4MJJA

Crystal structure of the c2a domain of doc2a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
128
structure length
116
Chain Sequence
b'ALGTLEFDLLYDRASCTLHCSILRAKGLKPDPYVKLHLLPGACKANKLKTKTQRNTLNPVWNEDLTYSGITDDDITHKVLRIAVCDEDEFIGEIRVPLRRLKPSQKKHFNICLERQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Double C2-like domain-containing protein alpha
publication title Crystal structure of the C2A domain of DOC2A
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 28
structure length 116
sequence length 128
ec nomenclature
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4mjjA00
3ZW3A 2WXNA 4L2YA 4TV3A 4AOFA 3ML9A 3APDA 1E7VA 4G11A 4WEEA 1DJZA 4ANWA 1RH8A 2WXKA 5CCJA 3CSFA 4WAFA 2K3HA 3ZIMA 5CCGE 3QK0A 3L17A 3DBSA 3F04A 2WXGA 3M7FB 3TL5A 4HVBA 4KITB 4URKA 2ENJA 3OAWA 3B7YA 3JZYA 2X38A 5JHBA 3QARA 4WWOA 3F01A 4WWPA 1DSYA 4FJZA 2A4ZA 3L16A 3R7RA 2CJSA 3L9BA 3ML8A 4FADA 1RLWA 2K45A 2K8MA 3CSTA 4F1SA 4KZCA 4FA6A 4LDCA 3PS6A 4ICWA 2K4AA 2WXRA 2NQ3A 4NP9A 3W57A 3APCA 1W15A 3IM1A 4QJ3B 1QATA 2DMGA 5G55A 3HHMA 4FULA 1DJWA 2Z0UA 4NPKA 3F00A 4F93B 2NSQA 3GPEA 4IHBA 2Q0ZX 1DQVA 2R83A 1V27A 4QAMB 3L08A 4PS7A 2CM6A 2QZQA 3QAQA 3RDJA 3TWYA 4HLEA 3PRZA 2CHXA 1E7UA 4OVUA 3T8MA 5H4ZA 4XZ4A 2BWQA 2V4LA 2NCEA 2CHWA 2DMHA 3MJWA 1WFMA 3F05A 1BCIA 5H4YA 2QZ5A 2CM5A 2KI6A 4GB9A 3P2BA 4PS8A 3L4CA 3R7QA 4ANVA 2B3RA 3NZUA 4WWNA 3RPBA 1TJMA 2WXHA 1E8YA 3FBKA 2WXOA 3W56A 4NPJA 2ISDA 3ENEA 1K5WA 1RSYA 4Y1SA 1E8ZA 2Y3AA 4ANXA 1HE8A 3S2AA 2WXLA 4XE0A 4L1LA 3PYCA 4QJ5B 1QASA 3N5AA 4OVVA 3SD5A 2N1TE 2JQZA 2Q3XA 2WXPA 4ANUA 3ZVVA 1DJGA 2YOAA 2WXMA 4LCVA 2FK9A 5EDSA 3FDWA 4LT7A 2D8KA 3PFQA 3DPDA 2WXQA 2CHDA 2LHAA 4ICXA 4QJ4B 4F92B 2ENQA 2UZPA 4FHKA 1DJIA 1W16A 3NSJA 4BGDA 4F91B 1TJXA 3IBEA 4FLHA 1BDYA 1UGKA 3NZSA 4L23A 4AJWA 1E8WA 3QJZA 3QR0A 1CJYA 4IQHA 2RD0A 4MJJA 3L54A 4EZKA 2WXIA 4GNKB 1DJHA 4TS6A 3QR1A 4PS3A 2WXJA 2EP6A 1DJXA 3KWTA 1E8XA 2WXFA 3TJPA 3HN8A 2FJUB 2ZKMX 1A25A 4FJYA 1WFJA 4FHJA 3LJ3A 3APFA 1GMIA 5T8IA 4EZJA 4J6IA 1UOVA 5CCHE 1BYNA 4DNLA 1DJYA 4JPSA 3PREA 4V11A 2ENPA 5G2NA 3KWUA 4XX5A 4DK5A 1E90A 2CJTA 4EZLA 3L13A 5JHAA 4TUUA 2CHZA 3OHMB 4KZ0A 3HIZA 1YRKA 4NS0A 4BFRA 5KJ7E 4Y1TA 2A5UA 2YRBA 1UOWA 4L1BA 4A55A
chains in the Genus database with same CATH superfamily
1QLRB 3PNWB 4E0RA 4R90H 5GJSL 1MCEA 4JO2L 5JW5B 1PX4A 2V3EA 1TETL 3IXTA 3PXLA 4JFOA 4KDTC 4ODVH 4PJHA 2EDRA 5ECGA 4BFIB 4FFVC 5EBLA 2DQUL 3ELQA 5J5EA 3TBTA 3UJJL 5FGSA 2W9LA 3NEXA 3LIUA 4A04A 2DWYA 3FTUA 4GKOA 1CDYA 2WNXA 4G3YH 1ADQL 1MHCA 5SX4I 3NSFA 1VFAB 2NNCA 3K2UH 3CLEH 1DTUA 3QZWB 3MR9A 4QHMB 2YLHA 3UBXI 2DV6A 2VN5A 3UX9B 5EBGA 3L7EA 3RLSA 1QEWA 4HH8A 3KBPA 4S1RH 4UM9A 1DQML 3N0AA 5T33H 4ZS7H 4LOUC 4GMTL 2BM3A 4JMXA 3MAWA 5F0LB 5JW4R 4PV1C 1E3XA 4JHZA 4JZNA 5E6IA 3REVA 3QEQD 1CL7H 4XN2A 4P3DB 3H6JA 3Q06A 4LLWB 1PLGL 1RPUA 3IGAA 4N6QA 4OVUA 1XGPB 3V52H 3QQ4B 3NIFE 1BZQK 4PR5A 1CD8A 4LNRB 2HH0L 4FZ8L 3QB7C 4PV8A 1KCSH 3HZMA 1FAIL 3DHJA 2OX5A 4WW2C 3L2LA 3T6WA 2HFGL 3DV4B 3RJDA 3C6EA 3GM8A 1RJYB 4L8BA 2P46B 2ZNWA 2H6OA 5FK9A 2N0KA 2VIRA 1IGIH 3NAAH 4C56B 4XOAA 2GBAA 3ET9F 1OW0A 5LXGL 2JQZA 4Q9QL 3TNNB 1MI5E 4WUUB 2FECL 2JKIS 1C9SA 2DWEA 3MV7A 1OSYA 2G2PA 5E5LA 3V4UL 4FA8A 1RUPL 2KERA 4F3FA 2UZPA 4FYRA 3UG5A 4OQTA 1NLDH 2XWTA 4OBRA 5D1QB 3LMJH 2PKDA 2WCSA 5DK3A 2H1XA 2QV2A 4ZTEA 4P23D 5IHWA 2XA8H 4EE2A 1J86A 1LXMA 3GJFH 2BRQA 1AXTL 3PUUA 1LO5B 1Q9KB 3FO0H 1I4FA 1CUOA 4CKVX 1PLBA 3O4OB 3P2DA 3SYCA 4DGIL 2J8OA 1BBDH 1GMIA 2X87A 5GGSA 1H15A 3EH4B 1DJYA 4R7DB 2Z9TA 3Q6FA 4HV8A 4ELKB 3INUH 2A6KB 4HXBH 4XXWC 4YHPA 1C08A 1P7HL 4JY4A 2RTTA 3OB0K 4LL9A 4XI5D 1GGCL 2VXSL 2Z7ZA 4ABUA 5T3XD 2WD0A 1GOHA 3UIYA 3QEUB 2VDRL 3IFPA 1ZAGA 3ETBF 3GMOB 3MRKB 4YGAB 5D72H 4LCWB 5AD0B 5ESVA 2CH8A 4GQ9H 3ULVF 1T83C 3OAUH 3RTQD 4GP5B 4Z0BH 3CSYB 3F04A 4JM2F 2Q8BH 3BGFB 4HIXH 4NSKA 5KVDH 5KAQF 3I9GH 1A6ZA 1I7ZB 1CC3A 3RG1C 1FO0B 3DETD 3ILPA 1G1OA 4I3RL 3MGTB 4TUJA 4XB7A 1CCZA 4PJ6A 3LNEA 1L9SA 4RETB 2EVJA 1A6WH 2B20A 4Q6YA 4CC4A 1XT5A 2NY2D 1EGJA 1KTLB 2EE0A 2ED6A 3F7PC 3Q2WA 4R3SB 3JWOH 2NZ9D 3SE3A 4RQQB 5D5MB 5I15L 1LE5A 5L2JA 2YPLE 5A1AA 4JZJB 3SE4C 1MWAA 1WCBA 3DX1A 3MBEB 1LO4L 1ADWA 5LCVA 2BCKB 5CHNB 4WJG3 1IL1B 1U41A 4HKXA 4FX5A 4ZQKA 1GOFA 2XZCL 3O6MH 4POUB 1BAFL 3GHPA 1CFSA 2ICWB 2JXMB 5AAMA 3RQ3A 3NN8A 4OCSL 5A2BA 5ACMA 2MOVA 3O9WB 5EWIH 2F53D 3DMMB 3GZPA 1D5RA 1PZSA 2E6JA 1T7VA 1V7NH 1RV6X 3BVVA 2YKKA 2B3RA 3OHXA 4QYAA 1SYVA 4D94A 3OKKA 4U6YB 1Y18A 1AHMA 1D9KC 4B0MB 3MXVH 1J05A 1JVKA 2WYTA 4OZ4A 3FYIB 4PAZA 3FU7B 3KXFE 3SO3C 1IEHA 5C2BH 3ZO9A 5SWSA 2P8PB 3PL6A 3P0GB 3EO9H 5KVDE 2W80C 3OKNA 2BVPB 1TYEB 2G9HA 5TFSL 2UWEA 3DOSB 1LDPL 2SEBA 5H94B 4GAFB 2DQIH 5C07D 3VXMB 3D0VA 1OB1B 3C09C 1DLFH 3MX0B 2MCPH 1CGSL 2YZ8A 4QDGA 4JHAL 3QJUB 5HD8D 3JWDH 2NYZA 4AYBA 2FL5B 3IBEA 4L23A 4ZYKA 2LAAA 2X6AA 4EO5A 3U7AA 1T03H 4OUOA 3SPJA 1T0PB 1I1RA 2B8OT 1RZKC 2YAQA 3K1KC 3Q0HA 1ROCA 1P2CA 2Z7WA 3FC8A 2ZKMX 1NEZB 3QDMB 1IARB 1A14H 2ILLA 3IAQA 5FHBL 3JVFC 3QZPA 4UYQA 4XBPB 4AKPA 1GTFA 5JHDA 2UZIL 2FQFA 1F13A 4WTWA 2WJ7A 