4MJJA

Crystal structure of the c2a domain of doc2a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
128
structure length
116
Chain Sequence
b'ALGTLEFDLLYDRASCTLHCSILRAKGLKPDPYVKLHLLPGACKANKLKTKTQRNTLNPVWNEDLTYSGITDDDITHKVLRIAVCDEDEFIGEIRVPLRRLKPSQKKHFNICLERQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Double C2-like domain-containing protein alpha
publication title Crystal structure of the C2A domain of DOC2A
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 28
structure length 116
sequence length 128
ec nomenclature
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4mjjA00
4XX5A 4WWPA 3TL5A 1DJYA 4ANVA 4Y1SA 2YRBA 3NSJA 1RH8A 3TWYA 4J6IA 4WWOA 1DJZA 4DNLA 2ENJA 1QATA 2CJSA 4JPSA 2K4AA 2Q3XA 3DBSA 4OVUA 2DMHA 4BFRA 2K8MA 4FULA 4QJ4B 3L08A 3HHMA 2K45A 3PFQA 4LT7A 3T8MA 2B3RA 3RPBA 4F91B 4L1BA 2D8KA 4GNKB 1DJHA 3KWUA 3MJWA 5KJ7E 4QJ3B 4XE0A 4KZCA 4FJYA 1K5WA 2Q0ZX 4FA6A 3DPDA 4EZKA 4PS7A 2WXKA 2R83A 3TJPA 4FADA 4ANUA 2CHWA 4L1LA 1DJWA 2CHZA 4HVBA 3QK0A 1YRKA 4URKA 4F1SA 1A25A 4NPJA 3W57A 2WXNA 3W56A 4WEEA 3SD5A 1E90A 3PYCA 3FDWA 2ZKMX 1GMIA 3ML8A 2WXHA 3PREA 1DJXA 4L2YA 5T8IA 3L9BA 3CSTA 2ISDA 3FBKA 3M7FB 4LCVA 5CCJA 2BWQA 3APDA 3L17A 3B7YA 3QJZA 2CM6A 1BDYA 1HE8A 2N1TE 2WXRA 3L54A 4Y1TA 4GB9A 2FJUB 1UOVA 3IM1A 3APCA 4ICXA 1E8WA 3F05A 4QAMB 3ZIMA 3GPEA 2Y3AA 4FLHA 4DK5A 1RLWA 4EZLA 4EZJA 4IQHA 5CCHE 4F92B 4IHBA 3HIZA 3ML9A 4AOFA 4A55A 1UOWA 2CHXA 2WXPA 4MJJA 4ANWA 2NCEA 2WXLA 3R7QA 4FJZA 4TS6A 5H4ZA 3ZW3A 5EDSA 2RD0A 1RSYA 4LDCA 1W16A 2LHAA 3L4CA 4KZ0A 4XZ4A 3QARA 3JZYA 1TJXA 2WXGA 3CSFA 1QASA 4WAFA 4ANXA 2A5UA 2ENQA 1DJIA 1BYNA 3LJ3A 3OAWA 1V27A 3QAQA 4NP9A 4HLEA 1E8ZA 3APFA 3ENEA 1WFMA 2WXOA 4V11A 5JHAA 5H4YA 2FK9A 2UZPA 4G11A 1DSYA 4FHKA 3S2AA 1WFJA 2QZ5A 2CM5A 1E7UA 4FHJA 5JHBA 1E8XA 2DMGA 3R7RA 3OHMB 1E8YA 2WXQA 4ICWA 3PS6A 3L13A 3ZVVA 1DQVA 1CJYA 3QR1A 3F04A 1TJMA 4TV3A 2WXJA 2YOAA 3L16A 4NPKA 4PS3A 2Z0UA 4F93B 1UGKA 2A4ZA 4OVVA 3F00A 4L23A 3IBEA 3PRZA 3RDJA 2QZQA 2K3HA 3NZSA 4AJWA 4KITB 2X38A 2WXIA 2V4LA 2ENPA 1BCIA 2CHDA 2KI6A 4NS0A 4WWNA 3QR0A 1E7VA 3P2BA 2EP6A 1DJGA 4PS8A 4QJ5B 2WXFA 2JQZA 3HN8A 4TUUA 2NQ3A 3KWTA 4BGDA 2NSQA 3NZUA 5CCGE 3F01A 5G55A 1W15A 2CJTA 3N5AA 5G2NA 2WXMA
chains in the Genus database with same CATH superfamily
1R3IL 2L8AA 2R29L 3DTXA 3P30H 4X2UA 3LHPL 3W5NA 1A9EA 4TTDC 1VADA 2P44B 3BP7A 3FQUB 5AKVA 2H1PL 1VCBC 4HUXB 4LGPB 3T0ED 4K5LA 2CGZA 4FFWD 4LDOB 4Y9CA 3V2AR 2VUKA 2GSGA 3C9NB 2K4AA 4GI9A 4O5LH 3WU1A 1CR9H 2A9MH 3CTTA 2PR4H 3QJFA 2DYRB 3L3KA 1D5MB 2AEWA 3P73A 4FGMA 4K9JA 3FOMB 4ODTH 4PRID 2VZUA 3HZYB 5HY9A 1YEHL 4XNQB 3VYPA 3DX8A 1HHKB 2CWRA 1TZGL 2H6OA 4EIZC 4HW6A 4F7EB 4PS7A 4I48A 5FYJU 1IGTA 3BN9D 1RUML 4I9XA 3KPQA 3UAJD 4LP8A 4CBPA 3OG4B 2X4QA 2GTZB 1NC4B 4UQ2B 3LH2H 4EZMA 5CFHA 1A66A 1HWHB 5E1AA 2X89A 3HVNA 1U8LB 1SF3A 2MCPH 3V5HA 3MRQA 2BNQD 3F6LA 2VOTA 4MA7L 4NZRL 4M5TA 4I0PA 1PTZA 1YDPA 3G9VA 3OHXB 2C1OA 3WHXB 1PIFA 4MHHG 2VLRA 3TNMA 3K72A 3LRSA 4RNRB 2KS0A 2OTWA 3QDAA 4Y5XC 2V3FA 4K7PL 1AAJA 1KPVA 4QCIB 1U3HA 1U8IA 3NK3A 4R0LB 1XGPB 5B1BB 4O51B 1LMIA 4PW9A 3DXAB 4UILL 4HJIA 1EDQA 1EJOH 2LU4A 2YD8A 4HIJB 4JCWA 1NLBH 4OKVA 4F20A 4LHUD 3BWSA 4MMZC 2AJZA 2IQ9L 4HEPA 1D6VL 5MI0C 1E42A 3K2IA 3QI9D 5T5FA 3H9SB 3GSQB 2YRZA 1RUQH 2EABA 4JFXB 1DFBH 3QQDA 4HK3J 4FNQA 5E2WL 4FZEL 4YE4L 3QNYB 1AFVH 1VESA 3GPSA 5DURD 3SOBH 1MW1A 2M83A 4D0BB 2WB1A 5EEUA 2GI0A 2Q7YA 4MCZA 1O5PA 3BVDB 3SKJH 3O4OB 2WXOA 1ZMYA 2YXFA 3NA9L 4G11A 2GUYA 3BAEH 4YK4C 3PWUB 1JNNL 4NC1E 4KK6C 1TSRA 2XN9E 2WBJD 4XP4L 2V5RA 2PUQT 3ZVVA 4JB9L 4TKWA 4ZS6D 4Q9QH 1L0XA 3L48A 3MYJA 1WFIA 5IQ7H 3EBHA 3ILEA 3MODH 4R7NB 5DK2B 4ODUA 4WI0B 2C9AA 2ED7A 2HH0H 1RZGB 2HTLD 4XRCA 3LB6D 4OD3H 1RPQA 5ADPH 2TSBA 1U92B 5F70A 2ICES 4DGIH 3KLHD 3LXAA 1J9QA 3KS0J 5GHWH 3PL6A 4ODHH 3IFPB 3VGAC 4QHPA 3DSNB 3K8LA 5L4MA 3NABH 3LRGA 1Z2KA 4Y1SA 2VR8A 5KYUB 3WUWB 4EI6A 4ZUSB 3BGAA 2OMNA 1DDHA 4ZFGL 3INUL 3B2UD 1TETH 2GEEA 4PGDB 2VLME 3MQIA 3VH8A 3L08A 3QGVA 2NZ9D 1NM9A 5KBKA 3HC3L 1QKZH 2Y7QA 3H4FA 3VG0H 1NAKH 4UT9A 5IM7A 1YMHB 2OCCB 4U0RC 1GGCH 4PR5B 5L2JA 2OL3A 1KFAH 1T1WA 4J4PA 3QULB 1A7QH 1HCYA 4LVNC 4R5TA 2R83A 1E9QA 1JWUA 5GJTL 2P7TA 1R5IB 2YLHA 3AY4A 4N2OA 4HJGB 4QOKA 4TNEA 1E5ZA 3BYYA 4C8XA 4BKLB 4LOEA 2Q1EA 1NMBL 1O6TA 3HCVA 5D2NB 1TYEB 5J5EA 2DQIH 3QE5A 3GIVA 4WEEA 3LNDA 2E9IA 2EDTA 2KQMA 3OF6D 2FECL 2FO4B 5FWRA 5I1KH 4M03A 4UNUA 5J6GB 3ZMEA 2V2WB 1E4XI 2IFFH 3MPCA 3NCCB 3IDJA 2QSCH 1MCHA 1NBYB 3TP4A 3J27A 2W9EH 1PS3A 3U46A 4XO4A 3WSQL 3BIKA 3SYCA 3WIIL 1O75A 1ZT7B 2V2XB 3AREC 1Z3RA 3S48A 2GBTA 1EQWA 3QIBA 3BQVA 4NZTH 3BAYA 1CIUA 3RWEA 1XB6A 4JKPH 4ZPVB 3LOWA 2VMEA 3H4HA 4FXGB 1T66C 2CHXA 4L0ZA 2HRHA 3II1A 1MF2H 4QXWA 4XVJL 4XN4A 4Z7UA 3TIDB 1T4KA 5GRYA 4S1SH 2EECA 2SEBA 1O5DT 4YMPA 4YHLH 5DHMC 2H5UA 4QAWA 5JYMA 2OXGB 4PWIA 3OKYA 4YBQC 1BVKA 3RGVC 4AV5A 2WXGA 5EN2A 5HGHA 4OLYH 3MRBB 1VEMA 5FGCE 4EUPH 3QEQA 4BCXA 1EV2E 4UB0L 3RB7A 1FJ1B 2NNCA 2B5IB 1CD1A 3RY6A 1MRDH 1F0LA 1XEDA 4YO0B 1H5BB 3DX3A 1FFRA 2UWEE 3BAIA 1C7TA 4RWYH 3VWJA 5JNYA 4O2EA 