4PP1C

The crystal structure of der p 1 allergen complexed with fab fragment of mab 5h8
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
210
structure length
210
Chain Sequence
b'DIQMTQTTSSLSASLGDRVTISCRASQDITNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGKTLPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase 1
publication title Structural Analysis of Der p 1-Antibody Complexes and Comparison with Complexes of Proteins or Peptides with Monoclonal Antibodies.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 51
structure length 210
sequence length 210
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pp1C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pp1C01
3WIHA 4NKOA 5T5FH 1ZXQA 4PGCA 1DQQB 2YK1H 4JN1H 5MHSE 2PYFB 1JF5A 2YRPA 2EDYA 4WI4A 2VLLB 3MMEB 1CE6A 4K23H 1U8KB 4Z7UA 3UTQB 3LH2H 4XNMA 2LV4A 2GW5A 5FKAB 3L1OL 1E4JA 1CD9B 4YFDB 2NXYD 3DX9A 5FYJU 1UKQA 5E03A 5D1ZD 4G8GD 1J12A 5TQ0L 4F8QA 3SE4A 3Q5TA 2R0WL 2FR4B 3BPNB 1S7WB 3ECBB 4LCUA 2JF1A 4NKIH 5EUKB 4NQDA 4J6RH 2LQRA 3Q6GH 1CDJA 3LB6D 3QJHA 4YHML 3L6FB 3WFCL 1ZLWK 2ADGA 3O6FB 4CGTA 2F9BT 3D2UB 3NABL 2B8OT 3LQMA 5DVNA 4LNRB 1EUUA 2DD8H 4YDIL 1UGNA 3U36A 1U6AL 4OZGE 4RQQB 3T77A 5DD5L 3VI4F 3OKDB 5B39B 4PIRF 5EO9A 3NACL 2EE2A 3BP7A 5FCUL 2X5PA 4HT1L 3WUWA 2Y72A 3RY6A 4YNYB 3MOAL 4M5YL 4F80A 5IK3B 5DZLA 4JKKA 3T3ME 3PUCA 4OSUH 4LASH 4MB5A 4C54A 4EXPX 1OF2B 1X5AA 4I48B 2D7TL 3VWKC 3KPOB 3D39A 5DZOA 2VH5L 4NOBA 1UXSA 2EEDA 4GW5B 1FH5L 4LVHC 4ZUSA 1T66D 1CDGA 2UZIH 2NY4B 4Y2DC 1E4WH 4UDTA 5HVGB 5KZCD 3DVNB 4LKXB 5DK2B 2BSRA 3MLVL 5FM5O 1EBPA 5EIIA 3UCRA 1A7OL 1N64H 3DUSB 2IAMD 2WLZA 5A3IC 5SWSA 2FECI 2HMIC 3BKJH 1WSST 2VAAA 3DMMD 3LDBB 1KN4L 4W4OA 4MSWB 2FB4H 5ALCH 2CK2A 4ONHA 1UT9A 5SX4H 3MV9A 2BJMH 4RFOH 1I7ZA 2W9LA 1FGNH 2EKSB 3LD8B 3MACL 5I1LB 4U1SA 1RIVH 4XP6H 1QBLL 1KEGL 2CO7B 2JK5B 4M02A 5JHDE 5CGTA 4E42B 4L8DB 5IFJB 1U93B 3F7VB 3QDHA 2NY3D 2HFEA 1SYVA 1HHIB 4CL7A 3KHQA 4PJHA 5LQBL 5D6CB 5ENWA 3OR6B 1GHFL 4QYOB 1I1YA 1GGBL 3GMLA 2ESVE 5DZNA 5CS7A 2AERT 1CS6A 3VFMB 3QXDB 4RDQG 5GHWH 3UX9B 2DQCH 4ISVB 5SV3A 3FO0L 1HSAA 3PV7A 4N8VA 4LCYB 5C6PB 3HZMA 3AU1B 2D0GA 1S9WB 4LVEA 4ZO8A 3VW3H 4PREB 1MFNA 5IW1B 3IDNB 1J88A 4I0PC 4P2RE 1FPTH 1IKFH 4GG6B 5I8KH 3IFNH 2IAND 3PJSA 5DJDA 3S9DB 1G9NL 1HWHB 2RFXB 4H88L 4WTZA 5GJSH 1JZ7A 1HINH 1P4IL 4H0HB 3QDMB 4L29A 5L9DL 1YY8A 3VXSD 3GMRB 3BJLA 2YN3A 1X5YA 4OCNC 2NY6C 3LQAL 3ULUC 1S7QA 4DKFL 5IW6A 3QDGB 3TCXA 1OPGL 5ITBL 2V2XB 3VFWA 1TJIH 5IKCB 1NLDL 3BIKB 3JUZA 1PGRB 3QIBB 3QYCA 5HGBB 2IPUK 1F6LL 3S5LG 1JNHA 4GFTB 3VGAB 3WNKA 5IVNA 1AD9A 4P3DB 2RIKA 2X4QA 3CDGA 5JIHA 3MV01 2NXZC 1NAKH 3KR3H 4DEPB 1SYSA 4GS7C 1A6TB 4Y16D 3FQTA 4OUUA 2IQ9L 3FFDA 3FJTA 4TTGA 4RWHA 1GRWA 1IBGL 3MV8E 3L5WA 4QXWA 5J57B 2R4RH 2K1MA 5BQ7A 4JPVH 2CLRA 4KVNL 3F58L 2AXFA 3GGWB 3BQUA 2VSCA 4IRZH 4ZD3H 5HVHC 5T5NF 3W5NA 3Q6FA 3CFDB 4OZ4A 2WBJB 1L6ZA 3O4LD 4H20H 4U1LB 4NFBA 1MAMH 3EOTL 2GY7B 2DLTA 2GJ6A 4KI1A 1GJIA 3PL6C 4XPFL 4OCYH 4Y1AD 1BAFH 2G2RB 4MS8C 4CRPA 2J2ZA 2R56H 5B3JE 4OQTH 2NY0D 3O2VL 1SY6A 4OTXH 3REVA 4XBEH 2MPAL 5HHOE 5CJOH 3HI1A 3VRJB 1L7TL 4U4BA 3VXRA 4IRSD 1F90H 3ULSB 2Z93B 3CMGA 3LKPA 4WEBH 4BYHA 3ULVE 1C7SA 5IROA 4K94C 4E0RA 4Q97A 2OK0L 1KF9B 5ILTL 3HMXL 1UB6B 4G42B 4HPOL 4K55A 5FUZL 1M1SA 5I2IA 1JPGA 4NGHL 4RIRB 3UYRH 1OHQA 5JOFB 4L5FL 4X4ME 1FIEA 1LK2B 1PSKH 1RJCA 3IJHB 4K2UH 1EEYA 3G9VA 2KH2B 4P2OD 5T3XE 5FYLH 1ZGLA 3DNKA 1DVFD 2FGWH 2HKHL 3G5XA 3NCMA 1I7UB 1TZHA 4CU7A 3PQYB 1ADQA 1EA9C 1AGFA 4QLRA 3Q2CA 2QHLA 3QWOB 4LPTA 3GSXA 4WFED 5IT2H 2Y7QA 3O8XB 3T2NH 4WHYG 1ULVA 3W0WD 1UG9A 4NKDA 3QUZA 3O6FC 2ICEA 4QHLB 4KZEL 1KTLA 4XVSH 1BD2D 3RWCA 3UYPA 1LVEA 1HHGA 2O26U 3FAWA 3MJ9A 2K9UA 1E4XH 4OJFL 5C0EA 3RA7H 1Q72L 5FGSA 4KUZH 3X11B 1D5XA 3DHJA 2H6PB 3NCEB 4J8RB 2IPKB 2ERJB 1A1MA 2H9GB 2RB8A 3BPOB 3RVWD 2D31B 3HNTL 2BC4A 4QRRE 4AM0A 3NAAL 2IADB 3GSRB 4JQVA 1EHAA 4Y5XA 3Q3GB 1NC4B 3O3UN 1MNUH 3FQNA 2W60A 3TVMB 5CP3H 4G6MH 4FS0A 3WNPA 3FFCA 2CMRH 3OJ2C 4FFZL 4PJBA 5KTEL 4RMVA 3UPRA 1U8OA 1IC1A 5ESAB 4DW2H 3SKOB 4KKAD 2GFBB 5KANI 3VFPA 43CAA 3QQ3B 5GS1A 1RUKL 5HYJB 5D7JC 2NY4C 3R06A 2WIMA 1R5VB 5JUEH 4OLZH 1FDLL 3RWJB 5A2KH 1JBJA 4Y4FA 1TZGH 3C8KB 3BH8B 4OFVA 2OTUA 4WUKL 3QEUB 1BIIB 4M6NL 4N1CA 3QCVL 4M8QA 1SJVA 3LDBC 4P2QA 4PR5B 1U8JB 3L7FA 4UILH 1MHHB 1CFNA 2XY1A 2X89A 1NMBL 4K71B 3QO0B 5GRVK 4FQXD 2PW1B 3BO8B 5C0BA 3VJ6A 3O6ML 1DQLH 4OGXL 3WHE1 5E08H 3WNLA 1O7VA 1GPOL 2OJZL 5EBMA 3EBAA 1KIUA 2QSTA 4JN2A 4OFDA 3OKEA 3QEQD 4GAFB 4JEGB 2VXQL 1EJOL 1ZE3C 1FV1A 5EBLB 1I9IH 1LO3H 4EI5B 1BBDL 4MQ7B 1UQSB 2R69L 5CIPA 4HXAH 3WHE0 3MRGA 3HR5A 3DO3A 1E28A 2ZCHL 1RV6X 2F53A 4MJID 4PP1D 2OJEB 3FCTB 4L4TE 1TMCB 4K9EH 2KDGA 5AYUH 4P4KB 5E6ID 1A6ZB 4MXQC 3D3VD 1GVIA 1IAIH 1PY9A 4MAYD 1NCNA 3RTQA 1MF2L 1T0NB 4FQCL 5E8PA 1RSFA 4M7LT 2J8OA 3MV7D 3NN8A 1HN1A 1DQDL 3TCLB 4LSTL 1NEZG 3ULVH 1YQ2A 2B2XL 5DURB 2X9WA 4FQIH 1NFIA 4TUJB 4OD3H 5F7DB 4OFPA 4OGAC 1M05A 5DSCB 1XF4B 3QPXH 1QP1A 2FH8A 1JGLH 5C9JA 1U42A 1YNLH 2ADIB 3MRBB 4JQXA 4G80B 3GRWA 5CJXC 1FBIL 