3GHEL 2WW8A 3RWHA 4U05A 3TS8A 3MXWH 2EUVA 1BIHA 2ED9A 4GUQA 1G5AA 4BSJA 5DMIH 1GHFH 2CMRH 3LNGA 2OTUA 1GY2A 3KCWA 2A5UA 2IH1B 4XNUL 3TA4D 5ISZA 1X6LA 1D5ZA 2J56A 1NIEA 3HE6A 3L3DA 1IAOB 4I9WE 1OWRM 3DX8A 3LV3A 1XB6A 4G11A 5CMAA 4W93A 4MB5A 3QDJA 2VSMB 3VFSB 4EI5B 2Y5EA 5BV7B 5IROD 1KB5L 2EILB 4G80A 1ANUA 5EU5A 5A43C 2NY1C 1I8MA 4TPRH 5AZEL 2C3VA 3O8XD 4JRXA 2V3FA 3TBSA 2ZYIA 1MCFA 3FUNA 4AZUA 2J73A 2DM7A 3BXNB 4OJEH 3BSGA 4HAGA 2WUBL 3NJKA 1AE6H 1U3HD 2LLGA 4XC1L 2PYFA 1ZV5A 2P5WB 1PAZA 2JCCA 1OAUL 2K8MA 3VFRB 4Z7OE 1RZJH 1J0YA 2JVUA 3JSSA 4PTUA 4IRJB 3MYJB 5DD6B 4B60A 3VXSB 4YR6A 3FTVA 4KUCD 1ID2A 4U6XB 3D1MC 3ZMEA 4GQQA 3AG2B 2GY7B 3P9MB 4MA7L 3ZSTA 1V27A 4LIQH 3LRKA 2ZOKB 3EZ8A 2XIIA 1EAPA 1FAKT 1FE8L 1CDCA 6PCYA 5HY9B 4EEEA 2DPKA 4UT9L 3BOVA 4KAQL 2EDQA 3ARBB 2X6UA 2NW2B 4L4VD 4TTDD 5C0BE 2Z91A 3V7MA 3J27A 2VDQB 1A7OH 4Y9EA 2XUWA 2ZKYA 3GJFK 1CR9H 4ILDA 5FKPA 4DAGL 4S2SA 5DMYA 1G7QA 4X42A 2ESVA 4U6VH 1HHJB 3PWPB 2CBMA 3BIKA 4HIQA 4PJFB 3TEWA 1W80A 3MV8D 5I8KL 3VYNA 3FQNB 2LT9A 3MCYA 2GITB 3FQWB 2D3VA 9CGTA 2X2YA 5EDSA 1W6WA 3SDXB 5IFHH 1ZGLB 1CXHA 3I75B 2IG2L 2QKSA 4ZXBB 3W9DB 4HIEA 4EI6A 5IKCB 2PW1B 3IJYB 3VFNA 2VQ1B 4LAQH 1ZA3A 2ZXAA 4N3UA 4Y2DA 3NZHL 2J5LB 3TBVB 5GGTA 1A5FH 1MRFL 1OAKL 1WITA 5CUSH 4XNXL 2NXZD 4HS8H 4Z1PA 2XA3A 5JHLH 1ITCA 4EOWL 5KN5B 3FTWA 4MJ6B 4PG9B 1RULH 4LIQE 3RKDC 4WTXA 4MA8L 4UOW0 4DOHE 3MCKA 3PGDA 4H25B 5A16B 1LILA 4V11A 1N7MH 5D7KE 3R4DA 3FFCA 1RUAH 1JZGA 1F6LL 2EQDA 3N6YA 5I82A 4FNSA 4NOFA 3EJQA 3QUYC 3U4BH 3EOAA 4L8SA 3DGDA 4L2YA 3AREA 3VFUA 2ADJB 2BNUA 3VXRE 2ITEA 2AJXL 2WV3A 4IOIB 3SJVE 5BZDB 5LNGA 1W72B 2CGRH 3UG3A 4P5TA 2K3HA 2QSCH 3AJ7A 1W8NA 3IFOB 1HEZB 1Y1UA 3CCHA 1MJUL 5AVYB 1QI4A 4P3CH 3PXJA 4Y5VC 1CXIA 3NGBB 2QSTA 5HDBB 4ZFZB 4ZBJA 4AT6B 1DVFA 1HKLH 4L3ED 5E00A 2ZOOA 1A3LL 5E1HB 3VRJA 1DQKA 3BAJA 4OZIE 3MKGA 1AS7A 4H5SB 5E4EB 1XGYH 3R4RA 1K5NB 2R0ZL 2X9YA 4X99B 5DJZB 1GL4B 2XV3A 4D0DA 5T1MA 2JKTM 4OZHB 1WJ3A 4UDTA 3CDGB 3LD8B 3MRRB 3QUMA 4L3CA 4LCUA 4UYPA 5DEZA 3VO0A 4CU8A 3UIZA 5K93A 1QPXA 1RZFH 3U1QA 3GBNL 4FLQA 4FI6A 3R06B 5BOPA 1L5GA 4P4KC 5CZXC 4M3HA 4N90E 5CN3A 1I53A 4L0YA 1U8MA 3B3IA 3C08H 1IEAA 5BOZG 4UZSA 4X6BB 5CJXA 1VACA 1XTMA 4HLZG 2KH2B 3OXRA 3SPIA 4JQVA 1ACYL 1NUDA 3ZZQA 4W4OC 2WNGA 1I8KA 4RIRA 4BFFA 4B7IA 4R26H 3WBDA 1IM3B 3EBGA 5T1DL 1KGXA 5CWSB 4N2IA 1GZPA 5DSCB 1VHPA 1P6WA 4AENB 4MBRA 2N01B 4N2KA 3H6AA 2GUOA 3HZVA 4LEEA 4P5SA 4Z7NF 1C12A 5IB4B 1YY9C 1AH1A 5FGBA 4N0FB 4QIRA 1QKZL 3AT9A 1VB9A 4S11A 2VDKH 2BVUA 3IU3A 4KO6A 4P46D 1E6OH 1LP9F 4PJ7F 4X7TA 3DX7A 1H9VA 1XGZA 3UERA 1DBJL 2YD0A 3D06A 3BT2L 2B9BA 2H9GB 1RZ8B 3JZ7A 3TA3C 4M6NH 1NCNA 3ARGA 5E1AB 5C7XH 3QCTL 2XWBA 5JR1L 3KJ6L 3OB8A 3V5DB 3FRPG 2Z93B 2OZ4L 3IRCA 1WC7B 2WYIA 3HN3A 1JXKA 4MJ2A 4AY0A 3OL2A 1I31A 2HN7A 1IZJA 3L3JB 3RY5A 5E2JA 3WY2A 4ES9A 1NANI 4JKNA 1IGYA 3OX8B 4UAHA 1UEYA 3U0TA 3BLKA 2QDVA 1WZ1L 4X4ME 1KPVA 2F18A 4BBWA 2W59A 3MTRA 3MLPA 2BVYA 4P5KB 2DL2A 1WA2X 3B9KC 3CSFA 4CUCA 1NBYA 5D2NB 3KPMA 3OSKA 1FNSL 3B2PA 4BUGA 5BVPL 5CGTA 2JJUA 4U3CA 1WICA 5DD3L 1MIML 4BWUA 1C5CL 1J5IA 3KPTA 3LZLA 4NQQA 1UA6H 4ZUVA 3F01A 1FN4A 2LAGB 3T3PB 1XMWA 4RAHA 3SGDI 3GTNA 4XXCC 3GSNH 4EMZA 1P9MC 4LSPH 1JXJA 1P1ZB 5C6TL 4TUOA 3FU8A 2W0FA 1TCMA 5IQMA 1R3HA 4OLXH 3VFMB 2D03H 4NM4L 3VGHA 2AJUL 1RUQH 1UYWH 3PV6B 5I1KL 4MXWH 1Z5LA 3QORB 2OMUA 1NPUA 3P77B 3BW9A 2Q7YA 1ZJBA 5DA0B 1FC2D 3G5ZB 4NFBA 4HLEA 1S8DA 4HWUA 1IT9H 1Q94B 2DWDB 2R69H 4MD5A 4TN9A 5E8EA 1SPDA 3WJLA 1YQVL 4Q2ZB 2FUQA 1PNDA 1R0AL 1HSBB 1NC2D 3JWOC 3HW7A 4Z8FH 4FFVD 4AEIH 1PFOA 1IC0A 3ZRSA 4DP6X 4KH2A 2BFGA 1E4XH 4HIIB 4Y1AA 5JPMB 3SPHA 5K59E 3BN3B 3KH4A 4LLYB 1F4YH 4PY8J 3RGVB 1A1OA 3TCTA 4FC3E 5BXFA 4H1LG 4NC1C 3D5OF 4WKZB 1JXFA 4YL9A 5E6SB 2Y36L 2YGVA 3W0WA 4P05A 1JTOA 1UADC 4JHBA 3MUGB 2CR0A 1REIA 1HI6A 4RSVA 4YSCA 1AHWA 3LKPA 5IJKA 5JNYA 2AJVH 1CU4L 2SODB 4LOUD 2VDLH 5IJVA 1NCBL 2FWOA 5EFIB 3NFSL 4AJ0A 4H8QA 4DGYL 1CJYA 1BVKB 3SQOL 1ZSHA 4YWGH 4B97A 3Q5TA 1S7UA 3MNWB 3RVXD 5DHYA 1ERNA 5DJDB 3NG5A 3VRLF 5KS9A 2W9EL 3AC0A 5INCA 1XR8A 2Y5TB 4I8DA 2VDPH 4AZ8A 3VI4E 2ZQKA 4HAFA 2QVFB 2Y1VA 3H42H 4J3SA 3L8QA 1NMBL 3E8VA 4LP5A 2BNQE 4PJAB 3MLUL 2QV4A 3DXAB 1SN0A 5BRZA 1JUFB 3JWDC 3VFOA 3V4PH 4Z6AT 1UXWA 4NM8L 1MDTA 4Y1TA 4NQDA 1LEKB 2GSMB 1JZDC 1N2RB 4JKLA 2E46A 4JRYA 2VXQH 4PRDB 3UZVB 5I2IB 3BCFA 5BMFH 3FNKA 1VFOA 4U7KA 4TLKA 1J10A 2R2HA 1A6UH 1QLFB 3RPIB 2PO6C 3GC3A 5HYEA 1A3RH 2VN3A 5GGRA 2W9DL 3MDJA 1ZS2A 4V1DB 4M7LL 5EZIL 4Y7MA 4LQFH 1TZIA 5E7BA 5FOJA 4F7PB 1Z9SA 3FCSB 3SCMC 3QRGL 3FMGL 3MV11 5CEZH 3BPCA 1F58H 3STBA 3GHBL 1BXVA 2FYYB 5E99H 3K71B 9PCYA 1UVQA 4NP9A 1WAAA 2AK1H 3W39A 1XB3A 2IPTH 5F8QC 1P5UC 4M9PA 4WV1C 4BCYA 2VQTA 3KS0J 1R3KB 2PR4H 3RA7H 2CDEB 1MVUB 1P7KA 3QUXC 2DJ4A 2F7IA 3QA3A 5I30L 3FCGA 1A9EA 1NGQL 2NYKA 2X9XA 2E9GA 4LL1A 2CHXA 4WWKB 5E6ZA 3IYLW 4M6ML 1KNOA 1LWHA 2CK0L 2YGNA 3IDIB 2O4EA 2A6JA 5ITBH 3B2XA 3HI5H 2R7EA 4YLQT 2ZUVA 3HC4H 5DWUL 3RL2B 3VUAA 2FO1A 2J71A 4X7SH 4JFEA 5IB1B 3I2CL 3RIAK 2WIMA 1QG3A 3H7BB 1EPFA 5JYMA 5L0QC 4PRAA 1ZXQA 4B9YA 4G8GA 