4MJJA

Crystal structure of the c2a domain of doc2a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
128
structure length
116
Chain Sequence
ALGTLEFDLLYDRASCTLHCSILRAKGLKPDPYVKLHLLPGACKANKLKTKTQRNTLNPVWNEDLTYSGITDDDITHKVLRIAVCDEDEFIGEIRVPLRRLKPSQKKHFNICLERQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Double C2-like domain-containing protein alpha
publication title Crystal structure of the C2A domain of DOC2A
rcsb
source organism Homo sapiens
total genus 28
structure length 116
sequence length 128
ec nomenclature
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4mjjA00
2WXOA 4L23A 4KZCA 4AJWA 3TJPA 4EZLA 1TJXA 2WXKA 2NCEA 3HHMA 3MJWA 2CHZA 4L2YA 3PREA 3SD5A 1QASA 1YRKA 4XE0A 4XX5A 1UOWA 2CHDA 4QJ5B 3L9BA 4FJZA 3APCA 1E90A 2CHXA 2WXIA 5H4ZA 3P2BA 2CM6A 4F1SA 4NPJA 2QZQA 2DMHA 3L08A 2ENJA 2WXHA 3HN8A 4FHKA 3CSTA 4WAFA 3W57A 5T8IA 1K5WA 1WFJA 2WXRA 3QK0A 3ZIMA 4ANWA 5KJ7E 2Z0UA 2K3HA 4ICXA 4KZ0A 4JPSA 1RH8A 4TV3A 2X38A 3M7FB 2RD0A 3QR1A 5CCGE 1W16A 3QJZA 2FJUB 3DBSA 3RPBA 3F00A 3PYCA 3FDWA 2WXGA 3S2AA 4L1BA 4HLEA 3W56A 4F93B 3TWYA 1W15A 1E7VA 5EDSA 2NSQA 1BDYA 1DJGA 4FHJA 4Y1SA 3QAQA 3F01A 3LJ3A 1BYNA 2R83A 3ML9A 2EP6A 3IM1A 3OAWA 3KWTA 1DJYA 2B3RA 2WXMA 4EZKA 3B7YA 4WWPA 3L13A 2ISDA 4GB9A 2CJSA 2Y3AA 2QZ5A 4MJJA 1TJMA 5JHBA 3NZUA 3L54A 3F05A 2D8KA 3KWUA 2UZPA 4V11A 3DPDA 4ICWA 2A5UA 3NZSA 4ANVA 1E7UA 1DJIA 1UGKA 2NQ3A 3FBKA 1RLWA 2FK9A 2WXJA 3PRZA 3APDA 1E8ZA 4OVUA 4WEEA 4FA6A 3CSFA 1BCIA 1DJHA 1QATA 3F04A 2WXQA 2JQZA 2WXNA 2Q0ZX 5H4YA 4WWOA 3HIZA 5CCHE 2YRBA 3JZYA 1E8YA 2K8MA 4PS8A 4Y1TA 3ZW3A 4FADA 4KITB 4LT7A 1HE8A 4L1LA 3ML8A 4GNKB 3T8MA 3R7RA 4ANUA 2N1TE 4OVVA 4TUUA 4NP9A 1E8XA 4TS6A 2KI6A 4NS0A 3RDJA 5CCJA 4IQHA 1A25A 2ENQA 3QARA 4HVBA 4BGDA 3PFQA 2ENPA 1DJWA 2Q3XA 2WXFA 2WXPA 2CHWA 3ENEA 3QR0A 2WXLA 4FULA 5G2NA 4A55A 2LHAA 2CJTA 4LDCA 4PS3A 4QJ4B 1CJYA 4FLHA 3R7QA 4IHBA 4NPKA 5G55A 3TL5A 1DJXA 3IBEA 3L4CA 4QAMB 2V4LA 4AOFA 4ANXA 2K45A 4DK5A 3ZVVA 4DNLA 1V27A 2BWQA 1DSYA 1RSYA 4EZJA 4XZ4A 4F91B 4LCVA 4PS7A 4G11A 1E8WA 3PS6A 3NSJA 4QJ3B 3N5AA 4WWNA 3OHMB 1UOVA 2YOAA 1GMIA 2A4ZA 2CM5A 2ZKMX 4J6IA 4FJYA 3GPEA 3L17A 4F92B 5JHAA 3L16A 4BFRA 1DQVA 3APFA 4URKA 2K4AA 1WFMA 2DMGA 1DJZA
chains in the Genus database with same CATH superfamily
1DTUA 1F90L 3RL1A 2F53A 3LEVL 5EULV 5FB8B 3GSNB 1UD6A 2QQKL 4N5EC 5FGCB 5JOPD 4XE0A 4F7MA 5I71B 4TQPA 1ZHNB 3KYMA 3O4LA 2Y1ZA 5IB3B 4PGJA 1I1AA 4KMTH 4P5MB 5EEZA 1Q9LA 2LU5A 2R39A 1XAKA 1HNYA 1ITBB 1CFVL 1ORSA 5EF3A 3V5HB 3CXDH 5MERB 3Q8FA 1KGWA 2HB0A 1H3VA 4DGUA 5EN3A 1D7FA 2BY2A 5LUMA 1E5UI 4MXWH 3MMEB 4UQ2B 3RFZC 4OFKA 5ICZA 3RKDD 4H88H 3FSWA 1P5UC 5E00B 4KZEL 3HC2A 5IKCA 4ZAKA 1WO2A 5J9PB 4IRJB 1E9OB 3IXAA 3T0VA 4F1ZA 1DVFC 2ITEA 4KHXL 4XVUC 2WBJA 5ECGA 2Y1YA 3VXMA 1BZ9A 4XNUH 4TSAH 1YNTA 2XWCA 1FQ9C 1QPKA 3HS0A 3BWAA 3PJSA 4YHKL 5LO7A 2VLRE 5IFAL 2R27A 3CXHJ 5IHLB 1GGUA 2XIIA 4MYWB 4RAVA 3DO7B 4HH9B 4TF4A 1P4IH 2M83A 4HOXA 5ADPL 1BD2E 1J8SA 1R3JA 4WI8A 4HCGA 1UJ3C 2FEDC 1FH2A 2XZZA 2HPTA 3QR2A 3ZYOA 3IU4H 5KSBB 2IDSA 3E7JA 2F58H 4PREB 1A6ZA 2DQTL 3S37L 2VR6A 1IQWH 1BVZA 1OAZL 1WIPA 3P11L 4FG6C 5ESAB 1E6OH 3VI3B 4XC1H 4APXB 3ELQA 3LZFL 3NJIA 4XN9A 5A16B 1UWEH 5F72S 4YSUA 3FFCA 2JJSC 4I48A 2EO7A 3I6GA 3HJEA 1EAOA 4Q6IB 4DH2A 1WBZB 4ODSH 3POHA 2WVTA 3QCUL 5DVOA 1MFAH 2BSEA 3W0WA 1DFBL 1KB5H 3WXWL 4DO6A 4XP4H 4TQHA 4FNUA 1IC4H 4D94A 1X5YA 3WFDL 4N8CH 1DUZB 2J73A 5I15H 5JMRA 4X5LA 3OQRA 5C7ZA 5A6MA 1MREL 1MWAL 5AOJA 3VA2C 2AJ3A 1EMTL 2BP5M 4GKZB 3CTTA 1PAZA 1E8WA 3D1MC 2BNUA 4WTWA 2EE2A 5DJZA 3UAJC 3U83A 1RK7A 4LLVA 1IGJB 5IBLC 2BOLA 2J21A 5F21B 4U0QB 3WNPA 3BN9C 2GTQA 2WQSA 1DDTA 1KCUH 3FQWA 1PLAA 3QXAB 3LXUX 1OP3H 4O5LH 4HJJL 3I9PA 3C60B 1A6VL 3LV3B 4JDTH 3DX6A 2CGZA 2VDNL 4MWFA 2VLRB 3LIZH 1A3LL 1A7QH 2AQSA 2JKLA 4UINH 2YSSA 4E5XA 4LF3A 3OSVA 4X6DE 2I27N 4PJFA 1MHHA 4G5ZH 5D1QA 4U1KA 3KHQA 4HX1B 1RUKH 1RVFH 1EZSA 3ALWA 1OF2B 1W0YT 1NPNA 4KAQL 4XWGL 5FUZL 1SHWA 3ZIYA 4A2EA 1GW6A 1JRHI 4BWWA 4M03A 5HGHB 1WSST 4QRSB 2H2PC 4XPTH 2VZSA 4HPYL 3HZYB 4JZOB 1DJGA 1XGQB 3GM8A 3AT8A 3QPKA 4LVEA 4TUKH 3HKZA 4E41A 1V3MA 1TQCB 1NJ9A 2UY7B 2VDPH 3FQTA 2HLFD 2XRAH 1AD0A 1DQML 5DJXB 5BO1H 5BXFA 2KLRA 3KPSD 4H0LC 2BSRB 5BZZA 3L4ZA 3INUH 2FECL 3HFML 3P4MA 3DV4B 1JF6A 1KG0A 1SXBA 2JXMA 2EIZB 5IQMA 3TA3A 4JG5A 1KXTA 1YEEL 4JREC 5FKAA 5BVJB 3DWTA 3KWWB 3X17A 4EDWL 3GS0A 1JZGA 3MJ6A 5KVFL 3QEQA 3BRDA 4ZXBD 1HFUA 3L5HA 1U93B 4LFHG 2XSKA 2VUYA 2W80C 3KWXA 3PWPE 3MOAH 4X5QA 3A47A 5IOPA 4NQVB 4M8UA 2DTMH 2G5BB 2VL5A 1A3QA 1OAUH 1WT5A 3WO4B 4JUTA 4Y1TA 1S3KH 2VN7A 4PV9A 3H6JA 2B1OA 1E65A 5F6HJ 2WB1A 1LQSR 2ICEA 5LGJB 4FQ2L 1OP3K 4HF5H 4XNAA 1SJVA 1DUYB 4JVUA 5F9JA 4S1SL 5CEXA 4R2GB 5ELIA 5BS0D 2ITFA 3SDCB 5C2BL 3RNQB 1JOIA 4PS3A 5FYKH 4EQ2A 1YMMD 4X6DB 3TL5A 2EEDA 3E1F1 4QHMA 3VTTA 3POCA 3SQOH 5GZOC 1ZIBA 4LU5H 4OCSL 3SE9L 1JVKA 4XN4A 2VXTL 2W1NA 5C0CE 4CVUA 3WS6C 1GOFA 5MI0B 4MCMA 4Z7WA 4TMPA 4IGBC 1UCBH 2QGCA 3LS4L 4GO9A 3HNSL 4KU1A 2GW5A 4CSSA 2DI7A 1ZSDB 1BV8A 4C4BA 3TO2B 4KK8C 2FX7L 4A7VA 4Z7AA 4L2YA 3FK3A 4NSKA 