1JK9A

Heterodimer between h48f-ysod1 and yccs
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
153
structure length
153
Chain Sequence
VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIFEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords superoxide dismutase
publication title Heterodimeric structure of superoxide dismutase in complex with its metallochaperone.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 34
structure length 153
sequence length 153
chains with identical sequence C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1jk9A00
3F7KA 1FUNA 3T5WA 1U3NA 3KM2A 2AQQA 4A7SA 3S0PA 1MFMA 1IBDA 1IB5A 2AQTA 1SRDA 1L3NA 1E9OA 1N19A 1F18A 4A7TA 3GZQA 3H2PA 2E47A 2ZKYA 1RK7A 2Z7YA 4A7UA 3QQDB 1IBBA 1PZSA 4OJAA 2AQNA 1JK9A 2WZ6A 1AZVA 1SXCA 5KBMA 3GZOA 1CBJA 4L05A 1KMGA 3GQFA 2ZKWA 2WZ0A 1E9PB 3CQPA 1XSOA 3HFFA 4A7QA 3CQQA 1SXAA 2WWNA 3GTTA 4U4IA 2C9VA 2WKOF 1SXSA 2AQSA 2XJKA 3F7LA 1OAJA 1XTMA 3KBFA 1SPDA 3ECVA 1E9QB 1HL4A 1OALA 4A7GF 3ECUA 2WZ5A 2NNXA 5CU9A 3SODB 2XJLA 1B4LA 4N3UA 1IBHA 1Q0EA 3CE1A 1F1DA 3KH3A 1S4IA 1F1GA 3K91A 3L9EA 1SXZA 2WYZA 3H2QA 1SXNA 3L9YA 2C9SA 2WWOA 1DO5A 2V0AA 3QQDA 2Z7ZA 1QUPA 1UXLA 2R27A 1SDYA 2GBTA 3HW7A 3MNDA 1JK9B 2AF2A 1CB4A 2GBVA 4OH2A 1EJ8A 3ECWA 1E9PA 1ESOA 2JLPA 3GZPA 1OEZW 2ZKXA 1P1VA 1Z9NA 1E9QA 3HOGA 2AQPA 5KBLA 4B3EA 1SDAB 2WKOA 1YAZA 1TO5A 1DSWA 4BD4A 1EQWA 1B4TA 4MCNA 1E9OB 3KM1A 2GBUA 4A7GA 1OZTG 2SODB 1BA9A 1YSOA 2VR8A 2K4WA 1SOSA 3MKGA 1BZOA 3KBEA 2APSA 1HL5A 1Z9PA 1N18A 4FF9A 1F1AA 2WYTA 4MCMA 2AQRA 1SXBA 2LU5A 3LTVA 1PTZA 1COBA 1YAIA 2AEOA 2ZOWA 4BCYA 1JCVA 3PU7A 3RE0A 1UXMA 2Q2LA 3GTVA 2C9UA 1IBFA 3KH4A 2VR7A 2Z7UA 4BCZA 1OZUA 2E46A 4A7VA 1TO4A 5KBKA 4N3TA 2Z7WA 2VR6A 2JCWA 1PU0A 1XTLA
chains in the Genus database with same CATH superfamily
2XG5B 4XVJL 2X4NA 2CDFA 4W9ZA 4F7TA 4F8QA 1NEZG 1F6AB 4FQLH 5FUOH 3L5XH 5DJYA 1IU1A 5T5FA 1CFBA 3RBGA 4WV1A 1EHNA 1Y0LB 1NCBH 1I9RH 2ADJA 3HZKB 2XX1A 1CR9L 1JS4A 5D93B 1UD3A 5IB2B 4L3CB 3QUXC 3UTPD 2UZXB 2XVKA 2YGQA 1E0OB 4GKSA 2DLHA 2FT8A 2OFQA 3UZVA 3JWOH 5EPMA 4MHHG 4Z7NE 1T89A 4KKAC 4KZDL 2NR6A 4LRIC 1L9TA 2UY6A 2Z3FA 3WJLC 5DMIH 2EO9A 3FT0A 4WI2A 5CR8A 3Q05A 5IJDC 1J1XL 5DZJA 3I6GB 3JSSA 3MAWA 2P3YA 4AQ8C 5M94B 1FNGB 2XTSA 1HEJC 3JWNG 3TZVA 2GJRA 3H3BC 3T6QC 3T65B 3MCKB 2BY1A 3C6LC 4IK6A 4LQFL 4XN1A 2J2ZB 4L4TE 4FKEA 1IGMH 5F7WC 5ALBH 4QXVA 2Z8VC 4PJ8C 3FU0A 2VWEC 5GSRB 2WW8A 4NHUB 2CCVA 2EDTA 2D0GA 2R56L 4U0RC 1GPOL 5LNDA 2ZCKH 1WT5A 4XPGL 4KI5E 3WG7B 3ZTNL 5EIIA 2ROYA 4X9GA 3WN5A 4YDZA 5TK2A 2CA4A 3MUJA 4GAGH 5ISZA 1UZ8B 1TJIH 1BCIA 2XWCA 3F7RA 3SGDI 2FX7L 1FYHB 3TEYA 1U8NB 5DJAB 1A4CA 5CJ5A 3TBSA 5I6MA 3CVBA 1GA2A 3ESPA 3GSWB 4BIKA 1Q94A 1MHHA 1XGQA 3FQWA 1MPAL 3SE9L 3ALPA 4XMTA 4LOUD 3SDCA 3SKJL 1QI4A 3JXAA 2IPUG 2BP5M 4WWKD 3X17A 3GRGA 4MRBA 1ED3A 2HG0A 5IMLA 1PZDA 4FLHA 5DJ6A 3RUGF 5GJSL 3IF1A 2YD7A 4I2XB 5K9JH 4KAQL 2MH4A 3CN4A 3MNVB 1A2YB 3QUMA 4ZUWB 4KKZA 1IARB 3RGVC 1WWWX 5D7LE 4JN2A 3SY6A 1DQJB 2CKBH 3VXMD 5HGBB 2EH8H 1AZRA 1H5BA 3TEZA 1QSFE 1SN5A 2K70A 4RAUB 1F8TL 2APBA 5DO8A 4QRUA 4R3SB 5CS7A 1RZKC 2Y2YA 3SB3A 5F3BB 3IFOB 5T3XD 5ENWA 1GYCA 1N19A 3DI2B 3ZXAC 3EO0A 5JHDE 3SDYL 3QWRD 4ZMXA 4WKZB 3UO8B 5AZEL 3IN2A 5I18L 1IBBA 4FXKB 3FHEA 1A7BA 3OPZH 1YPZF 4ATWA 2OMWA 2WZ6A 1SXCA 1IKFL 2NW2B 3MA9L 3VE0A 2Q8BH 1FFTB 3IXAB 1WHOA 3VXUD 4NKDA 3BP6A 4J3SA 3O4LD 1I8KA 2Q1EA 3WLWC 1LE9A 4NRZB 2BMKA 4CL7A 3VW3L 5EA0H 2ZUQC 2OTWA 3HAEH 3KBFA 2X0UA 2XNAA 2PYEA 4G6KH 4MCYB 4R90L 5DUPH 1FGVH 3HC0B 4WDIB 1ZLVH 4QCIA 3KH3A 5GIRB 2YAMA 3DJ9A 1NAML 4HLZH 4XE0A 1SBSH 3Q06A 4WHCA 5I1CL 1K3ZA 3QUGA 4P2OA 4XCNA 5I1LB 2H1PL 2NNAA 2OJ1A 4Y5VA 4Z5RA 2ZUYA 2ZG3A 4BFBD 4PBDA 3OHXC 4DPCX 5HBBA 2QV2A 4KJYB 4OZIA 4NCC2 1W0VB 1FCCA 4NO0A 2V8MA 1Q9KA 3FO9A 1KIPB 4P07A 5FYLD 3VWKD 3INUL 3GZPA 3KPNB 4EOWL 5DHEA 3VTMA 5IQ9B 5CBAB 3V6FA 4IIQA 2DWDB 2J1ZA 2H45A 2IMNA 5AYUH 3RZCB 1DQTA 3WXVH 1XX9C 5JXED 1BM3H 2P45B 4MCNA 3ZTEA 2JKSA 1AI1H 1NCDH 4YHIA 3RPIB 3T0VA 5SWZD 3HN3A 4UUJB 2J4WL 1BBDL 1M2VA 2FJGA 5AAPA 2BOBB 4FQ1L 4PSRA 4LKXA 1VADB 1YQVL 5A7BA 5JIIA 2CBOA 3WTXA 3DRTB 4X7DC 2ENJA 3DSNA 3QS2A 3NRPA 3UOAB 3IDJB 2ZJSL 3WFHB 3DPBB 1RMFL 4QWWD 1F6FB 4OV5B 1A9BA 4WW1B 3MJ9H 3BMVA 3LEYL 3G6DL 2KDYA 1VZIA 3B2VL 4LIQE 3V4VA 1A9VA 1HWHB 2X41A 3C2SA 3QPXH 3UABA 3WCYA 2Q6WB 4LPTA 4APQB 1RURH 3O3UN 1I8IB 1KBVA 4F20A 2APWA 3OQRA 3QDMB 1UFUA 4Q8BA 5A40E 2YEZB 9CGTA 2CRMA 3MXWH 3MOAL 2ED9A 3RIFF 1VEMA 1X5ZA 3VFVA 3DTUB 3QR2A 1UWEL 3WTSA 1W9XA 4XNBA 1ADQA 1RUQH 4FL4C 2ZG1A 4J4PC 5I9QB 1A6UL 5HDQH 3V7MA 2C9XA 4QXGL 1IL1B 5AW1B 4XX1G 3FZUD 4JPWH 3O6FD 5T1LD 5D2NE 4BH7B 5D5ME 4HJUA 4UQAA 5LN4A 2EDBA 4O4YH 3RJDA 4EDWH 4OIIH 1L9OA 1P9MC 1NL0L 2XYBA 2ITCB 3PRZA 4HFUL 2H3NB 5BRQA 3QDGE 4X4MA 1MFEH 1X5IA 1F42A 1HE8A 4UT9A 4U33A 5HYSB 3L3JB 2BNQE 4UM9A 4NZRH 3G5YB 1WTGT 2DQCL 4Y8DC 3VACA 1OPGH 4WTZG 1H15A 3O9WD 4AV5A 4JZJA 2I9LA 3AG3B 1S5HB 5EF0A 4D9QD 2ESVE 4E9QA 2AJZB 3TIEA 5IVZB 2AFNA 4DERA 1KLUA 2YWYA 1GC1H 1MI5E 4PD4K 4UU9B 1DANU 5JHAA 1J8KA 4RA0C 4J8RB 4Z8FL 