4ZFFA 4W6YB 1U92B 4Z7UE 2ED8A 4HSAC 3S4SG 2DMKA 4XNDA 5EMYA 1T1ZA 2WQAA 2ICWJ 3HUJA 3D2UB 3JV4A 4UM8B 3MLWL 3T4YA 5CEZE 4OI9A 5F7YC 5KYYA 1CFBA 3QQ9C 3ES6A 3GSUA 1R24A 3ARFB 4KKLC 1ORQB 2DRUA 1NEPA 2IV9A 3CFKB 3U46B 3BP4B 2VLLB 2VSCA 2HPOA 1FVEB 4JO3H 5EZOL 4TS6A 5IT2L 1QX1A 1G9ML 4QRRB 2WXJA 4Y16B 3CWGA 3T0EA 4CGUB 5GZOC 1JZEA 4IBZA 3L4XA 3VXPB 1Z6JT 2BVOA 5LG1A 1JHKL 2WQ8A 2YBGA 4PRPA 4Y5XA 3QQ3B 5E56A 1KV3A 4Z7WA 1I3VA 1X5YA 1TYRA 1L0QA 2XOTA 3HNTH 3P30H 4YK4C 2GHZA 2R39A 3TNMA 3VRIB 3SQBA 4UNTA 3RI5K 2J8UF 3KGUA 5LHDA 2DLFL 1SJEB 3S96A 1XF2B 4LSUH 3CHOA 1D5BB 3CH1A 3RUGA 5EF3A 5KBDA 3HFML 1S7XA 4NAQA 3ZQWA 4U3SA 2WIIA 4RMBA 3TFBA 1KJ2A 3HE7A 2QT6A 2VZTA 1UENA 3E6HA 4MXQC 5DQ9A 5AWNL 4TQEL 1UB6B 1THCA 4KJQD 1SN2A 2QTEA 4Z7IA 5CAYB 3BVDB 4F7KA 4ENEC 2YKLH 4ONGH 2ZPKH 4WWOA 2XCMC 3RRQA 1A2YB 3FT1A 4KTDH 1CDIA 3UG4A 4BCZA 2XZAL 4ETQA 2CCWA 4JDVB 1Z3GL 4OCWL 3UTPD 2P8LB 5MENA 1WZMA 4W9DC 3AXLB 3HBQA 3QHZH 1B9KA 4F7CB 4HUVA 1UH3A 2NX5A 5G5DB 2IOOA 2X7LB 1WWCA 1G7MB 4WNSA 4JM0A 4YHML 1R5WA 1TO5A 3PJLA 1UFGA 1PF3A 1FV1B 3GM0A 5CINH 4LCYA 4BRVA 2Z31B 2OMBA 2XWRA 4G43A 1A64A 1EK3A 1AD0A 3HMXH 3NDZE 2V4LA 2M1KA 2H6UA 1V55B 3R18A 5H4YA 4S0TD 2KZBA 1SJVA 3A3YB 3HS0C 4MJIB 3S5ZA 5DHMC 4D0CA 3FAXA 3ROOB 4C83B 1DUZA 1M7DA 1NFDB 1HXYB 1TKWB 3RL1A 4QOKA 3RVVC 2NY1D 5ESAB 2ENYA 1U8OB 4G2AA 4GG6A 3K72A 2YPVL 1OAQL 4N0UB 5DTFB 2P5EB 3MJ8B 4TULL 3VG0H 4IOSA 5A2FA 1CIUA 5TTRA 1N3NA 4GYBA 3ZQXA 3OXSB 1FL5A 2X42A 1NGZA 2OJEB 5L7XL 5D70L 1OSEA 2IFGA 3BQUD 3K3QA 5F7BA 4U7SA 1ML0A 2BRRL 4BH8B 1VCBC 2CGZA 2HTKC 1GKOA 4H26B 1QD0A 5EBMA 5KVGL 3B9AA 5EOTA 4F8QA 3WLBA 5DK0A 2MQCA 3O6KH 4JFDA 3RWEA 1HN1A 2B2XL 1TNMA 4X8CA 2BW5A 4AQAB 2BC4B 4JFYB 5AZUA 3RJQB 1JV5A 1Q90A 3KWWA 4JY5L 4AVKA 5I75B 4FTVD 4DQAA 2VMFA 4LU5H 4PCSA 1IILE 2VDMB 4P2QE 3SDDB 5HVHC 5JXEA 4IJ3B 3C6LC 3P0YL 4M6OL 2DQFA 1UJ3A 3PP4H 4YBQD 3L7FA 4N2OA 1U8LA 4JS7A 5F7AA 3UJIH 1ZIBA 3IDJA 4B41A 5E08L 3O6LH 1JD9A 5CFHA 4G42B 4A63A 3G5XA 1BZDA 3HRZA 1CWVA 1PDKB 2HKHH 5IIEA 4UTBL 2BP0B 3EDDA 3C5ZA 5DFTA 5KANG 4I1PA 4JK0D 4HJTA 4XCYB 2G75B 4JFFA 5B1JA 1XF5B 4D9RD 3JV6B 1RCYA 3RVUC 3M7FB 2IGTA 3D39E 2AANA 4J3XA 3UEZA 1AOZA 2CHNA 3QDHA 1DFBH 4WI0B 3VACA 5ID0B 3LKQA 2ATPA 4BHUI 2Q2LA 1A4BA 1NMAH 3MRQB 2EYTB 4RAVA 3IF1B 2X4SB 4HOXA 1JZFA 1DZ0A 5E8PB 3WIFA 5FM5O 3MRHA 1L9PA 4PJXF 3U25A 3RKDD 4RA3A 3VJ6B 5I8CB 1OPGH 3G04B 3U7WH 3MMEA 5BZWB 3OLIA 2V5RA 3TEYA 5E0FA 3QO0A 3BSZL 5LGHH 5E5UB 3CFDA 2IGLA 1JGEA 2MSPA 1A65A 3QEQB 3QWRA 4XX1G 4ZX3A 5IQ9B 5JZ7C 3EUUA 3AB0B 5KOVC 5FW6A 3MV9B 4RWHA 2YXMA 4XPTL 1Z0NA 3PQYA 3U79A 2W38A 4UIMA 5GQBA 1PPIA 2IVFC 1FH5L 2BWDA 4JPIA 2AJYH 4NENB 3GK8H 4I2XA 4CNIB 4N8CL 5I1LB 4M61B 4HDIB 5HHNB 3ARDA 4G70B 2OMWA 1ZDQA 3WS3A 5JLZB 2Q3XA 5I6XB 4MNHA 1TFPA 3BEVB 4L4TB 3QPQC 4UT6A 4P8QA 4R4FH 4MD0A 4F7MA 2V6HA 4O02B 4J3WA 2C1PA 4YE4H 5KVMC 1Q1JL 4NN7C 1G0XA 3KW8A 1D5IH 1WFIA 1KPUB 2ENQA 1ND0A 3T8XA 4HWEL 3KR3H 4MMXC 4O9HH 4ZAKA 4WW1A 2A73A 2Y4SA 1BZ9A 4XMTA 4I0PB 4FQIH 1JCKA 1OCZB 4P57A 1HL8A 1PX8A 1MF2H 1Q0EA 3HG1A 3KCPB 4DW2H 4NQSA 4P4KD 5CZXD 1DLHA 5DZAA 4AM0B 5I18L 5T1KD 4PJCB 4U1JB 2GI7A 2HXAA 4BFEA 5JOFB 2VJXA 4FXKC 4V2BA 4BELD 2D73A 3QJHA 3ZRCC 4X6FB 1C5DB 1IKFL 3VQ1C 1A21A 1I1YB 4PJ5A 5B3JE 5DO8A 3VXNA 1Z9OA 1H6TA 2ORBH 1WVZA 2I26N 1WV7T 4G9FD 5CP7B 3D3VE 3QIUA 4IHOB 1CMOA 2O6FA 3MCG1 4MNQE 2YS4A 1A7NL 4TNVK 3UH8A 4WAFA 1YY9D 4WGWB 5IMOB 4ODTL 4LOFA 3C5SA 3CZGA 2FJGB 3TVMA 1YEIH 2EYSA 2WLHA 2PWGA 2H8PB 4AMKL 4F9PA 2ZWKA 1SHSA 3CXDH 1CYWA 1H6EA 2QVKA 5ILTH 1T6WA 5JPNC 3U9WA 5EU4A 4KV5E 1TZGL 2ZWZA 4JFPA 2A83B 3JYBA 3Q8EA 2XKNB 2I9TA 1T1WB 4KZEL 4URTB 1WISA 1ZHNB 1RVFL 3OKLA 4JY6B 5DVMA 3TYGL 1E3FA 1FSKB 3QCUL 2FB4H 3M1BA 3VXOA 1P4IH 1I8UA 3BWAA 2BIMA 3ZGIA 2R4SL 1U8NA 2X53A 1EHNA 3MRNA 3PWVB 1PG7H 1BVNP 4MKTA 3K7UA 2ZUQC 4CADB 2F53B 2CCVA 1FORL 5CD5D 3LKRA 1YEJH 1EFXD 1YEFL 2Y3AA 2X05A 4RRPG 3AVEA 3Q1SL 4GLRI 2BZDA 5IW3A 2CRIA 4M5YH 3DI2B 3DSNB 4ANUA 2B3IA 3US0A 4N2EA 3GUTA 4NRXB 2FNWA 3SGJC 5HHME 5GJTL 4F2FA 3BE1L 2CO3A 3F83A 4OLEA 4PJEE 3IVKB 3A24A 5EIIG 3T77B 5C07B 4Y19D 3JXAA 3T6VA 5HVWA 4JPVL 5FA4A 4ZW8A 2AI0H 3STLA 4XVTH 4NKDA 3RHWF 2IXQA 1QBLH 2A74C 2ITCB 4JFQB 2X2JA 4N0YH 4PJHE 2BSRB 4K7PH 5INDB 4LDEB 5F1KC 2C9SA 4WU7B 2AK4B 4FQCL 5TK4A 1ZLWH 1LO2L 4QEGA 2HKAA 3P4MB 1JHTB 2H3NB 4JPWL 4DN4L 4EZJA 4ZMOA 5JW3L 2L8AA 4KY2A 4FA7B 1KWGA 1Z9LA 4D3CH 4XNAA 1B9ZA 2FECI 1HZKA 3HNSH 4UQIM 3DGGB 5DZJA 2IWKA 3EBAA 2Z7YA 2LTQC 5D6DA 2WKOA 3EFDL 1I8IB 3C60A 1F1DA 1R3JB 4WJKB 1RHHA 1X7QB 1HWHB 3ZR6A 1SRDA 4DFHA 1FJ1B 5IB3A 1XAKA 3EYFA 1Q9WA 2VZSA 5KVFH 2NY5H 3X1EA 1KYDA 2LW3A 4F2MA 5CCGE 4JGJA 3C5JA 1TTRA 1DR9A 4ZPTA 5H37G 3KPRB 3CVHL 1FFRA 2X4UA 3NQIA 5AOKA 2MNUA 3V4VB 4FG2A 3LB6C 5C09A 4WKXA 3F12A 4I9WD 4FQQA 4N9OB 5HI3C 4D9QD 2IH3B 2AV7A 4M7ZB 3P4NA 2COVD 2PABA 3LNHA 1NCWH 5F1OB 5GSVA 1RP9A 4QTFA 3S36H 2BY2A 3MLSL 1F90H 4RFOH 5D5MF 4Y4HD 2G2RA 3BN9D 5CSGA 3KYAA 3ZE1B 3NIDB 3W9EA 1J5OH 1BYPA 2FX7L 1E4HA 1UATA 2NXYC 3GPSA 3MA9L 4L0ZA 1H0DA 3P73B 2CPCA 3GQFA 3TJEH 3G5YA 2IOIA 1L7IH 4XMUA 4W4NA 