1ROCA 5AW4B 1F8TL 1N8ZA 3EJCA 4Z0XA 4HJTA 3W9DB 1KCRL 1AGCB 1TU2A 4F37F 3GJFA 5HJDA 1GC1H 5TE4L 3RVTC 1OK0A 4WUUB 3N40P 2LR4A 3EO1A 1IGFL 4ZMYA 2EILB 2RB8A 1VB9A 1KIRA 2COQA 1TZHA 2K9FB 1PZ5B 4L4VD 2HG5A 1ZEAL 4HJUA 1FO0B 1HHJA 4RFOL 4XXWA 3RPBA 1B6DA 1IUZA 1P6WA 5EBWB 2E7LA 1XCQA 4UU9A 3PWPB 4BIKA 5ID0A 3MSPA 1BSIA 5JOPE 1ZA6A 2DEXX 3N0AA 3F83A 5F1OB 2M1KA 3IAPA 3QWOB 3RWCA 1NIBA 5EHFA 3QDGA 3VFOB 2F18A 2QKIB 4PRHD 2IANA 4LSPH 4OCXL 1B2YA 5GGQH 1SXNA 3WUWA 5AOIA 4HXAL 3VX0A 1FH5L 4KPHH 4NN5C 1OM3L 1KT2B 1R1CA 3OJDA 5TDOB 2OSLA 3HC3L 2R23B 2FAUA 3CU1A 3MV7A 2EAEA 3QXDA 1KJ2L 3GT6A 3C5SA 2X1WL 1IBBA 4PJ9B 1SFHA 4G8IA 1EX0A 1XTLA 3QUKA 4Z3HA 2GSGB 4MA8H 4NRZB 2X3CA 2X4PA 3M6DA 5HJ3A 5C0CB 4LO9A 2JK5B 4GS7C 2HFFA 1YAIA 3PDDA 1L7TL 5DK2B 2DI8A 4TVSa 3VRJA 2ZD0A 1QFWM 3BSZA 4G8FA 4M62H 1P9MC 1BVKA 3HG4A 5EPMB 2BOBB 3BYTA 5AAMA 1LNUB 1SLWA 1AR2A 3NSCA 2OYMA 4XI5C 3A4FA 5GRUL 1NCGA 1KPRB 5F97E 2QEJA 1J12A 5TH2B 2EE6A 1T1ZB 1O5PA 1M6UA 3AVEA 3FUIA 2AERT 2B4CC 2EXSA 1NC2D 1PGRB 3NIDE 3RX9A 2CG9X 1K2DA 3HG0A 4J2XA 2WZ6A 1RMFH 2XXCB 1J9CT 3TCXA 3QZOA 4OUUA 2LLGA 3O41A 4P2QB 4AH2A 4DVRL 5IM7A 1X9RA 2AKRB 3BD5A 2XN9D 3OLEA 1MCDA 3L45A 4AYBA 3KM2A 1OB1B 5HGAA 3EYUH 4Y5XA 5C6TL 3II1A 2GK2A 1CGVA 1DJZA 1G5AA 2P5WA 3VAEA 5I76B 1FFPA 3FT4B 3T6XA 1RJZA 4XBGB 5LGYA 3MJWA 5T1KA 2VLLB 4IOFD 1MKFA 3GSUA 1U8LB 5DO2D 1B2WL 1NCBH 1W0WB 1YN6A 2FL5B 3FUMA 3OF6A 4JZJC 4N2HA 4TNVK 2R8SL 3VFPB 4PJ7A 4FF9A 2VDRL 3DIFA 1COBA 3I2CH 4FFYH 5HDRA 3ZE0F 3FUEA 1IQDB 4XPFL 4I3RL 1QVOB 4LARL 4CMMB 4Z7VA 4I0PB 1BMGA 1TQUA 5DO8A 1SXZA 5EORH 1R3LB 5L9DL 2QADC 1IEBA 4P5RA 1HIMH 1I8MA 4K7PH 2KLSA 1DVQA 1I3RB 5FGSA 3L2LA 5HYFA 5JPMB 3DGGA 4TUJB 1CIDA 3D07A 3ELAT 2CO6A 4WQOA 5BRZD 5I1JL 1THAA 3FTSA 5HHPA 4MHHG 2XDHA 5IK3B 4P3DA 3V5DA 2IPUG 1BOGA 2XY1A 4AW4A 1BMWA 5GISL 3ULVD 1NKGA 4LLWB 4TNGA 3EBIA 3KPPA 1DQLH 3W5NA 4YFEA 3BAYA 5D6DA 5DJAB 2D8KA 2UV3A 2C34A 3FOLA 5DC2A 5EZOL 2I60H 4A39A 1HSBB 3MJ7A 3ZTNL 3NIDB 1WAPA 3QS2A 2EEBA 5HJGA 5CJXA 1H5BC 1EEQA 1JWSB 1B3IA 4ZFGH 3HBPA 1UURA 1XTMA 4HUVB 3OZ9L 3BW9B 3D18B 3KPSE 3NSYA 2Q76A 5AUMA 3O11B 3AXLA 2NX5A 3S3CB 5B38A 1LE9B 4WCYH 4R4FH 4RAUB 2ZCLL 3GMMB 4X6FB 3P2DA 1B4RA 4CU8A 3WDIA 1E5ZA 5FYJD 5LHDA 5MEPA 2RAMA 3RWHA 5CGYD 4PJBB 1N10A 1W80A 2ICES 1BQLH 1YNKH 1T7XA 3QIUB 4MD5B 4KFZC 5B1CA 1VEOA 4MMXA 4PHZA 1TMCB 1FG9C 1A1NA 1PLGH 3TNMB 5F1NB 5HPMB 5TK2A 2VDKH 3FO9B 3U79A 2H26A 5LNEA 3SPCA 1MFVA 3KBHE 1YY8A 3BT2H 1ANUA 1A6TA 1YY9D 4ODWB 2PCPA 1VESA 1GGBL 2FO4B 1HHHB 1KFAL 3FXIC 4MJHA 1GZQA 4ZRGA 3IRZA 3O6LH 2PO6C 3OD3A 2A4ZA 4DO4A 4PVMA 1F3RB 3MVSA 5FO8A 1ACZA 1QP1A 4K9JA 1YNLL 1I7UB 3H3PL 4H8WL 2X4NA 1PFOA 5D8JH 1U95B 1YMME 3MLSL 1K3ZA 2PTUA 4JHBA 2G3MA 5DUML 2VWEC 4FJZA 5K1JA 3DI3B 4Y9BA 4MAZA 1IO4C 3NCJL 2IIJA 3TCLB 1NMAL 5E6ID 1NDTA 1G1YA 4UMSA 2JKXA 4NBYB 2I25N 2DBLL 3QNXA 2X0UA 1GPOH 4OCMC 4RNRA 1MG3C 5LWYH 5DS8A 2EDOA 4HCRA 1TTAA 1YPZA 4BFKA 3VJ6B 4W9GC 3HC0A 1MFBH 4RGOL 4X7FC 4BDVB 4FTVA 4GG8A 3CD4A 3PWLB 3T4AA 3KPRD 1FAKT 3EFOB 1RK0A 5I1DA 1L5GA 2GK0B 1CPUA 2YEVB 4UNTA 1TVHA 4CKQA 2OCFD 2ZOTA 2IH8A 4FFTA 4L4VE 1MN4A 2YMOA 3MJ9L 2QR0A 2XG5B 4ZXBB 2UYLA 2PP9A 2N7AA 4HJSA 4OLWH 2ZNXA 3FO2A 3IJEA 5AYUL 1N59B 1MF2H 3UDWC 3U1SL 3H9HB 5TJWK 5A1AA 1IKNC 2A6KB 5IMOB 2AEWA 2XZQH 4PRHE 5CR8A 1ASQA 3FU3A 3MNMA 4HIQA 3ZY7A 3SYAA 5A3IC 2EC8A 4DN4H 3SD2A 4NIYE 1OXYA 3S36X 3L3JB 2GSMB 1KTLA 3O6FD 2EDLA 4XPHH 4AQEB 2Z7WA 4YH6A 4M7LH 3G6AA 1KB5B 1I1AC 3P4OA 3PDOB 1RUQL 2XQ0A 4TLKA 4HDIA 7FABL 4EE2A 4MJ4A 3CZGA 3DIDA 1I4FB 1I8IB 3BC9A 1W6LA 2G0LA 5GGVY 3L1OH 3S0PA 2YPKA 2VABA 1CFSA 3B9KD 3GTTA 1REIA 5M7QA 2YO3A 3FCSA 4D0DB 2RCSH 3BXNB 4UUJA 4XMKL 5CZRA 5E0FA 1FLRL 3SYPA 1Z9SA 3BSHA 3UC0L 4WEBL 4XZ4A 4ZAKC 4AI7A 3QRBA 3Q8EA 4Y16D 3VXPA 2VISA 1JPTH 5E1AB 5GRJL 8FABA 3BKMH 4U1IA 2PABA 1HWHB 2WBJC 2BCKB 2X7LA 3HE7A 3KPQA 3O2DL 2OMVA 3HS0C 4YZFF 1AXTL 35C8L 4F3FB 2MOGA 2BSTA 3U48A 2BO0A 2OMNA 1A14L 4PBXA 5BQ7A 5IT2L 5DHMC 5DS2A 1UZGA 3DGDA 3NZ8A 5F7AA 1FV1A 4OCYH 3D39D 2XIDA 4EN2A 3Q8CA 3D85D 3VGHA 1UH4A 5A2BA 3U2SB 2ED8A 2XN9E 4ODVL 3OB0H 4P9ML 3CK0H 2EIEA 4AYMC 3AW5A 4MA3A 4HK3J 1HOEA 2AJUL 5HTSA 1G0XA 4EBQH 2AI0H 3QEHB 1JHKL 3PL6B 4P57A 4PRHB 3BRGC 4IOIA 4U2YA 1TOXA 5ESQA 3K1KC 5C9JB 1HXMA 2R7EB 4HIEB 2Q8BL 5DRXA 1JL8A 1OGAB 2NY6B 4AG4H 5IW6B 2RIKA 4FQXB 1RL1A 5CEYA 4P2CG 4KVNH 3FPYA 4TN9A 4U2ZA 3KLLA 2IGTA 3QH3B 1R3HB 3LQAL 3ZT6A 2ZUQC 4S1DD 3AY4A 1UXWB 3GHPA 4HFWB 3VNZA 4PV8A 1S5IL 2E59A 3UO1L 4N2EA 4ZS6D 3VXRB 4WW2B 3U0TA 2MQ0A 3Q8AA 3TT1H 2A5UA 4E9RA 1JXKA 1OHQA 5FB8A 3GSNA 1RLWA 3FH7A 5BRZE 3GK8H 2FR4B 3US0A 4XNDA 1ZHNA 4NKQB 5IB3A 3VE0B 4NI6A 1DN0B 2IPKB 4FA6A 5GS1B 4P5MA 2W95A 1V54B 3VVWA 3O4OB 5DQDH 4NP4H 3V5HA 3ULVE 3F7KA 1ED3A 5MERA 1WUZA 1U91B 3ZTEA 4E9TA 2OULB 1RQ5A 4AC4A 4PJ5D 1TQBC 2QFPA 1A0QH 2XTLA 1J1OH 3CHPA 4UT9L 3WLBB 1T03L 1QEXA 3DXAB 1NC2B 3MMEA 1PG7H 3DHUA 4UQ2A 1X5KA 3C5JB 5EN2B 4FOMA 5D1QC 5A40E 2VQUA 3FC8A 5AWNL 3MKGA 1ZVNA 2WANA 2CJTA 5GRVL 5J9PA 5CZKA 2EDFA 3CZJA 4JL1A 1E9OA 4NZTH 3OB0K 3ZQWA 4DQOL 3BRFA 1QFOA 2E27L 3IDMA 2F0CA 