3BKJH 4KVNH 3WIHH 3EOTL 1KCUH 4D9RE 3KHOA 5TDOA 4GSDL 2DYPB 1KG0A 4K9EH 5C0IA 4G43A 4LQFH 3FB5A 1CFSB 3GSVA 3EJYC 4Z9KB 1Q0XL 1QYGH 3FQUA 3QEQA 2AQ1A 3AY4C 1II4E 3RX8A 4GG6A 3IKCA 4NN5C 3PL6C 5IUSA 3BD3A 2D0HA 5FUCE 4TUJA 4HLZG 4P49A 1KBGH 4W4OC 4QXUL 3SGKC 3VXOA 3BJLA 1ZGLB 3V0VA 1JK8A 3NIFE 4UV7L 2GK0A 2Y4SA 4NKOA 4WFHD 4LSSH 1ZE3C 3UZEA 3HR5B 4FG6D 4KTDL 4OZHE 2CD0A 3AXLB 3FT4A 3C87A 4JB9L 3P11H 5FA3A 3QDJA 2VYRE 3QIBA 4G6KH 1I3VA 3JTTA 1R3HB 2JE8A 3LS4H 1U41A 1HQRB 4MSWA 4BFEA 1YEIH 4DVRL 3HPLA 5EZLA 4RMRA 4RFEA 5F8RC 4QY8A 1A7QL 5C08D 3K0WA 4KKCD 3V6OC 1ZT1A 3M17B 5D7JD 1G0XA 3BUTA 3JVGC 3WMSA 1LE9B 1PKQE 3AS1A 4M5YL 4LMQE 1JGUH 1KCSL 1QSZA 1J1XH 4LLWB 5IVXA 3HR6A 5EU3B 5D7IE 3QEQD 1RZ7H 4HMDA 4MA3A 1NCAH 5IB1B 3QUYB 3RY5A 4OCXH 5ISZD 2WQRA 1HHHA 5E7BA 3DV6B 1DTUA 3CFKB 4NKDA 5FYLD 4JN2B 1FV1B 4IJ3C 3KLHD 5GIRB 1EFXB 3BW9B 1A1OB 1DBKH 1DBML 5JOPD 1YDPB 1LNUA 3IJSB 1AD0B 4CNIB 3MREA 2XZAL 2EO9A 3SDDD 3SJVD 2DLIA 2AJZA 3QDJD 3QIBD 4WU5A 4Z8FH 3WHXA 3QH3B 5DMKA 1DLFH 4PLKC 1CR9L 1NC4B 3ZDZF 1AR1C 4G42A 3FO9A 3K4AA 4GBXC 3WFHB 3T0XA 5IM7B 1GOHA 2CDGB 3T2QA 1EA9C 5C0CA 2IH1B 4ZPVA 5FA4B 4Y5XA 3HKFA 4YFLF 3NZ8A 3BSZL 1JF1A 5IHBA 4HKJA 1CXEA 1XIWC 3RVWC 3DUUB 4HWNA 4WUKH 1F4YH 4G7VH 5CIPH 3P4NA 4F37K 4KROC 3QG6A 4LFHD 2VQ1A 4FFVD 3IU4L 4YHPA 1G1CA 1QRKA 1IJ9A 4JO1L 5JLZB 2RBLA 5IMKB 2VJXA 4PUBH 3WS6C 4YWGH 5HGDA 1GC1C 3L6FA 1P4LA 4RWYL 3EUUA 1HZHH 4JFDA 4MMXC 3EDEA 5B4MC 4PD4J 4NOFA 1H5BA 3BH9B 3KLDA 1JPSL 2CGRH 2A6KA 3GI9H 4F58H 5F9AC 4BSWB 4JO4L 3SOBH 5ANMB 5E8EA 5BZDA 3OGCB 3QWRA 1NAKH 3ZKXB 4M1DH 2BVQA 4ZUTB 4YX2H 3PV7A 2YEZB 1J0YA 3A0OA 2HT2D 3GMRA 4FQJL 4P48A 1ZLUK 4ZNEE 3MNVA 4LQ1A 1ZA3A 2YN3A 3WCYA 3PV6B 1IEBA 4LF3B 4FXGB 3H9ZA 1RPQA 2FZ3B 5BRZD 4OZFA 4O58H 4ORZC 2YPLA 1BIHA 4V1DA 1GAFH 1YN6A 3FONA 4DUVA 1JFQL 5C0CD 1DUYA 1HIML 2ADGA 3TVMB 5AD0A 3HPJB 3WO4B 4ERSL 3BVNB 1IKNA 2IFFL 3CGTA 1WIUA 3O8XA 2YKLL 3O81A 1WAAA 4KK9D 5FKAB 3QEHB 2DWDB 4HFWB 5DD3H 2CJUH 5BXFB 4K94L 3QIUD 2KL6A 2OXHA 5CIPB 3IETB 2DD8H 1I1AB 1TCRB 1VENA 2NY1C 2LTQB 3BP7B 3QEUA 5F7KC 1EAPA 3RBGA 1QLRA 4UBDC 1UEYA 3SE8H 1Q1JH 3ROOA 5E5MA 3BRGC 1J05A 3ARTA 1KN2L 3QG7L 4HGWA 3D0LB 4PGCA 2WINA 1J1PH 1HQ4B 1LWRA 4HIIB 4UT7L 2Z0BA 5LGJA 1QA9A 3MV9A 5HHVH 3G6JA 5BO1L 3RUGA 2BP3A 1FNEA 4BJLA 4KDTA 3BISA 3X3GH 2KPNA 3FQRA 1LO4L 1TVHA 3PQYD 3PWLA 1DQLL 4V1DD 4FFWC 3AREC 5GGQL 3CIQA 5FF6A 1J87A 2H26B 1MRCH 1BF2A 1OHQA 4M7JH 5E00A 2JIXA 3FQXA 1B90A 3LKOB 2PF6A 5E94B 3O8XD 1RZFL 3PWNB 2FHCA 1WLHA 3B6SB 4QHLB 4MD5B 4X6DE 5FO9A 3N0PB 3VCLB 4Y5YB 4NQDD 1X5GA 3UJTH 5EUKB 1T0MB 1E28B 1IZKA 1D5MA 4HPYH 2BVTA 4KK5C 4XPAL 3OB0K 2A6JB 4WIQA 4P3CL 2W60B 1UWEL 2EICA 4IRJA 1OGTA 3MCLL 3PWUB 4LPXA 4M7KL 4JJHA 1TMCB 5DD6B 4QRPE 3BQUA 3I6KA 1T22A 5DURD 1KFAL 3BEVB 3JWOH 3V6FA 43CAB 4F80A 3WBDA 2W0LA 2GTWA 2OBGA 3BIBX 1UCBL 2ICWB 3QUMH 4XP6H 3K80A 1HN1A 3IGAB 1A9EA 1I7ZB 4FTVB 4XNUL 4TVPH 1PSKL 1UB5A 3EOAB 3ZO0A 4G8FA 4PP2A 4DN4L 2OZ4L 1E4XL 4YO0B 1WFUA 3B9KC 5GGVY 3QPQD 3VFGL 3QUXD 5D4QA 2JIXD 2A74A 2W9LA 3G08B 4PLJC 4J6RL 4O9HH 1JHKL 2FYYA 4XWGL 3V4VH 4P9HC 1MFBH 5SWZE 4U1JB 2AJUL 3FTGB 1O0VA 1BM3L 2CKNA 3L3HB 3PHSA 2VDQH 3DGGB 3CD4A 3WIFB 3ZE0E 2HAZA 5J12B 1FFNA 2DQHH 4PJIA 2I25N 1MFDH 2GJ6B 3Q5TA 4QHMA 4XVSL 1FIGL 4AH2A 5C0BB 4ONFL 3VXME 4QRTB 4CVXA 5CINL 1ZHBA 3B3IB 2B4CC 5E6IA 2X09A 3VFSA 1GPOH 1ZHLB 4YHKL 5J1AB 1BWWA 4ZFGH 4Y4KA 1FN4B 3L5XL 2F54D 4Y0GA 4M1CD 3RVUD 5HYQA 1TVBB 4X4YB 