1JK9A

Heterodimer between h48f-ysod1 and yccs
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
153
structure length
153
Chain Sequence
VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIFEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords superoxide dismutase
publication title Heterodimeric structure of superoxide dismutase in complex with its metallochaperone.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 34
structure length 153
sequence length 153
chains with identical sequence C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1jk9A00
1CBJA 1OALA 4BCZA 2GBVA 2VR7A 3HW7A 4FF9A 1XSOA 2AQRA 1KMGA 2JCWA 1SPDA 3H2QA 1E9QB 3KH3A 1E9PA 4OH2A 1QUPA 3GZOA 2V0AA 3HFFA 2Z7UA 3GZQA 1SXSA 4BCYA 1PU0A 1F1DA 3S0PA 2C9UA 3T5WA 1PTZA 1PZSA 1IBFA 1SDAB 1E9OB 2APSA 5KBKA 1B4LA 1F1AA 3KH4A 1IBDA 3F7LA 3ECVA 3PU7A 3F7KA 4OJAA 2WYZA 3MNDA 2GBTA 3KBEA 1F18A 2E46A 3L9YA 1DO5A 4A7QA 1YSOA 1OEZW 3CQQA 1B4TA 1MFMA 1E9QA 2VR6A 3K91A 2E47A 3GZPA 4A7SA 1SRDA 2AQSA 3GTVA 1SXNA 1YAZA 2AQNA 2Z7WA 1SXBA 3GQFA 3RE0A 1TO5A 2SODB 3MKGA 3HOGA 3ECWA 4N3UA 1UXLA 2ZKYA 1OZUA 4A7TA 3H2PA 2WKOF 1IB5A 2Z7YA 1XTMA 2NNXA 2ZOWA 2ZKWA 4A7GF 4U4IA 2ZKXA 1P1VA 1E9OA 1E9PB 1JK9B 3QQDB 2Q2LA 2VR8A 1OZTG 2Z7ZA 4A7VA 5KBMA 1EQWA 1CB4A 1HL4A 3CQPA 2C9VA 1U3NA 1ESOA 2LU5A 2AEOA 1HL5A 1UXMA 1BA9A 3KM1A 1F1GA 3SODB 3L9EA 2WKOA 1RK7A 1SDYA 1JCVA 1SOSA 5CU9A 4MCNA 1EJ8A 2WZ0A 1DSWA 4B3EA 4N3TA 4A7GA 1SXAA 4BD4A 5KBLA 4L05A 2GBUA 2AF2A 1N19A 3GTTA 3CE1A 3LTVA 2AQPA 1S4IA 4A7UA 1L3NA 1YAIA 3KBFA 1COBA 1SXZA 2WZ6A 3ECUA 2AQQA 1N18A 2R27A 2K4WA 2WZ5A 1JK9A 3QQDA 1BZOA 2AQTA 2WYTA 2WWOA 3KM2A 1TO4A 1Z9NA 2XJLA 2WWNA 1Z9PA 2XJKA 1FUNA 2JLPA 1AZVA 1Q0EA 1IBBA 2C9SA 1IBHA 4MCMA 1OAJA 1XTLA 1SXCA
chains in the Genus database with same CATH superfamily
4YHPB 1SN0A 2AK4E 2FZ3A 5INCA 5L2JB 4I2XE 5B3SB 1BVOA 2B59B 1K8IA 1DJIA 3KPQB 1GGTA 4NM8L 3S7GA 1UT1A 1J5DA 5EZLB 4AJVA 1JL8A 2X4QA 5JW4M 5I18H 3U30C 1AC6A 2V5RA 2IH8A 3GZQA 1T3FB 1WZ1H 4XNUH 3WXWL 3VFNB 3L9BA 4KRMB 2IBGA 2IH9A 1DUYB 3V8OA 2YN3A 4WSKA 3LOWA 3RWGA 4XXWA 2FCBA 3A47A 2Y7QA 4F7PB 4HKBB 3D87B 2NYKA 1JI1A 4GS7C 3K72A 5I8CB 4ZUTA 1UWEL 2MCMA 5C0JB 1NIBA 2D4FA 5F9AC 2F1AA 5J3HC 5K59E 5AW6B 5BS0E 2OMWB 3TCLB 2JFCA 1XF4A 2MQCA 4IRSC 1BX2A 1XB8A 4HS6A 4CJ0A 4NYLA 2OAAA 1XZWA 3NJMA 3RNQA 2RCSH 4PJCE 1BEYL 1JNLL 2DD8H 5A43C 2VLJA 1TJHH 4N2CA 1XO8A 4WUUD 1QPXA 5F0PB 2I9LB 4GSUA 1T83A 2F8XC 4NO0D 2PP8A 4S1SH 1C8QA 2X5PA 2CK2A 1ZWIA 3LRHA 1E4WL 5HHPA 3FQXB 1J18A 2HLFD 3KPNB 1EJ6A 3B3BA 5JO5A 5KUMA 3RBSA 4OFIA 4X0KB 2HA1A 1CD8A 3QJVB 1UC6A 3ARRA 4X4ZA 2ADGA 3X11B 3LQAC 1PY9A 4MQXC 3T6ZA 1PG7X 2LU5A 1J1XH 3CXFA 5SWZA 5C9JA 2R0LL 1Y6MR 2IDTA 4IMLA 4KUZL 3R18A 3DTXB 4Z76A 3KDMB 2XFXB 4H0HB 1F11B 4AEFA 3REVB 3CFTA 4UILH 3WNJA 4C59B 1MRCL 4DHLA 4FQIH 1ETA1 3EJZC 4YLCA 9CGTA 1S7XB 1WAEA 2NW3A 3RNKA 4AYMC 1CF8H 3HRZC 4GS7B 1KFAH 4IBWA 3MNMA 5HVFB 3EYSL 3VW3L 4F2ME 3KS0H 1DL7H 1ODAA 2VM3A 3FO1B 4XWGL 4F58H 1IC4H 2L3BA 1I85C 4MMXC 5E9AA 2P9RA 4HA1A 4IRSB 1PZ3A 4X99B 3A6BL 3OZ9L 3OJDA 1QBAA 3COOA 4MNQB 3DMMC 1VRSA 2BRQA 1IE5A 5EEXA 4GO6B 4M48H 1WD8A 3LIZL 1CBVH 1U3HD 3QHFL 4ZUUA 1BBJB 3RWEA 1KDIA 5CKGA 2NY0D 4YSSA 1ZIAA 1GJWA 4X0NA 4G6KL 3GXDA 4FMVA 2O5ZH 3FQRA 1GC1C 3E3QC 5D7IA 4AYFB 3AWEA 1JHTB 3DX9B 5JHDA 3QIWD 1JAEA 4FXLA 5CEYB 4OUOA 2WHVA 4ALAL 2J1WA 2F7QA 4PU2A 5EOCH 3ZO0A 2BCKA 4G7RB 2F68X 3D5OF 5G5DB 4IKJA 3UDWC 5B38B 3KGUA 3BVDB 2X7LA 2NUPA 3MCG1 5KSAA 5DU7A 1PY4A 3DYOA 2DMHA 1KTDB 2AK4A 4PRDB 4OAWA 4WHDA 2HTLC 4QRPD 4YH6A 4LAJH 4FI7A 1F6FB 1R3KB 3ZDYB 4AOFA 4DZ8B 5GGTL 2W60B 2IFGA 5A7BA 1E4KA 3QQ9C 1EPFA 5EF1A 1AQDB 2ROYA 4CSPA 3RVTD 3RAJH 1J1PL 5D93C 3IS0X 1FZOA 3RVUD 2WGXA 2EEFA 2EKSA 1WZMA 2JF1A 4OLXL 2CA4A 3IYLW 4QR7A 4KQ4H 1YEIH 3HRZB 3SE9H 2J56A 4XB8A 3WDJA 2GPZA 2NY6D 3A21A 2ITCA 3L7EA 3OMNB 4G82A 4XE5B 2H45A 4O58H 2ICCA 4ZFZA 4KOBA 2C7UA 2KZ1B 2J3SA 3KPTA 4MMXB 5HGBB 3S34L 3WYRA 2Z64C 4G7SB 4X6EA 3OXRA 3LS5H 1JPEA 1ZMYA 2BZCA 5DK3A 3UAEA 3TNNB 2WLIB 3DMMB 3K5SA 5DHXB 4ZW8A 3WFZA 3DIFB 4F7EB 2OJZL 1FBIL 4FLQA 3INOA 3QIUA 1KXVC 4Z7OB 3Q2WA 3HIZA 5K9JL 1N70A 4MASA 4RISL 3CX5J 2NY2D 3GJFK 5DLML 5EA0L 3RZCD 2VR9A 1UADC 4F5CA 2DLGA 2IWEA 5DHEA 3WNNA 1D5XA 1N9PA 2NW2A 2XPGB 3K0YA 2W9LA 3KPSD 2WKOA 5EU5B 4YVNA 3CXDH 4KJQC 1BBDH 1QSZA 4EBQH 1D6VH 3FN0H 4FG0A 4I88A 1SBSL 4AMKH 3VGFA 3BJ91 3DGGA 3MJ9H 4FE9A 5CR8A 4R7LA 5LN8A 4L8CB 1AQ8A 5AOKA 5LNGA 2ZJSL 1MVYA 4GKOA 1RUAH 1YLBB 2WPGA 4PW3A 1ETZA 2WCGA 2EH8H 3MODH 3P69A 4DGWC 12E8H 1N6VA 5SWQA 1X4ZA 1BVLA 3US1A 3SDXE 3OKMB 5C0BB 5D93B 1N6UA 4H20H 4P06A 4ZMAT 1Z5LB 4G8IA 3GI8L 4P9MH 4WCYL 2LABA 3CLWA 5DC0A 2V3EA 2F8OA 1SHXA 1FYTA 1DUZA 1S7QA 1R3HB 2YSSB 2F58H 2ZX6A 2A3TA 5LGYA 3CHSA 5AW8B 3VFOA 4OLVH 5F6HI 3KCPA 1WH0A 1BECA 2OMUA 2VERN 4QOKE 1B9KA 3FT2B 3W0WE 2OMTB 1RK0A 2W8CA 3IKKA 3MO1A 4XN2A 4PB0L 2AXGB 2WIIB 3NSXA 2BWDA 3NK3A 1UD6A 2LFEA 3DI3B 2FAUA 5EEVA 2CUMA 3L95B 3QUZA 4ATWA 2C9UA 4EUPG 1SLXA 1SM3H 3QEQD 4QXGL 2DWDA 2ATKB 3OAUH 2LGNA 3ARZA 4HJTA 3LKOB 1JPSH 4L0ZA 4ONFL 