1J5IA 3D9AL 1VEOA 1M7IA 5G4MA 1WH0A 1NEZG 5DCCA 1WF5A 4JN1H 3BISA 3HMWL 4LL1A 1FL5A 1G7LB 2BSTB 2I07B 4FEMA 2XTJD 4MDJA 2V2TB 2Y7SA 1KACB 2AEPH 5EF2A 4DCQB 3BYTA 4UTAA 4X9FA 4GW4B 4WHYH 3BUDA 3NQKA 1FP5A 4MSWB 4PBWD 2YBRB 5IJKA 4QRPE 1ZHNB 2KI6A 5CP7B 5BOJA 4LOFA 1QEWA 5I17A 5FA3A 3FUDA 4LL4A 2J12B 1PDKB 3MUY1 2Q2LA 2VR9A 3WYRA 4U49A 2OMTB 5FKPB 2ZUTA 4NQCA 4JFEA 3JVGC 1A3RL 1W91A 1WIUA 2VDKB 3N1GC 4OV6F 3HG2A 1TZHA 1SJEA 1CLOL 4UDTA 2P24B 1XH2A 4PJCF 1AZRA 3QORA 1YEEH 1ZVSB 4ACTA 2MHAB 1YNTF 5I6XB 5DQ9A 3HC0B 3MV8E 3IN2A 5ID0B 1D5RA 3DGGB 5KYXB 1NL0H 4ONFL 2UVEA 4TYUA 3ZGIA 3KYOB 2B16A 4Y4KC 3ZE1B 2JJVA 5E1QA 2ZUVA 2X4NB 2XZAL 3H0TB 5D5MF 1G4MA 1PSKH 2CIKA 1A4CA 4K0OA 1L6ZA 4LLYA 1OCCB 4HX1A 4YHPA 1N6VA 2IDFA 4IRJD 3TCTA 3NJFA 4N6RB 2UY6A 3WJJA 4PCSA 1MAMH 2FZ3B 4MS6A 3Q8CA 2NUTB 2HMIC 4D9LH 5ITFB 3VNZA 2Q20A 2GY5A 3MSPA 2AJYH 4E5XB 1HHIB 1CLZL 3PQYE 1LEKA 3GHBL 1ORQB 3HE7C 3VRIA 1A3LH 1OAKH 1XIWD 3O6FC 1F97A 1AKJA 3BP4B 1JGVL 1EHAA 3HLAA 4MA8L 2DLFL 3BVUA 3TNNA 1N4XH 4AGLA 4WWKD 1HQ4B 2YN3A 1U8PA 3AQXA 4D0CA 5BRPA 1RSYA 1XV8A 4R4FH 4XNXL 3O9WD 4DN3L 2ZP0T 4OLUL 1KEMH 3FT0A 3G6JB 3X3FL 1TVHB 2IALA 3NIGB 1JZIA 3IPEA 1UB6B 3F8UB 4JZJB 4IBQA 2A6DA 4I77H 1VFAA 1WA0X 1QFHA 5FCSH 3QO0B 3TESA 3IDNB 1O7DE 4XH2A 4X6CA 5B39A 5I18L 1CL7H 5IJDC 4H0GA 2WWOA 3QJRB 2H32B 1AYOA 4UQBA 5HVHB 2E56A 5D1QE 3T4YA 4NWTH 3WMQA 1J11A 2I26N 4Y4FC 3O8XC 3U0WH 1KB9K 1R34A 1M7XA 4PLJC 1B6UA 4JKWA 4NO2A 4F7CB 2IAMA 4G8EA 3Q0HA 3WE1A 3A4EA 1CBJA 1M9SA 5T3ZD 4PLOB 2ZUYA 4JG1H 4OUOA 1FSKB 2DQUH 4S1DC 2FYVA 4F7PA 3S35X 3CE1A 2ZTBA 4KRPC 5CMAB 3DBXB 2ZNWA 1N2RA 1TNMA 3SDAC 1Q9LA 1EUUA 2KT6A 3HZ3A 3EOAB 2EE9A 4BZ2A 1SXBA 1MCIA 4Z0BL 2ALWA 4YHYC 4U3XA 5CZXD 2DQEH 3HBGA 1RUKL 4N9GB 1TITA 4JFFA 4KMTH 1DJHA 1N6UA 1NCDL 1Q38A 1ZA3A 4QJ3B 3CD4A 4XN1A 1LO3H 3FQ1A 3T71A 3ESNA 5FUOL 2OK0H 3UJTL 1PBYA 2WXKA 4DTGL 1UD8A 4HHAA 3MDJA 5GISH 2VLKB 3HHSA 2CNZA 1H6EA 3IFOB 5SWQB 4KKBC 5CHNA 3L2MA 3VI3E 3M6DA 3IJ8A 4KPHL 5L88H 2AITA 2EAEA 2E7HA 5KVFL 1R3KA 3E9UA 1HJCA 4YHIA 2BDNH 4DAGH 5F88B 4OZFA 5I9QB 3G3LA 5LVEA 1A0QL 4LCVA 1IMHC 2V9RA 4YDKH 2QGCA 1SPDA 5K9QG 4BXVA 1QI3A 3BZFA 5TK4A 2WBXA 2Z35A 4KH2A 5C3TA 2HT4C 4R4BB 5H37G 2QQNL 4QXGL 1P5UC 3MUJA 3ARFA 1OIOA 2EXYD 3KCWA 5GXBB 1L4IA 3EGXA 3IXTA 2VDMH 3RGHA 4HWNA 3L3HB 2WTRB 4M8VA 5DJ2B 4JY4A 3X14B 3VACA 4NNXB 5CZRA 2FWOB 4PD4K 3UCRA 2B77A 5IHUH 5KG9A 1J1OL 3K91A 2ITDB 1MXDA 1A22B 1PD1A 4NKIL 4PJ7A 1UOLA 5C0FB 1F4YL 4XX1E 1DVTA 2F5AH 4H8HA 1B0GA 3SYOA 5HJBA 3MJ9H 4UF7C 4R7VA 2OSWA 1VA9A 2ALAA 4HCFA 2AW2A 2HG0A 5TE4L 1EXGA 3NTCL 2OR9H 2O30A 3ELAT 5A2JH 3ME0A 1NUDA 1IKNA 1CTMA 5ALBL 3PHQA 1W0YT 2V17H 3ZYOA 2J8HA 3L16A 4GS7C 4WSJA 1FV1B 4JRLA 2XBZA 4XPTH 2ADJA 4JGNA 3D69A 1OP5K 1LEGA 2QKIA 1YSOA 3SJVB 5D7JB 4TUJB 2W60B 4OAWB 5L9DL 4BGDA 2G2RA 4CRPA 4OZGF 1H8NA 2X9XA 3SDCA 1DSFL 4B50A 4DKAA 4ELMB 4N5UA 4WFHD 5E6IA 4BWUA 1JGDA 5ALCL 4N2BA 2AK1H 1DJZA 5GQBA 4PRAB 3TU6A 3MV11 3FO9A 5GJSH 1KB5H 1NGQL 4YSPA 2SODB 5I8CB 1K8DB 1F2XK 3MA7A 3OKKB 3SGKA 4Q97A 4CL7A 1IZJA 2Y5QA 1QFUL 1EJ8A 3UMNA 3VI4F 2YD4A 3D6GA 1YJDH 2Q86B 4CVZA 2QPDB 2JKNA 5IF0B 1AP2B 4XPAL 1YJDC 3T2PA 4L3CA 4NZUH 2VSCA 4V1DA 1AGDA 5AOJA 2PCPA 4GLRI 5JQHC 5EIIA 2Z31C 4FTVB 3FXIC 1G0XA 1E30A 1NJ9A 2YXMA 5HHPB 1GY1A 1S7TB 5FECB 5K69A 1I7ZA 1OGAA 3KPRB 3IETB 5E2UH 2OMVB 4GAGL 4N24A 1VERA 5AOMA 5FAAA 2BVEA 4GUPB 2X4OB 2J5LC 3LZPA 3B1TA 1YNLL 3FCSA 3Q7JA 5F72S 3MLZL 1Y1DA 2J57A 1P6WA 1F6AA 1RU9H 4PG9A 4MNGE 4ZO6A 5D7IA 3OAUL 3P3UA 2C7UA 1QLFB 3MRKA 3C8KA 5SX5K 1JL8A 4XAKE 2EDQA 2FL5B 3VXRD 1F13A 4F33B 3HG3A 3RWJA 3OXRB 1X9UA 2UXGA 3ZHFA 5C0CE 2AVGA 1ETZB 3QDGB 1PLBA 2ZSVB 4JFOB 1KENL 3II2A 3B34A 4QXTA 5FHAH 4OI7A 2NUPB 4PJ9A 1JN6B 4PWKA 3VFVB 2Z4QA 4NAJA 4WF7A 2LLLA 3HN5A 1DLFL 1LD9B 3TCXA 3RL1A 3KM2A 1VIWA 4CGTA 1IAIM 1HYSD 4MXVE 1VEPA 4OCRL 1YEKL 2ZPKL 2VDLB 4FXKA 1TUPA 1YY8A 2EACA 2AEIT 2P5EA 4M3JA 5BW7C 1UZGA 3WCYA 5ICYA 4BWTA 4YQXL 5CILH 4AYID 2XY2A 5HHMD 1I9IL 3TTYA 5GS1B 2CM5A 5CCKH 1QRNE 4OT1L 1I8MA 1NOFA 5GSRB 1CDUA 3I6SA 3UTSA 3QDJE 5GZNA 3VXMD 3LPGA 3A5VA 2EDLA 3BEVB 1BZ7B 3D3VB 5F0LB 5BO1L 4AQ1A 2W0LA 4MNQD 3MMEB 4JRYB 4QD2E 2BPBA 1LP9A 4OGYL 1B3JA 2PP7A 4Y2DA 1NFDB 3U6RB 2K3HA 4PHZA 1DO5A 1WQVT 1XEUA 3DTXB 2KDYA 5AOIA 3U6XS 1ACCA 1A9EB 3GIZH 1VADB 3BP7B 3PDDA 3TBVB 5CLYA 4BH8A 2VAAB 2GSGB 3GO1H 4ZOBA 1NDMA 4JFUA 1ADQH 3U2SA 3A6OA 1RZ8A 4Z7NE 3QJFB 4R0LC 3L3KB 3P73B 4XWOC 2J1YA 4D9QD 2OJZL 3RVTD 3VXSD 3WN6A 3EHBB 4IMKC 4XWGH 5HY9B 3CH1A 4FULA 3DX8B 4QTHA 5DRZB 2X53A 5AOZA 4GMTH 2O93L 2DOCA 5CLTA 4I48B 5F7EH 4DOHE 2GBAA 5TPWH 1IGTB 5HHOD 1DL7L 5FXCH 1VHPA 3FKUS 2X4QB 5SV4A 4HFWA 2C4XA 5JA8B 5FA4A 3N9GL 3OMZA 4QXVA 3RDTA 4CGUB 3GJEA 4QRRB 1I9RH 5E1AB 4HWZA 5K9JL 3NPSB 2JLLA 4KK9D 3JWNE 3E8UH 4PGBA 3V5HB 3WE6A 2VR5A 3MRQB 1OWWA 4ZSOA 4I0PB 1S9WA 1YDPB 3RJOA 3VFMA 2C1OB 3TNMB 2VLRB 3GMNA 1ED3A 3K72B 1RK1A 2A6JA 3LRSB 3N50A 4OIIH 1ACXA 2OTWB 2VMCA 3S37X 2WYHA 1RZ7H 3A22A 1L9SA 2P45B 1U3HB 1U8IB 3JTBA 3MX0B 3N0PB 4R8WH 2ZX9A 4RVBA 5FOJA 3SGEI 4KQ0A 5A16A 2NW2A 4KKAD 3QRFM 2MQ3A 4XVTL 