3WKMH

The periplasmic pdz tandem fragment of the rsep homologue from aquifex aeolicus in complex with the fab fragment
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
222
structure length
216
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYLHWVKQRPEHGLEWIGRIDPANGNAKYDPKFQDKATITADTSSNTAYLQLNSLTSEDTAVYYCSNRQLGLRGYYYAMDYWGQGTSVSVSSAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Structure-Based Model of Substrate Discrimination by a Noncanonical PDZ Tandem in the Intramembrane-Cleaving Protease RseP
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
molecule keywords Putative zinc metalloprotease aq_1964
total genus 46
structure length 216
sequence length 222
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wkmH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wkmH02
4OLUH 3T1FA 5D71H 3IFOA 3FOMA 2YA0A 3K81A 4P2OB 2W07A 4IJ3B 4Y5YB 3SGKA 4NHCH 1RIHL 2OMNA 2YRLA 2Y07H 4RDQG 5EO0B 2PTTA 1GXEA 1X6LA 3WV0A 3FFCA 5LBSH 4PJGA 4JN1L 5HYFA 3BWAB 3UJTL 3U36A 4ZUSB 5ESAA 4JVUA 4WHCA 2P24B 4GUPA 2ITDB 3O8XB 4ODSL 2OR9H 1KEGL 4X7CC 1F3DH 4XNQA 1MUJB 5KSUB 4MD4B 5B22A 1I9EA 1DUYA 2OK0L 4CMMB 1U8OB 5GRVL 3ZKMD 4JE4B 3DV4A 4BYHA 3P2TA 4UAOB 2QSTA 4HKXB 3ZDYF 3TN0D 1DLHA 3DHJA 4WFHD 4A6YA 2H9GB 5FOBA 1MCNA 1CWVA 4YHML 5CP3A 3LQMA 4ZFOA 4MLSA 5K33A 4DGIH 5L6YL 4BZ1H 3OKLA 3PWNA 2FHBA 1TNNA 3NZHH 2AI0H 1KT2B 1AKJA 2CDEB 1QFWH 1J8HD 2VERN 4Q6IA 1TJIH 1DVFA 1FYTE 5HGDB 5CS7A 3OBAA 3VFNB 4ZUTB 4YXLL 2P24A 1T1YA 4EI5B 4L3EB 1LO4H 1NGZB 3PDDA 5CSZB 3QFDA 1JF5A 5MEOA 4KK8D 1N6VA 3L5XL 1TTUA 1VACA 4OIBA 4PBXA 3QUYD 4OV5A 1K6QL 4HC1L 3ZHKA 2FECI 3SDAD 1HOCA 4BQCA 5TH2A 4LLVA 5DUML 2M1KA 1WCBB 4Q6IC 5EPMB 3QXWA 3NFNB 2ZOKB 3PQYB 4Z78A 3L9RB 5D7IA 1XGQB 2J6EH 5E2TH 2X7LB 4I2XA 4RGNC 4P4KA 3N9GH 3OXSA 2NW3B 1XF4A 4NSKB 3BP6A 2VDKH 3LN4A 4NM4H 1BOYA 5C0IA 1HQ4A 1BD2D 3V6ZB 4MZ2A 2XTJE 2C3HA 4TNVK 3KGRA 4GKZA 1VADB 2HRPH 2WZPD 4J4PA 1JFQH 4M61A 1AD9B 3I2CL 3EOYG 3N06B 4L4VE 4PJHF 2J12B 2JB5L 2NY6D 4GRMB 1OPGH 5GGSA 4ELME 4OFPA 4PJ7E 1REIA 1YEEL 4JFFE 1EK3A 3PP3H 3W0WD 3G6JA 1LO2H 5DQ9B 4MXVE 3V7MA 1HZHL 3MUY1 2ICCA 4MXVF 4OZGB 4LLWA 4U1NB 5I16A 5DXWA 4NKQB 3HE7B 3VWKA 3WKML 2NY4B 3KPOB 4PRHE 1I7TB 1HKLH 5E8DL 1M6OA 1MRCL 3PNWB 2ESVA 4KUZL 4G3YH 5E6ZA 2PTVA 2FDBP 3O9WD 1RJCA 4JO2H 4R4NC 5ACLA 4YBLC 5T1KD 4YHPA 4JRXB 1EEYA 1W72A 2DYPA 5D1ZC 5I8KL 5IFHH 1QO3A 4IOFC 1TVDA 4LPVA 1RURH 1UXSA 2FYYA 3VG0H 4IRSA 4HLZH 4OCWH 2WUCL 1QR1B 3TN0A 2NW2A 1UADC 2NY7L 3NH7L 1LP9B 2G60L 5BXFA 1QSEE 1S5HB 1H15B 3G08B 1ORQB 3OKNA 1GSMA 2H2SD 3D25B 2QLVB 1FZJA 1JF1B 3O9WA 4XGZA 3EIFA 5D7JA 1S7TA 4CAGA 3BPNB 1U58B 3IXAA 8FABB 4OI9A 1CGXA 2V9RA 5JOPE 1G7JA 2H41A 4F15B 4IRJB 5IIEB 12E8L 1NMBH 1A2YA 4HUNB 3WUWA 4L8SA 1YN6A 2ICEA 3TN0C 1WZ1H 3QUYC 3FCTB 1P7HL 4OAWA 1GRWA 1HINL 4NRYA 3KXFA 3PWUA 2BVPA 2JJSA 1I8LC 4XCNA 4MQ7A 3CX2A 1J7VR 2ATKA 5ADOH 4JM4H 1CFQB 2X4PB 3K1DA 4PJFA 2X4NB 3CVHH 4Z76A 2X4OB 5JQ6H 1YMHA 4XX1E 3OKKA 3BIKA 3RL1B 3MLWL 4S0TD 1XF4B 3DI3B 1OP3K 3MOQA 1IGTA 4M5YL 4PP2B 5IHBA 4JKLA 2YXMA 1CVRA 3D25A 4LHUB 3SJVE 4LRNL 4ZXBB 1B0GB 3ZYIA 4CBPA 3BP5A 5H2BB 2A6DA 5DJXB 5D8JH 3T8XA 1MELA 5H94B 2ADIA 4RGNB 2OQJB 5FYKU 4LARL 1GIGL 1G6RH 4P4RB 5F9WB 5JXEC 4JHWH 2IBBA 4N9GB 2IPKA 1WC7A 4XNUH 4ZS6D 2APBA 3GJEB 4QXUH 5D5ME 4K3EH 1QSFE 3S7GA 4MJ2A 3H3KA 2BSTA 4JR9L 2O5XL 3BEVB 3VFMA 2ITDA 5E9DD 2DBLL 1V7NL 2NTSP 1MUJA 2AV1B 5IW6A 1P69B 2D0HA 3EYOA 1EUTA 3EYQC 2MCPH 2ZCLH 4FMKA 2BNRB 2UY7A 3DNKA 4OLEA 2YHGA 5DT1L 2V2WB 4F9PA 3QEUB 2H9GA 5FOBB 4Q0XH 4JHAL 4GQ9L 4CMHB 5I17B 1NMAL 1BBDL 4HG4J 1LEIB 2DAVA 3PV6A 4JHAH 3X14B 3QDMD 4X5WB 4WWID 2X4QA 2NLJB 3U0TB 4HKBB 1CR9L 4HUWA 4G8FB 3GGWB 5FM4A 5J56B 1V7ML 3RBSA 4GMTL 3CFJB 5TE7L 1E4KA 3VD5A 2W38A 2FO4A 2Z9TA 2APFA 4LEOA 4WW2F 5AZEH 1DEDA 2Y36H 1S7WB 5DK0B 4MNHA 5E2VL 2VC2L 3Q1SL 2EEAA 2AAVA 1HXMB 3WJJA 3PXJA 2ITCA 2AEWA 5DFTA 1RULH 1NGQL 1QSED 4WRLA 4F9PC 2AJVL 