1JK9A

Heterodimer between h48f-ysod1 and yccs
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
153
structure length
153
Chain Sequence
VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIFEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Heterodimeric structure of superoxide dismutase in complex with its metallochaperone.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords superoxide dismutase
total genus 34
structure length 153
sequence length 153
chains with identical sequence C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1jk9A00
4A7QA 1JCVA 2ZKWA 1JK9B 3ECUA 1SDYA 1HL4A 2AQSA 2GBVA 5KBLA 3HW7A 1SXCA 1UXMA 1N18A 1P1VA 1SXBA 3QQDA 3F7LA 1UXLA 3GZQA 2C9UA 1IBHA 3GTVA 1SXSA 1YSOA 2WYTA 1IBFA 2APSA 2Q2LA 1SXZA 1E9QB 1YAIA 2XJKA 1XSOA 2ZOWA 2JCWA 1IBBA 2LU5A 2Z7UA 1Z9NA 3KH3A 3QQDB 4BD4A 1IB5A 1FUNA 1E9PA 1EJ8A 1OZUA 3KH4A 3MNDA 4A7UA 1N19A 1DSWA 1OAJA 2C9SA 2Z7ZA 4MCMA 1AZVA 1XTMA 1KMGA 3T5WA 1OZTG 3CE1A 1E9OB 1ESOA 1TO5A 2AEOA 2WKOA 3L9EA 1F1DA 2WZ6A 5KBKA 3H2QA 4OH2A 1U3NA 2AQNA 1SRDA 3KBEA 5CU9A 3GZOA 2E47A 1B4TA 3L9YA 1SOSA 1CB4A 3CQPA 3GTTA 3KM2A 4OJAA 1TO4A 2AQQA 1OALA 2XJLA 1IBDA 4A7VA 3LTVA 1BZOA 1QUPA 1XTLA 2VR6A 3MKGA 3PU7A 3F7KA 1YAZA 1CBJA 2WZ5A 4N3TA 1E9OA 1MFMA 4L05A 3KBFA 1PU0A 2ZKYA 1F18A 3HFFA 1SPDA 2AQPA 4N3UA 1Z9PA 1BA9A 3KM1A 1S4IA 2NNXA 1F1GA 2K4WA 1RK7A 2V0AA 2Z7WA 1SDAB 2SODB 1Q0EA 2ZKXA 2WWOA 2JLPA 3K91A 3GQFA 2VR7A 1OEZW 3H2PA 4A7GF 2Z7YA 4A7SA 1F1AA 1SXAA 2WZ0A 2E46A 3GZPA 4A7GA 4B3EA 2AQRA 4A7TA 2R27A 2C9VA 1PZSA 4BCYA 2WKOF 4FF9A 4BCZA 3ECVA 3RE0A 1JK9A 2GBUA 1COBA 1L3NA 1SXNA 3ECWA 3HOGA 5KBMA 3SODB 1PTZA 2WWNA 1DO5A 1HL5A 2AQTA 4U4IA 3CQQA 3S0PA 1EQWA 4MCNA 1E9PB 1E9QA 1B4LA 2AF2A 2GBTA 2WYZA 2VR8A
chains in the Genus database with same CATH superfamily
4N1HB 1T5KA 1DBJL 2PPDA 5KBDA 1R5WB 2H6PA 3ZHFA 5F1NA 1UZ6E 5G5DA 5DJ8B 5I1JL 3PLYA 4ONOA 1JPGA 4YNYA 3RIAF 4B27A 2AJXH 5LAXA 4MJ2A 2N7BA 5BS0E 3VFGH 2X4QA 3NOIA 2DLEA 5A7EA 3UZEC 3PWNB 4PU2A 1U8CB 5K9QI 2XRAH 2Y06L 4H2CA 4QF1A 4MZ3A 3FB6B 4MMZC 4EE2A 1PYWA 2EDFA 5JTWA 2XKNB 1N68A 4IHBA 5KSBB 1QVOB 4AGNA 5AW1B 4H13C 4AQ8A 2DQ6A 1PY9A 4TQ8A 5C0EB 2BJMH 2LHAA 2XQ0A 5E6ZA 4IMKA 4ZQTA 3EJSA 1FAKT 4MMXB 4DP2X 1X5XA 2BRRH 4N28A 4ZMQA 3UGUA 1YEKL 1MIMH 3STBA 2Y7QA 3SGKC 1S9KC 2FQFA 4NUGL 2RFXA 3MX0B 2NXZB 4PRIB 3GHPA 3QYMA 5J3HD 3CHXA 3HN5A 1BXXA 2ZCKH 3F58H 3AREB 3ARYA 4YEFA 2GPZA 2O6DA 4XXDA 2ICWB 3WJMB 2W94A 4IDJL 2B4CL 1NCDH 4KV5E 5KSUA 2Q8BH 4JZOB 4DKDC 3F7VB 7FABH 2VUYA 2BHFA 4F58H 1FL6A 5DQJA 3CVDA 1U8QB 1EJOL 1LO3H 4F7MB 5D55A 2ZUVA 2XZCH 3AJ7A 2F5BL 3F5WB 4JPWL 3BPNB 3O6MH 3UBFA 3KCPB 2A9ML 3SO3C 5IT2H 5FGSA 1VACA 4N0UA 3WDIA 5IOPA 3THML 4AY0A 5I18L 1K4CB 1Z9PA 4TRPL 4WUKL 1S4IA 4PJ6A 1SMOA 4BKTC 3QJTB 5AOJA 3HRZC 2FZ3A 1A7NL 1UCBH 4ELMA 4F7PB 4WO0A 2OMWA 3C2SA 1T1ZB 1D5RA 4ELMF 2HVJA 4N8UA 3LKQB 4OZGA 4YLCA 1UB6B 4NS0A 2JJSC 4AL8H 3VGDA 3P9LA 2OSXA 2QZQA 5F1IB 3CDZA 3GRWL 1JGUL 4KFZC 5AKTA 3Q06A 1REIA 2IQ9L 4TS6A 5KVGE 1JI2A 2D03H 4WK2B 1T1WA 3LZRA 3W9DB 1TVBA 4N8CH 4ODUA 1DE4A 2VIRB 2VLKD 4ZSOB 1U8OA 1B9KA 3NZSA 1I7UA 2GCYA 2YD6A 3K6FA 4QOKE 3KE0A 3BEWB 4PJGF 1YEDA 3X1FA 2J1WA 4XX5A 1T6VN 4NPJA 4U1GC 3TBBA 1TYEB 2EZ0D 1PFCA 1UOLA 4PUBL 5IB5B 4L4JA 3ZO0A 2FWLB 1N6UA 3FN0L 3PXHA 5IIEB 1FFNB 2CUIA 1E42A 3C08L 2JCCA 3PHSA 2KMWA 4LLWB 3UADA 2BERA 2NZ9C 4LOUD 1U9KA 1H5BA 1M05A 4PJDB 1R46A 5BV7B 1CE1H 4QHUA 1L0PA 3SDAD 2NY2C 2DQIH 2CO6B 5CILL 1OT1A 2F58H 5EEVA 5KZCB 2JKLA 3BWUC 4Y4FD 5AUMB 4G9FA 2G2RB 5D7KD 5FGBA 5HYJD 5C70A 1LWRA 2MKLC 2HPOA 4UOW0 4QTHA 3QPXL 3BD5A 1URZA 4G8AC 2UUDK 3D4YA 1RJLA 1JWSB 3BP4B 2C9QA 3FT9A 4JDTH 2I7OA 3QUZD 5HYEA 2OP4H 5GSRA 5AW5B 1ACYL 1BLIA 4FQIH 1KACB 2YBGA 5I16B 1MVUA 2J57A 4DGUA 1MHCA 2YA1A 1N5AA 1MJJA 2OCCB 3G04B 4N87A 2CR0A 5HYJA 2UZYA 5I1GL 2PLTA 1S7QA 2N56A 4Z7UF 1BIHA 3IJYA 4UQCA 3AS0A 4A6YA 2WIMA 1WV7T 3LXCA 3IMTA 4NOBA 3JWNG 4Z95L 2F1BA 4M3HA 5D1XE 1LK3L 4G70B 3KPOB 3PHQB 5E70A 3EJYD 4AYFA 2FATH 1EHNA 2CIKA 1J86A 4Q9RL 4OR1A 1G7MA 1A6TB 2ADJB 4QHLA 3QEUA 4Z0BL 2XC8A 1O7DE 3V5HB 3GJFA 3B5TA 4GSDH 3BCDA 5HGAA 5J11B 2L0DA 2W65B 3QJUB 3HPLB 4DGYH 2BOCA 3VI4B 1EO8H 1ZLSH 1ZRUA 3UC2A 3B9KD 4U6VH 1QBMH 5LHDA 5J9PA 1L5GA 1M7DB 4IBWA 1XEUA 4X5LA 5F9OL 5FUZL 1UJ3A 4BHUI 4JMNA 3MRCA 4XB8A 5JW4Q 3O81A 4XNAA 3ECBB 5TF1L 5FW6A 2A4EA 1TEYA 3A0OA 2XKNA 1AXSA 4L4VE 1MQKH 3HAEB 1CYXA 2CDFB 5EEYA 1KYDA 5FK9B 4TNVF 4UT6H 3L4YA 3ZU8A 1H5BB 1M05B 4PJDA 3E80A 2DD8H 1RIHH 3IFLL 3C09C 5DJ0B 1EXUB 4XBMA 5D5MB 3P11H 4NQDB 4AIXA 4D0CB 3MX0A 3O2DL 2D3JA 3UCQA 3OWEA 1RCYA 4JKWA 3SBQA 4WJG3 4A2FA 4N0YH 2X9YA 3VFPB 4RWYH 5D2LF 4ZXBB 4RGNC 3SBWA 3EOBB 3HJEA 3Q43A 1KTCA 3D1MC 1CYGA 2LAAA 4NSKB 4R4BB 1OHQA 3N1MC 5DJ2A 4AW7A 5H2BA 5B1JA 4ZO9A 4YZFE 3CX2A 2QHLA 4PAZA 5ECGA 3ATDA 1H6EA 3VWKC 4H88L 4JJOA 4K9EC 1RD6A 3ULVC 1E5BA 1FH5H 1TJMA 4HKBA 5DSCB 4K5MA 3BKML 1E4WH 1IAMA 1F41A 3C12A 1J1OL 3LHPH 5AKVA 1U8JA 4NN7B 2VM4A 4KJYB 1XL6A 4BWWA 4TLSA 3LEVL 4JB9L 4XODA 4X9YA 1MI5B 3ELAT 3OXSB 4M62H 3ZE2F 4LL1A 1X3DA 4OZGE 4P2RD 4E5XB 