4JFPB 4ZYKA 3BPNB 3OKMB 3CCHB 2WBJB 3H0TB 5IJKA 1AJ7L 2A83A 2IPTH 3X17A 4ODTH 2OQJB 3QUMB 5DJ8B 3SKJL 4FA8A 3I2CL 3SDAB 4F7PA 5EUOA 2ID5A 3CDGA 3W5NA 5DJ2B 1XFPA 4K7PL 3VDAA 2XY2A 4UOW0 5I1AB 1JN6A 5IMMA 4OF7A 3LAFA 1MEXL 5JPMA 2YA0A 4MXQC 2FJFA 5JW4R 1A4KB 2KDGA 3S98A 2WSKA 1ZK9A 3CMOH 1KJVA 2VXQH 4RZCA 4U1GC 1I8IB 2XN9E 3I02A 5LGKA 3S88L 4NNXA 2C1OA 1B0GB 3B2VH 1N3NA 3NIFF 2XV6B 5DD0H 4Q9BA 2ESVD 3MV8A 3V4UL 2Z8RA 1OSPL 5E6ID 4AL8L 1AKJA 4ORGA 4CN4A 4NQXB 4OAWA 2BXYA 3HC0B 1MCOH 2K9UA 4P5MB 4QO1A 4HUVB 4HUXA 4KDWA 4UV4H 1LO3L 3MUHL 1D5IH 4XPHH 1QSVA 2DF3A 1J5OH 2CR6A 4DGIH 3FB6A 3TO2B 4D9RD 4X5XA 3U6RB 2W59A 1R3KA 2IANB 1MFNA 2RIKA 2I60L 5IEKA 4HIEB 2DWEB 3GBML 2DAVA 1HNGA 3O4OC 4WW2A 5D7IA 3SO3C 4U6YA 3B8SA 4M43H 2NY3B 2R0ZL 4KK8D 2R23A 4J3SA 2J5LC 3FZUD 5CZVH 5D8JH 2P5WE 2ZG3A 1G7IB 3QO0A 3TT1H 5IWLC 3LKQA 4K3GA 5ABDE 4OIAA 3S34L 4NJ9H 3J7HA 1KXQE 4TOYH 1KCLA 5I1LA 1G6VK 3HZYB 1CDBA 3QJFB 5CGYD 4JG0H 5EOQH 4ZSOE 5SX5K 3CVHH 2AJYH 4M6ML 4HUUA 2MQ0A 1UVQA 25C8L 4PIRF 1BVLA 1ITCA 2H32H 4XBPA 1N0XL 2B2XH 4H1LG 3MGTA 1NCDH 4P59L 1L7IH 4WI9A 1FRGH 4XC1L 2BNRA 5EWIL 3OR6A 3R06B 4XPBL 3DV4A 3MLYL 1QBML 3PP4H 1PQZA 2IAMD 4TSCH 3MXWL 4G9FA 2GW5A 2EYTB 4Z7NE 1S9XB 1MHPH 4K8RC 4YR6B 4TUKH 1NGPH 4JRYA 2C3VA 4KRPC 5CSZA 4FQ1L 3U4BL 5E8OB 4LSUH 2RFXB 4I0PA 4Q9RL 4U1NA 1NKOA 2NY4C 3A6CL 3VFRB 1D5BA 3V0AC 2YHGA 1P7KA 1IFHH 3C6LB 5HXMA 2NY6B 2A73A 4KQ3L 4G6AD 4YXKL 4JPVL 2DQEH 2FGWL 1HEZB 2R9HD 2AV7A 1A02N 3QI9A 4NNPL 1JGLL 4HJJL 2Y72A 4HUNB 1BFVL 4X98A 2SEBA 2E6JA 3BRDA 1MQ8A 1LEGA 2GTZA 3BPCA 1D9KB 3CVHB 1EHXA 2IWGA 2R56L 4RRPA 4ZNEA 5A43C 5GPRA 5JOEA 3QNYB 1XGQB 2J4WH 2GHWB 3TCXA 5DFWH 4PRNA 1H3GA 3C8DA 3LCYA 2IG2H 3MLRH 2H32B 4DGYL 3WIIL 1LK2B 5I1GH 2LU4A 2BNRD 2BVOB 4YBLC 2Z35A 1UYWH 3BUYA 5GRUH 4QGTA 4X7SH 5J89A 1A6ZA 1UH3A 4GRLC 2OMBA 3FO2B 1CD0A 3QNZB 2IF7A 3ESVF 3O3AB 1EO8L 3EYOA 5C71A 1B4JH 1V7NL 1A6TA 3QUZB 2ICEA 5DVNA 3S5LG 5ALCH 3KLAA 5EZJA 1BAFL 4KK5D 4KUZH 5GGTA 1V05A 4L4VA 4H8WC 4I0PD 3N1MC 2VR5A 3MZGB 2XZQH 1S5IH 2HVKB 5EOCJ 3MYZA 3MFGB 2FHFA 3GK8H 2HJLB 3FFDA 3OKOB 5ADOH 4HIXH 3G04A 1QBLH 5KS9B 4DTGH 3MJ8A 2OP4H 3RY6A 3CC5B 3OKNA 3QCVH 1T7YA 3DTXB 1RZIA 4MA8L 4LSDA 1T1XB 4O2CB 4QRRE 3KPSB 4HWUA 1S3KH 1VHPA 4MYWB 3BZEB 1AGDB 3X12B 3VMNA 4L5FH 3CXDH 4WNQA 3EOBB 4AMKH 2AXGB 3OZ9H 4UNVA 5KSBB 1MWAA 4ACPA 1FVEB 4KY1H 4M62L 3Q6GH 5D1ZA 3INUL 3IJHB 3DMMD 2VDPH 4WEMB 4JHWH 4LGPB 3PWVA 3HNTH 5JW3H 2CIIA 1EJOH 1IKFL 2F8XC 5AYUL 2UWEA 5HY9A 1NBZA 3OB8A 4M7LL 1WBYB 2LQRA 3AU1A 4HIHB 3CXHJ 4S1RL 3QYCA 1ZWIA 5E08L 4QRSA 3RHWF 3ZT5A 4JRXE 5EOCL 3TF7C 1IEAA 4HPOL 5EO0B 1LQSR 1INEL 1PY4A 1XF3B 2D31A 2X4SA 3LS5H 3VFVB 4QRPA 1VESA 2EDRA 3D3VE 3SE3C 3KAAA 2CO7B 4IMLB 4H20H 5F88B 2Z4QA 3LKRB 1BZ9A 4MQ7B 4OLXL 3F58L 3LEYH 4XCEB 1S7WA 1AGBB 3NOIA 1FAIH 4YFLI 32C2B 1TZGL 4R90H 5EB9A 1MUJB 1QHOA 4CMHC 1EVUA 1HILA 4LVEA 3LPGA 3IRPX 1S7TA 3I75B 4U1HA 1WIOA 4MXQD 3ARZA 1PY9A 4H0HB 2BERA 2DM4A 2BY0A 2XFXA 5DJ6B 1L7TH 4JZOB 1CLZL 3GFUA 4I2XE 4KZDH 4L1DA 1PAMA 5GS0C 4LEXH 1ZLUH 1MHHA 3JWNC 3OKKA 1YJDC 4M6OH 3FQTA 5CD3A 2BSTB 1HHKB 3RZCD 2P5EA 2JJTC 3S37X 5C08B 2EDQA 4JFZL 4WUUE 2IGFL 4YQXL 5AG8A 5D7JB 1V3KA 2VN7A 3DGCR 5FYKL 2K7PA 1MRFL 4G43B 2APXA 3NIGF 5INDA 3FB5B 4QRPD 4ELKA 3GSVB 4RMTA 5GQBA 1KT2A 3SN6N 3FQUB 3QEQB 4GG6B 3IKCB 4RMUA 4LSQL 5CILH 3DVFA 3WEXA 2VH5H 1WC7A 5E5UB 4TUJB 1O5DT 2FO1A 4QRUA 3WKMH 3P77A 4DOHB 2J88H 3R1GH 4UTAL 3VXOB 1ZS8A 2WWMC 3Q3GB 