4EZJA 2DIBA 5FYJE 1KV3A 4M00A 1EXGA 2GTZB 3N1GC 1U36A 3ARTA 3FUJA 5K1NA 4HH9A 3GMRA 3DMMD 4PJAB 1X5IA 5DMGC 4TVUA 5ID1A 1TETH 3GSXB 5JW4N 2YPVL 3KCWA 3SGJA 2FO8A 4M6OL 5KSBA 3DX8B 3TA3C 4KQ0A 4PREA 3APCA 4X7SH 3B7RL 4Z1PA 4LVOC 5ESAA 3VI3A 1EZVX 4JE0A 1RURL 4ONGL 4APXA 4Z5RB 3FULA 3LKRB 4NZRL 4RMSA 4UTAA 5A16A 2WAHA 1G9NH 1S78C 1OPGL 5E1QA 3S3SA 5I1GL 4JBSA 2B8OT 1JFQL 4IYKA 2WLNA 4Q6IA 4QCIB 2HTKC 1WBZA 5FV2A 3MOQA 1VZHA 1WT5C 1E6JL 2KDGA 4LL4A 2IBZX 2MKWA 2AQQA 1DZ0A 5FLUA 2VC2H 2LVCA 3UAAA 4YR6B 2ICEC 1DUZA 3CXHK 2A9CA 3A6OA 3ML9A 5EU7E 3O3UN 1WA0X 4FC3E 3BQUD 3QJOA 4WWPA 3LXCA 2YIHA 4GKZA 4B9YA 1OHZA 1WBYB 5B3SB 2ZWNA 4OKVB 5DZPA 1BF2A 3MZTA 1THCA 1IGJA 4DTGL 4KNQA 1UD8A 4KXCA 5AB2A 4LGSB 3CSBA 1QMUA 2QV2A 3QXAA 2WBXA 3OTTA 4AMKH 3KVPA 3KPRE 3C60A 3LV3A 5DURB 1MHPH 4PJIF 3GI9L 2VLRA 4CKVX 2WXQA 5CJBA 4JVWA 3WEAA 3KLKA 1ZY9A 2ED7A 1TYRA 2VQ4A 4M6AA 2BVOB 1UWXH 5I1CL 4LQFH 3RZCB 3SE4A 4HX1A 3FOMB 1JHTB 4GAFB 1OF2A 2GJPA 4IK6A 4NC1C 1N0XH 3HPLB 2BXZA 3OJMB 1D7DA 5HGHA 1GKOA 4NLAA 4QRSA 2AJXH 1VKXB 1A4AA 4N8PA 1FA4A 2I26N 3G6JB 1OTTC 2A83B 5AKTA 3HZYA 4JZOA 4XX1G 1XGQA 3DKHA 1JNHB 4KJQD 2DLGA 2EH7L 2UY7A 5D72L 4XXWC 4QLWA 3QUZD 1FAIL 4K5PA 3TPUB 2E7LC 3QJXA 2VIRB 4O4YH 2BSRA 3FTXA 4CVZB 3U30B 5EF0A 4TVPD 4LXFA 3DV4A 1XSJA 5G4MA 1CXFA 4BZ2L 4XN1A 5ABDE 4Z95H 1FZKB 2EIZA 1AR1C 1J5OL 1KLUB 3ERXA 5BVJA 1E4JA 1TFHA 3KWWA 1XT5A 2BS9A 2WP3T 4TXVB 3IPEA 1ZK9A 3TWCL 1Z0MA 1IAMA 3NIGF 3EOTL 4RCAA 1IT9L 2YLKA 4L5FE 2VJXA 1U93A 5DS1A 2BNQB 3ET9F 2G5UA 4WHTB 1VGKB 3ZQ9A 3LH9A 4NQVA 5C0GB 4YHML 2F8VA 2G5BA 1MCWW 3OKLB 4ZODA 1OP9A 2GVYA 2JKJA 2VR4A 2ENJA 3DA0A 1J05B 1NM4A 2DEWX 4TQIA 4QHPA 2AQ1A 1AJ7H 2J2ZB 4KRPC 1SPDA 2XKSA 4PIRF 3V4VH 3ULUC 1W8NA 5LGJA 3BKYH 1MFMA 4P07A 2O5XH 3KPRB 3LVTA 5J3HD 1H6FA 4JAMB 1DUYA 3F6JA 3F00A 4AZ8B 2VSCA 2UXVA 3WFEL 3SDCA 1G4RA 3RNQA 3U6XA 4DQAA 5AAMC 4DFHA 3U2IA 4MCZB 1XIWB 1PL3A 4R26H 1UM6L 2ADFH 2FRGP 2SODB 4X6DA 1C5DB 1JZ8A 3SY0B 3VACA 2DBJA 3D39E 1UWXK 5FYKU 4NO5B 1UKSA 3ZU8A 4HOZA 3QQNA 1OV8A 4EOWL 2XTJC 5A43C 1VERA 2AXJA 4UQCA 2C3GA 3D4YA 2IWKA 1YQVL 2W0LA 2C4FU 2WZAA 4JCWA 1CZ8L 1I8AA 1JXJA 4Q56A 1WE5A 1EXUB 1ZSDA 3TO2A 1PTZA 1ADQL 2QGBA 1FL5B 4K8RH 3WOVA 2A77H 3BZDA 2VW7A 3O6FB 4Q0XL 3RU8L 3VVVA 1NL0L 1X4ZA 1OAXH 5AD0B 4HBCL 1AGCA 4XNQB 4Y5XC 4IKKA 4I4WB 2K8QA 5K9QI 3GBNL 4O58H 5KBNC 4WUUA 1J5IA 1VFAA 1BQ5A 3L6FB 1GJUA 2AK4B 3JWDL 4WWKD 3UYOD 4LSQH 3D8MA 4YHOH 4P46B 4JL2A 4KITB 1QTYT 1EJFA 1PZ5A 2CLRB 4WTZG 4U6VH 3B9KB 3H4FA 1FO0A 2XV3A 3X1EA 1UM4L 2AHIA 4RIRB 3MUY1 2VDKB 3PWPA 1SGKA 4KNTA 4LEXH 1B9KA 2Y06L 4GKOA 3VFOA 3QWOA 4H20L 4NPKA 4Y16B 5D6CB 2QKIA 3D2TA 2YD8A 2J57A 2FVNA 5DVLA 3GSOB 3THMH 2WQWA 3MODH 4ZPVB 4DKEH 5T3XH 2XYCA 3EAKA 1ACCA 1CDGA 2L8AA 2PCXA 4XR8C 4S0SD 4PJ5E 1KT2A 4NGHH 2J5WA 1T20B 2GJ6B 5IFHL 5TDOA 2N7BA 3TS8A 2R23A 2OJEB 1VGEH 4NUPA 2VERN 2YD6A 3LVEA 2XKNB 5L88H 4PJ9A 3D85B 2GSGA 5D6DC 2YAPA 4NRZA 4N0CD 1YMHB 5C0CA 2JK5A 4YVNA 2CHXA 2XG4B 4JM0A 5DK2A 1UACH 2GEQA 1CXEA 4FQLH 5CJXC 3K8MA 1HAWA 5EPMA 2BOBA 4JGMA 4A6YL 4ZSOE 3VXNB 1MRFL 1LNUA 4KGLA 1N8OE 4WKXA 5IEHB 2FDBP 4E0RB 4OB5L 1NCIA 2V3FA 2BVQB 3GXDA 5TH2A 4L1BA 2IVFC 1T1ZA 4NRXB 1YNTF 2ZAHA 4PJDE 2CCWA 5IVOA 2F19H 3QIWD 2YEQA 5D1XE 2LGNA 1U58B 4MMXC 4P2QA 4WO4D 1JNLL 2AKRA 3MTXA 2VXUL 1QHOA 1ETA1 1OB1A 5IB5B 5D93B 1BXVA 4X9IA 1NCJA 5I76A 1LQBC 1GRWA 4NQDB 4TSBL 3ATBA 3ECWA 3FT4A 5FCSH 4XBGA 1HKLH 1A3RL 2VLLA 5DTFB 3RGVD 2HT4C 4H0IA 1BFVH 1U8LA 2FL5A 1W0WA 5TQ2H 1P1ZB 3SEPA 1S7UB 5DD1L 3VFPA 1BPLB 2R56L 4PJ5B 1OE1A 3A6BL 4TTDC 1BOYA 5D2NE 5EA0L 1UM5H 3MO1B 2UZXB 1IQDA 1RERA 5AKRA 4M6NH 1QVOA 4CMMA 1B9ZA 3QYMA 4G70B 1XAUA 2W81C 4I0PA 1O9VA 2EIMB 5DRZB 1R3LA 4AUYA 2GHWB 2EEFA 2UX7A 4QOKD 1I3RA 5DYFA 1OIOA 2Q3XA 1DJWA 5JPMA 4TUJA 3ZGIA 5BUGA 2Q8AH 4PB0L 4X7DC 1PX4A 3ARED 3VGFA 4ZMXA 5JA8B 5DSCB 2V9TA 4XMTA 3BUYA 1NBVH 4I18B 3FTUA 4IKIA 5IK3A 1DVXA 4IIQA 1NOFA 3QYCA 3AGVA 4TQEL 1FNEB 3GHBL 1ML0A 3IKCB 4LAJH 2WIIB 2VDOL 4KFMA 2DJ4A 4LLWA 2GYSA 2FH6A 3LPOA 1MFUA 3NP4A 4PJCB 4QJ3B 5FDWB 4Z7NE 3T4AC 2WLLB 2XACC 1YEIL 3H9YA 5DJAA 1Q94B 4EXKA 1A7PH 3ZMRA 3G5WA 2V7HB 3PGCB 1MH5B 1AZNA 3DBXB 4PJDB 5CFHA 2EDBA 4PLKC 4UQIM 1HSBA 1CL7H 2BIMA 5D1XB 1KTBA 4KJWD 2A7BA 1JWSA 2JI2A 1QSFA 4PJFF 5JNYB 4HUVA 2Q10A 1CK0H 4QYOB 4JY6B 5K9OB 5CWSB 4IBWA 3BW9A 3D18A 3HOGA 5D1ZI 2ESVD 2XWEA 3O11A 4N68A 1ZVHA 4TVPE 1LE9A 1U2CA 4N8UA 4RAUA 4NUJB 3GMMA 4X6FA 5J12C 4WNJA 2QLVB 2OTPA 4PTUB 5K9QG 1IC7H 4PJBA 1F41A 2FUTA 4OLXH 4NEHB 1OEZW 1V05A 2TAAA 3NRFA 4MD5A 3QIUA 3IDYC 3RJOA 3BHBB 3RWEB 2WYZA 2XY2A 2ZJSL 5FUCE 2QJDA 5D2NB 4JR9L 3U6XS 2EDEA 5F1NA 5HPMA 4UWQB 3C09C 4Y8AA 3FO9A 4AUUA 3S9DB 1A1OB 1CG9B 4YSDA 3WIHA 5EF1A 5E2WH 3MOBL 4KJPD 4ZO6A 4ODWA 4MNHB 4PWJA 1MCFA 2RQEA 2D7PA 1HHHA 2FO4A 2PNDA 3DVGB 3ZZ1A 2R2BB 4UAOB 2DI9A 1SN5A 1X5FA 4TRPL 3I3BA 4D0BB 4NUGL 3OAYH 5IBUB 4RWHA 1G0DA 1I7UA 2W0FB 3WKPA 1GYAA 2JJTA 3ARYA 2X28A 3N9GL 2FQDA 2E7DA 1U95A 1R5WB 1RKRA 2HRLA 3WBDA 5SWZD 3O6KH 1BAFL 1GSMA 2FNWA 1I3GL 3MREB 2V2WB 1TQSA 3HE7C 4P5SA 4Z7NB 3HAEB 2LVEA 1PF3A 5I6LA 5JIQA 