4W81A 3IGUA 2ZX5A 4OZFG 5JPMA 5F44A 1BF8A 2YARA 3KBEA 4G83A 2NMSA 1DJYA 4GRWB 4J4PC 4BXSV 3K91A 1ANUA 5IJVB 2J6EA 4QRBA 3FO2A 1T21A 1QKZH 2ZCHL 4MX7B 3V52L 3TVMA 3SPJA 2D31B 5DJXA 2HH0L 1MI5A 2P24B 4FTVB 2I26N 5DMYA 4N0CC 1TTUA 1E27A 1JN6A 1R17A 4KQ3H 4FNTA 1PLGH 1VGKB 4YJZL 3NCYP 4KI5E 4RMVA 3BIBX 1TU2B 2FRGP 3LRKA 3QPQD 4QTHA 5I1EL 5JXEC 4G9FE 3FT3A 5F7FA 4X50A 4X4ME 1RXLA 4IBZA 2G75A 1JXFA 1OP9A 1SN5A 2CHDA 2L0DA 4F27A 1RMFL 1T2QH 1V05A 1BIIA 4JRXA 4QRQB 4IQHA 5MEQA 2EVHA 3EZ8A 2XA3A 1H3PL 3QXUA 4PP2B 5ICYA 5EO1B 4AENA 4J3SA 3CXHK 3T6WA 1A14H 4V1DB 2FX8L 4HFWB 4JG5A 3LN9A 1TMCB 1U93B 4MCNA 2Z0BA 3QRBA 2LAGB 2VDRH 5JPNC 2ENSA 3LHAA 4ZTEA 4DVBB 3NN8A 2OMVB 3KPMB 1PDKA 2MPVA 3ULVE 1C12B 2VC2H 2XYCA 3OV6A 5J3HD 4GSXA 5C0RH 2EVIA 3BZFB 4KO6A 1MRDH 4F7MA 4XGZA 1BFOB 3ARDA 2AVGA 3O41B 4JO4H 1MZZA 4MDJB 3DETD 4KXCA 5A6LA 4Z3IA 4KOCA 5FKPB 5CF3A 5E9DD 1DVQA 4S2SB 2QPSA 4NFDA 4GUPB 3Q2VA 2ATAA 1OL0A 3WAKA 2EDQA 3IXAA 2AKRA 3DX7A 1O9VA 4WI0A 4NERA 1WA2X 4HIIB 4XE0A 4KHXL 4FHKA 5F7MC 3ARVA 2AQ3A 2CDFB 3OJ2C 1EAPA 4XPAL 3SDXA 1PJ9A 3T8VA 2DQEL 1MCCA 2N01B 3OWRA 3V0IA 3IGAA 3ATAA 1A3QA 1NQBA 1FDLL 5C6TH 3LDBC 3F6IA 5DZJA 1A6UH 3RGVB 4X6BA 3VXPA 4RDQF 4TKWA 5D5ME 3GSQB 2QPDB 5E2UL 5A16B 4KPHL 4M29A 1E8YA 1JPST 4TNEA 4OZHB 3QISA 4JG9A 3ZRSA 2EEXA 4G9DA 4JN2B 3JV6B 3MACH 3NJHA 1RHFA 1QA9A 2FATH 4FQQA 5T5FL 5I1IL 2NY3D 5D1ZI 4A6YA 5CO1A 2H8PA 4DESA 4NN7C 5IGXH 2EDXA 2YPKA 1EVUA 1EDHA 3D30A 4LCYB 3VSVA 4A2LA 4Y16A 1P4LA 3ECWA 1SJHA 1T03H 3DV6A 1SOKA 4Z7VA 3KL5A 1P7KA 4M8VA 1RURL 2F8IA 4QXUH 3SDAC 3FMGH 1U8IB 1KNOA 4HU8A 1HINL 1EJOL 3BH8A 4JY6B 1GCFA 4OUUB 2BNQD 4G7YL 3TZVA 2B39A 3ABZA 3IJ7A 1F3JA 5H4YA 2HG5A 2VXTH 3BYYA 2HLEB 5AZEL 2EINB 3A23A 2FT8A 3ULVH 4I13B 2AGJH 2X0VA 5CCKH 2AV1A 3FQUB 1U21A 4DKTA 4P59H 4NC2B 4C55A 4DCQB 1UH4A 1VESA 2HTLD 3FULA 3EYUH 2G9HA 4GLRH 3DVFA 1PMYA 3QQ9D 3P30L 4X4MA 2R7EA 3LDBB 2HVKA 4UWQB 5MEPA 2DQUL 1LEKA 5IVZA 3IF1B 1W0YT 2FX9H 2L7UA 5IB5B 1DLHA 3II3A 3LV3B 2EIDA 3ZU8A 1BXXA 2XZAL 5HJ3B 3EH2A 4BH7B 4ABVA 3BWAA 2V8LA 3L3DB 1H15A 1Q8MA 3B2XA 4YSDA 4E2OA 5BOJA 5C0CB 4OLEA 2WY3B 1B90A 3AITA 3G04A 4YDVA 1Q0EA 1JE6A 2GSGA 2CQVA 4NN7B 2Y6SC 1YQVL 3JZYA 7CGTA 4IBYA 1RD6A 1ZHKB 1ZE3H 4N85A 4LU5H 2E6QA 3CSYA 1OLZA 3QH3B 3DVGA 4XXWC 4UU9B 3MJ8A 1NCTA 4XPBH 1NGZA 4MTMA 3UFIA 5IJBC 1WAAF 4NC1C 3QRGL 1NGQL 1U91A 1N5YH 4U1LA 3SJVE 1FORL 4MMYB 1H0DB 4KJQD 2WWKT 2Y2TA 1S7SA 5CBEB 1X7TA 2X4SA 1AI1H 5FKAB 1EFXB 5E1HB 1U4FA 3TJEH 4PJ5A 2CUAA 2IAAC 4J6RH 2J5LC 1ORQA 2NCEA 1XEUA 2VZUA 2QEJA 2A4CA 4OZGE 2IEPA 2FDBP 4JMXA 3S3DB 1ED3B 4K7PY 1KENL 3QFJE 3SE4A 2PTVA 5E70A 4NGHL 1I8LC 4HAGA 3UP6A 2CLZB 2UZYA 1MCLA 1TJGH 3N0PB 2B2XL 2I24N 3ZDYF 1KG0B 1T83C 2OJ1A 1OEZW 1KYDA 1O6SA 1TEYA 4FTVD 4NFBA 3QO0B 4ZMWA 1WEJH 3H54A 4C56E 3GTVA 4NAJA 4OD2B 2DQJL 4AXWB 4BQ8A 4RWYL 3B34A 5ESAB 3CN3A 4RMBA 3D3VB 5INCB 3ZHKA 2DTSA 3FTGB 4IOIB 3SN6N 2XTJC 3H2PA 3PF2A 4HUCA 5D5MA 2XETA 4Q0XL 1XTMA 3BVWA 4AYDC 1A6AB 1QFUL 3TM6A 2X4QB 3GRGA 5D70L 3ZDZE 1XSJA 5LHDA 4LKCA 2KZKA 1BAFH 2QADB 1BEXA 4LGRB 4N2EA 4U1SA 4F1SA 4F91B 3JT0A 5GS0H 2A6IA 4KMTH 1F8TL 1KN4H 1RKRA 3FB6A 1JF1B 4Z7OF 2Y7QB 4ECNA 2Q0ZX 2ZOUA 1QBML 2OXHA 1ZHNB 2IQ9H 3EGDB 3IFOB 5F9OL 2CIIB 1RJCA 3O0LA 4R7DA 4BFIA 1OP3K 4XNZC 5EOTA 2J2ZA 3CE1A 3O4OC 1EZSA 3FUKA 3GLEA 3P11H 4LLWA 1E43A 2IAMA 4L0PB 3MRDB 1BX2B 4NYLB 4AIXA 1HC1A 2J5LB 3S96A 3EYVB 1JK9A 2C3VA 1BZOA 4J4PD 3ZT5A 5EU6A 2AJYH 3WLBA 2VLJB 4WV1C 3U4EA 1I8MB 4LCUB 4OGAC 3F12A 5FO7A 5IQLA 5BNXD 1MCDA 2WV3A 4JM4L 4OU3A 4Y2NA 4LL9A 2D3NA 2CO1A 4LPWA 3U4AA 4N0CD 2IDCA 3P9LA 3BUQA 4OF8A 5I19H 1CDGA 1XMEB 2PW1B 4J3OC 5HHPB 1FSKC 4ILDA 3LN5A 4I0PC 1RZPA 4NZTL 5JO5B 2RAMA 1I53A 1BSIA 1DHKA 3HG2A 3MUGA 3SGJA 3RU8L 5JXED 2WIMA 4G8FA 3L4YA 4GRLA 2XTJB 3KPRE 1IEBA 1VFMA 5IW6A 5E1GA 3QUMH 2VAAA 2Z91B 4WW1A 3MYJB 5DUBA 5SWZB 2IG2L 3IE4A 1SQ2N 5HHVL 1VADB 2R0KL 1UEYA 5C07A 4KNUA 5L4IA 3SE3A 1T1YA 4WWID 3ZKXC 4Z76B 2X6AA 3QXDA 3UBFA 1E4KC 4EKJA 5CGYD 3WTTA 4K3GA 3ZY7A 2ICWB 2NW3B 4JDTL 4WJ5A 5JQ6H 3NCWA 3LH2H 3NCYS 3HI6H 1LEIB 1KUMA 3QPKA 3DA0A 5D6DC 1RVFH 4GNKB 4LBEA 1BREA 4GW5B 1A0QL 4KV5E 3VX1A 1F18A 4NRXB 1TQTA 3EJYD 3OJDB 4AE0A 3QUMA 4KJWC 1BYNA 4ZO9A 1SXNA 3EW3B 4O9HL 4R5TA 1QO3A 3MV11 5SV4A 1NSNH 2GJ6E 4FQHB 4GRWF 4KTEH 4OJFH 3RPKA 4HZAA 4WV1B 1XGUA 1CFBA 1OB1B 2KERA 3JTSA 4ZUUB 3MV8A 1TSRA 3BH9B 3QFJA 3LZLA 3SO5A 3CLFH 2O4EA 3FQRB 5EORL 5I15L 1LWRA 2Z8RA 2ZXCA 1EA9C 4D9LL 1I1CA 3ZDWA 3F85A 1Y0LA 5F0MB 1NKGA 5ILTL 5F1OB 2BCKB 1UKQA 2XUWA 5BJTA 2BS71 3TTYA 4C56A 1R0AL 3U46B 4ZPVB 2NUPB 1LEGA 4MJ5B 4ZTOL 4XI5C 3UOAB 1KJVB 1GZHC 4M1CC 4OAWB 1KBKA 3TT3L 4MD5A 3ZKXB 3V6OC 2ZXAA 2YUWA 2ZP8A 5IT2H 1XIWD 4QYOB 3MRHB 1H6EA 1K2DB 1I7ZB 2QQLH 3R1GH 4NNXB 2PPFA 1FZOB 3H7BA 1O6VA 1QP1A 1JHKL 1LK3L 2EKSB 4LSPL 5EC1A 1F13A 3RUGE 1FHNA 4PB9H 4ALAC 2YD5A 4LCWE 3BD5A 3S36X 4YPGA 2HVJB 2V2TB 3L7EB 1KEMH 3BT2L 1EWHA 3ESPA 2WWNA 4ZTPL 4K07A 4YSUA 3AQZA 4NEHB 4KKLC 5JXAL 1FI8C 2MQ0A 3G6JF 4K7FA 4LOUC 3VD3A 4K94L 5DD0L 3T3PE 1SXCA 4Q9QL 2YFOA 3AWFA 5C0GA 2VTFA 3QIUB 2G5UA 