5T3XH 3RBSA 1JHKH 3N9GH 1RZIB 4OFKA 3VGAC 1AXTH 1CICA 3LEVH 1M6OA 1FL5B 5J1AB 1T7WA 2V17L 5IW3A 2P42B 4DEPC 3GMPB 4R96B 1KNOA 5EBGA 4JFFA 1OAUH 2XTJB 4WGVB 3KPPB 3T2OA 4YHYC 4PV9A 1EFXD 1MVUB 3U6RA 1BLNB 4KPHL 3FB7B 4M93B 1G6VK 1I8MA 2NY5C 4JPWL 1A1NA 1HILB 2IBBA 4NM4L 4XMPL 2UY7A 3DBXB 5F6IB 2NW2B 3N1FC 2YHGA 1WC7B 5ISZB 2FNBA 1U8IA 2EZ0D 1CE1H 5KSAC 4JVPA 1MCJA 1F13A 3CFIC 1GC1C 2O5YL 1UA6H 3T2PA 3TJHD 3O9WB 3VD7A 2VITA 1OGTB 5D5MA 2ZKHL 4G6JH 1FNEA 4KJYB 4JFED 1FO0H 5C71A 4U2YA 1GGIL 4BK5A 1IAKB 4POZD 3BESR 4DWHA 1U8MA 1EAJA 3SKMA 4M1GH 1DBKH 2IG2H 5CGYC 3DTXA 3MODH 3P4OB 3T1FB 5GRJL 5IG7A 5IMMB 4QOKB 4YHKL 3NZ8A 4JPKH 1I1AB 5KVEL 2J8UF 4HS3A 5GRYA 3MCG1 2AJZA 1NDMB 5DDHA 2GITB 2WP3O 5DJ0A 3FT3A 4X6DE 1KB5L 1A7PH 3LQZB 4MQXC 5DTFA 5DWUL 4Z7QF 2QJDA 5IQ7L 2UYLB 4JPIB 3WFZA 1BEYL 1PZ5B 1Z9SA 1Y18A 2VDOH 5BVPH 5BV7L 5ICZA 3D39E 3MRJB 3RKDD 4YK4B 5D7KE 5DVOA 9CGTA 3O3BB 4QO1A 1B0GB 3O3AB 4L8BB 3RKPA 1D6VL 5BOPA 1MQKH 4KJPC 3ROOB 4UBDC 2R1YB 3ARFA 4WO4B 4I3SH 4K3HA 1T03H 4LCCB 1I8KB 2ADJA 1J1PH 1WVZA 5GRWA 2X4UA 2HT4D 1MOEA 3RL2A 3WFBH 4N0YL 5SWSE 2A0LC 3E1F1 4ZNCD 1VFBA 5I73B 4YBQC 3QAZB 2Z8WC 3VG0L 4MVBC 4AEHL 2HH0L 2YRLA 4PRHD 3ZHDA 3MRQB 1IAIM 3DYOA 2X7LA 3MV9E 1FVEB 4HQQL 3LS5L 1YMMD 5HGDA 1Y0LB 2ERJC 2EIZB 2FHBA 1YYLL 3RWDB 4YHOL 2ITDB 1YNTB 1BFVH 2FX8H 4KHTH 3RZCB 5CBAB 3DX7B 5ANME 5DHYB 2Q7NA 3VGDA 5EC1B 1CVSC 4E5XB 2ATPB 4PJCF 1JNJA 1F97A 2B0SL 5CZXD 1M4KA 1YJDH 4P3CH 4M62H 5I8OH 3CCHB 3RVUD 1E6JL 3WFEH 1CLOL 2GSGA 2BVOB 4LSDA 1PBYA 3Q1SL 3NIDE 3ZMRA 2XKNA 3JBG7 3M8OH 2YPKB 2ZUTA 4NQSB 2MCPH 3HUJE 4NQCB 4IMLA 4J7RA 1NGPL 1U3HD 2RAMA 5C0AB 3STZA 5TE7L 1BZ9B 3ALWA 3AS2A 3L3DA 2X10A 5L2KE 3MUGA 2XYCA 2EDLA 2ENSA 1EVTC 1QRNB 2IH1B 3GSWA 5H94A 3O2WH 3TN0A 3B9KA 4FTVE 2DM4A 2O5ZL 1S7XA 2HJFA 5EU4B 1MAJA 1MEXH 5FGBA 3PV6A 2X4NA 3L5JA 1AO7B 1FVDB 4BUHA 4K71C 5CEXA 5KN5B 3WIHH 2XOTA 1QQDB 5CJQL 2HAZA 3QWQB 1DTUA 5I30L 1OAZL 3MLYH 1MRDL 1A8JH 3GIVB 5FF6A 1NGWB 1K3IA 1X5HA 1ND0A 2LU7A 4AEFA 2A6IA 1MCLA 5EB9A 3S36H 4PP2B 5DUBA 2HRPL 4Z7WF 3UMTA 5GIRA 1A9BB 4Z77A 3CMOL 1JPTH 4LU5H 3QUMA 4EQ3A 1NCWH 5EOTB 2Q86A 4UT9H 1BFTA 5DJXA 4PRDA 5J1TC 3B5HA 5JR1L 5EOCH 4LHUA 4NO5A 1A3QA 3MRMA 3PHQB 3IJYA 4HIIA 3HE6C 4U1KB 4JHWL 3BVNA 4ZSOE 2I5YH 2Y5TB 4NP4L 3VXTB 3BZFA 2NLJA 4OF5A 1RPQA 5DRXB 1C08A 4PRPD 4D2NA 3MC0A 3SOBL 2VABB 4F33A 1NGZB 2F19H 3WIFB 4KJQD 2BCKB 5JO5B 2YD4A 2KUTA 5IB3B 5LJYH 2ID5A 2JIXB 1OGAB 4G8GE 4LRNL 2BXYA 1KBGH 4DKAA 3HE7D 5I75B 4XC1L 2O61B 5I74C 2D3VA 4WY7L 5T1KD 2QSVA 1UZ6F 1INEL 1U3ZA 2ZZUT 3MRIB 1P1ZA 3I9GL 3O2DA 4OCSH 1G9MH 3K2UH 3L3IB 5F71A 5GGVY 5ESQA 2UWEB 3F7QA 4NZTH 5ID0B 3KVQA 2W07A 2AJUH 5EU6D 2CUHA 4AIXA 1JE6A 2WK2A 3CSPA 2X4SA 2YWYA 2FIKA 4KQ4L 4TUKL 4XP9L 5KVGL 3HC3H 5DS8B 3K8KA 4IOIA 4CMHC 1EXUA 4S2SA 1K6QL 3WKMH 1WBZA 4QXGH 3ARSA 5IB1A 5C09D 4OM0H 5CD5C 4PJEE 1FZMA 3MGOA 4DGIL 3FRPG 1MJUH 2X4TA 4EZMA 1T83C 3BMVA 5I8CB 1I85C 1IGJA 3QIWC 4NKMA 5FUCE 4O02H 5IEKB 2F5BL 3D9AL 1FJ1A 3AAZA 4ODTH 4RISH 5BZDB 2EDJA 4XWOD 5E5MA 1MWAL 2QQKH 1JRHH 3MBEC 5GJTL 1M7DA 4FXLA 4UT7L 3G08A 3HI5L 5F6IC 1I8IA 2NY7H 3BEWB 3OKOB 1A22B 4PLJC 2VLKA 1IC4H 1UM6H 2BRRL 3BISA 4TYUA 4M43H 2DICA 5B39G 4WFFD 1CD1A 1GYAA 1FVCB 4PTUA 2BNUA 1D9KA 1UEMA 2UWEF 1DEDA 1WEJH 3KPSA 3QDJA 4G9FB 4X99A 4JVWA 4BH7B 1QFWH 4LVNB 1T1XB 1RZJC 5D2NA 1KN2L 4DOHE 4JDZB 2CIKA 5EBWB 5LAXB 5KG9A 1T6WA 1VA9A 4KY1L 5C86A 3AB0B 1Q1JL 5E6ZA 2Y06H 3GJEB 4E41A 1M71A 2VLJB 4LSSH 3A6BH 5FM4A 1FAIH 1ZWIB 3T0VA 1F3RB 3TJEH 3E6FB 2R2EA 1CK0H 3RWIA 1I1AC 2VIRB 3QH3A 4GRWE 1SJHA 2HVJB 1ONQB 5KVDL 2DBLL 4WJ5A 1QO3B 5CGMA 4PJDA 3MJ7A 3MLWH 1RY7B 1WIPA 1JNLH 2CJUL 2YD6A 1QNZL 1JMXA 4PJ9C 3ZE1E 2FX9H 4HKJA 3OXSB 4P9HC 3JV6B 1JYWA 4HCRA 4YK4C 2DI7A 4ZTOL 1LP9F 3EJZD 1UH2A 1YC7A 1IM9D 5HI3C 3EFDH 5IR1A 4DGYH 1U2CA 4QHKI 5ESVB 4Y8DC 1AGBA 3HG1A 2B1AL 3P40A 4N0UE 4H25A 4N5EC 4S1QL 1CZ8H 2HVKB 1N2RB 3GHEL 3LEYH 2A2QT 1H9VA 5HD8C 1MHEA 1XGTA 1DSFH 2V2WB 3QAZC 2DWDB 2E9BA 3O41B 3T4AA 3ZE0F 4A6YB 3BAEL 3DHMA 2R0WH 5E99H 2F74A 3DRQA 4ZPTA 3VI3F 2EDOA 5EZJB 1Z0NA 4OD1L 2DBJA 3SKNA 3ABZA 4AYFA 4HK3J 4Z7VB 3KPRA 3AMKA 3P4NA 3EJYD 4LQFH 4BZ2L 1DLFH 3A0OA 3RZCC 3NABH 2H26B 3U1SL 1IM3A 1FFOA 4RWYH 1IAOB 3FQWB 4ZQKB 3RL1A 5LXGH 3KNBB 3WCYA 1EPFA 5KANG 1H0DB 3BKCL 2FX7L 3QSKB 5DD5H 4BFEA 4WV1B 1K8DA 3C9NB 2D0FA 2E7CA 3FQXA 1N59B 4X7SH 5D1XB 2Y23A 5FCUH 4HT1H 5F1KC 5C07A 3P30L 1CLZL 4NZUL 5T5NG 1U3JA 1KCUL 3VRIB 1CFVL 1YPZB 4JZJA 5FGRA 4KTEL 4HSQA 4WW2B 2D7TH 3C5SB 3TYFB 4R3SB 3EFFB 3DV4B 1WZMA 2VH5H 5E8EB 1CN4A 1ZK9A 2Z35A 3C60D 1IZKA 4EVNB 1FH5H 4RRPA 3SO5A 1YYML 3PXHA 3BP4A 2APXA 4Z7VF 3H9YA 5D1QD 3X17A 2JCCF 1TVHB 4U1GC 3O4LE 4HPYL 1D5IH 3LS4L 3ARXA 1FYHB 4CVZA 4NQED 2I9LA 4PJGF 2GK0B 1J0ZA 1JWSB 4WUUB 5KSUB 4KZDL 5E0QA 1BF8A 1HH6A 1KN4H 5C7XL 2NTSP 1QFWM 4APQB 2NYYC 1QSEA 2AI0L 2LAGB 3HZVB 5LGHH 3MACH 1AHWA 1CL7I 2IQAB 2ZOLB 1EIBA 1ADQH 4KK6D 4FQ1L 3U7YL 4PLKD 15C8H 2XZQH 4HUKB 1T66C 4XWGL 4IRJB 2ICWJ 3AREB 1MHPH 4G9DB 2Q8AL 4WW2F 3BDXA 1NH6A 2VZSA 2HFGL 1AP2A 2IAMC 2WV3A 5LQBH 3HNSL 1GGBH 3QO1A 3GSQB 3DMMC 