3NJNA 1MLBB 1X9UA 3RNQA 3L1GA 4TSBL 3AC0A 3ULUE 4TNVF 2JCCB 5D7JB 2DLFH 4U1LA 5EO0B 7FABL 4PRPD 5HYIA 1A7RH 4NKMB 1QBLH 2GI7A 4RESB 3W38A 4TKWA 4JQXA 4MJID 3HB3D 3US0A 4ES8A 1PJ9A 1U8PB 3QI9A 2CLZA 3PGDA 5JPNA 4O9HL 1NGPL 4FHBD 4L8DA 1OAYH 3MRGB 1YG9A 2F53A 2GPZA 4IU2A 3AG1B 1NFDE 3FRPB 1B9ZA 1RULH 4F8NA 3RE0A 5TFSL 3B9KD 1MF2L 3FDWA 4G7VL 4ZUTB 5JMOC 4ZK8A 4YSQA 5C0ND 3REWB 1PQZA 4JPKL 3VXQA 4UOJA 2CK0H 3VFNB 3TBWB 3GKWH 4B5EA 3H7LA 2J6WA 4ONHA 1YEDB 4Y4HD 1QSVA 4X6BA 3IFNL 2VM3A 1IFGA 2ICEB 1OT2A 5DQDL 2JKTM 3A47A 4WI3A 3VWJC 4EN3D 2HSIA 4GP8B 4ZAKA 4LP4A 4RX4D 2CCWA 5ANHA 2FYYB 4OCXL 1V05A 2QJDA 4JKWA 3MRRA 4QUOA 5DUMH 1L5GB 1KPVB 5H8DA 3NIDB 4KTEL 5JW4Q 4B5ZA 2DQTL 1ZLDA 1WGOA 3NJGA 1TQVA 2ZF9A 4ZUSA 4LP5A 1YNLL 2ZUVA 4ZFZB 3WFBL 3MLUL 2JKLA 4N9GA 1FGNL 4XCYB 3VXNB 2FEDC 4FG2A 4O51B 4QHPA 1DL7H 1OSZA 4M7ZC 5FKAA 2K3HA 1OALA 5CGYC 3HJ0A 4IU3B 1SOXA 3U9UB 4EKJA 2XG5A 4OZFG 2OMBA 5F9OL 1B2YA 5JYLA 4G43B 1F1GA 1F6AA 3MV7E 3UAJA 5J6HB 2TRHA 1ASPA 1HZKA 2OR7A 1Y0LA 2P5WA 1A3LL 4LCIH 5E2TL 5JA9A 5F70A 3IJ9A 4J12A 3HZKA 3EOAA 4P4KC 1E50A 1MFVA 4U1JB 1O7VA 5IB2A 4L3CA 5FM4A 3KPQB 2ENQA 3TT1H 4P05A 3RL2B 5I1KH 1BJ1J 2UZXA 4P3WA 4Q74A 5HI4D 2NDGA 4FA8A 1H8LA 1SJVA 2A3TA 2KQNA 3V5KB 4CSPA 3H9SE 3IWVA 1DVSA 1KBGL 3CTTA 1U0QA 3PWJB 5D6DA 1DHKA 3S98A 4QLWA 3UH8A 3QZPA 2HKFL 1YA5A 4YUEL 3B2XA 3BCDA 1MCDA 2D7MA 2BVEA 1HH9B 1PX8A 2F8VA 4GO6B 4PWEA 3P40A 4OGAC 4OZ4A 4FFZA 3FU7B 2W9DH 1FNGA 3JWNC 3PWUA 4JDVB 2HJLB 3KZ8A 3SYPA 5JYMA 4LESA 2PP7A 1G43A 3WKMH 2XKNB 3T65A 5FB8B 3PDDA 2Z34A 1MJ7H 3BKMH 5FOBB 3MCKA 3PL6C 2J2ZA 1IEBA 1JWUB 1JYWA 1Q9WB 2J5LC 5KJRL 2O5ZH 2X6UA 3IAQA 2WVVB 4YO0A 3QAZB 1JZ7A 1PTZA 1YAIA 5IBUG 4LSRH 4NHUA 3T1FA 3W56A 3I9IA 4N2AA 4ZXBC 2DPKA 3EJSA 4LPCA 4RVBA 2C9QA 4HPYL 1ODAA 2AXHA 1SJMA 3MV8B 4ELME 3GRWL 3LXAA 2YWZA 5DTFB 4DGYH 3WOVA 1DFBL 5LG1A 1PCXA 2VN6A 4MMZB 1BVOA 1UZ8A 2P44B 3LHAA 2Z0BA 5BUGA 1QFHA 5CF3A 2CUMA 3ARPA 2QSCL 1U8NA 1WZ1L 3VI4B 3Q8EA 3GSWA 2NRDA 4ZYKA 3US9A 3IPEA 5GRVL 2WZPD 1MY5A 2JJWA 2RH0A 4OZIF 4B7LA 2IXQB 3KR3L 4ZW3A 1G9ML 3D3VD 5B1BB 4ZMVA 4P2RB 1XB6A 2Y36L 4FFWC 3SE3C 4E36A 1ECZA 3EHBB 4L4VD 1SFHA 5B1AB 4I2XA 1CF8H 3MNVA 4CMHB 1A2YA 1OOWA 4FZ8L 5I6NA 1TYJA 4Y7MA 3FMGL 3EH4B 3ARFD 1DQJA 3Q5OA 3KYAA 5HGBA 4L1SA 3MZGB 2XWTA 3QFJE 2F9BT 4MA3B 4RAUA 3VFTA 2I5YL 5IP4A 3VM7A 4M56A 4GMSH 2VMDA 1AO7B 1KTBA 2NXZD 3HNSH 3A4FA 4FXLA 4R3SA 5F3BA 1IKNA 5FA3B 3AZUA 5GJTL 5D96C 4I48B 3OG4B 2E7CA 4XT1C 3TJEH 2C3HA 1A6AA 5IROA 4L1TA 1Z5YD 1OGAB 1A9EA 1MNUH 1FHNA 2ZUWA 3BZFB 4I1NB 4FXKA 3S2CA 4E0RB 1L9MA 5IG7B 1OWRM 2J1XA 3NABL 1Z9MA 3FRUB 1AS7A 2XV2A 3ATEA 2XWDA 4W68A 5MENE 3LXBA 3IXAA 4ZNCD 9PCYA 3E9TA 1IBGH 2EKJA 5GPRA 3X14B 1WF5A 1NLDL 1OK0A 5IB4B 1EFQA 4HMCA 2B39A 1HCVA 2R0LL 2ZXBA 1EMTL 4Y5XC 3APCA 3LHPH 3B2PA 5C7ZA 1WA2X 4MCYA 2P5EB 3G5ZB 4NOBA 5D1QC 3HC0A 4WDIA 1U95B 2N0KA 3HCVA 3ULVF 2VLME 4Z9KB 3FU6A 5B1CA 3U7YH 1OAZH 1OAQL 1WBXB 1LYQA 1HINH 5AEAA 1Z9LA 1S5IH 4NQDB 5DEZA 4PP1C 5JW5B 4A2DA 3EOTL 3TZVD 1EJ6A 2V9QA 2GFBB 2HLAA 1WUZA 3L16A 1TFHA 2YBGA 2R1XB 3EUUA 3LDBB 5E4IA 3RJQB 3CIAA 4J39A 1KIPA 1YN6B 2Z7WA 3P3TA 1YEWA 1PU0A 3LMJH 4P5KB 5HVGB 4FTVB 5IQ9A 1AE6H 5CBAA 2DWDA 1ZE3H 4QRTB 3O11B 2N1TE 4WFED 3RZCA 1JXJA 3ESMA 4MZIA 5C86A 4CDGC 1CGTA 1CZ8L 2V9TA 3RPIA 4QIRA 1MIML 4UUJA 2E8YA 4HU2A 4IBSA 3RB7A 5ISZD 1NM4A 5D1ZB 5D6CB 2BOBA 4H88L 1VADA 4PMEA 2E59A 3H2WA 5IFJB 1DDHA 3DRTA 4WJ5B 5I19H 3QRGL 4ZMAT 5D2LF 4JANB 5JR1H 1W72L 3K6DA 3IDJA 4H5SB 3DPBA 4L23A 4XP5L 3K8KA 3V0VB 3QJSB 4LEXL 1I9JL 2JB5L 4GUCA 1EO7A 5LGJA 1BF8A 1QW9A 4J8QA 2YK1L 2DQGL 2VAAB 1J5OH 1NLBH 1T1WB 3WJJA 3TM6A 5HYJE 5IF0A 2Q6WA 5LG6A 2CE6A 1H3XA 2YAFA 3ELQA 2ZUXA 4FHKA 3ZRCC 3NFSH 4AI7A 4YOKA 3QDMA 5FGRA 1H6FA 2YEZA 3D07A 1USQA 3CU7A 4K9JA 3X1NA 2UZPA 3WTVA 3OGOE 3AY4C 1JI2A 2BSRA 1I7ZB 4K3DL 5T8IA 3WTTA 5JO5B 2ZXEB 4N8PA 5KTEH 2HX7A 5BV7L 3HIZA 5J5EA 5IW1A 3AB0B 1Y07A 3W9EB 3T1WA 3D09A 3ETTA 4YXHH 1KXVA 1KJ2H 1WCBB 1IL1A 3S34H 4TTGA 1RQ5A 3VI3B 3IKCB 4FQXB 3QE5A 4BH7A 2ZAHA 3VA2C 1VIWA 5H37A 4PYGA 4TQ8A 5DLMH 2LTQB 4DT2A 5C0FB 2QQKH 1OM3L 1IAOB 2Y5TB 3S35L 4WTWA 4LOUC 1XF3B 2FNWA 3T8VA 4DHLA 5IMKB 1M7XA 2H3NA 2CM5A 4WWKC 1XMEB 2X1OA 1CO1A 3ML8A 5HDBF 3L1EA 3G04B 3NFPA 2APSA 2R7EB 5HYSA 3L3JA 1G0DA 2BVQB 3G5YA 1MCWW 4U1IB 2WXQA 4X83A 3NCMA 8FABA 1EGJH 1RZ8A 4J6IA 1S5HA 2YPKB 4PTUB 4EPSA 3OAYK 3F7YB 1BQLH 2AJZA 3ATBA 5IVZA 4CU8A 1NEUA 1M71B 1E4HA 2V2XA 4OFDA 2VDNB 4PCTA 4P23A 4PS3A 1T3FB 4TLKA 3H0TB 4UU9A 5IQNA 4LIQL 4MNQD 4P2OD 4FFYA 4J8RA 3UL4A 1AY1H 5D7SH 3AU0A 2E9JA 2EACA 5SX5K 3NIGB 4W9EC 4PRNA 2JCCA 3BISA 4YFLI 5D7JA 3FB6B 2D2CC 5EO0A 1ZLWK 5T1MB 3OSVA 5E51A 5L9DL 4NKMA 4XN4A 5DD3H 5C7XL 2OL3L 3ALXA 2V2WB 4QAWA 4RRPM 3JWDL 4WI6A 1AHMA 2ZSWB 3BD3A 2LLLA 2LR4A 1U8PA 3OKMB 4L1HA 4KZCA 1RAMA 5ABAA 3BE1H 4HSAC 5CEXB 4FYQA 3MRGA 5SX4I 4JM2B 1OAXH 3ZQ9A 3VH8G 1N12A 2XYCA 4MA1C 3EYSH 4XGZB 4DK3A 4FNQA 1IAII 1F4XH 1CWVA 3K3QA 3O8XB 4LPXA 2PXYD 4ZUTA 2MWCA 4YFEA 3WFCH 3MOQA 3B2MA 4KRPD 4WW2C 2BSSB 1E40A 3BAIA 3LB6D 4XVSL 4DK5A 1CQKA 1YEDA 1RJZB 