1JK9A

Heterodimer between h48f-ysod1 and yccs
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
153
structure length
153
Chain Sequence
b'VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIFEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords superoxide dismutase
publication title Heterodimeric structure of superoxide dismutase in complex with its metallochaperone.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 34
structure length 153
sequence length 153
chains with identical sequence C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1jk9A00
3ECWA 1EQWA 1SXSA 1HL4A 3CQPA 3KBEA 1BZOA 4OH2A 2WWNA 1OEZW 1RK7A 4A7UA 2WKOF 1PZSA 2V0AA 2XJKA 3HW7A 1SDYA 4MCMA 1PU0A 2WZ0A 2XJLA 2C9SA 2WZ5A 3KH4A 1BA9A 2C9VA 2AQRA 3GQFA 1Z9NA 1HL5A 1JK9B 1E9QA 1E9OA 1U3NA 2E46A 2ZKWA 4U4IA 3ECVA 1CB4A 1N19A 4OJAA 1FUNA 1YSOA 3GTTA 3L9EA 1PTZA 2AQSA 1OZTG 1SPDA 2VR8A 4A7GF 1UXMA 1TO4A 2WKOA 1TO5A 3S0PA 2AEOA 1N18A 1OALA 2APSA 3K91A 2VR7A 1B4TA 1S4IA 3PU7A 1SXNA 1SXBA 3SODB 2Z7UA 1E9PA 2AQNA 2WWOA 4L05A 3CE1A 1L3NA 3KM2A 1DSWA 3QQDA 3GZPA 1COBA 3GZOA 1SXZA 3RE0A 1YAIA 1KMGA 2WYTA 1SXAA 1IB5A 2E47A 2R27A 2GBTA 4N3UA 1QUPA 1OZUA 1JCVA 2Z7YA 4A7GA 4BD4A 3T5WA 2AQTA 1B4LA 3MKGA 3F7LA 1F1DA 1Q0EA 3MNDA 1IBHA 1E9QB 1F1AA 4BCYA 2JCWA 2C9UA 1XSOA 3KM1A 3LTVA 5KBMA 2AQPA 2ZKYA 1EJ8A 2WYZA 1SRDA 2ZKXA 1IBBA 2JLPA 3F7KA 1ESOA 3KH3A 1SDAB 3L9YA 1F18A 1OAJA 2AF2A 3CQQA 3KBFA 4BCZA 1JK9A 2SODB 4A7VA 1SOSA 2K4WA 1YAZA 5KBLA 4A7SA 2LU5A 5CU9A 1E9PB 2GBUA 1AZVA 4A7QA 2Z7WA 1SXCA 3QQDB 1E9OB 2AQQA 2VR6A 3ECUA 4N3TA 1IBFA 1Z9PA 1UXLA 3H2QA 1DO5A 3GTVA 4MCNA 4FF9A 1XTMA 4A7TA 3HFFA 1P1VA 3HOGA 1F1GA 4B3EA 2NNXA 2WZ6A 1MFMA 1XTLA 2GBVA 2Z7ZA 1CBJA 2ZOWA 3H2PA 1IBDA 2Q2LA 3GZQA 5KBKA
chains in the Genus database with same CATH superfamily
3FQWA 2F7OA 3ECWA 3WG7B 4UNVA 1KIPB 2VN6A 5FYKD 1FYTD 4JGJA 4OFQA 1HHJA 5CM1A 5IREA 3WO4B 5I9QC 1S9WB 1MRFL 4P4RB 2YFOA 3HE7D 3VFUA 4JO2L 2YWYA 2Q3AA 4HD5A 3ZU8A 5HI3D 3LNIA 3Q2VA 4XPGH 5B39A 3QUYA 4PREB 1XCTB 1X5GA 3T0AA 3VMOA 1A4AA 5AENA 4F92B 4Q9CA 3EH2A 2VJXA 2GYSA 4Z7VA 4DN4L 3ARUA 4P5TA 3M88A 2VSKB 5BVJB 3C5ZD 4QF1A 4HS3B 3NYKA 3D51A 1G7LB 5FYKH 3LVTA 4TQEH 1CXIA 1RIHL 1XZ0B 2G75B 3W9EB 1A4KA 4LEXH 3VRJB 2HXAA 3FT2A 2CRMA 4MAUL 3LPFA 2G60H 3WJJA 1PG7L 4H0LC 4ETQA 2G5UA 3DTXA 4X7TB 4DQOH 2Z3FA 1AKJD 2W91A 5C09A 3WNOA 2XETA 4Y9EA 4PR5A 4N8PA 1QO3A 3MNVB 5LCVL 2CDEA 3LIZH 5ESQB 3MLYH 5E99H 2WZPD 1MCSA 5C0IA 4PBDA 4L9DA 1XB8A 3KDMB 3SSGA 1IBHA 3VA2C 2ITCA 4TUOB 5H4YA 1FFOA 2OXHA 2B14A 3GXMA 1JZ3A 4JFOA 1E27B 5BNXD 1S8DB 1RIUL 2EJ1A 2R7EA 4JDVB 4LSQL 4XMKL 3LZNA 1Q0XL 3ZJAA 4TUJB 2DM3A 3HPJA 4ZSOE 5I1LA 2XTJE 1T4WA 3EYQC 2YD8A 5DMIL 1MF2H 5GS0L 1E28A 2R69H 3V4VA 1MAML 5IBTH 1A6TB 3BXNB 4BINA 3RVTD 2IALB 2VDNL 5GQBA 1CGVA 5A3IC 2NUTA 2D7QA 2XWRA 1X3DA 2GJZA 1NC2A 4RFEB 3O3AB 3W37A 3CZKA 4W68A 5I30L 4L8CB 2OW6A 4AUUA 2Y25A 1PAMA 2Y7QA 4U7KA 3SGDH 2F54E 3IDIB 3VGAC 3FO9B 3F8UB 1RK0B 1OP9A 5CMAA 2NT1A 3NZ8B 3QUZC 4PPTA 4AX3A 3H7LA 4DTGH 1B9KA 3IBOA 1MLBB 4KPHL 4XZUB 2BXZA 2WNGA 3WJMA 4G43B 2ICWJ 4P59H 3ABKB 2QQNH 2XDHA 1KB5H 3GBEA 3V10A 2BP0A 1I1RA 3DV4B 3S4SA 3ARDC 5FECA 3P73B 4BA8A 5HYSB 3WBDA 1EZVX 2EABA 4RWYH 5TJWK 4FAAB 1VZIA 1YSOA 4WUKL 2FYYB 3BAKA 1MW2A 2PTVA 4GUOA 1ASOA 4DGUA 5L0QC 1CLZH 1BGXL 1EO8L 4EO5A 4XN1A 5EU5B 5GS2D 1C8QA 1JPTH 3TO4B 3HC4L 4DP9X 1UD3A 2EDMA 2DJ4A 4B9YA 5KSAC 2H32B 3UOAB 2PPEA 4LOEA 5FKPA 4WUUD 3B2UD 3N91A 1J8KA 3C87A 1IGCH 2A77L 1KSRA 4HQQL 4XRCB 2WNWA 2ATPA 5F1NB 4XVSL 4K71C 4AQ1A 3LQMA 1T0MB 3GXPA 5FW7A 1S7SB 5C6TH 3GJFH 3WXWH 5L8KB 4JGUA 4AJ0A 4K7FA 4LMQE 3FRUB 2MKLC 3D3VD 4APQB 2EC9T 3L1OL 4NQEE 3OQ3B 1OGAB 5CN2A 3QO1B 3VXNA 4L1SA 1D7CA 2V2XA 1U8HA 2VLKB 2JCCE 4L8BA 5G2NA 2JI1A 5KVGL 5BJTA 3BEWB 1EO7A 4ECNA 5E6ID 3GTNA 5DJXA 5T1DH 4C58B 1EJ8A 3DIFA 2XTSA 3CX2A 5MENA 3D39B 5IK3A 4BXVA 5KZCD 1SDAB 1QP1A 3B5HA 3IWVA 1UWGH 4U7SA 2XQBL 5F1IB 5JIHA 1BIIA 2HJKA 4KTEH 1N0XH 3WE6A 4HIXH 3FTWA 4EI5A 3D30A 1HSAA 3KJ6L 2Y5QA 4P2RE 3T0EC 5D7LD 3ZKXB 5KS9A 2OMNA 3TTYA 2V17L 3I9IA 2VISB 4FQXA 5EBWB 4IIQA 2OP4L 5DURB 4MQ7B 2FUQA 3U4EA 4N3TA 4D8PA 3MZGB 5HGAB 4PU2A 3BSZL 4KRNA 3POCA 1L0PA 4XNQB 1BIHA 3JQOB 3UTQA 4IBVA 2A0LC 2PP8A 3C75A 3MREB 2X4PA 4I3SL 2FECL 5AUMA 5I0XA 1AD9A 1MWAH 3GDBA 4Q2ZB 1T04B 2P5PA 5FA4A 4QAMB 2XQYK 3MOBL 3T2QA 3K6SB 4ZW7A 2DQTL 2QVIA 1DBBH 1JUFB 3UROR 2P47B 3RVVC 3QHFH 1UC6A 1N64H 3MNZB 2R0ZL 1YEDA 4IK6A 5E1HB 3L13A 5H37G 2O5ZL 2J21A 3GM0A 4X8CA 2QLVB 3WAKA 2DMCA 3L4ZA 1LVEA 1PU0A 3FQUA 4NOFA 3VH8A 2NY0B 3R1GL 5I6LA 4M3HA 3CCHA 3CVHH 4JDEA 2SEBB 4OVUA 4NQCA 2VLJD 4TL4A 3C08L 1H9DA 3GBDA 2PWEA 5DD0H 5I6MA 4WW1B 3W57A 1XCWA 3GHEL 2GSMB 2O6DA 4PB0H 1OGTA 3GSUB 3LB6C 5JQIB 4Q9QL 1FFNA 2H3KA 4OSUL 1T1YB 1EJ6A 3SGKA 4S1DD 1CE6B 4P3CL 1R5WA 4LASH 4UTBL 5FW8A 2PABA 5ANMB 5LKNA 4ELDA 3QUXA 3UGEA 2OJZL 4WEMB 3B2DC 1FGNL 4HZ1A 3L16A 3MCKB 2VL5A 3NMEA 1JZ4A 4Z76A 3HVDA 1MHHA 4HSAC 4L3CB 1M1XA 4OVVA 4X5LA 5FC9A 4DEPB 4HJTA 4NPJA 1SYSA 3FUHA 5JOPE 2DQGH 4TSBL 5LAPA 4ZXBB 1QVOA 2X0WA 4JO8A 