3BOVA 5EU6B 3LCYA 4Y19D 1FRGL 4YQXL 2DQIH 4MVBC 3GKWH 4FQIL 1KJ3L 3FQRA 3HTLX 4LQFL 4G9DA 5CEYB 4C56D 1QLEH 1EJOL 5IB2A 1HI6B 5I8OH 5HYEA 4ZUWA 5T1MB 1LP9E 1FDLL 1HCVA 3ARDB 1E4KC 1C16A 1SYSB 2O93L 1FO0B 2NY1C 4LFHD 1FFNA 1J8KA 1ES0B 1SVCP 3MJ9A 4GOSA 5J12C 5F7EH 4A6YL 1WWCA 4RWYL 1XGQA 3JWNC 3HZMB 1JWUA 1XR9A 5IB4A 2IG2H 2NLJA 2E7LA 4FRWA 4LU5H 4XHJC 3RKPA 1CT8B 3ZKNC 3HG1D 3PDOB 3DUUA 4BFIB 5EU5B 5HSFA 2VN4A 4F58H 4E42A 2R4RH 3DMMC 5EU7C 1DBAL 3CK0H 4J3OC 4Q9RH 4OAWB 1T6VN 4JZJA 1HXYA 4H25A 5IGXL 5J3HD 3DROA 5TE4L 5IJVA 1OWWA 5FKPA 3O6FD 5DGRA 3IFLH 4I13B 3QULA 3BJ91 3BN9D 1G7PB 5JW4Q 3BKCL 3U4AA 1G84A 3VMOA 1LO2L 3ROOA 1ZANH 1HH9A 4JM2D 4HWBA 4MX7A 4X6DF 2Q1EA 2ZCKH 3SGEH 1H5BB 1MWAA 3LS5H 3O6FC 1WBYB 1IC7H 3RWCB 1E6JL 4JY5H 1H3XA 1QPXA 2XZCL 2Y7QA 2EDEA 1RZKC 2BC4B 4PTUA 4QRTB 4QWWD 5K9KB 3DO3A 3L5WA 2ZUUA 4P9MH 5LQBH 4PLNC 4PS4H 1CDYA 3MBEB 3TBVB 5EZJA 4P3CH 1INEL 4GKOA 1T0MA 4NFDA 1A6PA 1J5OH 4G8IB 4XI5D 4QCIA 4HWEH 4XCCH 4J23A 1T80A 3TVMB 4N8CL 4FFZH 3UDWC 2EDXA 1YEIL 4Y4FB 3MRFB 3FB6B 3H9SB 4IRSC 1ZS8B 4QXGL 1H9VA 1A64A 2VXSL 4M02A 5AYQA 1WGOA 4JN2A 3TO2B 4BSWB 3GUTA 1VB9A 2ICEB 1Q9KA 1UKTA 3LN9A 4GRLC 4CDGC 2FGWL 4NRYB 3TCLA 1EEUA 4X98B 3FO0L 3DX7A 5CGTA 5F3HB 2CDGB 4M8QB 1PX4A 5IMMA 2A83A 1OPGL 1CFTA 3KPMA 2P42B 1SHMA 3HUJE 3WYRA 1IL1B 4TRPH 1J0YA 4OM0L 5BZWB 5JHDA 2UUDH 4EVNA 3BDYL 1X7QA 2YPVL 5I66B 3VFSA 4FQLL 2Z93B 1LE5B 4G8EB 1IC1A 5HHPA 2VDKL 4ORGA 5D72H 4F3FA 1A6WL 4J3UA 5C08B 5J12B 1YC7A 4LOUC 4QRUA 1ZVYA 5I30H 2R4SL 5JPMB 3FTGB 5KSBF 4CMHC 4LDOB 3O3AB 3QXAB 5TQ0H 1A7OL 4HKZB 3VW3H 1HKLL 3BRGC 1HCFX 4K9EH 4OZHA 1MJUL 5DZNA 3QPQC 1F6AA 1S7WA 4KUCF 4KMQA 1R3KA 3AB0B 2BNRE 3MRDA 1MCBA 2Y07L 3D2UB 1PFCA 3QHZH 1YEEH 3OHXB 3V5KB 4QGTA 1G7QA 4NQED 1IAMA 3DGGA 4NCDA 4LHJB 4X83A 4AJ0A 4RQQB 2CDFB 2KZ1B 3PF2A 3BE1L 4W6WB 1MVUA 4G8GE 5I75C 4I3RH 1FO0A 1MCQA 4DK3A 4M03A 2FSEA 3RPIB 5I1EH 1V05A 1QG3A 2P5WD 1PG7H 1HILB 4PS4L 4G9FE 2C4FT 5I76A 2XZAL 4N1HB 1E0OB 2IAMC 3FRUB 3GSWB 3QDJA 2EYRB 4Y16A 5CEZE 3TH3T 4GXVL 1PLGL 3BN9C 3VJ6A 4X7TB 1XGUB 2BNRD 1OAXL 1HHIB 4OTXL 3LKOA 3DXAB 2X7LA 4JY5L 4LSPL 3SKNA 3GO1L 1DBJH 3B8SA 3GM0A 4FTVE 5DJCB 1DE4B 3PIQB 4P2QA 5L9DH 3U9PH 3O6LL 4ETQB 3U2SB 5ID1B 5I1EL 4X8JB 1CD0A 3KJ4C 1ZKAA 2VDQH 2XY2A 5SWSB 3PQYD 2FIKB 5DS8A 3OG6B 3OZ9H 2EC9U 2JJUA 4X6DE 4ENED 3V4VH 3CPLB 3T08A 2AJUH 1QBML 3O6KH 4GAYA 4YFEA 4NFBA 4LLVB 3BVNB 1XZ0A 4GQPH 3NGBB 5D5MB 5CBAB 3QRGH 5I1KL 1NH6A 3D85B 4NWUL 4OCNC 3L5IA 5HDQH 2YUZA 3C5JA 5DMJB 5J1SC 5E8PB 4MNQE 5DJ0A 4N1CA 1D5BB 1FIEA 3CD4A 5GRXG 1L9MA 4JJ5A 1JF6A 5MERB 3X12B 1XIWB 5AUMB 1I4FA 2XKNB 4CU6A 4EQ3A 1KCRL 2UVEA 1OT1A 4OZ4A 3VI3E 4WCYH 4YHMH 3VXUA 1WZLA 4LSRH 3RFZC 4HT1H 4RWYH 4XHQA 4JRYE 2FLRT 4MHHG 4CGTA 2DI8A 4QOKD 4IRJA 5FV2A 1ND0A 3MYJA 4P5TB 4KGLA 1T21B 1EBPA 5KZCB 43CAA 3CSYA 1YYMH 1EJOH 1OAQL 3D3VD 4EN3D 4I3GA 1LP9F 3DSNA 1U8OA 1J8HE 3GMRA 4S1DC 4WWKD 4AM0A 5ILTL 4POYA 3QEHB 4NO5B 3RVWC 5ITBH 4H5SB 5LVEA 1VESA 3ARSA 3ARBB 1IM9D 4XNXH 1MEXL 3VXOA 4ZAKB 5E5RB 3VFWA 5BV7B 3BQUC 2OL3H 4OB5H 4RFEA 4PRBB 2JIXB 3DWTA 4G7YH 4F80A 1AJ7H 5ICYA 4NZDA 1UWXH 1HIMH 4FABL 5KSAB 4H26B 3RWEA 2KDGA 1EXUA 3ARDD 4YGVA 4H20L 2HT2C 4ELMB 3GMQB 3AREB 1Q0YL 1GGUA 3MV11 5F7NC 1NCTA 5C0IB 2A74B 2XQYK 2W0PA 1BGXH 5ICXA 4S1RL 1RU9L 4S1QH 4QEGA 3VXSD 5CSGA 1FN4A 3N0PB 1UXWA 1FL3A 4Y1AA 1NLDH 1A3LH 1AHWB 1GYAA 1UJTA 1X9QA 3D0VB 2XFXA 2XZCH 3U7WL 2HT4D 3PWLB 4ZQKA 3LZFH 2YPLA 2F5AH 4HQQL 5EZLB 4JY6B 4E5XA 2W0LA 5DHVB 1T7WA 3RZCC 3IDJB 1PX3A 4HQQH 3UJIH 5I1DB 1A1MB 4OSUL 2FB4H 5IV2A 3OHXA 4MA7L 4LCYB 4XP5L 1JV5A 3WIIH 2XN9E 3ESVF 4NC1E 4ELMA 4X9BA 4YDKL 5L0QB 3FQNB 2WBJC 4K7FA 3PP3K 3MV9B 4JM2B 4QWWC 1G7LB 2F9BT 5L8LB 1D6VL 1HDMB 5TE4H 4O5LH 1KT2A 2CGRL 2E9JA 5FDYA 2V7NB 2W65A 3O8XD 3QUXA 1KG0B 4HKZA 2GT9B 4OD2A 3DXAE 2C7UA 1U8QB 5F8QC 2OR7A 3LRSA 3PP4H 2GHWB 3GBMH 4FQQA 5A3ID 3EYOB 1KTDA 1UFUA 2IANA 1T6WA 3QDME 3I9GL 4OF8A 3S5LA 