3IPBA 2WBWB 3S88H 3VW3L 1UWEH 3IJEA 3OSVA 4MA1C 5DFAA 3CVIH 4TRPL 1QLEL 4CBZA 1VFMA 2EIEA 1J5DA 5C0JA 5KSUB 4L9LA 4PJ9A 1EAJA 4J1UB 5IHHA 5DK2B 4E2OA 1RURL 1KBWA 2PTTA 4A7GF 2XACC 3M8OL 2E9BA 3AG3B 3FF7A 3DX9B 1SYSB 3LZFL 4HUUB 1LLAA 1F3RB 2H0PA 1IGJB 4Y5YB 5DJCA 2AXJA 5KVFE 4RGNE 2DIJA 2IGFH 4A67A 1UQSA 4K8RH 4BINA 3U2JA 2E4TA 5FYJH 4LXFA 2CRYA 2QADB 3MV8B 1YEKH 3QI9B 4BK5C 2HTLC 2IWGA 1WG3A 2JKXA 3ASNB 3LXUX 1U58B 4XMPL 4MLSA 2XQBL 1BPLB 3V5HB 4OF8A 1FZMA 2QKIB 2XETA 5I5IA 3FB6B 3L3IB 2WYHA 3BPLB 3UTZA 4AGLA 4YN3A 4ANKA 2W07A 4LLAA 2VZUA 3NRPA 4HCFA 4PMEA 4U1SB 4EIGB 4C4UA 3S8WA 4KK8C 1BD2A 3SE9L 1UXSA 3QUXD 1DQJA 2AXGB 3OG4B 4R4ND 1RIHL 4XH2B 5I1DB 5LWYH 3DTXB 4J3UA 2WBJA 3D33A 5D7IA 3UC0H 4HF5L 4F15C 1YECH 2D7TH 2AKRB 4GRLA 4XHQA 4TLTA 3IT8D 2Z92A 5EOQH 2NY4B 3CDFA 3Q43A 5G4NA 3LPPA 4RBPH 1AQDA 1SEBA 4I3GA 4JHUA 2MQ3A 4ODXA 5EUOA 2MOQA 5AW1B 1F8TL 2P5PA 1LP9A 4F33B 2JELL 4DERA 4TV3A 2D3JA 1JNJA 4G7SB 4G9DB 2VXTH 4NQED 4DEUA 3QWQB 3PP3H 1IIKA 1KIQB 1RZPA 4GRWH 3VH8B 2Q1EA 5DVLA 5IB2B 4U2ZA 4AV0A 3NT0A 5FYJE 1LO3L 4K9JA 3B9DA 3GIZL 2H32B 3RZCC 1EEQA 2VITA 1K8IA 2JJVA 4GAYB 4NN6B 5EU6B 4YAQA 1XSIA 4WI4A 3QQ9D 2YAEA 3I50H 5A2KH 1X5MA 1JZJA 1L7TH 3ELAT 3WNKA 4JFHD 1VENA 4QHPA 2M83A 3K74B 4KKLD 3VWJB 4X4YB 3UAJA 1WZLA 3GXMA 4PLJC 5F7HA 2KL6A 2QPUA 3SGEI 2OW6A 4N0CD 1ET5A 4JG5A 4KZCA 3ZL1A 2YGPA 4K3JH 1QP1A 5GZOD 3CVHB 3O6FA 3E8UH 1JNNH 2ZSWA 2DMGA 3CHRA 3MSPA 4XCFL 3WEAA 3RU8H 3ZL4H 1YMMB 3NJJA 3QULA 4MMYA 4U0QB 3EO1B 4NZ8A 3EG9A 3FUJA 5CJ8A 2XQYG 5D93B 3K2KA 4KOCA 3L08A 2Y72A 5FUCE 2IWEA 4ODUB 4ZMZA 4NJ9H 3KYOA 3D9AH 1SDYA 2OYKA 4AC4A 3JTBA 2GAZA 3HC0A 4M1GH 4M8QA 3X1NA 4O2CB 5HYFA 2J8UE 5I5RA 4ZFOA 1Z5HA 3BUIA 5J7CC 3NSYA 4GRWE 4MXQD 4YQXH 1OF0A 3NCJH 4ACTA 5FUOH 1ZLWK 4BSVA 4PJFF 2Q3AA 4Q0XH 2BNRD 3MCLL 1RZGB 4ENED 4JO5A 1AFVL 2XXFA 2MNWA 5GGVY 3VI3B 4NKMB 4FQHA 4CMHC 3VGAC 4QXUL 3SDXF 5AL8A 1RU9L 5JHDE 2AJZA 3ZLQC 5FO2A 2OYMA 4HIJB 3Q6GH 3BZDA 4JO4L 3RWDA 4CA4A 4LLUB 5KBLA 1KXQE 3QJFB 3ZDXB 4P46B 3QQNA 5GGVL 1AO7E 1E2WA 4NQCD 43CAB 4LP8A 4TNFA 1BFOB 2IPUK 4ZSOA 5D1XB 1KCRL 1QBML 4HCRA 4P04A 3DSFL 1SOKA 3QDJE 4JE0A 3KWTA 1ZWIB 5GGQL 2IMNA 2BIOA 1TQBC 2FD6H 3X13A 1UUSA 2J88H 2H3XC 4M5SA 2CNZA 3T2NL 3FQ4A 2EDKA 1A4JB 1U3NA 2OJ1A 4XVJL 1MFEH 2XWJB 1BYNA 5TPWL 5I1CH 2ENPA 1U8KA 5ICYB 5FLVA 2WTRB 3L13A 4HWZA 1UB5A 4OJDH 3B2DC 3ALXA 4ONHB 2GTZA 4A7UA 5ID1A 4G6KL 3FTSA 2PETA 2PPFA 1I3RA 1TZOA 5HHVH 4L1HA 4P99A 2MPAL 4G1EB 4AYDC 3A4FA 1ZVSA 5D6CB 3T6XA 1W0WB 2EZ0C 2ZUWA 2XG5A 2OR9H 5GZND 1H3GA 2DM2A 4FQ2H 5EUKB 3MODL 3RPKA 4AYFB 4NUMA 2HYMA 5DFVC 4D7BA 3DC0A 3ECWA 4LKCB 3VSUA 5HDBF 5B38G 3QJXA 1IV8A 1I75A 3P54A 5K9JH 4AXWB 3HAEB 2DZEA 1YEHH 3PFUA 1X5ZA 4YZWA 3QEHB 3LXCA 4U1IB 1GS8A 2CRZA 2Q6WB 3TPUB 4OZHF 4JO1L 4QLWA 2HJLA 2Y1AA 4HUXB 4M3JA 3SPVB 1PNCA 2BSTB 4Q6IB 2ZX9A 3VXTB 1W2KT 3C6LD 2GSGA 3Q1EA 2Q8AL 3CNKA 4L37B 3HR6A 3G6JA 2OTWA 3K46A 4NZFA 1T1YA 1HILB 2WLLB 2W81C 2C9QA 4G8EA 2ICEC 1G4MA 2H5UA 2ZWNA 3BZ4A 1UM6H 4PLKC 4YO0B 2BXZA 1RD6A 2CD0A 2HT2C 3FQXA 4W9GC 4X2UA 3MRGA 1SM3L 1YEDB 2FEEI 2VWEE 1XXFC 4YL4A 5KJRL 4U33A 4GH7B 4QTIH 2C7UA 4YGVB 2WNWA 3STZA 3V0VA 2ADFH 2PTVA 5F1SA 4FP8L 4BXVA 1D2PA 4QD2E 2XPGB 2YMTA 3ATBA 2ZCLH 1O5DT 4RBPK 2BP8A 5F88B 3WTSA 3F58H 5EU3A 2J8HA 4KMTH 2WUCH 1G87A 4QI3A 4HZLA 4Y4KD 3B7SA 3FHQA 2N7SA 1IBHA 1YPZA 3L4YA 4R8WL 4QGTA 7CGTA 1HH9B 4HEPA 4M7KL 4OLVH 5D71H 5FCUL 5I1IL 1KJ3L 3PP3K 1JK9B 4IMKC 5B3SB 4G6FB 4NZTL 2NLJA 2FQGA 2IAMC 4YFLI 1SJMA 2EC8A 3SZKC 2JK5A 5KSAA 4HC1H 2JJSA 4J8RB 4KVNL 4ETYA 5JYLA 5E6IC 3RTQA 1IU1A 1KCVH 2YD2A 3O3EA 4JANA 1Y6MR 4R0LC 3W82A 3V0HA 4WW2B 1QACA 1BLNB 3FPXA 4OZFG 2IDQA 3KLHC 2CO4A 1FGVH 2CR3A 2V9UA 3LN4B 5JQIB 1CPUA 3GGWB 4I77H 3IMBA 1MRCL 3KZ8A 3GMPA 4OQTL 4Z78A 1JPEA 3MRFA 1G7JA 3L5JA 2EH8H 4MJHA 3DO7B 5EG6C 3GMLA 1L6ZA 3D87B 3PNRB 5B21A 1JV2B 1HNGA 3LH8A 3GYRA 4R4BA 1OW0C 3T04D 3B2UC 4KITB 1MLBB 5J9PA 1HQ4B 2HWZH 3T3PF 3HB3C 3LXBA 3ZE0E 3B5HA 4U1NB 2VLKE 2K6ZA 2R1WA 1QSED 4HKJA 1NFIB 4KXZH 1D6VH 2DD8L 4FADA 2EIMB 3QNZA 1SZNA 4GQRA 4KDWA 4YSAA 2VXVH 4MAUL 5B1CA 3ZO0A 3RBGA 4HIHA 1MREL 5TDOA 2V7NA 4RGNC 3LH9A 4HP5A 4ZTPH 5HYJD 5HXMA 1OQOA 2OL3A 4FNRA 5F7EH 2B1AH 4OIIL 3K1DA 1M9SA 3OZ9H 1FHNA 1J8HE 2BCMA 4PGZA 4X6CB 4X5RA 1TJIH 2FSDA 3TASA 4E41A 4FI8A 4DZ8B 3VU1A 3WUZA 2C9UA 3JWNC 4MYPA 5E6UB 1BEYL 4I1RA 5I76B 2W60B 2VDOL 3KLAA 5GGUA 2J21A 1QHQA 5DZLA 2IANB 5HPMB 2KLTA 3LZRA 3QFJD 3SOBH 4JB9H 1DSFL 5I24A 1OLZA 2F19L 4FYQA 4Y1SA 2MKLC 1OPOA 3IN0A 4AUJA 4Z7QE 3SDAC 1FWXA 1J0JA 2F58L 4ZODA 4UF7C 1MVFA 3IDXL 3D25B 3HI1B 3NEOA 2VW6A 4HFUL 5CKAA 1GS7A 3MQIA 3MRLB 2WB1A 5LCVL 3WNMA 1YCSA 2OJZL 3W2DL 4CVZA 3NP3A 2DJSA 2ZWSA 4OT1L 1KY7A 2I24N 4IRSA 4AYSA 4TSCL 1BVZA 1PLCA 2F54D 3PHOB 3TBYA 1ZV9A 2OQJA 3TP4A 1FL6A 4PRNA 5FECA 4XODA 3SBPA 4Z3IA 4K8RC 1AYRA 3J2PA 3PIQA 1NGWA 1S9VA 3WKPA 2AV1B 4XB3A 4ZUTA 1N6QH 4A6YB 1WGOA 5D9SA 3D6GA 3EH5B 4PJAF 5F0JB 1FG2A 2O5YH 3MJ7A 2AERT 2CCLA 5J1AB 1A47A 3HBGA 3O8XA 1XHHA 2WSPA 4KY1L 2KBGA 2MHAB 5AAMC 5C0EA 2DEYX 3ISYA 3FRPA 5AVUB 2ZNXA 3WN5A 1N64H 3LOWA 