4KK8D 3KYAA 1OP5H 4YHOH 3SDAD 4DN4L 3BDBA 4RDBA 1TFPA 3VFPB 2X1XR 4HWEH 4W9ZA 1QBLH 3A67H 4GAGH 3S8WA 2WXOA 1EBAA 4E41B 5BO1H 3WTXA 4FFWD 3Q8BA 2VUYA 5K93A 3SE8L 4G7VL 3OKLB 5I1HL 3WEMA 1WD9A 4F7CB 4YSCA 5JA9A 3MV9D 4OFVA 4XO5A 4H88H 4MS8C 5EULV 3W5MA 1G87A 3DGGB 1U3JA 4AZUA 3MROA 4QXWA 2KDGA 1CFNA 3HNSH 3GSNL 3QORC 3G08A 4HMDA 5DT1L 3MBXL 3KBHE 4F37K 2NTFA 3EJSA 2XWRA 3VRIA 1PZUB 1NFIA 1IGML 2HG0A 4D94A 4LHQB 2N59A 2VR6A 4QTFA 4XPGH 1JHLL 4OZHF 1KB5A 4JFFE 4UM8A 2CGRH 3EO9L 4G8IB 4F8PA 5BOPA 3WO4B 3B5HA 4OLUH 3FT4A 1IGFH 3Q1EA 4LNVA 4AGLA 1WC7A 4S1RH 1K4DA 1QHOA 1MZYA 5E8DL 1OZUA 1W72H 3UAJA 3NRQA 4ZOAA 2IOMA 5L7XH 1LO3L 2DM4A 1A6ZA 4WEBH 4FEMA 3VFOB 5AYUH 2DDQH 4LEXL 4JFXB 3HMXA 3OQRA 4FNRA 1ZDQA 5AKRA 1D5IH 1GSKA 4HEPG 1U42A 5IFHH 4CSZA 2A9DA 3UIZA 2X09A 5F3HB 4XNYH 4POZD 2WM0A 4PBVC 3PYCA 3RRQA 4FXKA 4G8GE 2DWDB 1D6EA 3ASNB 5DD3L 5DJ6A 3QJXA 1FV1A 5BVPL 5JZ7C 2BVPA 4WF7A 4MJHA 1QSEE 1X3DA 4QRRA 3S37H 2EIZA 4IBUA 5CJ5A 3DDFA 5JPMB 4X6FA 4M7LL 4AEIL 4PJDF 4HWUA 1OANA 1XHHA 3O3DB 3QORB 3ZL2A 2CPUA 1NANH 3FO2B 4AYID 1CLOL 5LAPA 4LHUB 5CP7A 3B37A 1MI5B 3KWVA 5T1MA 1JGVL 3O4LA 1ZPLA 5I1AA 5AZ2L 1YC8A 1JN6B 1S7UB 2FYYB 1W80A 3MGTB 1HU8A 4U3SB 1HILA 3APCA 1O5PA 2XTJD 2Q3AA 3Q7JA 1IBHA 3FQWA 1JV5B 4IRZL 5E4EC 1BJ1H 5AQ0A 1CTMA 3FT3B 1CLZL 4P46A 1G7IA 3T3MB 2H1PL 1W0VA 3FUEA 3G9AB 1EJFA 2NXYC 3L4ZA 5MEQB 4OT1H 3R7RA 1QUPA 2DM2A 3BGFC 5DJCB 1YDPB 5AWNL 5AD0A 3UG3A 4KXZI 5DVNA 3HR5A 5E99L 2VOTA 1WWWX 1NAMA 1GGIH 2PNDA 3B7YA 3BKJL 3NN8B 1HKLH 3BSGA 3K2UL 2Q8BL 2Q7AA 2VSCA 2V2WB 2AJXH 1S7WA 2OMBA 1SDAB 3AS0A 2HFEB 3CFDA 1VSCA 5KSVB 1J5CA 4F7MB 3F7LA 4XGZB 4Q4EA 1CQKA 4IKNA 5SX4H 2ED6A 3IKCA 3HN3A 1RUKL 4KAQH 4KZCA 4FABH 5GRXG 5I76B 2GY7B 2B3RA 2CRZA 3CQQA 4OGAD 3ZYJA 2EC9T 3JTBA 1C5BH 2Q8AL 2OJEB 1JTOA 5LGJB 3WTYA 1GYUA 4AQOA 1JDAA 2E86A 2Z0UA 3IXAB 4PJGB 4J3OD 3EOTL 4I0PD 4QPEA 3RX5A 2X88A 4WI0B 4JFWA 2ZZUT 3EG9A 4YDNA 4YL9A 4AC2A 3PL6C 3GSRA 3CHOA 4ZJ9A 5E4EB 2DMKA 2R2BA 1VZHA 1XD1A 3UJIL 2I69A 4FP8H 4XBGA 2E8ZA 3OF6D 1FFNA 2VLME 1LMIA 3BRGC 1S5IH 3IGAB 3V6BR 4JLRA 1OAQL 2G3NA 3BGFB 2PLTA 1CL7H 4X6BB 1A22B 4TQPA 3CQFA 4GAFB 2O30A 4P48A 5FYJE 3Q2LA 5FOBB 3IMUA 2E9JA 1XD0A 4Q7DA 3ROLA 1PEZA 5GGQL 3WGVB 1KYOJ 4M4RB 1VFAB 2BP0A 1SDDB 4G9DB 1FPTH 3EIFA 4XVTL 5L2KA 4FQQB 1QA9B 5MENA 1K3IA 5DURD 4A6YB 3TA4D 2H8PB 2B15A 1HTYA 3N91A 2H3NA 1IM9D 3K0WA 5HHOA 3BDXA 4RNRA 3UYRH 4Z3TA 2V37A 3O11A 1PCSA 4Y16B 2CMRH 3F64A 5E51A 3AGVA 1SJHB 5KOVC 2ERJC 3DV6B 3DURB 3QDJD 4FD0A 3ARTA 4Z7VB 4JFSA 3ZUCA 4OCRL 1P7KB 2WWMC 1UM4H 4XBMA 3GF8A 4Y9GA 4B9YA 2CO2A 3QDHA 4E41D 1KNOB 1EGJH 2X1WL 1WICA 2XICA 1X6LA 1K3ZA 3BUYA 5HI4D 3PL6B 2XQYG 2E75C 1F3JB 1CXIA 2HG5B 2XV0A 4HX1B 3VI3E 1FIGL 3ABMB 4KFZC 4ZQKA 3B43A 4XI5D 3NABL 3FUDA 2AMGA 3AFLA 2WO2B 4LLMA 2G9HB 3CMOL 4MAUH 4NO5B 3GMNA 4GOSA 3KWUA 2ETWA 2EXTA 1R5IB 2R7EB 2WCPA 2F61A 2HVKB 4X5PA 1RFDH 3H3PL 5GGUB 2KLTA 2W9DL 1LEKB 5ADOH 1NMAH 4ABQA 1CE6A 1RSFA 1RQ5A 1Z3GL 1DLHB 2OTPA 2FQEA 1EGJA 4DGVL 5DTFA 4Y4KC 1ZJAA 4PJFB 4FQXA 3CFBB 3MI6A 1CFQA 5CHNA 4Y2OA 4KKLD 2UZPA 3G04B 1DVTA 3OSVA 3DHUA 5DJDA 3RE0A 4LOUD 3X17A 3IETB 5LBSL 1FAIL 1B6DA 2O5NA 4WI3A 1B88A 1KJ2H 2X3CA 1B0RA 3CSYB 3IMVA 4LSDA 5HJBA 1QUNA 2ERJB 3DVGB 3A4AA 4JFED 2AEIT 4X4YB 3MJ8B 3LEXB 4HT1H 3TYGH 3WS3A 4L48A 1NGZB 1R3JA 3CSPA 4P57A 1DEEA 1M7XA 4ZNEA 4A7VA 1RUPH 5J9PA 3CC5B 3PXHA 5BW7A 3FCTA 4J3OF 3WS6C 1RP8A 5GRWA 5IJKA 2APTA 4IGBD 1S78D 5PCYA 3SGEH 3EOBB 3R0NA 4NPJA 4O02H 3CHXA 2X4SB 1OGTA 5FYJH 3ZZQA 4HCGA 4XX1E 4DUVA 4PJ5B 1L9MA 1NUDA 3IDXL 5CGBA 1ORQB 1P9MC 1G1KA 3QORD 2Q2EB 2XN2A 4I18A 4U6YB 1PX4A 3UBGA 4XBPA 2KHAA 4LHUD 3BAIA 1O6SB 2JJTC 4XOCA 1QRNA 2J73A 3LKNA 3QQDA 4WU5B 4MJIB 3BO8B 3RWIA 5I6KA 2CIKA 1I7TB 4P2RD 1P4UA 2QQKL 4BGDA 4XC3H 3U36B 2YPLA 1OAZH 2CHNA 2KH2B 3FUFA 4L8BA 4O02A 4YZFE 2FD6H 3ZZLA 4OM0H 5CLTA 3HAEB 1IAIH 1YC7A 4WI4A 4C4KO 4XAWL 4CBPA 5JIKA 1Z5YD 4ODSH 1X9RA 4L29A 1ROWA 3VXSE 4APXA 5BVJA 5TE4H 2QHLA 3GXPA 5IBTL 3KLHD 3STZB 1A7NH 1KCBA 1QX1A 4K9EC 2IWKA 5EEZA 2IFFL 2FO8A 4D9QE 4XCYA 4HC1H 1QLEH 1XZ0A 2WZPA 2OXHB 3T2LA 5A40E 1CDYA 3F62A 4R7DB 1QZ1A 1U8NA 3WE6A 1RZ7H 2GUYA 5EOTB 3PPEA 1YJDL 2VLLA 3FTYA 4LLWB 5HHXH 2ICEA 2FEEI 4OJEH 2OYMA 4FFZL 4JFHD 1OF0A 1GGYA 1DLFL 2C3VB 4JPIB 3WLWC 1IFRA 3CK0L 1D5BB 3F5WA 3OJVC 3HLKA 3C60A 4GW1A 4GMTH 4JG0H 2KQMA 4J23A 3F12B 5FO7B 4OGYH 3MN8A 4RAUA 4X9FA 2AJZA 2VLRD 3QUYA 4HXBL 4OFYD 3QFGA 5K1JA 3IDJA 3P9LB 5JHLL 4ETQA 4H8UA 3QEHA 2D3JA 3RIFK 3LN5B 4Z5RA 5IJCC 3BKCL 2EJ1A 3VTAA 1MNUL 1F86A 3DUSA 5EUKA 3MKKA 1TDQA 3L4CA 5DWUL 5IVXE 4Y2DC 1EZVY 3D6GA 3MUHL 4U1HA 2Q7NA 1IEBB 4E5XG 5IW6B 3T4AC 2NXYD 2VAAB 3P0YH 5FHBH 2Q2LA 4OD3H 1LWHA 1OCZB 3F6JA 3TIDA 2V5TA 1VLXA 1AVAA 1T1YB 2ZAHA 4PV9A 4TL4A 4HK0B 3VFGH 1VEPA 5D1ZC 1Q38A 3KPOA 2RB8A 3O2DA 4OJDH 1RJYB 2BNRA 1A4JA 1OAXL 4XXCA 5HVWA 1BFVL 3MBED 4XP4L 4LP8A 1SDYA 1FGNL 3UCRA 3N41B 3WGUB 5IV2A 1ONQA 1KXTB 5E4AA 3MGOB 4HH8A 4MLSA 1JYVA 4YGVA 2J20A 3D34A 4MCYA 4UBDC 1OE1A 1URLA 4Z7QE 5DUPH 2WB7A 4ZMLA 2CRIA 4JPKH 4Y1AE 1QG3A 2KC0A 1WIPA 5DHVB 4NQCD 5C97A 