2V5RA

Structural basis for dscam isoform specificity
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
391
structure length
391
Chain Sequence
QKGPVFLKEPTNRIDFSNSTGAEIECKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQFGSIISRDVHVRAVVIQSYESEADNEYVIRGNSVVMKCEIPSYVADFVFVDLWLDSEGRNYYPNNAAETDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVGSVRPKVNPQDKHQFIDVELASSYSLLCMAQSYPTPSFRWYKFIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVFTCQYTGNPIKTVSWMKDGKAIGHSESVLRIESVKKEDKGMYQCFVRNDRESAEASAELKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Dscam Isoform Specificity
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Cell adhesion
molecule keywords DSCAM
total genus 70
structure length 391
sequence length 391
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2v5rA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2v5rA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2v5rA03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2v5rA04
2YK1L 4FFWC 2NR6D 4LSTH 5ICXB 5KSBE 3BP7B 4WUUB 2EYTA 4PJCA 3VFOA 1ES0B 1REIA 2GTWB 3V4UL 3KDMB 5ECJE 1RFDH 4PGEA 2Z31A 3EJZC 3HAEG 3JUZA 3D39A 4NCC1 43CAA 2D7PA 4JFHE 4IOSD 5HDQH 2XZZA 3MRQB 1TXKA 2R0LL 5E00A 3RVVD 4ZAKC 4BSVA 2X89D 5J3HC 1CD8A 3LB6C 5F93C 4OLWL 1UH3A 4LHQB 3O2DH 4XCYA 4HQQH 1AXSB 1RUPL 3VXUD 4N0RA 4UT9H 1RIHL 3WEXB 2AGJL 3QUZD 1T03L 2ORBH 3GI8L 3NTCL 5DDHA 5FA3B 5SV4A 1H15B 3MLTB 2E9IA 1ZHLA 2GYSA 2CLZB 5IM7B 1WZ1H 2R2HB 3I9GH 1IILE 3MRJA 3HLAA 3C60A 1I75A 2QQLL 3MFGB 4LCYB 1NLBH 1KIPB 3QHFL 2XN9D 5KVMC 2GIYA 3RPIB 1Z5LA 2DM3A 5HI3D 4KY1H 4PY7A 1C08A 3M17B 5IR1B 4RIRB 2R0LH 2LABA 3VFSB 4YHLL 2DTMH 1KCVH 3QXAA 1T1WB 4Y5YB 4IBLT 4OCXH 5TQ0L 5I1LA 3I50H 1MPAL 2DQCL 1T5XB 4K9EL 5GGVH 3ARXA 4PG2A 4WFED 5DRNA 4ALAH 3DXAE 2NXZD 1WTLA 4DEPB 4AIZB 3UJJH 5GS0L 1I7UA 2EDHA 4L29A 2BXZA 4OZ4A 1QRNB 5E8PA 2EDWA 3OGOE 5J9PA 5K9OB 3WS3B 3DX9A 1W8NA 1WK0A 4IIQA 4DK3A 3HZKA 4HBQA 2E5EA 4LEXH 1CLZL 1N5YH 4Z0BH 4G8GE 1CFQB 4QWWD 4J7RA 3OKMA 2BOCB 5KANI 1MIEH 5DRZA 1UJTA 3QHFH 4HCRL 1NMCC 1U8IA 3PQYE 3ME0A 4JHAL 4LRNH 4MLIA 4WGWB 1M05A 4I3GA 1U8PB 2VIRA 1QO3A 4AM0B 2EIDA 1EBPA 4M4PA 1OGAE 5EBGA 2YD9A 3MRDA 3QRGH 2GSGB 3SN6N 1M7XA 1TENA 4M1GL 1SY6A 1SYVB 2NLJA 3RAJH 2N7BA 3PQYA 4HF5L 4OQ1A 4APQD 4PJEE 4CGTA 2KZ1B 3V6OE 5KAQF 4NQVB 4OFDA 2G75A 1DLHA 3RWFA 4YGVB 5I8OH 5LGJA 2EZ0D 3EDJA 3I6GB 5DQ9B 2H8PA 3HUJB 2PO6A 4XWGL 3PP4H 5IK3B 2VDMH 2AK1H 3NCFB 1N26A 2FZ3A 4R7NB 1MI5D 5HYSA 1R5VA 1YYML 1BJ8A 5FYLH 4QOKE 3MROB 4NZTL 3RGVC 1FC1A 2UZYB 4PP1C 1ZVSB 4OLZL 1V3KA 2W9EH 1NDMB 4N90D 4BZYA 1TNMA 1P5VA 1OCWL 4Q9QL 1J8HA 3CXHJ 3CDCA 4WTZA 3TVMD 5DJ2A 3LD8C 4PJ5E 4Y5YC 4KPHH 4M1DH 2VDNH 4OUUA 2DQDL 1F45A 3V0WL 4X9FA 2DBLL 1IQDA 3TT1H 3DX8B 4ZPVB 3OHXA 4YHMH 3SKOA 1CXEA 4P4KC 1ZT1B 2GUOA 5L2KB 1QR4A 3FQTA 5C0DA 4JHWH 3BUYA 1NFIA 4S2SA 4RSVA 1AE6L 3TIDA 4OZFA 4IJ3B 3BN9D 1UKTA 1KC5H 2VH5L 5E8OB 1WC7B 4LSQH 3BRGC 3LMJH 1K4DA 5KSVA 3O6LL 2X4RB 3CFBA 2P45B 5FO7B 4Z76A 3MLUL 3OJMB 5FK9A 1DBJL 1FL3A 3FQUA 1IGJA 1QFHA 3IKKA 5T1MA 3DIFA 3H6JA 3QI9A 3DX6A 1OVZA 3W81A 2X2YA 1TJIH 4B7IA 4J1UA 4JY4A 4CU8A 3CSYB 1J88A 2WWKT 2AJYH 1DFBH 3RU8H 4G5ZL 4YR6A 4NUGH 4NQCA 2CO7B 2BNRA 3VFPA 4GMSL 2B5IC 4PJDB 5FKAB 2QADB 3MV9B 4GKNA 1IARB 4WFGE 3QIUC 5DD3L 2DLIA 5C0GB 2IANE 4HUKB 4KGJA 5I76A 2PTUA 2ED7A 5AZ2H 4KVCL 2E7MA 2B20A 1KTLA 1YNLL 1KCUL 4LF3A 1OSPH 5IGXH 2F53A 3OF6A 4QXGL 3MRKB 3QCVH 1XMWA 5KTEL 3MXWL 1N8ZA 4G7YH 3P0YL 3ZE2F 2YC1A 4MWFB 4N9GA 5ITFB 5JNYA 5T1DH 4CDGC 1U8KA 3EYSH 1H3WM 2B1AL 5I66A 3ARFD 1AQDB 2YEZB 3DO7A 2DQFA 3VGFA 4UTBH 2Z93A 3SDDC 5DD5H 2ZKHL 3CIQA 4GMSH 4TVPD 4XNMB 3ZZ1A 2IMMA 4ODXB 1JNHB 3QDME 3QNYB 4M9OA 1FORH 4N8VA 2ZUSA 5A16A 3D69A 1UB6A 4PREA 2CDFA 4O2FA 1A9BA 1FBIH 3TJEH 5ETUA 2OQJA 3LEVH 3SCMB 2QQKL 1E4XI 3EO1B 4OZFG 4PLOB 1KB5B 1TZHB 4FQQB 5DFTA 3DV4A 4P3WA 1OY3B 2PYEB 1MWAA 4KY1L 2RCSL 2W59A 3GJEB 4MA7H 5I75C 4M6MH 2UZXB 4YGAB 3UTTD 4DN3H 2E3VA 2XRAH 4POZD 1Q0YH 1D5MA 5I6XC 2HJLA 4Y1AA 3X14A 1JTOA 2APFA 4ZFOB 3HCVA 1JGLL 4RX4A 1YPZE 3QQ3A 4WUUD 1MUJB 3D1MC 3LPFA 3MRLA 3RNQA 1NBZA 4X9GA 1YNKH 3VDCA 3QDGE 3MLPA 1I1YB 4UQ3B 2CXKA 5EOQL 4X4XB 4OF5A 1JZ4A 2VUOA 3QXTA 5FCSH 1BVKB 3U0WH 1U3HB 4IEFB 3RWEB 1BP3B 5E1HB 3SQOH 1J10A 5HGAA 1S9VA 1CLZH 1Q9WA 5EOCH 1N5YL 2X09A 1QVOB 5HVWA 2NX5B 4OZGA 2NXZC 1H3PL 2I27N 2OTPA 1A47A 2BVOB 2VZ1A 5CBEB 1PKQA 3MCLH 5DS8A 1LO3H 1L6ZA 1YN6B 1JZ3A 2VR5A 1JGEA 4JKPH 3UBXI 4WEBL 5DK2B 4YIQA 1K85A 4NKIL 3F12B 4HUNB 3RY6A 1T1ZB 3I3DA 2VXVH 4FP8L 2W38A 4QHUB 2OTUB 1PQZB 1WT5C 2QSCH 2EO1A 1ACZA 1ORQA 4I18C 1J1PL 4NO5A 3ZYOA 3HE7C 5SWQB 4HWUA 5AEAA 3VXTB 3S8WA 4KVNL 5FYJH 1T1YB 3GSRB 2H2PD 5GRVK 3E2HB 1KOAA 5F1NB 3EYUL 4ENED 5JXED 1F11A 2IWGA 3M45A 5EC2A 5IJKA 4QRTA 4ZNEE 4JFPA 2ADGB 4C83B 1A02N 5T5FL 3GMRB 1X5KA 3RDTC 3MLSH 3F7YB 1KYOK 5ESQA 3C6LB 4GUPA 1R3IL 4X6CF 3WHXB 5H2BB 1K2DB 1NGZA 4MNGB 1XZ0B 3RVVC 4ODHL 2OM5A 3WIIL 4FNLL 2XN9E 4Z7VB 5C0AE 3I85A 4NQDB 2XZQL 1AXTH 4IRJA 5CZXD 2CIIB 4PRBB 2FD6L 2GJZB 1MVUA 2BCKA 2JELL 2WINA 3MA9H 2BJML 3VXRD 4GKZB 3OAUL 3BH8A 3GKWH 4YHOL 1BM3L 2PUQT 