2FEDC 1Y1UA 3HS8A 5J1SC 1GH7A 1X9QA 1OB1B 2JJVA 4ELMB 1WS7A 5DZJA 1Q1PA 3REWB 2Q20A 2X7LB 5FV1L 1V7ML 4XMPL 1KELH 3OLDA 4R8WL 1UENA 4F57H 2C3GA 1HAWA 1UATA 3WTYA 1JGVL 3WG7B 1YDPB 2EDDA 3UAJC 5C0RH 1HHKB 4NIYE 3OKKB 1G94A 4C56D 3RYMA 1G9EA 2X4SB 4HD9A 1NCGA 3QUYA 3V8CA 5EOCJ 1MOEA 5E2WL 3ARBA 3LPGA 3SPVA 3D7PA 3KLHD 3BH9B 4OY9A 4L9LC 4HJ1A 1FNEA 1X5IA 4AYEC 4OD3L 1AXTH 3WTWA 1FH2A 5LQBL 1JUFA 1ZV2A 4GKNB 4X4KA 2BZCA 4WSKA 5C2BH 5KSUB 2EKSB 1AHWB 5LVEA 3BAIA 4FULA 5EBMA 4E9WA 1HQ4B 4F15B 1BVLA 1IQWH 4HAFA 3WFEL 4GUOA 5H4ZA 2Z7YA 5BRPA 1XF3A 1DVQA 1NEZA 1A47A 4LSUH 2R2BB 3GZPA 4CW1A 1ZIBA 2O6PA 3MJ9L 1Z32X 1D5BA 4GSRA 2L7UA 1OE2A 1R5WA 2H6PB 4R7NB 3BP7A 3TPUB 4CMMB 1T5WB 3QE5A 1RHHB 4KNUA 1OAKH 5IFHL 1IEAB 3FK3A 1FZKB 1I31A 4QRSB 3I02A 1JPSL 1S7SB 2APFA 1BGXL 2GJJA 2NSMA 3TN0C 3OBAA 2OR7A 1JTPA 1TG8A 1DEEB 2QDVA 3U0WH 1U30A 1C16A 1BMGA 4Y4KA 3DI2B 5A7BA 1RIUH 3N6YA 4LFHD 4TUUA 2VTFA 3S97C 1FZOA 3O45B 2MKWA 4DK5A 5FDWA 2YMTA 4X7TB 4LPXA 5E9NA 5TDPA 1P0SE 2PP7A 4JN1L 4OVUA 3QVAA 3H3BC 2W95A 1HIMH 3HUJB 4DFIA 2DIAA 4UM9A 2DJ4A 1ZLEA 3VD7A 4GBXD 3WI9A 5TDPB 4HS8H 1FZMA 1QI5A 3PNWB 1NEPA 1L9PA 5T5FL 5AOZA 2WXQA 3PG2A 3QORA 3H7BB 5E4EB 1YAIA 5T1MA 4M02A 1K5NA 2XIIA 3T0DA 1KC5L 3KPSE 4FP8L 4HGKC 4M1CD 3I75A 4JO3L 2WBXA 2E27L 2J71A 5GGVH 4BE6A 3FQ4A 3DJSA 1HQRA 2CGRH 1XCQA 5FYKL 1ZDQA 5HGHB 4DFHA 4BEIA 4FHKA 4TN9A 4PG9A 4K23H 4GT7A 1CDJA 4UTAL 2FX9H 5EIIG 2D4FA 1J10A 3ARGA 4XMTA 1I9EA 3IXAA 1JWMB 4GQ9H 4PRID 1SLVA 4OGZA 3H1ZA 1KIRB 3QP3A 3MRLB 3S5LB 3L9EA 3KGTA 2HT3C 1TDQA 2UV3A 2VLJE 2RAMA 4D0BA 1HK6A 4JFPB 2NY6B 3LEYL 3GO1H 3D2UD 3HZKB 2GIMA 3O4OC 4RNRB 4FFVD 3EO1B 3O3EA 4WV1C 5I5MA 1BFVH 2P8MA 5F6HI 2QEJA 3K0YA 2VLJB 3DVGB 1PPIA 4MNGE 1AXSB 2ADIB 4CRPA 4R97C 1VF5C 4L8CA 5FIEA 3PFQA 2IWFA 4UNTA 5GRZA 4J39A 4G8IA 1DLFH 1SPDA 2LVEA 5C07E 1YN6A 3NFNA 5AZEH 1OARH 1Q0YH 2GTWB 4XCCH 1EZVY 4FQLL 4A2EA 2ZKXA 5BZDB 4FNLH 3DJTA 2PNDA 3QULA 1JGEB 3A21A 4HWBL 1R19A 4OM1H 4JHAL 3BC9A 2HJLA 1J9CT 1GZHC 5D2NB 5EOTB 4NP4H 3H2WA 4FABH 4CUCA 1I8MB 3BW9A 5HHOD 4NBZB 4NZDA 1U42A 4WWKC 3DX8A 4UDUB 1NZRA 3D85A 1BQUA 4RMSA 4PVMA 4U05A 4DK6A 3IDYC 2RGSA 3DSFH 1P5UA 2WY3B 5CJXC 4P9HH 1DVTA 1TJHL 3PJSB 4TL4A 5GISL 3L2MA 3DYPA 4EI5B 5GS0D 1LEIB 1UD6A 1WT5C 2ZXBA 3TFKC 4Q74A 2HT2D 3PGDB 3VD3A 3PUUA 2AGJL 4OCYH 4Y2DB 4PJIE 4UAOC 4GXVL 2UWEA 3GSNH 1OSZA 5IB4A 3KCWA 3VFNA 1H19A 2IANE 3IDGA 3MROB 1XGRA 2A83B 2QSVA 5C07A 4GG6F 4IIQC 2CHXA 2RCSL 2X05A 3SY0B 1GZPA 2P42B 4KROC 2RIKA 2RBLA 3PWJB 1G43A 4DTGH 3G6JF 5CJBA 4Y2OA 3TO4B 1KIPA 3C2AH 1WBXA 1IZJA 2EDEA 1A25A 2W0FB 2DJSA 4UV7H 1AACA 2WQVA 2ARJB 4MRBA 3HS0A 5GGVY 3MC0A 1NAML 4NN5B 2C9AA 3QZMA 4GKSA 4KKCC 2Q87A 4F8TA 4PGDB 1UVQA 5IMKB 2R2EB 2QSTA 3LZQA 4KUZL 3HC4H 4CGUB 1FL3B 4V1DB 3STLB 5HHXH 5BQDA 3BKYL 3HE6D 3TA3B 2KT6A 3ARGB 3WN6A 4PMFA 1UTDA 5CGMA 1I7ZA 1L0YA 1X5YA 4CDHA 1G9ML 1ODUA 5C0AE 4XBPB 3ILPB 4K8RD 1EUUA 4HAKA 1D6VH 2F15A 1JN6B 2IG2H 4P2QE 4GW5B 2GC7C 4W9KC 5E8EA 4YXLH 1DR9A 3TZVA 3S88L 4LP4A 3OF6A 4RISL 1BF5A 4Y89A 1O7DC 2C7UB 5F44A 4MA7H 4HZAA 1ILUA 1YEDB 2AQQA 2W60A 3L9RA 4ZOEA 3LYRA 2F7PA 1PAZA 3DNKA 5T3ZH 4EDXA 1QPPA 3V52H 2X7LA 3OZ9L 1E40A 2PO6D 1E9OA 2ZG2A 2ENQA 2Y1YA 5IHWA 4J3OD 2VLRE 4ODUB 1KLFA 1MH5B 1YEFH 3N3EA 3CAFA 4E5XA 1JXKA 1E28B 3IXTB 4MB1A 5FO7A 4OZIE 2AS5M 2WZAA 2B3IA 3BJ91 5HHME 4OFYA 4OFQA 4HZLA 5KAQG 2F7OA 3VXMD 1D7DA 2R1YA 4ZFOL 3BUIA 4G1MA 4OZIF 2ED8A 2VSDA 3OKNB 1NIAA 3RHWK 5F6HJ 1WBZA 1CBVH 1WZ1H 4NXKA 3CFDA 1TZIB 5DYFA 1OM9A 2QR0B 3EOAA 3OV6A 5DMIH 2HTKD 5DYOB 4NM4H 3RIAK 3MCG1 3W56A 4U1LA 4CU6A 4HC1H 5B1KA 2Y36L 3MLVH 5DD3H 5E6SB 4JO4L 2EXTA 1OV8A 4P5MB 4ABVA 4B50A 4PJ8B 2OTPA 1XCXA 2NY7H 1TETH 3FUDA 3HIZA 2HKFH 4RMTA 3D3VD 5CJ5A 5DURB 1HYSD 1LHZA 3HNSL 4MD0B 4MSWA 5EUOB 4RAVA 5EIVA 3B1UA 1NANH 4G9FB 2V9TA 3VXRE 4KTEH 1DANT 5DJ0A 4NZFA 1GR7A 4HLJA 2ERJB 1GHFH 3QIBD 2IDQA 1A7OL 4AKPA 5CM1A 3AWEA 4PS8A 2FUQA 1VENA 3FO9A 1IM9B 4KY1L 4BGLA 3NJHA 5DQ9B 5KJRL 1JUFB 4HT1L 3R8BB 3RURA 1R34A 4ZO7A 1PCSA 2Z8SA 4ADJA 2J21A 4EN3A 3CZFA 4PLKD 1Z9MA 4FQ1L 3L3IB 5LLIC 4AH2A 4HFWA 3VFVA 3MLRH 3O6FD 2AEPH 3UAJA 1BQHB 2WYTA 4N2OA 1N64L 4PV8B 4OKDA 4MD4A 4Y2DD 4XPAH 5E8NA 4HPOL 1MAMH 3QJSB 4M5YH 5C08D 3MOAL 4WCYH 4DGIL 1MF2H 1PLBA 2P49B 5B1CA 3QZWA 1PKQE 5ALCL 3GI8H 1F4XL 4PCSA 1NANI 2PXYB 3IGAA 1BD2E 1QABA 1XB3A 1OAQL 4ADIA 4EIBA 1J0JA 2XA8H 4U7SA 4WHDA 3CC5B 1KGWA 3QUHA 2R8SL 4OGXL 1M1SA 1Q9OA 5EF0A 1P4LA 3VUAA 2OYMA 1MCDA 4F33A 3TLRA 4DOHB 1D7FA 2VDQL 1IARB 4UQEA 2O5ZL 3IXTA 4HBQA 2NSXA 2VWEE 2XWJB 4OH2A 1SRDA 3VFRA 4M9PA 2E47A 3NABL 3M46A 2FD6H 4ZPTA 2K9FB 2I27N 5KVDE 1CDGA 2NXYB 4PJXB 3WTUA 2Z6FA 3LTVA 2B1HH 2FGZA 2Z8WC 2WTOA 3HZMA 5DUBB 3DUUA 4J4PD 5FYLH 4F5CA 1DVYA 3HE6C 4X80L 1KJ2H 5AAPA 3U4EB 2C9PA 4FLHA 5B8CC 4LGSB 5BRZE 1B90A 4NO2B 1SQ2N 3CVHH 1F1GA 5L4FA 1SOKA 4B9YA 4AM0A 3ABKB 3U7WL 4ONFH 5FO8B 4H25A 4WFED 5DD1H 4A63A 2TSBA 4UQ2A 5C3LD 5EV7A 3JV4B 4MJ4A 4M93B 4YVUA 5IOKA 3UDWA 1ROCA 1CXLA 2FRGP 5FA4B 3FJTA 3X14B 3HBPA 4N2LA 5JOPD 4L9DA 1NWPA 3I6LD 4NNXB 1P7QB 2R29L 5CP3H 1U0QA 4AEFA 