5MP6L 3HZMA 5D72L 2F8VA 4PVMA 2D0FA 1QO3B 3NSYA 5AAPA 4XMTA 4XVJH 1QSFE 2XDHA 1HSBA 1XGUB 3W56A 4E9QA 2R0WL 2WLKA 2CO7B 3C5ZA 1OPGL 3JTSB 2RBLA 2QVKA 1JYXA 3OGCB 2WB1A 4O2EA 3WKQA 1YMHA 2X3AA 3U6XS 4M6NH 4AEEA 1IFGA 2LLNA 3GKWH 5F1KC 1ITCA 4X5QA 1XAKA 2I60L 1S9VA 2YS4A 3HBZA 4R4FH 2XV2A 4ZFOL 4Z0BL 2BVOA 1JVKA 3S3JA 2YKLH 3N3EA 3VRLE 5DMJB 4ZZKA 2WC7A 1LEGB 3T3MF 3T4AB 5GGSA 2J5WA 1F4YH 3RL2A 4KO5A 4XNUL 1SXSA 3HC0A 4Z3HA 4AMWA 5D9SA 2WOYA 3TV8A 3BW9B 4MD5B 2WVVB 3H4HA 3VGAC 5D1ZB 1F0LA 3FQ4A 3L5JA 1JZDC 4Z78A 2X87A 5TTRA 3O6KH 1E9OB 4ADIA 3HC4L 1A6VH 4FLHA 5HBBA 5EC1B 2CO6B 1WK0A 2ADIA 3KPSE 1N59B 5IMKB 2EDNA 4N20A 2OSWA 4B5EA 1C7SA 4DGUA 3UAJC 4MSWA 3IMBA 5IEKA 1ZRUA 1I3UA 3C5SA 3QR2A 1L7IH 4BUQA 3QUXD 4K7FB 1RZ8A 4W6XB 2CJ3A 1TF4A 1A4BA 4H8HA 2DD8L 3NOIA 1I4FA 1TJHL 4ICWA 1LNUA 2ZYSA 1CGXA 3H9SD 5GGSY 3S5LA 5JTWA 1JV2B 4BUGA 2GABA 2LT9A 4OTXH 1EZUA 1OP5K 3GLDA 1KSRA 4PJGF 4AK2A 5B7FA 1MJ7H 3TBCA 1OCOB 3LPWA 1A02N 4C4UA 2GEQA 3I9PA 4KKCC 4DZBB 2MNWA 2IDUA 2YQ3A 4LE8A 1OHZA 4N1EA 4EI0A 2IC2A 1J1XL 4K94C 1UXMA 1FNSH 4L4VA 2DH3A 3MROB 3AXHA 1CFNB 1QWNA 3G08B 1P5UC 1YEJH 5I8EB 5EN3A 2DN7A 3ARXA 5LAXA 4RESB 3HZ3A 2NTFB 4ISVA 4N90D 1Q0XL 4U49A 1KJMA 4DERA 5CZXC 3VRIB 5DMIL 3H0TA 2DZEA 2FEEL 1JXGA 4ZZFA 3MREB 3QUGA 1TTRA 4R0LA 1JZ2A 1CF8L 3VWJA 1KB5B 3QEQE 4KRPC 4Y4KD 1KFAL 2F15A 4FL4C 4B3VA 5CP3H 2R1WA 3FT4B 1MHPL 2BHFA 4MXWL 1RZFH 1WC7B 1IC4L 2QL1A 4KC3B 5HGGS 3LN4A 3WUWA 1N10A 3S6CA 1TSHA 2W0FB 1ET5A 3OBAA 4UV4H 4ZMVA 2ZKHL 2OP4H 2XXFA 4U7KA 3BHBA 3ZKQD 5I0DA 3L2NA 3ZDXB 3UACA 4JB9H 5DEJA 2QT6A 1EO5A 4HMCA 5B1JC 2EYSA 4RGND 1A65A 4ODHH 4MNGA 4Y1AA 3FFCD 4Z7VF 2AERT 1YUKB 3E8UH 1CXFA 3UYOD 2O5ZL 2OCCB 2BIOA 4FXKB 1AC0A 3QC6X 3WKNA 4I3SL 1F6LL 4QKTA 3FB7A 3PWJB 3O3UN 3EJJX 4J7RA 5L4JA 3VXUB 1QQDA 4TOYH 1AR1D 1J8HE 2XWJA 4PRPD 3T77A 1TZAA 3FTVA 3DHJA 4XP6L 4Y7MA 5DJYA 4UQ9A 4ZAKA 4OF3A 3AROA 3GDBA 1BMGA 5E5MB 1P5UB 1RH8A 4OLWH 3BMWA 3LQZA 3QDGE 3P3RA 4F9PA 1UKTA 2GSIA 3ETSA 3I9GH 3OG6B 3RAJL 2VJXA 5FO8B 3NZHL 2E9WA 1K72A 4UAOB 5T1MB 2YLHA 1XL4A 1U8CA 3O4LB 4FYSA 5T1KA 4KQ4L 4DUXA 3WEBA 2WGNB 4FL4B 4OZIE 1DN0B 1DDHA 2GJZB 3GZKA 2DLHA 4JM2A 4PJFF 2Z1KA 1IUZA 5D4QA 2Z8VC 3HE6A 4QRSA 1GOFA 2ZP9A 1UOKA 4Z7UE 5FM5M 2RTTA 3LS5L 2Z1PA 3GSNB 2A9MH 2ENQA 4NZUH 1G6VK 2ZCLL 1FNGA 1CLVA 4PG2A 5IM7B 5AD0B 5DYFA 2HYMA 3GSVA 1G84A 2R29A 2Z7ZA 4N0UB 2GTQA 2PYED 4ONOA 2XWTB 5I6PA 5TDNB 3UBXA 3IAGC 2OTUA 4B9IA 1J11A 1JWUA 2E59A 2Y23A 4B9PA 3KL3A 1EXUA 1HQ4A 4RAVA 4EBQL 1U3ZA 3CN2A 2BIQA 2F19H 4L3CB 5DVOA 2XNAA 3I6SA 4A2MA 4TVUA 5DQ9B 4R83A 2NX5D 1HDMA 1IGYA 3ZE1E 5D1XA 4RFOH 4NQDD 1W9XA 2X4TA 4QHKJ 1TZHA 4HZLA 1RUAL 4HJ0C 4LGSB 2EH8L 4FMKA 5CJXC 2C3HA 3LKRA 3MODL 2JV6A 1A9BB 1KCUL 3GNMH 5AL8A 12E8L 3MOAH 3AT0A 4PLOB 1B0GA 3IB4A 1IAOA 2Y07L 3FHEA 4CRPA 4DAGL 4H20L 2DJUA 2N0KA 1BZDA 3K71A 2HLAA 5K1VA 4WFHE 3BP7A 7FABH 1G1CA 4Y2DD 3GSRB 2MOGA 4FXGC 3P73B 2JELL 4B96A 3ISYA 3QE5A 2H41A 3HW7A 1A5FH 4XBGB 3FCGA 1L9TA 5L9DH 4OLVL 4Y4HA 5CD3B 2BRRH 2JKWA 3ZTNH 1HIMH 1OCWL 4Z7AA 5L4MA 4KDTC 2VN4A 5CLWA 1M7DA 1T2JA 4UQIM 4OLYH 2X41A 3GKZA 2QZQA 2OMNA 5F88B 3PGCA 3DKHA 3CVIH 1UCBL 2XWZA 4KZEH 4BINA 3FRPB 4XMUA 2CM6A 2P52A 4G42B 3MNZA 4FNPA 4XBEL 3GGWB 5F1SA 4KKNA 2GTWA 1AKJD 3THMH 3OAUL 5FFOA 4WTWA 4FQXC 1JPSL 4PTUA 2H5UA 3GFUA 5MENB 2Q20A 4ZOEA 1MY5A 4LSSL 2WYZA 5KZCB 3GMMB 5FW8A 1FRGH 4XNBA 3AM8A 1JGDA 4W1TA 2X1OA 1WFOA 1B4TA 2C3WA 1E3XA 4P04A 3GZPA 4TLTA 4ZQTA 2IPKA 2IBZY 1HXMB 5BQDA 2JB5H 4PBXA 3GQFA 3GC3A 5KAQF 1NCBH 3U0PA 1ZCRA 3GJFB 3WY2A 3H6JA 3MCKA 4NQUA 1SY6L 1XGRA 2W65A 3US9A 7PAZA 1BQHG 2YQBA 1G6RH 2DKSA 3VXMA 4KQ3L 3DGDA 4NX0A 3BAEH 1PLGL 2OV0A 4NQTA 1BCIA 1QPKA 2Y06L 2YEQA 3BUYB 4OLZH 5DUML 3ESNA 4Q6YA 1FO0A 2GUOA 2IADA 4FXGB 3I50H 1OTTD 4O00A 4TVPL 4R7NB 3CFEA 5I9QC 3UPCA 1T2QL 1II4E 1R3LB 1TITA 3MC0A 3DK0A 4ZW7A 1D5ZA 3APNA 4ZFGL 5D7LD 4LLMB 2C9XA 3O6FA 3V4PL 1A14L 2HPTA 3S2CA 4JVWA 2J55A 1I9JH 4DN3H 2CK0L 2Z93A 4D0CA 2H7WA 2C3XA 1AOHA 1F3RB 5H8DA 1DVSA 4EZMA 4AUUA 1SXAA 5D2LA 2VDRL 1CE6B 1PSKL 3RA7H 5HYJE 3N41F 4ZS6D 3CU1A 4PRIE 2P5EE 4JW3A 1BFTA 5DTFB 2X2UA 3MOBH 4FQXB 2XXMB 5CHNB 4Y2OB 4M5SA 2PWDA 4JO4L 1JP5A 2ZXBA 4L9LC 5CBAA 1XBRA 4YHMH 4IOFD 4IS6A 4X7EC 5CEZE 4JR9H 1JXDA 1ZTXE 1YPZE 4JPWL 3T0EC 1KOAA 4O2CA 3TCXA 3LX9A 4GT0A 3WS3B 3D85A 3NJFA 2E74C 2YZ1A 1RIUH 1QWUA 2R2HA 4P57B 1W16A 4DKFH 4Q56A 4BZ1A 1A9EB 1PY0A 2AMUA 4N68A 1ZDSA 2Z31D 1MW3A 4PSPA 3MRMA 3RFZA 4XN5A 4BKLB 4O51B 4OBSA 1RV6X 4CKQA 2EUXA 1LO5A 2YD9A 5I9QB 5KVDL 4EDWH 3VH8G 3C60C 3L5XL 5H37A 1CFVL 3ZKNC 4I18B 2F54D 4MHHG 4E9LA 4GG8A 5EC2B 3ZBMA 2H9GA 4D7BA 2APSA 2VH5H 3TBTB 1QRNB 5C0AA 4PRHA 1WGOA 2CIKB 1AIFA 3UAFA 3NDZE 2BSSA 4KRPD 1HNFA 3KYOB 2YO3A 1YN6A 3D0AA 2QPEB 4KU1A 3D69B 5E6RB 1XWVA 1OD7A 3DRQA 1E9QA 2GJJA 1E65A 4L8BB 4N86A 4B7IA 1BD2A 3NEXA 2K7PA 5I1GH 3KVDD 1J0JA 4G6MH 4KHTH 3CZGA 1MRFH 1EXGA 3BH4A 3FCSB 1NLDH 1J8KA 3CZFB 3U7YH 4L29B 4W4OA 4XXDA 2YGQA 5BVJB 4P0DA 3T0EB 1QR4A 3KXFE 4X9HA 5K9QI 4QXUL 1PKQA 1VCAA 3FMGL 2Q76B 2XIBA 4TNWK 2PABA 3KEDA 4N25A 5C0EA 5C09A 4BCXA 