1HHKA 4BQ8A 2RGSA 5C0JA 2X4SB 1UENA 3GSXA 3BPLB 1UEMA 3QI9B 3T4AB 2DQHL 3WNNA 5GSRB 4XAKE 4Y5VA 3A6CH 5I1IH 4RA0C 3O2WL 2BSTB 4G8GB 2IAND 4JZNB 4ONFL 2FZ3B 2A6KA 4W4OC 2XZZA 3UYOD 1N0LA 5I8OL 4UB0H 4KGJA 1F58L 1HSBB 5D7LB 4I9WD 3HUJB 3OKEB 4PY8J 3NPZB 4HC1A 1MHEB 3QDMB 5DVKA 4DN3L 4JREC 2F8VA 5ITFA 3QH3B 2GFBA 3LN5A 1EAPA 2Z92B 4X98A 2A6IA 4KVNH 3Q0HA 3SDXB 3HE6C 2CSPA 3ZDZF 4S1RH 5B39G 1KB5A 3KYOB 4OCWL 1RJLB 4AT6A 2JB6B 3NCFB 1K8DB 3ZDZE 4QKXB 3K7UA 4FZEH 2X5PA 5J6HB 5DD0L 3TZVC 4HZAA 1T1WA 1I7UB 3QG6A 5LGHL 3O41A 1IEBB 2N7AA 2I60H 3BXNB 2F74A 2XWTA 2VL5B 3GJFK 1XF3A 4X8XA 4HV8A 1BJ8A 3MXWL 2V17L 1R5WA 3GFUA 3MOAH 1ZGLP 3FQXA 5KJRH 1S7QB 4N0FA 2YKLH 2X1XR 4IRZL 1I9JH 4Q2ZA 5DJZB 3VE0B 2F53B 4EQ2A 2JB6A 4F8QA 3EO0B 3BKYH 4U05A 4D0CA 5IR1A 3QJFA 5B38A 3QDJD 3D39B 3WN5B 1MEXH 3HRZB 5FYLD 5KAQF 5KG9B 3QG7H 1VFMA 1TNMA 1E4WH 1LK2A 2NR6D 4RBPK 1MFBL 1QVOA 1UA6H 5HHXH 3KJ6H 1EDQA 5F9JA 3AMKA 3UP1A 2AGJH 4AIZA 2D0FA 5FO9B 4P2OD 2AJUL 2P8LA 3S35H 3CXDL 4KY1H 3Q6FA 2VQUA 1T1WB 1CFBA 4GXUM 4P57A 2XI9A 4M3KB 5F7YC 4RAVB 4GG6B 2J8UE 1EO5A 3OX8B 1QLFB 1BPVA 1WF5A 5E1AA 4I18C 1CK0H 3PDGA 1RJZA 4NBYB 3BI9X 15C8L 3UTTD 5CWSA 4XC3L 4FQQB 2DIBA 4MB5A 1R5IA 2C3VA 4NT6A 2NYYD 3F12B 4ERSL 4MS8C 1UM6H 4NGHH 2X89A 2E27L 4OFVA 3QXVA 3IXTB 4AENA 4KHXH 5I15L 3HZYB 3MGTA 4QOKA 4N68A 1KPUA 1NCBL 4CVXB 3BGFC 4OB5L 3IAQA 1NDMA 3C09C 4MCZB 1FVCA 1JHTB 3ILQC 4OCLC 4NUGH 5DJ6B 2Z8SA 5ERWB 1LO3H 5C3TA 2MTPA 4WNQA 2IPUG 4XP9L 5ITBL 1UZ6E 5HVGB 2QBWA 4AENB 2CK2A 4LLMB 1TJIL 3C60C 4WTZG 4XNYL 4G9DB 2EYTA 2VR9A 1FVDB 1KJ2L 3KYNB 4F7MA 3WFDL 3O6LH 2KZWA 2F58L 4Y2DD 2I9LB 1RUAH 5FM8A 5TDOA 4IMLA 3VXRA 4XCFH 1JPFB 4QRUB 3T2NH 1P84J 1I3RB 5I1GH 1BZ7B 4YR6B 1H3WM 3O3BB 5I8EA 5BOZG 4WFFE 4NKIH 2W0FA 3IJSA 1R0AH 2A9NL 1ADQH 4QY8A 4RMUA 3PDOA 2EH7L 1CFTB 1WAAE 2IMNA 5GGQL 2X42A 4BJLA 1PG7W 1DLFH 4LVHB 2XT1B 1AD0A 2O5YH 1KIPB 4MQXD 1NL0H 3DJ9A 3MRCA 4L5FL 4PRHA 5CHNB 1HYRC 3FRPG 2GI7A 4M1DH 2LTQC 5M94B 4M9PA 3QQ4B 3D6GA 5C0BB 4HJJH 3KWWB 3TT3L 4Z8FL 1MH5A 4KKCD 1WFTA 1PKOA 4JANB 4DVBA 4PJ7A 5BRZB 1D9KA 3VGEA 1AXSA 1QYGH 4MGXA 4RGOL 5T33H 2AKRB 2XIDA 4G43A 5D1ZA 2Z4QB 3C2SA 1FLRH 4WDIA 2VDRH 3CCHB 2EEDA 3D5OF 3K1KC 1QLFA 2HH0L 5FK9A 3MTRA 1LO5A 1FFOA 3I6KB 4TTDD 3A6BL 5IVOA 2OTWA 2YA2A 2A1WH 4NQEA 3UBXB 1M71B 3B9KA 5K9KA 4Y4HD 2L7UA 2X1QA 4Y2DA 2H2PC 2NX5B 32C2B 5D1ZD 4PGJA 3ZDXF 4AT6B 1F13A 3JZ7A 3MBED 1P1ZB 5CILH 2HRPL 3QYCA 3ZDXE 1I9IH 1IGYB 4NHUA 4X6DA 2FEEI 4HDIB 2ZZUT 2WUBL 4NQDD 1BREA 3T3ME 4KKBC 3QUZB 4ONHB 3GI9L 5D9SA 5CJXA 1U91A 5D2NB 4MXQD 1U6AL 2OTWB 3T3MF 3V6OC 4Z0BH 3DETC 3DARA 2AS5M 3O81A 1OTUD 5KSBB 2ZSWA 4X5LA 1Y6KR 5FYJL 5CCKL 2AQ2A 2VXUL 1MFEH 3QQ9D 3C6LC 1IC7L 2Y5EA 5B3NA 1VFAA 5D1ZB 4WHTA 5EWIL 4JFDD 4FG6D 1T89C 2XWJA 5F7UA 1YECH 2X89D 4NZRL 2EE3A 1FAIH 1HEZB 1S78D 3IDYB 3IETB 4ZUVA 5FV1L 5ESAB 1A6TA 4GAJH 2WIMA 4ZSOE 4HPYL 2QADB 5KOMC 5JNYB 3MRKB 2AJYH 5EZLA 2ENSA 3OWEA 4PRIA 4G9FD 2BOBB 3I6GA 2FIKA 5DS8B 5IFJB 2ATKB 3IDIA 4R0LA 5KVEL 3RTQB 3F7PC 5EU5A 4ESKA 3FB8B 1NGXB 1TZGH 4ODUA 1MOEA 2OI9C 3VRIA 2YA1A 3D9AH 3EHBD 4PFEA 3BP6B 1NCDH 3IKKA 3F6LA 1A14L 2DQDH 1GGCL 5D72L 3NZHL 4XVJL 4PLOB 3DX6B 1PW3A 4PTTA 2R0ZH 3GMPA 2VXQL 4L4TB 4DTGL 1WQVT 4X4YB 1MCJA 3D18B 1N4XL 3KG5A 3WEXB 3OKMA 1U3HB 4KROB 3OJMB 2WANA 3U46B 4XBEL 4NKIL 2FYYB 3VI3F 4G9FA 1RZGA 2RFXA 4KHTH 4LSVL 1GCFA 5EOTB 2ZUVA 1FG9C 3KR3H 3R1GH 5E56A 4PJ9C 2FCBA 3RUGF 1FNEA 4OJFL 3MRRB 3RAJL 5IWLA 1FVCB 4R3SA 5DLML 5HYSB 2DQUL 4RFOL 4AMKH 2A77L 2BRRL 3MRQA 3E1F1 3NFSH 1QYGL 5T33L 4BSVA 4FMFA 5F1NA 1MHPL 1F4AA 4X6CB 5IJKC 3DGGB 1NAMB 1RK1B 3GSOA 2NX5E 4XPHL 2FR4A 3HPJA 4WO4B 1ZT4B 4TQEH 2NX5D 4KROD 4KTEL 4PJIA 1T2JA 2VC2H 2RR3A 5IGXH 4O4YL 5C07A 1TVBB 4GSDL 2FSEB 3IXTA 1YUHB 1OL0A 1RPQA 2BNRA 3MBEC 4ISVB 1KIQB 1YY8A 4Z9KB 2V2WA 3ZHLA 5T5FH 2WLYA 3AM8A 3WKNA 2UY6A 3MJ9H 3F12A 2V5SA 4HZLB 1KEML 4XP1H 3WJLA 3JWOL 4HUUB 2Z93A 4R4ND 5IJKA 2VXVH 3M17A 