3B2XA 1IAKB 2Y3NA 4RQQA 3VI4F 1JDCA 2P8LB 1A6WH 2XKSA 1JCVA 4FFVC 3VI4E 2RB8A 4WI4A 4N68A 1KNOA 1JHKH 3G5ZA 4X0KA 3NEOA 2BRRL 5J9PA 3TASA 2IH1B 3WFBH 3O9WA 1K8IB 5KSBF 1R17A 4PWJA 1YPZF 4UIMB 4P5RA 4TOYL 5KSBE 4FQ2L 1YPZE 2ICEB 5DD6B 3L95B 5EN2B 3MLWL 1JF5A 5HYEA 2WNXA 3EADA 2JQMA 3D0LA 1DE4A 3RGHA 1S7TB 4KC3B 5DK2A 3TN0C 4K2UH 4X9FA 4ODHH 2DL9A 3NABL 2VDPL 1I53A 3UTSA 4A7SA 1U58A 4ZPVA 5FDYA 2B4CC 3O2DH 3WEXB 5JQ6L 5L88H 2BP8A 3PGCA 32C2B 3C8KB 2X38A 1UWEL 1ZIAA 2LTQC 5DUPH 4HIEB 5EZOL 1UG9A 4LSVL 2OMYB 4NQDD 5HD8C 3LNFA 3PWJB 1UZ8A 3EYUL 4NZUH 4WSJA 1E4XI 3L5IA 4ZTPH 4ZYKA 4JHAH 4WQOA 2YEZB 1VGKB 3VXRA 2ARJQ 4ZAKA 5JW5B 4I18C 3JZYA 2LQRA 1NDMB 1PYWB 1OAZL 2CM6A 3EYQD 4PJGA 2ZUQB 4B53A 4AQAA 4KKPA 3DWTA 5D2LA 1KCVL 1L0QA 1TVHA 2Q8AL 2JLLA 4IOSA 1A1MA 3UJTL 4CRPA 2NT0A 4JM0A 2K6WA 4Y5XB 1XBRA 2MHAB 5A3ID 1GCYA 4Y1AE 3QUMA 3VGHA 1Q9KB 5DJCB 1ZRUA 1KGCD 3A6CH 3CSFA 3WS6C 1CYWA 4YNYB 1FZKB 2W9EH 1SQ2N 5HGBB 2G5BB 4OM1L 4DAGL 3JVGA 3BUQA 4XO9A 2QZQA 1XEUA 5B1BB 4WU7A 2NXZC 2WLIB 1WJ3A 5F7LB 4EDWH 4Z1PA 2EUZA 1NLBH 1B4JH 2YIHA 4GFXA 3QIWA 3U2JA 4D2NA 5F7DA 1J48A 4MDJA 1EEZA 4V1DE 2YQBA 5CKAA 3QUZD 3DMMC 1AS7A 3SODB 3QCTL 5SWZB 4AM0A 1T7WA 3ZYIA 4JNXA 4OTXH 5H94B 3ESUF 4BFRA 3VFTA 5GZOC 3W56A 3ARDD 4L8SC 3RE0A 2AKRB 5LXGL 4KJQC 4DP7X 3D0VB 1ORSA 2CHXA 1CGWA 1OZUA 5CBAB 2OX5B 2XG4B 12E8L 3QQNA 1NBVH 4F5CA 4IRJA 5I6KA 3QWQB 3FQNA 1CN4A 1E5YA 5FUCE 5JUEL 4OFVA 5SWSE 4IHOB 4ONHB 5GJTL 1S7UA 1MJ7L 2EDKA 2WLYA 4G8FB 4R3SB 1AYOA 2NXYC 5ABAA 1UKSA 3MV7B 5KSAD 3ZHNA 5ACMA 2XVGA 3SE6A 2NTFA 4JS7A 5EIIB 2C1PA 1CG9A 1I9RL 1ETJA 2EUXA 5KEZA 4F8NA 3IXTA 2V9QA 4XC3H 3L1GA 4G9DA 3ZDYF 1HL8A 2CA4A 3MUJA 4IIZA 4KVPA 3VGGA 2HYMA 2VRQA 4DK6A 4WW2A 1E9PB 1H15A 3ZDYE 2ADFH 3MLXH 1RZGA 2X4NB 4OKVB 3MV9E 4G1EA 5ISZE 4X4XB 3B83A 1E3FA 2BSRA 3H56A 4JQIH 3MBXL 3FN3A 3K4ZA 5DQDH 2OMZB 5D1XA 3NA9L 3BZ4A 3K1KC 5MEOA 2WWKT 4Z23A 3OLEA 1PX4A 4FE9A 4G70B 4HWBH 4N0UA 3GO1L 3ISWA 3VCLA 1IVTA 5D8JH 5DRWB 2Q2LA 3NSFA 3EUUA 4TN9A 1CFNB 4IKLA 3GLEA 4U1MB 1MNNA 3UIZA 3FAWA 1QUNB 4N2BA 3L8QA 3U1QA 2W0LA 1QLEB 3OMIB 1P7BA 1LDPL 3BEVA 3CC5A 4IRSB 5CN3A 5IB2A 5GIRA 5IB3A 3T0ED 2ZOOA 1DEEA 4FNTA 4ES8A 5ECGA 2R1XA 1KB9K 1FE8L 3IF1A 4UUJA 5I1IL 2DDQH 1SOXA 3ZGIA 1YMMD 3CX5K 3ATBA 1FZOB 4NO0B 1UZ6E 5D2NE 2X0VA 4E5XA 3CFJB 4ZX3A 1E9OA 1HJCA 5HHOB 4FRWA 4E2OA 2A0LD 2NZ1A 4OV5A 4M5YH 3RNKB 4PP1C 3U9UB 3VWKA 1QRNB 3WTXA 1S5IH 4KY1L 3R0MA 3W39B 5I15L 3GI9L 4L3EE 1I7ZA 2ADIB 5B38G 1XX9C 4J3XA 2XG5A 5J4MA 4JRXB 3IMVA 4POYA 4ODXB 1OCOB 3RVVD 3KXFE 1L9OA 4MTMA 3AG1B 4NKIH 4G5ZH 1EBPA 4NM8H 3RB5A 2G2NA 2BDNH 3QFJA 4WTZG 5JMRA 4JFPA 4KTDL 1MPAH 4JG1L 4LVOC 1ZOXA 3FQ2A 3HZYA 1KENL 3MBEA 3NZHL 5GXBB 3CH8A 2QGDA 5E8OA 4TLKA 3SDCB 3O3EB 3FQXA 1BWMA 1F11B 1ZVSB 2IAMC 4HS8H 4H1LH 4U0RC 3WU1A 3O4LD 2MFNA 4FFZA 2ATKB 1ND0A 4UQ3A 5D5MB 1L9SA 3LB6D 4ATWA 1SHSA 3DX8B 3EDFA 4NFBA 3Q8AA 4Y8AA 3V0IA 2E27H 1TQSA 3B4NA 4I9WD 4QRPE 4YGVA 4HLEA 4I2XE 4H8QA 3LD8C 2XA3A 3I6KA 5E70A 2A4CA 3CZUB 2HG5A 1KYUA 2QHLA 5C0EA 2IPKA 3VGEA 4N0FA 1CGUA 2ZYHA 3OC8A 3P3RA 1KUMA 3VXSE 2Q6WA 4AMXA 4E41B 1XEDA 4IU2A 4ODVH 2V2TB 5JLZA 3ZRCC 1Z9LA 3WTWA 5E23A 5E4AA 1KBWA 4HWEL 4Z3JA 4YUEL 3DSFL 4FFVD 3WFCL 3NJNA 3QIUB 4BZ2L 3CK0L 4M1DL 3I6LD 3NJIA 3SDDB 1P5VB 2KC0A 4R84A 4JHVA 4F7CA 4LKCB 1IJNA 1ASQA 1D9KA 4QXTB 2HKHL 4IJ3C 5HYSG 1JSYA 3VFRB 2WQSA 3CXHK 2I60H 3DIDA 2CBOA 4GAYB 5I1CL 2Y06L 4MWFB 5DEFB 3TN0D 5T1LA 3N44F 1SLXA 5EUOF 3WKPA 2H2PC 1NL0H 3MJ9H 4Y2DA 3VXUB 5BVPH 4G8GA 1RZ7H 3RJQB 4YHIB 4LP8A 3EYOA 1AQKH 1IM3A 5EC2A 2VXVL 3UYRH 1BLNB 2LE9A 4BQ9A 2MNUA 3MRHA 2AMUA 3CBJB 1QASA 3IFLH 4HS6A 1I9IL 2OS7A 2X6MA 4GRMA 1TZGH 2FD6L 2X1WL 1JF1A 4X4YB 3BE1H 1OCZB 4DOHE 3S5LB 1X6LA 2G4GA 3MV8D 3PWLB 1GMIA 2HRHA 2WWKO 2XQYG 3TH4T 3WFDL 4PRID 3MJWA 3ARSA 3ETBJ 5IT2H 5HD8D 1R3JB 2FGWH 4AEEA 1OB1A 2PYFA 3U82B 3GSNA 3QIBC 4GI9A 5B1JC 1ZA6B 2HVJB 2WQVA 5FYJL 2CDGB 4P2CG 4TUUA 4GXFA 3DX6A 4BFIB 1UH3A 4HK3J 4PRHB 3BI9X 3WN5B 5KWYC 4XPAH 3ZTNL 4ZO9A 5ADOH 2B4CH 2WY3B 1FJ1B 4MDRA 3EGSA 1AMXA 4BWUA 4Q0XH 3ES6B 4H8PA 4M03A 1PKQA 2BVTA 1MW0A 3DOHA 4OAWB 3UC2A 3TA3C 4G8EA 4HISA 2V9RA 4WCYH 3ZDXB 1M7DB 1N2RA 3HS0B 4WKZA 3K72A 1NPJA 5CIPA 5LGJB 1L4IA 2V7NB 4RMVA 4YDIH 2NXZD 2BOCB 1PFCA 2CLRA 4LT7A 4NQTA 2YN5A 4GUPB 3K2UL 5F2FA 1MJJB 1YEGL 3DBSA 1EFXD 2A3TA 5IB4A 4MMXC 4NO3B 1S9VB 3VUAA 3UPAA 4QOKB 4WWPA 3RIAF 1A21A 1QNIA 3DMMD 3HUJA 1J88A 3RTQC 1BM3L 3HS9A 4PRPA 1IFRA 2X2YA 4XAWL 2Y5TA 2R2EA 1H8LA 3PHQB 4F7PB 1I8IB 1LDSA 1QATA 4O2CA 3N85H 5GZOD 1OSZA 2ZWYA 4PWIA 4LLYA 4KJQD 4ZRGA 4ZUSB 1UKTA 2ENPA 3TBWB 4K5NA 3LZFH 4XOBA 2CO1A 2ZG2A 4MNQA 3L9RB 1IAII 2VUYA 5BRPA 5E5RB 5L4FA 1AXSA 3AZUA 3S3SA 2FX9H 1RZFH 2XYBA 2YD2A 3VXQA 1CICC 2ADGA 4XNDA 1KCUH 2H8PA 2NXYD 5KYUB 3GSRB 3QNYA 4BZYA 3DX4A 5CEXA 3AXHA 2P8MA 5DC2A 3FB5A 4JFEE 3I75B 4IKNA 5L2KA 4RBPK 5CHNA 1AGDA 4YLQT 4HIJA 4JZNB 3EBIA 2WVVA 4JRYE 4BZ1L 1BQLL 4FNSA 2PUQT 1HCZA 1UM5H 2K9UA 3O3BA 2ZUYA 1HESA 1W8EA 2F61A 1HE8A 2NW3B 4Z3GA 3SYAA 2JMRA 3ILPB 3VD1A 3BRFA 3MRBB 1E30A 2CRZA 4CDGC 2VLRE 4JUSA 1SY6H 3BP7B 