2H32B 1U8NB 2QQNH 2R51A 3G5VB 3WE6B 1P5VA 3X3GL 3L1EA 4OGZA 3TBSB 2MKLC 2CKBH 2H0JA 2VXTL 4TUJA 1MCFA 3OMIB 3HG1B 3SKJH 3ULVL 3OB8A 5CCKL 3HJ0A 2K9UA 4N9GB 2CLRA 3NBNA 4CW1A 4PGDA 1FYHB 5DJAA 3TNMB 3VG9C 1CFSA 3MA7A 3F5WB 3C60B 5DO2D 4JFDA 3UTTA 2EDYA 1WITA 2NYYC 3C5ZC 2WLNA 4RAUB 4X8GA 1H9DA 1TEFA 1XH3A 3H42L 4XAKE 2OMYA 2OI9C 3OHXC 4L4TD 5E23A 5CEZH 1ZTXH 2H3KA 4XC1H 3IDMA 4P3CH 7PCYA 1QHPA 3QEHB 1NC4D 4NRYB 3US0A 4QWWD 2YAPA 4UT6A 1T5XB 4Z5RB 2XWBA 1A7OH 1YJDC 3PGFL 3WJLA 1M3IA 5EUKB 2GK0A 2FNWA 4KVPA 1S3KH 1Z9SB 4TQ8A 2CKBA 4TQEH 2YAQA 3RVWD 1WSST 4GXUN 1ADWA 4PRIA 2NZIA 2P5EA 4JPSA 2AANA 5IZ7A 3DX8A 5I6XC 3WMSA 3ZDXF 2NY1D 2E5EA 2VSKB 1GIGH 3J2PA 2ESVA 4YE4H 3KPOB 3A4EA 2SEBB 2XX1A 5I5MA 1UD2A 4OFPA 2I27N 4Y1SA 4WFEE 2NLJA 3DBSA 3C6LD 2DPKA 2FQGA 3QWQB 1ONQB 1YPZA 1DANT 1UVQB 2XTLA 4YGVB 4E0RB 1HZKA 5E0FA 1AI1L 1YMMD 2WSPA 2YWZA 4GI8A 1GGUA 1S7RB 1T1XB 3TJEL 3V0AC 4E42A 4ODVH 3CBJB 3MQIA 4S10A 3K6SA 1FH5H 3IM1A 4M00A 1MQ8A 5ITFA 3L54A 3BIAX 4AEHL 3MBWB 3AREA 5A2FA 1TJGL 3GDCA 2YGOA 2KI6A 4P49A 1HSBB 1FN4B 4F8TA 3WELA 3UTSE 2FUQA 3HNTH 3C5ZB 4Z23A 4JREB 2E47A 2K3HA 1SUJA 2OI9B 3OHXB 1G9NH 3VUAA 5GRUL 4EPSA 3I84A 5MHSD 2VMEA 4NUMA 1W2KT 1AHWA 3HOGA 1H3GA 1S9VB 3BMVA 4BFJA 5BXFA 4C4KT 3HPLA 4YSEA 4GXVH 1M42A 5DEGA 1AGDB 3QJZA 4R4BB 5DQJB 5GGSB 4QRTB 3RL2B 3K5RA 1UACL 1BAFL 1ZK5A 1FFRA 4NKIL 4WFGE 4YDMA 2JJSC 5I6XB 5GS0L 4HS8H 1SHMA 1F41A 4ZW6A 3ISWA 1IFHH 1A3RH 3QEGH 1HCYA 1VFUA 2NRDA 1BA9A 1SJMA 3L9EA 4M6AA 2P5WA 4R0LC 4APQA 3VWJC 4FKEA 1RLBA 3UTPE 2J25A 3F2LA 2PP9A 3Q2CA 3TO2B 2HFFB 3I6LE 3CTTA 5JOPE 2I25N 1H3XA 3AB0C 3KXFA 5E2WH 4LZKA 5KSBB 2XN9E 1HCVA 2DJ4A 3VFTA 3PHAA 4MSWB 1GMIA 2IPUG 4MAZA 2FB4L 2WBJA 2UZXA 4KKZA 4UM9B 4D9RD 3OR6B 4JJHA 1YHPA 5AZUA 1RZ8B 2YAMA 2AJYL 1DCLA 1YZZA 3WSQH 3NCBB 1LNUB 4Z18A 4L1HA 4Y7OC 2DICA 3GD1C 5D8JL 1L9QA 4B9KC 5JORA 2PXYD 1X5IA 3HI1A 2JCCB 1TJXA 2B0SH 3BX7C 2WQ8A 5EF3A 2A74C 4PV8B 3FTUA 4JUSA 2H1LM 5TJWK 1ASOA 1MFVA 1OB0A 4RETB 1FP5A 1O6TA 1TQUA 4IOSA 4P2QB 1KLGA 5B3JF 4P5RA 4L3EA 4DNLA 4P23C 5DA0B 35C8H 5IG7B 3RGBA 4P2OA 4WDIA 4Z9KB 1VPOH 1EEZB 1HYSC 1U2HA 1UM5H 4R97C 4JRYB 4OIIH 2NT0A 3VRJA 1A1MB 4BJLA 2HT4C 2Q1EA 3WFHB 4WNQA 3BPOC 5FDYA 4PS4L 3B5TA 1BAWA 2MHAA 1C8PA 4PJIA 4ISVB 4PLNC 3IFLH 3VFWB 5JR1H 3BJLA 3EHBD 2BHUA 1MCJA 1JZJA 1G7JA 4LLDA 1BPVA 3MRFB 4N8CL 1NGXB 4UQAA 3FPYA 1AS8A 3KH4A 4R0LB 2HJKA 3LH2L 4XH2A 3B1UA 3IJ9A 3VWJB 5CZRA 4ZFOB 1RVFL 1NANI 2R1WB 5K9OA 2BSEA 5JDJA 3AB0B 3HE6C 5DA4A 3WUWB 1NBVL 4OIBA 5E5RB 5E9NA 4UDTA 4YHYC 3BHBB 3AXIA 3C9NB 1WA1X 3CZKA 2EYSB 2YHGA 4OJFL 1XX9C 5ICUA 5SX5H 4RFEB 4MNGB 5IR1B 1I1FA 1U33A 2Z34A 5FCUH 2X70A 1EHNA 1T0NA 4DGIH 5D1QA 3CLFL 5GZOA 5IFJB 2A74B 4G6FD 2UY6A 4Y9EA 3T8XA 2GIYA 2O61A 2N3JA 3LNDA 2VRKA 4NXSA 1J87A 2VIRA 3HG1D 3FB7B 3BDYH 1OARH 1ZAGA 3CQPA 3V4UH 5TF1L 3EXLA 4KZ0A 1QQDB 4P23B 2XWJB 1IGIH 3T77B 3RI5F 4XPFH 4YSRA 2HB0A 5KYYB 3Q5OA 2VXSH 1DSWA 3GT6A 1MAJA 1E5BA 5J56B 1INQA 1VB9A 3BPOB 2BINA 3VGHA 1M2OA 3ME0A 4RIRA 5SX4I 5J6HA 2GSIB 2ZNWA 1I9IH 5IROA 2DWTA 1QNZL 5E4IA 5E2JA 2QQLL 2IWGA 2VW7A 5DWPA 4AQAB 4Z7NB 1TXKA 5BRZA 2WN3A 1U8CB 4X6CA 4ZMOA 3TBYB 3A22A 5T1KB 2OM5A 3H2WA 4ZX3A 2ATPA 1FNAA 1KWKA 4AX3A 3QJHB 1RSYA 5SWSE 5TFSH 1P1ZA 3U1PA 3RGHA 4WKZA 2F5AH 1OLLA 1N8ZB 4WFFD 3QIBC 3HE6B 3RTQC 3VWKC 3E1F1 3OZKA 4RMSA 3DDGA 4YHYB 3CN4A 4Y5VC 1FNGB 3H1ZA 1ZS8B 3MTXA 4HXAH 4J27A 4HKXA 4I3RH 3GSVB 4H1LA 1T4KB 4YHOL 1FVCB 3QAZC 5ESQA 2X4PA 4BZ2H 1S6NA 4PLKD 1QBLL 3A67L 3MRKB 1V3MA 3UBXB 3DXAB 5TE7L 4ZMZA 1JWUB 1A1NB 3N85H 1DQLH 4IRJD 4WW2A 32C2B 5BO1L 1ZLSL 1CL7I 4PWIA 2DY2A 2QV4A 5FS5A 1B9ZA 4RAVB 2JVUA 43C9A 2ZNXA 4Z7WA 5HYSG 2ORBH 1UUSA 1RUQH 1ZA6A 3MLZL 5JNYA 3KYMA 1XF2A 2LVEA 1B3JA 1CLYL 4PGBA 4X7FC 3KZ8A 3PWVA 4I2XB 1SHSA 4F8LA 1YY8A 1KT2B 3BLKA 5HDOA 3JQOB 4N5EC 2XG4A 3R19A 3BWSA 4HIPA 4PREA 2QPFA 2ZXWB 3GEFA 4U1NA 5LCVL 5KS9E 3WTUA 1KTJA 3D0VB 1IAOB 2R4SL 3MJGX 3MRLA 4DKEL 4ZX4A 3CVHH 2HX9A 1BHGA 2FJHA 3O2WH 3K71B 2VLKA 1IC5H 1IGFL 4OVUA 1HQRB 4S1RL 4GEJA 4ZG1A 4PJHA 5E08H 3VFVB 1W72L 5HP5A 3QIBB 1AJ7H 2E3VA 4X6DE 4XNMB 3RTQB 3VWKB 3N1MC 1OGAE 3PQYA 3DECA 2VZSA 4LDOB 5AYUL 5AW4B 2BCMA 5I2IB 1PD1A 3ESOA 1NFDB 2CLVB 3LZPA 4Y5VB 4RQQB 2VZ3A 3RVVD 2H26A 4YFEA 2F53E 3I75A 2CR0A 4WU7B 5C0DA 4K23H 1NCDH 4N0FB 3SPVA 1CE1H 3VQLA 2XSKA 4XNYL 3QAZB 4U1KA 1SJEA 2W9EH 4EVNA 1PNDA 2QHRL 3SDYH 1S8DA 1V7NH 3MNZB 5DR5H 4ZW3A 2D03H 4PWHA 3ECQA 2GTWB 3P2BA 1QTSA 3LZOA 1R24B 1LDSA 2JIXB 3T2OA 4I87A 4L18A 1TVDA 1M1XB 4L8DA 5F1NB 1U8PA 5HTSA 1GS6X 4HEME 3S37L 1OAUL 2P8PB 5F7HA 1LJMA 1PKOA 4G1EA 2ARJA 1JGDB 4K2UL 4WEMB 3HE7D 3DX0A 2K4WA 4TNVF 3CH1B 4YZWA 2IPKB 3QEUA 1LILA 4RCAA 2L4OA 3WN6A 1QI4A 2L7EA 4K3JH 3U0PB 4JJOA 4LB8A 3MCKB 1XGRB 1FFQA 2W65B 5E03A 4Q6IA 4QCIA 1U8LA 3A0OA 3DJTA 3ULUE 4FNLH 4N2DA 4RGOH 1ZV5A 3VXMB 4AGOA 1CIDA 4P5KA 3MPCA 5JMRA 2YD3A 5EZIH 3WKML 5AVYB 1PX8A 2GUOB 2IADB 1F2QA 4BIKA 4QAMB 3QZPA 4Z7IA 2OK0H 2DM3A 3CFEB 4RGMC 4YSAA 3CDFA 5DK2B 3IN0A 5BMFH 3T2QA 1D5ZB 4LQFL 1WAPA 2JQAA 4AYGA 4OT1L 4LRIC 1OKEA 3BUDA 3LRGA 3SGEI 4HFUH 