1VKXB 1RUQH 2YGQA 1CDIA 2OMYA 5A2JH 3W0WA 4Z5RA 4FYQA 2AFNA 2P5ED 3O11B 4B3VA 4PY8J 2IH1A 2X9ZA 3IKKA 2WMPA 1XBRA 3QXDA 3ULSB 2OZ4H 4U4BA 1ND0A 1OAXL 5IBTL 1IILE 1UADC 1JZ6A 5E1AB 4XBPA 2GTZB 4HFWB 2X6MA 1KYUA 3O3DB 4ODTH 4M8UA 2X2IA 3QXVA 1K3ZA 1O7SA 4HS3B 5IVXB 3ZBMA 1K5WA 5HHNA 2UY7A 1XGYL 2ZG3A 4QHLB 2WXKA 4HIXH 1MFCH 1S3RA 3NJJA 4N2KA 2YGOA 4IOFC 2ESVE 4LT7A 2K9UA 3V0VB 2HFFB 2CIIB 4YHMH 3HLAB 2BSED 4YDMA 3PDDA 4UBDC 5GZND 2DBLL 4KK5C 2YLHA 2OMTA 2C3WA 3QDJD 4JQIL 2CK0H 4RX4D 3GBEA 4C56E 1SJEB 2ENSA 3C5XA 4NAMA 4I3SH 4K94C 4PGJA 4FG6D 4GO9A 4K7PY 5D7SH 4FNTA 4MAYA 2ZF9A 4JCWA 3U7YL 1JXJA 5DC2A 2IV8A 3SPHA 2QV4A 2ZXDA 2A9AA 5E9DB 3IKCA 4MAUH 3U0TA 1SUJA 1IGTB 4EKJA 1RZGB 4DSYA 3H3KA 5EWIH 1CGSL 1XTMA 1WYJA 1KCRH 1FNLA 5DVMA 5DMYA 3L2LA 5CCHE 1CG9B 4OD1L 3IBOA 4ORGA 4LOUC 5EBWA 5ILTL 5JIKA 5JQ6H 4E68A 4FZEH 1R3LA 5J6GA 1E5ZA 2GW5A 4HJ0D 4PJAF 4MCZB 4LKXA 3STZA 2WXHA 1OGAB 1IM3B 4HSCX 1E7UA 3ULVD 1RK0B 3O0RH 1NBVH 1NGZA 3EYOB 4KU1A 3RQ3A 4O58H 1CI5A 1UM6L 2KZWA 4P49A 3UTTB 2PKDA 4WHTB 3S2CA 3O3EB 4HW6A 4HUVB 5EZOH 5IMKA 3QFDA 1IFRA 4PRDA 4ZW7A 4HIIA 3MFFB 2WP3T 2V17H 4FADA 3WBDA 3HZVB 3WJLA 2WTRA 2X6AA 3MOBL 4LLWA 1L0XA 4M7KL 2ARJA 4KOBA 4JVWA 5GRVK 5E6IC 2XN0A 5EEZA 1DQJB 1SEQL 4RMVA 1WFTA 2SODB 5DU7A 3NIDB 4PJ9B 2CMRH 1XGUB 4HCGA 5I6OA 4P4RA 4D7BA 1F1AA 3FOLA 1A5FH 4N0FB 3UZEA 4ZO6A 2AJ3A 3HMXL 4BFGA 3Q9PA 3OLIA 1AC0A 4K8RL 2Y24A 1MFVA 2YWZA 2DWYA 3JWDL 3D0LB 1GYVA 3IK2A 1BZDA 1P5UB 2JJTA 1KGYE 3CDGB 2XFXA 1XGTB 2C1OA 2C34A 3TWCH 4FLSA 4FZ8L 3IXAB 5DHYB 1IC5L 1GGYA 4IS6A 1HEJC 3JYBA 3L4TA 1IL1A 2JF1A 2JKNA 2NY5H 2OMXA 5C0ND 1JWUB 2HN7B 5GS1A 4PYHA 2R23A 1FGNH 4EN3C 3OAUL 3MUGA 3D39A 3IDMA 2EEAA 4AI7A 3IB4A 3LIZL 2DLTA 3ZMEA 2AKRB 4XP4L 4TOYH 1BQRA 4WJKB 3TURA 2UYLA 5ACLA 1HI6B 3CC1A 1U3HB 1NMAL 5IJVA 3D39B 5FWQA 5GHWL 5EZIH 3GJFK 3CGTA 3SJVD 5F9JB 4TPRL 1VIWA 4YFDB 3FTGB 1PG7X 2V9RA 3BVVA 1KTDB 5CGYC 2I60H 3EUUA 1IBBA 4LHQB 4HPYH 2A77L 2H32H 2WXOA 1RZPA 3KS0H 3MNMA 1CLZL 1A2YA 1OGTA 4HUUA 2ZAGA 3TT3H 4XOEA 4JY6B 1G9HA 3SGEI 4IEFB 5I8EA 2EYTB 1LP9E 3QJQB 2IWKA 4LCUB 2HRHA 3PCYA 1IBZA 2NW2A 4PGBB 3VD5A 4QHNA 3QJZA 1AKJA 4OFPA 1TO5A 4FMKA 3LN4A 2BY1A 3CZUB 4LESA 4DESA 1XGQA 3VRLE 1U3HD 4GEJA 5KOVC 1EZLA 2AQNA 5JHDD 3I9GL 3TBSA 3ZDZB 4I4WB 2Q3AA 4PSRA 2GTZA 3NCJH 1CFTB 4M48L 1PZBA 3Q8AA 4Q9QH 1LO0L 1SN5A 1RK1B 4ONGH 1XF5A 1ZVNA 3IFPB 4B5EA 3FCSB 2JSFA 3IDNB 3OHXB 1DJYA 2WMPB 1V5JA 1WBYA 3WY4A 1USQA 1MNUH 1AY1L 1XFPA 4AUUA 1YQVL 4JCMA 4IW4C 4MJ6B 2V33A 4E41E 1MSPA 1CYWA 1T2QH 3QXUA 5IESH 2HLAB 5IHHA 4OLYH 4KI5F 1BZEA 1ASOA 1JZEA 2QQLH 3JTTA 3UMNA 2J2ZA 5LWYH 5MEQA 4MNQB 1UWEL 3C60D 2BNRB 1FIGH 4AT6A 3ETTA 1FE8H 3BFOA 4JGUA 3TCTA 3VU1A 4QI3A 2XXCB 3T1FA 3VNZA 4U6XA 4KI1A 1QNZL 2V5YA 1MFAL 3S37X 1J8HD 4ZFOB 1JGLH 5TQ2H 4B3EA 5CFAA 1R24B 1GMEA 2VL5B 3KPLA 3WEAA 1VPOH 2F5AL 3O6LL 4QTIL 4MXWH 4F8PA 1AGCA 1WG3A 1BX2A 1JZIA 3BWSA 3DURA 4XPTH 4XP6H 1A6WH 1F6AA 3DARA 1BOYA 3GBML 5JHDA 4JFZH 3TYGL 4KNQA 1DQTA 4H8HA 1N9PA 3ZTNH 3RUGB 3QUMB 3O6KH 4RQQA 2EIKB 4MCYA 1NC2B 4P2AA 3MV8B 4TQHA 5T1DH 4HLZH 1AKJD 5MERA 5C0IB 5DEJA 5KVFE 1EDHA 2AK4E 3S35L 3S5ZA 5E6YA 2QELA 1AGEA 3KHQA 1L9TA 4LFHG 4EEEA 2JKXA 1ZA3B 3D18B 4CN1A 4Z3TA 4PJFE 3TBCA 3ZKND 2YKLL 4A39A 3MJGX 3CSYB 1QRNE 1U33A 2V5TA 3KVPA 2J1KA 3QPQC 4K71C 4FOMA 3KYAA 4BH8B 4OV5B 3S34L 1NFKA 1IKNC 2ZP0T 4JANB 1YNLL 4NSKA 2E7DA 4WI0B 4XC1H 5JA9A 3DRTB 4MBOA 4HEPG 3G5VA 1LGVA 4G7VH 5GGRB 3SD5A 3ZT6A 2F53A 1L3WA 5DJYB 1UKQA 3DOSB 3VD1A 2DQCL 5IFJB 4YHOH 5T33H 1LO2L 4WWKD 1GS6X 1EIBA 1RULH 1VFOA 3NP4A 1BVLB 4YXKL 2EYSA 4YDIL 1XAUA 3QAZC 2WVVA 4X5XA 1E7VA 2AAVA 3KPOA 1G7JB 1IAII 1SUHA 8CGTA 5KVGH 4Q56A 3U83A 4HIEB 3PV6A 3GZOA 4AE1A 5DJAB 4F91B 4RFOH 1CB4A 3SGDI 1A4AA 1CGTA 3QJVB 1C1EH 4LBEA 1HL9A 2P24A 1OCZB 3L4ZA 1QD0A 3QIUD 1Z9LA 4FQPA 2WBWB 1QEWB 4P23B 3C5ZA 4UOW1 4QRFA 5DWPA 4D0DB 1A1NA 1NIDA 3FQWB 1IEHA 1HHKA 4KROD 3WCYA 4ZMVA 5DO2C 3P73A 4YN3A 3U9WA 3WMPA 2MPAL 1P5VB 5DRWA 3KPPB 2WJ7A 3RY4A 4Q14A 3SDYH 1L0QA 1V10A 2YOCA 1CLVA 2OMXB 3MBWB 4MDJB 3FFOA 3KWTA 1W8NA 4HG4K 1DVZA 1Q9WA 5KS9A 3ULUL 2ZAIA 2I5YH 3H3PL 2WQ8A 2Q1EA 4HWZA 4MNHA 2A73B 4DH2A 5EO1B 1A0QH 2OYLA 5D5MA 3UACA 4DQOH 4HWNA 3EGDA 3PF2A 1J9TA 2ZWNA 4PV1C 1H8NA 1YA5A 2RMNA 3MREA 2JJTC 4BBWA 1JG9A 1V3KA 4PJXF 2AQTA 1DJSA 1SNRA 2Y6SD 2Z1PA 4IJTA 4FQ2L 5K59F 1HT6A 1BXVA 2VDNB 4OI9A 4QAMB 4ENEC 5ANHA 3KDMB 5H2BB 5J1TC 3QZWB 4M1CC 5SWZD 4HOMA 4QHMB 4HJEA 4OBSA 2HH0H 1I8LA 3E0GA 4PEEA 2KI6A 3WENA 3QJHB 3A4DA 2BSTB 5IBUB 4WUUD 4LSSL 3VGAC 5DI8B 2I07B 4ZQKA 4U2YA 5HHVH 5I30L 3TEXA 5ITBL 1N2RB 3CBKB 4U7KA 4M7LH 4H0GA 1ICTA 5TPWH 1XZWA 4OI8A 4L1HA 2FWOA 4UUJB 3TS8A 2H3KA 4M1DH 4G59C 2A99A 3UTSA 5D1QD 2R4SL 1I3RB 4LIQE 5DEGA 3GXTA 5I6PA 1P53A 5EMYA 2O5YH 3KR3L 1M53A 1BQ5A 3SSGA 2QQNH 3KG5A 3V95A 3V55A 3OX8B 2BSEA 1KPUA 2UZIH 2FL5A 3HKFA 4O4YL 5I1KH 4HSQA 3CPLA 3AXLB 3ES6B 4A67A 4XMLL 3RKDC 4Y2NA 4L8SC 4QRPD 3QIWD 2WBJA 2XWZA 3AT8A 1BM3L 2X1XR 4OFKA 4Z78B 3RPIB 1JRHH 4XPFL 2D9QB 1JWSA 4UOJA 3LZFL 3WFBL 1EHLH 5D1QE 2JE8A 2D3LA 3QIBC 2KLRA 4HIHB 5SWSE 