4DGIH 3MODL 4PFEA 2EYSA 1E6OH 2A77L 3B8SA 3C2AL 2I07B 2NR6C 5GZNC 2BSTB 1M7DB 3KPOB 4AG4H 4RFNC 3T09A 4FQXC 5EFIA 1RULL 3G5YB 5I19L 1WBYA 5HDQL 1B9ZA 1HE7A 3OAYH 3QFDB 4G6AD 4ETQA 4NUJB 4N90E 3BIAX 3VFTB 2QSVA 4N0UE 3S35H 3BPNC 1G9EA 4HJ0C 4KTDH 3TV3H 3DO3A 3PNWA 1MI5A 3HG1B 5EFIB 1J1XL 3E6FA 1QA9A 3CX5K 1P4BH 3CD4A 3RJDA 3SHSA 2F5AL 4JFDA 4DEPC 3RKDC 2VNCA 4OIIH 3GSQA 4JZOB 4WI2A 5F6IC 1S9KC 3FL7A 2LE9A 2P8MB 3HAEH 3BOVA 3TNNA 1SVCP 1CXHA 4PRBA 4FQLH 5CEZL 1J9CT 3K4AA 4NQDA 4OCRL 3S5LG 2BRRH 3Q5OA 2BVPB 1RIVH 4OLYL 3TZVC 1HIMH 4PGCB 1I1AC 1AD9B 3WNKA 5MP6L 1P2CA 1K2DA 3FZUC 1SY6L 1IGIL 5DUBA 3VMNA 3BDBA 3DVGB 5JORA 3BPCB 3T77B 2R0ZL 2NXYD 5FUZL 4TUJB 4NP4H 2R23A 1U92A 5JW4Q 4KMTH 1JUFA 1CGXA 1KPRA 1TJGL 4XNQA 1MNUH 4JFPB 3RHWF 5JOFB 1YC8A 3QI9C 3PWVA 3QUMH 3BPOC 4MAUH 1U95B 3TBYB 5JW3H 3C8DA 1RURH 1W72H 5F7WC 1RIUH 3DRQA 5DD3H 1G6RH 3FTGB 3BW9B 5FA4A 5GS0D 5JDJA 1V5JA 4YZFF 1YNTA 3J7HA 4LHUG 3KR3H 3GSNA 4JCLA 4WW1B 4B41A 1EBAA 4NO5B 2GJ6D 5DJAA 5SX5H 4KRNA 2JK5B 3BSZL 5IGXL 2KH2B 5D2NA 5C0JB 5HHQB 3DNKA 1V8HA 3ROLA 3SDAA 1PQZA 4PBWD 1AY1L 2OTUA 2OTWB 3MBED 4JG1L 2N1KA 2JJWA 4RAHA 3T3ME 1NBYA 3RGVB 3AVEA 2P8PA 3ULUF 4KDWA 2BNUB 4MCZB 5JHDB 5J11B 4N0YL 3U0TA 2YZ1A 3GGWA 1YEEL 5I1DB 2G60L 1LO2L 4IRZL 5EH1A 5EBLB 3UPRA 1QVOA 2EDLA 1KLGA 2Y6SC 5D5ME 1VGEL 3BEWA 1RSFA 5HGAB 5DJXA 4YLQT 3KPSA 5FO9A 4I48B 1FRGH 4Y16B 4PBVC 4QLRA 3L95B 4DTGH 3SDCB 2BOBA 4M93B 1I1YA 4WU7B 3Q3GB 4Y2DB 3FQXB 3U4AA 2AK1L 3RWJB 3CJJA 4HIHB 3QG6A 4NQCD 4PJEA 2EE3A 1U58A 3WV0A 3ROOB 2MPAL 3X14B 2HJLB 4Y1AB 5KJRL 1AO7A 3ARTA 1R3LB 2AQ1A 5E7FA 4U05A 1Q9KA 1RUAL 4HWZB 5HDBF 1HZHH 5CCKH 1VEMA 2R4RH 1VFBB 5GSVB 4XXDA 5KSAD 4LPWA 1CL7L 5D8JL 1KLUB 3TH3T 4APQB 1PZ5A 1AC0A 1KB5A 4DKFH 2I5YH 4NFBA 1CGVA 2A6DB 4F7CB 4K94C 1BJMA 2F58H 4HLZG 1QLFB 1S7SB 3WHE1 3BGFC 2GAZA 3RVWD 1D5ZA 1R24A 4PREB 1CZ8H 3SKNB 4HH8A 2J88H 3HNTL 3UX9B 4JM2F 1HINH 4JM4H 4MXWH 5FF6A 1MAMH 2M1KA 4FFWD 1I9EA 3QNYA 5SWSA 2X05A 5CZVL 4LCWE 1JNHA 1WCQA 2VWEE 1YYLL 5FUOL 4X6EB 3O6FC 3ARRA 2DAVA 4DZ8A 1OWWA 1GVIA 4FXKB 1JNNL 3IDMA 3MTRA 4F7MA 4JAMA 4JKPL 1DEEA 4JVWA 4FQ2L 1WBXA 4KV5E 4LPXA 2EDKA 5BQ7A 4NC1E 4EEEA 4ODUB 5JNYB 5ESVB 4MCYB 3PWNA 1AGCA 3MRPB 3UTSE 2ICWI 5C7XL 1N8ZB 4O2EB 2VOTA 3MRNB 4M5ZH 4ELMF 5M7QA 4LF3B 4JO2L 4OI7A 1JF1A 5E9DA 4RGMC 2K7QA 2O93L 2CIKB 3QEQE 4Y2DC 3LY6A 3O3BA 3TBVA 3UYRH 4M00A 1BD2E 1BLNB 1TIUA 4PJIF 5FKAA 3LH2H 3VFPB 2R56L 4OGZA 3KLHC 4NQCB 5C07D 3RTQB 1A21A 4KI5F 3GSNH 4MS8C 1V7ML 3B9EA 1AKJA 3N9GL 4XWOD 1OW0A 1FVCB 2AABH 4JFXB 5EO9A 3PGDB 5IFAH 5IHLB 4U1NA 3DX6B 2D7TL 1OF2B 4NNYB 4NQDD 4YHKH 1WCBB 3QO1A 3KS0H 4ZD3L 5T1DL 1R3KB 1BPVA 2WP3O 4ZFZA 3D39E 3D5OF 1NEZG 3VU2A 3TO4C 3JWOL 3PWJB 3S9DB 4JN2B 3MUHL 2PW2A 2NTSP 3MGAA 2ESVB 2OJZL 5I75B 3V79C 4BQ9A 5E8OA 3B9KD 4WUKH 3ARUA 4X7EC 3TN0A 5D4QA 5E08L 3T0EA 2NY3C 4YHPB 2NTFA 3AS0A 3VWKC 1I8MA 1HNGA 4HC1L 5F7KC 2AABL 5JO5A 1IGML 5MEQB 5FYKU 1ZT1A 2GUOB 2DQTL 2SEBB 3BRFA 1QKZH 1F8TL 1A3RL 4ODTL 4ZPVA 3SKOB 1IQDB 1FV1A 1KPVB 1IFHH 1QNZH 1FZKA 4QEGA 1BBDL 2N7AA 1K5NB 5DJZA 1T7WA 4HCRA 1F2QA 3E8UH 5CP7B 3LRGA 5E1AB 5K93A 4H88H 1FNSH 1QBLL 1J5OL 4CU7A 3JWNC 4H20L 5CJOH 1OAZH 3TFKD 1OARL 1IM3A 5C0IA 3MGOB 4KK6D 3RX5A 1E4JA 1JL8A 4PBXA 1KGCD 4MQSB 5E2JA 4XAWH 1TVHB 4DGYL 3H7BA 3TPKA 1NEZB 2C4FU 4WVRA 4U1MA 2FO4B 1S9WB 2H8PB 3HUJA 4RAUB 1HSBB 3S4SA 4HPOH 5L8LB 1FPTH 5JUEH 4ODSH 4B5EA 1P53A 4KI1A 4K7PL 2G5RA 5L6YL 2X4QB 1BHGA 1FL5B 3MJ9L 4M6ML 4JFFD 4EKXA 1RFDL 1X5FA 2NLJB 3NFNA 4L4JA 4UB0H 1A3QA 1BFSA 3S34H 3IAGC 3QUZA 2HRLA 4HUWA 2CO6B 1U8PA 4UT7L 2VZOA 2VDQH 1EGJH 3QNZB 15C8L 1CFSB 3LKPA 3T8XA 2FIKA 3ULUD 2IANB 4IDLA 2IH1A 3L3OB 4J3TA 5DT1L 1M6OA 4Q0XH 2G9HB 4NOFA 1AGFA 5F3HA 2WNGA 3X12B 5IB5A 5IFJB 3QDJB 1IC7H 3VWKB 1NGPL 4IIQB 3WS3A 3RIFK 4E42B 1QRNA 4OZ4B 4KK9C 2CXGA 4XPBH 4WI3A 3HMXH 3WSQL 1J0IA 4KKCD 5DZNA 2UY6A 3VE0A 3MUGB 1KBGL 3WNMA 4P3CL 1DP0A 1HDMB 2EE6A 1KJ2H 5FOJA 1K4CA 4EUPH 3H7BB 2NYYD 3V52L 4H1LB 4H5SA 4KJYA 3A6CL 2UV3A 2BVQB 4QRRD 3UC0L 1OAKL 1DQMH 1OQOA 5GZOC 4AEHL 5ILTL 1QPPA 3WJLC 3MGOA 3JWOC 5IROC 3FB6A 3D9AH 1LK2B 3OKOB 1R5IA 2YPKB 1XIWC 3D39D 1WEJL 2AVGA 4HIEB 3U30B 2JELH 2V9TA 3MA9L 2B4CC 4P4RB 2BJMH 4FABH 5DJZB 1I1AB 3LS4L 1H15A 3OSKA 5DHVH 3RKDD 5CEXB 3GMQB 1ZT4A 3WEXA 1FFQA 2ZCHH 1DN2A 2WUCL 1WISA 4MQXC 3I3BA 4GW5B 4XNXL 2VXTL 2AJZB 4FQCH 4PV8A 5FHBH 5INDB 1T0NB 4RMRA 4U3XA 1NDGA 4YHPA 3ULVH 2VE6B 3TN0B 4BZ1H 5GZND 1ZGLP 1OTTD 3P11L 1T5WA 5E5MB 1YQ2A 5DHVA 2NW3A 4BK5A 4OSUL 3BP5A 4BKLB 4RCAA 4ZTPL 3KNBA 2ESVA 4DOHB 4LVEA 4CN1A 3D25B 5EUOF 1T0MB 4PJCB 3VI4E 1YY9C 4MJ6A 2VDML 4O58L 4RGNC 1W0VA 5FHAL 1RULH 3FT4B 2IAND 1OAYH 3MV9E 2B1HH 2X9YA 4PJDE 5ADPL 3ZKXC 5FM5M 4NNYA 5MP6H 3BJLA 5TE4L 3U9UB 4PJBA 5DMIL 5B22A 2WSKA 5HYJD 2BNQD 2A83B 2VDLL 5H35B 1HWGB 1I9IL 3PGDA 2AV7B 2CLVB 3LEXB 3O45B 3UPCA 4AK1A 2ARWA 4P46D 4PB0H 5DD6A 4G3YH 5I1HL 2W65A 4OGXH 3LH2L 1JK8B 1AKJB 2R0WH 1WFOA 3PHOA 5EU3A 1AC6A 2RBLA 3R0MA 3VG0L 3O4LD 1MHHA 2R0KH 1YEIH 3NACL 3OKLB 4X7DC 4KPHL 2CIKA 2BSRB 3O2WH 3G5VB 4JQXC 4G7VL 5BRZA 3UTQB 4S1SH 1A4KB 2BVUA 3HS0B 5T3ZL 4UIMB 4QRPA 