1HN1A 3OJDB 4OZHE 1KCUL 3MLRL 3ULSB 1A5FH 2X70B 1G1KA 3CSGA 5F7EH 3GXPA 4J3BA 2ICEA 5DMKB 5IBTH 3V4LA 4Y2DD 4FNLH 4Q14A 3EJRA 3LQAL 4BK5C 1IKOP 1L5GA 2FYYA 4ELKA 1S7RB 1KPVA 2J6EA 1JYNA 3DX3A 1MXDA 1EO8H 2B4CL 5EZJB 5DRNB 3ILDA 1JK9B 1E4WH 4K94H 3LRGA 3A6BH 5JHLL 1BFVL 2NY6B 4G8EA 4WFHD 4ZFZA 1OP3K 2AVGA 1KLGB 4HEPA 1LO4L 2EICA 4XCYA 1UATA 3VXNA 1ZOXA 3MBWB 1DBJL 2H32H 2PPAA 4O51A 5K33A 5IEHB 3BAKA 3GT6A 4Y9EA 5JXEC 2QDVA 1MH5B 5BO0D 2NW3A 4IU3A 1J88A 1JNHB 3U9UA 2VWEE 3U1SH 4XPAL 2NX5B 4PJ9B 4WENB 2FCBA 4NJAL 4YR6A 5I1HH 1UJ3B 5I8KL 2QPDB 1PKQE 4G43A 2BIMA 4R4FL 2KHAA 3GZKA 4ZPVB 1VGEL 5EZIH 2EVJA 5A2LH 4IBLT 2P8MB 4PN6A 4QWWC 1XQ4A 1HU8A 5PAZA 4U1JA 3WKYA 2BZ7A 3TLRA 1WIPA 2IOOA 3KPQA 3LKSB 4UV4L 2F5AL 3FK3A 3ARRA 3RL2A 1PJWA 1YO4A 1GGUA 4ODXB 3HI5H 2IH3A 4U3XA 1IBFA 4D8PB 4M6NH 4JRYE 3PWJA 2FQEA 5IZ7A 2XWJB 4JJOA 3B34A 4O02H 3AABA 4HETA 1UZGA 3US1A 1JZ2A 3UJTL 2AJYH 2CO2A 4ALAC 3QJVB 3FU7A 12E8H 1IO4C 4NZUL 1DO6A 4EF3A 1EAOA 3N40P 4JDVA 4DQOH 1F4WH 5LDSA 1KG0B 3MJGX 4GT0A 1T1YB 1T2JA 2H3KA 2XKNA 3KVQA 1CLOL 5FOBA 2WQVA 4HF5H 3T0WA 2D0HA 1RXLA 4ZOBA 1QR1B 1Q9WA 5DR5L 2QDWA 1JGVH 2WVVA 4A66A 4HIQA 1XR9B 3O6FC 1CFVH 3OMAB 4DGUA 4GIAA 3CVIH 3KG5A 4NQEB 2OULB 4OD1L 3TL5A 3MV8A 2AQSA 4G7RB 3DI3B 3BAXA 2VM4A 5DTFA 1JGLL 4OLZL 4MMZA 3I50L 2IH9A 1JHKH 5J06A 2ILLA 4N3UA 2EDYA 4K9EC 1EXHA 1T03H 3BPNB 2F5BH 2KUTA 2PR9A 3CHRA 3ZE2B 3TO4D 4HUVB 2F7RA 2OTUB 3OL2A 2OR8A 3VI4A 1DANT 5E2UL 2BW4A 1QSEB 3O9WC 3VG0L 2IDCA 2G0KA 4TUOB 4UAHA 3VD2A 2IXQA 3GIZL 1FIGL 1AIZA 2V2TB 1UM6L 3D8MA 4GG6E 3UBXB 5C09D 4P2RA 5GRJH 4HBCL 5KOMC 4L9LB 4I3SL 2RJMA 2Y6SD 4I18B 1NSNH 2VC2L 4OI7A 4PM1A 1ZT4A 4ZZKA 3ABGA 2X4PA 4M5SA 1TSHA 4BWTA 1N8ZB 2CPCA 4ES9A 1HYSD 3NRQA 4MA3A 3HB3C 2MOQA 4WTQA 1KJ3L 4XO5A 3HZVB 3KS0H 1AO7A 3K2UH 3LRKA 2PYFA 1YSOA 1UM4H 3SPVB 3QIUB 2EEXA 3RILA 4KUCF 1J5CA 4U1KB 5FA3A 4HSQA 2I25N 1N5YH 3CC1A 4DESA 1RP8A 2YPVL 5HJDA 2O93L 3U46A 1OAUL 3COOA 1OGAA 3JYCA 4KQ3L 3BZFA 4V2BA 4E0RA 1INDL 4UILL 5F72S 1IX2A 3B9KC 2HP4A 5GRXG 3FRUA 5C0NC 2DWYA 1E7UA 4R7XA 4XOBA 3UAJD 1XGUB 3BZ4B 5BXFB 3X14A 5D4JA 3J8F7 1M3IA 2P5WD 2X44D 4LT7A 4Z7NB 5PCYA 5IB4A 4F37F 3POCA 4ICWA 4S11A 4HXBH 2BWQA 3KW8A 4XVUC 4M5TA 2PETA 1XCXA 3V0DA 1T04B 1QOKA 2X1XR 2ORBL 3BKCL 3MLYH 3MRIB 4EN3C 1CGWA 2P5EA 3G5ZA 2WKGA 3B2UD 4AYGA 3BAJA 4N0FB 5E7FA 5ITFB 1BEYL 3FN3A 3WUWB 1YYMH 1OM9A 3UC2A 2RALA 1T4KB 4OB5H 1NAKH 2IDQA 3BQUB 3ZRFC 3SO3B 1WBXA 3NDZE 4MWFA 5LCVL 3E2HB 4NQDA 4AYEC 5GISL 2VMCA 4EZKA 1K9TA 4KHTL 3X13B 5JW5A 4L4TB 5B38A 1U33A 5IY5B 1TJHH 4YEFA 3TNNB 2GFBA 2FE0A 4YDNA 5EULV 2R1XA 3WV0A 5J3HD 5F0LB 3I9GH 1IGTB 1NANI 2Z8SA 4JY5L 3TA3B 4YIQB 2QKIC 3L1OH 1YN6A 1MJUL 1HL4A 2LE9A 4BE5A 4CVXB 1THCA 1UD4A 3P73A 3VD3A 1URZA 4P5KA 3MRFB 3O6LH 4FTVA 1RIUH 3S5ZA 4QRTA 1HZLA 2NY4B 2BLFA 4ZUUB 4NNXB 3VRIB 3IE4A 3C2AL 2I9TB 1FQ9C 2B1HH 4PRDB 5IFHH 2DYPD 1D5ZA 1RZ7L 4F91B 3U2SA 2CLRB 1WWAX 4N2LA 5D6CA 2X05A 3ZN6A 5L6YL 3KLHC 2C4FU 1JPTH 4XPFL 4JANA 2BNUB 1HFUA 1IGFL 2G5BA 2IPUK 1BBJB 4H5SA 3V0VA 1TNMA 5KVEE 1CL7L 3DX0A 3NSXA 1JCKA 3BC9A 2JCCF 2X9YA 2EVFA 4Z7VA 2VAAA 1QLEH 1T1WA 4X6FB 4ZFFB 1PDKB 5D7LB 3PHSA 3ISYA 4JO4L 1F2XK 4HPOH 3GXDA 4OLVL 5F89B 4KH9A 2WCSA 2EDXA 3R8BB 2WGNB 4R96A 4LAQL 1B2WL 4R0LC 5I0ZA 4LSTL 3VD5A 1TQBC 4ZSOE 5J11B 1L9RA 4XMPL 5F7UA 4P57B 3LNDA 4IS6B 4FF9A 2WYTA 3GXFA 1I7ZA 1IC4L 5JO5A 5JHDB 2VLJD 2A9ML 3L13A 4K3EH 2ZWLT 2FR4A 2F7PA 2EIZB 4LDCA 3TURA 1KEGH 1GMEA 1AR1D 3PU7A 3W9EA 2EIBA 2WV3A 3QZWG 4A2LA 2IAND 2W60B 1WCBA 4P3CH 2CBTA 3VI3A 3IKCA 4FQXA 4BFOA 5IW3A 2OYMA 2YO3A 1W6LA 2YKKA 1U2CA 3ZDYE 1LO0L 5HD8D 2XVBA 3TYGL 4P5TA 1YYCA 4JDTH 3O2DA 4NZDA 3TBTB 5C0FA 3CK0H 1IAOA 2Y5TA 4OQTL 1XF3A 1U30A 5IMKA 2ITDB 1CU4L 2NY0D 1H3PL 3HE6B 3NIDF 3LZFH 3H2PA 5IVOA 4K55A 5CILH 4BQ6A 1ET8A 4YHML 2R7EA 1JRHH 3L4UA 4NIKB 3APFA 4O5LL 3E9UA 2BVQA 4PBWD 1AG0A 2WLKA 3LKPB 1SF5A 4U1IA 3T8MA 2IQAB 5L88H 4H1LA 1R34A 2HX9A 3GZOA 5HHPB 1QTYT 4NEHB 3OB8A 4YQXH 4BFJA 3QCVH 3DJZA 3F7YA 3HFFA 3CVHL 5FYJE 1QLFB 3ARFC 1M71A 4WI4A 4BA8A 2R4SL 2XKUA 4I3RL 3NK3A 4PGEB 2E4TA 1I3VA 1NEPA 4HVBA 1QVOA 5CLXA 2NXZC 3FBQA 4QOKE 4TOYH 2XQYG 2YD9A 1AKPA 3GB7B 2AEQH 2DMHA 3F62A 4M6OH 3JTSA 5T1MA 3JYBA 1NBVH 3D39D 2V2WA 5AVWB 2ZSWA 1Q9OB 1EUTA 1X5AA 3P0GB 5F7FA 2FTAA 3OKMA 4R84A 4ANVA 4YSAA 5DYFA 1NCAL 4BKLB 5CEXA 4RGND 4KC3B 3BHBA 1BFOB 1D3CA 2DJ4A 1U8HB 4HS3B 1DQLL 4XGZA 3HLAB 4YSUA 4F9PA 2K8MA 3O8XA 4H0IA 4UNUA 3NN8B 2ZYIA 4NM8L 5FW8A 4H20H 3M07A 1F58H 1I1FB 2AGJL 1MG3C 3ZT7A 3SDDB 3GPSA 4XN2A 2GC4C 5TDOB 3CSBA 4KUCD 3QHZH 3H9HB 4KDVA 2BSSA 4WWID 5HVHC 1KPUB 1QTPA 4XP1H 3ULSA 2FEJA 1RJZA 5I76B 1YUHA 1ZLSL 3BPLB 2X70A 2NSXA 1XGRA 5I28A 1QLRB 3IBOA 3PP3H 4I0PB 1XH1A 4FG6C 1WA0X 2X12A 2WLNA 1MVYA 2FIKA 3P0VH 4PCYA 4UAOC 1P7QA 1PY0A 1C16A 1HQRA 2QVTA 4D3CH 4FABH 3TZVC 4DGIH 4XNUH 3PWPA 4YDLC 1S7RA 3D5OF 2X1PA 2WXHA 4KNSA 2V5TA 1UYWH 5EZJA 2XN2A 3BZ5A 3JWNE 5DRNA 1DCEA 4Q0XH 4HUMB 5ICXB 4PJ5E 2R69H 3CMOL 2DMBA 4UF7C 5LQBH 4RCAA 1VFAB 1A4JB 4E41D 3G5VB 1KB3A 3UG5A 1KLGA 1ZLVK 3VFGH 1MFDH 2VXTH 3MBWA 2YD8A 5GRUH 