4POUB 3EF4A 4QJ4B 5EU3B 2OX5B 3HN5A 3FBKA 5LCVA 5AUMB 1HHGA 3JWOH 4BK4A 4G80B 2MCPL 1RZIA 5F89B 2CZNA 3CMGA 5D2LB 5E56A 3IGKA 1KYOK 1HKLL 4CVZA 4ZO6A 2X4RA 3ALPA 3NRPA 4BK8A 4OQTH 3VVVA 4NS0A 1DJZA 4MXVF 1GVIA 1G9EA 5T1LD 5FFLA 1MJJA 3BXNA 1PYWA 3QDMA 1MAMH 3IU3A 5CBAB 4KAQL 4FABL 3DO7B 4Q9RH 4M5YH 5E1QA 2WNGA 2CA3A 2Y1AA 4K5LA 4JO1H 1E42A 3DX1A 3L45A 4PQXA 4MMZA 4OBRA 3NSCA 4IDJH 4QIRA 4ZRGA 3O0RH 1JNHA 1SEQH 3D85B 3EAKA 2XQ0A 5L6YL 2HKFH 2VE6A 3HG4A 1IAII 4CVUA 4P2RE 3VYNA 3QQ3A 3VNYA 4RA3A 3FO9A 4DEPC 3FSZA 3N1GC 3OKDB 4P23D 5CCJA 4XO8A 2AK1L 3UPRA 4FP8L 3HNVH 4GW4B 5CILH 1HL4A 2HT4D 2UYLB 3HZVA 4CMMB 2Y22A 1S5IL 5LN4A 1CLCA 1L7TH 1JF6A 2WYHA 3X13A 4GG8B 1CL7L 4KUCD 4WWOA 1DVYA 3P0VH 4YR6B 3OG4B 4B3EA 4AW7A 5HHNB 1L9NA 5I82A 5IMOA 1M1SA 3CCHA 4GIOA 4WI7A 1E0OB 2ZOOA 4S11A 2BNUA 1AIFB 3N2JA 4P4KA 2WXKA 1AGCA 3L1OL 2F53A 4UT9H 1CWVA 4PJBE 5E8NB 3ULUH 1BD2B 2Q5BA 5KSBF 5D4IA 3KM2A 1H3VA 4LSVH 1MCEA 3B4NA 4WWKD 1ZD6A 2BSCA 1UGNA 5IB2A 3V4PB 2EXYD 4I48A 3S48A 1OGPA 3BI9X 3BP6B 2VDMH 4XXDB 2GITA 3SYQA 4BFRA 4HEMA 2O93L 4AVJA 1UM4L 1XF3A 2JCCF 2VDRB 2YJQA 3DXAD 4JGJA 1PKQB 4M7JH 2AQRA 1NAKL 1N2RB 5CU5A 1MUJA 1E9PA 3BE1L 3CX2A 3P9MA 2YIHA 4DEPB 3S88L 3LNGA 1P5VB 2V9RA 3EO0B 2AK4D 4PJ9A 1JNJA 3NFSL 4KXAA 1JGLH 4TUJB 1VACB 2JK5B 3EH3B 4AM0Q 3UBHA 4KI5C 2Y5TA 3ES6A 5CIPH 4LPYA 2CLRB 2MNUA 4QGTA 3TA3A 4CW1B 4PGDB 5DJAB 1A66A 1XXDC 4LARH 1CFSB 3MA7B 3AG3B 4JFDB 4NZRL 3EDJA 4O5LL 1Z5HA 3DSFH 4PMEA 1RFDL 1XH3B 2X1PA 1XBDA 1H6TA 3O6LH 4QOKB 1NMAL 2DKMA 5DMGC 4RBPK 4A38A 4K8RH 3IDMB 3OMAB 3Q8EA 4LVEA 1YNTA 2V9UA 4OKDA 4XTRD 4NWUL 2G9KA 3VXQA 2W0LA 1ZGLP 3MJWA 3ULVC 4PN6A 3B9EA 5BS0D 4LIQL 5IBUG 4HOMA 2SODB 1YRKA 1A6WL 1ML0A 4XN7A 4NQCE 2WQRA 5AG9A 5EZOH 3MRGA 3TPUA 1HCZA 1H9VA 5DVKA 1R1CA 2XPZA 4A2DA 2ZICA 2ESVB 1OCRB 5DSCA 3O9WA 5C08E 4HT1L 3TYGL 4PRAA 5J8OA 4JHVA 1CN4A 4KWUA 3W2DH 3NPSC 3PWUB 1N7MH 2WLLA 4P3DA 4M1GH 3H53A 4APQC 8PAZA 2WSKA 1IGCL 3T6QC 5HDLA 5ISZE 1QFPA 3IJEA 4BXVA 4YWGH 4F2FA 4E42B 2FSEA 1M2VA 2NQ3A 4RA0C 1PZCA 1Z9OA 2YEZB 4FFYL 5C0NC 1E40A 1HEJC 2Y2YA 4PGEB 4YBQC 3MDJA 3K6SB 3KJ6L 5T1DH 1YN7B 2BWQA 3IDIA 2GIXA 4G9FB 4N5ED 1GGBH 3A24A 2EUWA 4QXTB 1BJMA 2W5PA 1OOAA 3ZRFC 2VXVL 4MVBD 4Y19A 1XQ4A 4MWFB 3V6FA 2DTML 4KY2A 3GTNA 4KUCF 2GCYB 4YEFA 2AQ2A 3VXRA 3IBEA 1FYTD 1HI6B 5H94A 3VQ2C 1CGVA 4XC3L 4NRZA 1OAZL 4DP6X 1JK8A 4X4XA 1JGUH 3LXUX 3OAYH 4YDIH 3R4RA 5F71A 5BXFB 3NZ8B 3HPLB 2VXQH 4PJ8D 1O5DT 4J8QA 3B2DC 2FD6L 2IGLA 4OM0L 4CDHA 2R83A 1ET7A 1IAIL 5GS1C 2E4TA 2FLMA 4WO0A 5C7XH 4HCIA 4AV4A 3QUZD 4UINH 3W38A 2WKLA 1DR9A 1MDAA 3EO1A 2VDKH 3PHQB 5CNHA 3VYPA 1A7NL 4NZ8A 3D39A 4M93C 2Q10A 2VQ1A 2F1BA 3SQRA 3NPSB 1K8DA 1QLEL 2P5WB 4APQB 5EIIA 3CG8A 2ZX9A 2CGZA 4OV6F 4PJEE 4PGJA 1C5DB 1FCCA 1BPLB 1RZ7L 4ZMYA 2HZHA 1O7SA 4A66A 3HFMH 4BFKA 5HHXL 4YDKH 2YD8A 2WINA 4GXUM 4BWWA 3FU8A 4P4RB 3X3FH 1EMTL 3DUHA 5ID0B 2UZXB 1J0ZA 2N7BA 4X7SH 4M6OH 3P77B 5F21B 1Q9OA 5GS0C 4GIPD 1DDTA 1WFJA 4J3BA 4XNXL 1NCWH 4GMTL 2X28A 5LG1A 2P5PA 2D7OA 2HT2C 1IVTA 4HIXH 3LXCA 4FLSA 4ORGA 2IDQA 1UA6H 5JORB 3HI1B 3MRBA 3U0WL 3ILDA 3MRCA 3MFFA 1OTUC 1XFPA 2B1OA 4UTBL 5JMOC 1XVSA 1ZVYA 1A3LH 4YHZH 1ZKAA 3W9DB 4HPOH 5D6CB 4X8CA 1KLGB 2WTOA 2NNXA 4WHYG 2JJVA 3C6EA 1EEUA 3TO4C 4FFYA 4L3EB 4XPHH 5AW9B 4L37A 3PWNB 4P2OB 3NACH 2VZVA 3K7UA 2EDHA 3IJYB 2EKJA 3P0YL 2BP8A 3JWDH 4K9JA 5FHBL 5B1CA 3V2AR 4I9WE 5K59F 3VRJB 4G43A 4UDUA 3QARA 1DN2A 3PWPA 3AUWB 3EH1A 3L9RA 4WNQB 3V95A 5KVGL 1NFDF 3VFGL 3UG4A 3K81A 4TN9A 1WRFA 4JFOA 1MFCH 2EVJA 5IROC 2N7AA 3PAZA 2J44A 3PAUA 4BV1A 2IMNA 3EBGA 2R0ZL 4M93B 1X5FA 4KKBC 4WUKL 2WTRA 3ZTJG 2QSTA 1LO4L 3ARDD 3BQUA 2HJKB 1IAIM 1KGJA 2W88A 4YHLH 3LRLA 3VJ6B 3NH7H 4ANXA 4OCXH 4HV8A 3QJOA 2A83B 5DUPL 3K2IA 2R27A 5I1CH 4A55A 2JMRA 3V5KB 1AQKH 4TLKA 5AEAA 1ACYH 4PBDA 4XVJL 3U4BH 3Q1SH 3WKYA 4NDMA 4OCWL 1DQDL 3GM8A 3DYMA 2UZIH 1PPIA 4X9BA 1I1FB 2ZF8A 1RZGA 2X70B 1EHLH 3CC1A 1T0NB 1BVNP 1KGWA 1U92A 4YSPA 4C54A 2E76C 1KGYE 2C8NA 5IHHA 4M6NL 4NKMA 3T8XB 4AZ8B 2ZOTA 4R3SA 5T5NG 1O75A 4R4NC 3WG7B 3P4NA 4R4FL 1P0SE 1IMHC 2Z92A 3AXLB 2CAKA 4HLZH 1JFQH 1JZ8A 3TYFA 5TQ2H 2DQDL 1D9KA 2DWXA 3UTOA 3MV7A 3WL9A 3BWZA 2QKIA 3C5JA 2FWSA 4H40A 3QFDA 1L5GA 2MOQA 5GHWH 1F4YL 1VKXA 3W5NA 1IGJA 2EO1A 5ICXA 1WF5A 1QLFB 3WHXA 1P7QB 5IFAH 1INQB 4PP1D 3FC8A 3ME0B 4QOKD 2BLFA 3W0WD 2DJSA 5J6HB 1WCQA 2FJSA 2OSLB 2VKWA 1PG7H 3M1BA 3NGBC 5D2LF 5BRZB 1XR9B 1MEXH 4X6CB 3IPEA 3MCLL 1XB3A 1V7MH 5T8IA 3LHPH 2W0KA 3TJHD 2EXWC 5FUZH 1IKNA 2BVYA 1DBKH 3CSBA 5FAAA 2BPBA 4YQXH 4XN1A 3SJVB 1TQWA 5D7HA 3UIYA 1CXEA 4N2BA 2O6CA 1F90H 3ARPA 4MZ3A 4DEWA 3Q6GL 1IQDA 3DROA 5TDPB 4YDJB 2Z6FA 2MWCA 3WBDA 1JYWA 2A9CA 4W70A 4KVCH 2KT6A 5AB9A 4MA8H 4A04A 1L0QA 3NFNA 5E1AA 4D7PA 3OPZL 5H35B 5DZPA 4KH9A 4HUWA 3MRIA 4I77H 5C70A 1UOLA 1Q0YH 4GY4A 4NQEE 5ESQB 3TZVD 2X4PB 3MX0A 5C8JA 4DGYH 1MJ7L 4S0SD 2YGPA 4YHIB 3JV5A 2J8UE 3QUKA 2R69L 2ZCKH 1FGVH 4LNRA 1NCCH 2JKIS 5DC2A 4NWTH 1TUPA 3GSXA 4Z7WB 4H44C 1UT2A 3A3YB 5JYLA 3P02A 5IBLC 4G9FD 3KYMB 3QNYA 4RZKA 2A4EA 3DO3A 4PGBB 4XHJD 5JNYB 2RMNA 1FNSL 3PWVB 5DYOB 