1NUNB 4OM1H 4PUBH 1D9KB 4TUKH 4QXVA 4OUUB 5EC1A 2EDLA 2V9QA 5IEKA 4ONOA 1NQBA 3SO3B 1X5IA 2IQAB 2YBRB 3SDCA 1F18A 1TQUA 4YHOL 8FABB 4BGLA 4C56E 3HNVH 1R4XA 3HS9A 3CFJB 4UWQB 3AU0A 1IX2A 2VT0A 3KS0H 4AL8H 5E94B 3ABZA 2VUYA 2X4PB 3ULUF 5I1EL 3C09B 1A4CA 5BO0D 4N2LA 1IQWH 2GJ6D 2DYSB 2ADGA 4ODWB 5BPPA 2E76C 1QO3A 2J2ZB 2GI0A 4FJZA 5T1LB 5GRUH 1BVOA 3EGDB 4WTZG 1KTDB 4F8TA 1MWOA 1PIGA 4L4VA 1L9RA 5D1QE 1NBVL 2EDJA 4GXVL 3VSTA 1DQLL 3L3HB 4MQSB 5D2LF 4LSVL 4Y1AE 3TZVD 5I1HL 2IADA 2W5PA 3MRBA 4PRHD 1SGKA 3FOMB 4XP4L 3SKJL 3ULSA 1ZVNA 5ALBH 2QFRA 3QXAB 5F9JA 4QHKI 2YXWA 4HH9A 1DVXA 5D4IA 1WSST 1S3KH 3FTGA 4PGBA 1GVIA 4LPVA 5E2VH 4I48B 3TJHC 1QZ1A 1XIWC 1U91A 5IESL 3GSQB 1YY8A 3AWEA 4D0BB 1VADA 2NSXA 4Z7VA 2F7PA 1BVNT 1E5AA 2V17L 4DZBA 5FYJU 5JDSA 4FNLH 3ILQD 4R90L 2WHVA 4KHTH 2WXLA 4PJXA 4X9YA 2NY1B 4LCWE 3ALPA 3UZEA 2VTFA 3WUWB 2FTAA 5KS9E 3WE6B 4RFEA 2QJDA 5FF6B 2YOAA 3UADA 3QC6X 3AQZA 3N43B 2X4QB 2XICA 1WYJA 3WTTA 5BRZE 5HYIA 2GK2A 5SX5K 3U9UA 1CFTA 4MDRA 4X80H 1AAJA 4H1LA 3U7YL 3T2PA 5C9JA 4FLHA 4XWGH 4AJWA 4BZ1H 1FNGB 3WEXA 5DQJA 5HGHB 3F8UB 1KBGH 3H9YA 4JRYE 2CO7B 2KZ1B 3CE1A 3P02A 2WBKA 3GWJA 2G30A 3ZYZA 5T33L 2R23A 4M43H 1HJBC 2HJKA 3HPJA 1F4HA 5KYWB 2WWKT 1CL7L 1WD8A 3R19A 3WYRA 5I6KA 4M5ZL 2YD4A 2OMTA 1PJ9A 3SE6A 2OPCA 3NJIA 2P42B 1CICA 3NIGB 4BFNA 2FBRA 2JIXA 2XTJD 4KKNA 3VD7A 4TSBH 1Z5YD 1BA9A 1WAAE 2BOBA 1IKNA 4A2DA 2XU9A 2GCYB 1ZHLB 3U2IA 5JQ6L 4NOBA 2HTLD 2CKBB 5BV7H 1EMTH 2A7BA 2GBUA 3F6JA 3NAAL 3BZFA 2WXGA 4CMMB 3S37L 3FQUA 3T6ZA 4B53A 3QJTB 3ME0A 3S3SA 2EVGA 4MYWB 2Q7AA 1UH4A 1AANA 4JAMB 2DQGH 2WN2A 5DMJB 3V2AR 2X89A 4PMFA 4N25A 1E4WH 3GMMA 3JV5A 3VGDA 2DWSA 4W70A 4ABQA 1VJSA 1ET7A 1NLDL 2VWEC 2EEFA 4PVLA 4Y2DC 1JPGA 2Y2WA 5C08D 2B14A 2FAUA 2TSBA 2ZOLA 4NXKA 4MMZA 4JG0L 1IQDB 2DM4A 1DZBA 1JIBA 4G8GE 3H0TB 4G6AD 4K5PA 3APNA 2QSQA 3LH2H 3QYCA 3O0RH 1FA4A 3X3FH 4KUZH 3WV0A 1VFAA 1WBXA 1AD9B 2A9CA 4XZ4A 4GEIA 4RDBA 3HUJE 3QUYB 2DMHA 1MUJB 4K5MA 1NFDF 3K0YA 4RGOL 4MA3A 2NDFA 3INUL 5C6PB 3SYAA 3MLYH 4FFYA 4L8SC 2AITA 4WU5A 2DDQH 2WK2A 4L4JA 3AREC 4JRWA 3AY2A 2PR9A 1CLCA 1K5WA 3G6DH 1PSKL 2AXHA 5FM5M 3CXHJ 1JZ7A 5I66B 4JKMA 1MQKH 1W0VA 2D4FA 2FBJL 3D85B 5C0AE 3KE0A 3T0EE 1Y0LB 4FZEL 1ZT7A 5CP3A 1BF8A 3G6AB 1HSAB 3PDOB 3NIFB 3NSDA 3GBEA 3OAUL 4Y5VB 5GSRB 4Z0BL 4B5ZA 3QQ4A 5A6MA 4Z7WE 5IVZB 1AXSB 4GKNA 5DJ6A 5KVDL 3U82B 4NRZA 1XGTB 1DE4B 3H55A 4YDKL 1DVFC 4N1HB 2EDMA 2DTMH 2P5WE 4BDVA 3S4SA 3PGFL 3WL9B 3GSOA 3U0PA 3RY6A 1KN4L 1PIFA 1YEEL 1B2WH 1RJYA 1F3DJ 3NMEA 4IBVA 2Z34A 1BQHA 4FG6D 4XTRD 1QZNA 5EHFA 1KEML 4CJ0A 4XWOD 1EHLL 4ZTOH 1CQKA 1MI5B 4XMKL 1QSFA 3BD3A 4P4KB 1CF8L 2KHAA 3FQ1A 3CSBA 4WUUA 3U30C 3TC9A 2BVEA 4QRAA 4X5WA 5T1KB 4GT7A 4X0KB 4DN3H 1LEIB 1PEZA 3AGVA 5IOPB 3RWCA 1F4XL 4OFYD 3F7KA 4KKRA 3U6XA 3TF4A 1PZCA 3D0LB 3O6ML 3ROLB 3I6KA 2ATKB 5L2KD 3VD0A 4BIKA 2OMZA 2O5XH 1UOWA 2X4OA 1ED3A 2P45B 1OAZH 1QYGH 5C71A 5CZRA 5EWIL 1H3UA 4HQQH 4JQVC 4NZUH 2DQDH 5FR3A 1V7NL 4WHTB 5GHWH 1U30A 1GR7A 1SXZA 2JTYA 4GAJH 4G9FB 4JRFA 1KENH 3MA7B 2NX5E 2GFBB 1LO5A 3C75A 1UZ8B 1TO4A 1P4LB 1GYUA 4DO6A 3IJSA 5AYTA 2HRHA 5C2BL 4X8JB 3GXFA 3F7RA 1G94A 4OU3A 5HHQA 3J07A 3ETTA 3EO9L 3WDJA 1SN5A 1VPOH 4PCYA 4X4ZA 3SDXE 1NAMB 1QUNA 4QXWA 2B1HL 3WFBL 4YHNB 3NPSC 3U36B 4ELKA 3A6BL 3HR5B 2A6KA 4MWFB 4PRIE 4QF1A 4K3DL 5EN2A 1N5YH 2EUWA 3VFWB 4FNUA 3TA3B 3OF6D 1OTSC 2MCPL 1DL7H 3VWKD 1S9XB 1WCQA 3TN0C 3HPLA 1HH6B 2GKIA 2IDTA 1DBBL 3ARGC 4QOKE 1E67A 3GMOA 4MX7A 1T03L 2Z0UA 3AS0A 4LRIC 5TQ0H 3N1QC 4GKLA 5CS7A 2IF7A 3O4LD 2Q87A 1I8LC 2N0MA 4KFZC 1S7WA 4M3KB 2FWLB 1A14L 4S1SH 1I7ZA 4DEPC 2JSFA 2K9FB 1FO0A 1OE1A 1FFOA 1ETZA 3MGTA 4ZJ9A 1OAYL 2KUTA 2F8OA 3QQXA 2YPLB 1GHFL 2YWYA 4R3SA 3KBFA 2CMRL 3B9KB 5SX4H 4MD4A 5AVVB 4LLMA 1ADQA 2Y06H 3OV6A 2ZICA 4JZJA 1FGNH 3MBEA 3QSKB 2UYLB 4FAAB 1I1AA 2BCKA 5DFVD 5CHNA 4NT6A 1IL1A 4EDXB 2Y22A 2OP4H 5MEPA 4HJ1A 4LOEA 4OFIA 1F11A 3FFDB 4QTHA 2EKJA 4QHNA 1A3ZA 1QBBA 2JXMA 3DUUA 4X6DA 4YSUA 1A22B 2AQSA 3WXWH 3DJZA 5HDBE 5I16A 4IS6B 3GBDA 1LNUB 1UGNA 2FHFA 3O9WA 2XVBA 3DMMA 5IBTH 4XRCB 1AMYA 2DH3A 1AE6L 3B56A 5FUZL 1KTJA 5C0GB 1GGUA 2RD0A 3KPQA 4YC2C 3WXVH 4U6YA 3KXFB 4IBQA 2W1NA 3N1GC 1DJHA 3NTCL 2WZAA 1RZJL 5LLIC 7PAZA 2WKLA 4PJCF 3GRBA 1B3IA 4X98B 4OAWA 4P9HH 4ERSL 5C0DA 1TQVA 2YK1L 1XGUA 2FO8A 1NBCA 2CDFB 1UA3A 3CLFL 1TSRA 3NACH 2XBTA 4JFFE 1ACZA 4OLYH 4I4WA 4K9EH 1MAKA 2BVPA 3UTOA 4I0CC 1D7DA 3MOQA 4PLKD 3DOSA 5DD0L 1UACH 1T2JA 3ZN6A 5H94A 3ORJA 3VXMA 1NKRA 1AGDA 4UT6H 3WAJA 3MX0A 2UXTA 1OT4A 2NY3C 5E8NB 5CFAA 5KYXA 4KZDL 3WIIH 2AEOA 4NHUB 5HVFB 4PB0L 4U1HA 5A7EA 3TCLA 3OMIB 2FL5A 5C70A 4HS6A 1FFQA 1I3GL 2GBTA 1CR9L 2XTSA 3TFKC 3HZ3A 2WSDA 5E2UL 3S35H 5CD3A 3VQLA 1LMKA 3CFEB 3FU3A 3B9EA 4BH7B 2V2WB 2HVKA 3AADB 3ZMNA 3GI8L 1DO5A 2BVQB 1MCQA 1U2YA 4CGTA 1KOAA 4DSYA 4FJ6A 4DKAA 5JHBA 3FSVA 1FYTA 1UA7A 1JF1B 1P1VA 3AS2A 2ADIB 5E1GA 4UM9D 3SDYL 5TDNB 4K7FB 3THMH 5DA4A 4I5BA 4LBEB 3CSTA 5I71C 1HC1A 4DQOL 3UZQB 2VJ0A 6FABH 1EHXA 4J3TA 1DDHB 1WT5C 4IRZL 3IXAB 4DP9X 4EI5A 1A5FL 4UNUA 3UYRH 5CUSL 5BS0A 2VLJE 1GTNA 4XPBH 4AL8C 3VMOA 1NFAA 