3HR5A 5DHYA 3C6LC 4Z0XB 4OIFA 1DSFH 1ZHLA 2A6JA 2YGOA 3MFFA 3NJLA 5E9DE 4WO4B 1E4KA 4PYGA 3KYNA 3ML9A 1VSCA 1FVDA 4LOUC 3CZEA 3Q43A 3S0PA 4LPYA 4P9ML 1J9SA 3UDWA 1XF1A 4PV1C 4HC1H 4WEBH 1ZAGA 3BDYH 1N7MH 3U0TB 2YA2A 5CJQH 2V7HB 5INCA 1HEHC 2W0FA 5KUMA 2F74A 3CLFH 5TE7L 1CDJA 4QRUA 2X7LA 4DO4A 4HG4K 3BCFA 3CMOL 3MV01 2WIMA 3QG7H 1KN4H 2G5RA 2EICA 2XU9A 1AOZA 1QFWL 4PBXA 3RJDA 5HDBF 4PP1D 1IBYA 5EBLA 2CJTA 5HDBE 4YO0B 5M94B 3TEZA 1F6LL 5D93B 4MDIA 4AXWB 1V8HA 3QHZL 2R0LH 1MI5A 2MPAH 3LKOA 1TLMA 1SEBA 2J7LA 3FTVA 3O6FA 3TCTA 1U36A 4ACTA 2DWYA 3ZE0F 3SBQA 1W8OA 1XGUA 1S7VB 2F19L 5DSCA 1J1OH 3ZE0E 2RHEA 4PVLA 4HJSA 1BD2D 4L18A 5KN5A 3H9ZA 1NFIB 2R4SL 3NTCH 1KYOK 1PDKA 2OSXA 5J6GA 2AXHA 5ICZB 5EN3A 4PJ5A 3CUPB 3DI3B 3MYJB 1Q1JL 1ZTXE 4XTRC 4HZLB 4YX2L 5KG9B 4LARL 1XGTB 2O61B 1U93B 3IAPA 1GS7A 3OJVC 3Q9QA 4FP8H 4PJCF 4MKTA 4K8RL 1M7XA 5D7HA 5AW1B 3SPIA 3TFKC 4KI5C 2BOBA 4QT5B 4JE4B 3GTVA 4PJCE 2XZAH 4HLJA 5EO1B 5E6UB 5PCYA 4YHPA 4NO5B 3WKYA 3ARXA 4KK9C 4C4KO 3GHBL 2OSYA 2AJSH 3QNZA 3DX7B 1LE9A 1AIFA 1A2YA 5TFSL 4R0LC 1BZ7A 3U83A 1YG9A 2COVD 2VXTL 3DYMA 4LSUL 2R51A 3IKCA 1PZ5B 5BZWA 2KPNA 4KVNL 5T5NF 5A2BA 2VH5L 1QLRA 2IGTA 1OARH 3FN9A 4HKJB 3VE0B 2YUWA 2R9HC 4YE0A 3RIKA 1FHGA 1T5XB 3M86A 4X80H 1IBGL 5GGTA 1YY8B 4LCWA 3SOTA 1NZRA 3SB3A 7PCYA 5ESVB 1QWHA 2VABA 4EIBA 3H7BA 1ZKAA 2VCOA 1S5HB 4IRZA 1RULL 3OAUL 2Q0ZX 5TQ0L 1I7UA 1IGMH 3OKEB 4KHXL 4WY7L 1CR9L 3KLAB 5K59E 3SCMA 1OZTG 1D5XA 3LPWA 2B5IB 2PYED 4ZPTA 1RMFL 1TO4A 1I8LA 1TYJA 2DH2A 3SJVA 3UAEA 1BX2B 5C0RH 5JOEA 2H2PD 1MZYA 1NPNA 3E38A 2IPUG 4M48L 3DXAE 4N6RA 3TEUA 3QPXH 3ZE2B 1X5JA 1IJ9A 1RV6X 2APFA 2IOMA 2VTFA 4Y16C 4YC2B 5FYJU 5DJYB 3AB0B 1HCFX 2X4QB 3AT0A 4AL8C 1MFBL 1FYHB 2VDQL 3QPQC 5EIIG 3HG4A 1AC0A 5FO7B 5C6WH 2PETA 2VSMB 3ASWA 1D5IH 5A7EA 3V2AR 4K73A 1PLCA 4O5LH 1I1YB 3HRZB 1JYNA 3GBNL 2HT2C 4HZAA 1TEYA 3QIBD 4TRPL 3DX2A 3LS4L 2XPGB 4JM2B 5MI0B 3DBXB 1DDHB 3H2WA 3S34L 5DQJA 1U8IB 1MJ8H 4XAKE 2QR0B 2H3XC 3N41F 4G6ML 4KUCD 5DEGB 2VZVA 3APDA 4CC0A 5C7XH 3PL6A 1ESOA 2Z92B 3SDXB 1P53A 3VJ6A 1ZGLP 4P2OA 4PLKC 2YPLE 4NQVB 4FJZA 5AZ2L 4DGIH 1KTDA 1KGYE 2DICA 3QQXA 1IQWH 1MHEB 3IFNL 4PJIA 5EBGA 1ITBB 4NRXA 3TA3D 1FFPB 2Y7SA 3HC0B 3IJEA 3KG5A 2KQMA 1TSHA 3PABB 2X3AA 4LEBA 4M7KH 4G72B 3R7RA 4NZJA 1AS8A 4FYQA 3RFRA 3TONA 4AGNA 4PCTA 3CFIC 2OI9C 4W9EC 1DQQB 3V5HB 4AYGA 5IWLA 4FTVA 5C0FB 4NDMA 3N43B 5J12B 5KVEL 3LKQB 3GJEB 3RTQD 1BVKB 1DFBH 3IBEA 1G9HA 2XSKA 3BPLB 3HKZA 4PJHF 4L29B 4NKQB 1AQDA 1V3KA 1WO2A 3QH3B 4UQ2A 1GCFA 5FX3A 3W0WB 1ZHKB 4QRFA 2ZPKH 2RACA 3B1TA 5EIVA 3G6AA 2FEDC 5AB2A 3DGGB 3VYOA 4S1SH 1NC4A 4M1GH 2Z64C 2K8MA 4HA1A 1BEXA 4PJBF 3LNGA 4YDKL 2NX5E 3RWFA 1G7MA 4PJBE 5FFGA 2ZP0T 2X9WA 1M42A 5E7FA 3QYCA 4H40A 4NERA 3TS8A 2BNUA 1NICA 1P4LA 5TDOB 4O00A 3HLAA 4GY4A 3NEEA 1CICD 5FYLD 4FLHA 3CH1B 5EBMB 1I85A 5DJ8A 2F5AH 3QWOA 4OF8A 5F96L 1HXYB 1RY7B 1JYXA 3MRDA 4YDLB 3EO0A 5D1QB 2COQA 2DIBA 1NMCB 2ZUVA 1V10A 2E7CA 3CDCA 4X7EC 3PXJA 3K7UA 1AGEA 3HAEH 4K23H 5J11B 1BOYA 1CXLA 4HWZB 4E9YA 1MREH 2IG2L 4FQCL 5AL0A 2BNQE 2WUBL 4JFZH 4QRQA 4Y2OA 3HI1B 3KL5A 3O6KH 1EXUB 3C6LD 3R7QA 3KPMA 1I9JH 2YPVL 1REIA 1CZ8H 4UT9A 1FVEA 4EF3A 1P84K 5FYLH 2GITA 3ESPA 3LMJL 2WP3T 4JFDA 4Z95L 4WHTB 3QW9A 4LXFA 5LBVA 4L1DA 3KHOA 4WKXA 4ABVA 4WAFA 5IUCA 4Y89A 5DUMH 3OBAA 2P28B 4LOUD 4DVBB 3DA0A 4JFYA 4NYLB 4OCRH 3LKRA 2ENQA 4JHWH 1R3KA 4EI0A 3HC3L 3ZHFA 1J1PH 3EJJX 2CLZA 2LFGA 3LTVA 4NBYB 5DRXA 5DR5H 5EA0L 2J12B 3OF6A 1NEZA 3FRPB 3UJIL 5E1AB 4Y9GA 4YSDA 4AT6A 3G5VB 4G7QB 4L48A 1F18A 2BC4B 1B0GA 3NPSC 5IHBA 4UV7H 4PY7B 1DVQA 3E3QE 4ZOBA 1EEYB 2FX7H 2XOTA 4X7TA 1GA2A 3VAEA 5H37H 5C0BD 1AI1H 3KGUA 2NSMA 5KJ7E 3QXWA 2WXMA 4LIQH 5B38A 2BZ7A 4YL9A 1BFVH 2YRBA 3TYFB 1IARB 4EXPX 3QA3A 4EBQL 4L5FE 4KX8A 4XP9H 4N4YB 3R8BB 4ZI8A 3BGAA 5IROA 4F20A 3MRPB 2A6IB 3CVCA 3U4KA 4HT1L 1ACYH 4XXCA 4FDWA 4WFHE 5JPMA 1C7SA 1PS3A 4PI0A 4B97A 3WEAA 1P1ZB 2XV2A 4ZFZA 2VN4A 4HUNB 4IEFA 4YHMH 3ZYJA 1TFHA 4ZSOB 2OMBA 4NXSA 4LHUG 3HG1D 2E6JA 4RGMC 3IPFA 1P2CB 4XTRD 5AW3B 3T0XA 1LM8V 3QDJB 3GSQA 3GGWB 1KV7A 2C9VA 1BF2A 2OSLA 3V4PL 1KULA 3QUHA 2DJMA 3TFKD 4UQIM 4KI5D 1HEZB 1HHHA 4NRZB 3RHWF 1UQSB 3IDGB 5C9KA 3VVVA 2HVBA 3RVUC 3TO4C 4LLAA 4F37F 1FL5B 2UZYB 3A3YB 3LPGA 3RWDB 4QJ3B 1NCWH 1P7QA 4XPFL 4KK9D 3U9WA 2DF3A 4NZDA 3T0WA 3QEQE 1H0DB 3A6BH 1NAKH 3NZUA 4FNLL 3S5YA 1RK0A 3DHPA 2JNZA 3BPNB 3Q1SL 3FU6A 3WJLA 4WGKA 2KYIA 2X28A 4Q6KA 3P4OB 5DZOA 4ALAH 1AKPA 2UY7A 3D06A 5T5FL 3RA7H 3PUUA 2R9HD 1THCA 4RMTA 1XMEB 4APQC 1GZQA 1EXGA 4Q7DA 5FHBL 1OGPA 2DIJA 2WW8A 1I4FA 4AJVA 4HJJH 2GQHA 3GPEA 2EVFA 4X6CA 5E2WH 3P11L 4ANWA 5HYSA 4GUCA 3KW7A 2EE0A 2W5PA 1F6FB 1S2EA 2LHAA 5I1JL 3IDXH 4ZUWB 1E8ZA 3TIEB 4WUUE 2JXMB 5E2VL 1IC7H 2PPCA 4Z0BH 2EE3A 3BZFA 2XTLA 3QZLA 3HN8A 2WYZA 4G7VH 4DK3A 1A6ZA 1O9WA 1EV2E 1MVUB 3G6JB 3ZVVA 5BO0D 1KEGH 1MFEH 4Y16D 3ZKXC 2VQ4A 5FCUL 4Z7WF 4B27A 3RL2A 4CILA 5HY9B 4Z7WE 2ICES 3L4TA 4WJ5B 4L3AA 4YSOA 2AJXL 3FQ1A 2HFTA 3QPQD 4FXGB 5TQ2L 2BW5A 3UG3A 1YEJL 1T0MA 2O1AA 5C0JA 2YAOA 4WFFE 5EPMB 4ETYA 3DV6A 1O9ZA 5E5UB 3CZJA 4U1KA 