4C55A 2YA0A 3LN5A 5IEHA 4LCCC 1ZT7B 5D2NB 1FUNA 2QQLL 2X4UB 1SLUA 1HZHH 5D5MB 1UKTA 2ETWA 1MH5A 3MUZ1 1RPKA 5J13C 5KS9F 2OP4H 4PJ9A 1ETZA 3J27A 2BRQA 3RHWK 1J9TA 1UJ3A 1MFAL 2V6HA 2WZAA 3BGMB 4LLWB 4KK8C 3QDGB 4UQBA 4L48A 4ZPVA 3D4CA 3Q44A 4IBYA 3TTYA 1DN0B 2P8MA 3VFMB 5DHMC 2MCAA 2GT9B 2BNQB 3S3SA 3LSOB 4E9VA 3LRMA 2CO7B 4XVTH 5C07D 3CZKA 2BSTB 4HS8L 1ZIBA 3WS6A 4BH8B 5C71A 3O2VH 1MCPH 2ESVB 2AZUA 4ODXA 3WFDL 5DJCB 4D8PA 3NH7H 5DEGB 4JX0A 5DJZB 5H2BB 3PV6B 2XWJA 1MI5B 1ZHBA 3O81A 4WY7H 5T3ZL 4UNTA 1J1OL 3AITA 2CO3A 4N2NA 2X3CA 2X6MA 1PCSA 4MJJA 1CXIA 5GZND 2LHAA 3P54A 1ZTXL 4TLSA 1KG0A 5HPMB 4P23D 1T1YA 2YMXL 3RTQD 3GDCA 4AYMC 1T21B 3R4RA 1RUMH 4PJFE 4NAJA 3PHQB 1OW0A 1OE2A 5FFOA 1PAZA 3GSVA 5FR3A 1QR1A 2J12B 4NS0A 5AW8B 1LDPL 1OHZA 3RL1B 2EDKA 2Z1PA 5AVXB 5FS5A 5LN8A 3IRZA 1XR9A 2AQ2A 3VFUB 3L3OB 4EIBA 1SFDA 5D1XD 4NQEA 1T83C 1WAAA 3N5AA 1NFDB 5E4OA 2JKWA 4ZD3H 3NA9L 4JFFA 3RGBA 3O45B 3V4PL 1D5IH 2AEWA 1FZKB 4G9FB 1I1CA 2ZOOA 4Q89A 3D0VB 4TNGA 1M6UA 4OJDH 5BW7A 4HIXL 3HC3H 4PRBB 4XP6H 3ZL2A 1TPXB 1S9WB 5I30L 2FD6H 3K0WA 1NKRA 4A7GA 1MFBL 2OTUA 15C8L 2TRYA 1BVNP 2YZ8A 2VXSH 2HT4D 5F9AC 5LBSL 1EV2E 4LSDA 1BZEA 4QRQA 2H4EA 1GGCH 1EFXD 3BH8B 4TUOA 2ED8A 2DZEA 2FDBP 2V2TA 3M45A 3V8CA 1MAML 2FZ3A 3E8UL 3HNTH 4FQHB 5D1QE 3UBXA 4QJ5B 5A3ID 4EAEA 4P2OC 4WSKA 2QMJA 5K1VA 1VSCA 4L9LA 5E4AA 4B6ZA 5MHSE 3PWNB 4BE6A 3PHAA 4I18A 3D0LB 3GRWA 2WXRA 4QRAA 1PLGL 5ICZA 2MQ0A 2XTJE 3ZO9A 5DD0L 1IGYB 3TVMB 2YIHA 1JGUH 3Q8CA 1O6VA 4JQVA 4EUPB 2E7LA 5DZVA 4XC3L 3HZVA 4OIBA 4IIQC 1J9CT 4GH7B 4U1KA 4ZMWA 1YY9D 3MV7B 2HRHA 4JFVA 4MB5A 4YFDB 1MIEL 1R0AH 2HRPL 3QH3B 2V17H 1ZLEA 4Z7VF 2PXYC 4CN1A 3F00A 5ELIA 2BX5A 4KY1H 5M7QA 2WIIA 3CDYA 3KBHE 5EUOB 5KANG 1XGUA 3BZ4A 4KRPC 3AG4B 2A6IB 1A7OH 1U92B 3SQOH 1NUDA 2XA8L 5C08D 3LB6C 3H9SB 3UTPE 2BIIA 3PPEA 5AFAA 2A77L 5J56B 5JPMA 4BUGA 2VRAA 3TFKD 3LIZL 2QPSA 1OOAA 5D7HA 2Y23A 1CDJA 3GDBA 5F7HA 2ZXAA 1T0NA 1T04A 3TBBA 4PJBB 1E4XL 3EYVB 2R2HA 2DI7A 3IGFA 3MRIA 4Y2DC 2JJTA 4YSOA 4JZNB 1AXTL 2HT2D 2P48B 1Q1JL 4WI8A 3W2DL 1A25A 2IFFL 3LCYA 4N0FA 2AVFA 2F7OA 3T4YB 3QXWA 4AENB 1T4KA 1OHQA 2P43B 3FO0L 3BQUA 3G3LA 3V79C 1QUPA 2A1WH 1JFQL 3VI3F 5CP3H 3QFDA 3X13A 2JFCA 4L4TA 4AEFA 1YEFH 4N0YH 1EJ8A 5GHWL 3TNNA 1LEGA 1GMIA 3QG7H 4QKTA 2CGRL 4PY8I 1HOCB 3F8UB 1YNKL 3J07A 1EHLL 2PF6A 1P84K 4WSJA 3TA3A 4ELMB 4TUKH 4YIQA 4CVXA 2X42A 3KJ4C 5DHVH 5F21B 3MRFA 4ODTH 2JF1A 3K6NA 4JREC 4JW3A 1I3GL 3N40F 4LLDB 5MP6H 2GVYA 4ZUUA 4NNXA 1G6VK 4XX1E 3KBEA 4NENA 3VRIA 5C6PB 1JP5A 4RWYH 3SE8L 3VRLE 2I9TA 4PRDA 3IFPB 1WYJA 3RIKA 2YXMA 5D1ZI 2CLRA 4BUQA 4U1HA 3ZY7A 4N2BA 1P4BL 5D71H 4JJHA 4L2YA 1O5PA 4GW1B 2O1AA 2BNUA 3EO9H 1UD5A 1BBJA 2XN9B 4CSSA 3WFEH 3ZW3A 2E46A 4AQEA 1OK8A 5ADPL 3MLVH 4Q9RH 3IETB 4GRLB 1G7PB 5I73B 1FCGA 2G60H 2F1BA 4KPHL 2LOEA 3DA0A 4ZFFA 1PDKA 3L4XA 5D7LA 1NBYA 2DMKA 3NOIA 4FQJH 3CPUA 4FMVA 3KXFD 4LCUB 3S37L 1QSFA 3FT2A 3QFJB 2VDKL 3PWLB 3BP7B 3P4LA 3VXME 3WN6A 3S3BB 1RK7A 5IEKB 3V6ZA 3QO1B 3T2PA 4P57A 1SY6L 1MCOH 2ZNWA 3I2CH 4IS6A 3GJFB 4NWTL 4G7SB 2CXKA 1TTAA 5JHDA 3CGTA 4JQXC 4OFVA 5T3XE 3S36L 1UD6A 2YA1A 3INOA 4ODVL 2X9WA 5JNYB 2D7NA 1N64L 2H41A 4KO7A 4K5PA 2B9BA 1J9RA 5MENB 2OSLB 3BEVB 3GEFA 2W60A 3VX0A 5AKTA 5B1JA 4TVPD 4AC4A 3SHSA 4UQ9A 5KVDL 4PJIE 2CNZA 3TO4C 1VHPA 1X5MA 3HE7D 3EJYD 3VXUE 1S78D 4MYWB 1QRNB 5BS0E 1A6TB 4XI5D 3TBTA 4N1CA 2R1YB 4RWHA 5CMAB 4XCFH 1MWAB 2WYZA 2ITDA 3HE6A 3VFOA 1JNNL 2VDOH 4C83B 1BGXL 2V0AA 3EUDA 3BSZA 1W2KT 5FYKH 4G9DB 4QD2E 3O41B 4KRLB 1A6WH 4UQ2B 3LKPA 4H8WH 5DT1H 5HJGA 1KFAH 2O5XL 2IQAA 1NMAH 4AJWA 5J8OA 4ZAKC 2HG5A 5HHPA 2Y6SC 4Z78B 5IQ7L 4C59B 1ID2A 4Z7UE 4XXWC 1QLFA 5C0EB 2EECA 5I24A 1HYSC 1MFCL 4LGRB 2FB4L 3Q6GH 1SHSA 2G2PA 2R8SL 5A2IH 4XWGH 3UTSD 1QG3A 3PQYD 4BGDA 3EZJB 4FEMA 1J1XH 4EDXA 3GB7A 4K73A 3U0WL 1E8ZA 5FYLE 3ZBMA 2AAAA 2SODB 3BVNB 3ZL4H 4YPGB 3QUZB 1YY8B 3P2BA 1GAFL 2CPUA 2FHCA 4PBXA 3T0XA 4F7CA 3FNKA 2VDMB 1BVZA 4Y88A 1KJVB 3ZHFA 1Q9OA 4XCCL 3SBWC 1GJIA 2EKSA 3UAJC 3CJJA 2NY7L 5SWZE 5IHUH 4BKLA 1KGWA 3IS1X 2Q2LA 2XV3A 1FO0L 3AUVA 1H0DB 3UZQB 3BT2L 1IEHA 1W6WA 1H9DA 1YYLH 3ZHDA 1BFOA 1HIMH 1U8HA 3W39B 3HLAA 3CVHB 4NFDA 3BPOC 4YXLH 3NN8A 1X6LA 4L4JA 3N3EA 4L8SB 1XD1A 2YD4A 3U4KA 1I1FA 1G84A 3B2UC 2PTUA 4KHXL 4A7SA 3SDDA 3OPUA 4TRPH 2ZX8A 1JN6B 5FLUA 2LFGA 4AGMA 4HUXB 1KPUA 2YGNA 4CA4A 5I76A 4D7BA 3EH1A 5FPIA 4Z3TA 1QLRA 2VMFA 4I0PA 4XC1H 4TVPH 4LHUB 4CVZA 2OL3A 3KWTA 3U9PL 1TVBA 1A7NL 1AHKA 5FO9A 4M7JL 4PB9L 1DVFD 1WAAF 3SGDH 3KYNB 5J3HC 1L0YA 5LGHH 1AQKH 3ESUF 1CJYA 2DWSA 5ICXA 1D9KB 3FFDB 4U4IA 3LD8B 3E6FB 3STZB 3TJHD 4Q4EA 2VL5A 5FYJL 1A4JA 2EQDA 3G5VA 2FYVA 3ARGB 4X6CE 3ZE2F 2EUWA 4A7GF 3ECUA 2Y06L 1BLIA 2C4FT 5HDRA 3VQLA 4G82A 4ZMLA 3SQBB 5CEZL 2I7SA 1Q0EA 1ZT7A 4IOFD 5D2NA 3K8MA 5D5MA 1IGCL 3LRHA 4PFEA 1LE5B 1IJ9A 4HU8A 1BD2A 4YC2B 4P06A 3RIFK 3VG9B 3G5WA 1MN4A 1PYWB 3BGMA 4S10A 4LLWA 4PS8A 1NGXB 4CKVX 2Q8AL 3T9WA 3QDGA 4KVCH 3U4BL 2CJUH 3WAJA 1MDTA 1R6VA 2GHWB 5FHAH 4P5TD 2V7NB 1DN0A 2WBKA 2X53A 3VFMA 5C0CA 1OGTB 1WCQA 2BNQA 2GT9A 3LSOA 4AUYA 5F9JB 2YFOA 2JB6B 