3HR5B 2XPGB 3E6HA 2DQHH 1DBAL 5F1IB 1K9TA 5C07E 5TPWH 5EG6C 3PWNB 1DUZB 1MCWM 4FZEH 2FB4H 2VLRE 3QHZL 4NKMB 3OQ3B 2P5WB 2LAGB 1RIHH 2F53E 4KHTL 4N8CL 4PJXE 1MHEB 1NAKH 1VENA 5MHSD 1JZ7A 5IIEA 4X6EA 2VLRA 4XH2B 1O0VA 3PG2A 5L2JA 1F4YH 1UJ3C 1MELA 3IU4L 1EV2E 3O6FD 3LZFL 2CRYA 2IC2A 5FF6B 1MF2L 2J4WH 5GISL 1AFVH 2NZIA 4YUEH 3CFKB 2GAZB 4WO4B 1NSNH 3O3EB 1HXMA 3AS3A 2Z35A 1C7TA 3MLZL 5DK3A 1QUNA 5DRWB 1GAFL 3V6OC 3GI9L 5HGBA 4X6CB 1N4XH 4R7DB 2E7CA 2A6DA 2GT9B 3BZEB 2F5BL 4JE4B 4KUZL 3RL1B 4H20H 3QH3B 2XV6B 2JE8A 3HZMB 4UTBL 4AYFA 5I15L 3KYAA 2VN7A 1CTNA 1YMMA 3WFDH 3PP3K 2EKSA 5F9WB 3V7AG 2VN4A 4PJEB 1JN6B 2VKWA 5I0DA 1D6EB 1GXEA 3RNKB 5F7LB 5LCVL 4LSRL 4UDTA 2FSEB 4Y2DA 5BV7C 2PR4H 3HNSH 3NGBB 2BOBB 2W0FA 2ZCKL 3FMGL 4I5BB 4S1DC 3RY6C 3FFDA 3RBGA 4Y88A 1E4KC 4UNTA 3BEVA 5CGYC 1BQLL 1AHWA 3QUXD 3IDJA 3KYNB 1G6VK 1F00I 4LSPH 3C5SB 4TVPH 3KWWB 4XP1L 5AZEH 1G9MC 3GGWB 1ZEAH 2Z8WC 4X99B 2VABA 4Y4KC 3EFFA 3BKYL 4BQ8A 1XCTA 2HN7B 4YE4H 2WWMD 3G5XA 3KPTA 1U8MA 2WK2A 2BNUA 5ISZE 4C4KT 4Y5VB 5JR1H 1XGQA 1RK0B 5B3NA 2OTWA 4PJIA 1GRWA 1KJ3H 1NGQH 1QFOA 3E0GA 3TO4B 4YBQC 3BQUA 4C56A 2XTJB 4DQOL 1S7QB 5GRJL 1HN1A 1E4XL 4YBLB 2IPKB 5KS9B 4Y19A 3MLVL 4Z9KB 4JLRB 5C09E 2YN3A 4L9LA 2KQMA 4FTVB 4KKAD 1X4YA 3BE1L 5EDXA 1J1OH 5EOTB 5GGUA 1ZK9A 2V7HA 4U1HA 3V4VL 5T3XL 3T1FA 4NRZB 1WT5A 3MV8D 1BD2B 5ILTH 1NUFA 2KL6A 5JORB 5DMJB 3MRGB 3DJ9A 5SX5K 3V6OA 3EJYD 5F6HI 2ESVE 5A43C 4UILH 1AD9A 5HDOA 1BVLB 2MJWA 4K71C 1W0WB 3ZHKA 2BVPA 4MNHB 5D1ZD 4P5TD 5GGTH 1NUNB 3O2VH 1NCCL 1WZLA 2HJFA 1QYGH 4QOKD 5BV7B 4LVOB 4U6HA 3IDIA 2GTZB 4F9LA 1P7KB 3SDDA 4L8SC 1E4WL 3PWUA 3W11D 3FOMB 3OZ9H 2OL3A 2EYRA 1UM5L 4UTAL 1MCNA 3ULSB 5I1IL 3GNMH 1BX2A 4QY8A 1U3YA 3MRBB 5DC0A 4LCWB 4U6VH 1JIBA 1FNEA 4KROC 5J6GA 3BYTA 4CVZA 1BFVL 3BD3A 5B21A 5E4EB 5HVFB 2AJVL 4HIJA 3CDYA 3ZKND 4YFDB 2UWEF 1YEHL 1EA9C 2UWEA 1EFXD 3BVNB 3OAUH 4LLVA 4X98A 1FCCA 3VGBA 4OZHB 3S96A 2CIIA 3LQZA 5TF1L 4IRJB 1FJ1B 3GSUA 4JKLA 3LRSB 1QHPA 3NFSH 5FGCB 2Z92B 3FB5B 3MBEB 5TDPA 4HKZA 5FOBA 4Z6AT 2NY5C 4IS6A 5CZXC 3WHXA 2DJ4A 4PJ9C 4HKXB 3HAEA 5CAYB 4NPYA 1RZIB 4HCRH 3QQ9C 1TFHA 1OP5H 2P8LB 3DXAD 3F7YA 4OCWH 1HHIA 4MB4A 4C83A 5DZOA 2ADGA 5ALBH 3BT2L 1I3VA 3F7VB 4P2RE 4PRHE 1U6AL 4Y4FC 4PJFB 5IJVA 2HLAA 3ARDA 5EZOH 4ISVB 1INEL 1NCWL 2NY6C 1U8LA 1T1YA 3GSRA 1OAZL 4TRPH 3PJSB 1YEDB 1N5AB 3WCYA 1B0RA 5I1CH 4FQHB 5B38A 4NT6B 1QQDA 2CRMA 5AG9A 3S5LA 3JVGC 4X6BB 2X4NA 5JIIA 4GXUM 4QHUA 4MJ2A 4XZUA 1T1ZA 5FDWB 5JW5B 5BS0E 3BKJH 1UQSB 2IPTL 2BNRE 4YIQB 3KPNB 1IM9D 4QWWC 5FYKE 1XIWB 5IKCB 5EN2A 1J1XH 1CICB 3CLFH 4WHYG 2Q7YB 1I3RB 1T2QH 2NX5A 4OZGB 2W9EL 3A67H 1Q9WB 4HUVA 1N64H 3SJVB 2QHRH 5IB3B 5D2NE 1FZOB 3IJSB 1WITA 1G6RA 4PP2A 1ZGLA 2COQA 1IKFH 3QQ4B 1HILB 2Y5TB 4X4XA 1EEUA 4P23C 3LHPH 4PJGF 8CGTA 3HTLX 3IGAA 1KXVC 3OX8B 3GIZL 3MRLB 3VG9B 4PJXA 3IDNA 3MLZH 43C9A 1PG7H 2P5WD 1UA6H 3F7RA 1UCTA 3DGGA 1NH6A 4OJFH 5DD1L 3U82B 1IC5H 3QDHA 4XPGL 4PJ8A 4X9BA 3O41B 4MA1C 3DGGB 5HGDB 2FX7L 1EEZB 1P4LA 4GT7A 2ADFH 43C9B 1KFAH 5JHDE 4UNUA 2AK4A 5CS7A 1U93B 1T80A 2X4OA 3H7LA 2F8VA 2ZSWA 4H0IA 1WZ1L 3IGAB 5IHUH 2PYFB 2AXJA 5BRZE 3GHBL 4PGZA 1ZGLB 3L6FA 1DQQB 4O2FB 3GMMA 3HC3H 3UROR 1CR9H 3AC0A 1CE1H 5KW9L 5IBTH 4F33A 2C4XA 4JG1H 5GRWA 2DF3A 3L5XH 3RWDB 4N8VB 4F8TA 3EOTL 4RISL 5EUOA 1MREL 3UJTH 4UT9L 3MJ6A 5GHWL 1SJEB 4LEXL 5TE7H 4XGZA 4OCXL 5C86A 3UBXA 2EDFA 3C08L 1DQJA 1HHKA 1RU9L 1RZJH 5I66B 3U4BL 2F54E 4P2OD 1QQDB 4YBHA 1TETH 4QNPF 3U48A 2RGSA 3WXWH 3PV6A 1MFCL 5FYJE 5L7XH 1SEBB 4PGDA 5TDOA 1XCQB 4NBZB 4XNZB 1OL0A 4ESKA 4ISVA 2DYPD 1OSZB 4ZPTB 3L3JA 4EDXB 1F90L 3RZCD 4ONHB 3V4PL 4D9RE 2NY2D 4LLYA 5I76B 3ZL4L 4BA8A 3WUWG 3QUKB 4BQBA 4GRLD 3G6JF 4E9LA 1RZIA 4GAGL 4PRPD 4U31A 1EFXA 3QCTL 2CJUL 1UJ3B 3JWDH 4YR6B 3IRZA 4IS6B 2FHFA 2RJMA 1FNGA 1FGNL 1KELL 5TDPB 3MBEA 3DBXA 4XPAH 4U1LA 1JWUB 2HT4D 5J6HB 3DHMA 3GSUB 2EXWC 1K8IA 2A74B 5F88B 4M5ZL 3PQYD 4IMLB 1ACYL 4DN4L 1GGIH 2QHLA 1FL3B 3VXUE 1N7ML 4DK6A 3BFOA 5IBLC 1TMCB 2FDBP 4HK0B 3RVTD 4LCWA 4KDTA 4XMPL 3QEGH 5JMOC 4R90L 2X4RA 3CFBB 4QY8B 4BFEA 3QJHA 3GB7A 5D1XD 4YHML 1FO0B 2FR4A 1NEUA 3EZ8A 2EEDA 2EYRB 3T2OA 3QG7H 5C0CA 4AL8H 3E3QC 3CH1A 1OCWH 3SGKC 4J3WA 1AE6H 3VXPB 4M1CC 4KZDL 1CGSH 3ARGA 2E9WA 2V7NB 1ZA6A 3NMEA 4HX1A 4ZAKB 5CUSL 4LOUC 4OV6F 3MNZA 5FYJD 3RWHA 1CFBA 4LNRB 5EZLA 9CGTA 1UVQB 4MX7A 1DBBH 3SGDI 4U7KA 1I8KA 3H9YA 4M3JA 3BUTA 4BSWA 4HGMA 5CBAB 4X8JA 4BELD 4KKCC 3W2DL 2UZIL 5HYJB 1GZPB 2VDPH 3CC5B 3SPVB 3MRGA 4PTUB 4DJMA 1ZV5A 3O11A 4CMMA 3I02B 3QEGL 4NRZA 2CK0H 1SQ2N 4Y5VC 3WFHB 3IXTB 5EOTA 2XKNA 4JPVH 5EU6D 2KDGA 3BZFA 1T7VA 4JLRA 1BBJA 4DAGL 3ULUC 1HKLL 3MLYL 1UCBH 2IPKA 5C0BA 3LSOB 4CADA 4PJ7E 4UZGA 5C08A 1S78C 1UWGL 4M9PA 4NO3A 5KVGL 3K80A 4U1IB 5E6IC 4M7JL 5C0BB 1JV5B 2Y23A 1RK0A 4R6UA 3WJJA 1QFWH 2E9BA 2O5ZH 3U36B 1HQRA 1CBVL 1VGEH 5ESAA 5KSUB 4I4WA 4LL9A 1EEYA 3GBLA 5ID0A 2Q8BL 3BKYH 1A6VL 4O5LL 5DUMH 1FVEA 2VDRL 5JOPD 3SPVA 4KU1A 5LGHL 3O3DB 3STLA 1OD7A 5IW6B 5FM5O 1WFUA 5JR1L 4ZDHB 4BSWB 5L8JB 2VL4A 3BYYA 4Q7DA 4GAJH 1I8KB 3SO5A 3KXFB 4XVTH 1UVQA 1IL1B 2BY2A 5JUEL 3DETD 5IFHH 4FFYH 1BQHG 5D7SL 5L6YH 