3ECBB 2DBLH 1A9VA 3KLHD 1KZYA 1RULL 2E8ZA 2BINA 3FU5A 2FIKB 1HEHC 3BXNA 5J4MA 4OCRL 5IW1B 2GTWB 3OGOE 1KDIA 3EXJA 5KYUA 4Z7OB 4ANVA 4FLOA 1RUAL 3ALWA 3SIKA 3VFRA 4ADGA 4K55A 3MYJA 3VXSA 3FQTB 2Y7QB 2PO6B 3HG1E 5I28A 5DRNB 4ZMWA 3QT2A 3ABLB 3GLEA 1JE6A 1N59B 2CGRL 2EYRB 3MV7D 1TSHA 3P9MA 3UYPB 1V7MH 2B4CL 2QSCL 3KVDD 3MLXL 4PV9A 3WCYA 4PQXA 5EBWA 3SCMB 1W9XA 2JCWA 4EUPH 3CQQA 2VJ8A 5HY9A 5C0BB 5IUCA 3T3PE 2DQTH 4NBXB 5FWQA 2DQJH 2R0KL 3BWUF 4PJ5E 5J56B 3QPKA 4X4XA 4Q9RH 4IJTA 1YZZA 3P9LA 1T22A 1G84A 1P5UB 4JZOB 5D7LE 4WV1B 1I1CA 1XGYL 4HWBH 4HPOH 1R5VB 1MCOH 2E59A 2UUDH 4A2FA 1MW3A 3QUXB 4PFEA 4ODSH 4PJFA 1C8QA 1A25A 1XSKA 2A1WH 2FWUA 1I9IH 2A9NL 3Q13A 2P49B 2PYED 2GITA 5MEOA 4L8CB 1RZFL 2QQLH 4LGSB 2XY1A 1ZGLA 2VC2B 4LF3B 3I75A 3WTXA 5BZZA 3VFPB 4ZXBA 5HGAB 4JPKH 2HLFC 3GT6A 3IFNH 2PW1A 4EXPX 3C08L 3IJYA 4QRSA 4ZQTA 2ITDB 5L0QB 2EDXA 3GO1H 2KMWA 3DRQB 3HG3A 3AY4A 1YDPB 4NQEB 4UNVA 4WK4B 5K39B 1TVHA 1XL6A 1NAKH 4N9GA 5TH2A 4DOHB 2EAEA 3FTYA 3LS4L 1J8SA 4TTGA 1A4KA 2N7BA 5A16A 4I9XA 1NSNL 4YDIL 1GW0A 2APWA 4W9EC 2XXMB 2ARJB 2X70A 3HCVA 3NA9L 1NCIA 1HL4A 3VXRB 3ZE1F 3NIDF 2TAAA 4R7NA 2B5IC 3MRIB 5BRQA 3V6FA 5I8EB 4AVHA 2AZUA 4IOIA 1J5HA 1ZTXL 4H0LC 1W72A 1VZIA 2Y07H 4HKBA 2B7DT 4PGDB 2GTQA 3T0EC 1E50A 5IMMA 2HT3C 3OKOB 4BKLB 3R1GH 3IFOA 1ZRUA 2AJ3B 4BSWB 1AGEB 1HEZA 1NCAL 4HJIA 2X4RA 4AITA 2Z3FA 1KJ2L 4U7MA 4YK4B 1CFNB 4Y5XC 5KSBA 3GKWH 4OZIB 3WY4A 3K6FA 1RIVH 1KB5A 1FFTB 2R0LH 2WTOA 3NEEA 4F9LA 4H5SA 4EN3C 3GIVB 1KTKE 2H0FA 3KL5A 4LMQI 3AAZB 3VDBA 3AITA 4M5TA 5DJZA 4X99A 4X8XA 4FCAA 2D0GA 5B1BB 3P3UA 5SWSD 4UT7L 3SY0A 4OZHA 3PGCB 3PL6D 3OWEA 3CDGA 1JZ6A 1HTYA 3ASWA 5LN4A 4Q58C 4HXAH 4KK6D 3WTYA 3FTXA 3R06A 2YSSB 2EXWC 3C8KA 1HU8A 1TQWA 1H8OA 3G08B 3DVGA 1AKJB 2LHAA 1GCFA 1HCYA 5HBBA 1OGAD 4OY9A 4RRPA 1XVSA 3EJUA 4DUXA 1WBZA 1E5ZA 1MFVA 5EH1A 1U0QA 4NQCB 2V5TA 4PS3A 3FCTA 1CGXA 5AW3B 3LNIA 4I88A 3O45B 5EIIA 4Y2OA 3HC3H 5TGBB 4M1CD 2C9RA 3RWGB 5EPMB 3REWB 1BAWA 1RUQL 3BCDA 1MHEA 5HJGA 2VMJA 3C6SB 3B6SB 3L5XH 1FNLA 3CX5J 5I6LA 1J5CA 3HS0B 3LZPA 4WGVB 2C1OB 5HJBA 5C09E 1E27B 3H2WA 3QCVH 5ISZD 3HE6D 3BGAA 2AAVA 4NDMA 2R69L 5IR1B 2EDOA 3QDJD 4CSSA 2CA3A 1RZ8A 2FGWH 5I1AA 4Z8FL 1FF5A 5E1AA 4YSSA 2ZYHA 2E4FA 4N2DA 2Z93A 2B9AA 1F4YL 2GT9B 3LQZB 4JRXD 3T65A 1S9WA 2ZJSL 5IBUB 4WIQA 4UQ3A 1Q72H 2YA2A 1JGDA 4JDZA 3OX8A 1ZVHA 4OIFA 1IBGH 4QY8B 1CI5A 2ITFA 4LHUB 5BZXA 4MCYB 2QPFA 5H37A 3OPUA 4OLWL 1F2QA 4GW5B 4ZMVA 2VDLL 1HWGB 3VVWA 1LE9B 1QRNE 2QVTA 2F8VA 4QRRE 1JTTA 2CRMA 4XT1C 5D2NA 4PJDE 4LESA 2NSQA 2VDKB 1UWXH 2YXFA 3NRFA 1ZS8B 4H8HA 1S7VA 5HVHB 5IVXB 1HHGA 3C6LB 3H42L 3OGCB 4J3OC 5TDPB 4ZS6C 2CHWA 5JXEC 1BBJB 4KK9C 2ZT9C 1P1ZA 2ESVD 2ZE0A 1TJMA 2NR6A 3BKMH 2COQA 2UUDK 2QGCA 4K94H 5T5FA 3TXAA 2R9HD 4JN2A 1GSMA 4KI5F 3HRZC 4TKWA 4YMPA 1JZIA 1LO0H 2N56A 3PV6A 3DROA 3VI3F 4OJCA 5D7IE 1OCWH 1RFDH 1IVTA 3P77A 4DP2X 2G0LA 2VR7A 2P52A 2CZNA 3X11B 5I1JH 1JVOA 5FYLL 1A3RL 2AMGA 1WRFA 3DPDA 4JDEA 4UQDA 1BIIB 2GIXA 1JPTH 1TZHA 1BGXH 4M9OA 3WUWG 3ZDXF 5EORH 4LQFL 4Y2DD 3ULVL 2E75C 4BGDA 1MXDA 2VXUH 2HVBA 1JI1A 1A02N 3FB8B 1PMYA 3H9SA 4XP1H 1NICA 1FFPA 5I74C 3QR1A 1F3JB 1KG0A 4LLYA 1WWBX 1XCWA 3LZOA 1G9HA 2AK1L 2VLRA 3QHTC 4OD1H 4CN1A 4FHBD 3TESA 3RX5A 2PR4L 3KWXA 5CKGA 4MB4A 3RA7L 3GSNB 4N85A 1F45A 3FFCD 3MUGA 4OD3L 4M4RA 3TT3H 3H53A 3QWOB 4CVUA 1INDL 3ARED 1KBKA 2X09A 3C9NA 4MJIE 3OJDA 2AHIA 5EFIA 3HI5L 1NFDE 4XGZA 35C8L 1QWHA 4P5TD 3JQOB 1EDQA 3VGGA 4OCXH 4KVCH 3TV3H 4B50A 4OSUH 3F2LA 4HUNB 2AEIT 3VI4B 3AUWB 4AQZA 3JYCA 4WNQA 4N0UE 4UB0H 1K4DB 5DO2C 4JQXA 1DQIA 3MRPA 2O61B 4NN7B 4NIKB 3SBQA 1MH5B 5HJ3B 3DXAA 1CLOH 3OKEB 3LQAL 1JUFA 1RZQA 4MMXB 2OR8A 3G5VA 5TE7L 2E7LA 3HG4A 4JLRA 1LEKA 4BQ9A 1BG9A 1D7FA 2WJ5A 4QNPF 3K6DA 2RALA 4TXVB 4XAWL 4LSQH 2NQ3A 2P8MB 4KKQA 4PRDA 1SVCP 3UZVA 1NANH 3QUKB 3ZE2E 1KGWA 4PHZA 3V0WH 4NNXA 4DTGL 1FDLL 5HYJB 5DJ8A 3KPPA 2EVHA 2XYCA 4FXKB 3BAEH 3NCXA 3HTLX 3CMOL 4LRNH 1H3WM 2VDLB 5IFAH 3ARTA 4HAKA 4HBQA 1JP5A 1JRHI 1EIBA 1CK0H 4CL7A 4Y19A 1ZHBB 2XQYA 4AIXA 4FN0A 3QO1B 3F64A 2VDPB 5KSVB 2NY7L 3QIUC 2EDEA 5D2LA 2ZCKH 3SGDH 5E2TL 1R3KA 1UURA 2CDEA 4QHLB 5CBEB 5JPNB 1AR1C 4OLZH 5E8OB 1JK8B 3ARWA 4KH9A 2E3VA 5FO7B 1G0DA 4G7VL 3V4PB 4F9PC 3CV5A 1C16B 2P7TA 3LKOB 5IY5B 4BQBA 3BWZA 3B5TA 1T5WB 1H5BA 1MRDL 3IDIA 3MACH 4LARL 5DJXB 4NZJA 2YKLL 3DX6B 2ZPKL 2FATH 4F58H 2ARWA 2OULB 4N24A 5B39B 2O6PA 4H2CA 3DV6A 4Q4EA 2VB5A 4KTDL 4Q14A 1OP9A 4EVNB 2EUXA 2F54B 3ABKB 4CILA 5KG9B 3F6IA 3QHZL 1SNRA 1VZHA 4M4PA 3P0VH 1U92A 5JQHC 2FJUB 2R2EB 4JUSA 3ZDWA 4TNEA 5LBSH 2UY6B 3MNVB 2I69A 3QEQE 4L1TA 1GRWA 4KRPC 3ZKXC 5FYKL 1PBYA 3EYSH 1J7VR 4WW2F 3D12B 3N04A 4UM8A 3RAJH 4QWWD 2ZUQB 4Z3GA 2CE6A 4A68A 3HZKB 3HMXL 5IG7B 3SKOB 2HG5B 1VFBB 3AXHA 1A6AB 3AS1A 4A55A 1KIPA 5JW4M 3ARFA 1ORQA 5GRJH 3CFKA 4KBPA 1RH8A 4LFHG 1MJ8L 1VSCA 3I84A 1ZMYA 1Z9PA 1UWXK 4F8PA 4QLRA 1KCLA 3FT4A 1M71A 1JGLH 5T3XH 1OOAA 3EH1A 4K07A 1A7PH 4P2RD 3FN9A 4KPHH 4MSWA 1E3ZA 1Q8MA 3QQ3A 5AOJA 5AZ2L 3EOBB 3OKMB 2KPWA 3VRIA 4LLVA 4OZGA 3KWVA 4XCCH 1RLWA 2OA9A 2C26A 2A74B 4LGRB 4ZFGH 5LJYH 3H4FA 