2CO7A 8CGTA 2OCJA 4I8DA 2BSTA 4BH8A 5LXGL 2IADB 2ESVA 5D70L 4FKKA 3G6JE 5DJCA 1A7QL 2WKLA 3VD9A 3IDXL 3RVXD 4S1RH 4D9QE 5DJZA 5H2BA 1ZLUH 2O6EA 3PV6A 4GKLA 1MI5A 2GJPA 2WKOA 2ZWKA 3FUMA 4M5YH 1GHFL 4OJEH 1HL9A 3DHMA 3QDAA 3CLEL 4LSUL 3RB5A 4B95C 3QARA 2DQUL 1XEDA 4YDKH 1HHGB 2D4DA 2EIJB 4KDWA 3EBAA 5KUMA 5KAQF 1Y1DA 5DVOA 3WIHH 5B39B 1OARL 1SF3A 5HPMA 1BAFL 5DUBA 1N26A 3VFPB 3O0RL 4POZD 5CZVL 4ODHL 4TPRH 1VGKB 3VSVA 1AR1C 4PRPE 1FORH 1IKNC 4KMTH 5I1IH 3KPLB 3MRNB 3HS0A 2HMIC 1J0YA 1MHEB 1T80A 4MJIE 3AU1B 3RL1A 3RUGE 4Z7NF 1SGKA 3Q5YA 4JPVH 2WOBA 4C57C 4Z7IA 3VTTA 4R7LA 1UEYA 3L3OA 3VFUA 4BZ1H 4OF3A 3UADA 2FUQA 2F1EA 1IAKB 1NFDA 1BW8A 4TLTA 4RSYA 5FA4B 1GGBL 1UWGH 4XP9L 3O45A 2C1PB 4WFFE 1FZKA 3GSRB 3IM1A 3D0VA 3ZRSA 4EOWH 2WXMA 1MG2C 2EEDA 1HHIA 2JMRA 4PRBA 4X5PA 3QUXB 4KGJA 1S9WA 4F58L 4BHUA 1CUOA 4A6YL 3EYFB 1CD8A 3MYJB 4OZHB 5GS0D 4G5ZH 5KSUB 4XOAA 1CVSC 2VDPL 2FEEL 3UJIL 1LO3L 2ZNXA 5EFIB 5FDWB 4FAAB 2Q76B 3WEOA 3BFOA 3BH8A 2IPKB 2CO1A 1YQVH 4OBRA 1YPZE 1V27A 2WSDA 4ZMPA 2VXVL 3DGDA 2IBBA 1RFDH 4DPBX 2G0LA 3V9EA 1CD1B 3UBXI 2RCSL 4FQHA 4KI5F 3UERA 3D33A 2W5PA 4Z7QB 1P7QD 3PWNA 4XMZA 1SVBA 1KENL 2K9UA 2O30A 5CJXC 3PWPD 4PJEE 1BZDA 1BV8A 3C6LB 1ASQA 4XRCB 1IGYA 3Q2NA 4N1EA 3TVMA 4FQLL 5FUOL 3L5XL 3FQRB 3MJ6A 3UAAA 4F5CE 1YECL 4HIIB 3UG3A 5TF0A 3MFFB 4EUPA 3ZYOA 2J1WA 4UNIA 4YLQT 1I9RL 2XFGB 3SD2A 2OJEA 4LGSB 5SWQB 3FTVA 4HJJH 1PKQB 1YEEH 3MV7A 1IM3A 2AAVA 2YSSA 5L4IA 4RGNC 1LILA 1AZNA 3QH3A 5L0QC 3JWOL 5J89A 1UWEH 2FO4B 4UQCA 1YQ2A 1XV8A 4X4XA 4ORZC 5EZLB 2XSKA 4I7ZC 1KIQB 1NOAA 5DMIL 5AG9A 4Q56A 1BFSA 2GJ6D 2A6IA 4PGJA 1U92A 4PS4H 3H9SA 4CBPA 4UTBH 4JRYB 3ZGHA 3UTOA 1IC5H 4V1DD 2G5RA 5IFAH 4AOFA 3B7RL 2CD0A 3ZE1F 4X9HA 3EYVA 3ZIYA 4QHMB 2B0SH 4B9JA 3FULA 4JZNA 1AQDB 4KVNH 5IHWA 3T4YA 3ELAT 3CFIC 1IGML 4GXUN 5ACLA 5C1MB 4QYOB 5ALBL 4AENA 4QNPE 3CSFA 5IGXH 4F1SA 1E28A 3MNZA 4MB1A 2J44A 4AXWB 5EF2A 4CC4A 2RTTA 2YPVA 3K1KC 4F57H 2ZCKL 4NERA 1UOKA 1UOLA 5D7IB 1YJDH 3CFCH 4GAGL 2H0JA 5GS0H 2YLKA 1CK0H 1NCIA 1TJIL 3IPFA 3U79A 1GIGH 1JZJA 1HOCA 1LEIA 3S5LG 3OHMB 4FQIH 4LAJH 4NIYE 4ELMA 1VFUA 1HSBB 4JKPH 4EXKA 1KXVC 4XMXA 4EZJA 1IBYA 4YMPA 2BSEA 1E43A 5ILTH 3K5RA 3P2TA 4LPUA 1MZYA 3H7BB 4LLDA 3HRZC 3PXHA 3K46A 4Z6AT 4JFFD 4WF7A 2J8UF 5GZOA 4OJAA 1XEUA 1UVQA 2O4EA 3W0WD 4EI6A 4WLCA 4Z3GA 3CFUA 3IFPA 1SVCP 3M6DA 1TCMA 4H8PA 2F74A 1EZUA 3FFOA 2ZUQB 4YSSA 5LGKA 5LCVA 4XZ4A 5K9JL 1JV2A 3IJSB 4NQXA 4YBHA 2WWNA 4GW1A 4AVHA 3E38A 1U4FA 4GG6B 4EZMA 1LP9E 3CCHB 2CKBL 2EH8L 4GXUM 1MF2H 1DVXA 1ET7A 3IETA 1G7PA 4GRLA 3WTUA 1N59B 5GZNC 4I4WB 2IOIA 1BMGA 5IHLB 4LF3A 4N2CA 1CICD 4P23C 4WJG3 3EYOA 4C54A 3RTQC 1M4KA 3LPFA 5F7AA 4TSCH 4LCUA 4MBRA 3X3FH 1E4KA 2BS9A 4KROB 3QFJA 2LABA 5LWYH 3PWLA 1F3RB 4A38A 3BP7A 2W0FA 3W57A 4ANWA 4MJ2A 1CFSB 4N2DA 3OPZL 5IEKA 3QO1A 4OVUA 2K0RA 4O00A 4RA3A 5D7JC 5KYNA 3H8NA 4JLRB 2Q8BL 3K4AA 2CDGB 2E9WA 5DFTA 4YHPB 5D1XC 5GGQH 5FCUH 1A21A 1YLBB 2KL6A 3NSYA 1WWBX 2PWEA 1WDAA 4OKVB 3AT8A 5JNYA 5EA0L 5HXMA 1WAEA 5C9KA 1IE4A 3MLUH 4QF1B 5MENA 2OSLA 4RNRB 1K6QH 3BEVA 3HMXA 4G6KL 4GP4B 1NINA 2Y3NA 1MREH 4OI9A 5DUPL 4NM4H 3OD3A 1FGVL 3JV5A 4P0DA 1JTOA 4Z3EA 2HN7B 2HT4C 4R5XA 5DHYB 1AAJA 2BSBA 2R1YA 3BZDA 5DURD 1SBSL 1MWAA 2QMKA 5H94B 1N18A 4FZEH 4C83A 4MAUH 5CP7B 2YRBA 5A3IC 4G9DA 4NO5B 2RHEA 3O41A 1DUZB 1Q1PA 3QZBA 1S7UB 3JQOB 1FP5A 1EJOH 1ZTMA 3SSGA 1AZCA 1MY7A 4Z78A 5T5FH 3EFOB 4MS6A 1DQDH 4FP8H 4HIPA 4HUNB 1WFOA 3OKEB 4GEJA 5D5MF 3LIUA 3P3SA 3PABB 3BH4A 3GS0A 5AYUL 4YHYB 3WXVL 4YGVB 4LKCA 4IDJL 5E8PB 2VNCA 1BM3L 1NCDL 1W15A 1ZGLP 3MCYA 3OVUB 1FLRH 3PYCA 3UGXA 3C6EA 2DLIA 3Q1EA 1SYVB 1YY9C 3BVNA 4B9PA 5ABDE 4YPGA 4FL4B 5EORH 3QUZA 4OAWB 2X2IA 1S6NA 2NY2D 1IQDA 4ETQA 3MRLB 1YY8A 3PNWB 1UKQA 2WQ8A 4WFEE 3RX9A 2A9AA 1URIA 4OIAA 2NY5H 4LLVB 2H2PD 4M61B 2QGEA 2PCFB 4CGTA 1NC2D 1P4LB 1OWWA 5JZ7D 1AD0A 4JPIA 5I15H 3UZQA 5ISZE 1H0DA 2WKOF 1HKLH 3QPXL 3WE6B 3TFKC 1F00I 3MV9D 3SGKC 1XTMA 3W39A 1RURL 3CVHA 3BN9C 3P4NB 3P2DA 3NAAH 3ULUF 3BVUA 2C8NA 2HT2C 3NCEB 2NTFB 3U4EA 2NT1A 5EO1B 5HYJA 3MXWL 1JN6A 4JG5A 1ZVHA 2VKWA 4HUXA 4WGWB 1X4XA 1R5IB 3EH2A 2NUTB 2WWOA 5K9QG 5IWLA 1G9NC 1JWMA 4XCEA 1DVUA 3BH9A 2VR3A 3RDTD 4LHUA 4ZSOB 3H9YA 1RUQL 2ZICA 4IBWA 1BG1A 4LE8A 5HDQL 1NFDF 3KYNA 4W9CC 3S35X 1X5FA 3ECBB 5AAWC 1QSFD 2CUIA 3DMMA 2DTMH 1KB5B 4JPWL 43CAB 2WXNA 2AJ3B 5DHDA 3V7AG 2Y36H 1D9KA 1E6OH 2APFA 2OW6A 3E6FA 1ZIAA 4ZTOH 3LXUX 4DGVH 5CCGE 4X99B 1MCRA 4EDWL 3ARGA 4O4YL 2DQDH 3H1ZA 3M1CA 1HI6B 1Y1UA 2JJSA 4OIIL 4WNSA 2BDNH 2JIXB 3OQ3B 3SQBA 2FO1A 3QYCA 4H8UA 1MFEL 4GAYB 1LE5A 1HWWA 2Y25A 1FH2A 1BZOA 5TDNB 3FTYA 3U83A 4NZRL 2BVPB 3DNKA 1H3TA 3ENEA 1PYWA 1OPGL 1EVTC 1NGXA 2ZWZA 4N24A 2DQFB 4NCDA 4NZTH 4HYTB 4H44C 1NC4D 2FLRT 1FSKC 2G2RA 1EDQA 2HT3D 1OGTA 4NKIH 5F9JA 1SM3H 2ZOUA 4ANXA 4EQ2A 1GC1L 3BVWA 2JB6A 3BO8A 1AGBB 3U7WL 4OTXH 3SE4A 4JQIH 1WICA 5AW3B 5E0FA 1TO4A 2IADA 1U91B 5HHOD 1QFWI 1F11A 2DQEH 3DGCR 3VWJB 4NKQB 5K93A 2DLFL 4KK5D 2OPCA 1A7RL 2YAPA 1QBLL 3KVPA 1J86A 1F3JA 3SPJA 4CMHC 4HOMA 3PP4H 2ROXA 4YDVB 4MNGE 2WVUA 4QOKB 4MNQE 4FI8A 