3M8OL 3MLWH 2Q0ZX 1KELL 5DJCB 3TCLA 2FO1A 3NZHL 5D5ME 3QC5X 3VFGL 4OD3L 1KFGA 3QUZB 3ZRCC 1T83A 3VJ6A 4Y2LA 5ICXB 1QNZL 3N43B 4D9QD 4XMLL 4QNPE 3PWLA 1Z1WA 3SKNB 1AHKA 2GBVA 5M95B 3O3BB 1R34A 3EFOA 3NJVA 4Z7WF 5IW1B 5JA9A 1I1YB 4PP2B 1WFIA 2GK0A 2YD9A 2WKGA 4CBPA 3R4DA 3C5XA 5C1MB 4ZUSB 3FQ1A 3NSXA 1JERA 5DZOA 1F90H 4PSRA 1OCZB 3KCPB 3LEVH 4GQQA 5ERWB 2XG5A 4ZXBA 4K73A 1ONQB 2QQKH 2BNRD 5DZJA 3CMGA 3QAZB 1ORQB 3VX1A 2HKHL 3WLWD 1FSKB 5FWRA 1N59A 1UQSB 3BJLA 5GGVL 3KYKL 3H9HA 2A6KA 3AY4C 3ARFB 5IMOA 5CLWA 1PZ2A 4P2RD 1CFVH 4JB9L 2VMCA 3ESVF 4G9FB 3BZFB 2LFGA 1KGCD 1XH0A 4X7TB 3MN8A 4U6HB 4KKBC 1E3FA 3OAYK 2BVUA 5I71C 4JMNA 2EDDA 2KZKA 1KB5A 1HL4A 3PDOA 4HJIA 4MZIA 1UCTA 4HZLA 4KZEH 4CSTA 3CVHB 4XVSH 5DHXB 2OTUB 4M7JH 5CD3B 1HK6A 1I4FA 1I8IA 3CQQA 3JWOC 4LOFA 1VRSA 2Q2LA 2Q6WB 1JIBA 3TFKD 4JKPL 2VR3A 4WEUD 4YHKH 4D0DA 5IFAH 5D5MB 1IAKB 4M3HA 3BXNA 1TJIL 4GBXA 1SJEB 4JS7A 3ZL1A 5HSFA 3RI5K 1KIUB 2OI9B 5ADPH 2Z3FA 2ZXGA 1GH7A 4W93A 5JIPA 3IN0A 1BWWA 5E1AA 1F11B 4S1QL 2BCKA 5F7DB 3WFZA 3RWIA 3HNTL 4ENEC 3QWQB 4QKXB 5K93A 3WAJA 3ULUF 4C56D 2DQTH 4A1RA 3NFSL 4Q6YA 4F3FA 1OAZH 2NQ3A 3P11H 3LIZA 4B7IA 3MR9B 3BO8B 1S3RA 4M7ZB 2MCPL 2L7JA 1BIHA 4QT5B 2VE6B 5I0VA 3SGJC 1TO4A 2WB7A 3U2SA 1ZHLB 4EJ1C 4UM9B 3CN4A 2X2JA 3TESA 3QCUH 3TJHC 1DFBH 3WXWH 2G4GA 2XN1A 4XZUB 2BK8A 2NY3D 3CVDA 5DZ9A 1TDQA 3QEHA 4TS6A 3PL6A 2UZYB 4PRHA 4JLRB 3ZKND 3WFDH 3ULSB 2BH0A 4GKLA 5D7LA 5FWQA 3QI9D 5C9JA 2X1OA 4GSQA 2R7EA 4HIEA 4OFPA 3F85A 1MREH 1MWAH 3LKSB 4K23L 4Q6IC 1N3NB 4PP1D 3T2QA 1OGAA 5IW6A 1EMTH 1YDPB 4FQXA 2ZOKB 3ZKQD 1XR8B 2CJUL 3QIBD 1K6QL 1ROWA 3QH3A 3KS0J 1R3HA 1KYFA 2QDWA 1UXWA 4HFWA 3VXRA 5F6HI 1IJ9A 2EXYC 4PTTB 1LGVA 1O6VA 2EDHA 3L16A 4WW2A 4OF0A 4XO5A 1JPST 4JO4L 4HJJH 2B14A 4QOKE 1A6VH 4AUJA 4PJ7F 1OLLA 1F5WA 1DL7L 1X5ZA 1FUNA 2VDNH 5BZXA 1KGUA 2K4WA 1A3LH 2VAJA 1ZV5A 5EUOE 2FR4A 2E9BA 2PP8A 3UL4A 5HHOB 5ITFB 3SKJL 3BPOB 3RIFK 3VE0A 4Z7VF 1DN0A 2IPKA 4WNSA 2XA8L 3BDYL 1DFXA 5IROD 5DMYA 4NPJA 1MVFA 3GRWL 1VIWA 2JIXB 4KAQH 4XWGH 2RMNA 5FUZH 1J1PL 1U91A 3GLAA 3RX8A 2DM3A 3C60C 4YUEL 5HI5C 3MRQB 1ECYA 5IBUG 1PNDA 2FHCA 2QTVA 3IFLL 2NY4D 3L5WB 1X5LA 3WLBA 3EFDL 5T1DH 5C0NC 4M9OA 1JZHA 1CDCA 1KBPA 3DXAA 4HPYH 1NC2A 1MW3A 5I1LB 1J0JA 2R9HC 2VLKD 5CN1A 3TVMD 3C5JA 4ACPA 2ZXEB 5IP4A 2NXYD 4PGEB 5EN2A 3V10A 5I5IA 3SE4C 3V4PL 1DQMH 3RKPA 2YUXA 4A2DA 2ESVE 3HFMH 3TJEL 5IREA 3IJ7A 1KZYA 3IFPB 3AY2A 3E0GA 3PHAA 1N18A 2GJZB 1YEEH 2JI3A 3J7HA 2GTZA 1FYHB 2IDFA 2PR9A 4BQBA 4U7KA 2ILLA 2PW1B 1TQCC 4PVNA 4EDWH 4AXWA 3L3GB 4PJAA 5KVFH 5KUKA 4YMPA 2D4DA 3MBXL 3RA7L 1Z9OA 4WTZA 3GSXA 4P04A 5AW0B 3NZSA 2D7MA 2E74C 5CR1A 4CL7A 3MLPA 4DERA 1R75A 3NCEB 3IXTB 1U8HB 3UZEA 1P84J 4Z18A 3Q5YA 4Y4KD 3VFWB 3OHXB 1CXLA 3LKRA 5TF1L 4FQ2H 4MKMA 3HG1D 2H9GB 4S1SH 4OQ1A 1M9WA 3PHQB 4GNKB 4O51B 4QCIA 3AREB 2BSSB 4ELMF 1FYTB 3CFBA 2P28B 4GAAA 4GEIA 4JRFA 5DK3A 3U82B 2WBWB 5AVVB 3KLHC 1E5CA 5IHBA 2ENQA 5SWZE 2VTFA 1DBKL 4OCSH 3UTOA 3SE9H 1E67A 4YR6A 4M1DL 3PF2A 3CHQA 3D50A 5IB4B 3RVVC 1ILSA 1D7BA 1B4LA 1MIML 4JN1L 2JJVA 4R2GC 3LS4H 3SDCC 1BPVA 2Y1AA 4Y4HA 2IQ9L 3ZUNC 1IZKA 3HNSH 3MA7B 1WBYA 2VDLL 4G6KL 3JZ7A 2N4IA 4OKVA 1N5AB 2FX7H 4PG9B 5AZ2L 5BCAA 2FWUA 1JD9A 3VA6A 3BEWA 1F8TH 5BJTB 1KCRH 4AQ1B 2ESVB 3DX7B 3L4WA 4XMXA 3CZNA 4D9QE 5TE4H 5MI0C 1L9MA 3JV0A 4AM0Q 4P49A 4AYSA 4HBQA 4G2AA 5D7JB 1A7OL 1IGFH 4E9XA 1IKFH 4PMFA 4PU2A 3HVDA 1USZA 3NJXA 3BZ5A 1KIPB 1ACYL 2SEBB 3CDCA 3P0YH 3NJLA 5I66B 5F9DC 1ZEAH 2BVOA 4OH2A 1YPZF 4RFOH 3RZCA 3FOMA 4ZQKB 1JHTA 5D7IB 5IHZB 2BNRE 1A1MB 2BP3A 3AWGA 2NXZC 3VXOB 4UQDA 3F5WB 2NW2B 3HPLA 4G7YL 5INCB 3GEWB 2ATAA 4DPCX 3DTXB 3RTQB 2A4EA 4P2RE 1VKXA 1TLMA 3G6JA 4GRWE 2EO9A 2A83A 4OCXH 3HNVL 1QEWB 3OKOB 3V5KA 1X4YA 4FG4A 5B8CB 1JNHA 3UOAB 5KS9B 4JO3L 1BXXA 5H8DA 2D9QB 4U3CA 1KGCE 1FH5H 1JYNA 2X4QB 1OM3H 5FEBA 3WY2A 3TPUA 2VIRA 5CINH 2WC7A 2F74B 4CVZA 2ZZUT 5H35B 1KJ2H 3LNHA 5CJOL 4MAYD 5JHBA 2QKIC 2ZUYA 5SWZB 1FZKA 5B7MA 4AIEA 4JJOA 3RIKA 1LWRA 5CMAB 1FIEA 1XH3B 3KJ4C 3ROLB 3TT3L 1TSHA 4ES8A 4BQ6A 4EIZC 1L7TH 2CNZA 2E9IA 1QLRB 2E9GA 4RH4A 2JNZA 1XGZA 2KLTA 4YAQB 2CPUA 1CE1L 1MPAL 2BNQA 3WV0A 3WEXB 4WHTA 3Q13A 1VGKA 3BFOA 2ID5A 3BLPX 1IM3B 3I02B 3OKLA 5C0GA 4AIOA 2WZPA 4PJ9C 4OFYA 5EC1B 4N1CA 5E9DD 1J05A 1S9WB 5DEZA 2DMCA 1JDDA 4NZ8A 4N2GA 2J2ZA 5K33A 4EVNB 2CDFB 2FATL 3LNGA 3AJ7A 3KPRA 2YR3A 4JAMA 4C56E 4AZ8A 4N6RB 4KDWA 1MCRA 2GABA 3PLYA 4HCIA 4MXQC 2YN3A 1E9PB 4MCZA 1XIWA 4IU2B 4XOCA 3WG7B 4X6CB 4C54A 4EAEA 2LLLA 1C5DA 3O9WD 4FQQB 4DVRH 3I6SA 3SY0A 4WJKB 3G9AB 4NO5A 5DJDB 4ADGA 4DGWC 3AXHA 3ILEA 2ZUXA 4OI8A 5B7FA 5C6TH 3D0VB 4X9HA 4UIKL 5TPWL 3MV9B 2OMWB 3STZB 3NP3A 4P2RB 3D0LB 4GRWB 2P48B 3PAUA 1B2WH 2ZE0A 2R8SH 1UUNA 3VM7A 1EXUA 4BQ8A 1LO0L 1HINL 4LEEA 2X0VA 3BPLC 1FL5A 2VDRH 4ZK8A 3O6FA 1CL7I 5I8OL 5AD0A 1HYSD 1IKOP 4Z77B 4XNQA 1IAIL 4OLVL 3JWOL 4XPFH 4I4WA 1FNAA 3KPNB 4I3RH 4LARH 4X8GA 1MCBA 5AAPA 3BP6B 3L6FA 4NXSA 2AK4A 4WU5B 2E75C 3DJZA 3R06B 1WRFA 4P46A 1XSIA 3W2DL 3K6DA 3U25A 4EUPH 4CGTA 2CLRA 4NX0A 5FM8A 3D7PA 3B9KA 4C58B 1NSNL 1ZLEA 5FUOL 3AUVA 4RIRA 