2OL3A 5F7NC 1N26A 2HT2D 1DN0B 1K9TA 5TPWL 3AXLA 4NWUL 2O4EA 4NQEB 1XF2B 1AANA 2B0SL 1RPUA 5SX5K 4WWKB 3ZL1A 2UUDK 4OZHF 4X7DC 1LNUB 1UURA 3BEWA 5DGRA 5AAPA 2JCCB 3E9TA 4HGKC 4OZHE 4Y5YB 2DQFA 3A24A 4HHGA 5F1SA 1YYLL 1JZ7A 3T77A 1FZMB 1U8PB 2Z6FA 5D7KD 2DQ6A 3L3JB 3ABGA 1E6OL 3MRRB 3PP4H 1N3NA 4MSWA 4NBXB 4TSAL 3UZEA 4AL8H 4PLKD 2NY0C 3FC8A 3EUDA 3FTYA 4D9RD 1BQHA 1NGWA 3OWEA 1H6UA 2E7BA 2XN9B 4EOWL 5GS0C 1CU4L 3QXAA 1UEMA 5EU6D 4BCXA 1WHOA 1A47A 4FLQA 2JB6A 4OZGF 2CJSA 4X6EB 4DPBX 1E4JA 2AK4A 2W94A 4DUVA 2FQDA 1FV1B 4XPHH 2J6EL 4HUXA 3LEXA 4H26B 4OIIH 4OZGE 4IBWA 4RISL 4XNMB 1RZKH 4HF5H 1PEZA 2JJSA 4GXVL 1UYWH 1YYMH 4Z7VF 5CUSH 1T04A 2D73A 2ZG3A 1CE1H 4YSTA 4Z7VE 1AZZC 4BA0A 4DEPC 3K6SA 3DVNB 3U30B 2VLJE 1QSEA 4ZXBC 4JGNA 8FABA 3MR9B 5IV2A 5CFAA 2FEDD 5KYWB 3MROB 4P99A 4PJ9A 4NP4H 2DH3A 1DVZA 3QQ3A 3BISA 4PD4J 4TMPA 1BF5A 3RNQA 3E6FA 1W0YT 4QO1A 3NIDF 1QZ1A 3UTOA 2VQ1B 2WYHA 2VW7A 2FJHB 2P7TA 3FZUC 1DZBA 5IB5A 3ZOAA 1QA9B 5IIEA 3PV6B 4HUKB 1IEAB 1J18A 3T5WA 3IETA 4NJ9L 4BM7A 4UT6H 2ICEC 4FNPA 2B59A 2IBBA 3F58H 1KTBA 3HLKA 3S35X 5C09E 5AYUL 1F1DA 4JFQB 4XNUH 5D72L 1T1YA 2GT9A 2LLNA 3ME0A 4HU2A 5C8JA 1NEUA 3GRWA 4BSJA 4XNYH 1BBJB 1TVBA 4N0CC 5F8RC 5TH2B 2OR7A 4OLXH 3CZNA 2WTPA 1U4EA 2AW2A 3F3HA 1M7IB 3PQYD 3WLBB 5AW6B 2DQEH 2EDNA 2OJEB 5ES4B 2EKJA 2KZBA 2GUYA 2GC4C 1HILA 2V33A 3R06A 1X6NA 4JG9A 2FO1A 2E3VA 3C8HA 6TAAA 5EO9B 1E5UI 1EA9C 4CDHA 3LZRA 1A3RH 3KR3L 1E65A 1KZYA 2ALAA 4UAHA 3VFOB 3LKSB 1A3LL 3MLRH 2DKMA 4PJDF 5F9JB 1A1NB 4JKPL 1D5ZA 2FO8A 4PJDE 5KBPA 2WXLA 5F44A 3P0YL 3T4AB 5KSVB 2ZUQC 5EU7C 2J1KA 3MPCA 5I8EA 1DUYB 3O11B 2HH0L 2J88L 4CMMA 1YPZB 4AG4L 3FOLA 2VAAA 3ZN6A 1N0LA 2PO6B 3US1A 4Y5XC 1TZOA 4PJ8B 1CI5A 5IM7B 1LMIA 7TAAA 3GDCA 2D0FA 2EEBA 2ZQKA 3ZMRA 2P5WB 1OSPL 2Q86A 4LDEB 4YZFF 2O5NA 4YZFE 2HRPL 4G7YH 3SKOB 3IJ9A 32C2A 4P3DB 3TBCA 4MJ5B 1ETA1 5FKAB 2E0PA 2GTWA 3QI9B 1ZLDA 4PRDA 3GUTB 1JP5A 1FUNA 4FKEA 1QFWM 5I76B 3EGDA 2HJLA 2BVQB 1WWAX 4DO6A 2PR4L 2WYIA 3KD4A 3V6ZB 1IKFL 4UM8A 1SFHA 1ZEAL 2J8UA 4JPWH 3VWJB 2UY6B 2ZX6A 3Q6GH 2KL6A 2JWYA 1ZXQA 5BW7C 2DWDB 1AQ8A 2EACA 2X89A 3DJSA 1CFSA 3AGWA 4D0CA 5ADPL 4HIHA 4P5MB 1MCFA 4S0TD 1T03L 1TJHH 2WD0A 4CGTA 2QT6A 1IQDA 5DJCA 5GRUH 1NGPL 2A9NH 4Y1AB 1W72B 3EO9L 3W9DB 3RVUD 3TO4D 4AZ8A 3TESA 1TT6A 1IKNC 4Y4HB 5FGSA 1HJBC 4QDGA 5I1KL 1XQ4A 3ZHKA 4G83A 4FN0A 2XQ0A 3RWEA 2CGRL 4LKXB 1AMYA 5E2UH 2FLBT 4M6OH 1A65A 3ECBA 4IMKA 5IJKA 3JZ7A 4A38A 4BFGA 2PCXA 4V1DB 1GSMA 3SDYH 2EO7A 4LSRL 1EHKB 2ODHA 3Q7JA 3QHTC 2E4FA 4APQD 1QTPA 1VZHA 1LEKA 5MENE 4M8QA 1OGAD 3M1CA 4M93B 1QWUA 1LTXA 3MBWB 3MUZ1 3V79C 1ZT1B 2EYRB 2VLKD 5D7JB 1G0YR 1PQZA 2VZ3A 3MUGB 3LRMA 2YBRB 3JTSB 2PCYA 3ALPA 2H32H 1HQRA 2AV7A 2C7UB 5KS9F 1IC1A 1WF5A 1X7TA 3D85A 5KS9E 1EHLH 3D39D 4JL1A 3K4DA 3L7FB 2GVYA 4O51B 3ULSA 2OK0L 4PVMA 3Q9PA 4X98B 3LHPL 3NAAL 1FNLA 4OCLC 5SWSB 3V55A 4OCMC 2AK1L 3BRGC 1EEUA 3KWVA 1LEIB 2VO5A 1JGIA 1TQWA 4IRSC 4GS7B 3EOAB 3U7WH 3UZVB 3NCMA 1RZ8A 1M2VB 3MRNB 1MRFH 3T8MA 3H6AA 5T1MB 4JO2H 3STZA 5K69A 1ZXKA 5DURD 2QGEA 5I5RA 4A2MA 4I9XA 2J71A 4GMTL 2AXGB 2X4SB 3H0TA 3VDBA 5JO5B 1G7HA 3HBQA 4F58L 3ARBB 1IO4C 4QHLA 2E8YA 4I89A 4K3GA 4X4XA 4ZOAA 5LG6A 5ISZB 3UTZA 3Q8BA 1JGEA 2MQ3A 1EO5A 1NBYA 3I9AA 5F7HA 2HZHA 1V27A 1XGPB 1F4WL 2CCVA 4Q9RH 1H5BB 4XCCL 4RNRB 3B9AA 1CJYA 2GC7C 2V8LA 1RHFA 5DYOB 3BMVA 1CT8B 1HHKB 3C5JB 2QQQA 4DZ8A 2NY0D 5C0GB 4MAUH 1KCRL 3HI6L 3P1VA 3SDCC 1P6FA 2BCKB 4IBQA 2FNBA 5GGUB 3LXUX 3MCG1 5GS0D 4CADA 2EYSA 1DTUA 1OTTC 3AG3B 3NEXA 4M3JA 4X5PA 2C26A 4XODA 3RDJA 4H8UA 3EHBB 1KLGA 1R4XA 4IMLA 3FCSB 4NRYA 5JHLL 1QUPA 3K3QA 2A6KB 5D2NB 2CHZA 3AREB 4XVJH 3TVMB 5E24E 2CBPA 1USZA 1WGVA 4Y19A 4ZTEA 2HX7A 1WC7B 3D50A 4AGPA 4ZT1A 3W39A 3BO8B 4LSQH 1C5DA 3PP3K 3MLVH 4PRNA 4HXAL 3OG4B 2Q87A 3SHSA 1GJIA 1BBDL 4R5TA 1HIML 3VX1A 3NJVA 3QJTB 3N2JA 1KBBA 2EDRA 5DMIH 5ICXA 5GS0H 4KXDA 3KXFB 3ZZSA 4U1LB 5DD5L 3RBSA 4WGVB 3LRLA 1MAKA 3QIUC 4TVPE 4Y88A 3SDDC 2EE6A 1ASPA 1A6UH 4L4VB 1UACL 3MACL 4JANA 1T89C 5LLIC 3FZUD 4OZFB 5E8EA 5IKCA 1R46A 1AZVA 3IMUA 2ATKA 4GI8A 2DKSA 4U6YB 4P8QA 3DVGB 5D5MA 4H1LA 4GP4B 4OLZH 1QAWA 2H3NB 3NK4A 4WK0B 4TSCL 4WWID 1P9MC 4S1QL 4KI1A 2BSTB 4ZMOA 2WQ8A 2WBJB 3V4LA 1JXFA 4N0CD 2L04A 3RI5K 4HUUA 4AEFA 5I1HL 2MPVA 4I2XB 4X99B 4PTUB 4RX4D 4G9FA 1R33A 4KPHH 3Q2LA 2WXNA 3HN3A 1W0WA 3ZZQA 3P3YA 2O30A 3VXSB 4DVRH 5E5MA 4XH2B 1OEZW 2AXFB 4MX7A 3VXRE 4DQAA 4ESKA 5D2LF 1R0AH 2UZXB 5CU5A 1NCDH 4L4TA 5D2LE 4KMLB 4N8UA 3QO0A 4WSGA 3ZKQD 5CR8A 3O4LA 2C9SA 1N59A 3LNDA 1ACXA 3H42H 1MDAA 1YNTB 3RB7A 4U4IA 4WHYH 5HDQH 1EO8H 3WE6B 2FO4B 4IDJL 1MCJA 1YEHL 2EXYC 3G6DL 4KROB 4XO5A 5ESAB 5E8PB 4M61A 3WIHL 1QHOA 5J89A 3WN5C 3B37A 2VZTA 3P0GB 3BP6A 2CKBL 2MNJB 2LLLA 4R26H 2JKTM 3PGFL 4H0IA 2BWQA 4YHKL 4MAYB 2IGFL 5L2JA 5LDSA 1FP5A 4HQQH 2EZ0C 3SPVA 1AGBB 1NCTA 1CTNA 3N44B 4AVKA 2V5RA 3HS0C 4HWNA 1UFGA 5BZDB 3CHXA 4NO2B 1XF4B 4GLRH 3APFA 3L5WB 5FA3A 2ZNWA 1ZK5A 3L1OH 2IMNA 2OAAA 3EAKA 4HPOH 2CJ3A 4J3OG 1ZIBA 1YQVL 4KJYB 1Z7JA 5KVGH 4BE5A 3FAXA 4F57H 2IFFH 1FNSH 5SWZD 5CCKL 2NLJB 3E1F1 1QBML 2WB1A 