2Z4QA 1BWWA 4GI8A 5B38A 1KC5L 4OCYH 3MLZH 3O6KL 5EC2B 4X6CF 4W6XB 1GKEA 4PRHB 3BAWA 4WFFD 5BCAA 3GJEB 1ROWA 2WLKA 1U6AL 4OGQC 2NY3D 3EJTA 2OMNA 4KTGA 1UKQA 1Z3RA 1A4AA 3GS4A 4MCZB 2LTQB 2PMZA 1A2YA 4MRCA 4KX7A 4QCIB 5HI4D 1G6RH 4RAUB 4Y1AD 5DR5H 5ERWA 1DDTA 3AXLA 3TFKD 2IBGA 2VKXA 4LDLB 4PSRA 5D6DC 3C60C 2JJTA 3LEVH 4KKAC 2Q76A 4GUPA 3TO2B 2PF6A 3O3AB 3HVNA 2DN7A 1M2VB 5T3XE 1PYWA 1Q38A 1BMWA 3W0WD 3BKJL 2NNRA 3UTQB 5E9DD 2UZYB 1OL0A 4N2BA 4RA0C 1OSPL 4NERA 5IFJA 1EANA 1XCTA 4PJ8C 1SEQH 2QR0B 2Z31A 4PWHA 3V0EA 4LEOB 4YZFE 4AEEA 2BLFA 4OQ1A 1KIUB 1ZT4B 3ZHFA 3I3BA 1DFBL 4B7LA 1HHIA 3UTTD 4DIXA 2DLIA 1TJXA 1YSOA 1NCUA 1QTSA 2NXYB 3GXNA 2OXHA 3TIEB 1TKWA 2H1PH 1UWFA 2DW5A 2ZAIA 4PVNA 1LK2A 1U8OA 1E5CA 4NHCH 2E9JA 2H7WA 2IDCA 4O5LH 4TQ8A 2P5EA 1OPGL 4L3FA 1AZRA 1RJLA 5TF1H 3M6DA 1PQZB 4MA1B 4HJJL 2D0HA 2E7MA 5LGHL 4NNPL 1DUYB 4IIQA 2OJEA 4EIZC 2VZ1A 4DEWA 4NQDD 1AYOA 1CXKA 3OHMB 4L9LC 4EDWL 1QAWA 1NDGB 4CW1A 1NC4D 3CXFA 2R1XA 2WKGA 4UU9A 4ANWA 3T1FB 5AB2A 1NOAA 4JL2A 3FO2B 3DLQR 2EO7A 4A2LA 1AIFA 1PY4A 5DUJA 1IAII 1JF6A 4GPVA 4JFYA 4OZFA 4G8IA 3AABA 4JCMA 1WZKA 4ZOEA 3VAEA 3WKNA 3EYVB 3LTVA 3P40A 1KELH 4HZAA 4ZG1A 2ATAA 1U2CA 3DTDA 3OR7A 4HX1B 1DP0A 4QO1B 5EZLB 3V4VH 4MNGE 1QWUA 4FQLH 5JO5A 2JKSA 3LDBC 5F1IB 5C07E 4KXCA 1DFXA 3VD3A 1AGCA 1B4TA 4XCEB 4R96B 1TJHL 4OJFH 3CFQA 2Q2EB 2WC7A 3FRUA 3MRMB 3KR3L 2FZ3B 3FO9B 4G42A 2BY0A 43C9A 4O9HL 1PDKA 4F15B 5ADPL 3NP4A 2IC2A 4CAGA 1YUHA 4PRBA 4E9LA 2BNRA 2WBJC 3KBEA 3NJMA 2G75A 4RDQF 2XN0A 3JV6A 2OMVB 2QZQA 2A9DA 2GC7C 1NBZA 4GRLC 2HLFD 4Y9FA 5CLZA 2Z1KA 5E51A 4WY7H 2CXKA 3A6OA 4OFQA 4JFED 1A1MB 1EO7A 4AQ1A 3MRQA 4WLCA 2NMSA 5MI0C 4Y7OC 3NOIA 1OP4A 1FL3A 3WHXB 4G8GD 4UBDC 5L8LB 2RFXA 2ORBL 5A40E 3WTVA 1UWGH 3G04A 3RZCB 3ATDA 3TWCL 5J06A 2QQKL 2YAPA 3M46A 3S7GA 1T20B 3L5IA 1YEIL 3N43F 3RNQA 4CBPA 1NLBL 4G7RB 4K71C 2YEVB 3ASOB 5IQ9A 3O41B 3SO5A 3PFQA 3CXDL 5ILTL 1TIUA 2A4EA 2YMOA 5I19H 4XMLL 2PP7A 4NUGH 3CVDA 2NY6C 4KI1A 4Z18A 1MCPH 3DPBB 5F3HA 3S34L 3NZSA 4K94C 4ELMA 4LZKA 2BDNH 3BP7B 4AGOA 3ZTDC 4M56A 4M61A 4YX2H 1E5UI 3O6FC 5ICXB 2BERA 4N22A 1E8XA 1HHHB 2WXFA 3IFLH 4GKZB 3TJPA 1J18A 1NDMB 1SDAB 4PRPD 4XP9H 3UMNA 3BEVA 4L4TA 1HL9A 4FQJH 5GZNA 4B27A 4O02A 1Q1PA 1MAJA 3DURB 4N6RB 4NGHH 5DJAB 3DYOA 4GMSL 2C34A 2APFA 1KPUA 2PN5A 3L1EA 3NIGF 1PG7L 3N2JA 1YNLL 1QQDB 1XD1A 1VKXA 4L4VE 3CN4A 4MHHI 3RNKA 2BIIA 3HE7D 4I0PA 1MCSA 4WVRA 1XF3A 5IW6A 4FFTA 4ONFH 4CMHB 1QEXA 3VGAB 1Y6NR 4PJCA 5HYQB 1IEBA 1Q0XL 2NNXA 1S78D 4DWHA 3WNJA 5DURD 5GRVK 2H32H 4HCRL 4XBGA 5HHPB 1G4RA 1MHPL 3MV8E 5JOFA 1D5XA 1E9QB 5AW9B 3IMSA 1J0IA 2PWEA 4X5LA 1FBIH 3VB9A 3DIDA 5MEND 5IHLB 3CHPA 2E27H 5FB8A 1I1YA 1PVHA 5C0ND 4CU7A 4XBEH 4JCWA 3D3VB 3EFOB 1BOYA 2NX5D 2R56H 4MNQB 1E5BA 3ZTJH 5GS0L 3GXPA 5CP7A 1UM5H 1H9DA 4LO9A 2Y6SD 2AI0L 1T1XA 1TQBB 3OJMB 2FJGA 1HXMB 4ABVA 1QBLL 4YXKL 1A6TB 2H8PA 5AKVA 4RH4A 4YHYC 3SB3A 3O4LB 5CLTA 5K9QI 3GSWB 4OFPA 5EO1A 3RKPA 2DICA 2CSPA 3D05A 3WFEH 5I0VA 2D7NA 4HD5A 1OM3L 1EEYB 4HK3N 5DZNA 4S1QL 3UAAA 4AEHH 2XKNA 2I7SA 1JF5A 2A77L 2XN9D 3KLQA 1INEH 1RSYA 2OCJA 4NWUL 3OJ2C 3UMTA 1I7UA 3CSPA 3CZUB 4OF6A 4IOSD 5AKTA 2X28A 2IH9A 5C2UB 3NVQA 1EXUB 4HALA 5F9WC 4YXLL 2A2QT 3DNKA 4TVSa 3NIFF 3FCUB 3SBWC 5KVFL 1SUHA 2NY5L 4D2NA 2AEQL 4MAYD 2G5RA 4F57L 5F1NB 3GEFA 3PWVA 5CN1A 4RNRA 2CA4A 3KGTA 4NKOB 1QFUL 3LRMA 4J2XA 4GW1B 1UEMA 4O2FA 2AABH 4L3EE 1NCWL 2I60H 4JFDD 3S36L 2C3WA 2OZNA 4AWJC 3UTSA 4E5XB 1YYML 3KPSD 3RVTD 1E9PB 5A6LA 2WO3B 4J3OD 3MHZA 2E0PA 2CKNA 1IC4H 3T4AA 3TJEL 5HHMB 4N8VB 3VYPA 1L7IL 4XVOA 4H40A 4NRXA 1KXHA 4PJEB 1KB9J 4N5UA 1TZAA 3EH3B 5LQBL 5F70A 3S88L 2ICEB 4FF9A 4GG8B 2HKFL 4LE8A 4XXDB 1MCIA 2BSDA 3CVIL 3S3BB 3LKNA 4U6HB 4GIOA 4XPGH 3AG1B 3RB7A 5DT1L 3PXHA 1YNKL 4E0RB 3APDA 4HBCH 4N28A 3C5ZD 4F7EB 3IXTB 4JFOB 4PJHB 5B8CA 4JFQA 5EBLB 1ZEAH 5JW4Q 2OAAA 4P23C 4RGMC 4WU7A 2AK4A 4YFLF 2B59A 3P4MA 1OGTB 2H3NA 3FU0A 3VI3E 3L9YA 2VISA 2UVFA 4RZCA 5BQ7A 2R4RH 2ZXCA 2F5AH 1FNHA 5GS1A 3RFZC 1YEKL 2X40A 1DSWA 3L9BA 2XXGA 3I6LE 2UY7A 4NKIH 2PW2A 1PG7W 2IAMB 3VXUD 1X7QA 3MREB 2D2CC 4YEEA 5FYLD 3KLSA 3ULAB 4B9ZA 4XVSH 2B0SL 3IMUA 1IGMH 3ULVD 3I3DA 3N85H 3BO8A 4JZNB 1PL3A 4LHUG 5E6IB 3REVB 5J0BA 5KSAC 5AW0B 5KZCB 4FFZL 4N3TA 5DUMH 2JJSC 3UC0L 5DS1A 4OJYA 2D7TL 5LGJA 3RTQC 3CK0L 3D4ZA 5IJCC 4R0LB 2EDWA 3PQYD 2Z8SA 4PR5B 3C12A 5EOQL 1PZBA 3ZSSA 2IH3A 3FZUD 1FIGH 2YOCA 3HZMB 2OX5B 5MERA 5C0RL 2APBA 2X6VA 4XVUD 1UTDA 3MLRL 3UDWC 7TAAA 4L8BB 3ARDD 5I8OH 2NY2C 3VVVA 5DO2D 5FK9B 3ETSA 2VIRB 3P73A 3T5WA 4U6TA 2HJFB 2VXTL 3LPFA 5HHOA 2AFNA 4HS3B 4JFUA 1PLAA 3NCMA 3MV7B 3MRJA 2FK9A 3L9EA 3HB3B 2BSSA 5KSUA 5DZ9A 3I50L 1L7TL 3F7LA 4PSPA 4QT5A 3IU4H 4ZAKD 5GJSH 1NCCH 1TETH 3HI6L 4JJ5A 4OGAD 1F00I 3RIFF 4LASH 4HUUA 4I0KA 4UOJA 2CLVA 1UFUA 4RGNB 3UJJH 3GRWL 1URZA 4XR8C 4K3JL 4DETA 1A7QL 2R2BA 1JNNL 2G3MA 2MQ0A 5TQ2L 3ZZSA 3QUHA 4R5TA 5HP5A 2D0FA 3CDYA 3QDAA 3RU8L 1PD1A 4J6RL 1UOVA 3US9A 1F1AA 5GGSB 1H15B 3RDTA 5FOBB 3QI9A 2EEDA 3CZFA 3PREA 1N8ZB 2YD1A 4BA0A 4GSQA 1OP3H 3H2QA 3TO4D 2X4NB 4X83A 5F9AC 3Q6FB 4Z76A 2GJ6A 3CZEA 5ETUA 