1HXYB 1BG9A 1XH2A 2XQYK 2DQIH 4B41A 5DJDB 1OAYL 3DV4B 1PD6A 4FTDA 4JFTA 1RULL 3KPLA 3MRNA 5KVFH 3G08B 4XH2B 1E9PB 5EZPA 1MHEA 3CQPA 1LD9B 4A2HA 3AU1A 2DKSA 2VABB 1AKJB 3QZNA 1SYSB 3ZDZE 3RWHB 3GBLA 3HE7C 3LVEA 3EJYC 1DUYB 1TTCA 3ZSTA 4KKPA 1S78C 1DVQA 1NEZB 1IAKA 1CS6A 1YRKA 2CK0L 2R2BB 3OX8B 3WE1A 3IVKB 4XI5C 5FA4A 3GKWL 5HVWA 2ZSVB 2B7DT 1DQQB 1M1XB 3AUWB 2C1PA 1QACA 3GSRA 1JXDA 4JRWA 2C26A 4JFED 4P4KB 3RI5K 4I88A 4LLAA 3T2LA 5I1GH 1DJXA 3QUXA 2JELH 5DMGD 3ZSSA 4S2SB 1E3FA 5DUML 1CFNB 2NNFA 3FN9A 3MYJA 4OZHA 5KSUA 1V3JA 2Z7ZA 1KYUA 4HKBB 3MYZA 4HV8B 1CIDA 3NSJA 5EFIA 5CLYA 2Q76A 5KEZA 2Y22A 3HS9A 4LRIA 3D6GA 2IPKA 4HWEH 3M7FB 4JJ5A 3ZKND 3NFNA 4GXVH 3NZ8A 5HDLA 4AL8L 1CD1A 4K2UH 1DL7L 3ZHKA 4PJ5B 1T20B 2DM4A 5T1KB 1NCGA 5L2KD 2AEPH 3N91A 3QW9A 3HG2A 5L8LB 3DVFA 5ETUA 2AZAA 5K39B 3Q8AA 2C7UB 2ZG2A 1UWXK 3C6LA 3PL6B 4WFHE 4XRCA 2B5IC 1KCSL 4FD0A 2J5LB 1BYNA 3FQRA 1J5IA 2GUOB 3FXIC 4WK0B 3MFFA 4MFHA 3D85B 4LCIL 5K1JA 3F7PC 1IRAY 4N5UA 4ZXBB 1QBAA 3L3GB 1DQMH 1A7PH 4XB8A 5SWQA 2JH2A 3TT1L 3BIBX 5LBSA 5I1KL 4N1HB 2AEOA 4BSVB 3CUPB 1BD2D 1U2HA 5IV2A 1CTNA 4PIBA 2X4TB 5EZLA 3QRFM 1KIQA 4MVBD 4QGTA 3C08H 5CXPA 2JCWA 5D4IA 3GUTA 3VRJB 3LAFA 1JIBA 2BNRE 3LEVH 2AQQA 5C0CD 3CFDB 3FPXA 4JRYA 2W9DL 4XBMA 3ULVH 4FQ2H 3UYOD 2AQTA 4K0OA 5CBEB 1YNTB 3WKML 2C3WA 3DIFA 3QEUB 4N86A 1A02N 2NDFA 5IUCA 1MJ7L 3BKML 4QHMA 1IZKA 1OCWH 3CLFH 1AQDA 5AD0B 3EOYG 1DVFC 2VDLH 5A2CA 3B9DA 3X3GH 2DICA 2WUBH 2O5ZL 2Y07H 4QYOA 4KZ0A 3V8OA 2FIRT 3CH1B 3I3DA 4LSRL 4HJGB 1CBJA 1GW6A 4PJFB 5J7CC 1IM9B 4O58H 1CIUA 3MRMB 4IOIB 5T1JA 5D2LE 3HHRB 3U7AA 4KV5E 1RERA 2Z92B 4DGYL 4ZI8A 4UT9H 2G4EA 1EBAA 4FJYA 4IOFC 3C60D 5J1TC 4UZUA 3JTTB 4NAMA 3ZYZA 5D96B 4ZDHB 1JNJA 1QPXA 1DLFH 1HSBA 4DTGH 1VFBB 1JPST 1CFTA 3B3BA 2FQDA 4N6RB 4HUUA 4P2QB 4WRLA 2CRIA 1K2DB 3H7BA 4P5TC 3DURA 3MX0B 5JOEA 1AC0A 5C7XH 2P7TB 4JFYB 3C8KB 5E03A 3I3BA 2V9RA 5CKGA 5EEZA 2YAEA 1CF8L 1XR8B 4Y5XB 3RVXC 4X6EA 3ZR5A 3N04A 4GG6A 3ZR6A 5D1QB 3S4SG 3QNZB 3BYTA 3CCHA 1X3DA 1G6RB 1O75A 1G1OA 1XL4A 2UVEA 3U4AA 1QUNB 2P8LB 1CF1A 2XFXA 5JUEH 5C09E 1PVHA 4JRXD 5SX4H 4I4WA 1YDPB 4GMSL 5T1DH 4MZRA 3HNSL 1NOFA 2Y7QB 3N43F 1IAIH 3BMWA 4IRZH 1E6JH 4JHAL 2GSGA 4A55A 4CJ0A 3DXAD 4POZC 3TJEL 1IGIH 3EOBB 1HS6A 3D4GA 1MNUL 2IG2H 1CFSA 3ARBD 5FM5O 5CCJA 5A16B 3D18B 3VGDA 1CDBA 2BW5A 3LQAH 4JLRA 1JWSB 2CDGA 1Y6KR 5DJ0B 1WO2A 1DBAH 4YHPA 4FJZA 5JIMA 1IBGL 1U3HD 1O7DC 1WAPA 2YN3A 1DP0A 1NFIB 3CBRA 3ECQA 1SN0A 3L3HB 3PNRB 4G1MB 4NUPA 1AP2B 4OKVA 3VFRB 3DOHA 4LK4A 3L9RB 3CFKB 4UIMB 2RB8A 3QCUH 5A2JH 1L6PA 1FVCB 2X3AA 3WL9A 4HHGA 2Z1KA 1XTLA 4QF1A 5I82A 1IM3D 1WITA 2CKBB 3LHPL 2EABA 2G30A 4F2ME 3SZ6A 2L0DA 1NKGA 1SMAA 4F9PC 2EDNA 3CZGA 1Z0MA 3LH2H 2Y72A 3GLEA 5GS0C 3POHA 3H85A 2HN7A 5DHYA 3U7YL 1OAZL 4Q2ZB 3Q2WA 5F8QC 1HINL 1D5XB 1JDAA 1PZSA 1Q0YH 3FTZA 3BUTA 4PUBH 5H94A 1QASA 2O72A 3BGFC 5HGAB 2XX0A 2RQ8A 4NO5A 3BIKB 4JR9H 3T0AA 1CE1H 4N2IA 1S7UA 5HHMD 4U7SA 4PRID 3EFOA 4OF7A 2WP3T 4KJPC 3N44B 3OKEA 3LMJL 3F83A 1AE6L 3PABA 3B1UA 4M8RA 2H26B 4XNZC 4YHOH 1GOFA 5C2UB 2VH5H 4G6FD 4JRFA 2NY6C 2ED6A 5E8PA 2UXTA 3DX8B 1TQSA 2VERA 4JL2A 3N06B 3VXTA 4XO4A 2VZUA 1SYVA 4EVNA 4FNPA 3ZL1A 3JV6B 5E8DH 4OAWA 4IMKC 1SN2A 1T6BX 2MEJB 3MRLA 5I19L 2W38A 5IB3A 4LHJB 4H0GA 1KYAA 5JR1L 2FX8H 4LLVA 1KF9B 1S8DB 4M61A 3IB4A 4CKQA 4JO2H 5AVYB 1QEWB 4NX0A 2C1OB 1KTKE 2AITA 4MLSA 5JOPD 1HTYA 2CMRH 1NLBL 1RZJL 5GZOD 1J5OL 4OD1H 5FM5M 3VGHA 2BHZA 4WWKB 3P4NA 5EHFA 3NFSL 2ARWA 5D7KD 2WBJD 3FQNA 5ES4B 2FO8A 1XGYH 3DV6B 4HGMA 4IKIA 2HJFB 3BXNB 4PIRF 1JZ3A 5F7LB 3I50H 4QO1B 2WLYA 5EO1A 4JHUA 2X9ZA 3RJOA 1NGYB 2XWBB 2IDUA 3KPRD 1R5IA 4B60A 4ABVA 2NUTA 3U82B 1NZRA 5KTEL 2FWUA 3B7SA 2XWEA 4JM4H 2QLYA 4LB8A 3QORD 4FFVD 5E9AA 2HVKB 3VXMB 4ZSOA 5I1AB 1NWPA 1MDAA 5JW4R 5TPWH 3LJ3A 3TIDB 4YXHL 1KJ2L 4LLQB 3S34L 1HAUA 3ECBA 2EC9U 3JVGA 5C0GB 4XP4L 4PJXE 4RZKA 2AJ3A 1CXKA 2VLJE 5I6OA 3WTYA 4X99A 1UUNA 3ZIMA 4YSCA 5DLML 2QQKL 1WC7A 4OT1H 1HI6A 2TSAA 3A23A 2JIXA 1ICTA 4M1CC 4OZHF 4PJIB 3GS4A 2IANE 3VXUB 4GAYA 3C9NB 1JZEA 1EJFA 3O4LB 5TDNA 4B3VA 2A0LC 3VNZA 3GYRA 2BVPA 4IGBB 4MA1B 1X44A 4LOEA 1EGJL 5F44A 1KN4H 2DQFA 2DDQH 3DX7B 2P26A 5DFVC 4NWUH 1BQLL 4QGYA 2C3GA 4NN6C 4PRHE 4AVIA 3FHQA 5K59E 4RDQF 5CLTA 5IUSA 1VACB 1I9EA 2HVJB 3BWSA 3LH9A 4WW2B 4DNLA 4TL4A 4ZX5A 4AG4H 2E7DA 5E9DE 4RRPA 1AY1L 1U91A 5D7SL 1CICC 2CUHA 2VLMD 3H53A 4MQ7B 3VWJA 5C97A 3NEOA 1T7YA 3IAGC 2VB5A 5IHBA 1GRWA 1R5WB 5DD3L 3ZU8A 4Z76B 2CO4A 4M00A 3SYOA 4YDVA 2Z8WC 4QOKA 3UIYA 1KCRH 3QYMA 3ET9F 3VU1A 3OAWA 1HXYA 3VWKB 1GL4B 3II3A 2OTPA 2BM3A 3BE1L 4JQVC 4W6XB 1MCEA 5DJDA 3H54A 4QRRD 3CDFA 3DV4A 3FL7A 1OAXL 4XBPB 4JFXA 4FA6A 1R47A 3AT9A 4OUOA 4YDIH 3EYSL 3MFGB 1F4XL 2K3TA 4E9WA 3G08A 1E9PA 3D39E 1TSRA 1LD9A 3CFJA 3O3EB 4XNDA 2VABA 5SWZB 1JPFB 1SYSA 4OZFB 5AKVA 4ZNEE 3RWHA 3WFCL 2C9AA 5B7FA 2GKIA 1M9WA 5CN1A 1DUYA 2ZP0T 1NEZA 3OX8A 2R2BA 2L04A 3FUIA 4G83A 1G9MC 1QEXA 4JFHD 4RGNE 1DR9A 4Z7WE 2ZSVA 3OWRA 1DQQA 1M1XA 3SZKC 1A5FL 2N59A 5F7EL 3MLZH 4OU3A 5IBTL 4E5XB 4P4KA 3PWVB 4FNLL 5JPMC 3W1ZA 3MKKA 1NANH 1SLXA 4MCMA 