4ZYKB 5I1JH 4G71B 4PRBA 5HDBE 4HS8L 3I9AA 4HUNB 4I0PC 1TQTA 4KH2A 4V1DB 2WD0A 4Y16A 1VFOA 1L4IA 4ADJA 1LDSA 4K15A 5GISH 3GSWB 1Q9OB 3GSOA 2A9AA 3QEUB 2WTPA 1KIQB 2YAFA 2Z4TA 4ZPVA 2K78A 3OGCB 3VXSB 5JPMC 1GSKA 5EZOH 5ANHA 4C56B 1MCIA 1T20A 5DQJB 2GJ6A 3ZTNH 4XNYH 4ZDHB 5HI4D 3O6ML 4DEUA 2OJEA 2VLKE 5FDYA 4IIQC 4UILH 1XV8A 2C8NA 4YGAB 1PJ9A 2E4FA 1CE6B 1NUNB 3QQ3B 4XE5B 2XKNA 3D85A 2HLAB 5D4JA 1H6UA 1F4YL 2K6WA 2ZCLH 1YMHA 4L4TD 3TO4B 2P26A 5CBAB 4B9ZA 4MDRA 4HJEA 1RIVL 3BYYA 4U3SB 1P2CB 4A63A 1I1CA 2DM2A 3S8FB 3N1QC 3V8CA 3BUQA 5EWIL 3QI9B 3L4YA 3F8UB 3VXNA 3FB7B 1GYWA 2P5PA 4L1LA 2VERA 1NPUA 1MNUL 4WNQA 5IEHA 1E8XA 1IIKA 4Y4FD 3WFCL 2BVQA 1F58L 3FAWA 2RTTA 5G4NA 4NRXA 3SO3B 4IU3B 5E99L 4IMKA 4K5LA 1GGBH 3FQRB 1KFAH 2E76C 5J57B 3DETC 2C3VB 4Y7OC 4ABQA 3IKKA 3QIUC 4K3JL 1U58A 3H3KA 1CTNA 3HG1E 4Y1AD 2P4AB 3VSQA 2XNAB 1RCYA 1YNLH 4NWTL 3PXLA 3S4SB 3H3PH 4H8WH 4M5TA 1X4XA 2VN6A 1R0AL 2HMID 4FNQA 3L4XA 1N0LB 5IB5A 5KSBF 2DW5A 3MLSH 4FP8L 3US9A 3IDJB 3V9EA 7PCYA 5CZVL 4FMVA 4NQDA 5GPRA 4BZYA 4LMQI 5DUMH 2JCWA 3D87B 1HX0A 1MI5B 1N70A 3AM8A 5DTFA 1BXUA 3NCJH 1P1ZA 1NCCL 1S7UA 4L8BB 5BRPA 1NMAH 1FNHA 3LSOB 4FA8A 4PJ5A 5F0PB 2NY4B 4GSUA 4I77L 2NNFA 4NXKA 3WFBL 2JJTC 3O3EB 1WTGT 2DBLH 3MO1A 1GYCA 4Y2OB 1X7TA 2UZXA 3TVMB 2Y5EA 1U8JB 2RA1A 4ALAL 2NXYB 4HK3N 2C4XA 1S7XB 4KUCD 4MDJB 4XMPL 4RGOH 5DRZA 2LABA 3TEUA 1GYUA 5FLVA 4U0RB 5L2KD 3SQRA 2H6OA 1RH8A 2K70A 3LTVA 1AZCA 2NDGA 3ZGHA 4BH8B 1T5XB 1T0NB 1BM3L 3CX2A 3GUTB 3HMWL 3FT2B 4BZ1L 5DSCA 5DWUL 1BYOA 1Y07A 2EYSB 2CRMA 2XN0A 3EG9B 3FMGL 4I18A 3M45A 1T83C 2HLFC 3MJ9H 1FNEA 4WIQA 3FN0L 4YOKA 3IKCA 4U31A 2WIIA 5F89B 3KAAA 3AABA 4PJCA 5FDWA 2XV0A 2ENSA 3CHOA 5AYUH 2J20A 3DUHA 3L54A 2FB4H 2DIEA 1AIFB 1Q94A 3QO1B 3U1SH 3L7FB 1G6RL 3U7YL 2V7HA 3PGCA 2UZPA 1MH5A 1P4UA 1PDKB 3DBXA 2JKIS 2P44B 4PJDA 4AEFA 5D1ZA 5JUEL 4HJ0D 2AQ3A 2ZG3A 5ACZB 4PJ8B 5D1XA 3WY3A 1ADWA 3GF8A 3QUYD 3VWJD 5JNYA 3HG1B 4ZXBC 5IMKB 4QYOA 4JY6A 5CWSA 5DZLA 4J1UB 2XPZA 1N7ML 1PCSA 4AY0A 3FSVA 4ZTOL 4MJ6B 2O4EA 3VRLE 1MVYA 5I8CB 2LQRA 1RUQH 4NUJA 5ACLA 3CAFA 5HBBA 7FABH 1JK8B 1KDIA 3AWEA 2CGRL 4KO7A 4PTUA 3MCLL 3MUGA 4UI2A 1HYRC 2H32B 1QLFB 1MWAB 4W6XB 3RWEA 3BHBA 1AXIB 2MPAL 2UY6B 5D2NA 3A23A 4CADB 4G5AA 3KW7A 4XMKH 1FLRH 3UC0H 4WEBH 1A1OA 4G80B 1CG9A 4D3CL 3WCYA 4LOVA 4K7PY 1JF1B 4MNHA 3KEHA 5E9DE 4QRBA 5GRJH 4ADIA 4BK8A 3DVGA 1OP4A 2R2BA 4EI5D 3O2DH 3N5AA 2Y4SA 1FHGA 1AXTH 35C8H 4D0BA 2VDNB 3GPEA 4GBXC 1JYVA 4A2MA 2W0FA 3EW3B 3C08L 3FO1B 1A14H 5IT2H 3ALPA 4U1MB 1R5WA 3OPUA 1N26A 3CLWA 5FO2A 3DI2B 2BZ7A 2X1XR 4RA3A 1OANA 4AVKA 3OLIA 3WJLA 1P7QB 1YO4A 4ODVH 3WKNA 3MREA 2CHDA 3WIFB 2X87A 4P9MH 4GPVA 3HAEA 4N5UA 4A37A 1HNGA 2EXWD 5DJCA 2YA0A 1YEGL 2AJUH 1WD8A 2BY3A 1O5DT 1JHKH 2AF2A 3A21A 2WNXA 4X6DF 4ABUA 1EHLL 2EDTA 2Q8BH 4WFED 2X38A 5ICXA 2F08A 1QA9B 4C4UA 1A6WL 4XO4A 5J8OA 4R9HA 2JELL 2L04A 3SKNA 3QUMB 3E6HB 3O3BA 3PL6C 1EH9A 1UGNA 5IW1A 4WGVB 2X1PA 2YA1A 3RVWD 4JVPA 1I1YA 1GJIA 4PP2A 2O30A 1S5IH 2FECI 3B5GA 3UO1H 5GS0D 4HFUL 5KVEH 3VNYA 2AZUA 4DEWA 4LB8A 1QSZA 4KK9D 4XODA 1PZDA 4KHTH 2XZAL 4QHUB 3KCPA 2NY6C 4X83A 4P2OD 5ERWA 4FQXC 1ONQA 1ORQA 4NN7B 5C0AD 1UQSA 3HLKA 2B4CH 1BZEA 3ARFA 4HGMA 4QRQB 5E9DB 2CQVA 3VQLA 1MNNA 1SLVA 4WW2C 5C0IB 3NACL 1E8ZA 3F7QA 2DKMA 3NK4A 4G9FA 2R51A 2ZCKL 3BZFA 2J1ZA 3QA3B 4X7TA 4U6HA 3S4SG 3W9EB 4GQRA 1T03H 4CN1A 2F5BL 5H4YA 1U8PA 5CCHE 3B9AA 1AOZA 2P9RA 4UTBA 1FCCA 5GQBA 4GXUN 5AWNH 2H3KA 2CK0L 2CLZB 1I7TB 4OW6A 1WWWX 1NKOA 2X6UA 2WINB 3CVHA 3ZTCC 4EZMA 5D55A 2OTUA 4DQOH 2WQXA 5CD3A 4JFWA 5E2JA 1PIFA 4YN3A 2E27H 2R29L 1K3IA 5JHDD 4L4TE 2Q6WA 4U1NB 3SDDD 5IB2B 2FNBA 5E70A 1ZTXE 3RVXD 5HDQL 4AE0A 3NVQA 2QMJA 2FLBT 1IAKA 5D5MA 4JGJA 2MNJB 4B9GA 5JZ7C 1XGYL 2EYRB 3L9EA 1GKEA 2WN2A 3WO3B 1MCSA 4NRYA 3QXUA 2R1XB 2FTAA 4GW1B 1IFGA 5AW3B 4WSKA 2YPVH 1F11A 3FU6A 1NIDA 1I1RA 5F7DA 4Y19D 1T2JA 4PSPA 4M6OH 5I82A 3OKKB 3DLQR 4XRCB 4X9YA 3T0EB 4JFED 2XETA 4ONGH 3RWDB 1M1SA 1RURH 3S98A 4Z7OE 1JI1A 1G87A 3MR9A 2NY7L 4NZRH 3BO8A 2PPAA 5L7XL 5EO9B 1OPGH 5I1GH 4Y1AE 4QT5A 4KOBA 2VE6A 1JFQH 1GC1C 1ZHLA 3LH2L 3QORD 4UM9A 1IGIL 5I9QB 3UZEC 2APXA 3GC3A 2RBLA 1E6JH 4YGVB 5LDUA 3KH4A 2AJYL 4LRNL 4XZUA 4G6AD 4HSCX 2UZYA 5IJBC 4JLRA 1MZZA 1H8OA 4TV3A 5K39B 3ULSA 2FJSA 2QPUA 3D4CA 3N85L 1KZQA 4RDBA 3H85A 3T71A 5E6RB 3LKSA 4OZIE 3NFPB 5FX3A 2YD7A 4FFZL 4QRPD 1RZQA 4XVTL 3HZ3A 5GSVB 3TP4A 1KJ2B 2JTYA 2ZOKA 2L4OA 1XR8A 4LHUD 1KXVA 2A1WL 3MTRA 3U0WL 4JG0L 1CF8L 1PG7X 4AV0A 3FN9A 4DTGH 1YN7B 5L2KE 4R8WL 4BA0A 4PTTA 3ASOB 1PD6A 1AQ8A 5JO5B 4Y4HC 4X6BB 2E7HA 3GXNA 3GI9H 1L9OA 3FO0L 1UT9A 3WTUA 2GSIB 4MBRA 5F96L 5HHOA 1WDAA 5ITFA 3TZVD 5B1BB 5AVTB 3QUXD 1QD0A 2V9RA 3E9TA 4NM4L 5I1CH 1ITCA 2JIXA 1BFOB 1I8KB 2G2RB 4Y4FB 3V4VA 3Q2NA 2GHZA 1FNSL 2DMBA 4HA1A 3MRQA 1UWYA 5EU6D 3L5WA 1PSKL 2NTFA 4W1TA 3MFFB 3NT0A 2YN5A 4LKXB 5C6WH 4FNPA 5I1LA 1YEFH 4Z7OB 2XV6B 2XXFA 1EAQA 1T7YA 2ARWA 6CGTA 4PGEA 5D72H 3RZCC 1FAIH 4HS3B 2CU9A 4PUBL 1NANH 4Y1AB 3CCHA 3RUGB 4G42B 4KY1L 2EEAA 1T5WB 2G75B 3J2PA 2WOYA 3PP3H 2Z31D 2L7UA 2O26U 3IFPA 5JYMA 4BZ2H 2HVJB 5H2BB 