3CVDA 3NEEA 5JIPA 1YEJL 4QDGA 3MLUH 4JQXC 2Q86A 5KBLA 2X05A 4PJAE 3VTTA 5IB3A 4CJ1A 3AQDA 4QHNB 1CZ8H 3SKMA 4Q6IC 3KW8A 5AAMC 2X53A 1CT8B 3GO1H 4CC4A 2GYSA 4WUUA 3B9KD 3EGSA 4NO0A 5EUOE 5I16B 3DX3A 4YXHL 4JFQA 1THAA 5DFTA 4WTXA 4PJHB 1NDMA 1QNIA 3DX6A 3TURA 4UV4L 2BXZA 4QY8A 1QEWB 3PQYB 4MKTA 3QZWA 2HSIA 1IV8A 4HGKC 4IEFA 4PUBH 1X5ZA 3O3AB 5DJ0A 1NM4A 3ATBA 4K3HA 1KC5L 2PR4H 2DKUA 3FUJA 4JB9L 4N22A 1MHHA 5H2BB 4M61B 1HH9A 4ODHL 2EYRB 3ZHDA 1TZOA 5C0DB 1EAOA 3SPVB 5J0BA 1YYML 1UWFA 3MR9A 4GBXC 4EVNB 5ERWA 4FQ2L 3SOBH 1XT5A 1S8DB 1MQKH 2B8OT 1INEH 1G4MA 4EN3D 2G60H 4K3DL 4DVRH 1RZJH 5B4MD 3DO4A 2EE2A 5INDB 1A3ZA 4QKXB 4TOYL 4X7CC 5AVXB 3T5WA 3CFUA 5E1IA 4G1EB 5EIQA 5KBKA 4UF7C 3KPRB 4B97A 2B5IC 4QF1B 5D4JA 6FABL 2GT9A 4OLWL 2K45A 3LKPA 3U25A 2EC9U 1N0LA 3QS2A 5EH1A 1T7VA 5G4OA 4NQXA 4Q6IB 3UJTH 5D7EA 1R3IL 1U3HA 5IOKA 2VR5A 2CXKA 2R69A 4ZNCD 1IBZA 4P5KB 4UZGA 4CGTA 4B9FA 1PZ2A 2VN3A 2WCSA 3GPEA 4F33A 3TGXA 2I9TB 3QI9C 4KKRA 4EI5A 3FU5A 1KJ3H 4LBAA 3MV01 2YD1A 3OX8A 3PY9A 1JVOA 3FQTB 4G6AC 2BVQA 5GRYA 4WAFA 4A7GF 3JYCA 5B8CA 3TEZA 2A9ML 2AXWA 3TEXA 3IRCA 3FO0H 1J7VR 2A77H 1W0WB 1GZQB 1IX2A 2OYKA 3UABA 3F7YB 4AQEA 3R0MA 1S9WA 1QR1A 1JPFA 3PHOB 1T0PB 4NT6A 4QRPA 5DJ8B 1ZHBA 1J86A 3LZNA 3IXTA 1WUNT 2RA1A 1W8EA 1DQMH 2IAMD 5GZNC 2NY4C 2X4RB 1T04B 1DJGA 3BVXA 1NLBH 3AABA 3WNKA 1EJ8A 4BSWA 5ANMA 4YUEH 2FR4A 2A9BA 4FZ8H 2QKSA 5EU6D 3RJQB 1W72B 1PYWB 3QDMB 2DOCA 3IU3B 2NYZA 4KI5F 5GS0D 1Z9LA 4HHAB 1TZGL 2DQGH 3TS8A 3RJOA 3VQ1C 1DBML 1BVKB 5AVTB 2B5IB 4X7TB 4TUOA 2XZCH 5B7MA 1H8SA 1WV7T 1E2WA 4MMZB 3GNML 1EUUA 1JNHB 1MCNA 1MIEL 2UXTA 3Q43A 2VE6B 4JFZL 2FJFA 4LSRH 3QQ3B 5KYUA 3CDZA 5DRNA 3CPLB 2CDGB 1T4WA 3FO9B 1UXSA 7FABL 2AEQH 3TO4D 5LG6A 5DC9B 4MNQE 5ACLA 3QI9B 2VRAA 1U30A 2DWSA 3GUTA 1A5FL 3ULVF 5EHFA 2YQGA 5L9DL 3WFEH 3TA3C 2X0UA 3QA3A 3V55A 2DBJA 3ZTNL 5DGRA 1WAAE 2LVCA 1I82A 3SQOH 3W9EB 5FWQA 5K39A 2YA2A 3ZR5A 3X13B 4OLYL 2IANE 1CR9L 3BAJA 3S4SG 1E50A 5ALCH 3CVIL 5CLXA 4KZEL 4FYQA 2EO7A 4O4YL 1IVLA 1UTDA 5GS3A 3WIHL 1LDPH 4Z6AT 5CN1A 5HDBB 3THML 4JHZA 1AGCB 2ICWJ 4O2FA 4JQVC 4PJXB 2J72A 2HRHA 1JG9A 3SJVD 1NZRA 4YHPA 3C75A 2ARWA 2VL4A 1AO7B 2KKQA 3ZDYE 2B59A 4HJJH 2ZAIA 1BZ8A 3CFCH 3KPQA 4OI7A 4ZW5A 4A68A 2HT3D 1FRGL 1UWGH 3Q9PA 3SGKA 2BIIA 2EAEA 3UERA 3UZVB 5IB2B 1ND0B 3QFJD 1T7XA 1OO2A 1T3FA 1TETH 2GITB 4BYHA 1JPTH 1NCBL 1IAMA 3VO0A 1XF3B 5D2NA 3ML8A 1PLBA 1DJHA 2P43B 4LDEB 1G6RL 4HKBA 4C56D 2HAZA 3BAEL 4DEUA 2R4RH 1E9PB 3L81A 3P9MB 5C0JA 1BP3B 1I7UB 5BCAA 1L6PA 4JFFB 1EHAA 2K9FB 5J6SA 1TKWB 4AL8C 3TCLA 4AM0A 1K5NB 3ES6B 2ENJA 1MF2H 4XNAA 5I74C 4Z7OE 3TA3B 4KTDH 4OF5A 4Y4FC 4H8WH 3OZLA 3EBAA 3TLRA 1F3DJ 5FGCE 1TG8A 2CKNA 3FB5B 1H6UA 4N3TA 2I9LA 3JVGA 3PWLA 2B7DT 2WMPA 3LXAA 1IGTB 4MA7H 3K6FA 2LQRA 4MJ4A 1SF5A 5E24E 3ULSB 4ODXB 3WV0A 2FGZA 4XMLH 1ZLWH 1RP9A 3KPNA 3UGEA 3CZJA 3VXQB 5E94A 3MOBL 3WTVA 4MZ2A 2W92A 3ASOB 1W8OA 3QQNA 2ZYIA 3D0LA 3GXTA 3LIUA 4YHML 1TR7A 3KDPB 2FWLB 3X11A 3BWUC 2QGCA 4R6UA 4B0MM 3CHRA 3ENEA 3MRGB 4HKZA 2AABH 4JR9L 1OM3H 1QSEB 2H6UA 1A6PA 2ZONA 1MIMH 4M7KL 4TYUA 4ZUVB 5I6NA 3PPSA 5IUCA 4U1JA 3O9WB 4PRAB 1F11A 1RIUL 3WIHA 1I3RA 2WLLB 5ABZA 2D9QB 2ZXDA 3NCCB 5ID1B 1CIUA 5MHSE 4G7QB 1RPQA 1KULA 4PWJA 3V0EA 3PABA 5AFAA 2CBTA 3IJEB 4KY1H 5IVNA 1MFAH 1KIPA 2G4GA 1C7TA 2XN1A 3GWJA 5IBLD 2RQ8A 4GQRA 3FO1A 2OL3H 4JUTA 3G6DH 3SDDC 1G0XA 3KPRD 2B3IA 2BSBA 4IRSA 3LQAH 5AYQA 4IKLA 4EDWL 3N40P 5AVWB 4X99A 3IDIB 5I74B 2K78A 4JCLA 4QJ5B 1X5GA 4Y4FB 4MNQA 5EF0A 1X5HA 3DTUB 4W9CC 5DQDH 4ES9A 4I0KA 1MWAL 5FB8B 1F1AA 1WLHA 3TX4A 5BZXA 4Y19B 3S97C 5JYMA 3PP3H 3IDYC 4LK4A 1CDIA 2GI0A 3SZ6A 5J1TC 2A6KA 3RIFF 3NP3A 1KV7A 4LLAA 3VXRB 2QDWA 3EFOA 3L9YA 5DK0A 5H94B 4X6CF 4NRZB 3GSUB 4AYFA 4X4XB 4RRPM 3VGBA 1KCKA 1WTLA 1HS6A 3DX9A 4F57H 4BBWA 4N2OA 1WZLA 3VI4E 2R9HC 3D8MA 1JWMA 3E80A 4G6ML 4KHTL 3PNWB 5GISH 5T3ZE 1MRFL 3EJCA 1DBAH 2BW4A 4N3UA 5G5DA 5B38A 3QCVH 3EYFB 2UXFA 3NAAL 1SN2A 4RRPA 1HYRC 3U7YL 5HDRA 1KTDA 4H0IA 2E8YA 2V33A 4PRDA 1UURA 3CBKB 2YKKA 1M6OA 3H55A 3EO1B 2RACA 2GJ6D 3TFKC 1VERA 4GBXD 3D39B 1AQDA 2YXWA 2F18A 3TWCH 4MAYC 1K8DB 2QGBA 3H56A 3KE0A 4QRRD 5FYJU 3IPFA 1C08B 2C4XA 4G5ZL 2WLZA 3EZJB 4I1RA 3BISA 2F74B 1PS3A 2WINB 3FK3A 4Z7WF 1I75A 4V1DE 1YEEH 2WUBL 1I85A 3SDDB 5HGBA 5KJRH 2LV4A 1YEKL 2VW6A 2WZ6A 3ZT7A 3DHMA 3I6KB 2J8HA 5AB0A 1HXYA 4F7EA 3DIFA 1G43A 2MTPA 1NDTA 1BYPA 3MRBB 4JQIH 4ICXA 3WMPA 4JKLA 2KUTA 1ZTXL 2D9CA 4XC1L 3D9AL 4P3CL 4TSAH 5KVFE 4AC4A 1HX0A 3SKNA 3VXNA 3V0WH 1A7OL 4YPJA 5B39A 2B4CH 2DMGA 3TBWB 4LCWD 4AJYV 1MFBL 4PMFA 5EU5A 1D9KC 1ZJBA 2FSDA 3POCA 4HP5A 1J1OH 4KK5D 4TQEL 2QKIC 2BNQA 4HIHB 4BCZA 3L3HA 3AU1B 4JHAH 2VM9A 3O6MH 4FQCH 4ZPTB 5JW5A 1LTXA 4L8CA 1MWAA 1GIGL 2QELA 3D05A 1TQCC 4PY8I 4JPVL 5I1KL 1YYCA 3IDNB 4YSTA 5DFAA 2V3FA 5DRXB 4ADGA 4BFGA 5CZVL 5EBLB 5F1IA 1INDH 5GZND 1BOGA 2NY4D 1FE8H 4FLOA 2EILB 4XN9A 3OKMA 5C0BA 5GSRA 3K2MC 2QSVA 4M3KB 4DW2L 5CUSH 1CGTA 2CWRA 4HUVB 3N1PC 4HV8B 4L1SA 1S7VB 4MRCA 5HGHB 4BRVA 3FB8A 5CJQH 4EO5A 4ZX6A 4ODVL 4HJUA 1TFHA 1AAJA 1R3HA 4LVNB 1FH5L 5I17B 4MJ6B 3P2DA 