3KYOB 3S4SB 1CCZA 4FQLL 5D7IA 4UTBL 1C5DA 2OLDA 3CXHJ 4DUXA 3MJ9H 4PRAB 5I75C 5GS0D 2EO9A 3DURB 1ZLSH 2VR5A 4NC1E 1MJ7L 5JW5B 4V1DD 3IKCB 5F9JB 3FO0H 4M7KL 3W82A 1A1OB 2ZOKB 4MJ6B 4K3EL 1WGOA 3G5VA 2AAVA 4PV8A 4GRWH 2E7HA 3NIFE 2NCMA 1D5BB 4LF3A 4WFEE 1N5AB 5HHMD 1FZJB 4YHNA 1K2DA 1GZPB 2XZCL 2ZG3A 5ITFA 2C3HA 2NY3C 1ZHLB 4GQ9H 3QUKB 5DVKA 2VZVA 2QEJA 1EO8L 1G7MB 3MCKB 4JR9L 4M6ML 4AMKH 5DMIL 4QWWD 2G75B 3RRQA 2JJTA 5FKPB 2DN7A 1G9NH 4OZIE 2CLZB 4H88H 3CUPA 3A6OA 4FXGA 4HIHA 3DIFB 5FYKL 1P4IH 1Q9WA 4JLRA 3BSZL 2P4AB 4MA8L 3MRRB 3I6GA 5CP7A 3QFJD 5GS0L 4G5ZL 3P0GB 3QXUA 3RPIA 4D0BB 3LQAH 4QTHB 4HZAA 1OAKH 2A38A 5F1NB 1MIEL 2FJFB 3I2CL 4LAQL 4MNQA 1NLDH 3HHRB 5DC9B 4UQ2B 2E6QA 2P8MA 1NCTA 5E4EB 3I6KB 3AY4C 5IJKA 1F6FB 2APVA 1DEEA 3GO1L 2FLRT 2FH6A 4OLVL 5M95B 2JB6A 4P2YA 1Q94B 3WXWL 4DKEH 1IBGH 1UXWA 1T7YA 1XZ0B 1MLCA 2YXMA 1XF2B 5JOPE 3X3GL 1ZT1A 3QR2A 3PDOA 2BOCB 3ARGB 5EFIA 5B38A 4MX7B 1MHCB 3F8UB 1II4E 3AB0C 4OZGF 5ADPL 3SBWA 1HI6B 2OS7A 4NWTH 4EN3D 4AIZA 2WIIB 5CIPH 2Z4QA 3EOTH 1U8LA 2FSEB 4YR6A 5KAQF 3RIAK 3B4NA 1WWBX 4XPFH 1UZ8B 4JM2D 4JREB 5J13B 1AGCB 2EICA 3VXPB 3O2VH 3CK0L 4TQEL 4Y16C 5F1OB 3T3MF 1BGXL 1RJLA 4XHJD 2MPAH 1R3HB 1WISA 1JUFB 2RJMA 3MUJA 1L7TH 32C2A 2J6EL 3QEQE 3L3OA 1WFOA 4L3ED 3NBNA 5KJRL 4L9LA 2OK0H 5ILTH 3HMXH 1ZA3A 5E2UL 2P5WB 5ICXA 3QUXB 4PRBA 2R2BB 3QBTB 3S96B 4L5FH 1T4KA 2PF6A 2X40A 43C9B 4JHZA 3B2VL 4L8CA 4JAMA 4W6WB 3VXMD 5KSBE 3GMMB 2VLRD 5F96L 4JKMA 3GRWH 4JFPB 3GUTB 4XMKL 2JELL 3DV6A 4P2RB 4WI5A 1NLBL 1ZLWH 5J6HA 1XEDA 1CFTB 3OKLB 1RFDL 4U6HB 2H8PA 3TPUA 5TDPB 5E2VL 1KJ2L 4JHBA 2GT9B 4BSJA 1CGWA 3FB5A 2D2OA 4LPCA 4PG9B 5DRNA 4KJWC 2HN7A 2R2HB 2UVEA 4X6CE 4KZEH 1HKLL 1BQHA 2I9TA 2R9HD 3G5YB 3ETBF 5HXMA 5I1JL 2X4PA 1UH3A 2DJSA 1J8HD 2VDRH 1K4DB 3LN4A 3CLFL 1FCGA 4KRMB 4JFDA 4RMWA 1VKXB 5LBSH 4GRMB 4WV1C 2AJVL 4KAQL 3D25A 4HWEL 3TIDB 1DVFC 4D94A 4HWZB 4NNXA 1ACYH 5FCSH 3RGVA 4ODUA 5J4MA 2AXJA 2EC8A 4FQ2L 3CX2A 3QRFM 2QKIA 2LVEA 1U3YA 4NYLB 5LG1A 2DI9A 1NCAH 1YECL 4MDIB 3S35L 1JI2A 1CFSB 2BHYA 2F5AL 2ILLA 4WW2C 3DGGB 3UTSB 5GS3A 3D5OF 1LDPL 4NC2B 1RUKH 3NPSC 2HA1A 1MCNA 4DZ8A 1Z5LB 2P24B 2Y36L 5MENA 5DD3H 1FDLH 1LEIB 2DWEA 3EOAB 4MZ3A 4PGEA 4DZBA 4WUKH 4YXKH 4PJXE 5CD3B 2D4DA 4M6NH 4PB0L 5HDQL 2EEAA 1WF5A 2VXVH 3QCVH 1LQSR 4OLUH 4P2QD 4APQC 1I3UA 1E6OH 4CU8A 4K07A 2F54E 2Q7YA 3QHZL 4OLWL 3CPLA 3W9DA 4Q2ZB 3KPNA 3O6MH 1TETH 2A9ML 2QR0A 4HWBL 3SE3C 3RVVD 2BY3A 1N3NB 5HHNB 1DBMH 3MMEA 4DCQB 2OJZH 2A1WH 4Q74A 4JO3L 5C92A 1MJJB 5FKAA 5SWZB 3HNVL 1NC2A 1ZS8A 3QIUB 5JQHC 4LLWB 4LSQL 5TGBB 4KVCL 1DUYB 4ORZC 1OW0A 3ARTA 4WFGD 1U8HA 4NC0B 4TSBH 4HIJB 5D8JL 2CRYA 2R69H 3RWHB 3GMQB 4QHUA 5ERWB 2IGFL 1S7WA 4EDXA 2ZCHH 3CFJB 1F6AB 1XMWA 3ECBA 2XN9D 3BGFB 4HZLB 4LSVL 4GOSA 3QXWA 3H42L 1WAAE 3LKQB 2XKUA 3UYOD 3OXRA 2DQGH 5E5RB 5B3JF 1IFHL 4HG4K 1HHKA 1NCCH 1XAUA 1F42A 4KFZC 4PY8J 3EO1B 4YHZL 5F3HA 1V3LA 1MF2H 3RTQD 3RZWA 1HEZA 1MCFA 3RWGB 1KACB 3QCUL 1KLFA 1DQDH 2J4WL 5IBLD 4Y19D 1P7QA 3ULVF 4P46D 4CVXB 2FEEI 3VMNA 1DBBH 2B2XH 4X8XA 2EDQA 2DQFA 4YHIB 2EH7L 1LEKB 2CK0L 4TVPD 5K9KA 1E4XI 2ZUYA 2CIIB 1KT2B 3A6CH 4QRRB 2FDBP 3X13B 1KIRA 2X44D 1J0KA 1H5BC 2X1OA 2AV7A 1KJMB 2R2CA 5AZ2L 3V4PL 5DMKB 1FO0B 1OF2A 4XCFH 5CSZA 4I48A 1L4IA 1XCTB 3KPOA 5FDWB 1Q9KA 4HJGB 1MFBL 5I8EA 5E4EC 2YC1B 4QF1B 4GW5A 4BSVA 1RURH 2FD6L 5TE6H 2NY2B 2FZ3A 3MRKB 4JFFD 3ZT5A 2W9DH 1I3RA 3KHOA 4O5LL 2P5EA 1V7MH 4U0RB 3RUGB 5IFAL 5BO1L 1MCWW 1DQMH 3DUSA 2DIJA 2WQRA 5GGSA 1W0YT 4NM4H 2IJ0C 2IMNA 5HPMA 3S34L 2G5BB 4LVOB 2AJYH 1JZ6A 2EYTB 3BT2L 4GW1B 5I1LA 2EKSA 3NCBB 4I5BB 4M9OA 3UXFA 4TULL 2J5LB 2D9CA 4JREC 5J13C 2O5YH 4L8SC 1UKSA 1RIUL 3DXAE 2DL2A 1U93A 4C56A 4LLVA 4NRYB 1HHHA 1XF5A 1HHIA 3UTTD 4UU9A 3GIZH 3F12A 1IEAB 5HI5D 4K8RC 4XCEA 3OR6A 3ELAT 3EGSB 4QYOA 4K3DL 1IEBA 4JY6A 5SWQB 5FA4B 1ES0A 1X5ZA 2QLVB 5KVEH 5C07E 3QUXC 4J3OC 2LFGA 4LCYA 3W39A 3BFOA 1T04B 5DWUH 5CFHA 5EG6C 2AQ3A 3O2DH 2V5SA 1AD0B 4JRXB 4PREA 5F93C 1QG3A 4JB9L 3TJHC 3MRNA 5T1MB 4XXDA 5BV7H 3IDNA 1F11B 4PRPE 1DN0B 3RDTD 2I26N 4YEFA 1BMGA 3BP5A 3TO2A 2VNCA 4X6FA 3OJVC 1D6VH 1IAII 4GKNA 1A14L 3V6BR 1JYNA 2IFFL 3ARFD 1WLHA 4RBPK 4UV7L 3DETD 3QDMA 3PF2A 3VWJD 4AENB 1YA5A 3BUYB 4DFHA 4XXCC 4B50A 1U95B 1UVQB 3DRTA 3VFNA 3VG0H 3QDGA 1DLHB 1WTLA 3KLAB 2PYEA 2HH0H 5IKCA 3QIBA 5HGBA 1QSEE 2BDNL 1L7IL 2ZP0T 1VEPA 1BM3H 4HQQH 4CW1B 4F3FB 3LS5H 4D9LL 1IC7L 5E8OA 4NO2A 4JRYD 3BX7C 3RKDC 3PHOB 1YYLH 1W8OA 4NKOB 4PGCB 1QRKA 5I19L 3QULA 4X98B 4ZFGL 3GI9L 4LRIC 1NAMA 4Z7UB 4XNMB 4PJ8A 1ROWA 4XRCA 5JTWA 5TH2A 3J7HA 3DX9B 3PWPA 5C08D 3WJLC 2E9JA 4ZTPL 1E6JH 3OAZK 1F4YL 1FNSH 1CLOH 3GMNA 5D7IE 1IGTB 4F58L 3T4YA 1EBAA 2WBJA 3O6KL 3JVGA 4D3CL 3RVXD 3K1KC 5A1AA 4LCUB 3EYFA 4XAKD 2FCBA 4P23D 2YUXA 4NQDB 4I13B 2F15A 1NGPH 3H2WA 4K9EC 3QJHB 5TE7H 3GSNA 1QSFE 4WFFE 2ADGB 4U2ZA 2OSLB 2VDPL 2P8PA 2X9XA 3S6CA 1KPUA 3VFGH 4XTRC 2OL3L 4A2MA 2DI8A 3ULSA 3QEHA 5LGJA 5CZXC 3U36B 4JFQA 3T77B 2HTKD 3CXDL 2C1PA 3RVUC 5EO9B 1UB6A 3OB0K 5I30H 5F7LB 3BP7B 1MRDH 5J56B 3VXOA 4Z7UF 4RIRA 4BA8A 4YE4L 3B6SA 2WNGA 2YS4A 5JOFA 1OAQH 3QHFH 