3V5HA 3WHE1 1LEGA 4AK2A 3FUFA 5FM8A 4YHPB 4NJ9L 1C08B 2H45A 3L3IA 3VXQA 4JY4B 4GLRH 4YLBA 1R3LA 4MQXD 3QIUD 5C7ZA 5BJTB 4M1GL 4GMTH 4G82A 2NZIA 4UV7L 4ZO7A 3BLBA 1O6SA 3SDAB 3TVMD 3IFPB 1AR1D 3CXHK 5ESVB 4OB5H 2YRZA 1PLGH 4JG1H 2F68X 5AL0A 4P2AA 4YFDB 1JZ3A 4Q0XL 5CZVH 1F6AB 2MFNA 5DJ2B 4NSKB 1CG9B 4FS0A 3FPYA 1A6ZB 4N1CA 3ILPB 2NUPA 4R84A 4TUJB 1T80A 1GC1C 4YSDA 4UNIA 1WUZA 3EBIA 4F33A 3MFFB 4ICWA 4IKIA 1U8CA 4MVBD 1CTNA 3WLWD 4K5NA 5L2JB 4G9DA 3IK2A 1TLKA 5LXGH 1MWAB 1WCBB 4ALAL 1XBRA 2E5EA 4Q9QH 5C0CA 3F00A 3M07A 2Q0ZX 4MGXA 3V4UH 4GAYA 1RUPH 2IALB 4ZQKB 1HEJC 1DBML 1RL1A 5EA0L 4R5VA 1H3PL 2HFFB 3NJGA 1JGVH 2X2HA 3VWJA 5FGCB 4HULB 1FVCA 1MFEL 3DIVA 3O8XC 4X4YA 4Z7OF 5ICZA 1K9TA 4X6DE 5I1CL 4WJ5B 4FGMA 2F1EA 2ODHA 1KJMB 3NPZB 3WN5C 1NIAA 4YUEL 1ITBB 1U3HC 1NM9A 1RMFL 1O6VA 1SYVB 1EV2E 3OKKB 1AXTH 1Y18B 3MRCA 4WO4D 2PCYA 3CVHA 1J05B 4OZ4B 3DK2A 1ZPUA 5FYKD 4MZRA 4GAGL 4UINL 1KTRL 4DGIH 3C2AL 1NJ9B 3LSOB 2WQXA 1YMMA 5DS2A 2I85A 2C4FT 1E9OA 3FT9A 1I1FA 2G0KA 2VAAB 3OKNB 2G9HB 2UWEB 2K1MA 2OR9L 4UV4H 4ODUA 4N26A 5C6WH 4EIBA 5I73C 3D0VB 1DQQA 1BX2A 4AJVA 2XDHA 3KM1A 2VXSH 1JGIA 3ZGHA 3SYPA 1AXIB 1MELA 1XH3B 4NEHB 3T2QA 5K9JL 4GRWB 1ZT1A 2VDRH 4CN6A 1MN4A 4K7PX 4TTDC 4ZUUA 4N1EA 5DYOA 1YEHL 2ZKWA 3ZRFC 2NNAB 1BOGA 4JBSA 3CLWA 2BOCA 1P2CB 2ZUTA 5B39G 4NRYA 5T8IA 5KBNC 2VOTA 4NKMA 1KN2L 4X6CE 4FKKA 5DWPA 5JHDB 5CN2A 5DS8B 1XIWB 3BUYA 1T04B 4BKTC 1I85A 2JFCA 3F7YA 2EC9U 4HIJA 5JHAA 1AO7B 1FYTE 1NCOA 2OTUB 4BFGA 4CSPA 2YMXH 2KQNA 1D5ZB 2OMYB 2VL4A 1CLZH 3L3DB 4I85A 5FHAH 3NQKA 4AYMC 3DX8B 3LV3B 1LO4H 3L95A 5CMAB 1UM6L 3UCRA 5KAQG 3QDJB 5D1XA 3ZYJA 1GIGH 1RPKA 3T6QC 4XNMA 4G80B 4WFHD 4ZD3H 5EU5B 2NXZC 2XZCH 5DUBA 3S3PA 3SYOA 1I8MB 4M8VA 1BAFH 2W65B 2E7BA 5K69A 3AS3A 1GZHA 2K9UA 4JRXB 3TBSB 3ZT6A 4PJGA 3D50A 3F58L 3VFTB 1ONQA 4ZPVB 2PYFB 4IM8A 2EE2A 4Z95L 3U6RA 3B37A 3MLTA 4LKXB 3ARXA 4LDCA 3TTSA 4F80A 4PTUB 5JW4N 4OLVL 5D71L 4YR6B 4LEXL 2OSLA 2Y7MA 5KBMA 4AQOA 3HHSA 3WO3B 4G1EA 4LDOB 1EUUA 3LPWA 5TFSH 4QAMB 1PKQA 1LDPH 1YMHB 2XBDA 2YQGA 2VABB 4HC1L 5MP6L 4YHIB 3CN1A 4PJ9D 5AVXB 1G7PA 1EAPB 4JHAH 3MUZ1 4OZIF 1KCVL 4JFWA 2K8QA 3EAKA 3AU1B 4AXWA 3OKDA 5FKPB 4C47A 1FGVL 4QXGL 1G7QB 1UH2A 3ISRA 4DO4A 1BJ1J 3TPUA 1E8ZA 4I77L 5JORA 3SPVA 4PEEA 1TVDA 4Q6IA 5FHBH 1SOSA 1IKNC 1KACB 2UZIH 4LP4A 3VXTA 3SGEH 1OP3K 2F9BT 3MJ9H 1WHOA 2L0DA 2YQ2A 4L37A 5LDUA 2WXQA 4EI6B 4HIEB 4FTDA 2HWZL 4E9YA 3VFNB 1T7ZA 2RB8A 3F65A 4GSDH 4P5RA 1ZA3B 1BD2D 2DJUA 2CO6A 1X9RA 3WY3A 4Y2DB 4KDTA 1KB5H 1C1EL 4JDTL 3UTPE 2WB7A 3ZDYE 2VXVL 1F4WH 1U95A 4GRLD 2GIMA 5AZEH 2D3NA 4A66A 1BFVL 4MMZC 2O6EA 3L4VA 2XPGA 3P3TA 1XCXA 3L1OL 1KULA 3VYOA 5CBAB 2XG4A 3CSGA 4Y9CA 5F7EL 2VAJA 5F88A 2EVIA 1ZANL 3OZ9L 2WUBH 3EGSB 3MCKB 1OD9A 3LEXA 4XX5A 1OAUH 1FFNA 3W81A 4CVWA 4KK5D 2F74A 1NA8A 3M45A 3EOAB 4JFXB 1HH9A 2KPNA 4L8SB 5MEQB 3VFUB 3AREB 4ISVB 3OF6A 2BNUB 1B0RB 5E5MA 4JKPH 1W0YT 2F8IA 2AGJL 4MA7H 2K4WA 1J9TA 2DYPB 3L6FA 1PTZA 4MS6A 3QK0A 3CCHB 1IJ9A 1FE8H 1S46A 2A38A 2UXFA 4UT9H 1N0XL 2DM3A 3UAJD 4HG4J 4EZMA 5IOKA 3RFRA 1JFQH 4MDIA 3DGCR 1DVFB 5KSBE 4FDWA 1SQ2N 4DAGH 1ZPLA 5DHVH 3O6FD 2KT6A 1P7QA 3ZZ1A 1MFAH 4M00A 4IBUA 3GGWA 3WTWA 1SHMA 3IGFA 2UX7A 1GGIL 3FQRB 5EB9A 4Y88A 5T1MB 1TTFA 3NCYP 2QQNL 3RY6C 4AGNA 4E42A 4QRPA 5I8KH 1Q0YL 3QUMB 4L3CB 4TYUA 4LCUB 3U30B 4IHBA 4KO9A 1KFGA 3GF8A 4YNYA 5IVXF 4F37K 4IK6A 1AP2B 4PPTA 1L5GB 2F61A 1OTUD 1MLBA 1HQ4A 2IG2H 2K0RA 2CBQA 1PZ2A 3ZE0B 2O5YL 3ZTCC 1U8MB 2NCEA 4FTVE 1IEAB 3WE1A 4YDJA 1VACB 3NZHH 3OXRB 4BUQA 2RIKA 1MRFH 1OAKH 2VDNH 3VQ2C 2C4FU 2JKRM 5J13C 2IV8A 2ISDA 4EOWH 4OM1L 4XP6L 3OZKA 1GZPB 2WZ0A 1HE8A 3FULA 1MFCL 4MA8H 1J1OL 3U6XS 2GUOB 1EQWA 2MTAA 3HZVB 5T3ZD 1C12B 4IKLA 1KXVC 4PJIE 1ZOXA 3HNVL 4WGKA 1T0MB 4PGCB 4IDJH 4D9RE 3NPSB 4HCIA 4RX4D 5DMKA 4P0DA 1Y1DA 4X7TB 2Q7NA 1BP3B 3DX7B 4YDVA 1IQWL 2QTVA 2HPTA 3KBHE 1ZY9A 3TN0B 1BDYA 5K59F 1FRGH 1CXFA 2A3TA 5GRUL 1ZKAA 1YYLH 3QNXB 1FO0L 3ARGB 5L88L 4Z7QB 2XWBB 1SLVA 3FQYA 4LPWA 2DQ6A 1T83A 3MO1A 5IQ7H 3E9UA 4WI8A 3MBWA 3HI1A 3QYMA 2VERN 5DZOA 5GS0D 2XIBA 2HN7B 1CLVA 4N8UA 4DEPB 4CC1A 4W9LC 1IGYB 3RI5F 2JB5L 3CZSA 3LPGA 3U0TB 1O6TA 4DVRL 1S3KL 3V7AE 4G7QB 1MCDA 3KPNA 2R0ZH 1KPVB 2VW7A 2X0VA 3SE4A 3V6BR 5F89A 4LSRL 2DYRB 4QPEA 3A47A 2QQQA 4YIQA 2XFXA 2J1YA 3GTTA 3VI4F 4FNLL 1NBYB 1G9NL 3FCBA 3RVXC 3EDJA 1D6EA 3KPMB 5HI5D 4GBXD 1I1AC 4A6YA 2F1BA 1X7TA 5EO9A 4HOZA 2ZCZA 2A6DB 4IEFA 3QDGA 3VD2A 3II1A 4ZUVB 1G1KA 3PPSA 1LD9B 1FN4B 5J6HB 1U8IA 1NAMH 3UO8B 3X12A 2QMJA 3WKQA 4TUOB 4YC2B 1TMQA 3K6SA 1D9KA 3FUIA 4IMLA 4X80L 1CVSC 1R3HB 4BZ1L 4NXSA 1S7SA 3FSZA 1KBGL 5CR1A 1QKZH 2OMUB 3CFJA 4PP2A 2Q7YB 1T4WA 3TT1L 4APQA 5E94A 3EHBD 4DKFH 1S8DB 3IDGA 5JA8B 2LVEA 4M43L 1GYCA 4MD5B 2NY3B 1DBJH 3CX5K 4J3BA 4BM7A 2IJ0C 1BQUA 1NL0L 4QRTA 2NTFB 3BT2H 5C1MB 1E6JL 5T1LA 3MJGX 3NJXA 3VGBA 3QCTH 1MLCA 2DWXA 3KJ6H 4KKBC 1P7BA 1XH1A 4LVHC 4IBYA 4Y1AB 1RKRA 4HUWA 4AG4L 2OZ4H 4K5OA 2YD8A 1JWSB 4G9FE 1NGXA 1T5XB 1W8EA 2IOMA 3H9ZA 1G7IB 2D31A 3FOMA 3HLAB 3W0WB 3QXAA 4I1NB 5BV7L 1EMTL 5EDXA 2PYEA 1EJOL 1HI6B 4KJYA 1I7RA 3IB4A 1MIEL