3RQ3A 5FYKE 5D72H 5F3HA 2DKMA 4AX3A 1BG9A 4OKVB 1XF1A 4ZMVA 1PEWA 1U3NA 1INEL 4AUUA 1IE5A 3NK4A 3VFTA 2AJZB 2HG5A 1RHFA 3OVUB 3BVNA 1QAWA 3U7WH 3FO1A 4Y1AE 2VSDA 5JW3H 5FO9A 3IFNL 3IDXL 3QQDB 4GO6B 4MJJA 2VR4A 2JKRM 1TNNA 3UTTA 3LN4A 2A0LD 4PREA 3BJLA 1EAJA 2YXVA 1I8IA 2O5YL 4FFYA 1G7IA 2Q7YB 5I1LA 5KZCD 4JE0A 2Q9OA 3N42F 4MCZB 5JORA 3QCVL 4ZO9A 4A6YL 4CC0A 4WY7L 3ESPA 2ZYIA 2K78A 4RH4A 3MGAA 3DYOA 1JXGA 4KKCD 3MCG1 1RI8A 3EO1A 4A7VA 4JK0D 3HN3A 3RVVC 3MYJB 4OSUH 5KS9A 1NPUA 1E2VA 1S9KC 3S0PA 4DPAX 1SBSL 1WPCA 1RZFL 4AW7A 1BXVA 1HAWA 5DVOA 4XRCB 4WO4B 4DKEL 3VNYA 4H8PA 4X5LA 5A1AA 2VUYA 5DUJA 5E8PA 5D2NC 3HEIB 1HKLL 3O6MH 3TYGL 4NRXA 1DO6A 4L23A 3PL6B 5CGYD 3NZ8A 5F0MB 2L7JA 3SDXF 4YX2H 1E7VA 4OCNC 4PBXA 4EI6B 5L2KE 1DDHB 5GS0H 1FNSL 4KI5C 4ZFQA 2X42A 2GB2A 3GM0A 4WK2B 3VH8B 4F5CE 5GS0C 3S98A 3ASOB 1SOQA 5KYNA 1XGZA 2OSXA 2Y7QB 1NIAA 2HT3D 3CIAA 1KUMA 3GTTA 3LRHA 4G9DA 5IM7B 5B8CA 5L2JB 4X98A 4MDIA 2OL3B 1FAKT 2Z7WA 1HFUA 1T1WB 3AG2B 1RFDL 4FXGC 5I5JA 1E9QB 1JWUB 1XGRA 2P7TB 1A64A 4GQRA 4QOKB 3U9WA 4GRLA 3WKML 2HTKC 3LMJL 4PN6A 3HCVB 4QHNA 1KYUA 1QFPA 3GIVB 3QQ3A 1R47A 3H3PH 4A7GF 4LNRB 3OMIB 4XN9A 1FAIL 3JV5A 4G5AA 3IDJB 2B5IC 1SJMA 1ZDQA 2KKQA 4IU3A 4P46A 1H5BC 1OAYH 3T3PE 3U46B 4HU8A 2F6AA 2DTMH 2HN7A 1YVLA 3BIKB 5ERWA 4BFOA 3TCLA 2JCCE 3BPCA 1IAIH 2EZ0C 2JJSA 1DUYA 2VZSA 2FRGP 3IJEA 2CLVA 3QIBB 2X9ZA 5FGBC 4PPTA 5AWNH 4P57A 4ADJA 1B2YA 3LZOA 4PMFA 4RMQA 4EJ1C 5LXVA 4LP4A 4J12A 4LNVA 5MEPA 1QX1A 1IQDA 4Z7UB 1PLAA 1T4KB 3K4AA 2SEBB 3QRGH 1A4BA 1NMCB 3HFFA 2J4WH 2BO0A 4A55A 1JZ8A 1BAGA 1T5XA 3AS3A 4PJEF 5EN2B 1YYCA 5HGHB 1Q1JH 3QZNA 3ZHKA 3D18A 3CSYA 4DK3A 1GOFA 3QEQB 2VDKH 1UCBH 1CD1B 4J3VA 3FQNA 5IMLA 4KAQH 4OCSL 2DI9A 5E0FA 1ASOA 3VWJB 5JNYB 1BZ9A 4O2EB 2J73A 1M7IB 1FZJA 4YDZA 4KK8C 5GGTA 1FL5B 5I6XC 2A2QT 3MBWA 4MDJB 1IM3D 2YAMA 2VCOA 3MLXL 5IB1B 5I2IA 3HHRB 2VLJE 5AYUL 3HBZA 3AMKA 5DUPH 1QEWB 1XGQA 5I17B 1VFBA 1OARH 2EDYA 2HPOA 3UP6A 5FA3B 3DURA 1GRWA 3GXPA 4ELKA 1MNUL 3UH8A 4JFEB 4RMBA 3RE0A 1EZVY 4NKOB 3D33A 4XNMA 1TZHB 3NZUA 1KELL 3NCJH 1SJEB 4UDTB 4R9HA 2R0ZH 4U1KB 3BUQA 3NSJA 4ZMXA 5BQDA 3NPZB 1ACZA 2DQFB 1WGVA 3ZDXE 5DQ9B 3RKDD 1TQTA 2BRQA 3FT2A 4KFZC 1MVFA 3VXUD 1BQSA 1G7MA 1IGCL 4Q2ZA 4AENA 3W38A 4ZUUA 1A7RH 4BUQA 4LEBA 2FBJL 2CIKB 3RUGA 1TDQA 3WD5H 4LLYB 3F7RA 5E2TL 1KJ2L 1WCQA 4U1IA 5IWLC 2HLFD 1TCRA 2MEJB 2NRDA 3X13A 2UY6B 1LK2A 1ACYL 1BEYL 3OZ9H 4JO3H 4JZJC 4OUUB 4JZNA 3AWFA 4L1DA 1Q9OB 2FSEA 4P99A 4FQLL 2H32H 3IF1A 1LEKB 4G59C 5HVHC 1K85A 1JYWA 4U2ZA 1K6QH 5IEKA 4IOIA 4H26A 3K71A 1AKJB 3S3BB 1U33A 4URTB 4KVNH 2K1MA 3HLAB 4L0YA 2VDOH 3TNNB 2AQ3A 4XTRC 1FFOB 4ZJ9A 4Z1PA 3ATEA 5CM1A 1RKRA 3ZIMA 3RB5A 2UZIL 4BK5C 3WEXA 4DSYA 4X4XA 4M9PA 5DFVC 3VSVA 1FSKC 2NNAA 4FG0A 4QRBA 1MCDA 2WBKA 2IALB 3UAFA 4AVKA 4G6AC 1DQKA 4R90H 4ZTOL 1AE6L 3B8YA 4TMPA 5EEWA 1YEIL 5IJVA 1IFGA 2A6DB 2EIZB 1VFAB 5CGBA 4OJCA 1AY1H 3H3KA 4W9CC 8PAZA 1T0OA 1R3LA 4OD2B 4XH2B 4X6CB 5C0AA 5B39B 4OCXL 25C8H 1LO4H 2I60L 4LO9A 5HD8D 4N1EA 5SWSD 2Q8BL 4F1ZA 3T4YB 5JPMB 1BHGA 4PRIE 2VT0A 1TXKA 1CF8L 3C6SA 4QRPA 2GCYA 3RWIA 1P7KB 4NO2B 2BWDA 4P2OA 4YXKH 2IAMB 4M56A 1HQRA 3RWFA 3P30L 3T04D 4NCC2 1AQKH 1LO2H 2K4WA 1R0AL 3QIWB 1GPOH 1MFBL 4F7PB 4ENZA 1DVFA 2X1XR 1PFOA 5AALA 3QO1A 3WTTA 1CR9L 2D7QA 1N2RB 4NAMA 3CFIC 4EI5A 5I9QC 4ODTL 4EQ2A 4TUUA 2FE0A 5KUKA 5G55A 4PJHE 1QLRA 3MV8A 1CIDA 2G3MA 1OTSC 1ZA3B 1GZHA 3LPOA 3LH2L 1JGEB 4IGBA 1V10A 4XMPH 3BLPX 4HHAB 4XC3H 1DBBH 1MAJA 4GRWB 4OZHE 3UTPE 2F7IA 2P8PA 4LK4A 2EYRA 3O45A 2AKRA 3HHSB 4M4RA 2IANB 3L9YA 2HJFA 5KVMC 1TJHH 5CHNB 4Z8FH 3BUTA 5FYLH 4ANUA 5C71A 5DT1L 3C2SA 3PAUA 2CHWA 4YR6A 2F54A 1P7QA 4YSDA 4OF0A 3ZQ9A 4YHIB 5IESL 3CXDL 1FLTX 3CLEH 4LPWA 3DO3A 1EJOL 4XGZA 5C0EA 2JIXD 4GBXD 4YBLB 5J6HA 2Y9RT 1QW9A 4JM4H 3BZFB 3OXSA 2GJJA 2VM9A 1J12A 2Z35B 1CICD 2NT1A 2XXFA 3V9CA 3RJDA 1MHCA 2QVKA 3VUAA 5LG6A 2VDNB 4W70A 3EGXB 1UOVA 4BQCA 2XX1A 35C8H 1UM5L 5B1KA 4M02A 2UWEF 1AFVL 5CKAA 4JY4B 3DV6A 3QNZA 3DROA 5D7JC 1BXUA 2WIIA 3HBQA 3LKRA 3KPMA 3BH4A 4Y9GA 4AYEC 3D87B 5KG9B 5IB3A 3MGOA 2YPLB 4H1LG 3SDYH 1E67A 2I5YH 3L4CA 3NJXA 4PJ7B 1HI6A 4KXDA 4WI9A 2EXTA 1JTTA 2ZUXA 4CN4A 3WFEH 1UEMA 4Q9QL 1B0GB 1QG3A 3DVFA 5IQ7L 1IM9A 5GGVL 2F19H 3LJ3A 4H8WH 4P5SA 3UJJH 1RVFH 4H8WC 3ME0B 4HGMA 4RRPA 4GQZA 3PHQB 1FNGA 4A04A 3ENEA 3QPXH 4XHJC 2BSCA 3FUKA 4OD3L 2HT2C 4AIOA 5ADPL 1EBPA 4DGIL 4LPXA 3OJDA 4AEFA 2ZUSA 5BXFA 4JHZA 5GHWL 2KDGA 4ODHL 2ADJB 4G7YH 4G9FE 2V0AA 1ZLWK 5FF6A 4JG5A 2QBWA 1AGEB 2IDSA 4LSUH 2F58H 3NP3A 1TETL 1TF4A 1GOHA 3GD1C 1WAAA 2KLSA 1RLBA 2J55A 4YZWA 1KCVH 3SDCB 1S46A 5C92A 3JSSA 4IW4C 4M1CC 3P0YH 5E6IB 3VG0L 1JGDB 1O6SA 3CK0H 5GRJH 3NN8A 1C7SA 1GGCL 3GJFK 4LOUC 2F1EA 4O58L 4UT7L 4XR8C 4YOKA 1Z9MA 5ICXA 3V8CA 1KFAL 5I1EH 2W38A 2BNRB 4XN8A 3FO9B 1HWGB 1P2CA 4TQEH 4U7SA 3CDFA 1IU1A 2YK1H 3MA7B 4EVNA 1YYLH 3BH8A 1E3FA 3I74A 1MFMA 4CVZB 2RALA 2EDEA 2DQIL 4KUZH 3P4OA 4AYBA 4M1GH 3S5ZA 4L3CB 4V1DB 1AGDB 5B38B 3VI3A 3L7FA 2PCPB 4YGAB 5GPRA 5EIIB 2K0RA 2L7UA 4YHNA 2CAKA 2ZCKH 1EBAA 3BQUA 3DUUB 4HBCH 1I7ZB 1KF9B 1B3IA 1OGAB 1ONQA 