4YHOH 3ARGB 1KCRH 4H88L 4J23A 5CFHA 4YXLL 3CH1B 3CFIC 2NY1C 2DLFH 4QHKI 5I1LB 4JPKL 4KKLD 4P2OA 2Z31C 1DBKH 4MD5A 5ICYA 5HHVL 3RWGB 4F7EB 5HPOA 2JCCB 5SWZB 3SGEI 3QH3A 2BSSB 1U8JA 4N0UA 1Z5LB 4Q0XL 4U3CA 1EAJA 2XA8H 5CEYA 5D70L 4BUHA 5DRWA 3T0AA 1HCFX 2NY0D 3HLAB 4OFVA 4PJ9D 4JHZA 4G6MH 4OF7A 4IMLA 2BXYA 5IM7A 2CLZA 3CFKA 1ED3A 3NIGF 4J4PA 3MLTA 1U8OB 4UOJA 4NQEE 5J13C 1WF5A 4FG6C 3MV01 4RRPA 5IVNA 4LMQI 4L3ED 3QEQD 1G9MH 1JWUA 4OZFH 3GMOB 5GSRB 5CD5D 3QEQB 2CQVA 3FQNA 5BZWB 4PGJA 1LEIB 5E24E 2VB5A 4N8PA 3EOTH 4XPHL 3SKMB 3UO1L 2OI9C 1SMOA 5E00B 3MRQA 1X5HA 4NNXA 5TE7L 5CSGA 4G9FE 3QUML 4IJ3C 1G7HA 1EJ6A 2E27L 2XI9A 3L3JB 2D9QB 2W0PA 2FEEL 2FX8L 5FM4A 1PLGL 1J12A 1ES0A 2GTWA 3A6BL 3OB0K 1SEBA 4PGDB 4WU5B 2DM2A 2Y1VA 5TDOB 2EYTB 3HS0A 2VLLB 1G7MA 1RZ8A 5IB1B 3G5VA 5FIEA 3N1MC 4UI2A 2E6QA 1IVLA 1OAXH 2VSDA 3UBXB 1Y0LB 3WKML 1F90H 5F7UA 1UH2A 5C0AD 3N1QC 4F8QA 1JYNA 2IQAB 4BH8B 4HLZH 4IOIB 4F7PB 4N0FB 4UV7L 2E8ZA 2NY2C 1JK8A 4NN6C 2CKBB 2IG2L 1QSFE 3W82A 2WIIB 5CILL 3EAKA 4G42B 1B3JA 1CQYA 5IBUG 2A83A 3HI5L 4GRWH 5GRZA 4KVNH 3FOLB 5FYJL 3TZVA 5L2KE 1BQHA 1BIIB 1RQ5A 5I71C 3IF1B 1FE8H 4OV5B 3X11B 1RZGB 5B8CC 5F97E 4P2RB 4PRHB 3VJ6A 2ESVD 4XMLH 4P4KA 4ZFGH 2ZSWB 3D25A 3FB7A 4FHBD 1YMMD 2APBA 3KNBB 3G08B 3TP4A 1C5CH 1EEZA 1P4LB 3BT2H 4KKAC 2WZPD 2H1PH 5E5MA 4OSUH 1ZA3B 1RUAH 3C5ZB 3WFEH 4BZ1L 1H8OA 2ZOKA 4TQEH 5GS2D 5FHAH 3AMKA 3A67L 3TH4T 3IDNB 4PJXB 5DMGC 5I0ZA 5IHZB 1IE5A 4OM1H 3ETBF 1U91B 5J57B 3OX8A 4Z95L 1IAIH 2J8UE 4PB9L 1ZT4B 2DMBA 4M7ZB 4PRID 5CEXA 1MLBB 3QQ4A 2VDLH 2ADJB 2HVJB 2IPTH 2Q7NA 5ENWB 4EUPG 4LHUD 3DXAB 5T3XE 1A3LH 1P84K 1CZ8L 2LVEA 4F2MA 3UTPD 1PG7L 1ZHBA 4QRSA 3ULVF 3TWCL 2Q7YA 2Z31D 1FYTA 1IKNA 1EZVX 3MRFB 4NQEB 5E2WH 5GGSY 2DQUL 5EN2B 4YK4B 2GI7A 1MCOH 1NL0L 2DBLH 2P47B 3ULUE 1YEIL 4LPCA 2UYLA 1U8NA 4QHKJ 1BQSA 1G9NL 4PUBH 1FCGA 3VH8A 4CNIB 4UUJB 5J1AB 3DETC 4OIAA 3KLAA 3BMWA 3RIAK 1RJCA 2FLRT 4Z77B 4JO4H 1MJ7L 1AP2B 5C6WH 1I7ZB 3MLYH 2VXSH 3CCHA 3O9WC 4PRNA 4UT7H 3SO3C 3FQWA 4UIKL 1KACB 1ZVYA 2X4TB 2K3TA 3F62A 3TIEB 4ZS6C 4X7SL 2ENYA 4PJFA 5DHXB 5IJVB 4N8CH 1NBVL 1FGVH 4I3SL 4ORZC 3ZE0F 1TJGH 3QDJA 3IFPB 5F3HB 5F44A 4QYOB 5I1AB 1HHIB 1M6OB 5E5UB 4MA8L 4PIRF 4GQPH 4G9FD 1PVHA 2IANA 4KJPD 2L7UA 3QA3B 4LSTL 3C5ZC 3FB5A 1SMAA 2J6EH 5IMMB 4R0LC 4NKOB 1AD0B 4OZHA 4GS7C 4POYA 3HN3A 3NA9H 3BVNA 1TZIB 4Z18A 4ODWA 4G8GB 4XXCC 1N4XL 1T20A 4OT1H 5D71L 5DXWA 4W6XB 5HY9A 1PG7W 1I9RL 4MGXA 4JANB 4OZIF 4HLJA 3KPMA 2YS4A 2OR7A 3DUSB 4XRCB 5J6GB 4U1MB 1NBVH 2FLBT 3R1GH 3ZL4H 4F3FA 4KAQH 3ZYJA 3O0RH 5GS3A 4LSQL 1CLOL 4X8XA 1GHFL 4MNQA 4BZ2H 3ULSA 1CGUA 4F7TB 4Q9CA 4JFQB 1TITA 3HZYA 1UENA 3QUYB 4MAYB 4XTRD 5AZEL 5HI5D 3S6CA 4JY5H 5FCUL 3PWUB 4PJDF 4EI5A 1KCVL 3RDTB 2EDYA 4HC1H 2WQ8A 4U6HB 4JJ5A 1IKNC 3O6KL 5KANG 4LLQA 4LCIL 1H3GA 1RJLB 1J0KA 4HFWA 1FZKB 3ESVF 1CDYA 1VHPA 4FQIH 4UT6L 4GMTH 3L3HA 4XP9L 4S0TD 3RIAF 5TDNB 3QCTH 4C59B 1V3MA 4XXCA 1EO7A 2HT3D 3EYFB 5JO5B 1Y6NR 1MPAH 2DQCH 3CK0L 3LV3A 5CWSB 2ATPB 2XZAH 5CD5C 5FECA 1CIUA 2UY7A 3T0EB 1X5ZA 4O4YL 3U7AA 2AXFA 5TH2B 3CVHA 4RZCA 4PRIE 4D8PA 3FT2A 4XPFL 4R8WH 3S3JA 3DX7A 5TE6L 4LPVA 4V1DB 2ERJB 4XX1E 3BQUB 2OMBA 1F2XK 3WDIA 1WCBA 3QO1B 3GRWH 4WV1C 1OP9A 5C6TH 4JFZH 3SBWC 3LCYA 5KSAA 4JDVA 3NIDE 1F4XL 1ODAA 5AWNH 4QRUA 5EO9B 1KJMB 4XAKD 2ZP0T 3G5XB 1S5HA 3UMTA 3C60D 4L8CB 1T2JA 4BK4A 5DWUH 1CVRA 3BJ91 4MQXD 3C5SA 3RTQA 3MQIA 1E27A 2YWYA 4LHUA 3QUMB 1R5WA 4JN1L 1S9XA 3QUYC 3UTTE 3O3BB 4YO0A 2NQCA 2R4SL 5CSZB 1XIWD 5DURB 3N9GH 3BKML 5E2VL 4O2CB 1I1RA 3KAAA 4TSBH 4O2EA 4RBPK 3OV6A 1MQ8A 1NC2A 4H0GA 3REWA 3OJDA 2VXVL 2WMPA 5T5NG 3GM8A 1FFPB 35C8L 3GSNL 3GJFB 3QXWA 4MA7L 4WWKA 1NCUA 3GHEL 2OXHA 4PV9B 3IDMB 4F7MB 1FN4B 2VRAA 4AIOA 5EIQA 3UTZA 4DZ8B 4UTAH 5EC1A 3QIBD 3SOBL 3HZMA 3MCKB 4JO3L 5D2LF 3MRIB 5CGYD 3BZ4A 5C09A 3RL1A 5DQJA 4Y19D 4F37F 1MY7A 4L3AA 1G7JB 3VRLF 3VXQB 5BXFA 1LE9A 4M6NH 3MUZ1 3U0WL 3EO0A 5IG7B 2R4SH 4KJWD 4NHCL 4OLXH 4EVNB 4JM2C 5F71A 1Y6MR 1QSVA 4EQ2A 1ONQA 1OB1A 2DOCA 1QD0A 4HBCH 4F7CA 3TVMA 2EZ0C 5C09B 1GGBH 2X4SB 3HMWL 2A6KB 3VDBA 4L4VB 3UTZB 4GAJL 1YECL 1MHEA 4JRXB 1GL4B 5C2UB 5EU4A 3X3GH 3PE9A 4U1GC 3GJFA 2OZ4H 5I1EH 3EOBA 3PF2A 1G7PA 4DZBB 1AO7B 4LAQL 1C5DA 1MHPL 3ROOA 1ERNA 1OPGH 1KCRL 4RFOL 3TYGL 3HR5A 3QUYD 3HC0A 3NIDF 5I74C 2QKIB 1MEXH 4TTGA 4F9PC 4ONFH 3IDGA 3T4AA 4L8BA 2HLFD 4XNYL 4JRYA 3M8OH 3KPSB 1OHQA 5FO9B 3Q6GH 4ZXBD 1DSFL 3BGFB 2EEBA 3L9RB 2IGFH 1FG2A 1WIOA 5EU3B 3LIZL 4M5YH 1I7RA 2J2ZA 2YK1H 3MFFB 3B5TA 5D1ZB 4WFEE 1U0QA 1KJMA 2Q8AL 1YDPB 4MB3A 1MCSA 1JYXA 1NBYB 1F58L 4HS6B 1MH5A 2E7HA 4HSQA 4PJBB 1RZ7H 3B9KC 4PRPE 3QCUH 5K33A 3VFNB 4WNQB 1BGXL 1OP3K 3A0OA 3FT4A 4G9FB 4V1DA 4HUUA 3GSNB 4WW1A 1I9JL 5D2NC 4BFIB 1R0AL 2DQHL 3B43A 4GOSA 4GRLC 4RZCB 4BKLA 4D8PB 2YD2A 3GSWB 4U4BA 1OGAD 5SV3A 1PBYA 3INUL 2F19L 3OF6D 3T4YA 1KPRB 3VD4A 1T1XB 4JO1H 5FECB 1XF1A 4GXUN 3P9MB 3CLEL 4PV8B 3LV3B 2PETA 3U0PB 3DVGA 1C1EL 4GRMB 1A7OH 4NM8H 4Z7OF 2BY3A 3TJHD 4KRLB 4IRSD 3VWJB 4S1RH 5J1TC 3UDWC 4E41B 2JB6B 1WVZA 1DTUA 1RU9H 1RZJL 4P2OC 2ED9A 5IQ9B 1FDLL 3WN5B 1UM5H 2X4UB 4X5XB 4P4RA 3LEYL 4TN9A 2F53D 