3MJ8B 5SX4I 4LHUA 2PNDA 2W81C 3CN2A 5C0AA 4K3DL 4F5CE 2V5MA 1Y18B 4AMWA 3DK2A 3BWAA 2CDGA 4LCYA 5HYQA 1ANUA 1S3KH 3FONB 3H9YA 5JHDB 3HC2A 4QRRB 5J8OA 3KJ6H 4M43L 4PVNA 3M1BB 4PG2A 1ZTXL 5E1IA 2A9MH 1G9NC 3MLSL 3MV11 3A23A 1OWWA 4BSWA 3V4UL 2F8VA 2GI0A 4YFDB 1GHFL 2PW2B 3FH5A 1FQ9C 5DVOA 3EJZC 5AWNL 3BSZH 5LGKA 3CN1A 1SVCP 1F4YL 4MJIB 4WW2F 3MV7D 4I3SH 3OZ9L 4YL4A 1JVKA 4AYBA 2AQ3A 3F7RA 1W80A 2XY1A 2BRQA 3MOBH 2F5BH 3IGAA 1F6AA 1FI8C 5JA9A 4PJAA 1HTYA 1JGVL 2Y72A 5D1XE 1DQTA 3F83A 1TSRA 4YHYC 1TJMA 2O5ZH 3KEHA 4F7PA 1I8IA 1ZK9A 4NNYB 4NZFA 2IANA 4QTIL 1JNHB 4HEPG 3R1GH 2OMTA 3NPZB 5FW6A 3C08H 3S98A 4E36A 3IRPX 2YZ1A 1LO4L 4WO4C 3GHEH 2LGNA 4LLDA 1AR2A 3NIGB 3GMNB 4Q9QH 4G3YH 5IB1A 5L8JB 2I9TA 2VZUA 1TQVA 4OSUH 1OT4A 3BLKA 4P3CH 3MCYA 1T83A 3H1ZA 3BHBB 4UTBH 2YAEA 3WXVH 4K7PY 2NCEA 15C8L 5DT1L 3O2WL 4LCVA 5KYUA 5IY5B 1DQIA 5DFWH 4IRSD 5DJDB 4Z3FA 1WFIA 1DQDH 1TZHA 2DQIL 3I02B 4P23B 2E75C 3MN8A 4HUMB 3LVEA 4H8VA 1FN4A 3UP6A 4NO0D 1SF3A 1XB3A 4JRYB 3INUL 2G9KA 1MCIA 2A9DA 2AQNA 3OX8A 4QHUB 2WQWA 4OZIA 4F7KA 2X5PA 1KT2A 1EDHA 1DSWA 5FWRA 3QFJE 1COBA 1HHGA 1TJIH 3B7RL 3MRJA 3WEOA 1P4BL 2BRRH 3B8SA 2GEEA 3FS9A 1KIQB 2VLRB 2M26A 5D93C 3BP5B 1SY6A 4A7GA 4U6VH 3CZFA 4JRXD 3IFPA 3SGJC 4TOYH 3QJOA 4OCSL 1FH2A 2AJZB 3RL1A 4LPWA 3RIAK 3WY4A 5CEZL 1AYRA 2ZOLB 4BFJA 3MLWH 4UIKL 4MJ6B 3L3HB 4ZFQA 3SQBB 4B7IA 3NVQA 2R4RL 1ZWIB 1INDH 1OOWA 4HOWA 3SDCD 2UYLB 2W9DL 5DA4A 3NABH 3KAAA 3P4LA 1QACA 2VDPH 5C9JA 2CR3A 1U92A 3EJUA 3KCPA 4I13B 3SKNB 4BUHA 4BV1A 5F89A 3RDTB 1OTTD 4YR6B 5FK9B 5GS1B 1J9RA 1GOHA 4O02L 5JQ6H 1QTSA 1XIWB 3FO2B 1UWEH 2LABA 2P26A 2XZQL 4WRLA 5J1AB 4MNHA 2WQAA 4PB9L 5C0DB 3LZPA 5E6ZA 4LSVH 2YUZA 1D3CA 2KQNA 1HINH 4MKMA 1A1OA 3EYUH 2UXGA 2X1PA 2ZSVB 1X5ZA 1XR8B 4ZMPA 9PCYA 1LE5A 4E41D 4Z78A 5IMKA 2D9QB 2EE2A 2WXGA 3PNWB 4DFIA 4XPGL 2F2HA 1OM9A 1NCIA 5E94B 2Q8AH 3O8XA 4Y2NA 1VFBB 3QIUD 1FG2B 4JVUA 5K39A 1AAJA 1CQYA 3SDDD 4OGYH 4UAOB 2LLGA 5EZJA 4Z77A 1Z5YD 3KVDD 5BZXA 2Z31B 3ZE0B 1T6BX 2XNAA 5B7MA 4G8GE 1AH1A 3VW3H 5JPNB 4NPYA 1HSBA 4KKLC 3NQKA 1INEL 3TBSA 4HZLA 5EOTB 5FYKL 1I7RB 2F7QA 1JN6A 1IILE 2N59A 4LEXL 3ZW3A 3HMXL 3BSHA 2OZNA 5E00A 4HFUH 2K7PA 1K2DA 3VXUD 3V0JA 2G60L 2NYYC 1T22A 1A6AB 1T1XA 4NZRH 3UFIA 4FA8A 4JHBA 4YC2C 3AB0C 1AGCA 3HG5A 3LIZL 3VMNA 3MLYL 5E99L 1J8RA 3L3KB 3UTTE 5LXGH 1UGKA 3TNMA 4YLCA 1NIFA 4ZMZA 1KJ2L 3L2NA 5IJCC 1T5XA 2RCSL 2NY1B 1UJ3B 2B15A 4Y8DC 5FO8A 2IQ9L 5MI0C 5GRVL 1PKQE 2EXYD 5GJTH 2AJ3B 1TTGA 1C5BL 4PRHD 4YVUA 2R69L 2UZPA 4KXZI 3IDNA 4QWWC 5IBTL 2GJ6A 2DB8A 3QJSB 2RFXB 2EZ0D 1GYWA 4GW4B 4NUJB 1EWHA 4LDLB 1RVFH 1UD5A 3DI2B 1KTJA 3GINA 4Z7AA 2R2BB 2KZ1B 3HUJE 4EVNB 1MCQA 3T65A 4PRPE 5AEAA 1CDUA 4A2EA 1GC1C 3MAWA 1EHNA 2JSFA 3SYCA 2O93L 2Z35B 1KPRB 5I18H 5KBLA 1E6JL 3MBXH 5FO7A 1N8ZB 2NDFA 5HGGS 1WBXB 3JWNH 5J12C 4KUCF 3NA9H 4QOKD 1G9MC 2IBZY 5MP6L 4DTGL 5AOLA 1WCBB 1J1XH 3RG1C 3BDBA 1SYVA 3CVIL 4ORGB 3GO1H 1UA6L 1RU9L 1D2OA 3FSVA 4P59L 3FHQA 2QQNL 2PYEA 5CEYA 1DDHA 4RBPH 3JV0A 3QDGA 1U3ZA 1G6RB 2EIKB 1Z9SA 3ETTA 3VFWA 4IKKA 4JB9H 1D5BB 4MD5A 2Z4TA 4PCKA 4AKPA 2ARJA 5CSZA 1KXVA 1YMHB 1K5NB 4RWYL 4N90E 4MCZA 1GYCA 1HT6A 2YAMA 4PGJA 4RA0C 4CJ1A 5I1IH 5L2KE 5CO1A 2WKOF 4ELMF 1FFQA 1CLZL 4OFDA 4ELME 1NIEA 3EJZD 5DO2C 4U6HA 3RGVA 2ITFA 3JVFC 5DLML 2A5UA 3MRKA 3OSKA 4PHZA 3MXVL 1KXHA 4KY1H 4YDLC 3VVWA 5D1QC 3GI9H 5AW7B 1I1AA 1IGCL 1NMCC 1TU2B 4MS6A 3S9DB 3NN8B 2NW2B 2NY7H 2FE0A 3OR6B 3QE5A 1U8QB 4WV1C 2ENJA 2YAHA 3B3IA 4V2CB 2OBGA 2E76C 3IJYB 4L8DA 4XC1H 3WXWL 3RWHB 3MMEB 4KTDH 1MCDA 3VU2A 4JG1H 4DUWA 4UM9B 1G9NH 2FEEI 1FIEA 5DWPA 1F3JA 3VFMA 1KENH 3DUSA 3NZHH 5I66B 1WZAA 1SDDA 2C3GA 1KJVA 3OKLB 4F8PA 3W0WA 2W65A 3AAZB 4OIBA 1URZA 3V5KA 5JR1L 2WWOA 5HDWA 2NY6B 3C60A 4WO4D 4FQQB 4F24A 4ZS7L 5DD3L 5T1DL 3REVB 4RAUB 5KYYB 2QPFA 4M7JL 1ZA3A 2NX5B 5DRNA 3PHOA 1BVOA 4HK0A 5AW5B 3UYPA 1DHKA 5JIIA 4C56A 5D6DC 1N6UA 3OJDB 1XR9A 4K3JL 2VIRA 1NMAL 1UWGL 1RK1A 2GAZB 4OZFG 1G7IA 3FULA 2VRAA 3K2IA 3ZBMA 4DH2A 4KTEL 1N0XL 1HXYA 3N0PB 4HIXL 1BAFH 3JUYA 1LP9B 2WCPA 4MCYA 1P0SE 2Z91A 2MCPH 5ICUA 3PV7A 4AKOA 1WT5C 1AP2B 5FO9A 3TWCH 3TU6A 3WFCH 1RP8A 2AJUH 1PZAA 4BZ2H 1VACB 2QFPA 3CK0H 2EH8H 3EH4B 4M1DH 5F6HI 5HJGA 4WF7A 1MWAL 1WTLA 1LO0L 1HDMA 2LU5A 4ANUA 4ZDHA 5JDSA 3WNKA 4Y7MA 5JW4N 3HB3B 1DBBL 1NWPA 2F58L 5CBEA 5IFJB 3QRBA 3CFUA 3QHFL 5EZIL 4KTYA 3KE0A 1KJ2B 3MLZH 2GCYA 4OJCA 5C70A 3V6FB 5JXAH 1DBAL 3DX3A 3B9KB 2KDGA 5DK3A 1G1YA 4KNUA 4Q4EA 2XTJC 2QTVA 2HN7B 4P2QA 1TZIA 2OMWB 3CFMA 1KGJA 1NGZB 1J8HA 1IMHC 3IYLW 2CKNA 1PNDA 5CZVL 4L1BA 3QQ4B 1IKOP 2JIXA 5T3ZD 2BERA 4OQ1A 3EOBB 2E59A 3LNHA 4Z7UF 1L9TA 2Z93A 2V6HA 1GY1A 4Z7UE 1NFKA 5HHXL 4G42A 4MHHG 4MJJA 2X87A 3E0GA 4LCWE 5FYKU 1ZVYA 3NH7L 3GSXB 5FYJH 2DQGL 1P5UA 4O9HL 3ROLB 1YC8A 1CYXA 3AC0A 5IQLA 3VFGH 3ZTNH 1A6WL 1RZJC 1N6VA 2OJ1A 2DM7A 1JHKL 4DZBA 1CFBA 3MLUL 5T3ZH 4WWNA 3WFBL 2CO7B 3FTXA 4LRIC 4U1NB 3D1MC 1HNYA 4A6YB 3NCYS 1AG6A 4KKLD 3X12B 1KWKA 1WFJA 5LNGA 5B1CA 1M05A 5F21B 4YXKH 1ZHBB 1MFUA 1DVFB 5CLYA 5D9SA 1NA8A 1QBAA 2QKSA 2Z7YA 4KZ0A 1YEGH 3IDGA 4AC2A 4JHZA 1S9YB 1J11A 