4DKFH 3ZE0F 2RBLA 1FC2D 5DVMA 3P9MB 4P5KB 1I1FB 3FN0H 1I75A 5KSBA 1KTKE 3MRLB 1INDL 3B8YA 2Q7YB 1WICA 1ZHNA 4Y2OA 4YDLB 1FV1A 2UWEF 3L3JB 1QLEL 2IJ0C 5IKCB 4PGDB 3FB5B 4F7TA 4HFUL 1EEQA 5SX5K 2APXA 4R96A 3QUZC 4LSTL 1YC8A 1J9CT 5TDPB 4FP8L 7FABH 4L4VA 2BERA 4Z78B 4GAYB 4XI5C 3BPCA 1LDPH 2W9LA 4Z7QE 2BOBA 2R0WH 1FFPB 5IB2B 3P11H 3GKZA 2ICWJ 4RIRA 1F2XK 4JFZH 4GMTH 4NQCB 4Z7VE 4R7NA 4KKBD 2DWEA 3ZKXB 1NCDL 3V52H 1E4WL 4PRHD 2X2YA 3RA7H 2LABA 5F6HJ 1NBZB 3P4NA 4WGVB 3RVVD 4P2CG 5DHVH 3GSUB 2BVOA 5B4MC 3LHPH 4PGCB 1QLRB 3S36X 3TYGL 4L8SC 1IGML 3K4ZA 4JEGB 3AXLA 4W81A 3VD9A 1U3HD 4R26H 4Q6IB 4CN4A 3IJHA 4JB9H 1MCDA 5IOPB 2DWEB 4PRIB 2P1YA 4P99A 1B0WA 5EN2B 5GGTL 4ZMAT 4OD1L 2BOCA 2HRLA 2Z91B 5BS0E 1I8IA 3MV9D 4Z95L 1YNKH 3ILQD 2CRMA 3QH3A 4Y8AA 4HS8L 4LL9A 3IFPB 1A2YB 1T83A 1LO5B 1RUML 3I6KA 4RX4A 4DQOL 3SCMC 2NY5H 2D4FA 4GG8A 3ROOB 5BS0B 4QRRB 3EFDL 3C5SB 5GGVY 5C0BD 4J4PC 3PUCA 4G8GA 1UA6L 1Y6MR 5GRVK 3VXPB 1NFIA 5I76B 2CO6B 2ICWA 4JFDA 3WSQL 2NW2B 3STBA 5DMGC 2IC2A 4LLQA 3W9EB 1LP9A 1NCAH 3FO2A 4P9HH 5E8EA 1EAJA 3PWPA 1V7MH 3IFOB 1VGKB 2F8OA 2DQTH 2IFFL 1KTDB 2OZ4L 1F90H 1CXLA 3UDWA 2VZ1A 2IBZX 1BQHB 4HBCL 3MV9E 2Z31C 5K9QI 4KQ3L 4OZFH 3QDGD 5JORB 4LMQE 4DZ8B 3QNXB 3HLAA 2GSGA 3OPZL 5ALBH 4JQVA 3VCLB 1JYVA 1WFUA 3TFKC 3FFCE 4OQ1A 2ZOLB 4U2YA 5GS0H 4LSQH 4Y1AD 2W91A 4NCC2 1OT2A 5SX5H 3PWJB 5T5NG 4OCSH 1MRDL 2ZG1A 4JO1L 1NKOA 4LCCB 1MRCH 3CDGA 4LP4A 4PJBE 3NA9H 4NJAH 4YAQB 4BA8A 5C09E 1N6UA 1N7MH 3TFKD 1NEZB 3X11B 2D31A 3IDJA 1YJDC 1UJ3C 4OSUH 3HZVA 3SPVB 1KB5B 2GYSA 3NTCH 2X9YA 3MLSL 1W72H 1BM3H 1R3LA 3L3IB 2EH7H 1YN6B 2JB5H 1DQLH 5IB4B 3VFTB 5EO1B 1A9BB 3O2DL 4V1DE 2PW2B 4ZAKC 5D8JL 4EVNB 3TVMA 4DKDC 3FB5A 3BHBB 2VDPH 4UOW0 1CD1A 3QAZC 2J5LC 3SJVD 3HZYA 2Z8RA 1TPXB 4R7DB 1BX2A 1CDHA 3VXSE 2NY1D 1BD2E 2HFFA 4M7LT 2L0DA 2CKBH 1D5MA 1GGCH 2V2TA 4JDVB 1J0JA 1MHCB 5DD5H 4R90L 5HGGS 5A2LH 4H88H 3D39A 5F96H 1IAOB 3WN5A 5GHWH 1TQCC 1N8ZA 4EI6B 3TO2A 3B5GA 2NCMA 1J05A 5TH2B 1CTOA 5J9PB 1BD2B 2ITCB 4JPVL 5EUKA 2DM4A 2UWEA 5C08D 1HHGA 5I18H 2D31B 4P2QD 4U6TA 1KSRA 2E6JA 4K7PH 4ZAKA 4JM4L 4Z5RB 4M6AA 4CU8A 4EUPA 4PV8A 1XF5B 1UB5A 3OL2A 4MA7H 3NA4A 2UYLA 1Z3GH 4V1DD 2NXYD 2NZ9C 4X4XA 2XWJB 4NIKB 5LJYH 4U1GC 4B50A 2EDWA 2OI9B 2YSSA 2MHAB 3U0PA 1VEPA 1NFIB 3GSOB 4ALAH 5DRWB 1X3DA 1GHFH 5E4EC 3MYZA 1AY1L 5F9OH 1MFEL 1CXHA 2YRZA 3PWNB 5DMIH 1T4KB 3IDXL 4PLKC 2AXGB 1CFVH 2Z91A 4NO3B 3NMEA 4Z0BL 2IBZY 4NT6B 1IM9B 3ALPA 4YNYA 4F7CA 3CZFA 2AI0L 3NH7H 5DC9B 1XEDA 4I48B 1EGJA 3U79A 5TQ2H 4TUJB 3IDNA 1CFSB 4HMDA 3WS6C 3C5SA 1DBBL 5L8KB 5E8OB 4WU7A 3U9UA 4P46D 2OTUA 3O6FA 5J8OA 3W11C 3IJHB 3SDYH 5CLWA 3SJVA 4U1IB 2Z35B 4G43B 1WEJL 3CX5K 2E8YA 2Z31B 2XQBH 1SEBB 3GEWB 4NNXA 5D2LE 4G3YL 1QFWI 5D1XC 3WXVH 1IQWL 3QIBC 4WEBH 4OZIA 3KYOA 1NJ9B 3G6DH 4DGVH 1MIML 3SDCC 3EFFB 3MGAA 1HWGB 3BPCB 4HXBL 2RJMA 3THML 1OP5H 3MROA 3FQTA 1EVTC 4GBXA 5C3LD 2XTJD 3MZGB 5LGJB 4P5MB 1MAMH 5BO1L 3UAJC 3VXNB 5EO9A 5T1LD 1J0ZA 4EIGB 1JF1A 1TETL 2DL2A 4KRMB 5MI0B 4R2GC 3VXTB 4JY4A 4U6VH 3UJJH 2PTUA 1M05B 5A2JH 4M1DL 4IDJL 5FOJA 4FFVD 4HIIB 5J1AA 4X99B 5I2IB 3FN9A 3QIBA 1CIDA 2CQVA 3MMEB 1NGWB 3OAUH 3T4YA 5CD3B 1T5WB 3TLRA 3X17A 1G7MA 5D1QC 4UQ3A 1OQOA 2OTPA 4MJIB 1CFVL 3AC0A 3GHEH 3N9GL 3QDJE 3IF1A 1YEGL 2V7HB 1KJ2A 4CRPA 3SDDC 4NN5B 5IMOB 3CFCH 4WFEE 1E4XI 4LHUD 3SKJH 4I0PD 1X5ZA 2NXZD 3SCMB 2GJ6B 2P48B 4JZJB 2EIZA 3CSPA 4JN1H 2NPLX 4OGAD 5LBSL 1XH3A 3MR9B 3QIUC 3CGTA 5ERWA 5BZDB 4PUBL 1UWXK 3D0LB 2XPGB 5DHYA 3OJDB 4XX1G 4LEXL 5D7IE 1DZBA 4HMEA 5HI5C 1LO4L 2FRGP 4X7FC 4G6KL 4UDUB 4K2UL 3L3OB 4NM8H 4H88L 3MUJA 4PRBA 2EIZB 4IIQA 3KAAA 3VXQB 5I1JL 4JDTL 1IQDA 5IB1A 1U0QA 5IVZB 3CFDA 2MCG1 3UPAA 5E00A 2AEIT 4OCMC 3EYVA 5TFSH 3VGBA 4DCQB 5HVFB 3VFGL 1CG9B 2V9TA 1QFPA 5C08A 5INDB 3TBWA 3P4OA 5IW6B 2R4SH 4U0RC 1SJXA 2EDKA 1UZ8A 4L29A 4M61B 2VE6A 3GHEL 3C08L 5F1SA 1PG7L 4K3GA 3HE6D 3RDTB 5F1KC 4UBDC 4ODWB 3RGVB 4YPJA 3EJZD 3NBNA 2CDGA 3F62A 