2VRKA 1PEZA 2W9EL 4OIBA 5I76A 4R2GD 2W07A 1YUKB 4H0LC 2VDLH 5IQ9A 1BFOA 4PEEA 2NY7H 4AH2A 3C6LD 3QK0A 1UKSA 2R51A 3FCSB 4HV8B 1JDAA 5GS3A 4NZTL 2ZWYA 1HZHH 4F9LC 3FDWA 4JKPL 4P3WA 3D06A 1F6AB 2QFRA 1C5BH 2VDQH 2XIIA 3P4MB 3C60A 4FQXA 1KIUA 3F6IA 4HCRA 4PG9B 4XOAA 2NTFA 5GS1C 2PKDA 4XXWC 2C34A 4XO3A 5D7IB 1BQRA 2C7UB 3MRKB 3C8KB 4IYKA 2WQXA 4S1SL 2V9UA 4GQ9L 4RWHA 5C9KA 2XTJE 1CPUA 3FAXA 1WVZA 5E8DH 3RWJB 2JXMA 3ILQD 2AQTA 1NCUA 4OLYL 5AW8B 2GK2A 3U7AA 5DFWH 4QXTB 1FNEA 3G5YB 4PJ9B 3K1DA 1MRDL 2Z4QB 1SLVA 4F8OA 4OV5A 3RL1B 3H7LA 4OI8A 2ESVA 4LLMA 4HFUL 3OKMA 1E3ZA 5EH1A 4FXKB 2NCMA 5KW9H 1YY8B 5D71H 3T77A 2P5EB 1T7VA 2WQUA 4WEBH 4PG2A 5ICYB 4XNDA 4FCAA 5KVDH 2AEPL 3EHBC 2XG4A 2ENQA 5FO7A 2OYLA 5A3ID 2DY2A 4HLEA 1I8MB 4YXHL 2CBPA 3QS3A 4ZRGA 3UTSB 4AQ1B 5BUAA 1ZT4B 1AR1B 4YWGH 5KSAA 3MNWB 3ZKQD 1LP9B 4Y2DB 3AU0A 3R7RA 3TF4A 4Q6IA 1MJ8H 3NPSC 4ZTEA 3QDMD 5ETUA 2ZXCA 4JFTA 1QFWI 4PB0L 4EXPX 1Q94A 4GIAA 1NWPA 4OIAA 4I0PC 4MZRA 1BVNP 2VMJA 4BH8B 5EWIH 3QHFH 2D7PA 1G7QB 3GBLA 3QQ9D 4K8RH 5AKSA 5JR1H 5DO8A 4NJAH 3C08H 1NDMB 1XQ4A 4K8RC 3U2SB 1QBML 1RZ8B 2V8LA 1U3HC 5I0XA 3GSXA 2DQTH 2XFGB 4PJAE 5FKAA 4F24A 1IGJB 4JY5L 3CH1B 5DJ6A 2RAMA 4QTHB 1XDTT 3NCFB 2ZF9A 1NL0L 4K73A 5IMKB 3GBNH 3FT3A 1MIMH 4G8IA 1J8HD 3GKWH 4AY0A 2J2ZA 3D2UD 1M56B 2WLNA 4JREB 4TVUA 1PSKL 5DMJB 5EZLA 4LIQE 4HFWB 3EO9L 5T5FH 3QFJA 5FA4B 5K5YA 3RDTB 3A0OA 1KGCE 3GJEB 4GSDL 3WKNA 3K6OA 3MLYL 1GY2A 1OP4A 3Q2LA 3SQOL 1M57B 2QHLA 4QTIH 3VSUA 5FWQA 2QSQA 3WE6B 1M9WA 2AQNA 2XWJB 4KJQD 4ZSOB 1IC5H 1S9WB 3GMNB 1ED3B 2AJYL 1RK1B 3EFFA 2GPZA 3PHSA 2PWDA 3FTZA 1MHHA 4EO5A 1P84K 4EUPG 1A3LL 1OAKL 4MNGA 2BCMA 4L8BA 5DMIH 5A16B 2NW2B 3PY9A 1BJ1H 4X6DE 5AOLA 3QZWG 4HHWA 4P23D 2PWEA 1N4XL 1A8JH 1AKPA 3LNIA 1B4TA 2VXTL 5MEQB 4OQTL 3SPCA 5CSGA 2HG5B 3VFTB 4CUCA 2CALA 3GSWA 3BVNB 3ZQWA 3O0RH 3FO1B 1V55B 3P9WB 3VFWB 2H1LM 1KEML 3VGEA 1J48A 2Q6WA 4F2FA 5FO9B 1W72H 1KCWA 3PL6C 3Q2CA 4WHYG 2Q8AL 1A3QA 3UTTB 5A6MA 4PREB 3PDGA 3QT2A 2NQDA 1NCCL 1DANT 1I8IB 4ELMF 4I77L 1G7IB 5T3ZE 5J56B 5I1LB 3EG9A 4AOFA 1RZJH 5L7XH 4G7RB 1JI2A 2J8UE 5JORB 2BIPA 1RZJC 1CL7L 1I82A 3P1VA 4PRPA 3WFHA 3MACH 4XZ4A 2J1KA 3ETTA 1B0WA 3H53A 4I9WD 3EO1B 4NWTL 2OL3H 5A7EA 1OB1A 3U0WL 1N5AA 3MROA 4RISH 4P5TA 2NY2B 4FP8H 2NY0B 4J4PC 4F7MB 4NQXA 2MTAA 3VXPA 2MPAH 1AJ7H 3CSBA 3AC0A 3AY4C 3CLWA 2P8MA 4LPYA 3QPQC 5E51A 3SZ6A 9PCYA 1KULA 1HXMA 4AC4A 2DQUL 1Z32X 4YLBA 5KJ4A 5E8PB 3Q5TA 4V2BA 4AQAA 5ITBL 4NRXB 3P02A 5H94A 1ZKAA 3NZ8B 1G1KA 3MV7D 1FLRH 5EUKA 3T2NH 2F0CA 3TS8A 1EHXA 4NPKA 1M1XA 3VFPA 4S1RH 2Z0UA 3CSGA 1MCJA 2XETA 1E4WL 3ELQA 3R8QA 4X0KA 4ZUWB 5DRNA 2DQEL 1EGJA 1ZGLP 1AZNA 1UGNA 2CXKA 4KMTL 5AZEH 2F8OA 4P2QD 1GL4B 1TYRA 4G9DB 5ECJE 3QIBC 5B8CB 3L4YA 4X98B 1Z9SB 4MDIB 2F9BT 2OK0L 3OJVC 2NR6D 3BVTA 3FUIA 5TFSH 4IK7A 3AAZA 5ISZD 4DGYL 4EAEA 5B3NA 1AOHA 5DZJA 2K45A 1NMCC 3G7TA 4QHNB 5I8KL 1UACL 2IH1A 1W8EA 3GZOA 3QQ3B 4WGWB 1AYRA 3H6JA 3MFGB 1AXTH 1AMXA 2BDNL 1ET8A 2F53B 3AQZA 4YE0A 3NFSL 4JDTL 3RY6C 3DK2A 2XRAH 3Q6GH 4YDKL 4IU3B 4P46B 5HDBB 2JI1A 2BY3A 3V0IA 3VWJC 4NLAA 3KJ6H 2HN7B 5ERWB 2C9RA 2ITCB 3TCLB 1AOZA 4O02A 3BPCB 2GBVA 1DUYB 3IJEB 2CLVB 1FNLA 3PXHA 5BV7B 3O4LB 1I3RA 2YQ2A 1EH9A 3GTNA 4PY8J 1HYRC 4UTAH 1N5YH 2VDML 1HINH 4Y1AA 5DLLA 5D1ZD 2EIKB 1OSPH 3L45A 4DP4X 5MEPB 4MXVF 1IQDB 5EIVA 1MJUH 4Z7VE 5IJKC 2ZWZA 1X7TA 3GRBA 3NCWA 5T1MA 4JQVA 5IHUL 2CO2A 2R9HD 1T5XB 3CZSA 4OGQC 3D4ZA 5KVGE 5EBMB 3AZUA 2WY3B 3CSYB 1RLWA 2NNXA 2PTTA 5FOBA 2F5AL 3MLPA 2E7BA 3FQNB 1F45A 2OULB 2G3XA 5LBSA 4MFHA 1BZ9B 2WVVA 4RZCA 4ZT1A 3MZGB 2OR9L 1CLCA 1W0WA 2VAJA 3ASWA 1FZJB 1T21A 2OV0A 3JWOH 4WFHE 4H44C 4YDIL 3Q05A 3JWOC 2P5WD 1NPJA 4OF7A 3MBWB 4BQ6A 2Z1KA 2X3CA 1CFNA 2OZ4L 4XPTL 1SDYA 1FCCA 3QWRA 4PMEA 3D85A 5I2IB 4FDWA 5JMRA 3QHZH 1TTCA 2DM4A 3GSUA 3QZBA 1UXWB 4JKMA 5B4MC 5I1JH 4DN4H 2WVSA 1XGQB 1VFBB 2WKOF 1JCVA 5F7LB 4G6KH 1NAMA 3DURB 2CUIA 4ELKB 3F04A 3CC5A 3NIFB 4GW1A 2AK1L 2EUZA 3WJJC 1FL3A 5L8LB 3FQRA 4FEIA 5GJSL 2LU7A 3TZVA 2G5RA 5D1XD 1T2JA 4WWID 2WWMC 3ISRA 1M71A 4FFZA 4UAHA 4KY1L 3N44B 2ROXA 3ZO9A 2N0MA 4A7UA 3LS5H 3HJ0A 4JQXA 4ORGA 3FT2B 3VFUA 1MI5A 1IAMA 1P4LA 4Q2ZB 4AENB 2X9WA 1XTMA 4WHDA 4HJJH 4ZUUB 1ZGLA 5CKGA 3WNIA 1E4HA 3VFOA 2AI0H 5E2UL 3RUGB 4XZUA 5KSUA 3HPLA 2C9XA 2CRIA 2R1XA 1LGVA 5H37A 2FEDC 4KJWC 4U1IB 2CO4A 4JFYA 1K5WA 1LK2B 2E9GA 2IPTL 4K3EH 4FLOA 2JCCA 1FNAA 4PD4J 3WG7B 4B97A 4Z9KB 3W2DH 4JZNB 3BPLB 3B3BA 3UEQA 3MJ8A 4B5EA 1M05A 1RU9L 3SDDA 4PLNC 2H0PA 4KKRA 5JPMC 2XJKA 1WFUA 2ZCLH 4H26B 4IOIB 3K71B 5L4JA 3QUXA 3ARBA 1WJ3A 3UADA 3B9EA 1TCMA 1PY9A 3CX5K 4NIYE 5FHAL 2IAMC 3QW9A 1F4XH 4NJ9L 3ZRFC 2VDPB 1BQHA 4ZXBA 1JVKA 3QJZA 2BNUB 4LGRB 5LXGL 4X4XB 4U1SA 5TF1H 4MNQE 1I75A 4FKHA 5IY5B 2NNAB 4G82A 4P2CG 3HNTL 1J1XH 1OWRM 1I1AA 3CFJA 4BZ2H 2PYEB 1I1CA 1ZSHA 5IJVB 5FW6A 5ES4B 5J4MA 1TG8A 1KG0A 1R3LB 5GGQH 2R56L 5C0AB 2H2PD 1TTFA 5CCKL 3LPFA 3IAGC 4P49A 1FE8L 4PJ8A 4D9QE 4Y7MA 3VXSE 2VLJA 5AAWA 3NUKA 1N7MH 3C6SB 3FHQA 2B39A 2GCYB 4QRPB 3RWIB 3TJEL 3FFOA 2RH0A 1OVZA 3ZKXB 2X0WA 1IIIA 4GRWH 4IRSB 2J21A 2B7DT 2CK2A 4M7JH 1HQRB 