1LK2A 2VL5A 3IJHA 3QIUC 4GAJH 2Z8RA 2XQYG 1TTUA 5B4MC 1T89A 3ZDZE 4Y4HD 4K7FA 3CMOH 5AZEL 3K2MC 2YA2A 4TSCL 3PP4H 3U4AA 1QBAA 3D39B 3PQYA 4K3JL 3IDGA 3SDAD 1K85A 5E2JA 4KXZH 1JZ5A 1UXSB 3BGFC 3QQ4A 1NL0H 5FUOL 4LHUD 3RWEA 4UDTB 3SGEH 1GGYA 4KC3B 5E94A 5E8DH 3VCLA 4QT5A 3O8XA 4LSUL 3SDCA 3V95A 2BSRB 5DUPL 5EIIB 4QHLA 4UDUA 1IARB 5EA0H 1OP3K 3G04B 3LVEA 4U1HA 3PGFL 3SOBH 5SWSB 3UTPE 4U31A 4P99A 2A6DA 2VAAB 2HJKA 3OG6B 4LRNH 4XPTL 3G6DH 3MROB 4WY7H 3X11A 4ONHB 5LGKA 2H6PA 3MV9B 4HWNA 1I7ZB 4J8RA 2K3TA 2Z8SA 3SGDH 2FBOJ 4XPGH 2AABH 5CJ8A 2WZPD 1NC4A 1PYWA 3PG2A 3TVMA 1DFBH 3NGBB 4YFLF 1NCBL 2HFEB 1TVBA 1WZ1L 5ANMB 1SYVB 5GRUL 1D6EA 1CXKA 4KQ4H 1RQ5A 4PB9L 4XP9H 5KVGH 3C6LB 2GFBA 4XVJH 3EYOB 1UM4L 5FGCE 4M7LH 5ENWB 1K6QH 3ILPB 1I1YB 1OTTD 3GMLB 3MPCA 3BEVA 5MI0B 1VGEH 4Z0BL 3HE7C 4ZG1A 1R5VA 1BZ7A 2VO5A 3WJJC 3IDXL 3RY5A 1LNUB 5GGTA 3DJ9A 4JRWA 4U0RC 3RWJA 3C8KA 3MLZL 3D9AH 5C0IA 1HSAB 4N8VB 1AKJD 3O11A 3FL7A 3HZMB 4J4PD 4BFIB 1BIIA 5GJTH 2IALB 4UT7H 1NSNL 3FAXA 3HI5H 3GI8L 3I50L 3V79C 2EIBA 3AS1A 4OZFH 3CLEH 4S0SD 2BRRH 4EOWL 3PJSB 4UV4H 3BO8A 5DJDB 3I85A 4WFHD 1L0XA 2EDHA 1N4XL 1W72L 5I9QC 3KPSD 3QDJD 1IQWL 4UQ3A 4L29B 5ACLA 3MNZA 1TQCB 4O4YH 1N5YL 1KN2H 4NQEE 4U3HA 1VFUA 1RZ7H 1S7QB 2QSQA 4KY1H 1Q1JH 3SEPA 4XWOC 3NA9L 4JFDE 1WBYA 2PXYA 4EI5A 3VFWB 4Q9RL 1QLEH 3NIDF 3QP3A 5FV1L 1AD9B 3G6JE 3GBML 4R90H 1T2XA 2X4QB 3CDGB 1YEDA 3PDDA 3THMH 2OI9C 4BK4A 3HUJF 1S3KL 5KVDH 2DBLH 3CZFA 1SYSB 1UB5B 4OIAA 1YN7B 3IS1X 4OUUB 5F6HJ 1MCIA 3QNXA 1LO0H 1RZKH 3FFDB 1QNZH 2CO6B 4PRID 1UADC 3L5WB 4KRPB 3MLRL 4LSRH 2AK1H 4ZAKA 2EYSB 1H8SA 3OKKA 4AIOA 2XA3A 3CFCL 1YJDC 1T0NA 3U0TA 3QG7H 3DVGB 4XPHH 2CLRB 3UP1A 2AXFB 5JPMA 3BQUB 5FYKE 5GSRB 1I8LC 5IVOA 2B20A 4GLRH 1CQKA 4OZ4B 1F4WH 5J1SC 4LCWD 4YUEH 1J11A 2B1AH 3D85A 4V1DE 2GJ6B 3QQ9D 5F9WB 5GGRA 5HGHA 2WBKA 2JJSC 4LP4A 4S1QH 3GHEH 3NCCB 1K9TA 5DSCA 1XF4A 5FM8A 1S9XA 2WUBL 3LZFL 3BIAX 2XWTA 2C3XA 4TTDC 3REVB 2J7LA 1B0RB 5HPOA 3HI1B 1RZIA 3VXRB 4OD1H 4Q6IC 1FL5A 3DVFA 1LEGA 3KPRD 3S7GA 3S4SG 4ELMA 4KI5D 2VDML 3LKRB 4E0RB 5FO9A 4BZ2H 3CIQA 4PJEB 3KPPA 2J8UA 5I2IB 1JPGB 3CC5A 5IP4A 3T65A 4R4FL 5CCKH 4M1DH 5F89B 3U7AA 1EEYB 3BKCH 3U7WL 2FX7H 1HILA 1VACA 3ARQA 4LARH 3IDJA 2NW2A 4WI6A 3ARYA 3F65A 4U7MA 4XP5H 3SE4C 3G5XB 1TZHB 5ISZA 3M1BA 3NCJH 2VKWA 2D7MA 4NZUH 4OT1L 3ESVF 3GSXB 4OIBA 4F2MA 1CFVH 4JQIL 2R0LL 4LP5A 1WFTA 1JPSL 4ODSL 2Y7QB 4KTEH 3EJYC 3O9WA 2DLEA 1OGTA 4NKDB 3QUZB 2DYPB 1OT2A 4KJYA 3HR6A 3WXVL 5LVEA 1FFPA 5JZ7D 5J11B 4DOHB 1UKTA 4BSWA 4OD2A 2EC9U 5BRZD 3RWCB 4J12A 1HHGB 4DUWA 4PFEA 2MSPA 3SQOH 1MCPL 3OV6A 5C0EB 3KPMB 4PJEF 1DQJB 1D5XB 4HPYH 2FJGA 4TNWK 3LS4H 4HS8L 1C1EL 1A1MB 4NDMA 4X80H 1NDMA 1DBAL 3RY6C 3T8XB 4GRWB 2BC4B 4FG6D 4AM0B 2V9TA 1G9MC 3KXFD 2H32H 3LQZA 1FE8L 4NRZB 3V52H 3WDHA 5C7XH 2VN4A 2W60B 3FQNB 4JPIA 1T2QL 3FFCB 2DAVA 4ESKA 2HT3D 4PJBB 4PJCA 1S7VB 5DD6A 1J0JA 3N85L 3MRJA 3VFPB 4L3EE 5L7XL 2L0DA 43CAB 5GS1B 4L8BA 1KYOK 1ORQA 5TJWK 5EC2A 3R06B 4WO4A 3BD4A 4WWKA 4LCCA 1GXEA 1HK6A 5LCVH 3V6OA 1A4KA 4Y4FB 1TNMA 2HFGH 4N0UB 5D72L 4YFEA 4AQOA 4MXWH 1NCUA 4KROB 3HNSH 2OTPA 2VC2H 4FQLH 1DUZA 1RZGB 4UTBH 1JWMB 2HTLD 4IDLA 2VLRE 3L7FB 1KELL 1PVHA 1MJ7H 2BNRD 4M7KH 2VLMD 3T0BA 2HKFH 4K3EH 2K7QA 5C0BB 4Z76B 4GRWF 3VJ6B 2ITDA 4PLKC 3H9ZA 5BS0E 1YNTA 3O4OB 1ZVHA 3NGBC 1IQDA 5DHYA 4AL8L 5EBMB 3VFUB 2ENYA 4YPGA 4XBPB 4M6MH 2O93L 5DMIH 4Z7WA 1FV1B 1J8HE 5MP6H 2NX5D 1JHLL 2FO4B 2L7JA 3CCHA 4CJ0A 5FYKH 5CIPB 5D7SL 2QQQA 3BSZH 3MRGB 4ZO9A 2YUWA 3NH7L 1E28B 2YD5A 5GS0C 2F53B 3RI5F 2R29H 2DM7A 4JKWA 4X83A 1FC1A 4NQCA 5JA8B 1MIEH 4LAQH 1FRGL 2FHCA 2JB5L 4MNQD 1QRNA 3T0EA 1EHLH 5DR5L 3VWKD 4WRLA 4JFYB 2XICA 3IETB 35C8H 2MMXA 5D2LE 3SQBA 2EDEA 5I1KH 5GS2H 5E8PB 1AO7A 3OG4B 5E8NB 1XR8B 3U9PL 3NN8B 3GO1H 1FSKB 4GH7B 4QWWC 3W11C 3OF6A 2YPLE 3VDBA 4IHOA 3LOWA 4HW6A 4OLVH 2DQUL 5A16A 3WXWH 2X1PA 5MEPA 3V8CA 2BFVH 1NFIB 1R6VA 3GIVA 3X3GH 3RGHA 1TQCC 5HYSA 1FG2B 5IHLB 2HMID 1UWEL 2PTVA 3ARBA 4B41A 5D7LA 5DMGD 5C3TA 3H9HA 3U9UA 3NFSL 3O0RH 1MFEH 2V7HA 5J3HC 5ADPH 5DD0H 25C8H 1A9BA 2F58L 3IAPA 1TCMA 3TA3A 4ERSL 1KC5L 2EH8H 3C5JA 3LMJL 1RK0B 1CICB 1BFSA 4XVTL 4UOW1 1BECA 3X12A 3V5DA 2YD9A 12E8L 3T3PE 4NBZB 4NNYA 2VWEE 3GJFK 3D48R 1KNOB 3PHQA 4M9PA 4ZXBA 5I1GH 3HA0A 1BGXH 2Y5TA 3VXTA 4IMKA 2P43B 1VPOL 4KRPC 2EECA 2J6EH 5DRXA 5TQ2H 1I8MB 1A1NB 1IGYA 5JO5A 4HUXB 3MA9L 2JIXA 5EO0B 5KJRH 3BQUC 5FV2A 2VDLL 5DD1L 4MMZC 2IF7A 5HYEA 5E2UH 2FATL 3IU4L 3B43A 3JUYA 1U8IB 2NW3A 4EN3C 1LE9A 2XN9E 1M7XA 3B2VH 4JM2C 3GBNH 2I60H 2YD3A 4R2GB 1ED3A 1DANU 5ID0A 4KTDL 4H5SB 5CZVL 4GBXB 4I0PD 5F96H 2GCYA 4XMKH 5IHUL 2JELH 4D9RD 4W81A 4W4NA 5DS8A 5F8QC 4X8JB 1RFDH 1F5WA 5E2VH 1KJ2H 4Y19E 1MFDL 5IROC 3RNQA 3DTXB 1J10A 4JKPH 5FO8A 1PG7W 3NZ8B 1NUGA 3F5WB 3MYJA 1HKLH 1QHOA 1KULA 4HS3B 2WANA 2NY6D 2BNQD 2AJZB 5DDHB 3TIEB 1RZFL 1UCTA 3QG6A 3FT3B 4FQHA 4N8CL 4OQ1A 4R4ND 2WUCH 1I1RA 4PLOB 1QFHA 1AQKH 1Y18B 2AJVH 4KAQH 5ICZB 3IFLL 4N0FA 3OKOA 2MQCA 3UC0H 1LP9A 1RJZA 1P4LA 4FQ2H 1K8IA 1BVKA 4LLYA 3UBXG 2W59A 4O00A 1FN4B 2VXUH 1UCBL 2FECL 1FYTE 3PABA 3VXUA 