3U7WH 4QHKI 1U93A 1CE1L 5HYJA 5C0EB 3QFJA 1IAIM 1B0RB 4KY1L 1I3RA 2DLEA 2VDLL 5F1IB 1MAJA 4HMCA 5GS3A 4C54A 4QHUA 2D03H 4KRNA 1OW0A 3C09B 1QA9A 2F54D 3BT2L 4JN2B 1MCSA 3BGMA 3UC0H 3SE4C 4MNQB 3MNZA 4U1IA 4NC2B 4NQEE 3BKYL 4XP6L 4MDJB 1BFVH 4XPAH 4QRSA 1PG7X 5KANG 3LEXB 3BSZH 2YKLL 3ZKMC 1HK6A 1QBLL 4M7LL 3HG1E 1F90L 1WEJH 2DS4A 2OM5A 4MQ7B 1QSFD 3SDYL 3MLRL 4N8CH 4FXGA 1QNZH 2I5YH 4PV9B 5JW3L 4PJBF 4U1JB 4F37K 3I6LD 4TUJA 1F02I 2C4XA 3BEWB 3TVMC 4I1NB 2EDRA 2R1XB 1FAKT 3TO4C 4NKDA 4X6FA 4XPFH 1IEAA 2XWBA 2B2XH 4P3CL 3ILPA 3UTTB 2EDOA 5DJCA 1DVFC 4BSJA 3O9WB 5F72S 4M6MH 2ZUYA 2DQCL 4R2GD 3NCYP 4I77H 2A6KB 2HG5A 4YFLF 4P5KA 1T5WA 3ARYA 1R3JA 3C60B 2MHAA 2IEPA 1TJGL 2QL1A 1HQRA 4NKDB 1KF9B 4KH2A 1IZJA 1YJDH 2VL4A 1ORSB 3GJFH 3LV3A 2AKRA 4OIAA 4X6CF 1DDHA 1MLCB 5MP6H 1AKJD 2VXSH 2G2RA 3EKCA 1KCRH 5HHNA 3QP3A 3BSZL 5I1CL 2DKSA 4U1JA 1IGMH 1EEZA 1Q9LA 5JDSB 3BEWA 3K2UL 1OWRM 2HYMA 5ID1A 3JV4A 5FEBA 1X5IA 4U7MA 1QKZL 4Y19A 4HWEL 5BZDA 5C9JB 3DUUB 1IT9H 4X5XB 1FNGB 5IFAH 5HBBA 1YN7A 1MPAH 1X4XA 3FQXB 3KPPA 2CGRH 3TBSA 5JW4N 2LTQB 2M26A 4DVBB 3BRDA 2HA1A 3AU1B 3MA9L 1TZIA 5F71A 5BVPL 3MLZL 5ENWA 1XR8B 2VDPL 1XGRA 2VUOA 4GT7A 4QOKE 5T1MA 1J0IA 2Y5TA 3U48A 4EN3C 4IJ3C 4Y5YC 2HKHH 2UWEB 5F7EL 4A6YH 5DJ8B 2HMID 1BHGA 1PJ9A 4ZUWB 5HYJE 1LQSR 1NCNA 4OT1H 3FFDA 4ZS7H 4TYUA 3GO1H 3QB7C 5ELIA 4YJZL 1D5IH 1ZT7B 4OM1L 5GJSH 4ELKA 3BO8B 3PHQB 4LK4A 4DKFL 1CT8A 4RGND 1G7HB 1R3HB 3QNZB 5DZLA 2C5DC 5ALCH 2F54E 4X7TA 3TIDA 2AXJA 3EOTL 2NY0C 3T0EE 1Q9WB 5HTSA 3G9AB 4JRYD 4KK5D 5AZ2L 4WUUE 4LBEB 4CDHA 1J1OL 2VKXA 2VITB 1R5IB 4OIIH 4HZLA 4AL8H 5C0JB 1XGRB 3HC0B 5IT2H 1N6QH 5CJQL 2UZIL 1RFDH 3LD8C 2P5WA 5HHOE 1A9EA 3FQWA 3HNTL 4U2ZA 2BNQE 3GMOA 4GLRH 4PD4J 3VFSB 4HWBH 3LQAL 5C0DB 1ZLVH 3EJYD 3VRLF 4KJQD 4HEPG 1EV2E 2AK4D 3AMLA 3SKJL 1OGAE 1YZZA 2C1PA 4P9HL 3ROLB 5CEZD 5GRWA 5TQ0L 4PBWD 4IRJD 3SEPA 4DFHA 4LKXB 3CAFA 3OX8A 4OZHF 2PR4H 4UIMB 3WUZA 2B5IC 4YQXH 1AKJB 2L4OA 5TF1H 4RMRA 3TCLB 4LCIH 3ZLQC 1CDJA 4DOHE 3T0BA 1OGTA 4K9EC 1GGIL 4MD0A 1A6AA 1EVUA 5KG9A 5T1KA 4HIEB 3ZE1F 3CH1B 4PJGF 4IOFD 1H3PL 2QADD 3GMLA 3F7YA 3BP5B 4PJGE 3IGAA 2EDYA 1ZA6A 3HNVH 1UM4L 5D93C 4HUKB 3NCMA 4OGYL 3QUYB 4YE4L 3ABZA 5GZOD 3QBTB 4QGYA 5DD6B 3GBLA 5I66A 2QHRH 4ZPVA 5HDBF 4K94H 3MC0A 2FH6A 5GGTH 1F4YH 5HGAB 4P2RB 3RWGA 4M6OL 5B4MD 5I1HL 4G6JL 5CIPA 5DR5H 3EJJX 3THMH 4HBQA 1MFNA 4HXBH 3W0WA 1RVFL 4LFHG 3OTTA 3HR5A 3OKOB 4WI4A 2YXFA 3HMXH 3PQYA 3MRJB 5JHDD 2MSPA 1RZ8A 1XT5A 2NXZC 4AEHH 4RIRB 2YPLD 3FHAA 4L4VD 3MBXH 1DL7H 5E99L 4M7JL 5J89A 1KXTB 3AS2A 3F7VA 1C7TA 5L7XH 1MHCA 3MLPA 5L88H 4L8BB 35C8H 1YEIH 3K4DA 1PD6A 2MFNA 1FIGH 2AXGA 3MCLH 1J11A 1HE7A 5CIPB 1CYGA 3RVUD 4OUUB 4WFHE 5KVDL 4M1CD 1DE4A 4JQXC 3U2SA 3FB6A 3NABL 3C2AL 3DXAA 3ARUA 2PN5A 4YWGL 3F8UB 3GI9H 3JTSA 2ZG3A 4MNGA 4OGXL 2VNCA 2YOCA 2CMRH 2X4SA 1MFCH 5DEGB 4JGJA 1IZKA 4R7NB 3REVB 3P9MA 3PG2A 4RNRB 4L8CB 3MLUL 5JDSA 1CLZH 1NUFA 1XGTA 1HILA 4GW1B 1J05B 3RP1A 3S4SA 1F3RB 4M6NL 3TO4B 4JM2F 4P0DA 5E2WL 5C71A 4UMGA 4PRAB 3QUXB 5FYLL 3SDXF 1IM9A 1JK8B 1AXTL 1MWAH 1ACYL 2EDBA 3QI9D 2X9XA 1KLFA 4PYGA 4L1HA 3L1OL 1BBJA 1WUNT 3LRSB 4MCZA 1HQRB 2E7BA 4G8GD 4UTAL 3G5ZA 2IGFL 1AP2A 5A40E 4HGWA 3L3HA 2VLKE 2ATPA 4IRJC 2PO6A 4AH2B 3AS1A 2X6MA 1QSFA 35C8L 2BXYA 2COQA 1T3FA 2HWZL 4YK4C 4AEHL 1JWMB 1OGAD 2X70A 4KKAC 4HEME 5SWSD 1QR1A 3P9LB 3BFOA 3QIWC 2LQRA 1DBAH 4FS0A 2YK1H 2RIKA 3CUPB 3MLVH 5I1HH 4O58H 1T20B 5DK3A 1G0DA 2J7LA 2Y06L 4N0UB 1FBIL 1XGYL 4QTHB 3T09A 5IHLB 3HAEB 3BHBA 1WWWX 4L8SB 3R8QA 2EC8A 4YE4H 5DC0A 1PKQA 1DFBL 4P2RD 1CLZL 4NKMB 4YPGA 3MLUH 2NY7H 1Y0LB 1M05A 1P7QA 1AR1C 2I07A 2F5BL 2LVCA 4X6BA 4RAHA 2FL5A 2AEQL 1FNSL 3HA0A 4MD5A 2R0KH 3SPVA 4LPUA 1DVFD 2K3TA 4YDJB 3HE6A 4N0UA 5CINH 3JWDC 3VFRB 4LSSH 2YEZB 2ZOKA 4O2EA 5BOPA 3OGOE 4PJDE 3ZL4H 5HVWA 3F7VB 4KTYA 5I71B 1MJ8L 5E2TL 2F15A 4ZNEE 2OMBA 5FO8B 3DHMA 1Q1JH 1LO3L 2G5RA 4H26A 3G9VA 3WD5L 1N64L 4BKLB 1I8MB 1X44A 