4P2OB 3RWFB 4PTTA 1FYTD 1WC7A 4C83A 4HD5A 4M5YH 4Q56A 5IQMA 4I88A 4QXUH 4L8DA 3E38A 2DI8A 1H9DA 2WXQA 3QO1B 1HX0A 2CBQA 4N86A 2IMNA 1GGBH 2WXJA 4KWUA 2YEQA 3HMXA 1FPTH 3BSZA 1ETA1 4EI5B 2A4ZA 5D2LA 1QTPA 4XWGL 2PLTA 4HXAL 5T5NF 4W9GC 4GMTL 4RAUA 3TA3A 2R59A 2L7QA 1QLRB 5F7EL 3L4UA 4IRZA 4YBLC 4YHZH 2GUOA 4R7LA 5MEND 2GAZA 5TE7L 2RIKA 4YSEA 3F01A 2V3DA 2VDNH 4EIUA 2RJMA 3ARFC 3MRGA 2AJUL 1KGUA 4KKLC 4IGBB 5DJAB 3MBED 3EXJA 4LU5L 3PWJA 3T3PF 4RQQA 2DQGH 2P8PB 3OBAA 2EYRB 3O45B 3SSGA 2AKRB 4M4RB 4UDUA 2HJFB 4OIIL 3AS1A 3EJYC 4WUKH 4YR6B 4JY6A 2F54B 1P7QB 4YGVA 2PO6D 2Q0ZX 4P48A 1F86A 5KN5B 1UA6L 4XI5D 1CGWA 1FN4A 3LKQB 4JANA 1UADC 2XKNA 1A7PH 4HP5A 4XGZB 5C0EB 4ZO7A 2PCYA 4FABH 4PJFE 1SUHA 2R1WA 3CN4A 2YKLH 5J6HB 2J88H 3CHRA 4OFIA 4Y2NA 4XBMA 3WY1A 1IKNC 5HYJD 1S5IH 3ZT5A 4NC2B 1QHPA 4R97B 4WFFD 3NSDA 5JW3L 5ADOH 1MHCB 1D7FA 5HI3C 3HG1D 4E9TA 2BVYA 3NCYP 3RVUC 3DK0A 3QNZB 3DROB 1BOGA 3LKRB 3KPMB 1QNZH 3KHOA 4N0CD 4KTEH 1MCFA 3HS0A 5I6OA 3T0EA 2HKHH 3ZLQC 3GFUA 5IB3B 1NCNA 3QUHA 1TSHA 2OMWA 1F56A 4PSRA 5IQNA 3S5LA 3SDCC 5GRUH 5DQJB 4EZJA 3KYMA 5F7UA 2HLAB 5IFJA 5E6IC 4K3DH 1ZJBA 4F2EA 5CEZH 1HI6B 5E23A 1FC2D 2J1ZA 2WZ6A 4KO9A 3OAYH 3WN5A 4I1NB 5EN3A 4BM7A 4ZFFA 4KXAA 2K70A 5E24E 2XN0A 4XCFH 1F41A 4KXZI 4YHOH 3SGKC 1FNGB 3GBDA 5EUOF 4DQAA 3UAJA 1KDIA 2EUWA 1OW0A 1URIA 3U25A 3OJDB 1RQ5A 4MXQC 3LIZH 5BXFB 4ALAL 4CKVX 1CUOA 3F62A 2BS71 3LEYH 4K9EH 1J18A 3MUZ1 5FF6B 3SY6A 1AGCA 1FG2A 4K9EC 4EBQH 2VM4A 4K7PY 2NQCA 3WTYA 2JH2A 3NGBB 2BNQA 4TVPH 1WGOA 1D5XA 4KVCL 4HUCA 1DQVA 1GSMA 1SY6A 2K7QA 2CKBA 1O6SB 4KVPA 2PPCA 1S7QA 1K2DB 3NN8B 2FJGA 3K6DA 5C1MB 3HUJB 3MCLH 3OR7A 1UJ3A 1P2CB 3A6CL 3V4LA 1H3PH 1GC1L 3P2BA 4CSTA 4UAOB 1KPRA 1QBLH 2QHRH 1OANA 4EVNB 4AC2A 5LGKA 1PZ3A 3BH8B 4MS8C 4LHUA 5EZIH 3FMGH 4LESA 1TPXB 1KWGA 3K6NA 3P4OB 5AZ2H 3UBHA 1BM3H 3QI9A 3QUMA 3H3PL 4X9GA 3L7FB 1OSZB 2IV8A 3VI3B 4Q9RL 4YHNB 3BQUB 3EIFA 2W88A 1EERB 3GK8L 4PJ9C 3TBSA 3ZJAA 5F96L 1CGTA 1ONQB 2CZNA 4PB9H 2M8XA 4KHTL 5I76B 4F7KA 2W07B 1OAYL 1E5YA 3UBXI 2LOEA 4PJXF 2WAHA 3MLRL 1BFOB 4X7CC 4W9EC 5BRZB 5IQ9B 1SVBA 4FXKC 4AH2B 1HSAA 3WUWG 2ZKHL 1BZQK 1K8IA 2DMBA 1X9RA 4EN2A 1FIGL 3HRPA 1JPSH 3C60B 2ZJSH 1KIUB 3MO1A 3V0FA 5J1SC 3ULVH 4ZNEA 3W56A 1QR1A 3ULVC 3EJJX 5GZNC 3QRGL 3SZKC 4AQ1C 1W0VA 2EIDA 1AR1C 2VL5A 1VB9A 4HIXH 5DEFA 4B9JA 1KBGH 2ISDA 4Y2DC 5L4IA 3VA6A 1Q1JL 4HOWA 2HX7A 4LHJB 1FNEB 1C5CH 2VDKL 3V6ZA 1UCBL 1WK0A 2A73A 4OV5B 4KAQL 2YGOA 3OPZH 1G9HA 5GGRY 4NN7C 2ESVB 4LLMB 1GJUA 2FNBA 3F05A 3CVHA 5EV7A 1CXKA 2A77L 3RIKA 4W9KC 3KH4A 3S3JA 1MHEA 3T77B 4OIFA 4OQ1A 3BRDA 3VXQA 5C08D 1TFPA 2NXZD 3ECBB 2JKSA 4ETYA 2XG4B 3V7AE 2BRRH 1JMXA 5FO7B 4HS3A 3NRPA 5IREA 2XZQH 3DPBA 4HKZA 4XOBA 1KTKE 3TN0D 5BZXA 4WCYH 4FRWA 4G1EA 5E5RB 3WDIA 3V0GA 3B3IA 4OCYH 3GS7A 5KSAB 4LEEA 3RDTC 3KGUA 5D4QA 1FL6A 5BUGA 1XHHA 2DDQH 3VXUE 1IEAA 3WS3A 1PY4A 4Q6IB 3OKEA 5ETUB 3OF6A 4PJHF 4UT6L 4QRTA 1Q94B 3DVNB 3AG4B 2DWYA 4OTXL 3X1FA 1WZ1H 5DXWA 3ZK0A 2R0ZL 3F12A 4NQED 3FAWA 3QFGA 1MHPH 4OZIE 4OF3A 1INQA 3GSXB 1RK7A 2L0DA 2YQGA 3IBEA 4JO1H 4NHCH 4OZHF 1ERNA 5FKAB 1F90L 5DJ6B 3S36X 3ZE0F 1G7PA 4MJIA 2RQ8A 1HU8A 3FT3B 4G8IB 1NUGA 4ANXA 2JQZA 3AXHA 1N0XH 5EF1A 2R27A 5EZLB 2ZWSA 3QFJB 1NCOA 3STZA 3ZKMC 3REWB 2X6MA 3ZTNH 4R83A 3R4DA 2HRLA 2X10A 4A2MA 4KK6D 1HSBA 2PF6A 3ZDWA 5TJWK 4Z3EA 3CHPA 4KJYB 1MHHB 4PVLA 4P9ML 4UINL 1H3TA 4MNGB 4GKNA 1K6QL 4ZQKA 4L8BB 3UIYA 4WW1A 2EKJA 1OT2A 2G2PA 4U6HB 3K74B 4KVNL 1WHPA 1AGBA 2X05A 5AL8A 4GAFB 2VDOL 5JDSA 2NY2C 2NY0C 4PY7A 3L5HA 4DZBA 5SWSE 2W91A 4ABQA 1E2WA 1A9BB 2B0SL 5CJOL 3OZLA 4B60A 4RBPK 2DBLH 1FVEA 3GUTA 4N90D 3KDMB 2EXWC 5GS2H 3ZXAC 4J3OH 4NP4H 2Q6WB 4POYA 1BIHA 2YMXH 4J3OC 1H8LA 4X9IA 4YVNA 1SEQH 3TEXA 3BW9A 4N8VG 3BCFA 5TF0A 2FEEL 5AVQB 3QRBA 3EG9B 3WFZA 2DLEA 4RGND 4GO8A 4PRPB 1LO4L 1FIEA 4L4VB 4ZODA 4B0MB 2CJUH 5K9OA 1SHSA 3VDCA 1OB1B 5B8CC 1N5AB 3MROB 4E9RA 4UWQB 3ECVA 4YXKL 3L9RA 4NQXB 1XCWA 3VXPB 1AQKL 1LO2L 2P8MB 4ISVA 4JFDD 5LJYH 4P3DA 3L3GA 2Z91B 1DJIA 1HXMB 1QSED 3BXNA 3UL4A 1JZ6A 3KPSD 1DE4A 4NI6A 4PGJA 2NZIA 4JPIA 1S5HA 3DO4A 1ROWA 4P06A 4IRJA 1M7DB 4L1SA 3GYRA 1M1XB 3VFPB 4AMKL 3IGFA 4Z7NB 3LRKA 3ARED 2DMGA 2MQGA 5C6PB 4BZ1L 4P46C 1G6RH 2QADD 4PJAA 4X0KB 5DRNB 1LO0H 4P0DA 4M5ZL 4YHKH 3CXHK 4NOFA 1OAXH 4RDQF 5HVGB 3AS2A 1T7WA 3WMPA 2GY7B 1T66D 3EYOA 15C8H 4GJTB 3V4PA 1H3GA 5E00A 2JJSC 3DX0A 4AL8H 5BV7H 4YFLI 2OTUA 4JO2H 2NY5H 2O1AA 5BV7C 1XIWA 2KYIA 4AL8C 1M7UA 2XXGA 4XMZA 4ZI8A 4NSKA 4XMPL 1XCQB 1EHLH 3AAZB 4XC3L 1B9ZA 4N2DA 1VDGA 4MD4A 4WI2A 3GI8H 3IKKA 4WWKA 2FQEA 2KH2B 1I7RA 5E8NA 5F7HA 3WJLA 2UXVA 3KL0A 1FHGA 4HH8A 2Z92A 1C08A 3O3DA 1UA7A 2IH1B 2X6BA 4EDXA 1G9EA 3O9WA 5JZ7D 4QR7A 3S37L 2LU5A 2AK4E 2XN2A 4YDNA 1ODAA 5DHXB 1YY9D 3T8MA 2R1YA 1C16B 4NC1C 3CFMA 4I4WA 1JUFA 1DBKL 3MJWA 1ZT1A 1SQMA 2EICA 2Z65C 3RWHA 1JPST 2R0LH 3BKYH 4H40A 4O02B 1NIDA 3QCUH 5GGTH 3SE3A 5DVMA 4N3TA 1I3RB 3AXIA 4TPRL 3W0WD 5HP5A 3WY4A 4CN6A 3VX0A 5EU3A 4AZ8A 5DD0H 4PAZA 1BBDH 1CQYA 4F2MA 1D2OA 1J0KA 1G5GA 2DKSA 4P2AA 1J9CT 3FCBA 5IOKA 3IN0A 5T1MB 2B3IA 3W82A 5I1CH 1CBVH 