1A7NL 4P2QE 2BHZA 1U9KA 3B6SA 3UJTL 3W9DB 3RDTA 1R5IB 2YPKA 4S1QH 2UWEE 5BVJA 5IW1B 3IKCB 3MOQA 1QA9B 2CK2A 4K3JH 4BFGA 3CFDB 4YNYB 3RTQD 1MI5B 3UJIH 1G6RL 3IDXL 1P1ZB 4ZUUA 2WM0A 3T2NH 3ZHLA 1LO2H 3G5YA 1KELH 4H25A 2YPVH 4ONGH 3KPOA 1M7DA 1WEJH 5T3ZD 2FHCA 1WLHA 3D2UB 5AAMA 3SO3B 2EYSB 2XYCA 1YMHB 1RZKC 1XF2A 3MPCA 2XWTB 5D7LA 3KPRB 4HH9B 4OF0A 2A73A 2H2PC 4YHLH 2C7UA 3UC0H 2WUCH 3ARWA 4YHNB 1P4IL 4Z7VA 4JEGB 3VI3F 2DQEL 1MCOL 4WGVB 1NL0H 2JJVA 5HSFA 3VXOA 1FGNH 1QBMH 4PD4J 3MJ8A 3SDAC 1CF8L 4GAGH 1CFSA 1MIEL 1F02I 4TVPL 4XP1H 4QYOA 5I1AA 2AK4D 3QG7L 4P2CG 1NJ9B 4ZTPH 5JHLL 1I9IH 4GS7B 4MDIB 1PFCA 4J6RH 3PGFH 5T1KD 5F1NA 2ICEB 1FL5A 3EYUH 2X4TA 1EHXA 4XCFH 3IAQA 1X7QB 1A8JH 2Y36L 3MV7D 3VFRA 4J3UA 4LCUB 1JMZA 3WUZA 2IADA 1HSBA 4RAUA 4DKEH 5CMAA 1BM3H 2BFVH 4Z77A 3WN5C 2FO4A 3FN3A 4WI7A 2J8UF 3F12A 5D7IA 1FLTX 5DK2A 1H9VA 4LASH 4NZUH 3RAJL 3F7PC 4JQIH 5C0EA 1OTUD 1PKQB 1F3DH 4K7FB 5CBEA 4DFHA 1D5IL 2IFFH 1DN0B 4AEIH 3QIWA 4OCNC 3FT3B 1T21B 3VXMB 2FBOJ 1S9VB 5EIIB 1B4JL 2ILLA 4DAGH 3STBA 3AU1B 3QXDB 3V9FA 5K9KB 4M6NL 5I19H 2DQJL 4U3HA 1BVKA 4OQTL 4DVRL 2GJ6A 4UOW0 2CKNA 4MAUL 1ITBB 2EIZA 3DYPA 4N1EA 2WUBH 2R2EA 4ZXBA 1NBZB 3P2TA 2K9UA 1NAKL 4AQ1B 3QQ3B 1SY6H 1UC6A 3EOAB 3IU3A 3MV8E 3QEUB 2PO6C 1HI6B 4WW2A 4HEPG 4YDJA 1NGXB 4RAVB 4XNUH 3VXRA 2R39A 1ZA3A 3QJFA 4QRRA 1IC1A 2ATKB 2VJXA 4WHYH 3UTPE 5GS0C 3QFJB 4JPVL 2CUIA 1LVEA 4OCSL 3V2AR 2PW2B 3QIBC 4FQQA 3MUY1 4K3HA 3PWJA 3BQUC 1CD1B 3T1WA 2PTTB 1B0WA 5L0QB 1JBJA 4K8RH 4D9LL 3X11A 1GAFH 1F6AA 1BIIA 1CBVH 1NSNL 3OR7B 3BISA 4ZG1A 1EVUA 1H3TA 3BXNA 1GC1H 4MLSA 5C9KA 4P48A 5IUSA 1JI1A 1AY1H 3DMMB 3QIUD 3ULUL 5BVPL 2YA1A 4JDTH 2NY3D 2XZAL 3WD5L 5H37H 1JNLL 3PL6D 2CKBA 1RJYA 4ODTH 1F4YL 5CJQH 3CFJB 5C0FB 1OSPL 4LLWA 4F7PA 3QWOA 3MGTB 1MFCH 4URTB 4NO2B 4JVUA 4U1KB 3WFDL 1RVFH 2W9DH 4GBXD 3VMOA 5ANME 3F5WA 1BOYA 1J0HA 3OKNA 4HD9A 5MENE 4FZ8H 1U8KB 4G6KH 5E9DB 1JF1B 4N5UA 2PYED 3R4DA 4ZQKB 1CDGA 5C2BL 1OLZA 2IMNA 2YMXH 4FFYL 2AW2A 2F53B 4DKFL 3FO0H 4ODVL 2WV3A 5D5MB 5ESVA 1J8KA 3QIWC 3P30L 4P9HC 4NC1C 1PJ9A 2X1XR 1DEEB 3ARPA 4E41D 4FXKA 5LWYL 1D5BB 5C08D 3MGTA 1I85A 3SKMA 5EU6A 4HEME 3V5HB 3QWOB 5EWIH 3HE7B 1MCRA 4KK8D 4HFUL 3CFJA 4Y2DD 1YNLH 1NGQL 4HKBB 3SGJC 3MXWH 4J1UB 4XB8A 4LEOA 3OBAA 3TBTA 5AWNL 3KPRE 2A0LC 2D9CA 4KMQA 3QWRD 4R90H 1R24B 4XVJL 2B1AH 5T1MB 1A6ZA 2DQGL 2VLMD 4ZSOE 3BIKA 1OTTC 4MHHI 4X4ME 5FK9B 3WL9B 3QPXH 1FBIL 5BJTA 1A7NH 5FFLA 1F4AA 3AY4A 2YPLE 1NCBH 4F80A 4KKLC 3CX2A 4PP1D 4R26H 1KLUA 3CZFA 4APQA 4F7EA 1Q9LB 3DMMC 5BOZG 4LDOB 5HTSA 3RWGA 4XXDB 2E27H 4GBXC 2ATKA 3QEHB 1JZ6A 4RAVA 5GGQL 3TIDB 1HI6A 4WW2B 1F3RB 4YDJB 2F8XC 3IU3B 3SY0A 3GMPA 4ZO9A 4NGHH 3LN9A 3QG6B 2YD4A 1BAFH 5E6IA 3UZQA 1JGLH 4ZXBB 3HI6L 4JQVA 1NCCH 1Y6KR 1N6UA 3SDCA 5DA4A 4HWEL 2YD6A 4N68A 4ZDHA 4I48A 4D0DB 2DS4A 3DWTA 2DIAA 2RR3A 3ZKSD 3O6MH 4P3CH 1PW3A 3HE6D 3VXMA 5HYIA 1CS6A 3OZ9L 1NCBL 5F9AC 1NDMA 3QIWB 4NRYA 5I1DA 3OL2A 3HRPA 4QF1A 4NCC2 3U0TB 5IWLC 2DI9A 3M07A 4XMKL 3MRMA 5ID0B 5LXGH 5C0EB 3F58H 3DUHA 3IAPA 3LMJL 4JRXD 1NCAL 2P8PB 3O2VL 3VXSE 5HYSB 3AM8A 1EH9A 2QL1A 1JE6A 2FX9L 5DFVC 1U3HD 3ZKMD 4R97C 1KPUA 5IK3A 3DARA 2HH0L 5C0JA 5D2NB 3WFZA 5DFWH 1KBGH 4OCWL 3I6GA 3HB3C 2GJJA 4S10A 3RWFB 1FIGH 3M8OL 1R3IH 4N0CC 5E6ZA 4ZFGL 4LQFL 2AI0H 3FHAA 3SDCC 4M93C 2IQ9H 4M6AA 4MDIA 4FQJH 2GSGA 3QDGA 5DD0L 3THMH 2IPUK 3TA3D 1A5FL 3TYGH 2Y6SD 4GW4B 4J3SA 5B39G 1U92B 1WZMA 4X6FB 2NZ9D 3E8UL 4XMKH 1MFBH 3MJ8B 4MZ2A 1OW0C 5DUBB 4TRPL 3VXOB 5IVOA 4EXKA 2I9LA 2EO9A 5CBAA 4XVSH 3MOAH 2DKUA 1BGXH 2XA3A 4M1CD 5J9PB 4NFCA 5K9OA 2XQYK 4X80L 3WIIH 3S35L 4FNLH 4HPYH 3RWHB 3UAJC 4L29B 2IAMD 1OTUC 2P8MA 4HIXH 2DL9A 4UIKH 3KPRA 4HH9A 5KZCD 3K1DA 4D9QD 1L7TL 4YFLI 4XC1L 3VXPA 1QZ1A 3BP4B 2HRPH 2BX5A 5C0CB 2XTJC 5DMKA 3RUGB 4G8GD 4Y16C 4RMTA 4EJ1C 2AQ2A 1P1ZA 4ZUUB 2FR4B 1C5BH 3L3GA 4K3GA 3V5DA 5CEZH 5A2IH 4PUBL 4NUJA 4ETQB 1S7RB 1V05A 2D7QA 2OP4H 4AG4L 2CRZA 4M43H 1NMBH 5HVHC 5DJ6A 5HDLA 4OZHE 3C60B 1MWAL 2A9ML 5BVJB 1YY9D 5HHPA 1FNSL 2LQRA 3RPKA 5I30L 2CLRA 1J5OH 1EAPB 2VXSL 1ZHLB 5FAAA 2WBJC 4R97B 1EPFA 4F58L 2A74A 1K8IB 2GJZA 4XBPA 1HYRC 5I1KL 4FS0A 2G5BB 2FGWL 1EHLH 5DDHB 4OLUL 5IQ9A 5C1MB 4U1LB 1B88A 2HG5B 5E95B 3D2UD 4JR9H 1NCNA 4E41A 1FNGB 4ERSH 2V17H 4P5KA 4BYHA 1UXWB 3OPZL 4L8SA 4HHAA 1B0GB 3C6LA 5ESQB 1A4JB 4OCLC 3NACH 3GBNL 4LLYB 3ARBB 5KS9E 3QO0A 43CAB 1F11B 1RVFL 1LO4H 4L3CA 3CVIH 4RA0C 4JFYA 4O51A 5ACMA 4Z7QF 2A0LD 3TA3A 4BFIA 1PSKH 3QPQD 1YNKL 3VXTA 4AIXA 4RMVA 4WUUA 3BP7A 4HUUB 2AGJH 2OK0L 4P3DA 3TNMA 4ZTOL 4KROB 2DWEA 1T83A 2HJKB 1NCTA 2X1WL 3HC4L 1CK0L 1W8OA 3MA7A 3NIFF 3PWPA 4M7LH 1G0XA 2D7MA 1G1YA 2FWOB 1YDPA 2GITA 1WAAE 1V3LA 2P4AB 3TJHC 2R8SL 5IHUL 2E6JA 3IDYC 4YZFE 1I7RB 4JY5L 2HKFH 5E56A 5FCUH 5EWIL 1FZJA 1FG2B 2VXQH 2GFBA 2VDRH 1EMTL 1HKFA 3RWEA 2OYPA 5I1GH 4KMLB 5C0NC 5FYLE 2QR0A 4GBXA 5E2UL 3LS4H 2H9GA 1KJVA 4FG6D 3DRTA 5D2LA 3CH8A 1F6FB 4N0YH 3U7YL 3ZDXE 4X5LA 4WJ5A 5L88H 5T1LD 4XCEB 1NBQA 4ZFOA 1D5MB 5HGDA 4A2MA 4ZO7A 4DZBA 3BP6A 4YPGB 4XX1G 4NC0B 3R06A 4MJ5A 4AT6B 3A6OA 5E99H 2A6JB 4X6CE 2YUVA 1YQVH 3DYOA 1J8HE 5TE4H 1NLDH 1ZSDA 5I1JL 