2CMRL 1BMGA 1JK8B 3C9NA 4PBXA 3V0VB 1ND0A 2GK0B 4Y89A 5T5FL 5IOPA 3CSYA 3S9DB 1A6VH 4XRCA 4MA1B 4XC3L 4XI5C 3DIFB 2UYLA 3FT4B 2LVCA 5EZOL 5LXGL 4DGVL 5FA3B 3MODL 2ZCLL 3QDJB 4JQXC 3QIBB 3JTTB 4DFIA 5FOJA 5ILTL 5SWZD 4MSWB 2EYSA 2PYFB 2C3HA 5IJVB 3HPLB 5EZLB 1T03L 3UAJC 4RFEB 1BBDL 4ELMB 4TTDD 2DI7A 5F7HA 3TPKA 1GGYA 4LVHB 3VGEA 1SMOA 3D25A 3L1OL 3QCTH 3VXMD 3ARFA 1VEMA 4WRLA 3SDCD 3MV7A 2E8YA 2NTFA 3QRGH 1DZBA 1UEMA 3TO4C 4EN3A 3NPSC 1VPOL 4MA3B 5IT2L 5CJXA 2LFGA 4X6CF 3EFDL 1A0QH 4GAGL 3OB0H 3WNKA 1CTOA 5I76A 1JYXA 1HHHB 3WO3B 1AXIB 4NJAH 4XXCC 4NKDB 4B53A 3EAKA 4JLRA 4XVJL 1CCZA 3BAEL 3ARYA 3IDMA 1X5FA 3JWDH 5I1EL 4JM2A 5HVFB 5HHNA 4ZFZA 2P5WA 4R3SB 2AJZB 4M7ZC 2EXYD 4AG4L 5ICZB 4OZFH 3T3PF 1QSEA 1MFCL 1G9MC 3KNBA 4K94C 3BH8A 1F4XL 4OM0L 1QP1A 5BZWA 4G42B 3FO9B 4OCSL 2XN9D 3HTLX 2D2OA 2Q3ZA 4DQOH 5BVPL 4YDIL 4OLUH 5C0CB 5JOFA 4Y5XB 3MLZH 3BEWA 5DHXB 1T5WA 3LY6A 1JF1B 2XT1B 2QHRL 3IJYA 4HKJB 1FAKT 1AXTH 2FX7L 4PJCF 4HH8A 1MFAL 4NQSA 4XNZB 5BQ7A 3P4NB 4EN3D 3QG6B 5F7WC 4YHPB 2VQ1B 5K9KB 1YY8A 4ALAL 3UTTA 4TSAH 2M8XA 1DBAL 5C0FB 5JZ7C 1UQSB 4ZFOL 5HGDB 4XNYL 5FM5M 3QQ9D 2NY2D 1FP5A 5HVWA 2VR4A 4JFDB 1JNJA 5CJQL 3LPWA 1KNOB 1JMXA 1H5BB 5E9DE 3OPZL 2XNAA 4M6NL 2RJMA 1IQWH 4RFOH 4RBPK 5GISH 5HVGB 4L8BA 2OJEA 4JO2L 2PO6C 1U8PA 3RI5F 2I9TA 5C0GA 3GI8H 3ZZ1A 3HZMB 1Z9SA 4JM2D 1WICA 2BVQB 2HH0L 3LHPL 3O3BB 4NKIH 2P5WD 4GJTB 3MNWA 2DDQH 2NXZD 3CFCL 3MNVB 5C0EB 1ZA3B 4ODXA 1L0YA 1IEBB 1MAMH 3OBAA 4PJBE 4OZIE 4OZFB 4M4PA 2HJKA 2YPLB 4V1DB 2MCPL 2R8SH 1YN6B 2XA3A 2YC1A 3EKCA 3FONB 1T04A 2XXCB 5M7QA 1FYTA 4HS3A 4C56E 1OARH 5T33L 3RFZC 2ADGB 5AD0B 3QIWC 3N9GH 3VE0A 3VGBA 3O8XB 1NC2A 4HG4J 1Z0MA 4YC2C 1RUPH 1SVCP 3L3OA 4F8TA 1TLKA 1XZ0A 5IW1B 1GIGH 1LK3L 2A77H 2WZPD 1AQDA 4I77L 4GKSA 3QEUB 5ENWA 2X05A 4LEOA 3I9GH 1HSBB 5ITFA 1EAJA 1NFDE 3P3YA 2BNQA 3JV6A 4QEGA 5DURB 3HG1A 1J05B 4HGWB 3UTSE 2NY5L 2VUYA 4RMQA 5FYJU 2N4IA 4PYGA 2WINB 4B7IA 1XCQA 1OAYL 3CH8A 2D03H 1YPZA 1OD7A 1LO2L 3U2SA 5LGJB 4KKBC 5CP7A 2IALA 1QA9B 5IB4A 3BZDA 3MV9B 3OR7B 3U83A 1A4JA 1VGKA 1H3UA 3RUGB 3RA7H 1FNEB 4TNVK 1J0KA 2VXSL 1NKRA 2FD6L 5SX4H 1YC8A 1GGIL 4ESKA 4LSVL 1NGXA 3PWLB 1F02I 3U4EA 1O7VA 5DDHA 5HHXH 3QUXB 1T1ZA 1IT9L 1UXSA 2JIXB 2BDNL 1X5ZA 2ZUXA 4TSBH 5I74B 5JW4N 2PTUA 5CJ8A 2Y36H 5BOPA 1NC2D 5EBWA 1RJLA 3BZFA 3NFPA 4JHAH 4NC1C 5FO9B 5C2BL 4PS4L 1D5MB 1DANT 4NM8H 4OD3L 5SX5H 4X7FC 4GRWH 5F8QC 2CLRA 2QR0B 4EEEA 4Z78A 1OAQL 5GS0D 5EU7C 1YEEH 4MNGA 3EYUH 4IRJB 1OGTB 1OTTC 3GJFA 2IH3A 2UVEA 4Q0XL 4OJFH 1KV3A 1T22B 3FRPA 3V6FB 3ZYJA 5F7EL 1NMAH 4OCYL 4Q9QH 2W9DL 1F3DJ 4JRXA 1MVUB 4MD4B 5JIPA 2PXYA 3KG5A 3C60A 4LSRH 1UB5B 3PGCA 2O5ZH 3C09B 2UY6A 5TFSH 4G8FB 4PP2B 3MA9L 2XA8H 4ZUUA 3SEPA 3QAZC 3ISWA 4G6JH 2A74B 2VDNL 4QRRD 1FVDB 1A6WH 5CUSH 3RPKA 1NANI 3TN0C 1RAMA 4JQVC 3ULUL 2YPKB 2FYYB 1LO0L 2EZ0D 3OMZA 1CD1A 4Z76B 1UC6A 3H2WA 1WIPA 2XI9A 1U2CA 2L7UA 4WFGD 2HLAA 3MJ7B 4XI5D 4P9ML 1ZKAA 5IFHL 3ZE1E 3V9FA 5IROA 1FFNB 3V5DA 4AH2B 4FMFA 4QHMB 1PG7W 1AR2A 3E0GA 5KN5A 2DLFH 5JDSA 4AQOA 4CVXB 2VABA 4U0RC 5HDQH 5E8DL 4I2XA 1ZTXH 3L3GA 1TQCC 1ZHBB 3ES6A 4GRWB 5E6IB 2NZIA 4RA3A 1JTTA 1JWSA 3ARDD 1YEGH 3BZ4A 1Z6JT 3MUGA 4L3EE 2EC9U 3O6MH 3L5JA 1BVKA 4JZJC 4LCCB 4ZYKB 2NYYC 4JRXD 2A83B 1YYMH 3LD8C 5I0ZA 5D7LA 4X6FB 2ED9A 1X4YA 2PXYD 3C60D 1D5ZA 3KPOA 1RSFA 5EUOB 4TRPH 3CDGB 2H9GA 4WW1A 3D3VD 4WI2A 3UO1L 4GMTL 1S7XA 4NO2B 5IMMB 1MJUH 2OI9C 4ZQKA 5HYJE 2ZUSA 4ZTOH 5AG9A 5TPWH 5JPMB 2FJFB 