3U1QA 3CMGA 3T3MF 4M93B 2A7BA 2XG5A 5DHVA 5GGUB 3T0XA 2BJMH 4LAQH 1K4DB 2VMFA 4AM0A 1CS6A 4OKDA 4WNJA 2PTTB 1N8ZA 1S7VA 4IDJH 2ICWA 4NZJA 1TEYA 4RRPM 3CVBA 2BOCA 2EO1A 1LWJA 3PP4H 3V5KA 3KE0A 1KGIA 5JIQA 4PJDA 2F19L 4H8WL 2OW7A 2WVVB 3L5XH 4RZCB 4NWUH 3FU0A 2IAAC 1T21B 5T33H 3RFRA 3APMA 4OFYD 3QPXL 4AGPA 3F3HA 2V9QA 4IDLA 5SX4H 1XGTA 3MV9D 2RD0A 1CFNB 1WP6A 4G7YL 4GLRH 3D85B 2GQHA 4J3UA 1UENA 1N26A 2LLGA 3GSUB 4LSUL 1QYGL 2FTAA 4AG4L 1U8KA 2F58L 3KG5A 3L7EA 1CDHA 5C9JA 1IB5A 4FA8A 4LBAA 5DQDH 2HMID 1KCVL 1AZBA 1NDGB 2TRHA 1PG7X 1NAMB 5ID1A 3AT0A 3P0YL 2XI9A 2UZPA 3CC5B 3T1WA 4GW1B 4P9HH 4CSPA 2HB0A 1FL3B 3QUZD 5AQ0A 3FQRB 5EPMA 5I1EL 2HCZX 5ESQA 2GI7A 4P9HC 3BPLC 3WIAA 4X80L 3TZVB 1TZIA 2YK1L 3NRFA 1ZANL 3GXUB 3WFCH 4FMVA 2VO8A 1YYLL 3TEUA 4D7BA 4DPBX 3UGXA 4DUWA 4Q4EA 1M71B 1L9TA 4RSVA 1OTTC 4YH6A 2W0KA 2D0HA 3D39D 2CHDA 4M1GL 4YC2B 4ORGB 3TEZA 2FYYB 2W0FA 4BSWB 3VFUB 4U3CA 4HAFA 4PCTA 1J0IA 1MI5B 1PPIA 2ZCKL 3D30A 4HBCL 1H6UA 1ZGLB 1OZUA 2A6KA 4WW2A 5SWZE 4G6MH 5JHMA 4XZUB 1IVLA 1ROCA 3HPLB 2R1XB 3ATAA 4ADIA 1QATA 1KC5H 4X6DF 3AWGA 4Y4HD 2CRMA 3UBXA 4JFYB 3WFBH 1MLBA 2R15A 4KTDH 4PTUA 2GJ6D 1HZHL 2JCCB 3OKDA 3UG4A 2VDQL 3MJ8B 1D5BA 2JSFA 1M05B 4DFIA 4FZ8H 4HDIA 1D5IH 4FLSA 1NWOA 3VDAA 3MV01 3VA2C 2BC4B 3PP3K 4Y9EA 3GMQA 3RWCA 4Z7VA 5E8DL 3QYCA 3QUXB 3JV6A 3HBPA 5I16A 3ARBB 4S1DD 3ZKXC 4P2OC 1AR2A 4TRPL 2J8UF 2AQ1A 1BQHB 3DSFH 2AZAA 3DJSA 4ZXBB 3L2LA 2QV2A 4U1SB 1G9NL 2D2OA 4JZOB 4LQ1A 5KW9L 1VENA 4NEHB 2JELH 5D71L 4FI8A 1I1AB 3CFJB 3S8WA 2N1TE 2IG2H 4HQQH 3QUYD 4EI5C 5DLMH 1HCFX 3B9KD 3CPUA 1KG0B 3N2JA 1ZWIA 1UXLA 5C09E 3CBJB 1P5VA 3EYVB 4KU1A 3QZOA 4N2NA 1SHMA 5C2BH 4PJ8B 4GG8A 2KZ1B 4YWGL 2VLJB 1GZHC 2Q5BA 4PJBA 2HFGH 5CP3A 4Z3GA 1J8HE 4IGBC 4PTTB 2DWSA 3HNSL 3HR5B 2VXVH 4JDVA 4XMTA 3TASA 4E9VA 2WWNA 5EWIL 3QHFL 5HPOA 2E7MA 2ZP9A 5JR1L 2QSVA 3C08L 1S9XA 3SGEH 2APWA 1Z0NA 5D2LB 1E8XA 4YPGA 4AW4A 3CAFA 3REVA 4RAUB 5IVXB 1MIML 1D7BA 3GKWL 4H0HB 5HJ3A 5IV2A 1S9YB 1KIQA 2GAZB 4R5XA 1UT9A 1P6FA 4GXUN 5DO2D 3SKMB 2RFXA 3NG5A 4WJ5A 4R97C 5CWSA 5JQ6H 2WHVA 4L1TA 5E4EB 3BH9A 3MRGB 3VXRA 5JTWA 3E3QE 1VSCA 5JIPA 4RMWA 4QTIL 1I3GH 1MY7A 1PKQE 4FQ1H 3PWJB 3IJ7A 3CG8A 2E4TA 4J1UA 1KYAA 3ZBMA 4WU7A 5FYJH 4L4TD 2Y6SC 3V52H 2RB8A 4UDUB 5FYKL 3K4DA 4DK6A 1G6VK 3KBEA 5E9AA 4JY6B 3TURA 4YGVB 4BYHA 1S7UA 5DMIL 3ABKB 1FN4B 4JANB 2XKNB 2Y07L 4KZCA 2XQYA 3NCYS 3FQXA 2D03H 5IJCC 1C5DA 3VO0A 4I9WE 5EG6C 4JHBA 5F6HJ 4TQIA 3O0RL 4JRXD 3QP3A 2IOIA 4OJFL 2WNKA 5DD5H 3VXMA 4JG0H 4K3HA 5HDOA 1PFCA 4IKJA 4WTZA 4MNQA 1W72L 3EDDA 1GTNA 3VFGH 1DVUA 2A4CA 1JTOA 2V7NA 1NGYA 3MYZA 4MQSB 2WWKO 3NGBC 4B0MM 1P4BH 2CE6A 4K55A 2FECI 3SE8H 3HS0B 4PVNA 3T0EB 3VG9B 3CU7A 1ZHKA 1V05A 2OMWB 4Z95L 2PW2B 3LEVL 3S5LB 2EVIA 3MV7E 1I4FA 3KYMB 5IFJB 4QRQA 2MJWA 4I1PA 1ZA6A 5DYOA 3RTQB 1UZ6E 3ZO0A 2J7LA 1HS6A 2WBWB 3VXSA 3WN5B 4BSVB 5C0IA 3PV7A 2YUWA 3AS0A 3SE6A 2VZOA 4ZFFB 4NM8H 1PZ5A 4P2QE 2MPAL 1NICA 4UAOC 5DS8A 1BVZA 2IBZX 5HHOA 1QEXA 1MLCB 2BW5A 4RIRA 1SGKA 3U9UA 3KM1A 4FLQA 1TPXC 5FW7A 1NSNH 4ZUVA 1TJXA 2RQEA 5IK3A 1MNNA 1AGCB 1PF3A 1PZDA 1FG2B 3RILA 3ZDYB 4HEPG 1LMKA 3BQUC 4S1RL 2L04A 2BNQB 1UQSA 2Y06H 3UABA 1D5XB 2Y7OA 5HYQA 4NZ8A 4EKJA 3OJ2C 1EANA 5EEZA 2VN3A 5AZEL 4JL1A 5F1SA 5EU6B 4E9WA 2YGVA 2CKBB 5L8JB 2YGQA 5BMFH 4JPWL 1S7QB 1ZS8A 3B7UX 2FJGB 2P1YA 3NFPA 1OE1A 4HCRH 4M43H 3UYRH 3AY2A 3OR7B 5AAMA 1UJ3B 4J6RH 3PJLA 5B1CA 1OPGH 1U8OA 3C60C 4ODVH 5EDXA 5J3HC 1U8NA 1P84J 1JZEA 1KPRB 3NJVA 4CKQA 3IJHA 2YPVH 3W5MA 4LHUB 2KPNA 5LCVH 1XZ0A 4LSVH 2DW5A 1T89A 1L0QA 3QI9B 5ABAA 5T1KD 1KNOA 3BEWA 3EAKA 4PCKA 3TO4D 4MBRA 3TBSB 5DURB 1I7UA 4FNLH 4ESKA 2XRAL 3Q6GL 5E1HB 1Z3GL 3WNNA 4YSCA 5B1JA 2FATL 4LSDA 4KTGA 1F3DJ 3KJ6L 2NYYD 5FX3A 4U1LA 4LCCA 3FO0H 1E6OL 2FIRT 1GAFH 1OCWH 2XA3A 1O9ZA 2AQ2A 2J1WA 2HXAA 1K8IB 2XWXA 5L4FA 4PG2C 1ZLSL 1N5YL 2FUQA 3VH8G 2VXUL 1A1MA 1HINL 1NC4D 3MO1B 3EADA 1OSPL 4PRBA 4CU8A 5I19H 5LQBL 3EKCA 3PIQB 4QRUA 1QR1B 5IW1A 2FJSA 2P5WE 2Y72A 2VL5B 1BSIA 3FSZA 5KSAC 4JM0A 4UOJA 3ILPA 1A25A 1WT5A 3B9DA 4XPGH 2AS5M 2OXHB 4K5PA 4Q6IC 3QCTH 1E9OA 4HKJB 1SMDA 4OLVH 1PZBA 3V6ZB 3B5GA 2WQAA 3X17A 4RCAA 4XWOD 3RAJH 3FZUD 3NSFA 4XCEA 2VWEE 3ULSB 2V5YA 3L6FA 3LQAH 5JOFA 1BDYA 1LK3H 7FABH 5E70A 3LQAC 4HWBA 3VXQB 4HBQA 4GIPD 4PJ5B 43C9A 2G3ZA 2AXWA 1URLA 3CPLA 2XKSA 1JS4A 1A6TA 4HS3B 1KCRH 3DPBB 2H3KA 4HKZB 1E6JH 5DZLA 4ZK8A 3QHZL 5DMGD 1A6VH 3ZHNA 3WY3A 4Z7WA 2UY7A 4DN4L 3SCMB 3B3IB 3CZEA 3TJHD 1FL6B 1MJ7H 2FQGA 4G6KL 4MLSA 1CFMA 3WS3B 1IEAB 1MWAL 2EH7H 2GFBA 3OKEB 2J6EH 4MQXC 4N5ED 1DLHA 4C56D 4QRTB 1ETB1 2PPFA 4OW6A 2Y7NA 1RIVL 3F12B 1QVOB 5H4YA 4ZMYA 4Q8BA 5JXAL 2BOLA 3WGVB 1Q0XL 5HDQH 1INQB 5DJZB 3BPNC 3OKNA 3PF2A 1ZGLM 3MA9L 5IUSA 1G7PB 1UB5A 4MJIB 1BJ8A 4RMVA 5FUCC 3NMEA 2BFVH 1KWKA 2J71A 4J3XA 3TXAA 4HJJL 1U8CA 1EO7A 3BAWA 3UO8B 2VW7A 3STZB 2XN9D 4KGJA 4BFNA 4U31A 5GSVB 3K3QA 4DQOH 3MJGX 4X7SL 5ICUA 4N1HB 2R29A 5BZZA 3K81A 4PJFF 2X09A 3QWQB 4K3EL 1DUZA 1KDJA 4FFVC 4S2SA 3GXIA 3QEUA 2WP3T 1HSBB 3VFNB 2B1HL 4GKNB 1YQVL 3PUUA 1FO0L 2OSLA 4WW1B 3NJHA 5JW4R 3B2VH 1AGBB 3FQWA 1XH1A 