4BELD 2OMXB 2WINB 2NYYD 4ODHL 3RWDA 3LSOA 5JIKA 4XAWH 1WZKA 4URTB 2Y2YA 2JCWA 3QEQB 2WOBA 3ARGB 3O2DL 1ZLEA 1PZ2A 1IAIL 3DO7A 4FXGC 1KXQA 4D7PA 1OTSC 4QNPF 3MRLB 5DUPL 4Q6YA 4J1UA 5DJ0B 4QNPE 1RUKH 3ZE1F 5KBNC 2OM5A 2ZKHL 1N67A 3ZE1E 1QPKA 3V4VL 3E2HC 3IN0A 3O3DB 1MCWM 3ILQD 4NZUL 3HG0A 4W9LC 2OXGA 1WS8A 2XV6B 1BQ5A 4JHAL 3MX0A 5I75B 3AJ7A 1BVLB 2BHUA 4WWKC 1HX0A 3ASOB 4PJIF 5HHVH 1O5PA 4WDIB 2QHRL 5I8CB 2VZOA 4PJIE 3DSNB 4Y5YC 1RIVH 4DPRA 4XXDA 3QPKA 1NAMA 2FJFA 4QWWD 5CWSB 1NDGB 4GAFB 2Y1AA 2ZOKA 1J5IA 1DYZA 4BZ1H 1LEGB 1BQLH 1XL6A 4U3HA 1RFDL 4FTVE 5ALCL 3A6CL 3L3OB 4PJXA 4BH7B 1T5WA 5FB8B 5HYJB 5GRJH 3KYMA 3VFPA 3CVDA 5D4IA 2NOYA 4KQ3H 1VEMA 3GMPA 3KYAA 5HY9A 2J55A 3DX9B 4EZLA 1JV2A 4S11A 2YRLA 2BVUA 2JJVA 1Z6JT 1TJXA 4H5SA 4OGAC 3LIUA 2QPEB 3RHWK 43CAB 5T3XE 1B6UA 1D6EB 6PCYA 5SWQB 4X9BA 3VB8A 4CVWA 1IEHA 4J5VA 2B77A 4J3TA 4Z7OE 2H47C 4QIRA 1U8LA 1E9QA 4ODTL 4BFNA 2CBMA 1A8JH 4R5XA 5D7KE 1E8XA 5J6HB 4KO5A 4DP4X 3U30C 2X09A 3LQAC 4OTXL 2DJUA 1GRWA 4FKKA 3P9LB 4GAJL 4POZC 4KUZL 4LVHB 1OOAA 4EN3B 2F53B 2W1NA 4P0DA 4OZHB 3K4AA 5ITFB 4HBQA 2WWMC 5DMGC 5FHAH 3ULUE 1JHTA 1AVAA 4LHQB 1OM3H 1E42A 4PWEA 5TE7H 1NBVL 5AYTA 4MXWH 4KO6A 4LEOA 4N5EC 1QHQA 4R2GB 5DO2D 1A0QH 3FQWB 3SKJH 1NOFA 1IEBA 1U8JA 1HN1A 3GMQA 3NFNA 3PRZA 3MC0A 1AO7D 4XN8A 4B9IA 3MKKA 3II2A 1HHJB 1SGKA 2IF7A 5D1QD 4FXTA 3HZ3A 4XNMA 1K85A 1GPOL 1SFDA 3ZT5A 4AGQA 2WGXA 4J28A 1UWXK 1OE3A 2A38A 4PLOB 1MZZA 4TXVB 5B39B 2XX0A 2YGVA 3QUYB 1JG9A 3KPNA 5K9QG 5LNDA 4K7PX 2F19H 4G6FD 1JOIA 7FABH 5EU4A 1YJDL 4Z7VB 1T1ZA 2ZIDA 4P5TB 1BSIA 1KLFA 4JQIL 5LAXB 4ZO8A 4APXA 5KYWA 3WY1A 4QF1B 5DQDL 5MERA 3RWGB 4P4KA 4YX2H 4N2AA 1X4XA 4LARH 3M8OH 4TNGA 1R3IL 3FU3A 4LAQL 1BJ1J 1FORL 1A4KB 2DLGA 2O5YL 2VQ1A 4FA6A 3LKNA 5D8JL 1QA9A 2MQGA 2PN5A 4L4JA 3D4ZA 2DTSA 3ESVF 3FT2B 3OD3A 4MJHA 3G9AB 5AB1A 3NFPB 1MIMH 1SJEA 4ETQB 2UWEA 1H8NA 3DTXB 4JPIA 1V55B 4O4YL 3GHBH 1P7KA 4MCNA 2PO6C 5TFSH 4PR5B 1BBJA 1HKLH 2A9CA 2YWZA 1QO3B 5AFAA 4PJ8C 4EKXA 4KBPA 1J5CA 2ZNXA 2X6BA 5C0IB 1IV8A 2J4WL 2VDMB 1FCCA 2B1AH 3M17A 4JG5A 1TQBB 2VH5H 4CC4A 2ITCB 3WCYA 1FFOB 2CWRA 4QXGH 4JMNA 5LGYA 1IBGH 2R7EB 3F7PC 3ZO9A 2BIPA 1Z9OA 1ZLUK 5DS2A 4N2DA 3QI9C 3HPJB 5I1LB 2WSPA 1YEFH 3OAUH 2PCFA 1ZGLM 4HJIA 4NKIL 4OUUA 4G5ZL 5TQ0H 4YXHL 3QXVA 4WY7H 2BDNL 2ED6A 1E28B 3V4VB 3M45A 1MPAL 3B9DA 1RMFH 4TQHA 1RJCA 3BUTA 3BC9A 4JY4A 5AVRB 3T4AA 3VWJC 2NUTB 5C2BL 4OFPA 2XTJD 2GJZB 4HS8L 4NKDB 2X1OA 3TPKA 5HHPA 3HG2A 3HNSL 3QDJD 2PP9A 5ENWA 1DQJA 1YEWA 2QKIC 5DVKA 2Y7QB 4FXKA 3I50H 2E27L 3HRPA 4GPVA 2WMPA 4NLAA 2P5WA 2YLKA 5IJVA 4Y4HC 4A04A 1OPOA 5CMAB 4LZKA 3GBNH 1NKRA 3MOAL 3QNFA 1WFTA 3HNTH 4MA8H 4TRPH 3LS4H 4X6CF 2I7OA 3S34H 1L9QA 4YQXH 3LXBA 4ODVL 4X6CE 2BP0B 3HBPA 3S4SB 3P4MA 2BVQA 4G6MH 4MYWB 3FQRA 3QBTB 2HJFA 3BD3A 3R0NA 4NUGL 3CNKA 2NNAA 2X6VA 1JHLL 3L3GB 1GW0A 3KM1A 1UB5A 1SHWA 3L5JA 3K81A 4M93C 3KWWA 3QXDA 4PV8B 3HTLX 4M6NH 2VN5A 2C7FA 5F3HA 2ZWNA 5D7JC 3GBML 3VQLA 3BGMA 1VKXA 5D55A 1UA3A 2IDSA 3ATDA 2CGYA 4QKXB 5I0VA 2I60L 1PLGL 2NY5L 5FKPB 4JBSA 4HPYL 5FUCC 1NBCA 5SX5H 4GW1A 2W8CA 1BXXA 2ATPB 3UERA 5BVPL 2UUDH 2PP7A 4AQ1B 2JTYA 1AQKL 4GS7C 3UYRL 2VLLA 4MJ4A 3FF7A 4DGWC 2WTOA 3BVTA 1KDJA 4LSPH 5AW0B 2HPOA 3QZWG 3MOQA 4K7FB 4N8VG 3VD3A 2DLEA 4M56A 3IFLL 4WVRA 3VXNB 1OTSD 1TZGL 1R24B 2VLKE 3FN0L 3VTTA 2CIKA 5ID0A 1MVFA 4G6JL 5GGVH 2V2XB 1U8HB 2P4AB 4L8BB 3ARBC 3FOMA 1H3PL 2FK9A 5BJTB 4YDKH 1OLZA 3N50A 5EHFA 5JA8B 1A9BA 3AS2A 5DJXB 2UZIL 1RK7A 4AY0A 4BUGA 2ZSWA 1XH0A 3DIFB 5FFLA 5MENB 2LU3A 4NQED 1OK8A 5IK3B 1DFXA 1SJHA 4WWKD 3S97C 2P45B 2XJLA 1XHHA 3U46A 1DCEA 5A2KH 1H5BC 4Q4IA 4ZZKA 3Q13A 1BIIB 2HJKB 4UYPA 1O6SA 2YXMA 5F96H 4EI5B 1HSAB 4XPAL 2B4CL 2IBZX 5KS9B 2AK4E 3UO8B 2HAZA 4AE0A 2WBWB 2DOCA 4NKOA 4FQXB 4IIQB 4X6DA 4I3RL 4DW2L 2BSED 2VWEE 1XB6A 1BDYA 1R3HA 3U4EB 2XC8A 4WCYL 3Q6FA 2XN9D 4D8PB 3UBHA 4FQCH 3P02A 4LPXA 1QQDA 4Y1SA 2WUBH 3VSTA 3BH9A 2A73B 3UTQB 5CCGE 4YHNA 5AUMB 4B5EA 2X4PB 5TDNA 1NIAA 2IDUA 4YAQA 1AD9B 3EHBC 4GRLA 4OGAD 5FA4B 2YPVH 2XIDA 5D2NC 4YBLB 2CUIA 3C6SA 3QQDA 1MFDL 3AREC 4LCCA 3TVMC 1JTOA 4D7BA 5LUMA 3K2KA 5F1KC 1UEYA 3QDHA 1YEDB 4JY5L 1RI8A 1ADQA 1S9XA 4AK1A 2Z65C 2RQ8A 3N85L 2AQTA 2DIAA 3FQUB 3VH8B 4X5XA 4PJFA 3CCHB 3F7LA 4JDEB 3BOVA 4POZD 1EDQA 4NQCB 1LL1A 5EA0H 4RAHA 4U33A 2WWMD 5DMGD 1X7SA 1GGCH 5DZJA 4YE4H 4NNXA 1OGTB 2ZKYA 1VRSA 4POUB 1YNKL 4F8OA 1FFNB 2BLFA 4QD2E 1IBBA 4TLTA 3F7KA 4N5ED 2FX9L 1FH5H 1R5WB 1RZFL 2HWZH 3JWDC 4HDIA 4Y4FA 4XP6L 1BVNP 3QUXB 1SMAA 2YC1A 4JMXA 1TEGA 1P7HL 1N6QH 2XWZA 1A3ZA 1LK2A 2VL5B 2DLFH 3FCGA 4Z76B 1SN5A 2BMKA 1JRHI 3P54A 3LQAH 1Z9MA 1MHHB 2L7UA 2WBJC 1M1XB 5LCVA 1FWXA 3WDJA 1NCCL 1NANH 1R3LA 3LH2L 1F45A 5EWIL 1G5GA 2D3JA 3TZVC 1UM5L 3VB9A 4HT1H 4HKBA 1QVOB 3MYZA 5CCHE 2KH2B 1MN4A 3T04D 2IADA 2X3BA 4RQQB 3BO8A 3LN9A 7PAZA 3HMWL 4OF0A 3V6OA 1M9SA 4ISVA 1KNOB 1VCAA 3G5ZB 4X0KB 5LXVA 2F68X 4R90L 5J9PB 2GUOA 2R0WL 4HU8A 1E4HA 3O9WB 4KFMA 4M7ZC 2AJVH 4N9GA 3IGFA 5JOPD 5JYLA 3AMKA 2R8SL 1DSFL 3B2VL 5F0JB 4U3XA 1CGSL 4NCC2 1PF3A 2WWNA 4HAGA 2NUPA 5JHBA 3V4PH 1T20B 2WGNB 