1VFMA 2G9HB 1ZEAH 5E8NA 1SBSH 1LO5A 1KJVB 1SM3L 1VA9A 2RHEA 3FO0H 1WCQA 3FAXA 1CS6A 5ESVB 2VDLL 1SBBA 5HYFA 3GJFK 4XHJC 3I02B 3MJ6A 4NQVA 4Y8DC 4NNXB 5DSCA 2C1OB 1NCCH 4OF8A 1N3NB 3Q1SL 2HFEB 3BE1L 3UBXB 4NQEA 2F5BL 4OFYA 3H6JA 2H2SC 2Z93A 4XT1C 1AKJB 4ORGB 3MLPA 4OAWB 1FL5A 3CZFA 4EDXA 1WEJH 4TYUA 2D0FA 1B2WL 4YPJA 5FHAL 1JZ2A 5I75B 4WUUD 3FB6B 3ARBD 4X5XB 1R3KB 5TF1L 3GSQA 2FWOB 15C8L 4Y1AA 5I1DA 4NYLA 5EFIA 4JFEA 4F7TB 3ZYOA 5IEKB 1TJGL 4PY8I 3WLBB 4O02L 5D7IB 4QWWC 4U6YB 5C6TH 5J11C 5MERA 5SWSA 2DBLH 3RZWA 3DOSA 2NY7L 2R23B 4FFYL 2W0KA 4JPWL 2R2BB 2BSRA 2ORBL 3QO0B 3LKQB 4N8VG 5GZOC 2UZXB 7FABH 5GGRY 1U8OB 4PJAE 1I1FA 5I1LB 2R4SL 1QR4A 2X41A 1CDCA 4M8QA 5HYSG 1KPVA 5FV2A 2JJUA 3E3QC 1BQHA 4W68A 4HUUB 1GJIA 4RA0C 5B38A 1UVQB 1AO7A 2LABA 1BVLB 3A67L 4XMLL 5C0RH 2JJVA 3D39E 3U4AA 1KTLB 4OFYD 1G9NL 4QXWA 5FYKE 3D2UA 3OTTA 3ARGC 1NCBL 1OAKL 2QKIA 4JZNB 5EO9B 2BNRB 2GFBA 2ZSVA 4I0CC 5F7FA 2C7UA 3OR6B 35C8L 2BNUA 3HS0A 4ZTPH 1C5DA 4WV1A 5L0QC 3HE7C 4KJYB 3B83A 4G9FB 4FQCL 5GGTH 5TF0A 2FLRT 2FO4A 3CDYA 3DETC 3T1FB 1G7HA 4G6MH 2VLLB 4ZODA 1FE8H 1EBAA 2C3VB 5CSZB 5DGQA 4K9EL 3IXTB 1J10A 1FZOB 4I0PB 5FGCE 2D7TH 4U1NB 5I1JH 1NEZG 5GGSY 3ZTNH 1JTPA 4X6BB 4NRXA 4R96A 1QFOA 3SCMC 2V17H 1P7KB 5EO1A 2A73B 3O6KL 2VLME 2R39A 4RSVA 1CDJA 2AV7B 3WNPA 3DARA 1H3WM 3CFJA 4XPFH 4Z6AT 2LV4A 5IBLC 2VLJE 4QF1A 3WDIA 5C0JA 2QQKL 2LU3A 4M5ZL 4LLUA 2SEBB 4OFDA 4HXBL 3C5JB 4QTIL 5ICXA 4XBGA 2YN5A 1U95A 3BPCB 4JANA 2X1QA 1HCFX 3ZKQD 1UZ6E 1X3DA 3AM8C 4PRNB 1ZHKA 3D2UD 1MWAH 3TBYA 2XQYG 3VWKA 4G6KL 3KYAA 3QHFH 2EH7H 2Z35B 3BUYB 4L8CA 2A6IA 5A3ID 3DMMB 1P84J 3HFML 4PJBF 3BI9X 5JPNB 3EYOB 1HKLL 3FHQA 4DKEH 2W38A 1A6TB 1UGNA 4LDLB 2ICEB 1K8IB 1Y6NR 4OSUH 4X7DC 1RZ7L 1GXEA 1NCAL 2YBRB 5E9DD 3DBXA 3FFDB 1UM4L 4A6YL 3OKNB 1RIHL 5TQ0H 1RZIB 8FABA 2CKBL 2J12B 2YD7A 3PL6A 1S7RB 2V7HA 3RQ3A 4ZO8A 5DVKA 5AAWA 3DXAE 4WHYG 1JRHI 5C07E 4GLRH 2ZWLT 3O11B 2OR9L 4IEFB 3RVTC 4BA8A 4JDTL 3G5YA 2Q7NA 1MWAB 4I9WE 1X5AA 4C56D 4O4YH 2HLFD 5T1LD 1XGYH 3ILPA 4XP1H 2BSSB 3PWVB 4CDHA 3RNQA 1F45A 2EIZA 5DR5L 2YXFA 3RWEA 1KPUA 5HY9B 1NBZB 4Z95H 4X6DB 3AU1B 4MB5A 4ZO9A 5GRZA 1J1OL 3EO1A 1PX4A 1QRNE 1F4YL 4G7VL 4QRSB 5MHSE 3W9DB 1EXUA 4G8IA 4JPKL 1IEAB 1CL7L 4JKLA 2X4SB 3JVGA 2BCKA 4QRPB 1RIUL 4WDIB 4Y19E 3UTSD 1HZHL 2AJVH 2C3XA 2XRAH 1P4IH 1U42A 2Z4QB 4P2OC 5BS0A 1BZ9B 1S7WB 5JQHC 2ZOLA 2CGRL 3MCKA 5DUPH 5IR1A 4POZD 3HMWH 2C4FT 4LRIC 2ICWJ 1IGFH 4NKMA 4RWHA 5KTEH 4M1DL 1S7TB 3MRRA 4EUPH 4U1HB 3O2VL 2EDBA 4J3UA 2VXUH 4GS7C 2DQGH 3MLTA 4RMSA 4P2QE 5ADPH 1KJ2L 2F19H 2XFXB 4G5ZH 3BPLB 4MAYA 5DMGC 4O58L 4WTXA 3QDGA 4ONHA 1QHPA 5T1DL 4IDLA 3OKKB 4L9LC 4NP4L 5SWZB 3FQTB 5KVMC 2MPAL 5CD3B 2P5EB 1IM9D 1XGPA 1KC5H 4HMCA 1BOGA 2AEQH 3CJJA 1A14H 4XP5H 4NZTH 4GW5A 2JELL 3BMVA 5I6XC 1MY7A 5DD3L 2ZZUT 4S0SD 3VXMB 2CJUL 5JW4Q 2HMIC 4P46C 5INDB 2EXWC 1CU4H 1XIWA 1KT2B 4Z7WE 3RWCA 4OV5B 2ATPA 3MBXH 1DR9A 4L3EA 5HJ3A 2X7LA 3SE8L 3G6DH 3VXUA 4J12A 1IL1A 5DO2C 4C4KT 1Q1JL 3WS6A 3QHTC 2XTJD 1CLYH 1WC7B 4KXZI 4OD2A 5I8CA 3MRQA 4QRUB 1N2RA 3S3PA 3P77B 5I15H 1SEQH 3FMGH 3O3DB 2P45B 3ZTJH 1ZS8B 4OIIH 5F96H 3C9NB 1RULH 5HHME 4YE4L 1ND0B 3EYQD 5IOPB 5HHVL 4XRCB 1T5XB 5IHUL 1RK1A 4EUPB 5HYJA 4Y4HA 5SV4A 4WTWA 1CBVH 4MAYD 1NAMA 3QCUH 2D7NA 4N0UA 3SGDI 1CFTA 1RZKC 2FEEI 5I1CH 4J8RA 1JE6A 4M61A 1JGVH 4NQCA 4PJDE 2EH8H 4DVBA 5DJZA 1H3PL 3EOTH 1CICC 5HPOA 2W07A 3D25B 4M8VA 4YFDB 1FLTX 4U6VL 3EO9L 4RISL 4HBCL 3VH8G 5ELIA 