3TVMC 4A6YH 2FO1A 5JOFA 3SPIA 3H9ZA 4RGOL 4WHCA 1K85A 2E7MA 1HCYA 3BGFB 1OT2A 2R0WH 4UWQB 3W0WD 4IBVA 5K9JH 2Z93A 4J3TA 4Q7DA 5E2UH 2AZUA 2BP3A 4AQEA 4EBQH 3TN0A 1PW3A 2XWEA 1N8OE 2GIXA 4U1KB 4L37A 3QDMA 4X6CF 5I6LA 2HLFD 3M1BA 4GAJH 3PREA 3FS9A 1QWNA 3K6OA 4PJHE 1JRHI 2ENJA 5B38B 4RDQF 1FLRL 5SX5H 4XCFH 1DBKL 3VSTA 3VGBA 2BCMA 3D3VE 3MACH 5EBLB 2RJMA 1Y18A 3IJSA 4ZRGA 1NMCB 2YO3A 3P0VL 5F3HA 3F5WA 5D7IE 1QW9A 4LCIH 4F7CB 4HKXB 5ID1B 2WQUA 4NUQA 1Q9KA 4WFGD 1XXFC 1NGPL 3PABA 1AD9A 5IROD 3BGMA 1A6ZA 1S9XB 2IGTA 4CAGA 1J5DA 4ZAKC 2TRYA 3GXFA 2OPCA 4YDKL 1QWHA 2LU7A 4KKQA 3N1PC 1IGFH 4YUEL 4AQAA 1U2HA 1FYTD 1DQKA 4LIQL 4JVUA 4GKZA 1ZMYA 5DI8A 3KAAA 5FXCH 2FBJL 3VMNA 4PWHA 3F12A 1TJIH 2BWQA 3ULUC 4ZTPH 1IAKA 3CUPA 1GY1A 3KVDD 3KXFA 4B7LA 4HA1A 1FORL 3GMQA 4HGMA 3SYOA 4P2RE 3DX1A 4FQQB 4NB7A 5SWSB 3JXAA 1DL7L 1SY6H 5C08A 2ZSWB 2X44D 1IFHH 1CLYH 1QHQA 4AMXA 2WQSA 3O6FA 3UAJD 3DIDA 5FKPA 5JIDA 1QEWA 4P23A 5TE7L 1CR9H 4UT7L 4L2YA 1YNTB 3RDTD 1F56A 1S9VA 4KI5C 4HZLB 5CWSA 2D7TH 3V6OE 4XO9A 1TTRA 1S7XB 1A9EB 3LKNA 2UXGA 1WHOA 4KMQA 4OF7A 4UDTA 2WXMA 5AB2A 4K3EH 1L9NA 1N7ML 4UIMA 3AADB 2XG4A 5H37A 3D3VA 3L9YA 4TNGA 2I25N 4Z3HA 4XO8A 3VW3H 4B7IA 2X6UA 2PW1A 1ZLUK 4JFOB 4XNQB 4OIIL 1XF5B 3IFPA 4MZ2A 1AJ7H 2OSLA 5SV3A 4G42B 4I8DA 3BUDA 1P7HL 3F7KA 3QZPA 1A8ZA 1CBJA 1IEAA 2X9XA 3N2JA 2QQKH 1K8DB 1F3DJ 1I7ZB 3AWFA 1UT2A 3CFCH 3V5DA 1AD0A 2Y2TA 4MQSB 3Q2LA 5E9DE 4WHYG 4EJ1C 5C09D 3T1WA 2FYYA 4EUPB 3NJMA 1JERA 25C8L 2NX5D 1IQDA 5A6IA 1ITCA 2BLFA 3RBGA 5AYUH 4LSQL 2UUDH 5I66A 1P4BL 1BECA 3WHE1 2WWOA 5ABZA 5IW1B 4Z8FL 3VRIA 3FF7A 3I50L 4WI5A 1OEZW 32C2A 4IGBD 2ZKHL 5DWUL 3OJDB 4U6TA 1IAIL 1RURL 3Q8EA 4W9JC 5DJ8A 2PYFB 3EJJX 3HG5A 4HJGB 4GMTL 1F90H 1OF2B 4ODVH 2PO6A 1DN2A 3C8KB 5DJXA 3ZL1A 4DGWC 5I1AB 3U36A 1AFVH 1T0OA 5L8JB 2CG9X 3U9PH 3O9WB 4J6RL 5F9JA 3S2AA 5C8JB 1BAWA 4CMHC 1YY9C 3QO0B 5AW6B 4CU7A 2FLRT 4ZXBC 1LWHA 4APQB 1UM5H 2VDOB 5JPNC 2VL5A 3KPLB 1JNJA 1N67A 3NRQA 4HUWB 4YE4L 1RVFH 4AYID 2BWIA 4KI5D 3EYSL 1AGEB 4GOSA 4ZD3L 2VL4A 1LMKA 5GRYA 5M95B 5LBSA 2AP2A 4OLVL 3TIDA 4KFMA 1PD1A 2WLIA 2WSDA 3MYZA 5AZUA 2N3JA 1ECYA 35C8H 3VXRB 1ZT1B 1D6EB 4Y4FB 3T6WA 3P4NB 4CVXA 1J8HB 4PY7A 5C0GB 4TLTA 1ACXA 4XZ4A 4ALAL 4HKBB 3D0AA 3B9VA 2DQJL 4IGBC 1NFIA 4XMVA 4PRHD 3L7FB 2ATPB 4YSOA 4ES9A 2GSIB 3RZCB 3M45A 1MCBA 4QRSA 3DK2A 5L9DL 2XZZA 1TNMA 5HY9B 1EEQA 5I0VA 5J06A 2VXUL 3T5WA 1GPOL 5INCB 4WU7A 2OTUB 5DLML 3MNZA 1GGCH 1HNFA 1E90A 1DVFD 4R0LC 1M7XA 4NENA 3DSNA 4U1MB 4Z7WB 5I8OH 3ARDB 1TTGA 1OAUL 1E2VA 2G5BA 1KT2B 1WK0A 2WHVA 3K72A 3TV3L 4NENB 3P4LA 4LVNC 5B3SB 1BG9A 1OP9A 3MRLA 1G7LA 1OO2A 3B7UX 3EOTH 4LQ1A 1UWXK 4NXSA 2WAHA 5DT1H 1ZHLB 2ESVB 3ECBA 4NI6A 1MEXL 3I9IA 3STZB 3ZMNA 4FQHB 4QT5B 4F2MB 5LBGA 1V05A 2A6KB 3MKKA 4ZMPA 1BA9A 4DP4X 5CN1A 3KJ6L 2PETA 4IU3B 2Z7WA 2Z65C 1T7ZA 4S1SL 5FS5A 1A6VH 2XQBL 4X4ZA 7PAZA 3QEQA 1GC1H 2XWBB 5FYKU 2UVEA 1QG3A 1WEJL 4UYQA 3FFCA 1S5HA 2CCVA 3FH5A 1JPFA 4WFEE 1S78D 1LXMA 4BINA 3FSVA 1Z3RA 4KDTA 3QQXA 3C9NA 4J8RB 1OAYH 4QRUA 3FAWA 4I88A 1IM9D 3V6OC 1RPKA 2WXLA 3NSXA 1U3JA 3G6DL 3OB0K 5CNHA 3D2UA 3WSQH 3BAEH 1G4MA 5IEHA 4OLEA 3C6LA 4L1BA 4X9BA 5E08H 1KDJA 4YFLF 1BXAA 4DO6A 1JK9B 4EKXA 2VQ4A 2Z8RA 3QULB 1IT9H 2AJ3B 4Y4HB 1MCPL 2EINB 4MA8L 3U0PB 4P2YA 4I3RH 4TYUA 3TBTB 1L7TH 4GS7C 4OT1H 4GUCA 4Y5VC 1MFEH 2BS8A 2GEEA 2EUXA 1KFAL 1N18A 3FB5A 1TZHB 1JGIA 1HFUA 1MRCH 1VESA 4M6NH 1XIWD 5FO9B 1RJLB 3BP4A 3QRLA 5GS0H 5I1HH 3E1ZA 3UO1L 3LPFA 4UYPA 1GGBH 3V4UL 4CKQA 2DI8A 3MMEA 3QORD 4NT6B 4K5OA 3QWRA 1U93B 4QRQA 3AZUA 3HZVA 5EULV 3B37A 4B9KC 2JIXD 4YSUA 1VDGA 4GBXA 2HCZX 4FFTA 4WSJA 5IW1A 3DSNB 2FEJA 2Y5TB 3RWFA 4H8WL 4NPYB 3F04A 2ORBH 3L6FB 3BGMB 3ULVF 4FYTA 1EBAA 3M07A 4NFBA 4XBGA 3WNNA 4G82A 1D2OA 1KTLB 2ZUYA 1NCNA 5D1ZB 1ZGLP 2Y2YA 5E00B 4Y4KD 1NBQA 2FIRT 5EN2A 3QDGD 3FO0H 4Q4IA 4JHWL 2WZ6A 2VN5A 1WFOA 5D6CB 4KZDH 3A6CL 2B1AL 2E6QA 4M6MH 5AOMA 1NGYA 2VDOL 1RZJL 2HKHH 5HHQA 2OI9B 1MHEA 3MSPA 3WIAA 1MPAH 1ZCRA 3H9YA 1M56B 1BYPA 1GYAA 4ALAC 3QNZA 3N50A 4AITA 2XZQH 4JHZA 4NNXA 3JVGA 3UTTA 5AOIA 4AE0A 4BZYA 1RZIB 4B9JA 5HDQL 3S96B 3TIDB 3WAKA 5C09A 3QCVL 1NCCH 4X5QA 4M9OA 1CVSC 5FO8A 4MCZA 3MRBA 3ZHLA 1UYWL 2VLKB 1NDTA 3CLFL 1U21A 1TTFA 2EIMB 1KJ3L 3L3KA 2DV6A 4XI5D 1TSHA 1UT9A 4XR8C 3C5JA 1JZGA 1ZS2A 2AJUH 1P9MC 3NCMA 3R4RA 4IMKC 5CLXA 4ZMAT 5I75B 1KLUB 3DKHA 3P9MA 3T09A 4TVSa 4A7TA 1SM3L 1FG2B 2LW3A 1NIBA 1ZHKB 2AJSH 2QLVB 3RE0A 5C7XL 4OCSL 4K55A 1MCQA 4XCEB 4J7RA 4YS4A 4D0DA 4UIKL 2O61B 5H8DA 1W72B 4K7FB 2PYFA 4HJGA 4GAGH 3GHEL 2JK5A 4ES8A 2H1PL 2ZX7A 3ZT5A 1NEZB 3GNMH 1RP9A 1XSIA 5E5UB 3L5IA 3VRIB 4J3UA 1Z7JA 4LNRB 4XH2B 1UH4A 3MV9D 1WFIA 5FGBC 1Q9OB 4C4KO 3O2WL 2HFFA 2OL3H 4HBCL 2DQTL 2ICWJ 4ODSL 1RZFH 2FYYB 4NN5C 3LQMA 2AERT 1SF5A 1YMMB 3PQYE 3GSQA 5CAYB 1YQ2A 2EO7A 3WLWC 1A7BA 4TVUA 2Y7QB 4JRYB 1SJMA 3UCRA 3HI5L 5FUCE 3BP6B 1CZ8H 3MJ7A 4FXTA 4U1SA 5C0EA 4QO1A 2AJYL 3Q7JA 5GRVL 3KBHE 3GJFB 3FU7A 3RA7H 3AG2B 3V9FA 2XZAH 2OQJB 5EUOF 2EE0A 1JNLL 1KLUA 2BFVH 2ZOKB 4G3YH 4JRXE 5AB1A 1A3QA 3FO9B 1KN4L 3IJEA 2EIEA 5DR5H 4AGLA 4WI8A 