3GUTB 3X13B 3RU8L 4F15C 2A74A 4P2RA 3RWGB 1ZA3A 3TP4A 2BHYA 4J6RH 3QWRA 1G9ML 1LO0L 2DTML 5IQ9B 5F9AC 4KU1A 4PB9L 5CUSL 4KQ3H 2B0SH 4G8IA 1Q0XH 1VPOH 5C0RL 5DHYB 1JRHI 2P45B 5ESQB 1T21A 5FA3B 1JZ2A 4KZEH 1EIBA 1SJHB 4XCCL 3V0VB 3CZFB 2APVA 3I2CH 1KGCD 4GW1A 2IQAB 1OGAA 2EIDA 4ZFZA 4KQ4H 2HT3C 2YD2A 3H42H 1KYOK 1IQDB 1OF2A 4PRAA 3GZKA 4NM4L 3WE6A 3GHBH 4N5EC 4H1LA 5I1AB 2BSSA 4P3WA 4LHUA 1WLHA 1IGIL 4DQOH 2E7CA 1NKRA 4Y7MA 3T0EB 1W0YT 4XAKD 1MCOH 2Z8WC 4MNGB 2AJSH 1JP5A 4S10A 1FGVH 4QRQB 3ZT5A 3JVGC 1VGEL 1I7RA 3ALXA 4CJ1A 1FHGA 4Y5XA 5I1AA 2VDRL 4JB9L 4ODSH 2YN5A 2EDDA 3QFJD 4Q7DA 2YBRB 1FFPA 1ZHBB 5CMAA 3O3EB 2VXVL 5D96C 3TYGH 2BFVL 1HN1A 4UT7L 1T7YA 4ZNEA 4ODHH 1QEWB 1S7TB 3LS4H 1D5ZB 1LEGB 2QHRL 3S96B 3TNMB 3O0RL 5CGYC 3ES6A 1MNUL 4N0UE 2JCCA 1EZVX 1CFNB 4E0RB 1SBSL 3MRJA 3BP4B 5FGBC 3CK0L 1RZ7H 5D1QA 2PXYB 4O4YH 2CPCA 4UIKH 3RDTA 5A2KH 3VXMB 4TQEL 4ZOEA 1C16B 2VZOA 1X5XA 1GGIH 2X4NA 5HY9B 4M93C 1F4WH 1QEWA 4NDMB 2V5TA 3ARDA 4G6MH 3QCUL 1AGEB 1Y18B 4L9LC 4YXHL 5FO8A 1GOFA 5HD8C 4X7DC 2B1AL 5T3XE 3QDGA 2QJDA 1AO7B 5IVXB 4OM1H 3F65A 4WJ5B 3RUGB 2EXYC 5E6IA 1CDGA 4YC2C 3E2HB 4Q74A 2YWZA 1PZUB 2EYSB 1QSFB 32C2A 4M5ZH 3A6CL 2YUXA 3HPJB 3IJYB 4GRLB 4PGEB 1F11A 4L8DA 4AEIL 1BMGA 3UPRB 1RULL 4PGDA 3MJ9L 3ULVH 5HGHB 4NPYA 3STLB 1MJJB 4FXKA 3ARDC 4QY8B 1KULA 5HHOB 3I6LE 3K8LA 4N0RA 5GGVH 3PP4L 3RJDA 2E8ZA 1E4XL 1JHKH 3W11D 3QULB 3O0RH 3BMVA 1ZXQA 2GJ6A 1DQMH 4BZYA 2RAMA 4Y8DC 1DJSA 1YYLH 3X13A 4Y16C 4EDWH 1KELL 4MAYB 1QKZH 2ARJB 4FQJL 1D6VH 3VDAA 5CSZA 4RGMC 4OCYH 5GRUH 3GJFB 1A02N 3O3DB 3D18A 3WJJC 2FD6L 4B0MM 4NPYB 3STLA 4TUOB 1P4LA 2NTFB 4PJIF 3QQ4A 2AV1A 4P59L 1S9WB 4U49A 2GQHA 1TQBB 4ZO8A 1FYTB 3V95A 4JM2A 1J88A 2FATH 4MJIA 3BT2H 4TSAH 4OJFH 1HDMA 3V2AR 4J1UA 4MQTB 3G5ZB 2CKBA 5ID0A 2GCYA 1I1CA 4ONHA 4PY8I 3MRHA 5D9SB 3QUXD 3PL6B 1YNTA 3AM8C 1AFVH 1JGLL 1TTGA 4HK0B 2PKDA 3REWB 2BOCB 4AIZB 2WMPA 5B38G 3GSNH 3LKNA 4HKXA 4PRNA 3HRPA 3S35L 1M71A 1JGEB 2KPNA 4JAMA 5BVPH 2PO6C 4KI5C 1FCCA 1U8HB 1RHHB 5DJ8A 5I6XB 1QRNB 2PW1B 4NNYA 3DMMA 3U82B 5D5MF 5JHLL 2VJXA 5IG7B 3FHQA 1MI5A 4GKNB 4PJCE 1A6ZA 1C08B 1EPFA 3IFNH 4MD5B 4QRRA 1JBJA 1CFNA 4E0RA 1NCWL 2J88L 5EORL 1IFHL 5H37G 4WUKL 2FD6H 5CGMA 2X05A 1OOAA 2L7JA 2ICES 4UUJB 5KVFH 5FO7A 1HIML 1KELH 3MSPA 1YYLL 4PJAE 1A4KB 1R6VA 5B39A 1GGBH 4ZFGH 4EBQH 5CZKA 3EYUL 4C56A 5HYJD 2XN9B 2VDOL 3MXWH 3I3DA 3TIEA 1YEHL 4P5TD 5ETUA 2QSQA 3C87A 4LSUH 5CEXA 5MEOB 1YECL 3S35X 2YRPA 1T0PB 2GUOB 2HVKB 3C6LB 4P23B 5HI5D 3FKUS 3I75A 2PYEB 4Y4FA 4J3XA 2ZKHH 5ADOL 2VAAB 4NN6B 1CGWA 1LD9A 2J5LB 5GRJL 3M45A 3RWJB 4KMTL 4XPGL 1NFDE 4U1HB 3HUJA 1KYOJ 1NMBL 2W9DH 4YUEH 1IM3A 3RX5A 3DUSB 1RD6A 3ARQA 4ZAKD 2J2ZA 4BZ1L 1YEGH 3LSOB 4U7SA 3S5LG 5BCAA 2VB5A 5C2BH 4JANA 4WI2A 1UWGL 2I5YL 4HJ0C 2PYED 3PABB 2RQ8A 4K3JL 1RMFH 5C0BA 1OSZB 2ENYA 4KRPC 4KKCC 3D48R 3MRPB 4HIJB 1EZVY 3WMSA 3SBWC 3DV4B 3ISWA 5EUKB 1EH9A 1T2QL 1TVBA 5CEXB 1OTTD 5I71C 4L8BA 2AJ3B 1M7DA 3CLEL 3MLVL 4U6VL 3QCVH 3UJJL 1PKQE 4WDIB 1TETH 4JZOA 1P4BL 3D3VB 2R29H 1DP0A 1K5NB 4NNPH 1KN4L 4PJ8A 5DJ2B 5FK9B 3R8BB 4LLWB 4U1NA 3FFCB 4B53A 4HUUA 2MOVA 3DBXB 3SDAC 1P7KB 3VWKB 1FQ9C 1JV5B 3OKKB 4KWUA 1JPFA 1J87A 4W6XB 3NPSB 1ZEAH 3HC4L 1EHNA 4PLKD 5BRZA 1KN2L 3RGVD 1CBVH 3OGCB 2HLAB 5FCUL 1BD2A 5L2KB 3U9PL 1TCRA 3ARBC 3WIFB 5FYJE 1G9EA 4N8PA 5FM5M 5FUZH 3KS0J 4KDVA 2A6IB 3MJ8B 1V3MA 4XB7A 4YHLL 4DVRL 5C0BE 3QNZA 5FUCE 3AU1A 4M9OA 5DMKB 3HMWH 4HIIA 4ETQA 4FFVC 1ZLVK 5KVGL 4YHYC 2ZUQB 3F58L 2EKSB 1D9KD 5KS9A 4KXZH 3QPXL 5ICXB 4UV4L 2PETA 3T3PE 3TV3H 2Q7YA 2GK2A 4PREA 3TNNB 4MA1B 5L2KD 3BH8A 2I9LA 3BD4A 4Y4HB 5KW9L 2YR3A 5JLZB 1GHFL 2IF7A 2ZSVB 4ONGH 3D3VE 3GI8H 1SY6L 3OKDB 3PWLA 4ZQKB 1CD9B 1ZWIB 1KPRB 1U95B 4ZDHB 4HHAA 1QHOA 1HNGA 4XVSL 3T2OA 5HHXL 1ZTXH 1PY9A 4LCWA 4UINL 2CD0A 4FABH 3VGAC 4KDTA 3NZ8B 4K55A 1NBYB 2AJZA 3CFIC 4KHXL 1P6FA 3PWPB 3MACH 4UOJA 3AY4C 1HHJB 3D0LA 4FQCL 4I0PB 2HLFD 4MXWL 4LAJH 5DWUL 5C0CE 2OL3L 