4EN3B 2WBKA 5I73B 4MQXD 3MGOA 1K5NA 4Y5VA 4L3ED 1A2YA 2Y07L 3SBWC 1YEJL 3GKWL 3HMXA 4I18A 3VFUB 4F7EA 1S7QB 3HE7D 2NY2B 1ZANH 1E4KC 3UZVB 1IQDB 5DMYA 5I76B 2WAHA 3KYOA 1KN4H 5T3XL 4KMTL 4MXWL 5D1XD 1DN2A 4RAUA 3W11C 1TPXB 4XP6L 1N59B 1AIFB 4JLRB 3ULUE 5FO7A 4UV7H 5DFVC 3IDMB 4K7PX 2GITA 1AE6L 4IOFC 2ARWA 4JM2B 3KYKH 4KTDH 5HYJD 5HHNB 4Y4HD 2Z31A 2V5YA 4XVTL 1EFQA 2P5WB 4YEFA 1QSEB 4GG8A 2Z91A 3BH8B 5ESAA 5LG1A 2DKUA 4Y4FA 5BZWB 4DVRH 2CSPA 4JN1L 1U3ZA 1YMHA 4ZD3L 3T2OA 1A7QH 3VDCA 4APQD 5JOFB 1T21A 2OMNA 3AREA 1FYHB 4PJAF 1XGRA 3BEWB 3S4SG 3JXAA 2VDQL 3IJYB 6FABL 5HDOA 2V2WA 4M5YH 1KCSH 4NQSB 5C9JA 1MFDL 4GFTB 1KIUA 1YY8B 4OGYL 1WWAX 4IM8A 4HJGA 4U2ZA 1NL0L 3I50L 3M8OH 4PRIE 2Q86B 1GPOL 1X5YA 4MJ5A 1EHAA 5JTWA 4ZFGL 1JV5A 1W0YT 1Q94B 2RB8A 2WANA 2P48B 4YDLC 2XNAB 4XP9H 1RJZA 4ODTL 1RZJL 4L8BB 3B9EA 5F7MC 4TUOA 1FGNH 4LCIL 2I9TB 1DBMH 3MLUL 2Z31D 4OUUA 2X4UB 2IC2A 2Y6SD 3IFLH 4KKLD 3MNWB 1XF4B 4IRSC 2Y5EA 1BLNA 3H3BC 4MD0A 4GQ9L 1H0DA 4P4KC 1BGXL 1P6AB 4Y4FD 5FEBA 1N6QL 3MA7A 2YC1B 3E8UH 1T04B 1UA6L 1NJ9A 4RMWA 1FYTB 3G9VA 3IAQA 3B9KA 4WWKC 5TE4L 1K3IA 1MJ8H 3VXSE 4YLQT 4LK4A 3VE0B 1T4KA 4Z0BH 1NH6A 4WO4D 3MRDA 4NZRL 1RD6A 1UADC 2GJJA 3D39D 5EIIA 1NC2B 3GSUA 4OLWH 4JJ5A 4JY5L 5JHLL 3BP4A 1I9JH 2PETA 3HUJE 5MP6L 1KULA 3B2VL 3GEWB 3L3OB 3IU4H 2MSPA 2YSSA 5FYKD 3BKCH 1XZ0B 2B1AH 3SDXF 3VG0L 3UTQB 5FXCH 2R0KH 4RFNB 3QJHA 3BP5A 1AQDB 5HYIA 4GKSB 2M2DA 4PFEA 4PJ5A 4I0KA 1CXLA 2VL4A 2WQ8A 5ENWB 3P2TA 4EI5A 1MCOL 4LEOB 4BZ2L 5ITFB 4UV4L 4P2YA 1DE4A 2BNQB 1D5IL 1E4JA 1GZQA 3A6OA 5C1MB 5L8JB 1RUML 4XPHL 3UDWC 1J5OL 3HG1B 1QUNA 1JPSH 4DGIL 4LCUA 3QXUA 1S7UA 5HI4D 4JO4H 5CJBA 3L5WA 5IIEA 4BK4A 1YPZB 4JREC 1RK0A 3U2SB 5CP7B 2IALB 1U8LA 5IB4B 4GW1A 4M9OA 1A4JB 1QFWI 4NDMA 1VGKB 1GHFL 4M43L 4CJ1A 1K4DA 3MTRA 4R2GC 2VLMD 4PJ9A 1NMCB 3TBWA 3DYPA 3TT1L 2I5YL 1NGXB 2KBGA 4ZAKC 2YRZA 2VLJD 4PJGE 1YEHL 3U4EB 1JFQH 5DDHB 1V7MH 1HIMH 4TOYL 1UXSB 4ERSH 3ORJA 4HDIA 4YNYA 2IFFH 2GKIA 4JG0L 2YKLH 3CVHL 2B5IC 4KTYA 3VD5A 1SVZA 2ZUYA 3NFNA 4S10A 1RJLB 5JQ6L 3DXAA 1CL7I 3BZFB 3NFPB 4BFGA 5JA9A 4JFHE 4AIZA 3S36L 2NXYC 1OTUD 2X4NA 2D9QB 2B2XL 2X70A 2CXGA 2CLRB 1Q9LA 4R0LC 4EI5D 1NCDL 4MNGB 4HJ0C 5D96C 1L7IL 2IH3B 3E2HB 4PJHF 1FRGL 3RKDD 3RIAF 4JG1L 2ATKA 4H1LA 1IGTA 3ARDB 1KN2H 1JHTA 2DMKA 4PG2C 3WJJC 3Q48A 3PP4L 4TSCL 3VRJA 4G8GA 3ARVA 4UQ2B 1QRNA 5D1QC 4JRXB 3PNWB 5I1HH 2EXWD 4TUKL 1RURL 5BO1H 1DANU 2PXYB 3C60B 3MROB 5GS1C 3PGCB 3VG9C 1VADA 3CLFL 4KUCD 2VLKE 1BD2A 5ITBL 1LO4H 1O7SA 3MBEC 3C6SB 5KSVA 4X4ZA 2ZJSH 1DQLH 4AIXA 4P2RA 1NLDL 4ZUUB 3WKNA 1ZGLP 3QUKA 3GRWL 1BZ7A 1MSPA 1Y18A 4XMKH 1U3HA 1U92A 3PDOA 3DXAD 2HLAB 5C07D 2JLLA 1FBIH 1QPPA 3V79C 1Q9KB 3V5DB 4DZBA 4I9WD 4XPAH 2RGSA 1RIVL 4HT1H 3LEVH 5KN5B 5JDSB 2IG2L 3MLRL 4I48A 4P3CH 4X0KA 1N4XL 1U93A 2VABB 5I1GL 4I2XB 3MCLH 4M7KH 3ES6B 4X4XB 2BVEA 1JWSB 5I1IH 1KFAH 3BZ4B 5GRUL 3MUGB 1U8KA 5KSAD 1GOFA 3RTQD 1UCBH 4G8GD 1B4JL 4ODSL 3TNNA 4G9DA 1QRND 4HK3N 4WUUB 5DRXB 3SKUD 5ALCL 1OP9A 3SKOA 3TBSB 4YBHA 5ANME 2I9LB 1MREL 1D5ZB 3KPOB 4XNUH 1PSKH 3IYLW 3UPCA 2H9GB 4WW1B 5DI8A 3S5LA 4MS8D 2ITCA 1OW0A 4DN4H 2OZ4H 1E4XH 1RI8A 3GK8L 1X9QA 1K4CA 2EDNA 4HIXL 5E8NB 4P5TC 4J6RH 4DTGL 3EHBD 3K8LA 1JHKH 4JFFE 1JUFB 1LO5B 1U3HD 1BHGA 5FECA 3QCVL 3BGMA 3ZSSA 1U8QA 2LVEA 3RHWK 4MLSA 2KKQA 5D72H 4K3EH 4BFIA 1S3KL 1JGDB 3N1FC 3LB6D 4P2QD 4U0QB 4XVSH 1FIGH 2HFFA 3PWPE 3V2AR 3CXDL 1I85C 2VIRA 1W0WA 3VD3A 1MIEL 2NNAA 2Z93B 4P23D 4L8SA 