3ZHLA 1T1XA 2X4UB 1EEZA 2F5AH 3RL2B 2R9HC 5F3BA 2XZAH 2B4CC 1OP5K 4OGYH 1VFBB 3RHWK 3ULUL 2RQ8A 2XZZA 1IC5H 3HTLX 4OZIF 4ZFOL 3VGHA 2Q8BH 2N56A 4DAGH 3BYTA 3K46A 3B5TA 5HGDB 5HYIA 1RMFH 4MS8D 4L4VE 1ONQA 4PB0H 5DHVA 1CXLA 4JQVC 5HDQH 1SVCP 1V3JA 4Y5XC 3E3QC 5SV4A 3V0AC 1DQTA 2N7BA 1MUJA 3ROLA 1FNGB 5DJ2A 1FNAA 1ZMYA 4WI8A 2PUQT 4OLWH 3SPVA 2YA0A 4PRNB 5TDNB 4UUJB 3FT2B 1TCRB 3HPJA 4HWBH 5GS1C 3SDDB 4G6FB 1EHNA 4KU1A 3HNVH 4S10A 4Y4FC 4LSQH 1KXVC 3IKKA 3L3DB 3QXAB 2V2WA 1MRCL 3GSWB 5EIQA 3H3PL 5H94B 2ORBL 3TN0B 3B9KB 3BRFA 4OM1L 2IGFH 3FB6B 1S7XB 4MB4A 2VUYA 4S1DD 4WW1B 2BX5A 3PV6B 4KDTA 1G6RL 2X4NB 5AAMA 2C4FU 4LSVH 3H42H 4BUGA 5ADOL 5CUSL 4Z7VA 1ZTXL 4Y2DA 1G84A 2BY1A 1HOCB 2BXZA 1H3GA 1UC6A 2EDKA 2JCCA 4RX4D 5IVZA 5CEXB 5CJBA 4K94L 4XC3L 1IFHH 1UM5L 3O6FD 1G7LA 2D7NA 2CGRH 4X6CB 3D2UD 2QSCH 3O4OC 4DVBA 5FF6B 4PJGA 4YHZH 4ODWA 2E5EA 1ND0B 2A6IB 2XY2A 3LIZL 5DEFA 4JFZL 4M7ZB 3QCUH 1H0DA 5DUBB 3TNNB 3PE9A 2AXGA 2YA1A 3C9NA 4Z9KB 3C09B 3QUMB 1FG9C 2Q86B 2CK0H 1Q0YH 2CR6A 5DJXB 4JRYE 4PRDB 1WTGT 3C08L 3REWB 3IF1A 3I75B 1QSVA 5KVFL 1FL6B 4NO5B 3MRMB 4NKQB 3UTZA 3CZJA 4HIIB 2P8LA 3GSNH 4W6YB 3V4PH 1J86A 5K9QI 3BVNB 4HLJA 4Y5VC 3P77B 5KSBF 2NLJB 2P45B 5E95B 1C08B 1S5IL 3HPLB 4MAUH 5E8EA 3FHQA 1KUMA 1I9RH 3MLSL 3RTQC 5C08E 1A7NL 5FOBA 2AW2A 1AY1L 2NY4D 1R3IL 4TN9A 3VFTB 5JDSB 3VG9B 5D70H 1X5FA 4P46C 1TVHA 4O5LH 4YPJA 1NPUA 3C5ZB 5BO1H 4X6CF 3OZ9L 1NGQL 3IFPA 1P1ZB 2R1WA 4DQOH 4PJXB 1JWSA 4MQTB 4LKCB 1KFAH 1PKQE 3S34H 3PWLA 1JV5A 4RMQA 2Q1EA 4X5WA 2VZ1A 3BT2H 4JQXC 1PKOA 1N0LA 4TPRH 3DROA 4NO0A 2IQAA 2X4SB 5FHBL 2FIKB 2F54B 4JFHD 5J9PB 4J3XA 1CICC 4HUVA 4IOIB 4M7JL 1P6FA 4OFIA 4S2SB 4ELME 3ARVA 3TBYA 5IB1B 1CFQB 5HHXL 3BH9A 1EGJL 3KS0H 4IRJA 1RIUH 2V7NA 3M45A 1IVLA 2AGJL 1FZMB 3MGOB 3AREA 3SO3B 1NMAL 5I1HL 5IOPA 5D9SB 1IGJB 5EN2A 5HY9A 4NKMB 2EE9A 3GBLA 4CJ1A 1FJ1B 3AAZB 3HKFA 2DQDH 1D5MB 2C3GA 5E5MB 2AQ1A 1YEIL 1M7DB 4K3DH 3KYOA 1VEMA 1I8IB 2BOBA 5DO2C 1WT5A 2E9WA 3V7MA 4HWUA 3HLAA 5JW5A 1VFAA 1CFBA 3P11L 3IKCA 2VLKB 1YEGL 1A1OA 1KB9K 2ZOKA 1U58A 5C70A 3V8OA 2VYRE 3QI9B 4PJXF 3WE6A 4MXQD 1LGVA 2X09A 4PTUB 2BNUB 1D9KB 1N5AA 1FZJA 4RGMB 1GZPA 4R2GC 3MLTA 4X99B 4Z6AT 4DGVH 5D2NB 4N9OB 4N1HB 2CIKB 1UYWH 3CSYB 5DRZA 5KG9B 5HI5C 2EDTA 1OCWL 1KCLA 4OZGA 4E41B 1M71B 3DX8B 2NY1B 1A4JB 1F58H 1W8NA 3QDMD 4NCC2 5DUMH 2HLAA 3RWIB 1F8TL 3DSFH 4G8EA 4U3CA 3PL6A 3QH3B 1Q9LA 1T1ZA 2IBZX 3EW3B 4OQTA 4QTHA 1SJHB 5FHAL 4D0BA 2LAAA 3QDGD 4PJDB 3MJ7B 1QFUH 1YQVL 4UQ2A 3QIBD 5HYQB 1JZ4A 2ARJQ 1L7IH 3FN0H 2VDKL 4OCRL 1XCQB 3KJ6L 4ODXB 5DQ9A 3I6KA 3CGTA 3RX7A 3RDTC 1WAAF 5I19H 4TRPL 1KPRB 1Q94A 5IR1B 3GI9H 4MD5A 3ARFC 1N7MH 3QJFB 3OKNB 1UWGL 1INDL 2L7UA 3B83A 1AGBB 3HG1B 3DETC 3V6OE 5CKAA 3PWUB 3VWJC 3GK8L 4H25B 4MX7A 1MHEB 1MHCA 1XGTB 3T4AB 1SMAA 3GM8A 4F58H 4MYWB 2DF3A 3O6KH 2WBJD 2KZWA 2F74B 3DRQB 4D3CH 4ZPTB 2WIIA 2FSEA 2H2SD 3SKNB 4GMTL 1RUPH 1PEZA 3MLXL 4F7EA 2AJ3A 3TO4B 2M26A 1HIML 2EE6A 5JHDA 1XGYL 3P4NB 1B3JA 4DN3L 5IWLC 3DXAB 2DQHL 1R3HA 3UTOA 2XWBA 1FFOB 2OL3H 1J1OL 1TJHL 2R4SL 3M17B 4N8VG 2HWZH 1MIMH 3RL1B 4YX2L 2IH3B 2CRIA 2NY5L 2CDFA 4M5ZL 5CGYD 1J1XL 5CJ5A 2ESVA 4S0TD 1K8DB 5J12C 4DVRH 1JZ3A 4PS4L 3LHPL 4EIZC 3U4BL 4YE4H 1JF1B 2R2BA 2M1KA 5JHLL 1WWCA 5C07B 3S96A 1VHPA 3L9RA 4WTZG 1YY9C 4JZJB 1GC1L 1U41A 3T0EE 5CEZH 4PRIE 5AZEH 4OZHA 3GJFA 1FP5A 2E7MA 3TN0C 4K3JH 3PQYD 2P44B 1ODAA 4JFPA 5C0GA 5MEOB 2Z35B 5FGBC 4P5MB 3OKLA 4U6YB 4KJPD 3CAFA 1PZUB 2HTKC 2JE8A 4PG9A 5K93A 3O8XD 4LSUH 3FQUA 2R2HA 1F4AA 1IEHA 2PNDA 3QPQD 4U33A 3IGAA 1IILE 1NBZB 4CVZB 1JZ8A 3PGFH 4YBQD 1A47A 5D7LE 5CEYA 4MVBD 1K4DA 5I1DA 4M7ZC 4PYGA 1NBYA 5IFHL 4UAOC 1QSEB 4GRMA 3HAEA 1V8HA 4OZFB 3EIFA 3BKML 3VGGA 1AHWB 4JM4L 4HWZA 3SJVE 1F45A 2AKRA 2NR6D 4R4BA 4OI8A 3F62A 2YBRA 4M4RA 1KENL 1MCCA 2AEIT 4DTGL 1NC4D 2XKSA 3MOQA 3TVMD 3SE9L 4XNXH 4MDIA 1NCBH 3MV8A 1WZ1H 1LMKA 5GRUH 1G7HB 3K74B 5TFSH 4PB9H 4HFWB 4XVUD 1UM4H 2VOTA 5HYJD 3QO1B 4XB8A 2YN5A 1EEUA 3MOBL 4WU7A 2YKLL 5D7IB 2WAHA 4Z0BH 3CVIH 2HT2C 1MREL 1WICA 2DRUA 4XPBL 3IDXH 1LEIA 2IBGA 4NJ9L 1UEYA 3MLZH 1NBVH 3HI6L 4K7PX 3G5VB 3G5ZB 4PV8B 1NSNH 1QSFB 4LF3B 3EJJX 3I50H 3ISWA 3VFRA 2A9NL 4YHNB 2BVYA 5T3ZD 4M1CD 5HHOA 1QEWA 5ITFB 1PEWA 1SJEA 4OBRA 1DCLA 5A43C 3TBWA 4EDWH 1MCSA 3MJ6A 2CUIA 5BRZE 2MFNA 2V2TA 3MCLL 3QEGH 2R0KL 3NFPA 2CKBL 4Q2ZA 1EH9A 5E2WL 3I3EA 4KDVA 1N4XH 1Q9WB 1BQLL 1IQWH 4JLRB 4LIQL 4YHLL 4OV5B 4ZO6A 3SO3C 1MJJA 3I6GB 1CR9L 1ZLVH 1AE6H 5I17B 5L8LB 2XG4A 3RPIB 4LLWA 4X4MA 5TGBA 1DUYA 2KZ1B 4PJ5A 4B7IA 4TOYH 3HMWL 1H8NA 4EI5D 4HIJA 1XGQA 3VGFA 1BPVA 5CJXA 2BSSA 2P8MB 5D7IF 3QCTH 1V3MA 4I77L 1XGRB 2WLYA 4NM8L 1P5VA 4JVUA 1DEEB 5C0CE 5DF0A 3ARDB 4P4KD 2VXTL 2DQJL 2JB6B 4KXZI 3WV0A 1D9KC 1MLCB 3DSNA 2EDRA 2IWGA 3K8MA 3MLRH 4N68A 4ODVL 1XIWA 3KYKL 4UNTA 3JWOC 1ZT1B 3SGEI 3CFCH 5BJTA 2GEEA 5D2NC 3PDOB 4YBHA 3VH8A 1JK8A 5EFIB 4RBPH 3WDJA 2VZOA 4CVXA 4GXUN 4PGBB 5DURD 3EKCA 4XP1L 3BP6B 4YHIA 4AIZB 2NY1C 3SGJA 5KSAA 2Z4QB 4XNZC 1U8LB 3KLHD 4YR6B 1G1CA 2VLME 4WHYH 1AJ7L 3EDDA 4QRRA 4QHNA 3ES6A 1P6AB 3CFEA 2C26A 4HJJL 3S37X 1KJMA 1GAFL 5J7CC 