5C0CE 5GPRA 1S7XA 4HX1A 1OOAA 2ZOUA 3NUKA 4JUTA 1ESOA 2R56H 4HU2A 3D0VB 3BQUB 2VDMB 4GRMA 4RFNC 1YNTA 3O8XC 1O6TA 3MR9B 5E7BA 1I53A 2VMCA 5CN3A 3SE9H 4XXCC 2WP3O 3UG4A 3AM8C 3R1GL 4I48A 3ABMB 2FQEA 4YWGL 4NDMB 4F93B 1CFMA 2FZ3B 3RGBA 3SOBH 1MVUB 1PLAA 1T7WA 4U0QB 4JY5H 3S3JA 3MA9H 2QADC 3V9CA 4JAMB 3SQOL 1GS8A 4WKXA 3FCTA 3O2VL 3OJMB 5CLZA 3GLEA 3QZLA 3UYRH 3B9KA 4ZXBA 1U8IB 4Z76B 2VC2L 4LGPB 4YPGB 3QK0A 4TQEL 3HLKA 2DI7A 4WHYH 4XO5A 3ZE0E 1E0OB 4R7LA 1PBYA 3KPSB 4ZS7L 4JPKL 1O75A 1X5KA 3QO1A 4JFYB 4YC2C 1QSEB 4ZFFA 2FH8A 2NX5B 1OTUD 3FOMA 3DX7A 4R4FL 1E4KA 3FQRB 1DJZA 1ZTXE 5ADOH 1KWKA 2BNRA 3DTXA 4AEHL 1PKQB 4YOKA 3HB3B 4JDZA 1L6ZA 4GXUN 2R27A 3D6GA 1QSEE 2ZX8A 4KWUA 2XYBA 3SQBB 4IJ3B 3MGTA 3LQAC 1BWWA 3AB0B 2RFXB 3NIGF 3ZVVA 5I0DA 3ZX1A 2ODIA 1TVDA 4L23A 3FSOA 1KY6A 4YX2L 1A14H 1B0WA 2BVPB 1WA0X 3T0EB 5F7AA 2J56A 3VWKA 5IIEA 4LCYA 2JKRM 1NBYA 3IM1A 3LDBC 1GYUA 3BE1H 3LEXA 1J48A 3BXNB 1EDQA 1C12B 1ZY9A 2AC0A 2VERN 5BV7L 3IETB 3MJ8A 2VDKL 4N6RA 4Q9CA 1YPZA 1J88A 4MS6A 4G5ZL 3EG9B 4LPYA 1DVFB 1PZ3A 1INEL 5DTFB 3QCUL 1MRFL 1IC7H 3NH7L 3L3JB 2MWCA 3VM7A 5F2FA 1X6LA 5KSAB 1IVTA 2VLJD 1SOXA 4MB4A 2WOBA 4QJ4B 4F7PA 5B4MC 2VKXA 3E3QC 1T03L 1HILA 1MHCB 5GZOD 4FXGC 1NLDH 2VH5L 2RACA 2CR3A 3MUUA 2XFGB 4JR9H 4I18B 1ZS8A 2Y6TE 4O02A 3WHXB 5BMFL 5KYXA 3RP1A 1KBPA 3WD5L 1OSZB 2Q10A 3TNMB 2NXYC 4NQEB 3DOIA 1GRWA 3QI9A 1R5VB 3MUJA 4GIOA 4WY7L 5I76A 3MA7B 3KW8A 2B2XL 4XAKD 1WVZA 5A6MA 2ZX9A 2DYPB 4XRCB 1EEYB 1Y6KR 5DZOA 3MRJB 5ESAB 3WUWB 4FCHA 1U3NA 3FTYA 4FKHA 3FMGH 1E4JA 4P05A 4XI5C 1A4KA 1CFSA 2AJXL 4AT6B 1UG9A 1RFDH 1NUFA 2A6JB 2OJZH 3VD2A 1G7JA 5KZCD 2Y5TA 2HVKA 4NHCL 2XRAL 2Y06H 3KJ4C 1MI5E 5IJCC 3EJZC 5BUAA 3ABGA 6CGTA 3MMEB 4N2FA 3U9UB 3MFGB 3TZVB 4K7PL 3T2LA 2DMCA 3NZ8B 2V2TA 2AJZB 5DJYA 3QJHA 1ZXKA 5I0YA 3N85H 2Z31A 1KCSH 1F58L 4S11A 2Y69B 3QIUA 2EC9T 4IMLB 5CP3A 4A7SA 1KTLA 2J20A 3ZKSD 5EZLA 1GIGL 2E46A 4FL4B 2R83A 1QP1A 1VB9A 1LNUA 2C9VA 3P69A 4LLAA 1JK9A 1OP3H 2OMZB 3NGBC 4R6UA 2B4CH 4P3DA 3KLLA 5KJ7E 2JXMA 2QKIB 4LCUA 1WAAF 3WL9B 3GSUA 1ZA3A 1U8MA 3D18A 4F58L 5D71H 4HJ0C 2QVIA 3QORC 1EJOH 5I74C 5JHLA 1S9WA 3QDHA 1O9WA 3QZWG 4RMUA 3OZKA 3LD8B 3QYNA 1BFOB 3DMMD 1B4RA 4Z7OF 1BMWA 2E4TA 3B2PA 2BO0A 2Y07H 4KVCL 4KKNA 4W93A 3VDAA 3FB8A 3LPOA 2G60H 2DB8A 2WIIB 4JM2C 3UPCA 2LAGB 4OF3A 5LCVA 3LXAA 3QG7H 1F4YL 4WUKH 1ROWA 1QLEH 4OKVB 4XGZB 3P3RA 1XT5A 2NXZC 2R23B 4WZ9A 1Q94A 4OQTH 3MYJA 3WNPA 5IW6A 1UKTA 2MPVA 2J8UF 1WS8A 3ISWA 3ZL4L 1YJDH 1QO3A 2DLGA 3BP7B 1JZ7A 2ADIA 3D85B 2LU5A 2WNKA 2JTYA 4YL9A 2FJHA 3HNVL 5C3TA 2AQ1A 5JIPA 2D9CA 3QHTC 3KH4A 1QATA 2X4TB 2WB7A 2J6EH 3ESMA 4YK4C 4TSCH 1GY2A 1ONQB 2QGBA 1XR9B 2X4UA 5KN5B 1CXFA 1XF2A 2HLAA 4DCQA 4L0PB 2FSEA 2JH2A 1O7VA 4JNXA 1IGCH 3B9AA 3RRQA 5FYKD 3IMUA 2HJFB 1JGEA 1PEWA 4AMKL 3U6RB 3LSOB 1IGYB 4NWTL 4PJAB 1A3RH 4WAFA 5ESVB 5KYYB 4DQAA 5T5NG 1OP5H 3H2QA 3FN0H 2JI1A 1K2DA 4CVWA 4XVTL 2ZPKH 1BAGA 3CH1B 4MQXD 1CU4H 1KCVH 1FL5B 3HE7D 5CSBA 5C0NC 4OLWH 3QUYB 4LVHB 4Q8BA 1ZSHA 3QEHA 4KTDL 2VDNL 3GJFH 3LN4B 4ONHB 5EU6B 3WIFA 1E65A 3IMVA 2CH8A 2G5UA 2HVBA 3JT0A 4HULB 1E50A 2WCGA 3QEQE 2XG5A 3EFOB 1K4DA 4LP8A 3X12A 3OLEA 4TSBH 5ACZA 5DD0H 4DPCX 1EMTL 1J1PL 5T1LA 1RMFH 1WT5A 5CINL 3C5ZC 1SJHA 4WU7B 3RIFK 1A7RH 3T4YB 2WYIA 5C0IA 5D70L 2CDEB 1R75A 2ZJSL 4UMSA 2W8CA 4GJTB 4ZW8A 2G4EA 4CC1A 3RTQB 4DVRH 1OVZA 4U3SB 3VXME 4XPHH 4Y4KB 1A7QH 4KAQH 1BQKA 4I1PA 1SLXA 3B2XA 3IGUA 5EU6D 5EEWA 1WDAA 2QPDB 4AYSA 4P5TC 3RUGF 1TQCC 1JV5A 5AAWC 5HYSB 4M6AA 2ETWA 2R1XA 1G7PA 2IPTH 1OTSD 1MWAH 5GGSB 1WTGT 1ETB1 2XVBA 4PJGA 2P26A 3QGVA 5IMMA 4PJXE 2BS71 5TE6H 1WPCA 2J43A 1GZQA 3OAZK 2PO6B 1JHTA 1FJ1B 2BSBA 5FGCE 3GM0A 1QLEB 5T1LB 4XP9H 1BFSA 1R3JB 3ILEA 5BS0B 1LK3H 2FJGA 1LJMA 1RZKC 3MRQA 2P5WE 4WNJA 1UXMA 3WFCH 4G8GA 4OGAD 1LEKB 3TYFA 3WS3B 2BNRD 2G2PA 4S1QL 3RVUC 2A9CA 5DZ9A 1ED3A 4ODHL 2E59A 4U6YB 2CM5A 4J27A 4OLZL 5KSAD 4GSDL 4PTUA 4M3KB 2IFFL 5GRWA 4Y4HD 5HHNB 1CFNB 4PJFB 3U46B 5AVTB 3BHBB 3MJWA 1U41A 3ROOB 3MQIA 3EGXA 1Z9NA 4N2IA 3INOA 3NTCH 4JJHA 2FO4B 1AO7D 2IAMA 1TOXA 1OF2A 1PSKL 2C9SA 4Z6AT 2F74B 1MFBH 2IH8A 4X50A 4YBHA 4GIAA 4MWFA 5HDWA 4UT6L 4AQAB 4P4KA 1RJZB 5C9JA 3NCEB 1DP0A 1OY3B 3ZZSA 3H85A 3PQYD 4LXFA 5TH2B 3G6AA 4B9ZA 5D96B 2HFGL 3RVXD 5IMLA 1E43A 1NTDA 3X3GH 1Z0NA 4BQBA 2G75A 3DVNA 3GDCA 4LHJB 4MVBD 1PCXA 3JWDC 3MRMA 3PWUA 4XN4A 5CJQL 5JLZB 4OM0L 3CDFA 1CE6B 4WJ5A 2UZYB 2ZWYA 3N0AA 3NIGB 3HUJE 3QR2A 4LCWE 5C6TH 4XMXA 1LE9A 4XT1C 4ZNEE 3T6QC 4UCFA 2B1OA 1E4XL 2R9HC 1PKOA 4RFEA 4KKBC 3SCMC 3TGXA 2WC7A 3TNMA 2XN9E 3SDCC 1TITA 3N0PB 4TL5A 4FXKA 3B56A 3DYOA 1BV8A 1HJBC 4Y1AA 1G7MB 2ADJA 2NY1C 1J0HA 1Z0MA 3QXAB 4HDIB 3CVIH 4XP5L 2FGWL 3O4LA 5F1SA 1B2WH 4E9XA 5ISZE 1TVHA 4NZUH 4M8VA 3VSUA 4F27A 2ZOLA 5KSBF 1ZVYA 1B4JH 1LILA 4ZS6D 1NUGA 4LLYB 2PPCA 5IMOA 5EF2A 2KDYA 3FL7A 1WWBX 3TBWB 2AQRA 4TLKA 3ROLA 5FM5O 1RKRA 3CHRA 2DTMH 1P4LB 1NKGA 43CAB 5E4AA 3BDXA 1KELL 2GJ6A 1OTTD 4NERA 5IHUH 4AIEA 5C2UB 4F57L 3EFDH 1JGVH 2YRZA 4XN9A 4EDXB 5MENB 1MREH 1ZJAA 4K8RC 2QGDA 2O1AA 1E8WA 5CU9A 4QLWA 1UT1A 1BZ8A 3QDGB 4LSPH 