4KY1L 2VNCA 5D2NE 1FL5B 1WTGT 1MF2H 3CZFB 4EDXB 5IEHA 3L5XH 2VDPL 1QNZL 1MRDL 1I4FA 2RAMA 3QUYC 3HNTL 5JW3L 4X6CA 3VXRA 3UEZA 5IV2A 2B20A 1AJ7H 4ISVA 3KJ6L 4N5ED 4M93B 4PJDF 4BKLB 4GRLA 5I1DB 4NYLB 5EFIB 3GGWA 4JFEB 1G84A 4DK6A 2HTLC 2GT9A 2UUDK 5MERB 5SWSB 3IDJA 1N64L 1TJHL 2VKWA 3TIDA 5CZXD 5IBUG 3MOBH 4FQXC 3UX9B 4H26A 4H20L 1IEHA 4G80A 4QHUA 3KHQA 1I1FB 2X89A 5HHMD 1QR1A 5EU5A 4M8QB 1KPVB 4R90L 2B0SH 3SGEH 5DMJB 4HLZH 1BQHB 1FDLL 3S88H 4OTXL 4IRSD 3MNZA 5F3BB 2LAGB 5B38B 1S78C 4KHTL 3CFEA 2DI8A 3X13A 5D2LF 4UT6L 3V4UH 3GJEA 4F7CB 2FLBT 5B3JE 3D2UB 3DO7A 1L7TL 2R0LL 4WWKD 1LO3H 2QKIB 4I13B 5E56A 1CK0L 2GFBB 2ZSVB 4KKAC 1Z2KA 2C7UB 3K46A 5IF0A 2BNUB 4AEFA 3HS0B 3OAYK 5DJCA 4UILH 3NCEB 1C5DB 1FFOA 5F44A 4MCZA 3L5HA 3WSQH 1KB9K 2FO4B 2I60H 2FX9H 3CH1B 4H5SA 1F5WA 3NCFB 1G7HB 3GBMH 3CDCA 4L4JA 1J11A 1AHWA 4FTVE 4PJFE 4UUJB 2R0ZH 4N8CH 5H37G 1M7DA 1OAZH 2Q8BL 4HUWA 3O2WL 4NRXB 5EU4A 2K1MA 3FB8B 3V8CA 1Q72L 3TC9A 3S34H 1QFWM 1P2CA 2BVYA 3QT2A 4L4TE 4MXVF 3ULUD 2BHZA 3DVGA 5DS8A 4QF1B 2X9XA 2X9YA 5ACMA 3T0EE 1NFKA 3CX5K 5C0JB 3TVMC 2J88L 2WUBL 1MVFA 3O9WA 3CZJA 2P8MA 4M6MH 5ICXB 4HHAA 4MLIA 4XBGB 4NWUL 5E4EB 2BVPA 4WGVB 5TGBA 1ZHKB 3WUWG 5EA0L 3TJEL 3TBYB 3RP1A 3VWKB 3QEGH 1I1AC 2VZSA 3FFCA 2LTQC 5EWIH 4L8CB 4C56B 1G7QA 2Q8AL 2DM7A 2A6IB 4XPBH 3MLYH 1NFIA 3R0MA 4R4FH 3B9DA 2NTSP 3D85D 3MLWL 3BWAA 1H3TA 2ZUQB 3ARRA 4FQ1H 3U4BH 3MMEA 1PZ5A 3IFOA 2JJTA 4DZ8B 4PRID 1AC0A 5IFAL 4U1IA 3HRPA 3A6CH 4TVPE 4KQ3H 3DBXB 3H9SA 5D5ME 1YNKL 4JPVH 2FGWH 1KIPA 1A0QL 4BQBA 3UTSB 3HB3C 4MZ3A 1JGLH 3QBTB 3FKUS 1BQUA 1YECH 4NJAL 3TNMB 3O9WD 1CVRA 2E27L 2V7HB 3MRLA 1W2KT 2R56H 1A3RL 2DB8A 1DDHA 4NIKB 5J0BA 1W72A 1KXTB 3G5XA 1P69B 4LHUA 4Y5YC 1CT8A 2D9CA 4DGYH 3WIIH 3CSPA 3B43A 2IQ9L 4PJGA 1I7RA 2C4XA 3G5YB 2X1WL 1XGTA 3AVEA 4PV9A 4KK6D 3ILPB 4QKXB 5HDLA 1FO0L 2E7BA 3RI5K 3RNQB 5HI5C 1I3UA 1EO8H 4O51A 2G5RA 4DQOL 3RWEB 1V7NH 4OLUL 5IMLA 1KPUB 1EMTL 1IM9B 2DYPD 3MO1A 3U7YH 4MB4A 4NO5B 5KANG 3EO1B 4KI5E 1HCVA 1T89C 4ZG1A 4IS6B 2BXZA 3IFNL 1EXUB 1E27A 2H2PC 5J6GA 3MRGB 2BCKB 4LP5A 1OOAA 2VZOA 3TO4A 2WBWB 1Q0YL 1S7SA 2Q76A 4ZO6A 5BS0B 2FBOJ 3CFDA 2AXJA 4MA8H 2ZOLB 4J3TA 1IQWL 2XTJB 3UYOD 3MCKB 4RFOL 1I8MA 1RFDL 4N5UA 2AAVA 3LOWA 2LE9A 2IBGA 1GRWA 4LASL 3P9MA 5DJXA 3AMLA 5C0DA 2VLKA 5F1IA 3TBVA 3MRRB 5J12C 4ZOAA 4YGAB 1NAMH 3DYMA 4GOSA 3MLTB 2A9NL 3DO3A 2XICA 3LN5A 4M62H 4MAUH 4MAYB 2J6EA 3INUH 4JVUA 2ZP0T 2R8SL 1V3LA 2JTDA 3FCTA 4JDZA 1IKFH 4YHNA 4HWEH 5AYUH 4U3CA 3U79A 2J8UA 4U1KA 4M7LH 1XGPB 3D6GA 3MUJA 3JWOC 2Y9RT 3MRFA 2Q6WA 4S1RH 3Q5YA 5I16A 3BPNC 4JFHD 3OG6B 5J3HD 5E08H 4GW5B 2VXTL 4EOWL 4J2XA 1OB1A 1FC2D 5EOCH 4HPOH 4D0CB 1FZKB 3ZKMC 1INEH 1A9BA 3QXAA 5HVHB 3QUYD 1KLUA 1TCMA 3RWCB 4KROB 4L3EB 1NCWH 2X7LB 3I9GL 5EBMB 2UVFA 4F9LC 1IL1B 3F58H 3MSPA 5GRJL 1DN0A 1B6DA 3DUHA 5HI3D 5CMAA 2VE6A 4A6YA 4OD2B 2ADJB 1BBJB 5JNYB 1K9TA 4D9LL 4O2FA 4PGZA 5D1XB 4K7PY 4HBQA 2CKBA 3S97C 2D03L 3TV3L 2VLKD 4MNQE 5FYJL 5I8EA 3RGVD 2PO6A 3TJHC 1RK1B 1B0WA 4HK0A 5HYJB 4Y4HB 1HOCB 1NAMB 4ODWA 1CLZH 5F1KC 4OM1L 4QXGL 4Y2DA 3U82B 3MOAH 4N0UB 1UH2A 5E5RB 5HTSA 4NN7B 1JZ6A 1CFTB 4AYFA 5HHXL 1MCFA 4J8RB 3VFNB 2X4RB 1U36A 5IK3A 2Y36L 5DJZB 3LKPA 4R8WL 2IGFH 4YQXH 2KH2B 1MHEB 3PWPA 4G7YL 3QIWA 5GZND 3T04D 3MUZ1 5AZ2L 3MGOB 4Y5VB 1G7LB 3HE6D 3OXSA 4EBQL 5FDYA 4I18B 4LSQH 4F7EB 3PXJA 3B2UD 4KJPC 1KELL 2DQUL 5C0AA 2DLGA 3KYOB 1NMAL 3D1MC 4RAUB 3BKMH 4PJEF 3MV01 5IFJB 5FO7B 4GXUM 3TFKC 4KJQD 