2XTJB 5JDSB 1UUNA 2DIAA 2RACA 6PAZA 5IR1B 2PPDA 4PY7B 5CXPA 3M7OA 4I2XE 4EOWH 1XL6A 3D09A 1KGJA 4CN1A 1FVEB 3RL2A 1Z5LA 3AITA 2CKNA 1DQDH 3GUTB 3UC0L 2OCFD 5KEZA 4XPHH 2ZOTA 4KI5D 1F11A 1I9EA 2FSDA 1FYTE 2QTVA 2ZKMX 4BZ2L 1QTYT 1NCBH 4PY8I 3ML8A 3BW9B 5IBTH 4L3ED 4X99A 3HKZA 1OKEA 3EYFA 1EGJH 3RVXD 5GGQL 3GZPA 1LTXA 3HUJF 4FF9A 1N19A 3ETSA 3CZFA 2H2SD 4LSTH 5H35A 3EGSA 4MWFA 5K9OB 3IJSA 3MRHA 1BAFL 1HHJB 3NIDE 1N7ML 4O9HH 2X70B 2Y3AA 4WNQA 2MFNA 4NO0D 5FK9A 1J1PL 5TD4A 1HVXA 3L9RB 4LARL 4YSUA 4QHKJ 3ZTEA 5MENE 3STBA 4M5YL 4HUUB 4GG6E 4ISVB 2K7PA 5E95B 4P3DB 4PV8A 2CLZA 3BXNB 4WHTA 4W9ZA 4ZW3A 3FU5A 1DE4B 4Z7AA 3I3BA 3C6EA 1MCNA 1G94A 1N9PA 1YMMA 1F02I 4JPIB 1GGBL 3HI5H 3X1NA 1S5HB 4B9PA 4RA3A 1FPTL 2P52A 4IRJB 5CJQH 2ADYA 4OZIA 3NP4A 1IAII 4G8FA 4N22A 3DMMB 2CH8A 4PJAB 4WFED 2XICA 2R69L 3BAXA 3JXAA 3SPVA 3OC8A 4N2KA 3PWNA 1MQ8A 4E9YA 5MEOA 1IX2A 2GIMA 1YAZA 3V4PB 2OTUB 2VDNL 4H5SA 5K1VA 2HVBA 2JKXA 5B39G 4TQPA 4DESA 2EIBA 1T1ZA 4NSKB 4K3GA 1AZUA 2AXHA 4MD4B 4JHUA 1SM3H 2FT8A 1LEIA 1IGFL 2WUBL 5AB1A 4AQEA 1OCZB 5I26A 5HYJE 4WWKB 4AQOA 1I7RB 1RIHL 5BZDA 5E8NB 1UWGL 4X7TA 4JQVC 2MQ0A 1HZKA 5F44A 4M93C 3PABA 2EP6A 2VN7A 2Z92B 1C08B 3CX5J 3O3DB 4R26L 4V2CB 4EDXB 4LPCA 1XB8A 3O9WB 2WPGA 1KFGA 1GZQA 4G83A 3BE1H 3M88A 4X9HA 2R1YB 3VFRA 4JKNA 1UH2A 1A7PL 4I4WB 1JUFB 2N3JA 3MNMA 3PWVA 1ZT1B 4FABL 1JJUA 1ZIAA 2YKLL 4W9DC 3RWHB 2J88L 4OJDH 5F1NA 4OJYA 5I8OH 1ILSA 4MD0B 4BXSV 5GGRA 1MCBA 2AXGA 4GNKB 4NLHA 4WSGA 3JV4B 4B27A 5ADOL 2EVFA 3R1GH 1Q90A 5FHBL 3S3CB 5EU3B 4AZ8B 1AS7A 2K9FB 5AVRB 1FH5L 4F2MB 1JPTH 2E27H 5G4NA 4J5VA 2AP2A 1QNZL 3CHSA 4LMQI 1XMWA 4NIKB 4O4YL 1PD6A 1PZ2A 3V4UL 3Q06A 1OD7A 5HYFA 3MTRA 5DHVB 3MNVA 4N0FA 1RERA 2J25A 3HS9A 4AM0B 1UYWH 3U0PA 4U6XA 5JW4N 4K3DL 3V6OA 1N8ZB 1S7VB 5DS1A 3JTTA 5CEZL 2AQSA 2BOCB 4JG9A 3C12A 3V5KB 1DQQA 4PJDB 1A7BA 3TZVC 5EMYA 1FFPA 2B15A 5I6LA 2AC0A 3MAWA 4XCFL 4FFZH 4JM2F 4OZFG 4B7IA 3LS4L 4WUUA 1XGTB 4W6XB 1KZQA 4IKIA 5JLZA 3IK2A 3LCYA 1PIGA 3LIZL 1HL9A 4YC2C 5E9DD 4JQXC 4YVUA 2XNAB 5IT2L 2E3VA 4N28A 1R17A 2B14A 1E4XL 3S4SA 4AVIA 4TVPL 1U8KB 1QSFD 3L7EB 5H37H 1IC4H 5C9JB 1UD3A 1OV8A 2RBLA 4G7VL 5ID1B 2UX7A 5C2UB 4YEFA 3HOGA 1HCZA 1ZHBA 5EPMB 3V0DA 3MCLL 4XNUH 1CD8A 2OP4H 1CFBA 1TZIB 1H3PL 4OCWL 3ZY7A 1L9QA 1OALA 1YPZF 2QHRL 3BDYL 5KOMC 2JIXA 4GBXA 3M1BA 3ZOAA 5HI5C 4LSQH 4F8TA 2HVJA 1D2PA 3SD2A 1CICA 1HE7A 2EDOA 4D3CH 3WXVL 5AZ2L 3QUXC 2YARA 1BM3L 3ARBC 5DFVD 2W0FB 5D1ZI 1KEGH 4GSUA 2BXYA 4ZXBC 2A6KB 2EJ1A 2X38A 4PB9L 1J10A 3L1GA 5D1QD 1PZAA 2ZKXA 2FWUA 2APVA 3QNXB 1Y0LB 5HHQA 3UYPA 3H9YA 3UBXB 5AL0A 5GGVY 1MLBB 1I1AC 4K5MA 4PTUB 4CA4A 2YRBA 1SJXA 1ZV5A 1SZNA 3OKDB 1D5BB 5DVNA 1JPSL 2ZJSL 1IV8A 4HIQA 3CZNA 4PJCE 2VC2B 4Z6AT 3RYMA 5AG8A 1HDMA 1PGRB 5AVZB 3I75A 4PJ8C 4PRHA 5C08E 1AO7B 4H1LB 5AAWC 3D34A 3GMQB 3V0EA 3RWCB 5KVEH 1KBPA 5I16B 4CW1A 3H7BA 4ODXA 2R8SH 3MRFA 3T1FB 4DHLA 3IJYA 4JFQA 1QFWH 3F58H 1OOWA 3W37A 2GT9A 4ENEC 5I1DA 2H4EA 3IFLL 4HOXA 2Y25A 1IUZA 2E9JA 3PE9A 5AW0B 4DVRH 3ZL4H 3WNJA 5LUMA 5CU5A 4U2YA 3HMXH 3WTUA 4MVBD 1GMIA 2H45A 2XLLA 2AJVH 4N8UA 1RZIA 4PI0A 4TQ8A 5LAPA 3EOTL 2MOQA 3KS0H 2XN1A 5DK3A 1UWYA 3IXAA 1OTSD 2BRRL 4IRZH 1BVNT 1ZWIB 2AXFA 3OMAB 4ZD3H 2ZNXA 2QSTA 2XZQL 5DI8B 2K3TA 4OBSA 5JIKA 1P5VB 3WNLA 1PYWB 2NOYA 4XCNA 4M7LH 1AD0A 2WK2A 2A74A 3SHSA 3E2HB 4ADGA 4OCYL 4PJBB 1SOSA 4UOW0 5TQ0H 4YAQA 5JUEH 3MOAH 2F1BA 1JXDA 2BVOA 2X3BA 3LNEA 3UTZB 3FUEA 1KTDA 3BKJH 1KXHA 2DKUA 2IH3A 2ZWKA 4OH2A 6CGTA 4JDVB 5DWUH 1RURL 2EILB 3HA0A 1WZ1L 1LXMA 1TTUA 1S9XB 3EFOB 3ZR5A 2ZAGA 2I27N 2GTWA 5MP6H 1AQ8A 3VQ1C 3C6LA 1T83A 3M07A 3PLYA 4PCYA 4FQHA 4YPGB 3T0AA 3MLSH 3REVB 3LZNA 3ABGA 4ZDHA 3DIFA 4D8PA 2H41A 5FM4A 5DD1H 5HJ3B 3Q5YA 5IV2B 3DHMA 3HRZA 1N0XL 4B9KC 3C75A 1C1EH 2RFXB 4WJ5B 5CWSB 4TSBH 5B22A 3QJUB 1LDSA 5D7JD 1MY5A 4LAJH 5EOCJ 5C0DA 3U2JA 2D3NA 3VXRB 3P3YA 3RVWC 2VJ8A 3KXFE 4RETB 4GFXA 3TA4D 3GI9L 2OYPA 2R2EA 4J1UB 4FAAB 3B2PA 4WU7B 4N90E 3HS0C 3T0EC 3VG9C 2G4EA 4QPEA 4FFWC 2X2JA 4HPOH 2VIRA 1S7UB 4HEME 1NCWH 2IBGA 1VLXA 3RTQC 3DBSA 4MD5A 4EN3D 4F9PA 4RGNE 3WN5C 3FQXB 4PWGA 1XSIA 1C5DB 4M6MH 5HHMB 3ARYA 4IS6A 1UEYA 2DBLL 1GCFA 2H26A 2X6UA 3L5JA 3GLDA 2IGFL 3UAJC 5AW1B 1OW0C 4JFZL 3VXMB 1JIBA 3CLFH 2XIDA 4JDEA 4R84A 4WRLA 3KPRD 4L8CA 4P07A 2YMXL 4MXWL 1RAMA 1FCGA 4NUJA 1SEQL 3N40F 1MH5A 2V7NB 1NGYB 2ZSWA 3QDMA 4M3HA 1T4WA 3LKSA 3TBTB 2WM0A 4LOUD 3DJ9A 4XVUD 2WYZA 1SY6H 1ZHKB 1UM6H 2CKBH 5IEHA 2C1PB 2CJUL 1ZTXH 3OGOE 1KTLA 2AJXL 4QRQB 2ILLA 3FU6A 4JVPA 1ZA6B 4Y19A 3ARRA 1CK0H 3IS0X 4TUOA 5C70A 3ZR6A 5H2BA 5C0IB 3VXSB 1XAUA 1UJ3C 4LKCA 1H3UA 5D6DA 5I0VA 3MLVL 2EC9T 1PZ5B 1BBJA 4I0CC 1J8HA 3POHA 5KBLA 1OAZL 3BPOB 3D2UA 5HHOB 1CXLA 2D0GA 5E4AA 4RIRB 3ARGD 4KUCF 3TGXA 1FHNA 1QMUA 1JV2A 1SN0A 3Q3GA 4ZUVB 1G1OA 3GDBA 5IK3B 3RNQA 3EYSH 3QI9C 1ZLVH 2B2XH 2GJZA 1Q0EA 1CU4L 3CZGA 1UQSB 3FQTA 1G6RL 2RCSH 4XAKD 1LO0L 4YHKL 1IGIH 1JPGB 1RJLA 2H47C 5B3SB 4NHUA 5BV7L 5C0CD 4AL8L 1ZS8B 2FLMA 4JO2L 3MJ6A 2NY5L 1BMWA 4X9BA 5K39A 5D7KD 5IB4A 3N85H 3WNKA 4Z7OB 1EHLL 2X4SA 2CNYA 1U8OB 2C3GA 4JRYD 1U8NB 1XTLA 1QQDA 