5DMKA 3BPLC 4HH9B 5HHVL 3WO3B 3ZDYE 32C2B 1S7UA 2DS4A 2NZ9D 5DJ6A 3JTSA 2NX5E 4HC1L 5CD5D 2VDMH 3L95A 1NUNB 3B9EA 3MNVA 4HF5L 4WWID 2XTJD 5TDOB 1OAXL 3K8LA 5ICXB 4PRBB 1OSZB 1T4KB 4UT6H 3QQ9C 1X5KA 5GSVA 5CHNB 1P9MA 2DDQL 5KSVB 5AYQA 5IIEA 3IVKA 3S36X 4ZMAT 4RAUA 5ISZD 4PLJD 4XPAH 1JN6A 1C5BH 1KCRL 1I9JL 1Q9OA 3TPUB 1LILA 1RUMH 3JSSA 2R0LH 4BH8A 1JPSH 4KI5C 5DRNB 4C83A 5JW4Q 3O9WD 2HN7B 5DQDH 4J3WA 5EO1A 1ZANL 3WXVH 4UB0L 5JIIA 4JHAL 1R3JB 2X4PB 3OB0H 3T0WA 3EGSA 4JFDB 1KTRL 1MCPH 2H41A 2D4FA 1TLKA 4QOKD 2ZNWA 1KB9J 4JO2L 1XT5A 5GISL 4I3RL 3D25B 4DFIA 1I1AD 4NNXB 3G6JB 1QLRB 1P7HL 3RGVB 4ODUB 1DBAH 3WYRA 4L4TA 1JTPA 3HZYA 4ONGL 5KW9L 1T04A 1FE8H 2QKIB 4QRQB 4JZJC 4BKLB 3WHXA 1T2QH 1TQBB 1HXYA 5T1MA 3IJSA 5F1IB 1KLGA 2KQMA 2OQJA 2YPVH 5JZ7C 1RZJL 4MJ5B 3QRGH 1OM3L 1IRAY 1REIA 2XQYK 1GIGL 3CVHL 1CBVL 4GAGL 3MLUL 4WO4D 5MENB 2DWEB 4NFDA 3OJDB 2XFXA 4PGEB 1OAYL 3ARRA 1U95A 4GLRI 4DZBB 4M61A 3IB4A 2ZCKL 4OUOA 4RGNB 3KLAA 2LTQB 2VL4A 1C16B 3VMPA 5T1LA 4BQ9A 3AROA 4OV6F 2AEQH 4CW1A 1AFVH 2EC9T 3SKJH 5JXEA 3LRHA 3G6JF 3ORJA 3PHOA 4NJAH 4P9HL 3CPLB 4S11A 5JQ6H 5J06A 3KPNB 5GPRA 2QR0B 4X98A 3WD5L 2VMFA 1UJ3C 3RZCD 4R7DA 4AL8H 1QUNA 5K9QG 1NJ9A 1L0YA 3IDYB 3EOYG 2B1HL 3GNMH 1NC2B 1ZS8B 2BNQE 3ULUE 4CVWA 4Y4KB 1OOAA 4RA3A 5JDJA 1U8HB 5AWNH 1C8PA 1IGTA 1N6QL 2BVQA 4XCCL 5GQBA 2ADFL 4QHUB 2HTLC 3NH7H 4EDXB 4XNUL 1S9YB 4R97B 3SE8L 3TLRA 1WIOA 2QADB 4X9HA 4NQCD 3KPTA 3PHSA 3CFBA 5C0AD 1HDMA 2C9AA 3OXRB 2YWZA 4KMTL 2JB5H 3HE6A 3OL2A 3PWJA 1QRND 2OSLA 3P0VL 5DR5H 3O45A 1HHKB 5DHVH 1QOKA 1INQA 5DJCA 4HFUL 5F3HB 3V4VL 4FABL 1HEZB 1AO7D 3U9PH 4D0CA 2ZSVA 5AD0A 3OF6D 1BJ1H 3JWNC 1P7QB 2DQUH 5EU7C 1Y6MR 2DQFB 1CTNA 1UACH 4OCWL 2YEZB 4DN4L 3R1GL 5K9KB 5BOZG 5ID1A 4X6DA 1KIRB 3NFSH 4X4XA 1A3LL 4JANB 4MA7L 2NYYD 2AV7B 5INCA 2F58H 5EU5A 4NHCL 1CTOA 4OBSA 5CSZB 1Y6NR 4HEPG 1KC5H 4HBCL 4X5XA 1Q9KB 3LMJH 5I8EB 1AR2A 1HCVA 4XVTH 3WN5A 1KJ2B 4BSVB 3BXNA 2FWOA 5IJKC 4CN6A 2FZ3B 5AG8A 1FLRL 3QNZA 3E0GA 1I3RB 3CD4A 2P5EB 1T83A 4NZDA 1VPOH 3QIWA 1NCDH 2GHWB 2HFFB 5IESL 3G04A 2Z91A 2UV3A 3V0VA 5GGSB 3BDYH 3K80A 3F7PC 5DMGC 5HPMB 2JIXD 1OGAD 3GKWL 5DD1H 4NSKA 2ZUWA 4AY0A 1P4BL 3MROA 4FFYH 5GZND 3SBWC 4O2CA 1EMTL 4MCYA 4R9HA 1I7RB 3EYUL 1E0OB 4YO0A 2VAJA 4LPYA 3AC0A 2XRAL 5BS0B 3OPZH 4QEGA 2E9IA 3ESUF 4KTDH 4LQ1A 4PBVC 3V4UL 2I07A 3QUYA 5ANMA 4C56B 4LLVB 1HHHB 1O7SA 1XF5B 4Q0XH 4UU9B 4AG4L 2QHRL 5IHUH 3F12B 4KRNA 3C6LA 4O58H 4IDJH 3EYOA 4XCEB 1FORH 3ILPA 2ED7A 1IEBB 4JY6B 5BZWA 4L9LC 5EZOL 1ES0B 3EO9L 4MB3A 5F7EL 1LNUA 3S97C 4OKDA 3EOBA 4GRLA 3HUJA 4ALAL 3KLDA 3ZTNL 1RZFH 3TF7C 4BFIA 3W39B 2CD0A 4UINL 2HG5A 3T04D 2IALA 5L2KA 2WWKT 1KSRA 1QA9A 4KKBC 4OZHE 4RZCB 3MRNB 4PJ9A 4FTVA 4XXDB 5KOMC 2AEPL 4FNLH 3PIQA 3IFLH 3BN3B 3BP5B 2Z0BA 2E6PA 3TO2B 4X6FB 5IGXL 2YPLB 4GKNB 3JWDH 2W9EH 1UCBH 4N90D 1IGCH 4NN5B 3D0VB 1OTUD 1FL3A 4G9FD 2Z31B 2PO6A 1T7VA 3S35X 3KYNA 3DI2B 4U6TA 1NFDA 4P3WA 4N8PA 3DRTB 2EYRA 4LHUG 3VFNB 1RJYA 4QGTA 1DANT 3GHBL 4QRSB 3ULUH 2PYEB 1CL7L 2VLJD 3HN3A 4R4NC 5C6TL 1MI5E 4F57L 5E8OB 4NO2B 4QKXB 3F7YB 4JFHE 3BE1L 4QHKJ 1UB5A 5T5FL 3QULB 1YN7A 4PYHA 2EIDA 2WINB 4JN1L 3U48A 5H35A 5D6DC 4ZSOA 1NAMB 4K23L 4PJ8B 2EYSA 1TQBC 2V9QA 4XRCB 5TH2B 3UDWA 3PWPB 5AG9A 4FOMA 3DVGA 4WI3A 5D1ZA 4N0CD 1OP9A 4G8GA 1PAMA 5GSRA 1T3FB 3GMNB 2GYSA 2RHEA 3T4YB 1I4FA 3O3DA 2P7TA 4U6VH 3EYFB 5B3NA 4HUNB 3INUH 1GZQA 4NKIL 4J6RL 2VB5A 1GL4B 4LGRB 4LFHG 4AEIH 3GSNB 4O2FA 4G43A 1MRCH 5FDYA 4RGNC 2LTQC 2P8PB 3CSGA 4EIGB 5L0QC 1KPUB 1B0RA 1KCSH 1G6RH 1A64A 3F6LA 3NTCL 3QEHB 5ADOH 5LGJB 1SHMA 5E2TH 4GG6E 5CUSH 4JFQB 1HSBB 3T3PF 3LKRA 4K94H 4L1HA 4TUOA 2C1PB 4KJWD 4ZOCA 1D5ZA 1OB1B 3MREB 4PJEA 4JDVB 4O9HH 3MSPA 4R7NB 3VXOB 1I75A 3B6SB 4GAYB 3MA7A 3LIZH 3IDYC 5JW4R 5F89A 4JFZH 2VL5B 4PJ5E 2DKUA 4J3SA 3KPQB 4JY4A 3ARWA 1FIGH 2YD7A 3TESA 5TF1H 4P9ML 1E27A 3VGBA 1FC2D 4K7FB 4OSUL 4RNRA 4DKDC 3C87A 4YGVB 5D1XD 4A6YL 4Y89A 2QQLH 3BPNC 3IDGB 4S1DC 3C08H 3FHAA 3QQ4B 5KVFH 2QADC 1JFQL 3H0TA 3RWEB 2UZIL 3TBVA 1A5FL 4NRXA 1E4WL 5E94B 1W0WA 1L0QA 4M6OL 3VCLB 4QT5B 3SDCB 3QA3A 4X5LA 1LK3L 2P49B 1FYTB 2DYPA 2R23A 2PR4H 2XV6B 4UDUB 2RCSL 5IBTH 1LDSA 4U1HB 1N64L 3BGMA 4X0KB 2A6DB 1PX4A 2HJKB 1AY1H 2Z92A 1R3IH 3DO7B 1HQRB 5BXFA 4L3AA 4HULB 3KPMA 1DQJA 2C4FT 2PTTA 1BOGB 4FFVC 4MNGA 4X4ZA 5ALCL 3RJDA 2BJML 4RFOL 1NGQH 1FGNL 4JG1L 3SCMB 2ZG2A 3T8XA 4L4VB 5CLTA 4A2LA 4WUUD 5DMJB 2DLFH 1PYWB 4NRZA 1CWVA 4LMQI 3RIAF 1HH9A 3OX8A 4APQD 3DGCR 1U2HA 1TVBB 4GXVH 2LVCA 1S7VA 3UJTL 1D6EB 2IPTH 3GJFH 2WWMD 1ZVYA 2APWA 1MPAL 2B39A 5HHXH 3BEVB 4IRJD 1GOGA 4Z18A 5MHSD 3ARED 3H9SE 3N1MC 4M6AA 1A7BA 1BZ7B 1NMAH 3L3GB 1ACZA 4WI7A 5IVXA 3LPGA 4IS6A 5C0IB 5E9DE 3B3IA 4N0UA 3O11B 2P48B 4UIMA 4AJ0A 5DEZA 2UZYB 2G60L 1VDGA 4HIXH 4NBXB 1I1CA 4YXHL 4JG0H 1RZGA 1JWMA 4QTIL 4RA0C 2A73A 5EZIL 2V9RA 4MWFB 3HAEH 3P11H 4X7CC 1AR1C 5F88B 3LD8C 3R0MA 4KKNA 1N8ZA 4LSPH 3RPKA 2IANA 3IFNL 4Z76A 3EDJA 5FECB 4WGWB 1CF8L 4UQ3B 5JIKA 1S8DB 3FOMA 3MNZB 3B5GA 5GGUA 3VFUA 2EDFA 4RAVB 3ZHKA 4NQUA 4XBPA 3D0LB 2GTZA 3WFDL 5IUSA 1OCWH 2FO4A 1WBYB 2PXYB 4Q6YA 1X5JA 