2GITB 2HA1A 4XC3H 1UJ3C 4LSRL 4C54A 2Z31B 4OGAC 5EZOH 2PW2A 2DQTL 2VC2L 5TFSL 5LXGH 4DGVH 2F53E 3MODH 2ZCLH 4Y2DD 1KJ2A 4GG8B 4JFFD 1TXKA 2Z91B 3DWTA 5ILTH 5DQJA 5ERWA 2FJGA 5LQBH 4Y4FB 1F00I 4D2NA 3EDFA 1S9KC 1T03H 5CUSL 1BBDH 1YMHB 5A16A 5C0ND 1T21B 4LOUD 1XGRB 4FMKA 3PWPD 1I7TB 4P9HH 3CPLA 4HK3J 2V2WB 4RGMB 5C9JB 3BN3B 2OR7A 4CN6A 1TNMA 5HDQL 4OQ1A 5IT2H 1I3GL 5F6HJ 1ZTXL 1A7PL 1IC5L 3T3ME 3NA9L 1U8NA 1OL0A 3EFDH 3F7YA 4GAGH 4MJ5B 3AUVA 4A2LA 2AK4E 3C6LC 2NY6C 4OLYL 4PV8A 2YD3A 4W6WB 4XVJH 4ENED 1CXIA 4TUOB 4GW4B 4HEPG 5I1EH 3S96A 1D9KC 2HWZH 3CU1A 4PTUB 5FGCB 1NUDA 4KJWD 5GGVL 2AABL 4CADA 4D0BA 2W9EL 4AG4H 4GAFB 3G6AA 4QXTA 1BLNB 5IGXH 5J7CC 2QADD 1MJUL 3LSOA 4XCNA 4EQ3A 2DJSA 4MD0B 3BXNA 4Z7UE 2EEAA 2BZDA 1NJ9B 2JCCE 2D3VA 3B9KB 4YDIH 4E41A 2G75A 4NCC2 4YZFE 4TN9A 1ZA6A 4NBYB 2FL5A 4JVWA 1T4KB 2QHRH 3MRDB 5A2KH 2AEIT 3V0WH 5EIIB 3GSUB 1MFAH 4JJ5B 3TN0A 4JQVA 4FXKB 4ZPTA 2YSSB 1DBAH 4R97B 5D71L 3QJHB 4NUJB 3BP5B 4XNYH 3L9RA 4H1LH 4EI5B 5J13B 3KLSA 5CJQH 1DE4B 4GG6E 4OZGE 1GZQB 4Z7OE 4U1LA 2WUCH 1OD9A 4LCUB 2QEJA 3UPRA 3L3DA 1A5FH 4UDTA 4JO2H 5SWQA 3W0WE 5IIEB 1I1CA 3WNOA 3GIZL 4DOHE 3O2DA 4FTVD 4RIRB 1RK0B 2HH0H 3LHPH 1DFBL 2NZ9C 3RKPA 1M7IA 4NDMB 1IE5A 2HN7B 1K4DB 2F58L 4PJ9B 3VGHA 3IU3A 4L4TD 3TBWB 3THML 3TYGL 2DQIH 4NGHH 3VFTA 4HV8A 1ES0A 2QTEA 3T0ED 2DIJA 3RU8L 3DVIA 1RZ8B 1KIRA 5T33H 3RAJL 4DJMA 1VB9A 5KVEL 5DEFB 4YNYB 4N8VA 1DQDL 2E7CA 3NFNB 3P40A 3DXAB 5C07B 1ZMYA 5HYSA 2IPUG 1LK3H 2VAJA 4X9FA 3OKDA 1YUHA 2AJ3A 4AIZB 4I77H 2X4NB 3T8XA 1NBVL 1Q9LB 5IVXE 3H7LA 4DUWA 4U6HA 2ATKB 1EJ6A 4H1LB 1IGTB 3Q2CA 4LGSB 2WBJD 1JHTB 3GSWA 3O4LA 3K4DA 1WGOA 3VRJB 4G8GB 1OAYH 4OCNC 3SDAD 1QRNB 5JMRA 1LO2H 3KXFA 3H42L 3L95A 4G6ML 5E2VH 3OF6A 3DSFL 2CIKA 3OAYH 4TVPD 4K8RH 1XR9B 1VADB 5I1JL 2D7TL 2VXSH 3MRIA 4OF6A 4KTEL 1BJ1H 4D94A 1GGIH 2HKHL 4LSVH 2BJMH 4FG6C 4P2RB 3O4OB 2V17L 5A2IH 3TWCL 1NEZA 1IT9H 3QFDB 1KTRL 4PG9A 2GAZA 2J5LB 2V9TA 3QUKB 1BZ7B 4K55A 2X9WA 1MCJA 1U3HB 1U92B 4LDOB 3HZVA 4CU6A 3LRHA 3PDOB 4PJXF 3MRMA 1QO3A 3K74B 2HFGH 4RX4A 3OJMB 5KAQF 4KKCC 3SQOH 5C2BH 1G7MB 4D9QE 1FNHA 1W8NA 3BO8A 2DQFA 4DZBB 5D7JC 4P2QB 5L2JB 4F15C 1OAQH 1LDPH 2A0LD 2VSCA 4I48B 4X0KB 3VI4E 1OP3K 1BQLL 4Q0XH 4NT6B 4P23B 2F9BT 4YHOH 4JFDE 1U8KB 4JM4H 1IAIM 2OTUA 3G5ZB 5F7EH 4PREA 4KI5D 3TZVA 4DKEL 3TNNB 5J4MA 5E4IA 2MKLC 2N7BA 4NQTA 3C8KA 3SKOB 3V52L 2GEEA 2AGJL 2NY3D 3KLHC 2GI7A 3GM8A 5DI8B 3S5LB 2KZWA 4MA1C 1MLBA 3TYFA 1IZJA 2XIDA 5DK2A 3MA9H 2X5PA 5FOBA 4EIGB 4OD1H 5IB5A 4JGJA 3SDDC 3IAPA 5TDPA 1K4CB 2HVJB 3QIBC 1XGUA 2YPLE 3ULUH 5FECB 3SCMA 1U8QB 1JZ8A 5JIIA 1QFUH 2EDKA 4ZO7A 5HHMB 4P9MH 5DJYA 4MNQA 1RJCA 4RX4D 5E6YA 5L8LB 5HGAA 5IHZA 1WAAE 3GNMH 4LVHC 5ID1A 2COQA 1C12A 5JUEL 1IC7L 4OFKA 3GIVA 2VIRB 2YD4A 4CRPA 2YD6A 1W0WB 4LIQL 2NNAB 4PB9H 4L8SB 4CW1A 3VFOA 1KACB 5IEHB 1P5VA 4AQ1B 2ERJB 1I4FB 3BIKA 1CGUA 1RHHA 3VXRB 3ARUA 5IV2B 4ISVB 3TA3D 1DBBL 3MRPA 1JF5A 4K07A 1OQOA 3RWIA 3GGWB 2VERN 1GYAA 1SYSA 5DQDH 5L88H 3U46A 3UO1H 2GT9B 3MV9E 3G6JE 5A40E 3IDJB 4LKCA 3TCLA 3RUGE 3TIDB 1AD9A 2HT2C 3LQAL 1UH4A 4QOKA 1Q9WA 2AJVL 3STZA 4H26B 2XRAL 4G80B 4QHUB 1SM3H 4MQSB 1EZVX 3GRWA 3S3JA 1QR1B 1ORQA 2VDLH 4MNQD 4QHKJ 4OUOA 5EU5B 5KS9F 5ESQA 3WHE1 4KXZH 3QDMA 3BYTA 1ZT4A 4Y5XC 5F70A 1UWGL 5CEXA 3MNZB 1W0VA 3NIDF 2AK1H 4LPVA 1YQVL 1ULVA 4PRAB 2XQYK 3Q1SH 2F74B 4KK9C 3X13B 2F53A 5BV7C 4XNZC 2F5BH 1RZGA 3GJEB 3MQIA 1LEIB 3VWJD 3PHOA 3F6IA 4G5ZL 4DKDC 3DO7B 3T65A 3OAUL 