4S2SA 2XZQL 3HEIB 2GQHA 4OKDA 4NUMA 4DP4X 4NOFA 4BINA 1EO8L 4HKBA 4HV8A 5HJBA 1E4WL 4YDMA 4K94L 4PGBB 1P7KB 3A6BL 5HYJD 3CQFA 3EDJA 3WNKA 2UX6A 4HZAA 1TOXA 1DQIA 1KT2B 3IT8D 3QDHA 5LUMA 1QNZH 5DS1A 2IFGA 3MO1B 2EC8A 4ZMZA 4PJ5A 1T20A 5T1KA 1T0PB 1TQUA 4AIZB 2YQ2A 3U1SL 3ATFA 4X6CB 4J2XA 2BC4B 4X0NA 3B8YA 5K39A 2C7UA 2I32A 5I1HL 3PL6A 3DMMD 5J12C 4E41E 3P30H 3TA3C 1BOGB 5F88B 2ZAGA 2GUOA 2J72A 4TULH 4ADJA 5IBUB 2GTQA 1ACYH 3D85A 2X10A 1XHHA 3O6FB 2H2PC 5EZIL 5G5DB 5T1LB 4LSTH 1G7MB 3WELA 3QG6B 1RVFH 5CN2A 5HYEA 2DKUA 3F84A 2NY4C 1NGQH 2EDDA 4EKXA 5JZ7C 2BOLA 4GG6F 3WDHA 1FDLH 3CUPA 3HI5L 3MRKB 4ZFGH 3VQ2C 2C9VA 4M6NL 2EE2A 2J73A 3SPHA 1SEQH 1MCJA 4GW5B 3MLSH 4PREB 4O02L 1UXWB 5L8JB 4AYSA 1I75A 1P6AB 2BCKA 3T4AA 4OSUH 5C07E 2VN4A 3G6JB 2AJYL 3VRJA 3O9WB 2QVIA 2FECI 12E8L 1H8NA 3CFDA 3B1TA 4DQOL 4HHWA 1F4WL 3B7UX 5CBEA 4GAAA 1YNTA 4JS7A 2PW1B 4NLAA 4ZQKB 3B8SA 1BDYA 5CIPH 3RDTC 5IBLD 3B7YA 1D6VH 4HF5L 1EERB 3V0AC 4LCWD 2BFVH 3UP6A 2DTSA 5AD0A 1H9VA 3FS9A 3SE3A 3APNA 2UUDH 2BXZA 2DQMA 5B8CC 4J3OF 5H37H 4U1MB 3OC8A 3CZSA 1HE7A 2H0FA 1CFVL 4HJGA 3CVIL 4PJCF 4PJFA 3GBMH 1IM9A 4PRPB 3MRMA 4YSDA 3ZUCA 1K8IB 3RY6A 4MJIB 2Z92A 3HB3B 3RUGB 3DJRA 3EFFB 5BOJA 2AQPA 1IE5A 4YHNB 1JHKL 4GUPB 3MUGB 2YRLA 3JTTA 1T03L 2F5BL 2J88H 5FWQA 3VTAA 4ZDHA 1MRCH 5D1XE 1NIFA 4R6UA 3GWJA 5IESH 4W81A 5B1JC 1VFBA 5C92A 3SKUD 2YRPA 3JZ7A 1J11A 3B9KB 4OJFH 4N6RA 1Z66A 2ZQKA 1E4XI 1I7TB 1K2DA 1VRSA 3IEAA 3MX0A 4FFYH 4LVOC 2GCYB 2HT3C 2QPEB 4MA8H 4QEGA 2FWOB 2L7EA 2P7TA 2CXGA 5AVVB 1PZ5B 4JFYA 2ZWSA 3C8KA 1WIUA 4NRYB 4OLEA 5GRJL 5T3ZD 5I0DA 4Y4HB 4LOVA 1GZQB 4FXGC 2HLEB 2P42B 2VLRD 1XR8A 4NLHA 1YPZB 1NSNL 1AGCB 4EN3B 4PWFA 4KK5C 3MRHB 1XBDA 1EEQA 2NY3D 3P3YA 5D1QA 4RQQB 5D4QA 5IB5B 5BV7C 1F6LL 2BPBA 1Z3GH 1QUNA 4RETB 2P8LA 1YDPA 3K2UL 3SE6A 3GHPA 1UM4L 2Y7QA 5LBGA 3LPPA 1ETB1 1N5YL 5C6WH 3A22A 2OSYA 3QQDB 1S7QA 1SOQA 4JUSA 4N2OA 1FFOB 3EOBA 2NQDA 3AWGA 3S7GA 3D12B 3X11B 3H56A 5AB0A 2WHVA 4G2AA 5A16A 1RUPH 3FTXA 3D18A 1ZLUK 3OR6A 2QKIB 5DJ0A 4LO9A 2HKAA 4UTAH 1BPLB 1NFIA 5FLVA 5C0BD 1KY6A 3E6HB 4G1MA 1AP2A 3FB5A 4R9HA 4B9YA 3VFRA 4UIMA 3L9RA 3CFKA 5BQ7A 1MW2A 1FVCA 2HFTA 4HXBL 3JVFC 2BIQA 3VYNA 2PKDA 5CUSH 2CKBA 4WNQB 3UPRB 1RLBA 3TPKA 1E3ZA 3JV4B 2QQLH 5DMGC 2Y2WA 4QT5A 1YYML 2DN7A 1UH4A 5C08E 4MJHA 4OB5L 3ARED 1NAKL 4Q2ZA 5JIKA 2WTOA 3SDDC 1XB3A 5HYQB 3IGAA 4D2NA 4GRWH 4UI2A 3ZKNC 3FB7B 1BXAA 1QO3B 1D5MB 2EDEA 1TJHL 2X09A 5HGAA 4X4YB 3BIKA 3LN4B 2WLLB 4I0PC 2AXWA 3QJHB 2QFPA 2DAVA 3I9GL 3JWDC 1U8CB 4JCWA 3DO3A 3BEWB 2HFFB 1ADWA 4RFEB 2PPCA 1CBVH 1FFQA 3FF8A 1OSPH 4LOFA 3ZDYF 4HJEA 4R0LB 4WEMB 5EBGA 3O6LL 1RIUL 1TQBB 1ONQB 2XHNA 2W0PA 4Z77A 1C08A 1J48A 2H26A 2KPNA 3SPIA 5E0QA 2ADYA 1KTRL 5F7NC 3DX8A 3L3KB 1QHOA 2B1HL 2C3VA 2CK2A 2L4OA 4HWBA 5IFHL 2DWEB 4S1QL 1J7VR 3AS3A 3JV6A 4KWUA 1MCSA 2P52A 1JPTL 2IV9A 3FRPG 4JAMB 3K71A 4FA7B 3Q5TA 2LQRA 3KCPB 3ETBJ 4MVBC 1S8DA 1PKOA 2VT0A 3PGFH 1FBIH 1FJ1A 5I75C 3NCFB 1QEWA 3BCFA 1QLEL 5MEQA 3FQYA 3LQAC 3ME0B 4N2KA 3CFQA 1I7UB 4HPOL 1LP9B 2BCMA 4WWKA 3NA9H 2CHZA 2B4CC 4IHOB 1G7IB 5EIVA 1SEBB 3D3VB 3DV6A 2HJFA 1ZY9A 3UBFA 3O6MH 1FE8H 4QO1A 4L4VB 4WTZA 5KS9E 1TEFA 3HI1B 1C12B 2KZ1B 4WQOA 1NGYA 2XWBA 3P02A 4LVHC 3MBXL 3S9DB 1Z9SB 2JQAA 4K3EL 4YN3A 3ARFB 2XWXA 3VXMA 2HVKA 3FU3A 3KXFE 1KEGL 5ID1B 1E8WA 2YAHA 3LNIA 3L2LA 4WK4B 4DP9X 3TIDA 5A2KH 2VZTA 2NXZB 4LLQA 2J8HA 3C60C 4P3CL 1DFXA 5C0GA 3MJ9A 2ZD0A 1A4AA 1EX0A 3U30C 5EOCH 3HS0C 3RU8H 4XBEH 3QWRA 4XNMB 1KBWA 5I1JH 3DYPA 4JDTL 2FHBA 5E5RB 2ZKHH 4HKXB 3BVTA 3CK0L 4M8QA 4GBXA 3CPLB 1UACH 4GQ9H 4JN1H 1QFPA 3KLSA 1CGUA 3LZFL 3VXUA 4TVPE 4J3OD 4MD5B 4X5WB 5DS2A 2C9SA 3C9NA 3GSOB 5BS0A 1TR7A 3QQXA 1JRHL 3VH8B 5B7EA 5DD5H 5E6ZA 4IGBA 4ENZA 2H3XC 3W81A 4HA1A 4BDVB 5L88L 2C3XA 2A6DB 4HK3N 3DX7A 4YQXL 3QCVL 2YBRB 1OTUD 4A2FA 4UCFA 5KSVB 4AIOA 3UBGA 3ZZSA 4CC1A 2AXFB 2HVJA 4WW2A 4AIXA 5HVHB 1XBRA 2WANA 2MRYA 4RIRB 2WQRA 5I0XA 4Z7UA 3WJMA 4TOYL 2D03H 2YGVA 5KVGH 4J3XA 4MQ7A 2AEQL 3RYMA 2AHIA 2HH0H 4M6OL 2WQXA 1AS8A 2I60H 3TZVB 3WU1A 3RWDB 1R5WA 5AVTB 4ODUA 1NBVL 4YDLB 2F19H 3GM8A 4WHTB 4Z76A 3ARBC 1L9NA 1JVKA 2JV6A 2N1KA 4PJHE 5DEFB 3QEGH 2LLNA 3UTSE 3PQYE 3OMZA 3VWKA 3KLLA 1U3HC 3WIIH 5F97E 4XVOA 2AANA 1WFUA 4XBPA 5GGRY 1WRFA 1PEZA 2PR4L 4U31A 2B16A 4LCCB 1FNEB 3L4WA 2QSQA 4ZRGA 2VR6A 2AJSH 4J6RH 5SWZA 4H20L 5J13B 1WD8A 1JPFA 1F58L 4OZFA 2NZ9D 3UJJH 4MMYB 1OPOA 5ISZB 3WHXA 1HL8A 3ARUA 1YNTF 3FONA 4ZX6A 3DJSA 3QHZL 1Y7VA 5DS8B 4NGHH 4JY6B 5T5NG 4XP1L 2N56A 3MCLH 1F18A 1JE6A 5DK0B 3KWWB 4E5XA 3FQWB 3PWVA 3P0VL 1X4ZA 4D3CL 4FABL 3WYRA 3OMNB 4DGIL 4YAQB 2GJJA 2NZ1A 4QRPE 2XY2A 3QUKB 4MHHI 1ED3B 3GJEB 3L6FB 1UYWL 3QIBD 2XPYA 4ZO6A 4Q0XL 2R69L 4M8VA 1P7KA 2DJUA 4GT7A 4NZ8A 5LQBL 5F1SA 2WNGA 1TYRA 1JD7A 3LEXA 2JJUA 1FIEA 1HQ4B 1KT2A 1K4CA 2DF3A 5IW6A 3QUMB 3VFGL 1MFDL 4G71B 5GRUL 4CC4C 4I0KA 2CIIB 2VSCA 5FGCE 2Q3AA 3EFDH 2JK5B 3MO1A 5AW9B 1HZHL 1TETH 1AZZC 3RNKB 4AIZA 3MUUA 2OP4L 1UM5H 3FFCD 4R2GD 4X6CA 3L9EA 5AKRA 4FXTA 4LSVH 3DX6B 3LVTA 2DLTA 1BOGA 1XCQB 4X9YA 1X5XA 1IC0A 3OGCB 3SOBH 5BUAA 3RDJA 