3WIIL 4YDLB 1CGYA 1WWWX 5D93B 5JXAH 3ZTJH 2UZXB 5IB2B 3J8F7 1YEDB 1A6AB 1YEFH 4RRPG 5FHAH 3KR3L 3CZFB 3RIFK 2DM3A 3QNXB 4ZUUA 4WI2A 5CILL 1E4KC 2VDKH 2DIBA 3AMLA 4JFYA 3IETA 4ZAKB 4U05A 5TPWL 5MEQA 3E2HB 3KJ6H 3OKKB 2AK4E 1HYRC 2APFA 3STBA 3U0TB 1GGCH 4YC2B 3D69B 4KMQA 1OQXA 1XR8A 5E8NA 2W91A 1JF6A 5JPMB 3ARPA 1A9EB 4XX1G 3HMXA 3FB8B 4LIQE 1MCOL 6FABH 3NMEA 4I18A 3FTGA 1OP5H 1INDH 2DMKA 3O4LA 4H20L 5HGHB 1MAML 3D85B 3JV4A 5GGRB 1FG2A 3TZVB 4JY5H 3ARGD 2MNUA 4OCYL 1S9XB 1BAFL 5FYLD 1PKQB 2XWTB 4RFEB 1GOHA 4DK3A 4XBEL 1R24A 3QIBC 3JTTA 4NN7B 1RK0A 4IRSA 3R4DA 4GMTH 5I76A 2DKSA 1LEGB 4WHTB 2VXSH 3MLXH 1MVFA 2EDXA 3P9MA 4ELMB 1XGYH 4Z7OE 5FO9B 2VWEC 3TT1L 2J8UB 2N4IA 3CC5B 3SGKC 1AIFB 1TJHH 4PJ8C 3T65B 4K8RD 3JV0A 4YLQT 2XQBH 1PSKL 2NY5H 4HUXA 4PJFE 4CN1A 1VACB 4CDHA 5EO0A 4P2OA 3IDJB 1MRFL 5FYLL 3UPCA 3LKNA 4PS4H 2H3NA 3LHPH 4KDWA 1DVFA 2P5WD 2WBJC 3JVGC 2N1KA 3M1BB 3U4BH 5JHLH 1EZVY 3QUXD 4KK8D 2PETA 3WUZA 2E27H 3RY4A 5I6XB 3QZWA 2H2SC 1CLCA 4CADA 4GQPH 1WBXB 2GJZA 4F2MB 4XZUB 4MXVF 1EEQA 1GC1H 4ZOEA 1X4XA 4QRPE 4H5SA 3BD3A 3T2NL 3W0WA 4GBXA 1FFPB 2C7UB 2AP2A 3FZUC 5CSBA 4ZDHA 4BSWB 4P2RD 4RDQF 4OD2B 2YD2A 1BD2A 4X8JA 4K8RL 4OZIA 5C0RL 4ELMF 4PUBH 4KQ3L 3F5WA 2FJGB 4FQQA 4KH2A 4RMUA 4OGZA 4NDMB 5INDA 3U2SA 1K4CA 3VE0A 3TIEA 4D9QE 3V6FB 2OR9H 3BI9X 3HC0A 4HKZA 2ZCLL 3IRPX 3BHBA 3WLWD 4XAWH 1U91A 2EXYC 3BKMH 4PJCB 5DD6B 3ALPA 4JM4H 1T1WA 1O0VA 5B38G 2ED8A 3FO2A 4DTGH 1ORQB 1FN4A 2NZIA 5EC2B 3SE9H 4WWKB 4YAQB 4G7YH 5BVJA 3O8XC 3SDCC 4JGMA 5JUEL 4OLZL 1A4KB 3QPQC 3U0WH 3UTSD 1TZGL 3V7AG 2H1PH 4Z7QE 2MKWA 1HE7A 4F7CA 1DUZB 2VTFA 3S98A 3R8QA 3SDXE 4TSAH 2DM2A 1MREH 2PTUA 4XPBH 2Y25A 3LEXA 4NJ9H 1P69B 5I1EL 1CQYA 2NR6C 3HI6H 3CXHK 2V5YA 4FQXA 3BPOC 2Y1VA 2A9NH 5E08L 4XTRD 3TVMC 1IQDB 4P5TB 5ALBH 3EAKA 4YPGB 1FNGA 1TZIA 3TBSA 1MH5A 2I24N 4GXUM 1EAPB 3QEQA 4Z7WB 3SKUD 4XVUC 2R0KH 4PRNA 5TDNA 2CKBH 4UUJA 3ULVD 3FT2A 1TCRA 1LO3L 1HQ4B 5JW4M 4QOKE 3MTRA 3W9EA 3SDDA 1G1YA 4HMEA 4LIQH 4UOJA 4OFYA 4YHLH 1CR9H 4MJIA 5SWZD 4G8FA 3QIUD 5CZKA 2H2PD 5IJVA 1DP0A 4K9EL 5B4MD 3TC9A 3QXAA 1H5BA 3TT3L 1QLFA 4BJLA 5E6IA 5T3XD 5IMOB 3T0EB 5KSBA 5C8JA 1BQHG 2OZ4L 3FB6A 4M1CC 4WW1A 1IAIL 1P2CA 4MAYA 3SDYH 1BX2A 2X1QA 3I02A 4NM8H 3LPWA 1RD6A 3NZHH 4Y5YA 1HOCA 4IHOB 2DQJH 5A16B 3DX6B 1S7SB 5MEPB 3CDYA 3RNKA 4X6BA 4FQIL 2XWJA 4X6CA 3KYKH 1FLTX 4OD3L 2A77H 5HYSB 1NFDE 4ZODA 4KRLB 3ARBB 4PD4K 3P73A 5D7LB 3H9HB 3TNNA 3U9UB 3FT4A 1R3LA 1J05A 3CDCA 2V7HB 1YNLL 2PXYC 4EI5C 1ETZB 1KEML 4YDLC 1QVOB 4XP1H 3S88L 3TA3B 5DYOA 3BRDA 5T3XL 1JHKL 3C5JB 5D93C 3GZKA 3SJVB 3REWA 1AJ7H 4EEEA 3LEVL 3I75A 4OLEA 5EOQL 3V5DB 3X12B 1FL6A 4QRRD 3VFVA 4NNYB 3P4MA 4ZXBB 4P4KC 1GAFH 1B88A 2IC2A 4AZ8A 1OAUL 3P77A 5HHVH 4LDOB 5FM5M 3HPLA 3E2HC 1IGYB 3RU8L 3V5KA 2DMBA 3E8UL 4YC2C 3ZT7A 5I1IL 5DT1L 3MR9B 2NY2D 4WVRA 3VFTA 5JDSA 5E7FA 1MAKA 4HF5H 2YXFA 4EXKA 1OAXH 3C5ZA 3EO0B 2NW3B 1LE9B 1CE1L 3KLHC 1B4RA 1KB5A 4PJXA 5C0AE 2GIYA 4LKCA 2JTDA 3LN9A 4FXKA 4KKLC 1IGML 3U79A 1ED3B 2ZPKH 1CXFA 4C4KO 5J6GB 4XNQB 2GCYB 3EYSH 1FO0L 4R6UA 2F54A 4NN7C 2NZ9C 5J9PA 1R0AH 4MZ2A 4ZO7A 1I9JH 2SEBB 3BW9B 5HHPB 3GSVB 1CFQA 3RNQB 4M1GL 1DBKL 2IG2L 1I7TA 3MODL 1VFOA 5FO8B 4CMMA 1CLYH 3OJMB 4MLSA 3WLBB 3MYJB 1ZANH 2XTJC 5D9SA 4K7PL 1CGSL 5CBEB 4UB0H 4Q9BA 1SBBA 5BMFH 4X9GA 5L2JA 5I0DA 1D5MA 4M93C 1CD0A 3QG6B 4YWGL 4FQHB 3GMOA 4JO4H 2ZWLT 5ECJE 5GGVH 3C2AL 4JO2H 5GISH 2OMBA 2D7OA 5BVPL 5IV2A 4N0FB 5I1CH 1LP9B 1RJZB 1KJVA 1P4LB 5I6XC 1WAAA 1K8IB 1BVKB 4LLYB 5C0CB 4ONGH 5KW9H 3QI9A 1MQKL 1S7RA 4JRXD 4LPUA 3O9WC 4IIQA 2NNAA 3PABB 3VXUB 5IMLA 1EEZB 5DRWB 1J1PL 4L3CA 5F3BB 3MGTA 3WS6A 3CSYA 4NOFA 3ZE2E 4UTAL 4JDTL 1GIGH 3CVHH 3OAUH 4QHMA 4PRHA 2AS5M 4GAGH 3DX8A 3MLUH 2FIRT 2YUZA 1A4JA 1BHGA 1IGIL 4PG2A 4LEXH 4MNGE 5I15H 1BVLB 4MD0A 3RFZC 3QNYA 2KQNA 2Q20A 5GGQH 5K59E 2ZCKH 5DHVB 5DJAB 4TTDD 2UWEE 2FX8L 4WI9A 4HKXB 2OM5A 4KHTL 5HYQA 3N1PC 4E9LA 1MUJB 3ROLB 4OLYL 4HMCA 1XCQA 5DJ2B 5TE4H 4ODXA 2YD1A 4JGUA 3SPVB 4P9HH 1YJDL 3WDIA 2A6JB 4V2BA 4P3CL 3W81A 3HPJB 1TJGL 1BVZA 3WD5H 7FABL 2LU4A 1KPRA 4QRTA 4YIQB 1P84K 3WFEL 1NGXA 5EZLB 3QJFA 4WO4C 5ETUB 3OKNA 4WWKC 4LCCC 4CN4A 3L1OH 3MRDB 5IVXE 3T08A 5GZOD 3PWUA 2MCPL 3V6OC 5E6YA 1TNNA 3S37L 1U3HA 3OGCA 3QXVA 1YEHL 5I73C 5TQ0H 4ZFZA 5J8OA 2JJWA 1N6QH 3WL9A 2ADFH 3O2WL 1A2YA 4XNUH 1CXEA 4JZNA 4CNIA 1MEXL 4NQDD 4ZNEA 4I1NB 3WO4B 2IANE 4Y2DB 4YHMH 4JO1L 1T7ZA 3TO4A 3V9FA 5IVZB 4C59B 2JCCB 3WFCH 5BCAA 4KMTH 3WIHL 1NDGA 1YEKL 3P0VH 4HHAB 3DXAA 1G7LB 4G9FE 3MLPA 3FO9A 3GDBA 4DVBB 4PJGB 3VXSE 4ODWB 3M17A 3N06B 2MCG1 3ZDYF 5DEFB 3ZZ1A 3EYQC 4YDIH 2IH3A 3ARUA 1U6AH 3S36L 5F7NC 3MFGB 2AXGB 2X4OA 5DVMA 1GCFA 2ZSWA 3NACH 1HNGA 1JZ2A 1NCWL 3FO1A 4OCWH 4DN4H 1JF1A 3V5HA 3DARA 3MOAH 4M5YH 1G7QA 2MHAA 3IF1B 2JJUA 5DA0B 2Q6WA 5C0DA 5BW7A 2DJ4A 1QPXA 3IYLW 2HP4A 2VISA 4H8WC 3UTZB 1NFKA 1BJ8A 4Z78B 3ARZA 2P8LB 5FB8A 3U4EA 1U8QA 2I5YL 3D39D 3AFLA 3DUUA 3WEXA 1JTOA 5MEOA 4PRPA 4P5MA 5FOBB 3ET9F 2F19L 2L4OA 4U6YA 1CT8A 1FLRH 1FGVL 4YEEA 3TNMA 1X44A 3FRUA 2HLFC 1VCAA 1M7IA 3MLVH 4BELD 5T1KA 3PXJA 4F37F 1A7OH 2BY0A 