2X2HA 3UPRB 1NBYB 3CFJB 3NAAL 4DP7X 3EADA 5I0WA 4HOXA 3AXLA 3NACL 2Y7MA 4NRXB 2F19H 2QHRH 1WWWX 1CQYA 4LPTA 3RFZA 4LARH 2DM4A 3JWNC 4CC4A 4F7EA 4Y8DC 4NKOA 2WLNA 1WJ3A 5CUSL 1AP2A 1UA7A 1T80A 3TJEL 3F83A 3UBHA 3STLA 1FL3A 1A6TA 4V1DA 4PJDE 1AGFB 3B2VL 2PCFA 2Y6SC 1SHXA 1X44A 2AI0L 5GZNA 1BIIA 4WEBH 2Q2LA 5JR1L 1U8LB 3G9VA 1HVXA 1X5ZA 3GMPB 2WNXA 4GRLD 5CMAA 5D4HA 4AQ1C 4ZG1A 1IU1A 1RK0A 4HMDA 5FDYA 3L7EA 3Q6FB 2OK0L 2G9HA 4XRCA 1BHGA 1S5IL 2JJUA 1UH2A 3FW6A 3FU6A 4UV4L 5FOBA 2BS9A 4Z3GA 5LGKA 5DO2D 1BGXH 1JPTL 3QI9B 1I8KA 3CFJA 1U8PB 5MP6H 2BC4A 4OIBA 5JO5B 4KNSA 7TAAA 2ZXCA 5E95B 1G7QA 4TVPL 2VAJA 1UZ8A 1Q72L 1X5MA 3EBAA 3B8YA 1L9QA 2P5EA 5L4IA 4NN6B 4ZNCD 2EDQA 1PLCA 5AYTA 3VXUD 1SF3A 5IBUG 1Q0XL 3TJPA 2YSSB 3BSZH 1NL0H 4KK6C 4NP9A 2VDRH 1S46A 5IMOB 2HFEB 3MRDA 4K94L 5F70A 2VXTH 1UA6L 3QUGA 5T5FH 1R9FA 1QSFE 3GKWL 3K81A 5DJCB 5I5RA 5DHVA 2JIXA 3ZKMD 3F01A 2DWTA 1Q8MA 5CLTA 2Q3XA 2IWGA 4Z78A 4KQ0A 1MHEB 4N8VB 4JRYD 1UOKA 5FFLA 5JOPE 4LEBA 1NM9A 1FGVH 3ORJA 3ETBF 4I9WD 3SPCA 1RUMH 2FT7A 5JW4M 4IU3A 3PWLA 2X6BA 4X7EC 4MMXA 3BN3B 3EYFA 4NQED 4B60A 3V5KA 5FUCC 2IEPA 3TT1H 3MRPB 1NIFA 3NEEA 4LLVA 4Q6KA 2IGFH 2BOLA 2CRIA 3CFQA 3PDGA 3TA3A 5DK0A 3D4ZA 4YHKH 5EC2A 1QEXA 1F5WA 3RU8H 4JZJB 3ZKXB 3CN0A 2HT3D 4MQ7A 4O9HH 4M1GL 1MCRA 1KV7A 4JFVA 4QHUB 3QR1A 2G4GA 3IU4H 4I9WE 4KZEL 4KZ0A 3L5XL 5FECB 1X5HA 2BVTA 4NX0A 1DQML 3H9HB 5JIHA 4OF6A 4N25A 5D7LB 2JCCB 2J88H 1IVLA 1QSFA 5H94A 3D87B 4G80A 2CKNA 4WFHE 5EORL 5EU3A 4GAFB 1BEYH 2BSTA 4NJ9H 4MNHB 3GI9H 4P2OA 4Y5YC 4CILA 2O61A 1DLFL 4M61A 2R69H 1LK2A 1T89A 3MRRA 1JNNL 1IGIH 4LCWA 1K4CA 3X2QB 1HQRB 1AIZA 3D5OF 5L0QC 1XD1A 4IU2B 5DJZA 3DURB 3T0EE 1I9RH 4D9QD 4GINA 1UOVA 3Q3GB 4PS4L 1LE9B 3RX7A 5F1KC 3IDIA 1RZKH 5IVXE 3FQXB 5E8OB 4M29A 3CNKA 2ISDA 2X4OA 1GJUA 3EJCA 4YBQC 1IX2A 3FHAA 2OA9A 4AEEA 5I17A 3CHPA 4TNFA 2YFNA 3BIKB 3DSFL 3QIBB 4BHUA 1NLBL 1WC7A 2ALWA 4BFNA 5F1NB 3NK3A 2NNCA 4U0RC 2IBGA 4PJGB 3O4LB 4U1HA 1DQDL 3ULUF 2VISA 5JDJA 5C97A 5HVWA 3VH8G 1AQKH 4BZ1H 1DO6A 1KPRB 4GXVH 2VJ8A 4B6ZA 2ERJC 3OKOA 2Z34A 4A55A 4MWFB 1KXTA 2K7QA 4M5ZL 5IFJA 1U6AH 3MXWH 1F45A 1NBZA 3QHZL 1UQSA 4CBZA 4M7ZB 2FJUB 1WITA 1J9SA 4Y7OC 1A6UH 5EOQH 5E8DL 5GJSL 4LHUD 5TK2A 4XTRC 1CL7L 1K2DB 2EDOA 2ADFH 2BY0A 3U46A 2QQQA 4XNUL 4PQXA 4FFZH 4JZOA 3L6FA 4HHAB 1MIEH 1RK7A 1RUKL 4XCNA 2R2EA 3GSRA 4S1RH 5HJGA 2D0GA 4FGMA 4EOWL 1UZGA 2N7AA 2NY3C 4U31A 3WIIL 3FQNA 5GS1C 5I71B 1VZIA 2ZXEB 3BZDA 4JDVB 2Q6WB 3TP4A 4LCCA 5F21B 1HE8A 3VD0A 2VSCA 5AOLA 4UILH 3ARFC 3RUGA 1FO0L 4QGYA 4RIRB 5CR8A 1KYAA 3D9AH 3LS5L 1M6UA 2E6JA 4N0CD 1W0VA 1T7XA 1JZDC 2TSAA 3DGGB 1NFIB 3Q2VA 4OZGF 3P0YH 4B97A 2HX9A 4Y9FA 3NIGE 4YQXL 3NDYE 3T3MF 2FBOJ 4FQJL 4U1GB 5DC9B 4EAEA 2JKSA 2X4QB 2YPLE 3REWA 1ONQA 3D09A 4AJWA 1R3JA 2KZBA 3QJOA 2ZUQC 4MB5A 4IS6B 1XGPA 1DJXA 3CU1A 3C6LC 3LKSB 4PRAB 2IPUG 1U91B 5I17B 2GY7B 4HV8B 1UD8A 2ZX6A 1MDAA 2QSQA 2D2OA 1F3RB 2NY1D 2QGCA 1CBVL 1WZ1L 1IRAY 4BSWB 3CXDH 3QZNA 5BW7A 4LHUA 1S8DB 4LPUA 4HCRH 3O6FB 4P9ML 5HJBA 5C0AB 4TNWF 2R0LH 5LGJA 3QEQB 2YUXA 5BVJA 3UBXA 4L1DA 3NJIA 1RV6X 1TU2A 2NY7L 1AZVA 1MIML 1C5DB 4OCLC 4YSAA 3C87A 4GBXC 3QT2A 1JXGA 4FFWD 2WKOA 1GTFA 2VAAA 1MY7A 2R2BA 2PCYA 3EDKA 3DYMA 4OSUH 4X6CA 4G6AD 4IDJH 3DUSA 1NCDL 3VO0A 3SDDB 5LG1A 4C54A 2V7NB 3GSRB 4PRDB 4HT1H 5EIQA 3CQFA 1LP9F 5FK9A 1K72A 3MNZB 3AG1B 3SIKA 2WQAA 4FG0A 5JMRA 3EIFA 5H4YA 5DK0B 2AV1A 3UJIH 1JWMA 4GKLA 4Y2OB 5GRJL 2YLKA 1CFQA 1FDLL 1ZK9A 5CS7A 4GFXA 4TKWA 4X99B 4XPAL 1EEYA 1TZHA 4I5BB 4IIZA 4P23D 1G87A 1HXMA 4M5YL 3MOAH 3TCLA 3CSTA 4IRZH 3N55A 4KMTL 2NNXA 4XVSH 5FCUH 2XTJE 1SFHA 4JPIA 1CICD 2FDBP 1FRGL 1ZIAA 3BT2L 2WUCL 3R7QA 4HWUA 1PQZB 2J1ZA 3BVNA 1UURA 4APQC 2W0PA 1MCSA 2WXIA 1ORQB 2DQDL 1IL1B 1G1YA 5KVFL 1E8YA 4S0HA 3ZO9A 5GZNC 4Q89A 4MFHA 1LE5A 2NQ3A 3MRDB 1QA9B 1UJTA 3UPAA 3CN2A 2A1WH 4NJAL 4OCMC 1F11B 3CMOH 2D3VA 1ORSB 3G6JA 5AVWB 2YD9A 3GXIA 4KJYA 4WTZG 1FNSL 1T0MA 4FYRA 2WSPA 1QFUH 2DWDA 3Q5YA 1CD0A 4HOZA 6FABL 3UBXI 3ULAB 2MQ0A 4NQEA 3ULVE 4PJBA 4DZ8B 1CXKA 4P57A 4WI3A 2MCMA 4GRWB 4MX7B 3QDGE 3LH8A 1PG7H 2WJ5A 2DMKA 4X7FC 2R59A 5CKAA 4IBUA 2GT9A 1W72H 5ECJE 3F7LA 3S37L 2WXRA 3VD4A 4FD0A 1HWHB 3BISA 2BVPA 1S9WB 3EHBC 3CU7A 4JMXA 3U2SA 1KEML 5LNDA 4B9GA 4XXCA 2BY2A 4UM9D 3KYKH 4FKEA 2FX8L 3CFEA 4ZMOA 1T3FA 2HT4D 2ZOWA 4KK8D 3IU3B 4WEEA 2WQXA 3GMPA 4QEGA 3W0WB 4JFHE 4JFPA 3B34A 4H8QA 2WO4A 4ZS6C 3KLKA 4TM9A 3ARBC 1USZA 4NGHL 1H9DA 2X87A 3GMRA 4GKNA 5EC2B 1H8SA 3CWGA 4TNWK 4XNZB 2YGPA 3P4OB 2WLMA 2OMUA 3LZPA 2FLMA 3LN9A 5HY9A 4GPVA 2GTQA 3DIFA 4X8JB 1KLGA 5SWZB 3WXWH 3FUEA 4BK4A 1EGJA 1CN4A 1AGDA 2GSIA 1MVFA 1N70A 4Z76A 1R5VA 3IJ9A 2GK0A 2VNCA 3FT2B 3KL0A 1G6VK 4LLDB 4Y16C 2NTSP 4BFEA 3U30C 5BRZB 4QHMA 3EYQD 3CX5K 2VZUA 1TJXA 1VGEL 2GJPA 4Q2ZB 4JAMA 4LPWA 4PY7B 2Y1VA 1KBGH 1E3XA 2AV7A 4AXWB 5I1DB 1ZTXL 4JQIH 2WZ5A 4QRRE 2VRQA 3VB9A 4AYFB 1BZ7B 2DOCA 4EIUA 4YBLC 3UTQB 4UM9B 5JW4N 5AALA 1DSYA 1HOCB 5AWNL 2VSMB 4Z0XB 2P5EE 1KBKA 4N2AA 3BIAX 4DUVA 2L4OA 2WLJA 2VLMD 4F37K 2VKWA 1RUPH 5E0QA 1TJGH 2W38A 3CFUA 4EQ3A 4S2SB 3S3SA 1M3JA 1RSFA 3K91A 