5E7BA 4EN3B 4NGHL 2FIRT 1IQWH 3WD5H 3MXVH 3MV9A 4M48H 3VXRD 4IMKA 1WZKA 3S8WA 1FC1A 5C07D 2BY3A 1K8IB 2G5BB 4G42A 3M1BA 4IRSD 5SWQA 4YX2L 5IFJA 5CP3H 5DQDH 5FYKH 1CICB 1WT5A 1NBYA 1A6WH 3NCBB 4WUUD 1X5LA 2BC4A 4PTUB 1N5AA 2DYPD 1CDCA 2A6DB 1MHHA 2XNAA 3W0WE 1KJ2B 4FQLH 3UTPE 3TH2T 3OF6D 5CWSB 3QJFB 4JO4H 1VFAB 1IBGL 3WS3A 3ULVF 4NQUA 5E5UB 4YHNB 1IM3B 1AC6A 3FFCD 1OAKL 1OSPH 4Y5VB 5BV7L 1I3GH 1UVQB 2XKUA 2XV6B 1XCQA 3NGBC 5C2BL 3SHSA 4KROC 1IJ9A 5D93B 3T4YB 3E2HC 5CD5D 3D39D 3EW3B 5BS0A 3ARPA 1EFXD 1NFDF 2PNDA 5E03A 5DFVD 1NCCL 2ID5A 5K9JH 1QSEB 2WINA 5F7WC 2MKLC 4LIQE 4NRXA 1DN2A 4U3HA 1ZVSB 4JKPL 5FA3A 3ARGA 2EIBA 5IHUL 5CP7B 5ANMA 3MFFA 4FQ1L 1W0VA 3WHXB 1BEYH 3MRMA 5I1KH 1UKSA 3WO4B 1CTNA 3MV8E 3DVFA 1T7VA 4XBPA 1WBZB 4MQXC 5JW5A 3QIBD 3SQOH 4OI8A 3U0WL 4ZXBA 1JGUH 1SY6A 4L4TA 2X10A 2AJXH 3OPZH 3BQUD 5ALBL 2IPUK 3OKOA 5K59E 3DX6A 3ZE0E 4D3CL 2VDOH 4BUHA 4HKJA 1P7KA 1AXTH 3ULUL 4ZUUA 3DRTB 3L3IA 4XZUA 1NMCB 1OAZH 5FA4A 1W0VB 4UV4H 1ORQA 5DUPL 1H8SA 4WUKH 3QA3A 3D85A 4F8TA 4RGNE 4FZ8H 5F7MC 3TH4T 4OZGF 5CHNA 4GXVH 4PJEF 1JJUA 4RZCA 1ZOXA 2E7MA 3G6JE 3QQNA 4WO4C 5E1HB 4OKDA 3GIVA 5ACMA 1U8KB 3UTSB 1MCPH 1DBMH 4JPWL 4Y4HC 1AI1H 1I1AD 1KENH 2PO6B 1ZT1A 5H35B 5ID0B 4P46A 2H2SC 3ET9F 4HS6A 1CL7L 3MRGA 4PJFE 1T0NA 5DURD 5E9DA 2N1KA 3MLZH 3S36L 3GBNH 4EUPB 5I18L 3QIWA 3TBYA 4BFEA 2DKUA 5FKAA 4LPXA 3D1MC 4OBSA 4DFIA 3WDJA 2HN7B 1FL6A 3KXFE 3CUPA 4OV6F 4M7JH 4X4XB 4JFPA 4NZTL 3IRZA 3OB8A 5E5MA 5J6GA 5E8NB 5DI8A 4QHLB 1ETZB 1B4JH 3GSXB 1OAYH 1OP9A 3MCKB 4O5LL 4LPTA 5L0QC 5T1LA 4U1GB 2FJFA 1HXYB 3VW3L 1CU4H 1PBYA 4UQ3B 5EORH 1HKFA 4NP4H 2V7NA 2YN3A 2HN7A 3LIZL 4C57C 1CZ8H 5EUOF 1T22B 5I30L 1JHKL 3WEXA 1U8MA 3B2UC 4OGYH 1PEZA 5F3BB 1J10A 1NCAL 3CVIL 1JPTH 3NTCL 3P77B 5DYOB 1RIUL 1QHPA 2BHZA 5IMMB 4G6FB 2IH1A 4B7IA 5D2NE 4UT9L 1FFNB 4Q9QH 5JIHA 2D7NA 1A3LL 3UTQB 1MQ8A 4JPIA 1CIUA 1T1XB 2G75A 3H8NA 5HY9A 1JYXA 4X7SL 1IGFL 3S37X 3Q6GL 5C6PB 3SE3C 4Z0XB 3X3GL 3KDMB 1ULVA 4KMLB 1YNKL 5T1LB 1INDH 2VTFA 4LAQH 3VFUA 2EH8L 5DRZB 2FGWH 3NCCB 3W9DA 3P4MB 43C9B 4XXDA 2VISA 1Q0YH 2A9ML 4HUVB 5I9QC 1AHWA 3ES6B 1EERB 1NQBA 2YC1A 2ZOLA 5DJ0B 5FHAH 3OKYA 1K4DA 5IMLA 1N3NA 1DCLA 1UJ3A 2RHEA 1YEHH 5GRUL 2DLTA 4FQJH 1DUZA 4U1KB 3EYSL 4HX1B 4QCIB 3TBSB 1AJ7L 1A21A 3ZT6A 2A73B 2R1YB 3CXHJ 3GGWA 1NDGB 1BJ1H 4W70A 5KVFL 4NKOB 3FJTA 1MJ7L 4KI1A 5BVJB 1E4XH 3NACL 3UTTE 1MCCA 3L3KB 2FBJH 1BWMA 2B39A 4DAGL 2WK2A 5C86A 2R56L 4JVWA 2EZ0D 3CDYA 4OLWH 5ANMB 2Y1VA 4OCRH 3WDHA 2GSGB 6FABH 2H32B 1EJ6A 5HDQL 4C83A 4M1GH 1EEZB 3FMGL 5FGCE 2IQ9H 4BSWA 5JPNA 1S7QA 4N0FB 1V7NH 4URTB 4BFBD 3O6KL 2GSIA 3DIFA 5CGYD 3UEZA 4ODBD 5IBLC 2DLFH 1ADQA 3GSNL 1UQSB 2O26U 1VFOA 3HCVB 5DJAA 3O8XA 5C6TL 3QR2A 3VXPA 1DN0A 3DECA 3GNML 2D7TH 2Q3ZA 4HS8H 1K2DB 5FA4B 1SVZA 2HFTA 1CXKA 2Q6WA 5DRNB 3GIZH 2KH2B 1G7PA 2QQKL 4HFUH 2R9HD 2V6HA 4P4RA 1ZANL 1G6VK 4MD0B 1YEJL 2NX5A 4AZ8A 3V7AE 5CZVL 2FATL 4TSAL 1WBZA 5HYQB 1YUHA 2P46B 1U41A 4PRIE 5A2IH 2ERJC 1IGYA 3IDYC 4NHUB 5DJDA 1Q8MA 4YHKH 3UZEA 5CEZH 2OSLB 4HCRH 4PJXE 1A0QL 3HPLA 4DZBA 3S97C 5MEPB 4GUPB 3GSQA 4Y5VC 2VKWA 3BIBX 4Q58C 5IOPA 2VYRE 3HFMH 4FNLL 4WW1B 2BXZA 3BZFA 3DVNB 4G6FD 5FECA 5EFIB 3VXSA 4GW5A 1KCVH 5F89B 3RI5F 3MRRA 2QSCL 1J1XL 5DJAB 1RK0A 3OAYH 3RIAF 3P11L 2Y25A 3C5JB 2NY1B 4PG9B 4NQCD 4PUBH 4FQHA 1BWWA 1WWAX 4DEPC 5FHAL 2APTA 3O3BA 1JTPA 4NQDE 3P4LA 4CW1B 4M93B 4PJ9D 3WFCL 2BNQB 2D0GA 2QADC 4H8WC 5GSVB 4ODVL 5HYQA 1Q1JL 1JWSA 1HXMA 4XBEH 3RI5K 4LLMA 2OJEA 3PWPD 3GK8H 4V1DB 2HTKD 4TSCH 3O2VH 3ALWA 3C5ZC 4UU9B 1KEMH 4XP1L 1F6FB 3H42L 3LKOB 3M17B 1R3KB 5FUOL 4R4FH 4CW1A 3QXTA 5EUOE 4JKKA 5HHVL 3ARWA 4WWKA 4GRWH 4IHOA 3QNXA 3CU7A 4UAOC 1KC5H 4PV8B 3KLHC 1YEFL 5T3XH 1RZFL 2J4WH 4PRDA 4U1MA 2A2QT 4TUOA 4JRXA 5C09B 3OAZK 1QFWM 5FYKD 3SE4A 5JQHC 2P5EE 3ZTNL 3VH8B 3VXOB 4XPHH 1S7UB 3S3PA 3KNBB 4PY7A 5MHSD 5E9DB 2ED7A 3SE8L 5FKAB 1K4CA 3RWHA 5JUEL 3VXUD 3HE7A 3LPFA 2ZCLL 4P46B 3VRLE 4BSVB 