2HFTA 1X4YA 4XO3A 3FL7A 1BXVA 2K4AA 5F96H 4U1GC 4ORZC 5LXGH 4Q2ZA 4UB0H 5T3ZH 5I73C 4NNYB 1NGWB 3HNTL 2PYFA 3SPGA 4QHPA 5ICZB 4OY9A 1E2ZA 1QLEB 2AXGA 1G9NL 1KXVA 3ESVF 4NKMB 2W07B 3L95A 4NHCH 5DEFB 3WNOA 1GHFH 4UV7L 3MLWL 2JE8A 4V2CB 2UY7B 3LKOA 3TYFB 4GXVL 1D9KB 5GXBB 2VQTA 3WL9B 3O8XC 2J43A 3NESA 2QKIB 3C5JB 3QWRD 2Q7YB 1VKXB 1IGJB 3PCYA 5ICXB 4KV5F 1J5IA 5PAZA 3WHXB 1AD9B 4HS8L 2OR7A 5KANI 3MLYL 2DI8A 1IFHL 1A3RL 2F5BH 3QEGL 3S35X 5IJVA 1TQCB 3TEWA 3NT0A 5L2KD 2OZ4L 1NKOA 3M1BB 2D31A 2YMOA 2JXMB 3D2UB 1WS7A 2Y24A 4FTVA 3QBTB 5HHOD 1H8OA 2FIRT 4G8GD 4HSCX 5E2VH 2WXIA 3SB3A 3UEQA 1UZ8B 1I1AC 3FF8A 4KNQA 3IK2A 2HLFC 3AZUA 3ECUA 2CBMA 5KVFH 2PUQT 3U79A 4F3FA 3MXWH 1M3JA 1QSED 1T22B 3UZEC 4PIBA 3DROB 2XJLA 4R90H 3WSQL 1JGEA 5HD8C 5FC9A 4U1GB 5EO1A 5GGVL 3WOVA 3NFNB 4HBCH 4HWBH 1ILUA 5I73B 1B4RA 2B0SL 5FV1L 3H8NA 4HFWA 5EZPA 3UH8A 2OCFD 3MX0B 1MPAL 5C8JB 1U93A 1B2WH 5C0CE 2AQ1A 1GXEA 4R26H 3QUKB 3UZQA 4DVBA 2OMVA 1C12A 5EOQL 2OMZA 3BZFA 4MB5A 3BIKB 3M8OH 1QI3A 35C8L 3GSXB 3ARBD 3FXIC 3V4VH 1AE6H 3BGMB 4CADB 5T3XE 4K71C 5EZJB 3RUGF 3QNYB 2QMKA 4YSQA 4M1DH 3TASA 1F42A 5I6OA 2X4UB 4MDJA 2V9QA 3LYRA 3G6JA 4M5ZH 5BV7H 3MCYA 2ADYA 2YMXH 4UNVA 4S2SA 5IB3B 5JR1L 4J4PA 4GUPA 3BSHA 5GRJH 3SKMB 1VFOA 3VXSB 1A8ZA 1B4LA 1JUFB 4WUUB 1PZDA 3U9PL 4X8JB 1U2YA 3IFNH 2NY0C 5HDBF 4EJ1C 1MOEA 3MNDA 4FKHA 1WWBX 4NO0B 4ODTH 4PJXF 2F08A 2QFPA 5DZVA 2BS9A 4A7QA 3LKQB 2HKHH 1JTTA 1MFMA 1NDMB 3I74A 1F58H 3HC3H 3DX6B 3QIWC 3K3QA 1E2VA 2CDFA 4DWHA 4KXDA 5JXEA 4QY8B 1WWAX 4PHZA 1EANA 3QZWB 2C3GA 4IEFB 4NIKB 3IDUA 4LPTA 2FWUA 3F58L 2B9AA 1E5AA 2HJLA 3V5HB 2MQGA 1AXTH 2B20A 3S36H 3ILQD 6PCYA 1HH9B 2CALA 4U0QB 5T33H 3VACA 2XYBA 3IU4H 5JUEH 5FCUL 1TTCA 4M62H 2OZ4A 2WW8A 4Z95L 4U33A 4JKPL 5ERWB 5FIEA 3RVTC 3BKML 4OZHA 5JPNA 1FNFA 3BDYL 3WFCH 1T80A 1OARL 4JN2A 1LE5B 4ODWA 1SVCP 3FTZA 2NY6C 2AV7B 4P5TD 4R5XA 4K71B 4XPFL 2ITEA 5I8OH 1JCVA 2VLMD 3O2VL 3EFDH 3V10A 2VXSL 2GW5A 4LCYA 4NJ9H 1JZIA 4PWGA 4TULL 3L3KA 1KCSL 4BKSC 5HYQA 4NC1E 3D2TA 3FDWA 3D4CA 3LKPB 3GXNA 1MJUH 3QZNA 4J1UA 1ZT7B 4HUMB 1I9IL 2YPLD 4QRUA 3ZZSA 4PVLA 3ZW3A 1RJLB 5FYJD 1IJNA 1LL1A 2APFA 3OR7B 1RIHL 2NY0B 1U8IA 3Q8FA 2NY2C 1NCJA 5F6HJ 1CXHA 3RZCC 1ADQH 4F33B 4JY6A 3CZLA 4OUUA 2LAAA 4GSDH 3LMJL 2F5AL 2AEWA 3F7VA 2VLJE 4UQ3B 3QIWB 2RH0A 2BVQB 2VXUH 2ZWNA 3CDCA 4LAQH 3SGDH 4AWJC 2ADJB 4Y5YC 4EUPB 2X10A 4PJDA 3FQUA 4FA7B 3N42B 2PPCA 3WY4A 1NWOA 2JI2A 3TFKD 2EO9A 5T3XH 4I3RL 3RB5A 4WY7H 4AQEB 1EO7A 1QR1B 2AI0H 1NL0L 2NR6C 3WI9A 2YPVA 4N8VG 4G11A 4NT6B 4MAYD 5GGVY 1XCWA 4OZFB 5JW4R 3ML9A 4BZ2L 3U6RA 3IXTB 5FGSA 1DFBL 1NIDA 3GHBH 3IMRA 3ZOAA 3IF1A 1XIWA 4BM7A 4AYEC 3HPJA 5IB5A 3Q3GA 3LV3A 5HGDB 5SWZE 3BC9A 4BSWB 4NHUB 3GHEH 1IM3B 5ANMB 1WBXB 2ORBL 4ABWA 4GG6B 1RUQL 1TZ8A 4CN6A 5EDXA 5C0CA 3WCYA 3DJ9A 2NY6B 3QUYD 5IQOA 4HCRH 1LGVA 4AQ1C 2OW7A 4TUOB 5I30H 1GA2A 2BMKA 2MJWA 3ARFC 4OFDA 3NSJA 3CSTA 2WXQA 1MVFA 3QH3A 3QZOA 4LPUA 1YEFH 5DZ9A 1DVFC 2FJFB 1CD1A 4Q14A 5KYUB 2VJ8A 4HK3J 4JRWA 3SDAA 1MCHA 1UXSB 2OXGA 1IC5L 2NY2B 5I75C 3RZCB 1H0DA 1P7BA 3CDGB 2TSBA 5CBEA 5FKAA 3BKYL 4JY4B 1AJ7L 4FS0A 5F7KC 3VU1A 3KPSB 4EN2A 4U4IA 1HN1A 2BNRD 3QA3B 4Y5YB 2V17H 4V33A 5TGBB 1JZ6A 3KLSA 1ED3A 2MOVA 4HVBA 1L0PA 1SLUA 1OZTG 3MV9A 2XWDA 1DFXA 5D7IE 1EQWA 4AVKA 2BFGA 2MIZA 4K23L 1KG0A 2XVBA 1CE1L 3FSWA 3D2UD 4JJ5A 5JHDE 5L8JB 1ZLUH 3LEVH 3SDYL 2AEOA 3QO0A 5TF0A 3AMLA 5DR5L 4HF5H 1QFHA 2P26A 3D50A 4O2FB 3WXVH 4YS4A 5KG9A 1DZBA 1KTLA 1KACB 2Z4TA 3D3VA 2GBUA 1WT5C 4TPRH 5DFVD 2VN5A 2YAOA 3FTGA 4IOIA 4H5SB 2AQPA 1S4IA 2F2HA 3QPQC 2W94A 1A6AA 2YSTA 1GJIA 3B8SA 2H2SC 3KWTA 1YY9C 2H0PA 3PDDA 2R56H 4NOBA 1LYQA 4KO9A 4AQ1B 2LU7A 4W9FC 2WWOA 4GKSB 4K3JL 3ARFB 3RIKA 2VMFA 5GS2H 1U0QA 3BVUA 2X0WA 2YC1A 5D2NB 1U8KB 5KUKA 1JF1A 4QHLB 3LXBA 3NP4A 1DVFB 4BFEA 4RGOL 1BGXH 3PHSA 2OQJB 4K4KA 3T1WA 1OT1A 1NWPA 5IMMA 1ZHNA 3EGDA 3IFOA 4N87A 2MCG1 3V9CA 5EZIL 2CIIA 1OP3H 1XR8A 2GBVA 3MLVL 1BLNA 2KBGA 4UIKH 3O8XD 3QEQB 1KMGA 3PP4L 1SOQA 2E7CA 4TNGA 4AM0B 2A38A 5LWYL 1B0IA 3X1EA 5I1LA 3MRDA 5BMFL 1QFWI 3N9GL 2EACA 4JK0D 3EYVA 3GRWL 3DETC 3C6SB 5E2TH 3VXSD 4F5CE 1I8LA 1YO4A 4LCUA 1X44A 2KLSA 1I8MA 3GBNL 3PWLB 1WFTA 4UNTA 2WMPB 4MB1A 4UTAA 5F70A 3RBGA 5MEOA 2O5XH 3OQ3B 2UX7A 4D9QD 4BWTA 3N55A 2PW1A 3FYIB 1I1AD 2TSAA 1ZLWK 5GJSH 5C71A 5GSVA 1W6WA 3UC0H 5E94B 2DQHL 4NZFA 1IEHA 2AJSL 4NM8H 4BE6A 1AXSA 3D0LB 1MAML 4W9EC 3KCWA 1FZKB 2HRLA 4GXFA 3MUY1 3V6OE 5J89A 1EEYB 3K8MA 3QR1A 4KKPA 4U6TA 1DEDA 2Z91A 3MYJA 4HKZB 5HD8D 3UL4A 3QRLA 1VADA 3U30B 1H19A 4FQ1H 2XQYA 3ESMA 4IDJL 4NI3A 4U1JB 2Z8SA 3QNXA 1OSPH 1X4XA 4BRJA 1SEQL 4ODBD 5EWIH 4B0MB 1I3RB 5AENA 4W9IC 3I02B 1DSFH 1UWEH 1FYTE 3QDGB 2Y1ZA 5EF2A 2ICWA 3PABB 3IDGA 1ZHLA 4L4VD 1LEIA 1U58A 1KLFB 2BXYA 4P07A 1MW1A 3AG2B 1KIPB 1ZGLM 1CI5A 3QQ4B 4PI2A 4G6JH 1EBPA 3ARYA 4N2LA 2A73B 4GW5A 1NJ9A 5FEBA 5F72S 5EPMB 4OZIB 4NRXA 3CJJA 2NY3C 4TSBH 1AS6A 1TT6A 1U8MB 1BEYH 2HXAA 3M17A 1L7TL 3BLPX 1ZGLA 1K4CA 2Y3AA 3QNFA 4HSQA 3RHWK 4Z7UB 2X4NA 5L4FA 3SHSA 6CGTA 4FQHA 1WFNA 4WV1A 4L05A 5E9DB 1EUTA 5KYXB 1OB1A 2ED8A 4CNIA 1SZN