3DV4B 5L0QC 3T0XA 3OAYK 1T4KA 4KKNA 3DSNA 2DD8L 2FEDC 2PKDA 3T3PF 4DN4H 1FNFA 4KZEL 4HIIA 1OB1B 4HWNA 3OGCA 1ONQB 2M2DA 3X13A 5HXMA 5D96C 5FHBL 2VZVA 4HWBL 1HH6A 2VLJD 3QIUB 1A9EA 1U8QA 3PP3H 3P73B 2ZPKL 2P5EB 3BGMB 1JI2A 3KYMB 1CICA 1CN4A 1WQVT 3I6LD 4L8DA 3WO4C 4ODXA 5IKCA 4KRPC 4CVXA 4XCCL 1C12A 1ORSA 5ADOL 1LO0L 2HLFC 3HE6C 1VKXB 3MRIA 4EN3C 4P5TB 3K0WA 2N56A 1DL7L 4PRAA 5I18L 4PRDB 2Z9TA 4FOMA 1YN7B 3ZO0A 4Q6IB 1A6WH 5C92A 4X6BA 5HDBE 4HC1A 2EDOA 1IRAY 1OT2A 1BD2D 1BOGB 5ITFA 4NT6A 5DJ8A 1JFQL 4XP6H 1B0RB 3ZTJG 4XMPH 1YEDA 4PJ5B 4JHBA 2ZUYA 1U8LB 5TGBA 1WUNT 3NIFE 5EUKA 1I8LC 3RZWA 2HLAB 4TYUA 1RUKL 4Y1AE 4JM2D 1VEOA 1BEYH 1CG9A 1DUYB 3FRPG 4YO0B 5CSBA 2MHAB 5GISH 3JTSA 5EZJA 5HGHA 3WE6B 4LLDB 3SDCD 3T65A 2VYRE 2MQ0A 4BFBD 3G9VA 4G8EB 3EIFA 3HAEB 5B3JE 4K8RD 5CJBA 1UCBL 3SKJL 4OT1L 2Z92A 5D71H 1Q9OA 3X3GL 2AEQL 2V9QA 1MSPA 3VD3A 3VFWB 4X4ZA 3SQOL 5GGTL 1L0XA 4WEUD 5JMRA 4GAYA 1AJ7L 2KQNA 5TQ2H 1M71A 5DR5L 1MAKA 3R1GL 1JPFB 1XGTA 1KC5L 2VH5H 1QFWL 1R3JB 3ABZA 3MC0A 2C3HA 3EO9L 1IGCL 1CLOH 4HBCL 3ZKQD 1GIGL 3PDDA 3S36X 4RWYL 2R56H 3PGCA 1EDQA 1OGAB 1G9NC 4KI5E 5FO7A 1EJOL 2AJSH 3GMLA 3DX7B 1EO5A 3GNML 1EUUA 1KUMA 1INEH 1NCWH 3FT2B 1X5JA 2ITCA 4P2QD 2ZUQB 2ZUWA 3O4LA 4KRPB 4CN4A 5HYEA 1P6FA 2GEEA 2YMXL 2Q20A 2ATPA 2AJVH 2GTZA 3B83A 4GRWF 4P5TC 1D9KC 1N3NA 4J3XA 4L4TB 1VB9A 1OPGL 3KHQA 4HMDA 3UCRA 1KTDA 4IMKC 2NXYB 4WUKL 5TDNA 4XP5L 5E08H 2DQGH 1E6JL 3VFUB 3L3HB 1W0WA 1S7TA 1BVLA 5E8DH 3SDXA 2VAAA 2VLRD 1YEJL 5T3ZE 4XAWL 4MXQC 1VADB 4V1DD 1KTDB 4RGNB 4WDIA 4ZSOB 3LIZH 4M5YL 5D6DA 4UBDC 1N3NB 4JR9L 4U1HB 1D5XB 2V7HB 2CKBH 4OZIA 3FQRB 4H8WL 1KIRB 1J0YA 2Z8SA 3BKJL 1SBSH 1FYTE 2XXCB 5GGQH 2MCPL 2HKHL 1EX0A 4JPIA 2D03L 2P1YA 1J0JA 3E2HC 3AFLA 3GMLB 4KC3B 3KLDA 3R0NA 5D72L 3B3IB 1B2WL 2FBJL 2I9TB 2Q86A 5CGTA 4G6FB 1R0AH 2HT3C 2LU7A 5HY9B 4P4KD 4CMHB 4YGVA 3TVMC 3CSGA 3FRPA 1DLHB 3I2CH 5HHVH 4L4VD 2G2RA 3CDFA 2F8OA 4IDJH 4GAYB 5DUPL 1RK1A 2JIXB 4NKOA 1BFTA 1DQLL 1U8MB 1BZQK 2HN7A 3DI3B 3EFFB 4XBEH 1OT1A 4LCCA 1ETZA 2VIRB 4OLVL 3ZE1F 3AB0B 4D0BB 3IFNH 4WTZG 3SGJA 4MXVF 3OAZH 1ADQA 4NO0B 5IB4A 1YJDC 1AR1D 4CVUA 2FX8H 1MRCH 3IDJB 3HE7D 3KYNA 3HC3L 2D2OA 3WE6A 4HPOL 2APWA 2ZUQC 7FABL 3BEVB 3WKMH 2BHUA 1DUYA 1JHLL 1CFQA 5JW4N 3RFZC 3PWLB 5CD3B 1EMTH 2NY0C 5EUKB 4CL7A 5IMKB 4LSDA 1D6EA 2YD3A 4PJ5A 5D6DC 1JN6A 3S88H 4PRNB 3CCHB 2ZZUT 4OLWH 4NM4L 4QTHB 1KIQB 2Q1EA 4UV7H 1DJSA 3PHSA 1HEZA 2AXGB 1DQLH 3G6JE 1YN7A 2ORBL 3MX0A 4FABL 3UJIL 4HZAA 4PY7B 4HKJA 1F3JA 4YX2L 5AAWA 1U8NB 2UYLB 1VKXA 4CW1B 3NN8B 4U49A 1T22A 1MOEA 4R7DA 1LO3L 4X6CA 1KIPA 5EU5A 4LCYA 2D7NA 1M1SA 2P5EA 3BGMA 1ZHBB 4QRSB 1NFDB 1HXMB 1NC4D 3O3EA 4XC3H 3A6CH 5JA9A 1A9EB 3BDYL 4UU9A 1OAXL 1PKOA 1VSCA 4TQEL 5KG9A 4Z7UA 1EEQA 5DSCB 3GI8H 3NTCH 5FA3A 3P11H 2GK0A 4DW2L 1KYOJ 4AY0A 1HK6A 1MLBA 5IMOA 4HIIB 4WY7H 2MQ3A 4DKEL 1QG3A 2ARJB 2PO6D 1N0LA 3OG4B 1WJ3A 3O9WD 3U2SA 5CJXA 1AXSA 2DQEH 4Q97A 1CXKA 4TOYL 1T4KB 1NC4B 3IRPX 4MJ4A 4BSVB 1RHHB 5ICZB 1T3FA 3SE8H 5JZ7C 1WFNA 5MEPA 3ZE1E 4JQIL 1LEGB 4WO4C 3R06B 3QFJD 4YPGA 3BP6B 1AO7D 2I60L 3B9KA 2FJFA 3B5HA 3D39B 4D94A 5DJYA 2Z31B 4PGEB 4XNXH 4WJ5B 3G08A 1VDGA 4XC1H 2MPAH 2VLJE 3KDMA 1S78D 4NJ9H 4M7LT 1MQKL 2QADC 3VFOB 3DRTB 1Z9OA 3UTQA 5DYOB 5IWLA 3B8YA 1H5BC 1MIML 5C3TA 1LP9F 1RZGA 3WXVL 2BSRA 2V2WA 5GJTH 3TCXA 2PNDA 4PJGE 5T5NF 5IVXE 4C56E 3FOLA 2Q8AH 3C2SA 4M1GH 4NFDA 5ADPH 4OZIE 4KTYA 1FZJB 3QDMA 5I8KL 3PHOB 4K7PY 1X6NA 4U6TA 2W65B 5EU7E 3MODH 5DD6B 1ZLWH 4GRWE 4IOIA 5FYJU 2FWOA 2EH7H 2C4FT 4PJAE 1OD9A 5IJKC 1N2RB 1CQKA 3Q2CA 1A6UH 3NAAH 3QZWA 2PF6A 4PJBF 2C26A 3T2PA 2DWEB 3S7GA 1TQCB 1MQKH 4P9ML 5HJ3B 5I73B 3K2MC 4OKVA 2VLLA 4MJ6B 1PD6A 1S7WB 4R4BB 3EDFA 2FH8A 4OLZH 4KFZC 1BJ1J 3CLEH 3TA3B 4O51B 3P9LA 4LRIA 1ULVA 2CD0A 4AH2A 4QGTA 3BP5B 1CFNB 3CMOL 1RZKH 1PG7X 3D0LB 4QTIL 1NDGB 5C70A 1ZLSL 1T0NA 4LARH 7CGTA 2R0KL 4JM2A 5GQBA 1CIDA 1JCKA 5DTFA 2DI8A 4HHAB 3NOIA 4L8SB 1A14L 3DTXA 2R0ZH 4YBLC 3PL6B 4OFPA 4P5KB 5FM8A 3SE4A 2B4CH 3ISWA 3MV9D 4X0KA 2NY2B 3NA9L 2XZCL 1JJUA 3O3AA 2G5BA 4LIQH 3FB8A 2RHEA 6CGTA 1ED3B 1EAPA 3K8KA 3FO0L 4ODVH 2MQCA 3ULUH 3AS1A 3ILPB 1S7RA 3W5NA 1IGIH 1P7QB 3EJYC 5JQ6L 4W4OC 3V5DB 2BVQA 4E41E 4R0LA 4H5SB 4KJYB 5FYLD 4K7PX 1T6WA 5D9SB 4A6YH 4YXHH 1K4CB 5MEOB 4I2XA 3Q48A 4MD5B 5ICYB 4RGMB 5EO1A 1LO5B 4X6DE 5FYKL 2NNAA 3QYCA 4LVOC 4TULH 4KZEH 3BMVA 3C6SA 3VE0B 2CDEA 4HS3B 1JP5A 3T0ED 4WENB 5C2BH 4EI5D 1C16B 2GJ6E 4MD0B 3TLRA 3WLWC 3SE9H 3O3UN 4QXTB 5E99L 5HI4C 5GS1B 1ZANL 1T0PB 4PJ7B 3QXVA 1FVDA 1AXIB 3H8NA 3VWKA 5LWYH 1SM3L 5ERWA 3EYVB 4HXAL 5HHXL 2EDJA 1IGMH 2G9HA 5HD8C 3TA3C 3STLB 5LCVH 1LNUA 4BSJA 1L0YA 1RUQH 3LKPB 4X6FA 3CFEB 1MCKA 1MFDH 1MAJA 2X1OA 1EEYB 1TZGH 1S5IL 3GEWB 3MRCA 5ESAB 5KSUA 4NSKB 4H1LH 1OTSD 4YC2C 1NFDF 3L1OL 4ALAL 3H9SE 1IEHA 3MV7B 3VXSB 3RRQA 4U1IA 1UACH 1KEMH 5C08B 4HG4J 2A38A 3JVGA 3QPXL 4KV5F 1VCAA 2N4IA 1WWBX 4EBQL 3P4OB 3JWDL 1NEZA 2X44D 1S7VB 4KK6C 5TF0A 4Y4FB 1BBJB 3G5ZA 1TVHA 1G9ML 4GKOA 4WHTB 3TO2A 1U41A 2EKJA 3IXTA 1D6VL 4MJID 4QF1B 1O5DT 4XPTL 3UO1H 1IM3B 1SEQH 5C0IB 3IVKA 4WI9A 1UG9A 4NRYB 2F54D 4NHUB 5DA0B 1CL7H 1LGVA 