1NBZA 3IFPB 1X7QB 5DJYA 1MWAA 5E4IA 5SWSD 4Y1AE 2R1WB 3ARBC 4AK1A 4OCSL 4ZUVA 3WSQL 1G9ML 2D03L 3K2UL 3GKWH 3PWLB 1JV5B 1P4BH 1W0VA 4X5WB 5EU6A 4OZFA 3DROB 3MV9D 4NO0B 3TA3C 1F3JA 4U7KA 1QBLH 3K4DA 1KEGH 4HUVB 3HC3L 1AXSB 2PKDA 4LLUB 3TBYB 3BH9B 3D6GA 3WKML 4QXGL 2V7NB 4OM0L 3A67L 3V4UH 1MJUL 5IOPB 1G7HA 5EN2B 4IMKC 5HY9B 4AG4H 2QHRH 2APTA 1A0QL 4HFWA 4O02L 3C6LD 4ODTL 4RISL 4LLMB 2XNAA 1GHFH 1PDKA 2YD8A 1BP3B 4KK9C 2QQKL 4MGXA 1R3KA 2BOBB 4OCLC 3T1WA 5H2BA 5GZNC 3HLAB 1VFAB 5F7EH 2NY7L 4F7PA 2Y4SA 2OR8A 1PX3A 4WIQA 2ARWA 2NXZB 1T22A 4GS7B 1U58B 3G5ZA 4QNPE 3WE6B 1YPZE 4M43L 1UFUA 4OKVB 1QSFA 2Y07L 3MLTB 3W0WE 4ZUWA 4NO3A 2AEPH 1TDQA 5DRZB 1MFCL 1BD2E 3W11D 3FN3A 4OZGB 1QBBA 2ICWA 2Y06L 4N9GA 3A6BL 3HZKA 5L9DH 3TJEL 4OV5A 2HLAB 4G8EB 2Y5EA 3PL6B 4Q9QL 1RULL 4LLDB 1Q9LB 5I17A 1T1ZB 3TFKD 1Q38A 4TNWF 3STLA 4DKFH 3ULUF 3GHBH 4WUUE 3L7EB 4EUPA 1OPGH 1SMOA 5ITBH 5DEGB 5J3HD 1NMCB 3FMGL 5C2UB 4MA3B 1JNLL 3PNWB 5DQ9B 4AH2A 1XGRA 2FX9L 1RK1B 3BE1H 4GKSB 2Z9TA 3ARDA 1SBSL 3MO1B 5IB5B 3AXLA 1IM9A 2IQ9H 4MD5B 4PD4J 3EFDL 5F7YC 4DGYL 1OTUC 4KRPD 1DJSA 4LVNC 3BGAA 1CZ8L 3F58H 4KVNH 3I3DA 3LEYL 1R5IA 3BQUD 4K3GA 4V2CB 1DSFL 3GSOB 4PGBA 1X9QA 3HFML 3BP6A 1MCDA 5E99L 5FK9A 5HVWA 3LAFA 1YUHA 2GJ6D 3BN9C 3K1DA 1BQSA 3IDMB 1JTTA 3PWNA 3K7UA 4F7EB 2AJ3B 5SX4I 2AV1A 5JHDB 4OLXL 3OTTA 1VGKB 3LKSA 3BZ4B 4LQFL 1DLFL 4Y2OA 4O2EA 4HH9A 2XWBB 5E00A 3VXRD 5HDOA 4N1EA 4RWYL 2AJSL 3NTCH 1Q0XL 1DE4A 5LXGL 1T1YA 2CDFB 4Z95L 4N0CC 3LPFA 5CMAB 2ESVB 4HAGA 4HPOH 3OKYA 2FLBT 4HUWA 3DVIA 5FUZH 1CDUA 5TDOA 4X7SL 4NGHH 4MJIE 1OSZA 2DLGA 2H32A 4WCYL 3L9RB 5CHNA 5KSVA 4YQXL 4P9MH 3MFFB 5IHBA 1T6VN 3D3VE 4LDEB 1C5CL 4OZHB 3GJFB 2HKHH 4A6YH 8FABA 1SY6L 2KBGA 1X6NA 3BRGC 3L3KA 1TPXB 1PW3A 5C0GB 5KS9A 4KDTC 3C60A 3MNWA 3MV7E 4NZRL 1JFQH 5D7JB 3WO4C 1X4YA 4X6EA 3HRZB 1A5FH 1Z9OA 5D1QA 4M6OH 5F70A 3BZEA 3FQUB 4WEMB 1LK3H 5A2FA 3QUZD 4YH6A 2DYPD 3O3EA 1BREA 2RCSH 2A6KA 1D5IL 1NGYA 3IGAB 4HIEA 1FZOA 4NQEA 5HGGS 1CXHA 1R3JA 5CEYB 3T0DA 5I1DB 2NQCA 2VSDA 5FYLE 3QT2A 2A83A 1NBYB 1JMZA 4OJFH 1Q72H 2C3VA 3HAEB 5EUOE 2MJWA 1MI5B 1FQ9C 5D1XC 4IJ3B 5LGHL 3G6JA 4JG1H 2AKRB 3U30B 1QLRA 4R4BB 2YBRB 3HNTH 4XH2B 1ADQL 3NAAH 1JWUA 4YDJB 2FL5A 15C8L 2XZQL 4QRQA 4OF3A 3AGVA 4BKLA 3MV8B 1MHPL 3FFCD 4FFZH 4Z5RA 5KTEH 3ALXA 5F1IA 4OZHF 3UJTH 4C57C 1FFQA 1RI8A 4MJ5A 1A6UL 5F9AC 1MPAH 4S1RL 2EXWD 2E3VA 2B4CL 2Y6SC 2GK2A 2FYYA 4XI5C 4PY7A 2VDNL 4LNVA 4WU7B 3MRLB 2QL1A 3OR7B 1TIUA 2F8OA 3MJ9L 2P5WE 1ZLSL 1BWWA 3OJDA 4V1DA 4Y4FD 4LK4A 3NCYS 2X1WL 4KROD 1LO4L 2G60H 4KUCF 4YXHH 3S3PA 3VFRB 3FQRA 4QTIH 3VRLE 1C16A 5GRZA 1QEWB 3NCYP 5HHOB 5EZIH 4JFEE 4GQ9L 1SJEB 4PJAA 2X89D 1NMBH 1WJ3A 3TBWB 1P84J 4AMKL 2WWMC 3MZTA 2V2TB 1OQOA 3NFPB 5I0ZA 5C0BD 3JWDC 3TWCL 3B2UC 3KPLA 4OGXH 1CF8H 1WCQA 4IRJC 1WQVT 5HDBE 3L5XL 1EFQA 1GPOH 2CDEB 3AREC 4JFOB 5E5UB 3QFJA 2VXQH 1EJOH 3WFDH 4JFXB 4AQ1B 1OAKL 4PJ5B 1MCBA 1P5UA 4Y4KA 4NHUA 1BBDH 4QXTB 5E56A 3WIIH 1XGQB 2WW8A 3ZT6A 3LSOB 1B9ZA 2BSSB 3FOLA 1S9YA 4H1LA 1ITCA 1WT5C 2F53D 4H0GA 4G7VL 3H3BC 1G7PA 3BWAB 2GJJA 3O81A 5T33L 3ZDXE 4BZYA 3C6SA 4YHYB 4I3GA 5CILH 2J6EA 4DKEL 3C2SA 3EDFA 5TPWH 5ICYA 1Q8MA 1XIWB 3IDIB 3KWWA 5BJTB 3UTSE 4FQCH 2BVEA 3VH8B 1JK8B 5DK0A 3ZSSA 4GG6F 1MCOH 4PRHE 4LSTH 4XCYA 4GW4A 1SVZA 2DQEL 1YMHA 3RHWF 1BFOA 4EN3A 5KSAB 4NWTL 3AM8A 2YEZA 1YMME 4YXLL 1AGEA 3MUHL 1GSMA 4JM2A 4QHNB 5HJ3A 3ES6B 2VR4A 3CFEB 4CDGC 3P0YL 4JANA 3BJ91 5F8RC 2COQA 1NMCC 1YEJL 1YDPA 2BSED 1FBIH 1S7UB 2FBJL 3EUUA 5DJ6B 3BPCA 1CICD 4WNQA 4PGZA 3JTSB 1KJ2A 4L3EA 2V17H 3ILQD 1CU4L 3L95B 4G6AD 1OVZA 2ATKA 2UVFA 1UJTA 3MNVB 3H9SB 3TT1H 1VSCA 3VFOA 2HFFA 3G6AA 5SWZE 4KPHH 4P2CG 5E9DB 4JPWH 4NCC1 4TVPL 5GSVB 3VDCA 3ARGC 5F7UA 3PDGA 2ZUUA 3CH1A 4XMPH 2W0PA 1CDHA 1MRFH 5IIEB 3IVKB 3VXMA 5DO2D 1ZHKA 2VLRA 4RAUB 1XGUA 5F9OL 2DTML 3GRWL 1I7RA 1FAKT 1JN6B 4ZNEE 5EIVA 5B21A 4HH8A 1Q9OB 4P59L 5BS0A 2DJUA 4P4RB 4BH8B 1G0XA 4R2GD 4C83B 2ZKHH 4HV8A 4ODHL 2DKMA 2FGZA 5EO1B 4GBXD 4R0LA 5AUMA 5FXCH 1GGIH 2YSSA 1NKRA 2CPCA 5L88L 1J8HA 4K8RH 1J0YA 1KTKE 2VDRL 3OKMA 5C0RH 3MGAA 5GRJH 1ZHNA 1LO5A 4KQ3H 4YHKH 5LBSL 4J3UA 2IBZY 4MHHI 4U1JA 3MBXL 2WQ8A 2CSPA 1RHHB 1ACYL 4KK8C 4KTYA 4BM7A 4YHPA 3L3HA 4L4TB 3HZYB 1KB5H 2ZCLH 4RFNB 1EZVX 4PJ7E 5IQ7H 2X41A 1B2WL 3WHXB 1NCAL 1BEYH 2DQTL 4RZCA 1HXYB 2E6JA 3IJSB 1KLGB 2OQJB 5HYSG 3MJGX 1ORSA 5D2LA 2AK4B 4DK6A 4NZJA 2CKBB 1TPXC 4HWBA 3V6ZA 2YPLA 3X3FL 4LL9A 2VQTA 1S9KC 3D0VA 4M4PA 2Z31A 4XCNA 5J89A 5DD3L 3RUGE 3DLQR 4EKXA 5JOPD 2FHFA 4N0YH 2XFXB 2VE6A 3MUZ1 4M61B 4P5KA 4YXKL 4QRSA 4WU5B 2A74A 4EI6B 1TITA 2CKNA 5CSGA 4AEHH 1QKZL 1U92A 5HGAB 3MRHA 2VXVL 3HS0A 4HAFA 5EU6E 4OLUL 3WLWC 5T1LB 1VADA 1PQZA 2W0LA 1E6OL 5I1EH 1T21B 4Y8AA 3F7YA 3UPAA 3I3BA 4IJ3C 1EO7A 3CX5K 3U30C 4YHOH 2GUOB 4F9PA 4M8VA 5C09E 1JPST 1S7TB 1TETL 1QR1B 1IKNA 2WINA 1DBML 4R7DB 3B8YA 2A1WL 1NJ9B 1YC8A 4I9WD 2B0SH 5JPNA 5C9KA 5F72S 1FZKA 2GQHA 4PJFB 2I27N 3IDUA 1T3FA 3M07A 4M00A 4TSBL 5EORL 1AXIB 3Q1SH 2BVQB 4JJ5A 3SDDD 4G6FD 4LLQA 3LKOA 4OFYD 4HDIA 1KIPB 5FA3A 2XN9A 1MFAL 1HWGB 3CFBB 1HDMB 1YY9D 2R1XA 4WHDA 3TT3H