5CP7A 2G4EA 1GSKA 3D0LB 1DE4B 4KROC 2AEPL 2ZWZA 4HC1L 4F9LA 4XPFH 2HPTA 4M5ZH 2XWJA 1N7ML 3UTSB 2E86A 3TV3H 2PO6D 5CJQL 3RPKA 1U58B 1U8CA 4ZPVB 1FBIL 2CPCA 4FNLH 4MAYC 1D7DA 4JKKA 4PJ8D 5CLWA 4H0HB 3B7UX 3CLFL 2BP8B 3PGCB 4X99A 3F84A 3Q1SH 1IU1A 4PTUA 3EF4A 3IK2A 4N2HA 5KTEL 3QG7L 1KN4L 2QELA 4H44C 5T5FH 3QNXA 4WSKA 3KCWA 1G84A 1OAQH 1UZ8B 2J8UF 3IJSA 4XH2A 1RAMA 4ES9A 1L6XA 4TQIA 1AZBA 4ZYKB 2J8UE 3QI9D 3QEHA 3VXRB 1UVQA 2R0LL 2AGJH 2K70A 2VUOA 4ZAKB 2I26N 2MPAL 4PJGB 5DD1H 4AQAB 5D2LB 5I1JH 5I8OL 4FNUA 1TVHB 1YNTA 1UADC 2XUWA 1A1MB 2EVIA 3A21A 5DZPA 3FQ4A 3KDPB 2BSBA 2QDVA 3VWJD 1DVUA 1VEOA 3QUMB 3UAJC 2C3WA 5F88A 1MJUL 3WELA 3DUUA 1LO2L 1T0OA 4UTCA 2FATH 3Q2WA 5FCUH 4BGDA 4N2FA 1FAIL 3KYKL 4WU7B 4W81A 2VQTA 1WA2X 4FP8L 1AGBA 4Y1AD 3QIWB 5HJBA 1A25A 2XWTA 3KPRA 4Y9CA 2CXKA 2DQUL 4I0PA 1EEZB 4MDJB 4Y4HD 3UPRA 1XF4A 5LBSL 4NAMA 3L5WA 5SWZE 4PWHA 1ZTMA 1OAYH 5D6CA 1B0IA 2AJSL 1IE5A 4EDXA 5DXWA 3F85A 4AM0B 5K9JH 5K1VA 2B0SH 4MASA 4NPKA 5JNYA 1KPVB 1T66C 4V1DD 2PF6A 4WI8A 3VI3B 2W9LA 2VMEA 3DROB 4FYSA 1ORSB 5DRZA 3PAUA 3FT0A 4YBQC 1H3WM 4MZ3A 2GK2A 4TSAH 2YRPA 3KWXA 4TTGA 4WI9A 3V7AG 1W72H 2XCMC 3T4YA 4IRJB 4EZJA 3FONA 3FQNB 1PMYA 5D7JD 3T3MB 1S7UB 1BG9A 5DZAA 4GO9A 1JZ6A 5J13B 2PXYA 3EH5B 2J6EH 2NTFB 5AAMC 1JMZA 2C1PB 2PW2A 5C0RL 1CG9B 5C3TA 2OYMA 2WZ5A 5SWSD 4XVUC 4OCNC 5B1AB 2VDLB 3OKMB 3IXTB 5AAWA 3U0WH 4G9DB 5T1KA 3RUGA 4WI0A 2Y24A 3J27A 1XSKA 3WLWC 3G08A 4W9KC 4WW2B 1H15B 4P23C 1BVZA 2G3ZA 4HCRH 1RZGB 5I82A 4G1EB 5FGBA 3CBKB 2BSRB 1FDLH 1WUZA 1U21A 3IMRA 4AIEA 3GXFA 5F7EL 3TJPA 4I88A 5D1XB 1ZV9A 1GS6X 1AHWA 3ARBD 3GSOA 3BZ4B 4O5LL 1WIUA 4WJG3 5MEOB 1IAIM 1ZS8A 4HX1A 5B39G 4BGLA 1D6VH 1JNHA 4N0UB 2APWA 5ISZD 4L0ZA 3F5WA 1YN6A 2FL5A 3JXAA 1Y0LA 4W4OC 3VCLB 4AVHA 5I6XB 1L6PA 3AU1A 4I5BA 3FMGL 1PZCA 2XXGA 5I71C 5CGBA 3WFEH 4JFHE 4J3UA 2J44A 4NJ9H 1BWWA 4JFFA 1IKNA 4Q14A 3WN6A 3BEVB 3NJKA 4YSSA 3CC5B 2JK5A 4G11A 5IB2B 5GIRB 5IB3B 1KGXA 1DEEB 2IOOA 2R1XB 5GGRA 3IF1B 3GXTA 4JREC 1NH6A 4UUJB 3PP3H 1F13A 4DGIL 1MLCA 5HHOE 4QCIA 4UTBA 1IQWL 4E5XB 3IVKA 1URIA 4G2AA 3SGEI 1KYAA 4FG6C 1QRNE 1FVCA 4ZMWA 5GGRY 4OV5B 4Q8BA 5GS1C 1DJXA 3VWKB 5GISH 1F3RB 2ZKXA 4XR8C 3EHBD 1XIWC 3S2AA 1QZNA 3UTPD 3AADB 1I7ZB 4JRXE 4L1HA 5A1AA 4JJOA 3EOYG 3MSPA 2XG5B 3TJEH 4DKAA 3ARED 3KBFA 2B16A 5E03A 3TVMD 1A5FL 4KWUA 1N12A 2FZ3A 1DFBL 3QFJB 3R4RA 4JFPB 4ENEC 4GW5B 5A2JH 4JKPH 2E9WA 4AOFA 4FFWC 3MBEB 4JX0A 3P0YH 3MRQA 4DNLA 4HCFA 1JWUB 1TQUA 2KZWA 3FQXB 2ZPKL 4ZUVA 3BQUB 2ZOLA 5D5MF 1BJ8A 1DVXA 3KXFD 1NMBL 2C4FT 4S1SL 2DW5A 1XTMA 5D5ME 4I4WA 3UBXA 1OSEA 1ND0B 4UQ3B 3KLSA 1D7FA 4UAOC 4L4VD 4JQXC 4UDUB 1NCJA 2Z31C 3S5ZA 1LWHA 4N2GA 2A6DA 4G9FE 4B0MM 4MMZC 3RDTA 3I6KB 4Y4KA 3MQIA 4L1LA 2HG5B 1G0DA 2EDLA 5C0EB 2IPKB 5D96B 2H1PL 2HRPH 2WLHA 2V0AA 2WBJD 3SE3C 3CTTA 2Q6WB 4E41E 4Z5RA 5HJ3A 4P48A 5C0DA 3TZVD 4IU2B 3NSJA 5JLZB 3FB8A 4L4TE 4K23L 5IEKA 3CXDL 4NC1E 1MRDH 3T6XA 3UACA 3T6QC 3VD0A 4OJAA 1IKFH 2H1XA 3H4FA 3VXSD 3FT3A 3O6KL 1ZEAH 2DI8A 4RMWA 4LB8A 4GBXC 1UUNA 2Y6SC 2IWEA 4OZFH 3S3JA 3X2QB 1I9JL 1QI4A 1EUTA 1CZ8L 2X9ZA 2ZWKA 3JWDH 3QAZB 4OQTL 3WIIL 5FYLL 2NY3B 1D9KB 2W60A 5ADPH 1HK6A 2FIKA 4ODSL 1UJ3C 2WZAA 3S3PA 3QR0A 1T03H 5GGQL 3U79A 5INDA 4KROD 4JHWL 5T1LB 2XZCH 4F7TB 1J1PL 1L0YA 3CVBA 5JPNA 3F12A 4Y2DB 3U4BL 1OT1A 4G8GB 4AYFA 4GSDL 3PWUA 3EYOB 5FOBA 2K3HA 4NLHA 1IM3B 5I1KH 5EC2B 3EW3B 1INQA 3MRHB 5C07A 3K6DA 2NR6C 4MAYD 4UV7L 4HS6B 3W38A 4HHAA 4GRMB 3ZR5A 3SO3B 1IAOA 1V5JA 5E2TH 4ZFOL 1AI1L 5F0PB 4LSRH 3CHPA 4RRPM 4LIQL 2D03L 2MMXA 3LNEA 4HIIA 1PZ3A 4G8AC 1XSJA 1BFVL 1OB1B 3QCUH 4AC4A 4OI7A 3CLEL 2BY0A 5C0AE 3GSNB 1Q9OB 4UI2A 4XP9L 1FO0A 1KELH 1MRCH 2CH8A 3OHMB 1JBJA 2VR9A 2JQAA 3GMLA 1SOSA 4P2AA 4IBYA 4FEIA 3DX6B 3NZSA 5M7QA 3NP4A 1KB9J 4U3CA 5H4ZA 1XF5A 3QK0A 4GYBA 3EGSB 3IU3A 3S36X 4FULA 4XWGL 3LHPH 3NAAH 5BUAA 2EIBA 3CDFA 1PKQB 1V3LA 3IE9A 1S46A 2P9RA 3UAJD 4BSVA 2H26A 5JHDD 4QRRD 4G8EB 3SQOH 2ESVA 5ALBL 1N2RB 4XCEA 1XXDC 4WKZB 3K72B 5CIPB 3HA0A 1JGDB 3LH9A 4AW4A 1HCVA 3PS6A 2CLRB 4GQ9H 1RUPL 3IDYB 4GMTH 4KTGA 2R2BA 1IZJA 4QOKE 3FCTA 5IB4B 4EVNA 4PP2A 4Z7QB 2M1KA 1JF6A 4MJID 1Q94A 1J0HA 2BX5A 3HUJB 3QDAA 4PRPB 5H8DA 2C4FU 2ZOUA 2Y5TB 2CO3A 2L7JA 5EMYA 2IANE 2R2EB 5DDHA 4AQ8A 2ZICA 1N8ZA 1NAKL 1M6OB 2UXFA 4O2CB 4R97B 5GGTL 1D7BA 1E5CA 1F4WH 1OSZB 2Q5BA 3TPUB 5E4EB 4BKTC 4ZMNA 1T66D 4LLYB 2EILB 5LQBL 5MHSD 3GMOA 4YBQD 4Q6IB 5IUSA 2EECA 4DETA 3OLIA 1OP5K 2Z4QA 4MNQB 3MZTA 1KCRH 2V5YA 1G6RA 1PCXA 3F6JA 2ROYA 1AXSB 1JIBA 5E6RB 2NQ3A 2RQEA 5F9DC 2NY6C 2APSA 3VXQB 2G0KA 2ADGB 1YDPA 5AALA 1CO1A 2H8PB 5IFHH 3QNYB 2NY4B 5AW8B 5CEXB 3IDXL 4GKZA 2HFEB 2P8MB 1TENA 3FB5B 4XHQA 4Y9FA 1IC7L 5L2KB 5JHLH 4S10A 4Y5VA 3WDIA 5CHNB 1AGDB 5JIMA 1MQ8A 1J5OL 1TIUA 2WVVB 2WO4A 4UANA 4XVUD 3O3BB 4M7LH 4G7VL 1B9ZA 3QZWA 3MJ7A 4N8VA 1BFTA 3WLWD 2HUHA 1KEGL 3QULA 1MFEL 5CJXA 1U3HA 2Q7AA 4JUTA 2JVUA 4P23D 4WK2B 1RXLA 4PJEB 4HXAH 3ISYA 4G71B 4H20H 5HSFA 3HR5B 1HIMH 4JRYD 5DHYB 3WUWA 2CIIA 5ITBL 1JZHA 4IKIA 3RWHA 4C4BA 1ZHLB 4NWTL 2A6JB 5DD5H 3MFFB 1CL7H 1YZZA 3KYNB 2ARWA 3HEIB 4HCIA 