3RY6A 3CH1B 2MSPA 2GJZA 1J5OH 2I69A 2Y5QA 4XBEL 3BISA 3NIDF 4UM8B 2OSWA 3QDJD 2PW1A 1ZAGA 3TWCH 1GMIA 3L3GA 2UUDH 2VZUA 2JMRA 3FQNB 3RHWK 1YLBB 3ZE2B 5DI8B 2VDRB 3EOTH 3KVDD 1CDHA 4XCYB 4YBHA 3U30C 4OZIB 2J25A 3KL3A 1Q38A 1L9TA 2JF1A 3CPLB 4I2XE 3IXTA 4YHMH 3L3OB 1U8HA 4P9HL 1KYDA 2CLVB 1YRKA 4YDIL 1XZWA 3FSZA 4U3XA 3VFWA 5L2KB 4PJBF 3OHXA 1NCHA 2A6DB 2AQNA 3FUFA 4EUPB 3GO1H 4AMWA 3UJJL 4GIPD 4BK4A 2H9GA 1DBJH 1FWXA 5DGRA 3WFEH 1UVQB 3PHQA 4O51A 1WFJA 3AREA 4JHUA 5CLXA 1JDAA 2BSSA 4DCQB 1FYTA 1UM6H 1ZLDA 1MDTA 2DOCA 4MJID 4XVJL 2UWEE 4ZFQA 2R0KL 3F7RA 4YDMA 1AXSB 1K85A 2QKSA 1IAIM 3ZX1A 4EOWH 5IB4A 1BEXA 4XH2B 4AEEA 1CYGA 2J43A 4XHJD 1BAWA 3CZLA 4OKDA 4MVBD 5KZCD 3QZMA 1YQVH 3KNBB 3KZ8A 5AYQA 1CZ8H 1HSAB 3S3BB 1XIWC 3MA7A 2CBPA 3H54A 4X7CC 1N5AA 3QUYB 4K3EL 1ADQH 4PG9A 4R96B 3VWJB 4WFEE 3FKUS 4Q0XH 3RU8H 5BJTA 1LWJA 1NL0H 4HBCH 4AQ1A 2ESVA 3DX7A 5FFOA 5K69A 2Q20A 3PP3K 4BUHA 3GBNH 5I6XB 2CAKA 4DT2A 5D7JA 3JWDH 4J4PD 3D2UD 4JE4B 5SWQB 1KIPA 2SEBA 4UBDC 1CXHA 4P5TB 1EZVY 1C7SA 5I66A 5AQ0A 4UIMB 2UUDK 3IRCA 2VSDA 3O6FC 4AGQA 1UM4H 4ZQKA 4EPSA 4CGUB 5D7IA 5IHZA 2ZUWA 5EZIL 5J1AB 4I2XB 1L9PA 1AHWB 1A1MA 2JKTM 4GY4A 4I3SL 2JE8A 2Y06H 4HCFA 3S3JA 3VXOA 2ZUSA 2NW2A 3F5WA 4N28A 5INCA 4A2HA 4WU7B 1AKJD 3VRIB 2C7UB 1A4JB 3DTXA 2W65B 3QARA 3OXRB 3RTQA 4P46C 1IM9B 4R4BB 5AKVA 1CI5A 5FOBB 1RD6A 1QEWA 2QMKA 3C6LD 3OKOA 4HGWB 4E9QA 5B8CA 5KS9A 1QBML 4HIHB 5T3ZD 3B9KC 4EI5B 5I75B 4L3AA 2X4QA 1YEHL 3LKQB 5JOFB 3PJLA 2KL6A 4KKZA 2FIKB 5IFHH 3DJSA 1XXDC 3B8SA 4KX7A 2F74A 5GJSL 3K80A 5H35A 5FM4A 1AYOA 3J07A 4KJYB 4F91B 2IWGA 1RIUL 3JXAA 2KQNA 4Y16C 5SWZA 5IMLB 4R4NC 3UP6A 1TTRA 5CMAA 2E46A 3TURA 1XH3A 3MRIB 2BP0B 4NKIL 3ROLA 1G9ML 5JHDE 2EDJA 4YDZA 2NY5L 5F88B 2IGFL 1QLRA 4G3YL 4YAQA 1MW1A 3WEXA 4TTGA 4WUKL 4A6YH 1IM3A 3I02A 4S0TD 5KYYB 3WN6A 5EC1A 3IAQA 2EZ0D 1S9WA 15C8L 2DWEB 2OX5B 2WP3O 3TBVB 4OB5H 4XXDB 4ISVB 4EVNA 3RZWA 2CDFA 3MRPB 4Y19E 2V5SA 1F86A 4YQXL 4ANWA 1Q1JL 2VJ8A 4WHDA 5HYQB 3L3HB 1M7UA 1RLBA 1ETB1 4N6RA 1C5BL 2YQ2A 3PJNA 1TG8A 4JFEE 3R18A 3BDXA 4Y5YB 1E9PA 2DAVA 3ESPA 4X6CA 4XPAH 3ZE1E 1NIFA 4X7EC 1MELA 1GZPB 1CYXA 2AEOA 4FQQA 1DANU 1JZEA 1JNLH 5F7EL 5FYLD 4PAZA 1BJMA 3WI9A 3X1NA 2VXUH 2OLDA 5DJDA 5H37H 1RUPL 2HFTA 5IVXE 1XF2B 4O2CB 3D0VA 4TSBH 4IMKC 4S1DC 1KPUB 3MV9A 2OMWA 3STZA 2C26A 4P2RA 1II4E 3D0LA 1A3RH 4F7CB 4ZS6C 1BIIB 1MRDL 3BIKA 3UG4A 2B9AA 1VZGA 3SBPA 3DTUB 3HC4L 4XCFL 5DD1H 3MRRA 2R56H 1GJWA 3MLZL 5K5YA 3A6BH 2F68X 5HDOA 4KNUA 5EA0H 2VR7A 4QRPE 5E51A 4Z77A 1KNOB 5D93C 3PUCA 3KPNA 2Q7YB 1HHIB 3BP6A 3BKJL 4WU5A 4TUOB 3AM8C 3WE6B 5LG1A 4RGMB 4WWOA 3VG0L 3R06A 4KI5D 3ILDA 5DJ8B 4WI3A 3OVUB 1A4BA 4WHYH 5KJRL 3N1PC 4ZYKA 3GXUB 4PH8A 1SM3L 1S7WB 3RDJA 5ESVB 1W91A 2J1XA 1PW3A 4V1DA 2XWRA 9PCYA 3STLB 3GHBH 1S46A 2AXGB 2VDOH 3CIQA 3BUBA 4BH7B 2BIIA 3GSWA 3DO4A 1Q9OA 4U05A 3RY5A 4EUPG 4POZD 1HCFX 1WZLA 3QEUA 5AFAA 1KIQA 4WW2F 1TCRB 4LBAA 1YEIH 4ZFZB 3OGCA 3VXSA 1HZHL 1SJXA 3FU0A 3MV8B 3DO3A 4JM2B 5EU6E 3TEZA 2YWYA 5DQJA 4ZDHA 4I18C 4F92B 3L17A 2FSEB 4JRYD 3S88L 1AGFB 1OSPH 1CE6A 1V7ML 3MPCA 1BLIA 3QQ3A 4K94C 1BAGA 3W3BA 4AGPA 4TQ8A 1KBBA 2XVLA 3PQYD 3COOA 3QORB 4LP5A 4PS4L 3T3MB 3FT1A 2PTTB 3FTYA 3TO4A 3ULVC 3OX8B 1IMHC 2FJFB 2HPOA 4EIBA 5CBAA 5D1ZC 4NQEB 2ITCB 3BKCL 4U3SA 1P2CA 4Z3IA 4FLRA 5D1XC 3QHTC 3A4EA 3QDJE 1DBBL 5F8RC 3QI9A 2WXHA 3FB7A 1GCFA 2FE0A 4GW4B 3ZKXB 2ZJSH 1TF4A 3GB7B 3ULVL 3OJ2C 3FB6A 4JR9H 4QRPB 4W70A 5FFGA 5TFSL 4FAAB 1X44A 3PP4L 2Y22A 4I3GA 4HSQA 3HS8A 3WGUB 4IU3A 4HHAB 3MOBH 2PYED 1LO2L 3RLSA 3QJSB 2FWLB 4FCHA 1UUSA 3DSNB 3FQRA 1SYVB 3KM1A 3LX9A 2R83A 2C3VA 4LCUB 1RHFA 4YWGL 4PJAF 4POUB 2FX8L 1C08B 4TRPH 3X2QB 4NUGH 1D5MB 5D2NC 2KPWA 1R6VA 2XNAA 4BSWB 2H0JA 3S4SA 3VB9A 3QG6B 5C8JB 2BVYA 3N9GH 1N0LA 5FYJL 4MJIE 3IDJA 3QDAA 4E9YA 3TZVB 2X53A 4GUPB 3SKOB 1YEDB 2OS7A 1I3GH 2A99A 3BIAX 1MI5A 3D30A 3N0PB 4UAOC 5IROA 3M8OH 3L95B 4L8BA 1KELH 4NBZB 4E68A 3LSOA 1BJ1J 4GYBA 1KGJA 5T1LB 1LP9E 3NZHH 4FMKA 1IU1A 1VEPA 3VFGH 2BWDA 3O3EA 1AGDB 2AJSL 4OD3H 4Y2OA 3MXWL 1EBAA 4YPGB 5LBVA 3UMTA 1U8JA 4AEHL 5D4IA 4ZX4A 3D0AA 4E9WA 3WJLC 1S7XA 4MDJA 2NR6D 1QNZH 2CE6A 2QTEA 4TNVF 2DLHA 4XMLH 3CBRA 5LAPA 2Z31B 2W60B 3T4YB 3FQYA 3L4VA 1Y0LB 4BH8A 1SUJA 1W0VA 3U46B 1T5XA 4PFEA 1PZSA 1T0NA 5DEJA 3PFQA 1BG1A 3Q2WA 2OW6A 3OAUL 3AG2B 3FT2A 4YSOA 1OAKL 3I6KB 3ZDYE 1UJTA 2EYSA 4GG6B 4NNXB 3EG9A 3UBXI 3T2LA 3RAJL 2AEPL 2BHYA 3B37A 3H1ZA 5F89A 4OZGE 4BE6A 4HUXA 1JTPA 3WTYA 4U4BA 2HKHH 3KGTA 4ZG1A 5GGVH 3KYKH 3OHMB 4OF6A 1AIFA 3QO1A 5LXVA 3L7FA 1M71B 1PDKA 3TTSA 2YQBA 2XT1B 4JB9H 2YXVA 3H8NA 1JPEA 3T09A 4L9DA 4AWJC 3VFTB 5ACZA 4PJ8A 3DDGA 5T3ZE 2IGLA 3BAWA 3HG1A 3QRGL 5EDXA 1W2KT 1WAAE 5CJ8A 5IMKA 3WMSA 3IETB 3QAZC 2XI9A 4AZUA 2XWXA 2G9HB 3SDAB 1FSKC 2HFGL 4JFFD 1G7HB 4MJ6A 4XC3L 4NNYB 5AZEH 5I8CA 1ICTA 1TLKA 3ARFC 4CRPA 1DN2A 4TOYL 4YE4L 3ARXA 2H1LM 1JK8A 3LN4B 4R5XA 3BUIA 3G6JF 3QJVB 3TF7C 1FVDA 3FUHA 2A3TA 2Y7LA 3SY6A 1G9NC 3H9SD 1OKEA 2H32A 1QLFA 2WJ5A 1MWAA 2YOCA 3DV6B 4JKPH 2DQDL 5KZCB 1CICB 4IBYA 3B83A 3PYCA 1Z9LA 4K0OA 2UY6A 3G04B 1TJIH 4CADA 1BWMA 