3QIUC 4K7FA 4JCMA 5F93C 2FH8A 1B2WH 3AAZA 3GHBL 4PGDA 5KSBF 2VQTA 3SGDH 5J9PB 5IF0B 3QUZD 4YK4B 5TE6L 4ZOCA 4MVBD 2NX5A 3GUTA 5DJCB 3T2NH 2VZ1A 4XNQA 3KJ4B 3N85L 4MCZB 4XP5L 5KSUA 5TF1H 3ZKSD 4KV5F 3EDKA 15C8H 2X4OA 3SQBA 1Z5LA 5I8OH 5CBAA 4H5SB 1TJGH 2ZG1A 1A7BA 1AHWB 5HGBA 2NY7H 1M7DB 3PDGA 2IBZX 4FFYH 4HUWB 4PRIB 3JWDC 5FYJE 2BOBA 2E8ZA 2ORBH 3T0AA 5EU4B 3UZQA 5CKAA 4FFZL 3G6DL 2L0DA 1GH7A 2VISA 3HZKA 1F58H 1P2CB 1S5HB 2R4SH 1MCCA 5F9WC 1EVTC 3LV3A 2AKRA 1SEQL 3LRSA 4RNRB 3O9WB 2ADFL 1IKNC 1W72H 4HHAB 3O8XC 2EDWA 3A67H 4XMLH 3KPPA 4K23L 2F53D 1MCEA 2HJFA 4LRIA 2BVPB 4PJIE 3MXVL 3GMMB 1IGMH 2EYRA 4LLVA 5TGBB 1L9NA 4WGWB 4CN1A 4PRHA 3HAEG 4G6FD 1OAKH 2IPKB 3REWA 1F4WL 2H8PA 3FFCB 5CFHA 1YZZA 1BX2A 5I1CL 4MJIA 5CP3A 1VSCA 4KH2A 1FZJA 35C8H 1NFIB 4NO3B 2EH8L 3DRQA 2YUVA 4OFVA 4FQCH 1ZXQA 1FSKC 3HI1A 3HUJB 4L9LA 4GKNA 2FDBP 1JCKA 2XKNA 3ESUF 3NH7L 3WFDL 2PYEA 1PZ5B 3IFOB 4MX7A 1KF9B 4HKXA 5EUOE 2GUOB 3ZKND 4U1IB 1R5WA 4NM4H 4BZ1L 2AK4D 2AV1A 1FFPA 1GGUA 5IKCB 4LLDA 3O6KH 3VH8A 4OZGA 3H9SB 4X99A 1KIPB 4P46A 3LEXB 2QSCL 1ZANL 4K3JL 3QPQC 5I1KL 4P4RA 1IMHC 2D7PA 3IXAA 4YAQB 3QUXC 5LKNA 1KN4L 3DJ9A 4Z0XA 3RWHA 3W0WA 2DQCH 1CFVL 4GG6F 2P8PB 2QQKH 4M5ZH 4HXBH 4QTIH 5I74C 4AEEA 3LKSA 3ZDXE 3PJSA 1NGZA 2HG5B 1DDHB 1W72B 3KYKL 3G5XB 5CAYB 4HWBL 3JV0A 4J4PA 3OAZK 4LLAA 1CT8B 3CK0H 2AQ3A 4C4KO 2J6EH 4PRPE 4WU7B 4Z7QE 3O3EA 4PJGB 3MV8E 3QP3A 3DX6A 1I7RB 1Z9OA 1XGTB 2YUWA 4PLNC 2ZCKL 4PV9B 1HXMA 4IRJC 4GKZA 1G9MH 3HFMH 4L3AA 4DEPB 4PJHA 4RCAA 1HKLH 4O51B 4PGBA 5IMLB 1IARB 4M1CC 3RVUC 1XT5A 5DJAB 3MO1B 4OGXL 4S1SL 1UKQA 2E6QA 2PYED 2WWKT 4N0FA 4ELMF 5KANI 3FQWB 4F7MA 3DX8A 2G2RA 3S4SA 3G5VA 1E27B 1ERNA 4NC0B 2BHYA 2VAAA 3M8OL 1UM4H 5T1KA 3TO4B 2Q76B 4A6YH 2FBJH 3W0WD 1RIHH 3CFDB 4O5LH 4UDUA 1MCIA 5E1AA 2CLVA 3SBWA 1SY6A 4MMZC 4XP9L 3MRHB 2CKBH 4ZS7L 4ETQA 5D70L 1E4KA 2IMNA 1FGNL 3GB7B 3JSSA 5IB2A 5MI0B 3P9MB 5EOTA 4JEGB 5C0DB 5FO8A 2VLKB 4J4PD 2YRLA 1MCWW 5F1IB 4PJ7A 3IFLL 2BX5A 2OR9H 4I3SL 5C7XL 3L3KA 3RGVB 4JDTH 4XPGL 5JORA 4N1EA 4NCC1 2OJZL 4IOIA 3LN5B 1TZIA 1C08A 2Z8VC 5DHYB 5E6IC 3E8UL 2BNRE 4JDZB 5DR5H 1MJ8L 1NUFA 2AEPL 2J8UB 5F7NC 4NKQB 3WL9B 4Z0BL 4LCCC 3MRFB 2Q6WB 5I16B 4G9FE 1J1OH 2ICWI 4OLWL 5IJKC 1I9JL 4FQHA 1OB1B 2X1XR 3BKCL 4JPKH 4EXPX 1CL7H 1Y0LB 2B1AL 4JRYE 4PRDA 4HS6A 4NZUH 4YIQA 5J1TC 2R0KL 5EPMA 2DLHA 1A9BB 2FJHA 3QXAB 4N0RA 1RIUH 1KLUB 1F6AA 1ZGLM 3HE6B 4KK8C 4UIMB 4LARL 4YHIA 1G6RL 3FZUC 4PJ8A 5FUCC 2Z9TA 1YEFL 1QKZL 1DN0B 3VRIA 1HE7A 2OLDA 2VE6B 5CMAB 4A6YB 3ARSA 4IMKA 3C5ZA 5DRZA 5H8DA 4JVPA 5EBGA 1J0ZA 1JPGA 1U8MA 3P0VL 2V5MA 5C09E 4MCYA 2CKBB 1YYLH 3QXDA 5CGYC 3RJQB 1MHCB 3SHSA 3FRUB 1KJMA 3PG2A 3O2VH 5I8EB 2YK1L 3ULVL 3RIAK 4EI6A 4JY4A 2PO6B 1KJ2H 3ILQD 4HK0B 5EH1A 5BVJA 4NO0A 4ODWB 4Y2DB 4U7KA 1RMFL 4JFFB 5T1DH 5LBSH 3OXRB 2EDLA 8CGTA 4KRMB 1V7ML 4NP4H 4N0YH 1FO0A 2MPAH 5A1AA 4P4KA 3NCJL 5L7XL 4ZUVA 4OCMC 3OSKA 5I75C 1A21A 4D9QD 3LKPB 2JELH 2IAMC 5TDNA 3PWPB 3ZDYF 1F13A 3CMGA 2O61A 4IDJL 1UB6A 3KS0H 4L4VE 4PB0H 3JZ7A 2WIIA 5B8CC 2BY2A 4F8QA 3WFBH 1OWRM 5D2NB 1HK6A 4JFDD 4JRWA 4XCYA 3OXSB 5D9SA 1PEZA 1HH6B 3TLRA 4RGNE 3IT8D 1A64A 3W5MA 4QNPE 1RUAH 3FOMA 2APVA 1QBBA 3GSOA 3M1BA 3C5ZD 4G6AC 4NFDA 3VRLF 2R9HC 4U1SA 1YMMA 3QWRD 1N6UA 1JL8A 12E8H 1AH1A 4YE4H 4R4BA 3OKEA 5I1HL 5B21A 1XCTA 5IHUH 2XWBA 3GSRB 3GMLA 4NO0D 2YXMA 2WNGA 3UJIL 3UBXG 2ZJSL 2YPLD 1KJ2B 2QADB 4K71B 2DI9A 3RUGF 5DQJB 4O2EA 4ZXBA 1CLCA 5F9JA 2QL1A 4IHOA 3IRZA