5JQHC 1U2HA 1UACH 2VLRD 3MACH 2OTPA 2R1WA 4X4KA 3CFBA 3HB3C 4BRJA 1MH5A 4XP5H 1Q0YH 2ZCKH 3FBKA 2IH3A 5E9DD 1E3ZA 1UOLA 3HJEA 4P46A 1FPTL 4C57C 4QHKI 2P44B 1K6QH 2L4OA 2FB4H 4S1QH 5INCB 4PRBA 3PP4L 4AL8L 1B2WH 4WFEE 2W0FB 3B9KC 4DCQA 5IOPA 2F74B 4P5SA 5I1HH 2AQQA 2QGBA 5CD3A 4QRUB 2X7LB 2XZZA 2VC2B 5DZLA 3D2UA 1AIZA 5EC1A 3IMWA 4NCDA 4FG6D 5G5DB 4TKWA 2XBZA 3O6MH 1XIWD 3U9PL 5EBLB 2ZOWA 2PTTA 1QBLH 2CALA 4HV8B 3E3QC 5T3XL 1MI5B 4ZO7A 4HF5L 4NSKA 2GJPA 4TULH 4J4PC 5F9AC 3LKOB 5EOCH 4B60A 1SEBB 3O6FB 1UYWL 1YYML 1OE1A 4ENED 4BZ2A 1MSPA 1XGUB 3OPZL 5DSCB 2WZ0A 1FC2D 2XWEA 4FFWD 3WI9A 1TNNA 4IDJH 3NFSH 4FL4B 4LAJH 3G6DH 3U2SA 3CPLA 5IFJA 3Q3GA 3BD4A 2ZT9C 1BW8A 1F3DH 1PDKB 5J6GB 4NP4L 5JW4Q 1WZLA 4PJ5B 1PG7X 2CKBH 5IHLB 1IM9A 4L9LA 4XBPA 3AITA 3PGFH 4I1RA 4YHKH 3AG4B 2Z31D 4NHUA 2BVEA 1K3IA 2BOBB 5IZ7A 2OMVA 1SUJA 2FRGP 4UT6L 4YHPB 3F58L 1DVFC 1KBVA 3VD2A 1PJWA 3QNZB 3GB7A 4DHLA 1LE9B 1AIFB 1A2YB 3NJXA 1BZ7B 3AUWB 4XNYL 3FT4B 5CXPA 3EOBA 2QJDA 2YOAA 5DO8A 2WLJA 4UT9L 5TF0A 3IKCB 5LGHL 1GZPA 3D69B 4X7FC 1EAPA 2PKDA 1IUZA 4LPVA 4NM4H 5IW6A 1QLRB 5CCKH 2DQEL 4XVOA 1QBMH 2FR4A 4BXSV 3ARGC 4K3DH 4GBXD 2Y6SD 1Q0EA 1IFHL 2APXA 2AP2A 3B7SA 5TDPA 2R83A 2VABB 1M57B 3H7BB 3RZCA 4X7CC 1ZTXH 2VR5A 1I7UB 1CD9B 1EGJA 3MLSH 3SCMB 2ZKMX 3BKYH 1D5XB 2DYPD 4I1PA 4JPKL 4ZPTB 5I75C 4MB4A 4U1NA 3QDMA 3SJVB 3ZE2F 1GHFH 2WXQA 2WM0A 2HSIA 4WI2A 1F4YH 3HCVB 4N6RB 5LJYH 1UD8A 5J3HC 1QI5A 2EKSA 3IJHA 3DPBA 1OW0C 2FAUA 2NR6D 4X9YA 3QWRD 4DFHA 5F7WC 1T4KA 4X42A 1H9VA 3L3OC 2F18A 1L9MA 3DXAD 4CSSA 4JQVC 1L5GA 2QLYA 3CFNA 3DGCR 1AC6A 4MNGA 3TYGL 3L4YA 3ARFC 3PWPA 2AANA 5HGHA 4JM2F 4KMQA 3IWUA 2BO0A 4G7YL 4N85A 4JG0L 4QYAA 3FUMA 3B5TA 1KYFA 3H9SA 4J3WA 4YDVA 2EVGA 2J6WA 1HL4A 1LO4H 4PHXA 4KKAC 5DQJB 1Q9LA 3SDXF 1ADWA 4PLJC 1GVIA 3SDXE 1JAEA 3EYVA 4NJAH 5F70A 3VJ6B 3ALXA 1BVLA 5DS8A 4P2OB 4JPWL 4LBAA 2WBXA 3C12A 3Q6GL 1KTDB 4UNUA 5DT1H 2QDWA 4JCWA 4FXLA 4LVHC 4ANXA 4EN3C 4AENA 1F58H 4PJIB 1XDTT 2RD0A 4NRXB 1ZDQA 4XAKD 1ZLSL 2VE6A 1VZGA 3AU0A 3H55A 3IJEB 4M8UA 3GSWA 2FSEA 1FG9C 3L9EA 3TH3T 4U6XA 3H4HA 1LEGA 1ET5A 1HH9A 3CHOA 4N0YH 1TJHL 5CZXC 4LDOB 3DJTA 1TO5A 4R2GC 2A9NL 3MA7A 3GI8H 4BZ1A 5AKVA 2G3XA 4FTVB 1DCLA 4NDMB 2F1AA 4HMEA 1M71A 3PU7A 2Y7LA 4HLZH 4CAGA 1HZLA 4O2EA 4QGYA 4R4BA 2B08A 5E2UL 5IBUB 3W0WE 1AQDB 4UQ2B 4M6OL 2ICWA 5ILTL 1FRGH 1YEEH 3EJSA 2GTQA 3G6AB 1PSKL 3WNPA 1N5YH 3QUYC 3SDYL 4FLRA 4NUMA 4Z7OB 1NC4B 3MHZA 4UM9D 2Q76A 2R4RH 1YHPA 1BZ9A 1QSZA 3IT8D 2XFXA 3RWFB 4B9PA 1G7MB 4YWGH 4XNXL 4P5TC 3FBQA 3K0WA 2W9DH 4EPSA 4N86A 2BNUB 1P4LB 3S37X 2NY6D 3HLAB 1X5FA 1DBMH 3OAYK 5E8DL 2AQPA 3FFCA 3U0PA 4OLWH 5CCJA 4KXCA 5I1AA 2ZUUA 5DJ8B 3FUKA 3QWOB 2ICCA 1MHCA 1NUGA 2NX5D 5FDWA 1E4XH 3MRDB 1SNRA 1IGTA 2X1QA 4YHLL 3EO0B 3FPXA 3STLA 4PB9H 2KS0A 4HCGA 5K93A 3S7GA 1J0JA 2JE8A 3WJJC 2E9IA 5L4IA 4NAJA 1AGEB 1O7VA 2Q20A 4D94A 3VG0L 1OAXL 3U7WL 3CFEA 5CINL 3ENEA 4LCIL 4QRQB 4Y2OB 3F01A 3U48A 4AE1A 2I07A 2VR6A 4QHMA 1BECA 5I24A 1EXHA 3KPMB 3VSVA 1FVEB 1TQBC 2GITB 4M4RA 2BOLA 4FI8A 4MHHI 4JFDB 3APMA 4UNIA 1Z2KA 3ZGHA 1XAKA 1T6WA 2BNQD 3JTBA 5LAXA 2X6CA 4AMKL 4JFYB 2BNRB 3LKRB 1J0KA 3HB3D 3RFZA 1R3KB 3TH2T 2CLZB 4P2QE 1INEH 4Q9RL 4J39A 5IBLC 3RWGA 4Y0GA 3SE4A 5B7FA 5DRXB 1J8HE 1NEZB 2GKIA 4XWOC 4XPTL 3RBGA 1CFQA 4AT6B 4KU1A 1AO7A 4MZIA 3HMXH 2CO6A 2R0KL 1FYTB 1I1CA 1J7VR 1B0GB 3B9KD 2P80D 3VA6A 5C92A 1TCRA 2MSPA 3NFPA 3VG9B 5J1TC 3EG9A 1WWBX 3IS0X 3ARZA 1WBZA 5TGBA 4OD3L 3M7OA 4PV9A 5B38B 4G7SB 3EH1A 4ZX4A 1XMWA 3TT3H 3D9AL 1Q9WA 4DSYA 1SM3L 3QA3B 4B9KC 3WKQA 2WK2A 2EEAA 1CD8A 3BZEA 4J4PD 2P24A 4XVJL 3BJ91 1KJ2H 1XZWA 3KLKA 1E2ZA 1TMQA 2RCSH 3LN5A 3P3UA 2UXTA 4OFYA 5JPMB 4TPRH 1QKZH 3J7HA 3F6IA 4BDVA 3PYCA 2IQ9H 3ARWA 1W8NA 5IG7A 1B88A 4E9WA 3LZOA 3MLVL 4ZFZB 1EAQA 4IEFB 2JB5H 4I77H 1Z1WA 4KRLB 1D5RA 1I82A 3WD5L 2FHBA 1C5BH 2IVFC 3D34A 3PGDA 3QDJE 1YECL 2Z1KA 4JR9H 3QZOA 1YC7A 4WFHD 1RLWA 2MTAA 4H88L 1MNUL 4RFOH 2ZP8A 1QEWA 3GSQB 1NCAL 4UTAH 2YXVA 4LGSB 4U4BA 1A6UL 2OSLB 1V54B 4Z3TA 1H8SA 3FUJA 4NKDA 4RSVA 1HHHB 2YK1H 3ZKNC 3ESNA 4QYOA 2FH6A 1CL7I 1P7QB 2C3HA 1FIGH 3GT6A 4OLZL 1DVFD 1FNHA 3RVWC 2IDFA 3OKOA 1E6JH 5K33A 4L5FH 5DTFA 4QEGA 5MP6H 2X1XR 5JORA 4AQ1C 3A4AA 4J7RA 2CUMA 1G4MA 1IBZA 3CVIH 4J6RL 4MZ2A 1UA6H 2UY7B 1RU9H 3QEQD 4Z3EA 3ARGD 1GZQB 4DVRL 1HL9A 3LKPA 4A6YH 1I4FB 1BFOA 3T08A 2LOEA 2ZXBA 1R0AL 3AM8A 4X6CB 1IGIL 1NCDL 1U9KA 1Z32X 4OJEH 3FK3A 3L3GA 4FMFA 1YJDC 3H42L 4PV8A 5BRZA 4K15A 1C5CL 5HDQL 3MRGA 4FA7B 3G6JF 4KX9A 3K5RA 3R8QA 1F90L 1HOCA 3BZFB 1EAOA 2CK0L 4PJXE 3F7YA 2L8AA 3G6JE 4GKOA 5DLMH 4XGZA 2IBGA 5J3HD 1VESA 3AG2B 1A6ZB 3LV3A 4EI5C 3KPLA 1U0QA 3MXVH 4NS0A 4R26L 2FEEL 3DURA 1T21A 3N9GH 3RL2B 2IIJA 2K1MA 3JT0A 3SN6N 5GGSA 1VFAA 4FQXC 4IIQC 2F54A 2ZG1A 2E4TA 1Z3GH 2Z8VC 4A55A 5C0JB 3BKML 4Q52A 2YXFA 2VZSA 4FQLL 2YA0A 2D0GA 3ARFD 1XH3A 3DV6B 4U49A 4XE5B 4U1KB 4R6UA 2OL3B 5D1ZA 3KMDA 4UQEA 4AH2B 5E5LA 3FT9A 3BDXA 5C7ZA 2VGLM 2B39A 3AXLB 1R24A 4HPOL 1HHIA 2JCCF 5JR1H 5GS2H 1W6WA 4YBLC 2OZ4A 2Q7YA 2W59A 3OC5A 5K9QI 3QG6A 3T1WA 4PSPA 4IBUA 4KKAD 4WFFD 4ZS7H 5DD3H