2V3EA 3FO2A 4P23A 3CHOA 5CLZA 5TDPA 1MEXH 2WCSA 2XBDA 4TL5A 1XZ0B 2HTLC 2G30A 1EJFA 3KBHE 4FNUA 5JOPD 1MDAA 3KLHC 3BEWB 4YZFE 2ATAA 3GMLA 3ERXA 3SGDI 2Q7NA 1E27A 1TZOA 1CXEA 1QRND 1I7UB 5IBLD 4HIHB 3B2MA 3QDJD 5KZCB 5ANHA 3EHBD 4J3OG 2TRYA 2R0LL 3BKYL 4AK2A 3B2UC 2NZ1A 4U1LB 3CN3A 3QCUL 2ZOKA 4A2FA 2XUWA 3ZTJG 1I8LA 1WBXA 5ICZB 5KSBB 2NZ9C 4N85A 1FQ9C 4BQBA 2WQVA 4Z3JA 1E4KA 1A1MB 4FJ6A 5DD0L 1KGYE 3FJTA 4PRBB 5DUBA 4QRRD 1A02N 4QRUB 3KCPB 5IW1B 1CE6B 1F8TH 3F7PC 5J0BA 3VI4E 3MV9E 2N1KA 3SCMC 2B4CL 1TVBA 3DDGA 4I0PD 2LR4A 2Y2YA 3ILPB 4LAQL 1A6WH 1LLAA 4MKMA 1E9OB 3GSVA 1ZJAA 4IDJL 1UXSA 3CX2A 3ECQA 1DEEA 3BKCH 4H88H 3OLEA 3DUSA 3KGSA 3L5XL 4XCEB 1TOXA 4NWUL 3L6FB 5JOFB 1D3CA 3LYRA 4X5XA 3TV8A 1O6VA 1XH3B 1P0SE 4M7LT 4P2QA 1JXFA 3BZDA 2CPCA 1AIFA 4MZ3A 3BESR 5H8DA 3MCKA 1QTSA 43C9B 4ES9A 1OTUD 3CPLB 4U1JA 4H20H 1A6TB 1OSYA 1O9WA 3A47A 3CXHJ 2LTQB 3QIUD 1JRHI 3K6SA 1G1YA 1U2CA 2NR6A 5ISZA 1NUNB 4U6VL 4Z3FA 5CBAA 2H3NA 4Z7WB 2UY7B 4KK5D 5I0ZA 5T3XH 2ADFL 3D39E 3MRNA 1O7VA 5DRXA 1QA9A 1TKWA 3TPKA 2GFBB 2AQQA 4AV0A 4E42A 1DBJH 2FGWL 2FVNA 1F00I 5FYKD 3S3SA 2W1NA 4G72B 5HHVL 2G0KA 1M6OA 3CFUA 4LSPH 1QACA 1CZ8H 1BAWA 3QVAA 3EYUL 3WFCL 3ULAB 5L0QB 3ULUF 4FXTA 1V27A 5KBMA 1BOYA 2GJ6E 3QAZB 2HFFA 3OKNB 4AEEA 4UV7H 3U4EA 2O6CA 3ROOA 3E6FA 1A6AA 1UB5B 2GHWB 4WO4D 1MAKA 1RJZA 2XTJC 2ITFA 4PV9A 1MREH 1MVYA 1E7UA 1MG3C 3ZDZF 1QABA 2GIXA 5D1ZA 1AANA 1MFDH 1U8CB 1UZ8A 3TT3H 4BFKA 2VDRL 1MSPA 5DZVA 5LO7A 5MHSD 4JPKL 5FCUH 3KJ4B 4CSSA 1I1RA 1R4XA 1UT2A 1DUZB 4DP0X 4S2SB 5C0GB 3GLEA 3DOIA 3QEUB 1FVDA 4HCGA 3WFDH 4N2LA 4DKDC 3DI2B 3NH7L 3KW7A 1EHNA 3ZGHA 3K5SA 4AITA 3BP5A 4FTDA 5EFIA 1NDTA 2OSLB 4OGAD 4ZX5A 3ROLA 4Z7QE 4ERSH 2P5WA 3BVWA 4DF9A 3FQWB 1OL0A 5L2KD 3DVGA 2QPEB 3OAZK 4ZQTA 3DSFL 2JKLA 3D0AA 1WEJH 2BSRA 1GGTA 1Z5LB 3D4GA 3ZDYF 3E1F1 5E2VL 5DMYA 1CGSL 3V5DA 2JELL 4EF3A 1F11B 1CO1A 2IG2L 2P42B 3DOSA 4IRJC 2XWBA 4KROD 5DLML 2CUHA 5LN4A 4DZ8B 4X99B 3RBSA 4I5BB 1BG1A 3EYFB 1M1SA 3V0VB 3DMMC 4BWWA 4FQCL 3V4PH 3CZFB 1TTAA 4Q14A 1OAUL 4MWFB 5D1XA 5DEJA 3IJSB 3MRHB 4AEHL 4NKQB 3K0YA 1PL3A 1Y1UA 1XIWC 5EA0H 4WNQB 3SO3B 5FK9B 5IKCA 2JK5A 4RFNB 1ZRUA 4A2GA 2VXVL 1H8SA 4WWKC 4PV8B 3QEQD 2CLZB 4FA7B 4WHTB 1YQ2A 2VXQH 4WI4A 3VCLA 3WJLC 4PJIE 1WRFA 2ORBL 1YMMB 4KKPA 3O9WC 3U4BH 4ANWA 3VWJD 1ZLUK 4W9LC 4LP5A 4YBHA 4OZIB 4L4TE 1LE5A 1GS7A 4YL4A 2OPCA 4G8FB 3LEXA 4HC1A 4MNHA 4ODSL 4X8GA 4A6YA 3S36L 5DJCA 3SPVB 1JYNA 4YXLH 5BNXD 3G6AA 3IU3A 3PWNB 4NQDE 4XB3A 4F8PA 1FA4A 4HAKA 3BWAA 4Z76A 2WLKA 5MEOB 2P47B 4XCCH 3SE3C 3LHAA 4AQ8A 3GNMH 1WICA 5JQ6L 3KEHA 4H5SB 3TPUB 1GYVA 2XV6B 2A3TA 4Q9BA 4AIZA 3DRQA 3LN5B 1T1ZB 5K9KA 4ZMAT 4DKTA 4FQ1L 4QGTA 4J28A 3FTXA 4DP6X 1LEIB 3NSXA 4AQEB 1CFTA 5FYJL 3K0WA 2J44A 4WDIA 4JRXE 3V52L 1HNYA 1NIFA 2ZUQB 4LLDA 5T3ZH 5BZDB 3DYMA 4QRSA 5DHVH 3PABB 3K7UA 2GEQA 1AI1H 1FZMA 3PPEA 5GGSY 3MNZA 1RHHB 1N6QL 3OX8A 4PJGB 3SDXE 2IOOA 2XXMB 4WFGE 3CIQA 3VFRB 4L9DA 4GXFA 5F71A 2W8CA 4FQJL 4ZFZA 2X2HA 3PWVB 3E80A 3QB7C 5HDWA 1TMQA 4YSOA 2CRYA 2WXMA 4IOSD 5F1NB 1Q0YH 5CZXC 1PU0A 3RX9A 4FNSA 4WI3A 1RULH 4KXZH 4Y8AA 5GGRB 3MXWH 4DEWA 4LVEA 2ZX8A 5DD5L 5IBUG 2DQDH 4LBEB 1ZOXA 1WV7T 3SKOA 3VFGL 1WWCA 3Q5OA 2AQPA 4WO0A 4BK4A 3JWDL 3IE9A 3QJXA 3OKOA 1PX8A 7CGTA 1P4BL 1FYTA 4RA0C 1MUJA 1SHXA 4CADA 4FADA 3MNVB 4N0FB 3IGAB 2WQRA 2OMXA 3U0PB 1UJTA 3NAAH 3GSNL 4A7QA 1IAOA 3QQNA 3JTTB 2QR0A 3BT0A 3W9EA 1IBZA 3O2VH 2WWMD 2EH8H 4MAYB 3VB8A 2XPZA 4A68A 1DQQB 1HIMH 2NXYD 4GAJL 1Q9KA 4R7XA 3MOQA 4FX5A 1FFPB 2XHNA 2GSIA 2JQMA 4QEGA 1MFCH 2H8PA 5T8IA 3X11A 1CFQA 2JE8A 2UUDH 3HZVA 1N68A 1G7JA 1BIIA 3NFNA 4N2AA 1B9KA 2D4DA 4WUUB 1N0LA 2XTSA 2HJKA 4XC1H 5JLZB 1UD5A 4APXA 2E6JA 4A37A 4KY2A 4N8PA 1XR9A 2JTYA 1CD9B 2J20A 2FEDD 3MBEA 1CXHA 3S4SB 2X0VA 1VRSA 3B5TA 2H3XC 3VGBA 3KYKH 4KQ4H 1F4AA 2O6DA 2NLJA 4J23A 4P5KA 4XBEH 2YAQA 5CZVH 3AJ7A 2WQSA 3WJMA 3GS4A 4KNTA 1ZHBB 2PO6A 3SO5A 3UG5A 3C5JA 2QV4A 3LZFH 4HCRL 4M43L 4UQEA 3UYRL 5M7QA 1XF2A 4J6RL 2VC2H 4ODVL 1KN4L 5F3BA 4P3CH 2JIXB 3MUGB 3M1BB 4GBXB 2HVJB 3FL7A 4H1LH 1AHKA 2YPVL 5DJ0A 1J9RA 4G1MA 5LCVL 5HYJA 1CICB 2QMJA 3A67H 3N06B 4LSVL 5JHAA 1PKOA 4DO4A 3LKPA 4HF5H 4I3SL 3QIWD 8FABA 3BLKA 4RRPG 5A2AA 3HG1A 1NPNA 3Q8BA 3BZEA 4FNLL 4JFVA 1BWMA 4NXKA 3CNKA 2NY4B 4L18A 3J8F7 5ESAA 1B0RB 1MQKH 2O26U 5KYWA 3EJCA 3PGFL 1KJ3L 5HHQB 3UYPB 2QZQA 4TSAH 2NPLX 2A38A 3FO0L 2CR6A 4L8SA 3S34H 3SBRA 4MCNA 2YXWA 4IBUA 1A2YA 3EOYG 2NQ3A 4RAHA 2NSQA 2BSED 3DXAE 3GMMA 2O61A 2GTQA 2UXTA 1U0QA 4ATTA 3I75B 1CXFA 4PRHB 4W68A 3E2HC 4DNLA 2BZDA 1INDL 4PYGA 2W9DH 4CW1B 2IAND 3H7BB 1ORSA 3DX4A 4ODXB 3MFFA 4F58L 2FD6L 4L1BA 3QCTL 3MRFB 3AVEA 3IJYB 4JFQB 3BOVA 5A2LH 2PPEA 5I1DB 3FB5A 3UTOA 1RP9A 3M8OH 1KJ2A 2VH5H 4Z5RA 1CCZA 1JGLL 3NIDF 1TT6A 5F6HI 3LQAL 2BERA 4HCIA 4GKSA 2LE9A 1RZIB 4C56E 1KLGA 2YD1A 1QD0A 4LQFH 1MIEL 5I24A 3IXAB 4KDTA 2Z0BA 4K5OA 3UTPD 4ODBD 1A7OH 4GG6F 3EW3B 3G04A 4RAVB 4HUKB 2AXFB 4CVXA 4G3YH 1KCRL 3KAAA 4K3JL 4XCNB 1AD0B 1SXNA 1A6VL 5E9NA 5D7HA 2A74B 3MRJA 4WLCA 1UKQA 3D4YA 4C4KT 4HUNB 2FX9H 3Q48A 3NJNA 1CDIA 4YAQB 1MJ7L 4TLKA 4Y1TA 3MHZA