1OAQL 3U6RB 2F61A 3NJMA 4G80A 4KQ4L 4PRID 4EEEA 3ARBD 2OR8A 5SX5H 2IBBA 1JF1A 1KGXA 5EZLA 1UXLA 1J48A 4W9EC 4AM0B 1FGVL 4ANKA 2VLJD 4S1QH 5JQ6L 3MI6A 4HIXL 1XCXA 4JFTA 5DUJA 5F7UA 5HY9B 3HNTH 2CUHA 3NFSH 4ODBD 1YC8A 1WH0A 2H3NB 2P80D 2HVKB 3T1FB 4QHNB 1NICA 2OI9C 3FO1A 3N2JA 1C16B 1H6TA 4H7VA 4U1MA 3UTSD 2MCPH 3JV5A 1QPXA 1ZT1A 3HB3B 4D8PB 2VNCA 4FNRA 3MKKA 4NJ9L 1FFRA 1X9UA 3K2KA 3E8VA 4OZGB 1P7QA 3AAZA 5LCVL 3WIFA 1MLBB 4F5CE 3LNEA 3U4EB 4XNZB 4HKBA 1WZ1L 3E9UA 3IMSA 4L5FL 4DKFL 3Q9PA 5EZPA 2G5RA 4H8HA 1RK1B 3H53A 4M7ZC 1NMCB 3C6LB 1IC0A 1K8DB 4JO5A 1RPQA 5CP3H 4DF9A 4YHYB 4K23H 2ZXCA 5FHBL 2VMDA 1QA9A 4G7QB 2ERJB 1WG3A 4KKQA 1I53A 2CJUH 1IBYA 4DZBB 1K6QH 2APWA 1UFGA 3QUMA 5EEVA 1NANI 2ZUUA 3E6HA 5IQ9B 4LKCB 3JV4B 2WGXA 4PB9L 4UQ3B 1RV6X 1GHFL 1VHPA 5I26A 1KCVL 5DC4B 2B08A 3IF1B 4CC4A 4KI5E 2J4WL 4QHUA 5E4EB 4OV5B 4N4YB 3SE8L 4KQ3L 1WCBB 3VFRB 1Z0NA 3HRZB 3OMIB 3UABA 3MGTB 1KXVC 3HBZA 2BIPA 2CMRL 3TLRA 4EI6B 2I5YL 3P4LA 2XA8H 1ZHKB 1AQKL 3BDYH 4HJGB 1OSYA 4QRQA 5SX5K 4FABL 5E9DA 5F1IB 4QXWA 4M5ZL 1T1XB 2LFEA 2HLEB 3GRWH 4P59L 2VR9A 3ISWA 3V4UL 1J1PH 4AGLA 5C0IA 4YUEH 3ES6B 1AS7A 1YUHB 3LRHA 4HXBL 3QA3A 3IFLH 4PWKA 2PP7A 5AB0A 2DY2A 3EFDH 3W9EA 2CM6A 2IPTL 4Q7DA 1TNMA 5TDPB 3DARA 2Y1VA 1A7NL 2VW4A 3BPOC 1CB4A 2IBGA 2NY2C 4AYEC 3V4PH 2ARJQ 2CLZA 1QAWA 3V52L 3E80A 2WINA 4KKCC 4MJ5B 4JPQA 3TJEH 3PQYE 4UOW0 1LO4H 2XWDA 4GI9A 1CLCA 4U1NA 1TVBB 5IB2A 4FXKB 1J10A 4QRRD 7TAAA 4HJ1A 4MASA 2EYRA 1MAML 1BBJB 3TBCA 1MRCL 3P1VA 4MNGE 5AVZB 2O5NA 2R1XA 3L2NA 5G4OA 3MBXH 4LLQB 3CLFL 3HE6D 4GW1A 4PJXF 2DQGH 3JWNE 4FE9A 3G5ZB 3MLTB 2KDYA 1RAMA 2MPVA 3RY6C 5HPOA 1SHSA 3VU2A 5ALBL 4BKSC 5B21A 3OKKA 3LB6D 3U9WA 4XRCA 1UWGL 1DVSA 4LSSL 3T0EA 2PYEE 1ZS2A 3F7LA 4L3ED 1ZS8B 4MDIB 4X9BA 3RWDA 3WELA 2YGPA 5C0BD 3IMUA 4NC2B 5TF1H 3PFUA 4K8RC 4XCNA 4YDJB 5EO9A 1HS6A 4Q2ZB 1T0PB 2O6CA 2DH3A 4KV5F 4HUCA 4ONFL 1GMEA 4YGVA 4CDHA 3MXVL 4LPUA 1A66A 4FMFA 1OW0A 4WO0A 1DBKH 3FSOA 4PJHE 4P23D 1J11A 3OHXC 4G6ML 4QAWA 5K39A 4M1DH 4NS0A 5MHSE 4UANA 2GY7B 1PD1A 2VDQL 4X5WB 1OT1A 1A25A 2QPFA 1MIMH 2EH8L 2KZBA 5G5DB 3NFPA 1XF1A 4YSEA 3AREC 1BECA 2IQ9H 3N41B 5DUPL 2X10A 4G6KH 2VDLH 5GSVA 1KJ2A 1NUFA 4X6EB 4AJYV 5AZ2H 3BH8B 1FL3B 2VMFA 1YN7A 4QGTA 5DFWH 3RFRA 3C2AL 3ZKMD 1KWKA 1SOQA 3WENA 1UZ6F 5JO5A 1ZA3B 2YGNA 1G1OA 4HWUA 5ANME 1UOKA 1DQVA 2KT6A 1U21A 1A7OH 2BFVL 2WM0A 3F7VB 2ZQKA 4WTXA 5I1KL 1Z9NA 2Z9TA 4I5BB 5KSAD 1KSRA 3ABZA 2VM9A 3SE3A 1ACYH 4DJMA 2YAOA 1HEJC 2NCEA 1Q4NX 2AQ2A 2GSIA 4A6YB 2J1KA 4MNGB 4OGZA 5EC2B 2F54B 4NAMA 4P4KD 1VADB 3QJQB 4N2MA 4AQ1C 1HI6B 1HQ4B 3VD0A 2GC7C 4PRDB 4N2IA 2OYKA 4RRPG 1BFOA 1JCVA 1I8KA 1QX1A 2ALWA 1E0OB 2G2RA 3D52A 3EH4B 4Y4FA 5D7JC 2X6MA 5DFVC 4K71B 1EHXA 5CZXD 3MFFA 3QG7L 1CF1A 4LKXA 3HNVH 5IQNA 2LU4A 2XWJB 3CSPA 3OG6B 3ROOB 1MW2A 4JO3H 5AKSA 3WY1A 4HWEL 1R24B 4HS3A 1SOSA 3QHZL 2VKXA 4N2OA 4Y1AA 3RUGA 4G42A 4JDZB 2G75A 1T5WA 4O2EB 5EUKB 2Q3ZA 4XAKD 4PJCF 5BOJA 5I30L 4PRPD 4JFFE 5CJOH 3NCBB 1V3LA 3TEWA 1S9XA 1A6PA 2HVJA 5H2BA 3RTQC 3CH1A 1JF5A 4PJDF 4IDJL 4PJHB 5B8CC 2Y2WA 2YSTA 1TCMA 2D7TL 2X4RB 4UM8A 2ZSVB 3TT3H 5GGSY 5A2JH 1J8HB 3H9SE 3IMWA 3FQNA 4B3VA 5DI8A 4OZIA 4XCYA 3T5WA 1YYLL 5AW2B 1CE1H 1MPAH 3FUDA 4DOHE 4PGDB 3CPLA 1DR9A 3L3OA 2ED9A 3HCVB 3TN0B 2CLVA 2VQ1B 3NSDA 4PRIE 3ZHFA 3EGXB 2V9UA 1IGMH 5DVNA 3WS3B 2D7OA 5HI3C 3UBHA 1RI8A 2EJ1A 2H41A 4J8RB 5KSVB 2VLJE 5L2KA 2A6DA 4EUPA 2LOEA 2FATH 3CQPA 3QWRD 2O6DA 2OMXB 4JJ5B 4TVPL 1UVQA 4OJYA 1LHZA 1WVZA 4XNMB 4Y2DB 4GXVL 4DCQA 1T66D 3UTSE 5T1JA 1ID5I 2VDOB 4QO1B 4R90L 4BGDA 2OL3L 3NEEA 1USQA 1AXSA 2ZX9A 1NFDE 1L6PA 3T2OA 1C8QA 4M6ML 2Z1KA 3EGSB 4XH2A 4UIKH 3NCYS 5TPWH 1E2VA 3OR7B 4DHLA 3KNBA 3EH5B 1HSAA 4LNVA 5FOJA 1XVSA 1ZRUA 2P8PB 5A7BA 2VM3A 2NT0A 2PWFA 2VKWA 4FFVD 1LO0H 1HINH 1EUTA 3GWJA 1N9PA 3QUYA 3D48R 3VWJA 4F7PB 5AVXB 3TASA 2Z8RA 1IAIH 4OLVH 3JWOH 4RA0C 1QBAA 4Z7NF 2C9PA 1MXGA 2ICWJ 1MCJA 2DIAA 2NYYD 2W9LA 4HEME 3T0DA 2IDUA 5SWQA 1GW0A 3QDHA 4P5TA 5EBLB 2KBGA 3W2DH 3CDYA 3H9SB 4JCLA 4UIMA 3CVHL 3ZQXA 1NSNH 4WJ5A 4WKZB 5FUOH 5E56A 3H7LA 3N43F 5J1AA 4I2XA 4TL4A 4HS8H 1AHWA 3ZYIA 3AC0A 4CN6A 4FKEA 4R5VA 4PRIB 4WU7A 3ARBB 3UJIL 1FHNA 2RD0A 2C7UA 3VRIA 1A4JA 4NO0D 1IM9A 5EIQA 5FOBA 2VLJB 4HGWA 5DWPA 4RZCB 4HIHA 4M93B 4EI5A 3BCFA 4XB7A 2ZKXA 3FT9A 3LKQA 1D5ZB 3KGSA 5JOFA 3DOSB 3SJVB 2FIKA 3O6MH 3IDIB 2WWKO 2X2YA 4KJYA 4F80A 3RVUC 3OM3B 4R0LB 4RFEB 3UTSB 2IAMC 2X12A 5TF0A 5IMLA 4HHWA 2G9KA 4U1HB 1UT2A 5I0XA 1JHLL 5I24A 4MJ2A 3MRIA 5IGXL 1F4YH 1NFDB 2BP0A 5EIIB 2F1BA 3BH9B 4KROD 1J5CA 4ZNEE 5LQBL 5DUBB 3B2UD 4QI3A 5E2VL 5F88A 1RIVH 1RHHB 1EHAA 4QRRE 4NFCA 1FG2B 2YLHA 1L9NA 2VRAA 5EWIH 2DRUA 1KTDB 4OGXL 2AXWA 3O2WL 1H9VA 5KYYA 3BFQG 1MNUH 2LAAA 2OX5A 2DWEA 2ZX6A 4AVIA 3TBVA 5M94B 4XXDA 4ISVA 5AOMA 3WFCH 3TO4C 3VUAA 3MRPA 3Q48A 1CDIA 3W11D 3HMXL 4UOJA 5E99H 3L3HA 3QISA 3AACA 3H2WA 4XP6L 5FHAL 2ZOWA 2YPLB 4PCSA 4WGKA 5D5MF 4B9FA 2WUCL 4UOZA 4L3EE 3P40A 4Y5YA 4JPIB 2MWCA 5C0BE 4K3JH 6TAAA 5I5MA 3UIYA 3JWNG 3MJ9A 1WWBX 1XH2A 1GZPA 2J88L 2OA9A 3EJYC 3EHBD 3IWVA 4UT6L 2MCAA 1CFTB 4NWTH 1JN6B 1Z3RA 