4PTUA 2D4DA 4Z7UE 4HGKC 4JRXE 1GZPA 4DQOH 4D0DA 2R1XB 3MRHB 4MSWA 3E3QE 1KPVA 5M94B 4GG6A 1X44A 4Y7MA 4MX7B 5HPMB 1FP5A 3MLRH 2OR9H 1VFOA 4LNRA 5CIPH 2SEBA 1KEML 4TTDC 2FL5B 2XIDA 5GGRA 5MEQA 1FO0L 1CTOA 1ZA6B 1RZJC 2W9LA 4GQ9H 1QRND 1XR9B 3TJEL 4OD2A 1Z3GH 2DKSA 3DMMD 5FYKD 3O4OC 3RZCA 1N59A 5F9JB 3QEHA 3RY5A 3FO9B 4I0PB 4L3EB 1CT8B 4OAWB 4TUOB 5FO8A 4RFEB 4XMLL 3QJHB 3V95A 4LGRB 3BRDA 5GXBB 4CRPA 3VG9C 5BJTB 4CMHC 1XGPB 5ALCH 4MAYC 4GW1B 1R3KA 4NJ9L 1X3DA 3IT8D 4NKQB 1JMXA 1OF2A 4YUEL 3EFDL 1FE8L 4S0SD 2DDQH 4OGAD 3L3DB 5DVOA 5GGVY 3HG1E 3I75A 4X4YA 2EH8L 3MJ9A 1FVCA 4UINL 1FH5H 3DBXB 3H0TA 3HRZB 1HKLH 2QEJA 2DWDA 4PRIB 2XKSA 5MI0C 4U7SA 2R1WB 5D7SH 1DCLA 3QUKA 1CCZA 1JWMB 1NKOA 4JRWA 4L9LC 4WHDA 3QPQC 1KCLA 1IGYB 2VR4A 4XVSL 1IGFH 3T0EC 3MLWH 4Z7UF 3PGFL 1MWAH 2A9MH 2AV1A 1KB5H 1OSZA 4YDVA 3WFCL 4ELME 3RVTC 4P5MB 3BO8B 3DROB 2JKXA 4NQDE 2R15A 5SX4H 3PV6B 2NCMA 1TCMA 5D7JA 1YEFH 2VMFA 3UZVB 3NCBB 4QHMA 3RGVD 5KSBA 4R3SB 5DURD 1KNOB 2Z8VC 3GSOA 4WUUE 4U1KA 1DVFD 4K23L 4XBGB 4U2ZA 1NAMB 2R29L 3V6ZB 3VGHA 4XGZB 2R69H 4OD1H 3BWAB 1A7RL 2ZUTA 4AMKL 4LLMA 4XNZC 1NMCB 4OLEA 3OKKB 1HXYB 2DBJA 1ND0B 1KEGL 5IESH 4H0HB 1NAMA 2X40A 3G6AA 3LQMA 1H3VA 3W9EB 4QO1A 4APQC 4OLUH 4G6ML 4D0CB 2DMCA 5I1KH 1F6AB 3WJLA 1QLFA 1I9JH 3EBAA 4U6YB 4ZTOH 1A7BA 3P0YH 2PYFA 1T2QL 3L5HA 2MKLC 2VZUA 2PTTA 2DTSA 2X4OB 1U93A 4KJPC 1FGVL 2FYYB 4I3SH 4P5MA 3X3FH 5JDSB 1MCBA 4JO1L 4YHYC 4K07A 1IAOB 1BZ7A 3OAZK 5DJ0A 1MCCA 1DEDA 1Q9KB 1HHHA 2QHRL 4JGMA 1JRHI 3BPLB 3B9AA 1JRHH 2NW2A 3NIGE 3ZLQC 3MACL 3F65A 4K9EH 3RWJA 2ZSVA 15C8H 3NBNA 4ZUTB 3Q3GA 5I1GL 3WIFB 3VI4F 4JFOB 2L7JA 1MCEA 1HILA 2Y5TA 3I75B 4WTWA 2YRLA 1KJ2B 4Y2OA 3RJQB 1ZE3C 4FMFA 3AU1A 3QXDA 3SJVA 2CUHA 3EDDA 3HFML 4TSAL 3FN9A 1DR9A 1A0QH 2R8SH 1KLGB 4K3JL 2VERN 1UH4A 1DN0A 5DMYA 4QOKA 3WUWA 1TTFA 4MMZC 1Y18A 3W0WA 2CMRL 3QUXC 4HT1H 3HPLA 2QLVB 4MCZA 4LFHG 5DI8B 5D7IB 4L3EA 4MAYD 3FO9A 3NABH 4AENA 5JW5A 1TQCC 1UEYA 1DANT 1TZGL 2XTJE 1N59B 4J4PD 3QRFM 1MREH 2X10A 3ZTNL 4R4FL 1K3ZA 1OP5K 5HHQA 4TOYH 4KUZH 1A1MA 4OD2B 3C6LD 3RI5F 5JLZB 4FQHA 4PR5B 4Z0XB 1YNTB 1S7UA 4WO4D 1UACL 4UAOC 1GPOL 4JPWH 3P4MA 1MCQA 2J8UB 2Z4QA 4M62L 3DOSA 1ZWIB 2O5XH 3F7VA 3V0VA 5JOFA 2XY2A 5D6CB 4PS4L 2AKRB 1JUFB 4MSWB 4ZS6D 1N6QL 2IBBA 2XWBA 2O5YL 5C0RH 2DD8H 2Y5EA 5E9DD 2CMRH 5E4IA 2XQBL 4N8VG 2NY1B 4NHUA 2O26U 4U1JA 4TNWF 3IVKB 1P2CB 3K2UL 4Z7NF 2GCYB 3ALPA 3IS0X 4PGCA 3KJ6L 1EGJA 3TO2B 1T83C 5IEKA 2C9AA 2WLZA 3FONB 4WHTA 2DQDH 3V0WH 3AXLB 3KPQA 4R96B 4Y19E 3B9DA 2XWTA 5D7LB 3PHQB 3PDGA 4PPTA 1BFOB 3UJJL 4GG6E 3B2UC 1QFWM 5J12C 4Z8FL 5F9WC 1D3CA 1F4XH 1GOHA 5CHNB 3V7AE 4OTXH 3EGSB 3MNVB 3SEPA 3ZDZE 3PNWB 2AAVA 5DMIH 1AGBA 4Z5RA 5BV7L 1HSAA 1NMAH 4ZOEA 2B1HL 5IHBA 1KCSH 3MRCB 1S8DB 5GS2H 1UM4H 2FH6A 4PTTB 2I07A 1ZHKA 3LN4A 5IW1A 1P7KA 3SDDB 1IM9A 5MENB 4G3YL 4LOUD 4JGJA 4FQPA 3BH8B 4L5FH 1NGWB 4V2CB 4JREB 1AXTL 4D9RD 4QTIH 3DUUB 4F15B 3ZDXF 4BH7A 5GS1A 2CDGB 3UPAA 2JB6A 1BEYL 1XZ0A 5H2BA 5EORH 1KB9J 5FV2A 2QJDA 3SCMC 2EH8H 2IF7A 2E9JA 3G6JB 5T3ZH 3H9HB 1MRFL 3T1FB 1PSKL 3P9MA 3NCJL 2MKWA 4FA8A 3T4YB 4GXVL 3BHBA 4OQTH 5J13B 4G6JL 4YC2B 5EO1B 4EOWL 4YEEA 1UXSA 3GSWA 4LMQE 1P5UA 2KUTA 3OJVC 4W6WB 1FZMB 2Y07H 4Y19B 4KI5C 5C9JA 4RGND 5KS9A 1G1CA 1ORQB 4L5FL 3VXNA 4P59H 1A7PH 3B5GA 1S7QA 4JVPA 1A6VH 3ZE0E 4G7VH 4YHZH 3BH9A 1NAML 5E8DL 1LD9B 4MJIB 3TT1L 2ICES 1MH5B 3K8LA 4G6KL 4HS6A 5I71B 2E7LA 1L7IH 4OCSH 4NZDA 1KGCE 2W9DL 1JGEB 5CINH 1DE4A 5H37G 5DS8B 4K8RL 4U0QB 3L9RA 2JJTA 3QZWG 3AROA 3D87B 1C8PA 2QSTA 2H6PA 3PUCA 2IJ0C 2IGFL 4OQTA 4L8BB 4PG9A 5LGHH 2EDNA 4LSUH 1ZLWK 4I5BA 1CFNA 1AIFB 2Q6WA 4UQ3A 4AH2B 1TPXC 2A9NH 1ZLVK 1Z6JT 5KVFH 4RDQF 4JZNA 4EBQH 5J1SC 5INCA 4H8WH 5FB8B 4OKVB 4XHJD 4O00A 5A40E 2EKSB 1G7PB 4JFDE 2D7OA 1U3JA 2YKLH 1D6VH 3GJEA 3MYZA 1MWAB 1T89C 1N2RA 2PYEA 4JKMA 4YXKH 4G8FB 4FQIL 4UT6H 2X4SA 2C5DC 2VDKH 2J8HA 3BZEA 4HULB 2DLFL 2WQRA 4O9HL 1MJJA 1B2WH 2FBJH 5E7BA 2HP4A 1T7XA 3SCMA 3S37X 1NCDL 1JNJA 5I17B 5C07B 2OR9L 1MCPL 1CD9B 1TQBC 1INDL 2YUXA 3N1FC 1K8DB 4P2YA 3ARDC 3T3PE 1HHGA 1G7LB 5BXFB 1LE9B 3PDOA 3U1SL 1SVZA 2P49B 5MI0B 3TGXA 3KYOA 4XNMA 4TSAH 4BQ6A 5F7FA 1ZHNA 5ID1A 2FJGB 1Q94A 3MOBL 5F3BB 1CDIA 5DQDH 1EK3A 4X7TA 4ZYKB 5JPMA 3FO2A 2DQFB 3UTSA 3DO7B 3TEUA 1XT5A 4JFZL 1ZXQA 4U6XA 1HNFA 4JFFE 5MEPB 2DQIH 4KZDH 4M8QB 5ICZA 1A1NA 4F57L 3F6LA 1EZVY 4YK4C 1NC4A 1QR1B 3E6HB 3X17A 4O2CA 3GUTA 5AYQA 4IOFD 5DWUL 3OB8A 2ARJA 2EIEA 5DRXA 3TBWB 5CSZA 2IEPA 3BAEH 2GK0B 4TNVK 3INUH 1LK3H 1TPXB 3H2WA 2AP2A 5DSCA 3KXFD 3JV5A 4K9EC 3VFGL 5MERA 1MHHB 3RVUD 3MV9A 4DOHE 4P2QB 5D1XC 3TBSB 4I77H 5K59E 2RFXA 1I85C 4WTXA 1J05B 5DLML 4Z7QE 4UV4L 1XR8A 3RUGE 3CSYA 4ORGB 1IGFL 3NN8A 3RQ3A 4HKJB 1VFAB 3WYRA 2OJEA 3U9PH 5KSAB 1ROWA 3QI9B 2VSCA 2AI0L 1IC7L 1HEZB 1Z9LA 3G6DH 1YEFL 3KPPA 1FYHB 1KIQA 4L9DA 5C0BD 4I1NB 5IMLB 4TSCL 5HBBA 1YEHH 5F7DA 1W0VB 4DVBB 5F96H 3MR9B 4KWUA 4W70A 3PWLA 1WC7A 4X4MA 3HZVA 5DHVB 1T5WB 3V5KB 1N6VA 5JXEA 1CE6A 4NHCH 5L7XL 4S2SB 5INDA 3IDUA 1JPSH 3L7EA 4UV4H 5JPNA 5EBWB 4MNQE 2EIBA 4PJAF 4NO0A 5IB4B 2DLEA 3M1BB 5FGSA 1MHPH 1ETZB 2B7DT 5L9DL 4PRPA 