2MOVA 2BMKA 1VCBC 3DV4B 2I26N 4PJ7F 1JGDB 4MS8D 3W9EA 1NCWL 4BUGA 3OVUB 3A6OA 1GS7A 2GSMB 3ETSA 2WKOF 1DLHB 1ZLSL 2GB2A 4U6VL 4UT9H 3IMWA 2JELH 4A2LA 3O3DA 1AR1C 1FSKB 4I0KA 2JQZA 3GHBH 1E4KC 3T0EA 3H53A 2TAAA 3EJYC 4PWGA 3ULUE 3QJFA 3ULSA 4Q0XH 1FF5A 1QKZL 1W80A 3WDHA 5J12B 4NQVA 3RUGE 1KOAA 1MCHA 5DTFA 3VFSA 4C4BA 4LHUG 1H6FA 4RCAA 3SDAB 3IJEB 4N6RB 3HI6H 3U79A 3IFLH 4CVUA 4YSTA 2QADD 4JZJA 5FA4A 1OSPH 3QB7C 5KVEE 3O4LD 3VFOA 4KXZI 4BFIA 3PP4H 4DJMA 5MEND 4ZFGH 3GXNA 3G3LA 4MSWB 4Y9CA 4OIFA 5GGTH 2CMRL 2EDBA 1Y18B 1W72A 2JI2A 4K7FA 1ADWA 4NUPA 4W9FC 4ZOBA 4K9EL 4Y16D 4Z7UA 4KRPB 2BVQA 1RIVH 3QARA 3IYLW 4P59H 2L7JA 3HC3L 2QTEA 3L1OH 4ZUVB 2F1AA 3RWCB 1ZHKA 4I77L 1MJ8H 1A4JB 4GKOA 5HGBB 3WFDL 1DDHB 4QHKJ 3MV7E 1J0YA 3GMOB 4Z5RB 1CDHA 3H0TA 3IF1A 2Q7YA 3H6JA 3HUJF 4NRZA 3BKCH 4YX2H 1CD1B 4NWUH 3JWDH 4FJZA 4J3WA 3GB7A 4M8QA 5KYUB 2A9BA 4N8PA 1M42A 1Q4NX 1QSEA 2P5WD 3ARZA 3B2UC 4WDIA 4FZ8H 5F89B 4AEIH 1WFMA 1BEXA 3DGCR 5D1QC 1QTPA 1I3GH 1T1ZA 4LCCC 3B7RL 4RAUB 4UB0L 1FGNL 3V0FA 3WNKA 4RQQB 5I1DA 2YD5A 4OZFA 1R3IL 4PR5A 1JNHA 2ZSWA 4WWKA 1MKFA 3T77B 5CEYB 5ES4B 4H0IA 3ZR6A 4DKEH 3W9EB 2H26A 3U6XS 5JXAL 2Q86A 4U1SB 4ZDHB 1BPLB 1HKLH 4KQ4H 4PJ7B 2A77H 2FL5B 4GP4B 1CLZH 3DPBB 3MRBB 5E00A 5E2VL 2UY6B 5LQBH 4MASA 3GUTA 2AMUA 1FFPB 3QCTL 1M2OA 4G8GD 4PI0A 3LX9A 1RZIA 3D08A 3GIVB 1JF1A 3SYCA 2XWDA 1V7NH 1FCGA 2WKLA 5CEZL 2C3HA 4OIAA 5ICZB 1P2CA 1U8KA 3JTSA 4L4VD 3ZMRA 3JZ7A 5C09E 1ZLDA 3GINA 3SHSA 5F7LB 4ZUUB 4JG9A 4HOWA 2DEWX 3CFEB 2F8OA 4QKXB 1UM4H 1TQSA 2X3BA 3FBQA 4U4IA 4ZK8A 2I07A 5KVEL 1RZ8A 3NZHH 4S1DC 4F9LC 2JKJA 3I9GH 1M7DA 1L7IH 5JPMC 4JQVA 1OAKL 5J9PB 1OHZA 1WE5A 5K59E 2VQTA 3MCYA 5I15L 3NPSB 4M48H 3VFMB 4ONGL 5EIIB 1DUYA 1T20A 4CU8A 4WFFD 4Y2LA 4UTBH 4JZNA 3KYMB 2ITDB 3GYRA 4M43L 2EADA 1WQVT 5EO0A 3WJJC 3ZHNA 3VFTB 3VQ2C 3GSOB 4G1EB 2QPUA 4N8VA 3G5WA 3U0WL 3P3UA 1NICA 3BKJL 4FEIA 1NEZG 4JFDB 1RIUL 1S7UB 5LAPA 4Y19D 1T2QL 1HHHA 1P1VA 4R26L 1X5GA 4NRYB 5IB3A 1UB5A 4F1SA 1IIIA 5KN5A 3A4FA 1XR9A 2M2DA 5IFAH 1O5PA 4OJCA 5JIQA 4EF3A 5D7LD 4RH4A 1UWGH 1EEZA 1CXHA 2DAVA 1IAIM 2CE6A 1PY0A 4UQ9A 1J0IA 3B3IB 4J3OH 2MTAA 1Y6MR 3FB5B 3RBSA 2PYED 4DN4H 1KC5H 1JV5B 1OZUA 2F5AH 5DHXB 5HYSA 1MAKA 1X4YA 3NFSL 4LZKA 3SJVE 4B0MB 2Z7ZA 5GGVL 4P46A 4G6KL 4ZX4A 1M71A 1HZHH 3U0PA 1K8IB 3LY6A 1OZTG 6PCYA 4YDZA 1JZ2A 4XZUB 1KJ2A 2VLKA 4AX3A 5KWYC 2CXGA 3V0IA 3FQ1A 5KBKA 1P7KB 5DC4B 2CJUH 3Q6FA 1A7PH 1WF5A 1KB9J 1YNTF 3KBEA 1W8EA 2VE6B 1AYRA 2CJ3A 2DY2A 1XCTB 3RL1A 4PW4A 5ANME 2DS4A 3BJLA 5E4IA 3JTTB 2F8VA 2DMBA 3WKML 4A1RA 3GO1L 1BZOA 3BD4A 5INDB 2IVFC 2DWSA 1ZT7A 2HJLB 1KB5B 1RJZA 2Y7LA 5C9JB 3RWEB 4X5PA 1MZYA 1FN4A 5EA0H 2A5UA 5AAMC 1YNLH 5BZDA 4IJ3C 4JKLA 3QWOA 3A23A 5AOKA 4PJBE 3VG0L 2FYVA 5BO1H 3SJVA 1EERB 1OARL 1ZKAA 3H2PA 4Z7QE 4G6FB 5ICXA 4K0OA 4WLCA 5GZOC 2FH6A 4FNLL 2OKMA 3AGWA 4X0NA 5B4MD 3IFOB 4GT0A 3NSYA 2J5LB 2ATPA 2P47B 4PBVC 1DFBL 4W68A 3AC0A 5DVKA 1G6RL 4OM1L 3QBTB 3V8OA 3PGFL 5J0BA 5LGJB 3II2A 5J3HC 1KJVB 1COBA 1KXQA 5LNGA 5CZKA 5C0GA 1RZ7L 2MQCA 5EB9A 1JE6A 1DBBH 4EI5A 4G8GB 2B59B 3CQQA 3WS3A 4F8OA 4LB8A 4TNEA 3MBXH 3KPRD 3MODL 4J3SA 4NO0A 1G7HB 1Q90A 3BH8B 1JS4A 4WTZA 3RAJL 1R4XA 2L7EA 1FAIH 2MCPL 2WD0A 3RY6A 3GBNH 3GLZA 3ATBA 4PM1A 1I7TA 3HVDA 2VE6A 2B4CC 5GISH 1A1OA 3SYQA 2X0UA 4L0YA 4I0PA 2NW3B 4PJCB 3SKUD 3PP3K 2AQSA 3KLAB 3P1VA 1KIUB 2MCAA 1TQVA 4BFOA 1JYNA 3E2HC 5EPMA 2C26A 4MX7A 1NCTA 2F68X 4H5SB 1MJUH 2IPKA 4R7XA 1VGKB 5GSVB 3DPDA 5BO0D 1DEEA 5A2BA 3AY4A 1S2EA 2B15A 3OQ3B 3FH7A 4P46B 2JNZA 3ALWA 5A2FA 1N0XH 5C8JA 3H4HA 2I5YL 4G8IB 2VRAA 1S7WB 3HFML 3MLWL 4PG2A 1WA1X 3U36B 2J4WH 1ZHLA 2ESVA 5FWRA 2B5IC 1Z9OA 3QDME 4P8QA 4OLXL 3OB0H 4I1NB 1JPEA 1PD0A 1KB9K 2NLJA 2X28A 1U8MB 3DXAE 4W9HC 1H15B 2OL3A 2ICWA 5MEPB 5TD4A 1LO4H 4DP9X 2X4PA 3MBEC 1ZHNA 4LF3B 3LB6D 3KLHC 4FQ2H 3MJ8B 2W9EH 3REVA 1GCFA 4RZKA 1I1FA 5F9AC 4PRPA 4U33A 2EIDA 5C9KA 3PGCA 5F6IC 3RVWD 2SEBB 4JPIB 3ZSSA 3QI9D 2VZSA 2UXTA 1AD0B 3H9SA 1PDKB 2FSDA 3QA3B 4YHLH 1WP6A 2NY0C 2FTAA 3PNRB 5ADPL 4FTVB 4JFFD 1KGJA 4G42A 4P3CL 1L4IA 1NGWA 3N43B 5HHVL 5E6RB 4ELDA 5ESVA 4LE8A 3VI4F 4KDTC 1N8ZB 4MA7L 4EDWL 3S35X 4OLUL 2H45A 1UWXH 3OJDA 3OJ2C 5A2AA 2VZOA 5DZLA 3V52L 1EWHA 1BBDL 4R90H 3OZ9H 3FRPG 4N6QA 3HZKA 3QJXA 4FLRA 4H0LC 4LEOA 1YN7B 5L88L 4YO0A 2FECL 4KC3B 3KM1A 1TZGL 4RRPG 1JPGB 4YNYB 5BXFA 1A3ZA 4DP0X 5DLLA 5CIPA 4HWBA 4Y88A 4DZBB 5I9QC 1KN2L 1MCOH 3GMLA 2M8XA 4Z7VE 3ALPA 1JFHA 3P30H 4RDBA 5E8OA 2EICA 4ZUWB 3SDXB 4PJ7A 3CZEA 3N1GC 2XY1A 4GQRA 1D9KB 3GC3A 3VH8B 3VI3F 3OKKA 4RGND 1BM3H 4JQVC 2MFNA 5FAAA 1VGKA 2XXGA 4JM2B 4JL1A 1BYOA 3ZL2A 4X0KB 2X53A 3FB8B 5HXMA 4L8BB 3H7BA 4ENZA 2PR4L 3NP3A 2Q0ZX 4NEHB 3BSHA 4OZFB 3KYNB 3B3IA 2HN7A 4XAWH 2BSCA 4G11A 3LPWA 3W1ZA 1NAKL 3EO9H 2XWTB 3BZEB 3HNSH 5A40E 3HG3A 1JFQL 1WC7B 2WUBL 3B2MA 4BELD 3K74B 3L1GA 5J13C 4ZTOL 3SD2A 4P2QA 5L2KD 4NKMB 1YNKL 4PRPE 2P5WB 1KDIA 4BA8A 2PWEA 2H8PB 3VCLB 3VJ6B 5I6MA 5KEZA 3OGCB 3AITA 3Q48A 4NCDA 3CC5A 1YSOA 2G30A 4AM0Q 5K39A 4MQ7B 1EEUA 1WUNT 2CXKA 3OMAB 4ANKA 3FCSA 4JO2H 3Q5TA 3VWJC 4MXQD 1XSOA 4X4ME 