2GFBA 4WGWB 3WY4A 5LNDA 1R0AH 2DH2A 2IFGA 2K45A 3VMPA 1XF2A 2ENYA 4FP8H 5CZVH 4O2CA 4EN3B 5K59E 1KPUA 5ES4B 5TQ0L 1DQKA 2FX9L 4Q52A 4F7CA 1BIIA 4Q58C 3VWKD 5FM5O 4BFRA 2WLKA 1NCCH 3G08B 1OCCB 5H37G 4I77H 1QHPA 1UD3A 4L23A 3WFBH 5DT1L 5HVGB 4P3CL 5FO9B 1KNOA 3BCDA 2J1WA 5F70A 4ALAH 2Q7YA 1HHIA 3IMVA 1A5FL 4XMPH 4TUOA 3WE6A 3QNFA 1AVAA 1A7RL 5HHXH 2NNCA 1LEIB 2J6EL 4AENB 5JIDA 1B0WA 5DJ8A 3VFMB 3T6QC 4IBUA 2NY4C 3F7PC 3N1FC 3NJGA 1BM3H 2DN7A 2R4RL 3NJFA 4QRRB 3RTLA 4ICXA 2CXGA 3A4AA 3RL2B 3HMWH 3U9UB 1PYWB 2IWFA 4BZ1H 5DWUH 3SBQA 1S7WA 4PW4A 4APQD 2NXYC 1Z32X 3FMGH 5ESVA 3STLA 4DN3L 3FN0H 4U0RC 2AXGA 4KKAC 4BH7A 4N5ED 3BGMB 1CTOA 2NDFA 4WHYG 4DP1X 3O2DA 4V2BA 4ZFZA 3NTCL 4LP8A 3CSYB 3PXHA 1G6RH 4JM2A 5J0BA 3MV8A 4KTDL 2WCSA 3TONA 2CO7B 5JUEH 4XT1C 4FXLA 4L3EB 4GO6B 4MNQD 2C9AA 3WMQA 3AG3B 2FSEA 4XMZA 2XJKA 1WBXB 1AGFA 3H42H 4PHXA 3QNYB 3UTTD 2Z35B 2N01B 1N7MH 3I84A 2BY1A 3QORA 4ZTOH 4XAKE 2V17L 2PTTA 4PRPE 1JRHL 3OX8A 2WBKA 2FJFA 4IBTA 3BGAA 1KACB 4NQEA 2ITCA 1F3DJ 5E4IA 2CGRH 1Y6NR 3BJ91 2BHZA 3MCLH 4PJ8C 3I85A 1DVFD 1B4JL 2NY1D 1EERB 1T4WA 2ATKB 4UV4L 3EDEA 4GW4A 4JPKL 5T5FL 3AMLA 3HN3A 3IJ9A 1MW0A 3GB7A 2MPAH 4YXHL 1EBPA 3MRLB 4IKNA 4QRPA 5SWSD 2YBGA 3Q2CA 5CCJA 1I75A 2GQHA 4P4RB 4D3CH 3VG9B 2Z91B 1T2QL 4HHAA 1BJ1H 4D0CA 5HHQB 5JIIA 4ZTEA 2FEDD 3DSNA 1SYVA 3V95A 3E2HB 4LCUA 4XWOC 3D51A 4NN6B 2YGQA 3SGKA 1C08A 5HVHB 1D5MA 5A2FA 4LOUC 1MEXL 4IKLA 3K2IA 4BSWA 5KSAB 2EE9A 3BDBA 4FG6D 4S1RL 3C08H 1E4HA 3PNRB 4FXTA 4S0HA 1AO7B 1Q0EA 3QG6A 5C8JA 2VW6A 2JI1A 1XF5B 2WO3B 4P3WA 4GUPA 3SKOA 4KRMB 2EICA 3B8YA 4BM7A 5BVPL 3DVNB 4H44C 4NNPH 3MNWB 1SJHB 2QPEB 3L95A 4LESA 2X6AA 3CDGB 1YEGH 4UT9A 3QT2A 3RQ3A 3RWJB 1INQB 2QQNL 5T1LA 2N0MA 4JKKA 4KO6A 4NAQA 1AGDA 4B0MB 1XB8A 4YPGA 4PCKA 3V4PB 1EHLH 1QFWL 4RX4D 1NWOA 3MJ8B 1SEQL 5KN5B 2KKQA 5EIIG 4I8DA 1JTTA 1Q0XL 1A6WH 4PY7A 4PRPB 2Z31A 2W60A 3T4YA 2JELH 3FH5A 2ROYA 3UAJD 1QZ1A 1R33A 1Y0LA 4KVPA 5D7KD 3GMNB 3U46A 5D96B 2ORBL 2WXGA 2XQYK 2EIJB 2NSXA 5J6GB 4GEJA 4HFUH 3QDMD 4OZ4B 1E7VA 3I6KA 3Q44A 3MRGB 4GG6A 4FN0A 4NNXA 1UTDA 1J18A 3I75B 2XZAH 4EZKA 2YPVA 4GIAA 3BT0A 2XLLA 1F00I 1FI8C 2E7CA 3V0IA 1T0MB 5LVEA 3LNIA 1U3NA 2H0FA 1A3ZA 1M71A 4RISL 4FQ1L 5DVKA 1A6AB 3Q2VA 3NACH 4CC4C 2IMMA 2HXAA 3VFTA 2ZCKH 2APFA 1MJ7L 2QGDA 2H2PD 2F5BH 1D5BB 1O7DC 1RZFL 1N4XL 3IETA 3APDA 1QTSA 4NN7C 4RMQA 2G9HA 3SDAA 5D7IF 2C9QA 3GMQB 1Q72L 1G7HA 4KK5C 4NNYA 3GZQA 2CK0H 3EH2A 3M88A 3VM5A 3RNKB 3LN4A 4EIGB 3AADB 2E47A 4ODUB 5KS9F 2AVFA 3IDNB 2EINB 2R29H 5PCYA 1G43A 1JFHA 3DV6A 3T2PA 4G6FD 1CICA 4NIKB 5HDQH 2KS0A 1N5YL 5E8DH 3G04A 3QPQD 1VENA 3U6RA 3UROR 1CLOL 5IG7B 4F20A 3LZPA 1KENL 2QV4A 4AM0A 3FTZA 5HY9A 4OGYL 2GUOB 2B9BA 4RRPA 5AVQB 5F0MB 3T6VA 1JZDC 1QBBA 2XU9A 3CU7A 2ZG1A 2H3NA 4OF7A 2HVKA 4JFYB 3T1FA 3TBTB 1PKQB 2CCVA 3TH3T 1C16A 2NY7H 2QDVA 2HT2C 3MRDB 2D7NA 3VFSB 4AJWA 4D8PA 3EKCA 2XWTB 1ZCRA 4PGZA 5HYEA 3LH2H 1IGIH 1KXHA 1MLBA 2O5YH 1JAEA 3HBQA 2Y7NA 4N26A 3U4EA 2Q5BA 4LRNH 3T0EC 4RWYL 4CNIB 3QJUB 2MNWA 5GZOD 4NO0B 5FA4B 4UQ9A 3NCMA 1BX2B 1RK1A 3P73B 3N85H 3HN8A 4X5XB 1K8DA 1WWAX 4OI9A 4FYQA 4X6CF 5CSBA 4HUUB 4FFZH 4XVTH 5I9QC 1AFVH 1EJOL 3FQUB 1ASPA 3AMKA 2IAAC 1LE5B 2DYPD 4BZ2A 2A1WH 1OW0C 4KK8D 1BZDA 5HHVL 3KG5A 4JG0H 1SBSL 5KVDL 1CF8H 3WTTA 4OQTL 5IQ9A 2Z93B 4LKCA 4HIPA 4GRWF 1U3JA 4UQ3A 3SKMB 4R8WH 4N0UE 5A7EA 5J89A 2PXYB 3RVTD 1PQZB 3IF1A 2DF3A 1TUPA 1ESOA 4OV5A 4M5SA 4PJEB 2VITB 2I32A 3FO0H 1WCBA 3GLEA 4HAKA 3VFRA 3HRZA 1NAML 4KO5A 3UGXA 5F96H 3VSUA 3NIFB 4HQQL 4DP9X 3IWUA 3LZLA 4EI6A 1ZHKA 4HJGA 4NM4H 4KMQA 5F1IA 3C87A 3S3PA 1U4FA 1T1XA 4GT7A 1S7VB 3FUNA 4KH9A 4IM8A 4OLZL 1FNSH 1YUHA 2X2IA 1AAJA 2HRHA 2DLEA 2J8UE 5IFJB 1PSKH 3SE3C 2VO5A 3WFHB 5L4IA 3BH4A 3KEDA 5TDPA 5IJKA 1QUPA 4I1NB 4Q14A 4P2AA 1XD1A 5CJQL 4MNQE 3L2MA 3B1TA 5ITBL 1S6NA 2YKLL 3EHBB 4PUBH 4KY1H 4N85A 3UTTE 4ODHL 4Y4FC 4MJ5A 1MFDL 1HVXA 2DQJL 4YHLL 4L1HA 5I17B 3DRQB 1TVBA 4FXKA 4LDCA 2OMTB 4PQXA 4TM9A 4XBEH 5B7EA 1BBJA 2F7OA 3TX4A 1R47A 1AZRA 2PR4L 2KHAA 1ADQA 4GQPH 4LLQA 4ZX5A 5KBPA 1ZV9A 3HEIB 1M42A 3ZBMA 1DO6A 4PS7A 5C0RL 4KKRA 3ZK0A 1Z7JA 43C9B 5SWSE 3G5ZA 5TK4A 2JB6B 3MLTA 4ZUUB 4F9LA 4P9HH 4XI5D 5CHNB 4YDIH 2ZUTA 3V2AR 2WXOA 1H8LA 3ZMNA 5ISZD 2WXKA 1ZS8A 4MDIA 3RI5F 4I13B 3KMDA 1QABA 3UJJH 4YDJA 5INDB 1KXQE 4KTGA 1FVCB 2DYRB 1S7SB 4Q2ZA 4NFDA 5EB9A 2HX8A 3ZO9A 2NNXA 3CNKA 1LEGB 3L3OC 4KTYA 4APQB 3X3GL 1RXLA 4XVJH 1CQYA 2Q7AA 3CVCA 1E2ZA 2KMWA 3OKEB 3WEBA 4J6RL 5MENB 3QZWB 3PV7A 4NFBA 3CVIL 4E42B 4OF5A 4X5WA 2WMPB 4RGNC 5EEUA 3P0VL 3A3YB 1XDTT 1HOCB 2EE0A 4J5VA 2J8UB 1NA8A 3AQXA 3R0MA 5F9AC 5G5DA 3G5VB 1W15A 3T8XB 5I18L 1NOAA 4XO9A 5C09B 3FQXB 1MFCL 1QI4A 4X6EA 3EYFB 2MRYA 4Y9CA 4K3EH 2D3NA 3BH8A 1QPPA 1FL3A 2YD3A 2ZWLT 4H8UA 3UTTB 1J0KA 5BW7A 4BFNA 5F7FA 3MACH 5I0ZA 1BVNP 4I85A 4KXBA 4ILDA 4B5ZA 5D7KE 3F7VA 3HG3A 4LZKA 4I5BA 1MXDA 2D7QA 4HJ0C 1C8PA 5DQ9B 3DK0A 3QRLA 4BHUA 4A6YA 1DQJB 4MNGA 3QUYC 3ZDXE 3VWJC 1JZ6A 1QWUA 3ESOA 2NY1B 4AJ0A 5EC2A 1IFHH 2F54A 2FK9A 1VADA 3ZHNA 1HI6A 4MZ2A 5GRWA 1HQ4A 3L81A 4LEBA 5CSGA 4PRDA 5EZIH 1RZGB 2XPGB 4I3SH