3DX8A 3GMQA 3TF7C 1P4IH 3QDGD 4WW2F 2F15A 4QT5A 4HFWB 2FEEI 5C09D 1QBAA 5DJ2B 4LLQB 4JFED 1J8HB 2BHYA 4HIEA 3OKOA 4EI5B 1IJ9A 3FB6B 1NMBL 3ECBA 3VWJD 4TUKH 3TWCH 3QT2A 4LARL 3L3KB 3NFPB 2YSSB 1R5VB 2BP3A 2X9XA 2E8YA 4H1LA 2FZ3B 4R7NA 3W39B 1G9NH 4LIQE 4PYGA 3ECBB 1QSEE 3DUSA 3KPMB 1TVDA 5HYFA 1WGOA 4KDTC 3MUGA 6FABL 1IEBB 4ODWB 5BZDA 2G75B 4AZ8A 1GGYA 1KN2L 1VADA 1DDHA 5IP4A 1AD0A 3HFMH 5I8EB 1SYVA 5ACLA 2EXYC 5KOVC 4HUMB 1WWAX 5IMMA 3MRDB 3GBNH 2EE9A 3SDXF 4NQCE 4MXQD 2ICCA 2F54B 4UMGA 3D18B 2IFGA 2IH1B 3S36H 3FAXA 3S97C 2FIKB 5JPNB 3QP3A 3QNZA 1EO8H 2BOCA 1CE6B 3NPSC 4CUCA 4PJFF 3IFPA 3WMSA 5T3XD 2VL5A 2ITCB 5C08E 3DX9B 1A64A 2WUBL 3Q5TA 4OJFL 4QXUH 3MR9A 4LSSH 5CJQL 2X4QA 5KZCB 1LE5B 3H9SB 2B8OT 5JXAH 4AIZA 4LSVH 2DJUA 3PGCB 4JFEE 1IGCH 5IMLA 4YX2H 2V9RA 4JRYE 5E2TL 1T5XA 3LHPL 3KPPB 4G7YL 5KW9H 1VACA 4UNVA 1JPFA 1XGTB 3VFVA 4CNIA 4OI9A 1N0XL 3GHBH 5ABDE 1C08B 3T0BA 1M71B 3AGVA 4KAQL 5KVGH 1IT9H 5C0AA 1Q9OB 1XR8B 4I9WD 4LAJH 2VXQL 3KHOA 3MRFA 2OK0H 4TULL 3P9WB 5I16A 1QBML 2R2HA 4PJHE 3TBSA 3VA2C 4F2MB 1GGTA 1F4HA 2XG5A 5IW3A 4R4ND 4MXVE 1UKQA 5FUCC 3V6FA 1RURL 1W72L 3J8F7 4DFIA 3MJGX 4Z78A 1K5NA 3CDGB 3L1OH 3JTSB 2MHAA 3IJHB 1YEGH 4YFLF 1Q38A 4Q74A 1FV1B 5E9DE 4ZAKD 5E4EC 5DRXB 3TBWA 4IRSA 2OX5A 4Q9RL 4L1DA 5TGBB 4PLKD 5I8CA 5IHZA 4HUXB 1QLRA 1MFDL 3WFBH 1EERB 1QR1A 5HYSG 3RY4A 2BC4B 5C0CE 1A1NB 3EJZD 3Q6FA 1I8MB 1S5IH 4U6XB 3B4NA 2NTFB 4P57B 1KN4L 3MREA 3FO2B 5F7HA 3SDDD 5JHLH 2D03H 3WBDA 5B38G 4P5TA 4JN2A 4IRZH 4XWGH 1C12B 1LP9B 1ORSB 4ZS7H 2CGRH 5IFAL 4FXGA 1DZBA 4ZFZB 4MA3B 3KYMA 2Y36H 1H3XA 3MV11 1U8QB 3GFUA 3RHWK 3JV6B 1BECA 1KCSL 2X6MA 3TZVB 1K8DA 5IT2H 1XH3B 2J5LB 5I9QC 2NY6B 4KQ4L 3GDBA 1CDHA 5IV2A 2XA8L 3FRUA 4JFXA 4X6DB 3D48R 5IF0A 4B7LA 4LCCC 3IFOB 4HXBL 3DURA 2DMKA 4P9MH 5SWSD 3GIVA 2VC2L 4BH8A 1HHJA 4S11A 2IQAA 3NVQA 4G8FA 2PTVA 3E1F1 2R4RL 1NANH 2H32B 1EXUB 2MFNA 1BLNA 4KI5D 1RUMH 4HZLB 5D8JH 4AT6A 3ET9F 1KTRL 3TBVB 2IAMB 4LKXA 2ZWLT 1IEAB 5IB1A 3VRJA 1F4WH 4NN5C 2J6EA 2PXYA 4JDZA 3F58L 2V5YA 4HJJH 1ACYH 4UQ2A 1XF4A 1GGIL 1AGCB 3MRPA 4HWEH 1KJVB 2H9GB 3VXME 3QDAA 1AIFA 3HA0A 2Q6WB 1G7HB 5T33L 1OAUL 2NY4B 2QR0B 3RZCC 3LKQB 5AYUH 1LP9E 1WBXB 4LGSB 2DKMA 5CLTA 2XZCH 4LP5A 3OKEB 2GFBB 4XWOC 3P77B 1Z9MA 2VC2H 4Y0GA 1BAFL 3P4LA 1A1OB 1GGCH 2VISB 4EIZC 3QDJD 1T2XA 3EO9H 4WEMB 3LKSB 3MA7B 1II4E 1LD9A 3RGHA 1UWGH 4A6YL 1GZQA 4EI6B 1I3GL 4GLRI 1ZGLM 5CEYB 3VXNB 4OFYD 3SKJH 1INQB 2FECL 4DGIL 1I1CA 2GSIB 5A2KH 4N0UB 1QBLH 1FZMA 2C3VA 2VDPL 5J8OA 1MLCA 1YC7A 2ED8A 4XVUD 4X80H 4L3CB 4LSUL 3RA7H 4FFZH 4FRWA 1VFBA 1RMFL 4DUVA 3RIFF 3BHBB 3LQAL 5TF1H 4HWZA 2LU4A 3WNPA 1KEGH 3H9HA 3PWPE 4RWYH 5IESL 1U58B 1UXWA 3H9SD 5BVPH 2ZCLL 2PYEE 3FQXA 4NN6B 2HG5A 3IJYB 2X42A 3KGRA 4XP9H 3WXVH 3ZT6A 5D1XB 4Y16A 4XBPB 1KSRA 5IW6A 4KXZI 3CU1A 2BRRL 5B4MD 3DVNB 3GI9H 4P2RD 4PRHD 3PABA 3BEWB 5DQDL 4LHJB 25C8L 2VLKD 5HHPB 5EBLA 1FVEB 3WHE0 3KYKL 4PJAB 5B8CB 1AI1H 3C5JB 4JFHD 5DUML 2FGWH 4I4WB 4JPKH 1U3ZA 3TN0C 3SGDH 3V0AC 3OXRA 3C8KB 3UEZA 1L7TH 2J7LA 3SDAB 1ITCA 2YD8A 3MMEB 2BNRD 4G9DA 5T1KA 4EIGB 4XBEL 1BFOA 5IFHL 3CXDL 3CZJA 2P24B 3PHQA 4LSVL 3O4LE 1W72A 2RIKA 3IFLH 4HDIB 1RZ7L 4J4PC 3BW9A 3FTGA 2APTA 3BZFB 5FA4B 5D1QD 3ARDD 5DHYA 1N64L 1JHTB 3CGTA 2XKNB 4R26L 4LPTA 3PWVB 1A22B 4UOW1 1RY7B 1JGVH 3L7FA 1P84J 3ZT7A 1MRCL 5AD0B 3ARQA 4HT1L 2JF1A 4LPYA 4G8IB 3UYOD 1OM3H 3F7QA 1S3KL 5HYJA 1PY4A 3MZTA 3L3IA 5GIRB 3S88L 4ELKB 4I13B 1C1EH 3CVIL 2HFGH 3V0VB 3QDGB 1IGTB 1AHWC 1JHTA 4KHXH 1XEDA 5EZLB 4WFFE 5A2LH 4JZJA 3Q0HA 4XPGH 1FAIH 4HDIA 1CDUA 4NM4H 5GS0H 2W91A 1NLBL 3QDMD 2V7NA 2P24A 3OPZH 1RJZB 3MCLL 4MJIE 3GSQB 3FHQA 5T1KB 3V8OA 4TNWK 4OGYL 4TPRL 4P46C 4NGHL 5HI4D 3C8KA 4DW2H 3HB3D 4K55A 4WY7L 2NY3B 2B5IB 5IVZB 2IALB 2PXYD 3GB7B 4OCYL 2H32H 1G7IB 3I6LE 2XWJA 3HPLB 3FO1B 1WBYB 4LVHB 3VH8G 3MRMB 3K2UH 1Y18B 1S3KH 4NZRH 2BSTA 1TLKA 1CXFA 2I5YL 1KFAL 5HVGB 2HFFA 4GKZA 2MNUA 5F88A 3VGDA 1NLDL 5I1JH 5T5FH 5D1XA 2VQTA 1LEKB 5J6HA 2A2QT 5ELIA 3WIFA 1UT9A 2XQBH 5HHOA 1IAIM 5E6IB 2HKFL 1UJ3A 3MLXH 5F9DC 4HIXL 4RNRB 1QBBA 5IBUB 4X5WB 5I1HH 4NN7C 2JJUA 4I8DA 2GY7B 3MUJA 1I3UA 3LS5H 4FTVD 3GMRA 1UM4L 3ARED 5DO2C 2V5RA 2C3WA 4KUCF 4YDKL 4LAQH 5EC2B 3VG0H 4LNVA 1PEZA 4EDXA 2H1PL 4Y4HC 5JDSA 1IC4H 5DGQA 1V7NL 2R1YA 4EUPB 2FYYA 3CZFB 2IQ9L 1PYWA 5L2KD 3HI1B 3LN5B 5F7EH 4M6OH 2OP4L 3K7UA 5E8EB 4J6RL 1GZQB 5CJ8A 4R8WL 4YHIB 3BD5A 3IETB 1DLFH 1NKRA 5BV7H 4K3DH 4FFVC 1QOKA 3MOAL 2WBKA 1J7VR 4NP4L 4RBPH 1YN6A 4HKBA 3GRWL 2BVOA 4I2XE 2V17L 3HE7A 1SEQL 4WCYL 3VI3E 5HHNB 3P77A 3R8BB 2H2SC 5EU6B 3SQBA 5GRYA 1IC4L 3GMMB 1DQQA 3AUVA 4XNUL 1B4JH 1U3HA 3EHBD 2Y72A 1CDJA 3LKQA 4QRPD 4RGNE 5KSBB 2AEIT 5I1CL 1DBJH 1X9QA 2DI7A 1XF4B 3QXUA 5F89A 2AEQH 2EDDA 3NCJH 3RNQB 1MRDL 4NZUL 2AK4B 3U7WH 1I3GH 3BO8A 1A14H 3HCVB 1PX4A 2VAJA 5DR5H 1N7MH 1DLFL 1FLRL 3BDXA 1A6UL 3O41A 2F19H 1XGRA 3PIQA 2IAMA 5E6YA 4TTDD 4PJCE 3F5WB 3OKNB 4U7MA 4HZLA 5KVDL 3QAZC 3CVHH 1EXUA 3HHRB 4NYLB 5EPMA 1RHFA 5CJ5A 3D3VA 3NH7L 4OBSA 1HHJB 1I8IA 4KJQC 3EO1A 3KPSD 2WIMA 3MLUH 3MO1A 4Y4KA 2JB5L 4Y4HB 2J5LC 5I9QB 3KPLA 5DJCB 1CYGA 5AZ2L 5IV2B 5GZOD 4PJ7F