4YXHL 3I6GB 1Q1JL 1JZHA 5FF6A 1SFDA 1NCAH 4NZTL 4QY8B 3PHAA 2KC0A 3KH3A 1HDMB 2CPCA 2IALB 4WCYL 3WJLC 3MTXA 4P2OB 3VXPA 4P48A 3P9WB 1YY8B 2NT1A 2VXSH 5KSVB 1D5IL 1FN4B 2P45B 3O9WC 4HEPA 4BZ2A 3A5VA 1AG6A 1HSAB 3BD3A 3SCMD 4BM7A 4OI7A 2X0WA 5CBAB 3OKMB 1KMGA 2R8SH 2EJ1A 1VHPA 1YEHL 2AEOA 1J5OH 1IGFL 2PYEE 1MHHB 1PZ5B 2CUMA 2DIJA 3DJ9A 4JFQB 3TL5A 2XU9A 2BNQD 1ZXQA 2AK4D 2Z93B 2B20A 1OCOB 3GXDA 3ASOB 2O5ZH 4A6YB 5EUOA 1MI5A 3AT0A 2YSSA 2X4OB 5K1VA 4ZPVB 3CBJB 3SB3A 4GG8B 3FUFA 3UTOA 2OFQA 2GI0A 1NFAA 4WI7A 4Y9EA 2BINA 1THAA 3QFJB 3Q3GA 4KJWD 4TVPE 5LN4A 1V3MA 2H26B 3PXLA 1PZAA 4QYOA 1R3HA 5HVGB 1KJ2L 4BJLA 4RZCB 2V7HB 9PCYA 3KLAA 1TIUA 3IN2A 4W6XB 5I1IL 1WBZB 1INDL 1VEPA 1DSFH 3F2LA 5DEFB 3QFGA 1OPOA 2R1WB 3WMSA 1XF4B 2YKKA 4ZSOE 2D7TL 3BQUA 4EN3D 1SLWA 5EOCL 5K9KB 2LV4A 3AM8A 4KVNH 1ZV5A 1YECH 1MWAB 3WXVH 2B39A 4QXVA 3H6AA 3EG9A 4HALA 3VRLF 2PN5A 1QPXA 4PJIB 2CIIA 5HGDA 4Q9BA 3ARDC 3GRWA 2AF2A 4G6AC 2PYEB 1CMOA 4ZUVA 3RWCA 3HE7C 1E27B 1HXKA 4JZNB 5EO0B 3GMQB 4FKKA 5L6YH 1JZ4A 1MW1A 1UACH 2XTJD 3VFPA 2Z31B 2EDYA 4XO3A 5KOMC 4PJ5A 5F3BB 3EH1A 3WNJA 3F7YB 3IPFA 2ARJQ 2NCMA 3H4FA 4J4PC 1Q38A 3UZQB 3VE0A 4EN3B 3E6HB 1U3YA 2GAZA 4JFUA 4ELME 4AV4A 1QLFB 3E8UH 1XSKA 3M1BB 4KXAA 4BGDA 3N41B 1QOKA 4XBEL 1LL1A 2APSA 4XWGL 5FA3A 3O8XA 2CK0L 1RL1A 2W59A 1S9XA 1AE6H 2ZKHH 5DWUH 4ERSH 4Y7MA 1IAIH 3DX7B 2VJ0A 2BW4A 3BDYH 5TK4A 2FWUA 1BCIA 5IK3A 3X11A 3PE9A 9CGTA 2MOGA 2UY6A 1QLRB 3MBEA 4ZQKB 5F3HB 5HI5D 3UTSE 5ERWA 1ZJBA 1TFHA 3NA9H 4IHOB 1WD8A 1Z3GL 4KJPC 1SLUA 2K4AA 4PJ5D 3U6XA 1H3PL 3LH2L 1F4WH 3QDGA 1B2YA 4G8EA 2H32A 4N0RA 4CNIA 5L2KE 3LAFA 4OD1H 4BH7A 1HINL 3RHWF 4LL9A 3WMQA 1RVFL 2DWDB 5DURD 2ZOTA 4D9QE 4JFXB 4PCTA 1EHXA 2VWEC 2R7EA 1NDGA 3V79C 3INUL 4U1IA 3I3EA 4QOKD 5DJ6B 3RDTC 4N1CA 5EO1A 1J0KA 3AROA 4NQXB 5J89A 4QRRB 4ZX6A 1V3LA 3NT0A 2MHAA 5JOFB 2R7EB 4GAYA 5AW7B 4HX1B 4NN7C 3BQUD 3ECQA 1IC4L 5E5MA 4F2FA 8FABA 1YYCA 1YEEH 4PP2A 3MOBH 5E1HB 3ZE0F 4K3DL 4ENED 4HHWA 4UINH 3UBXG 4BQCA 4Y1AB 1C12A 4Q2ZA 2VDPH 1UXWA 3NZUA 4KKCD 4BSJA 2VXQH 1KTKE 4RFEB 3ZDYE 3VI4E 3PJLA 4LU5L 5I19L 2GHWB 5I73C 1ACZA 2F53B 4IOFD 2ZWKA 3AY4C 3KYOB 3OM3B 4L5FL 4N5EC 4QY8A 2XPYA 5C07D 3P77B 3UPRA 5KBMA 3A67L 3QUZC 2IH1B 3MLUL 2E86A 4EXKA 5IEKB 1MI5D 1YMMA 1WUZA 1HKFA 5CLWA 4QRRD 3D50A 1UD3A 1IM9A 3LS4L 3ZYZA 2AK4A 2R29A 1MN4A 4PJCF 2G9KA 1CICC 4JFFE 5T3XE 4QMEA 4EQ2A 3M1CA 3KHOA 1FVDA 4F3FA 1Z5LA 1HHIB 4N2CA 1ZE3H 1UEMA 3DO4A 3FTUA 2OX5B 4FXGA 2GBVA 3VI3E 3VE0B 1RJYA 1TF4A 3ZDZE 2F74A 3KPSA 4NKQB 2GABA 4YDJA 4MHHG 1XH1A 3MV11 3X1BA 2ROXA 4ZUTA 3IDXH 3QS3A 4L1SA 3ZT7A 4S1SH 2R0ZH 5JHDB 4J5VA 3KPPA 3ASWA 4UTCA 3PY9A 3GMMB 1OK0A 5IF0A 1ZSDA 1MXGA 4LOEA 3O0LA 2OULB 2O5XH 4FA8A 4KDWA 4NM8L 3FQWA 2EZ0C 3OGCA 2CRYA 1JD7A 3C6SA 3TVMD 5B39B 3MV7B 4HPYL 1KGCD 4FQXB 1OAYL 1ORSA 3G6JB 4URTB 3IFNH 3CFMA 3D2UB 3K46A 1HZKA 1TCRB 2Q7AA 2DDQH 3AT9A 2HXAA 3S3PA 1W0WB 5I1LB 3VYPA 4X6DE 5IQ9A 5D8JL 3HAEG 3Q2CA 3S3DB 5IM7A 4LSRH 3S5LG 1YMMD 5JMOC 5E08L 3VD9A 3RWGA 4J3OF 1DJIA 2IH3A 3BUYB 5IUCA 4G6ML 5LCVL 1DTUA 4OGYL 1MCPH 2Q9OA 1HSBB 1MW3A 5CCKL 1VACB 3N9GL 3V9EA 1KEGL 2M83A 2Q7NA 4GW5A 2YXFA 1ODAA 3IDNA 3LRHA 1K6QL 4PRHA 5HI3D 5D1ZI 1HDMA 2IALA 3TXAA 4Z7VF 5LGHH 3CN1A 3W38A 3EGXB 3NCJL 4RIRA 2CRZA 4JM2D 4Q9QL 4YLBA 4ZFOA 2VCOA 2P46B 2ZKYA 1EGJH 1BJ1H 4AYDC 5ISZA 2ZNXA 3HBZA 5E0FA 1FP5A 1HHGB 5DD5L 3QG6A 5BVPL 3BT0A 1U8CA 5LO7A 1B0RB 2QQLL 3UZVB 4BK5A 5I6XC 3CVHA 1TPXB 1EAPA 3R06A 5TE4H 3U2IA 3O3AB 1F0LA 4LDCA 1LWJA 1FE8L 1MJ7H 3U1SL 2P80A 4FHBD 1NSNL 4TUKL 3CZJA 4NBYB 5HHMD 1MFAH 2EKJA 3O4OB 3BO8A 3ECWA 1OM3L 3QRGL 4QNPF 3UGXA 3RWJA 1RI8A 3FTGA 3UDWC 2YGNA 4IQHA 3RPKA 1VPOL 3O6LH 1DLHA 3A6CH 4MXWL 4X0KA 2C5DC 2XSKA 2WN3A 5DMJB 4XPTL 1XV8A 1A6WL 3MLYL 5IB4B 4NZJA 1P84K 2VUKA 2Y0SA 5EZJB 2XI9A 1JZFA 3ECUA 1A64A 3HG1D 4JFZL 2VM9A 4X8CA 5AW8B 2CBPA 3TYGH 5E1GA 1YEIL 4NZRH 3O6KL 3AW5A 3Q44A 1TTAA 2GY5A 5IQOA 3AWGA 2ZP8A 3TWYA 5FR3A 1WFNA 5F8RC 1L9MA 1SHSA 4IKLA 3N41F 3S35H 5PCYA 3BEVA 4YVNA 3CLEH 4AJYV 4FNRA 5JW5A 2DYSB 4L1TA 1UYWH 1CI3M 5C7ZA 2FK9A 5LBVA 5KTEL 4N2BA 2C9RA 1F8TL 4K3GA 1CFVH 1N5YH 1WIOA 1S5HB 2OMZA 4XGZA 3QXWA 5EZPA 2GK2A 3BZ4B 4Z3EA 4WTXA 3S34H 2AJVL 4XWOC 3OHXA 3X1EA 4DKTA 3IJ8A 4OAWB 3VU2A 3FT2A 2G3NA 1WZAA 2GK0B 2EH8H 5C7XH 3ZGHA 2OV0A 3A4AA 4N68A 1HXMB 3QUYD 3L5HA 4G43B 1KIUA 4NIKB 2W88A 3FPXA 4C56A 1F86A 4XNMA 1XAKA 3QXTA 1OQXA 4OQ1A 4GAGL 5FUOL 4I3GA 4LKCB 2FR4A 4PGCB 4XP1L 2VW4A 5L8KB 5BXFB 2VDRB 2BX5A 4YDLB 4AKOA 1TQBB 2WTRB 2NW2B 1P84J 4DERA 5D7IF 1UKSA 4BWUA 5C08E 3RDTA 4ODSH 4EI5D 4Z7WA 1O6SA 3AMKA 1UGNA 2F0CA 5C0CB 4J3XA 1KCBA 4S0TD 2VUOA 2VR6A 2LLNA 4YEEA 2WGXA 4QCIB 5INCA 1KBBA 5KYNA 1NCJA 3OPZL 5SWQB 3F84A 3P3YA 1GW0A 3T2OA 3RL2A 2CDGA 2ZCHL 4K5LA 1CG9A 3N1FC 1G7IB 2UYLB 4LK4A 1BAFL 4PJBB 4PRPB 4TTDD 3V5HA 1OLZA 3BZ4A 2HJFA 4G3YL 5KYWB 1RZGA 3CMGA 3LNEA 2NRDA 4NPKA 3ULUH 3A22A 1J5IA 2APTA 4WTQA 4PP2B 2GJZB 2K8MA 2ZKMX 3BVDB 4MA3B 4E9RA 1OB1A 2NX5E 2JIXB 3FT3A 5EU6E 2DM7A 1HCFX 4EIGB 4YIQB 4AQEB 5DHYA 4JY6A 4RESB 3EDJA 1EEZB 2PMZA 4L8DB 5IZ7A 1PTZA 3LV3A </