5T1LA 3O6FA 5G5DA 3SJVD 1U8KB 4U49A 3E1F1 1G7MA 3UMTA 3IK2A 1OQOA 3QQNA 4N4YB 4RMBA 4KKCD 3FO2B 4XVTL 3V0HA 4UOW0 3P9WB 1D7BA 1MCPL 4WUUE 5GZOC 4XNQB 1CQYA 4OFIA 3TOPA 1I8KB 4DAGH 3NH7L 5I6PA 3J7HA 4FYTA 2X2JA 4WY7L 1R75A 4PREA 2BSCA 4FG0A 4BD4A 4ZODA 5F1KC 1OAKH 3G6JA 2A4ZA 3B3IB 4D9LH 3EH5B 1OZTG 4RMRA 2EC9T 4LVNC 4QCIB 5DZNA 3TCTA 4P5RA 4GRLC 1ULVA 2PW1A 3QORC 4FFVC 1TQCC 4ZQKA 1RUML 5MEPA 1X4YA 2GUYA 4MNGB 4MNQB 4P2OB 4XCNB 1WBYB 4R97C 1T5XB 5IVXE 4Z5RB 2X7LA 4U1MA 1KGCE 3O2DH 1XCWA 5CEZD 1XSKA 4PRPA 1ROWA 4U6YB 4ZD3L 1K8IA 1Q9KB 3D1MC 2E3VA 4RFNC 4D9RD 1D5IL 4MJIA 1P5UA 1T66D 3KMDA 3RUGA 2BY3A 4DJMA 1WH0A 3IU4H 3EFFA 1WSST 2Q7YB 1C5CL 1OTSD 4O02B 4YHNA 2JTDA 4GUPA 1RL1A 1K4DA 4FLSA 5BOZG 3HC3L 3MUGA 4XP6L 2R8SH 4ZTPH 2FD6L 2AQ1A 2V3FA 3FB8B 2HB0A 2OMTB 2VXSL 5C0AE 3ZGIA 1NM9A 1D2PA 3CN0A 3B9KA 1NGZB 4CMMB 2PXYB 2JI1A 2VDNH 1GGCL 1TNNA 2FJGB 1I7TA 4FERA 4LKXB 1C7SA 2GCYA 4FNSA 2BXYA 1JZDC 2FWOA 2VSKB 4KRPB 1PZ5A 1ZA3B 3HNTL 4NI3A 3NEXA 4NRYA 4L37A 4XCCH 2YD5A 2NOYA 1GSMA 3N44F 5AENA 3HC4H 4Y4HA 3TV8A 1GZQA 1VKXB 1KGXA 1AGCA 4R5VA 4F2EA 4Y2DB 3WY2A 4EN3A 3VSQA 5IB5A 4RQQA 1U8LA 3SPCA 5I1EH 4ZZFA 3HI6H 1JGUL 3RBSA 2HWZH 1ERNA 1IC1A 4KNUA 1FFRA 2DIJA 5IB1B 4BBWA 1BZ9B 3NVQA 2J8OA 4P9MH 4PJEA 2OM5A 1A4KB 4NUJA 4YWGH 3VM5A 3FTGB 3PWPE 1R0AL 2E76C 3RHWF 4X50A 3VRLF 2X4OB 3QQDA 4F5CA 1FFOA 1FYTD 3H3PH 4UYQA 5L2JB 2V17L 2D9CA 1SDDB 3VFVB 3X11A 1NFKA 3V5DB 1Y18B 1CB4A 4AGOA 4KI1A 4KY1L 2QKIA 3NT0A 1IBZA 4I9WD 2PPDA 5E1AB 5DGRA 3KJ4B 4PJDE 5GGSY 3M7OA 1A7OL 1E2ZA 5DRWA 3SQOL 1OEZW 3E6HA 1NDMB 4JREB 4KQ4L 5F0JB 3OM3B 3P9MB 2W95A 1L6ZA 5D72H 3UPRA 1BPVA 1NA8A 4HDIB 5I5MA 4Y19D 1ETJA 2WAHA 2GJ6E 5KW9H 3KWVA 1AXSB 1INQB 3K2MC 2CR6A 1VEOA 2LU5A 4V1DE 5TF1H 5HHXH 2A1WL 3GXNA 2W9EH 5HYQA 4RZCB 2EEAA 1N10A 2OR9H 5FUZH 3FB7A 1QO3A 4JL1A 1MHCA 1D5MA 1YEFL 1ZXKA 4N0YL 4C58B 5IWLC 4BSWB 4X4YA 1IAIM 3LN4A 3BVVA 2WLLA 3QG7L 5HSFA 1AOZA 3QJHA 1CCZA 3K0YA 3PLYA 2A4CA 1U8CA 4DH2A 5D2LB 4DKAA 4TUKL 3BEWA 2HFFA 5LXGH 3F12A 1HOEA 4ZFOL 2UWEE 3DMMC 4G70B 1OB1B 4R0LA 1ONQA 4ODTL 4U3HA 1TKWB 4PJ7E 1AHWC 5TQ2H 5MP6L 3ARGC 4PWGA 4IBZA 4LSUH 2DBLH 2ZOKA 4RWYL 1AMXA 2MPAH 2IVFC 3L3KA 4EBQH 3OJMB 1BAGA 2DWEA 2GB2A 3PGDB 4QHNA 5B21A 1DEDA 3Q1SH 3QZWB 2A83B 3KE0A 3L8QA 4WW2F 3SD5A 3SKMB 5D71L 4YC2C 4JAMA 1EEZA 4HG4K 3DSFH 3KCPA 4IU2B 2XXFA 1A1OA 3EO9L 2RAMA 3TO4B 4Z7UF 1D7CA 4JFFE 3WFEL 1I85C 3W0WE 2BWIA 3T04D 2DM7A 3MLVL 4Q9RL 1NBCA 1HHKB 2G60L 2WZPA 1SOKA 3Q2LA 4PLKD 1JPSH 3ME0A 3QEQD 1U3ZA 1G7LB 4DKEH 3GS7A 1LP9A 4FQJL 1ZV2A 3N1MC 3N9GH 1KNOB 4A2EA 2WLMA 4IHOA 3K91A 1G7IA 4ONHB 4P48A 5IBLC 5A2AA 3TT3H 1SEBA 4BA0A 5C09B 3FKUS 5E8NA 3LPGA 4M7LH 1WUNT 5FYKU 2X88A 3RQ3A 4C4UA 1C12A 3QPQD 1MCOL 3DDGA 3I2CL 4R4BA 1BYPA 3B6SB 3EADA 4J1UB 4XXDB 1M1SA 2Y7SA 3ARFA 3TPUB 4XB3A 3TEUA 4L3AA 4UZGA 5ID1A 4JB9H 2XTJD 3RVUC 3E3QC 3GMNB 3ZE0E 3BP5B 1U8JA 4Q6YA 5AVSB 3MACH 4N9GB 5DC0A 3A5VA 4M1GH 3PAYA 2UXGA 1ZHKA 5EDSA 1QLEB 4ODWB 4LPYA 4XNMA 4HK3J 1BJ8A 4L3ED 1I8LC 4HKXA 3CPLA 3OAZH 4XCFL 4F2MB 1AYRA 4DVRL 1FZOB 4FCHA 2I7OA 2B9AA 2VDOL 2RA1A 1YECH 4FNTA 4MD5A 4X5WA 1ILSA 3DVNB 4MDJB 3GSOA 4G7QB 5FYKL 1N7MH 2P5WB 3EAKA 5EC2B 3VH8A 2PNDA 1A6WL 4U1SB 4H8WL 5DT1L 1KFAL 3EOAB 4Y4KD 1H3WM 4OVVA 4BDVA 1NMAL 1UD8A 2A6DA 1A22B 3BPOB 3QQ9D 2ZKMX 4UT6H 3W9DA 2YBRA 4TUUA 1PY4A 5KSVA 2NY3C 3APDA 3GLAA 2AXFA 4MD4B 5B7MA 3JUZA 2AJUL 1B4JH 4X6CF 4YVUA 1ITBB 1G7HB 3Q6GL 4N9OB 4XWGL 4RIRA 4MASA 4MLIA 3ZO0A 3NIFE 2J55A 4X5QA 3CXHK 3C5JA 4YSPA 1QPPA 4OD3H 4OZ4B 3FAWA 5B4MC 3PWUB 2LVEA 4FNRA 3VX1A 3ZL4L 3VNYA 3HPLB 3OLIA 3RWDA 3Q9QA 4LSSH 1HHHB 2Z7YA 2ZX7A 1JK8B 4WHTA 4AE1A 4BXVA 2MTAA 3F7VB 2QTVA 4NPKA 5DEFA 1NPJA 1IEBB 3RVVD 4GS7C 3L48A 4F33B 4YO0B 5IHUL 2E6PA 2ZKWA 5K1NA 1EGJA 1KCVH 4AM0B 3BUPA 3QQ3B 5I26A 3D05A 3T1FB 4A7QA 5T33H 4Y4FD 1YYLL 1AQ8A 1HIML 4HGWB 2BJMH 4WZ9A 3MNMA 4LCCA 1OSYA 4NQVA 1FNAA 1FNEA 3G6JF 4YXLL 2AMUA 1A14H 1NKOA 3V55A 1JZFA 4JHWH 4MMYA 2DYPB 1KCBA 3S8FB 4TRPL 1RD6A 5DS8A 5F7DA 3MJ7B 2IPTH 3TBYB 4JY6A 3GXIA 2HXAA 2WXLA 3AREC 1U36A 1Q38A 4LLMB 3WO4C 3MV9E 1TENA 4IKNA 3FUEA 4ZYKB 2R15A 5DK0A 5JW3L 2NPLX 2X0WA 3KWWA 4TVPL 4FI6A 4XC1L 4DPRA 3WDIA 2E7MA 3DBXB 1OCZB 3Q8FA 4YAQA 3KVDD 4HG4J 1XH3B 1R19A 4K7PL 5KVFE 1GYUA 1FZMB 3T0ED 5LGHL 2WXFA 3QUKA 1AQKL 1KIRB 3GJEA 4OH2A 2G75A 3L6FA 3K5SA 4AEHH 2OZ4H 3LNHA 2NT0A 4DEUA 1CD9B 2AP2A 2AV1A 2M26A 2Z6FA 3NP4A 2XA3A 2WK2A 1MRFH 4GG8B 5EU7C 1HQ4A 4YSTA 4KX8A 1RZQA 2CIIA 2CDEB 1XIWD 4PJXB 4AEEA 2XZAL 2UYLB 2FHFA 2JK5A 4IJTA 2VLJB 2XWTB 5INDB 2QL1A 3VFTB 2DQJH 3IU3B 2R83A 2H6PB 1AR1B 3M17B 3ZE1E 5C3LD 3DX6A 2IANB 4KVCL 3B9EA 1XCQA 2CJUL 3CX5J 3EF4A 3OGCA 3TNMB 1EDHA 5FHAL 1A6AB 1KGYE 4IJ3C 1PIGA 1A9EB 1U8KA 3OKNB 3QXDA 4WIQA 5DVNA 4CAGA 4F3FB 1T83A 4K7FA 3IGUA 2N3JA 4GBXD 3FO2A 3RWJB 1JZGA 4XMVA 2WNWA 3TONA 1WS7A 2Y3AA 1V5JA 2NUPA 2JKNA 2MFNA 1EAQA 4Y2NA 2WCPA 3A3YB 4XNQA 2FLBT 4N3TA 2NY0B 4BFGA 5BS0D 2VLKD 4GO8A 2ZIDA 1R3IH 4S1RL 3AM8C 2YPLD 4IGBD 1TCRB 1PD0A 4PJEF 3CHSA 4ACTA 5LLIC 1Z32X 3EO1A 3LQMA 4M5YL 2XCMC 4HC1A 3EDDA 4YDKL 4BZ2H 3B3I