4AH2A 1V3JA 2OJEB 4XPBH 3KPMB 1TCMA 2FR4B 2VLMD 3MUHL 3GBNL 1YEFH 4ORZC 5T3XL 1JZ7A 3G5XB 5DC4B 2FX7L 2ESVD 4LLAA 4JPKH 1B9ZA 3QO1B 1ZK9A 2BY0A 5CBEB 1C5DA 3IF1B 4L8CA 1QRND 4QNPE 1DBBH 3IAPA 2HFGH 3VFUB 3W9DB 4CJ0A 3BAEH 1LHZA 3S3SA 4AYFA 3T8XB 4E41D 2ZSVA 2ED8A 5L2KA 4Y19E 2ZCHH 1GIGH 5MENA 1FZKB 3QIBB 3V8CA 1MCEA 2HFFB 4OD3H 5IROA 3V5DB 4WIQA 5HDBE 1YY9D 3RTQD 4EI5C 1YNLL 1EHLH 3NFPB 3L95A 3MREB 3DBXA 4WJ5A 5C0ND 3HAEG 4ODUB 4GBXB 4LLUB 5D7IF 3ULUH 1XF2B 1QRNA 2PW1A 1MCKA 2QKIA 3DETD 3U6RA 1G9MH 1LO0H 4JZJC 4S2SA 3DTXA 4I4WB 4OF3A 2J8HA 1MF2L 2P5WE 4RFEB 4E41E 4IS6A 5HYSG 3IDGB 4H8WL 4UUJA 1E27B 5IHUH 3SJVB 1CE6A 3IETA 1DQDH 1S5IL 1JTTA 1V5JA 2WSKA 5DRNA 4JPWH 4LVNC 4HUVA 5F89A 4NNXB 2ADGB 4M4PA 4XGZB 4YHNA 1F97A 5L2KE 2E5EA 3IGAB 4LGRB 2H1PH 3FQUB 4X5XA 4N0YL 4XP4L 4U6HB 1OW0C 2MMXA 1S9WA 5JR1H 2VUYA 1F4YL 5DJDB 5GGQH 5C0FA 3UXFA 3BKJL 5DUPH 1JK8A 2VZTA 4OGXH 5HHOD 1CCZA 3FCTA 3WE6B 5E4IA 3GNMH 3L5HA 2IAMD 4MJ6B 4UIMA 4OQTL 5C07B 1FFOB 4XC1H 1RURL 2YZ1A 2JE8A 4IDJH 3HMXA 3VD3A 1FRGH 3TM6A 3U1SL 4PJIB 1L9NA 5DSCA 5IM7B 4I0PA 5DK2A 3LPGA 3B9EA 1UQSA 1W0WB 5IK3A 4P3DB 5E8PA 1I7TA 2NY5C 4JO1H 4Z8FH 1JHLH 3BZ4B 2VLJA 4LNVA 2PCPB 5C0DA 2JJSC 3NVQA 5GGUA 5IVZA 5IBTH 4RFNC 4PP1C 5C09A 1AGDB 2DKMA 4FQ2H 2VDNH 4F57L 1Q9WA 4E41B 1PSKL 4BKLA 1BBDH 2GY7B 3QUMB 3RDTC 5EU4B 2DICA 3ARGB 5EC1A 1GVIA 2E27H 1I7ZA 4MJ4A 1BAFH 4P4KD 2XN9A 2EKSA 3VFPB 2JJWA 1RZ8B 1ZVHA 3D0VA 4CU7A 5IVNA 1TQBC 2LV4A 5DD0H 4PR5B 4TPRL 1MCHA 4QYOA 4GBXD 3T2NL 5JO5A 1WC7B 3WFBH 4LASH 5HI4D 3G6AA 2SEBA 2A6JA 5HPMA 3KPRB 5TGBB 3RVTD 5IMOA 1BQLH 4R3SB 5GS0C 5JPMA 5D7IB 1GH7A 3TA3C 2F19L 1AGEA 4F37F 2NY5L 4WW2B 1WFOA 3VFPA 3RHWK 3BQUB 5FYKL 5F9OL 3FO1B 1CG9A 3Q5YA 2X4RB 1BF8A 4R0LC 4DVRH 1JPTL 2WBJD 5HHMB 5CEYA 4N0CC 2D7PA 5HI4C 1WIOA 4LARH 3KJ6L 5IBUG 1MFBH 3E8UL 4X4YA 3LEYH 5TDPA 5JMRA 3AUVA 5F70A 4KKAD 4ZSOA 5I73B 1QOKA 1DL7L 5E99H 5DK0A 1KIRB 1S7SA 1QFUH 4OQTA 4MJID 3NPSC 1N6QL 2DJSA 4FXKB 1MJJA 3HMXL 3R0MA 4LHUG 2EDNA 2CIKA 4MJIE 4M5YH 3H3PH 5DFVC 1A5FH 5DT1H 1KB5L 1JNNL 1B4JL 4OIIL 2N7BA 3SCMD 1S78C 1NANH 3PGCB 4TVPH 5HGBA 5I16B 1T7ZA 1OF2B 2R29L 3QDHA 4GJTB 3NZ8A 3C9NB 5D7SH 1JI1A 4WGWB 3T77B 2ARJA 5GISL 1RAMA 1G9NH 5GIRA 3OKEA 1NLBH 1X5JA 1YMMB 4LP5A 3EGSA 1CL7H 2ZUQC 3ARXA 4GO6B 5K9OA 3QWRD 3MNVB 1HINH 4NN6C 4AEFA 2VLKD 4CN6A 1IEHA 2ZSWB 3SGEI 3VFVB 1UWGH 3OAYK 4O9HL 1C7SA 1MHHB 2D7TL 5GQBA 4JG0L 1HSAB 2R1XA 1KEGH 4I77L 1F2QA 4ELMF 3UTTA 2FX8L 3T1FB 4K8RC 1P5UA 5K9QG 1KG0A 4N8VB 3L3KA 2W59A 4D0CB 4JFFD 2EE2A 4KJWC 4RBPH 2VXTL 5E2JA 1MCLA 4XMPH 3VDCA 4CVWA 3H9HB 2R56H 3ZZ1A 1BVLB 4JFYA 4M00A 1IAIH 2P8PA 3VXMA 1KFAL 4KVCH 2NY3C 1TZIB 4FZEL 5EIQA 1BEYL 5FYJD 2LU7A 1XZ0B 5MI0C 4TTGA 3MREA 4RMSA 1OAUH 4JKPH 2A38A 3EOBA 1NEZG 3ORJA 4K3JH 3CFBB 3PGFH 4IOIA 5LCVL 4HIEA 1NC4A 2QKIB 4M7ZC 3QUYA 3AVEA 4NQSB 3VGAB 1IGCH 4P23A 4AG4L 4MDIB 1VHPA 3TBVA 1ZLWK 5D6DC 3HG1B 1U58A 3IXAB 2PO6D 2BX5A 4KI5D 5C0AE 2Y7QB 3U4BL 4QHNB 3BISA 3RPIA 4LCCA 1EAPB 4P23D 3DX8A 2OL3A 1GZQB 1I7RB 2YD6A 4NN7C 2P49B 2B5IB 2PUQT 2J8OA 2Q76B 2W0FB 3QEQE 4RMQA 1N2RA 1G7IB 3OR6A 4IIQC 5BXFB 3MV7D 2E7HA 5D70L 4LSUL 4C56E 4BZ2L 2WWKT 1HHHB 4M62L 5D6DA 4CADB 4Z77B 3S4SG 2NZ9D 4WV1C 1HNFA 4ZFGL 1EGJL 5E6IC 4YHPB 1NAMH 4JAMB 4OLVH 5CJ5A 1A9EB 2WIIA 4U6YA 1NC2D 4Y0GA 3S37H 1CN4A 3BYTA 5DWUH 1RJZB 5EBWA 3ULUE 4NRZA 1MI5E 3S37L 4NZUL 4OFYD 4OLVL 1S7SB 1YQVH 3JTSB 4OZIE 4DGYH 4NM8L 3E8UH 1GC1C 3O45B 1LWRA 4TVPD 2ICWI 5E95B 1CVSC 4Y2DC 2K9UA 3ULUC 3OJVC 5IW3A 3OJDA 3E6FA 1G9MC 2Q76A 3JV0A 5EWIH 3FT3A 3JUYA 4B7LA 4GRLA 4QRPE 1EBAA 1SM3H 3IJSB 2YPLB 1HOCB 4PG2A 2J1KA 2HLAA 4WHYG 1CGSL 2CRZA 5CJXC 5KOVC 2UUDK 4GMSH 3QPXH 1ITCA 5H2BA 1FFQA 1ZGLB 3NCJL 2G9HA 4S1QL 5LKNA 3EDEA 3VU2A 2SEBB 1UH4A 2B1AH 4MB4A 3FONB 4KJYA 2WNGA 4ZNCD 4H20H 1GAFH 5HVHB 1UYWH 3IS1X 3ZTJH 5C9JA 4OGZA 4ODTH 1VENA 3VA6A 1RK0B 4P5MA 1NEUA 5F6IB 2OK0H 3E6HB 2EKJA 2BVQB 3MROB 4ZD3H 2FWOB 3ZMRA 1RIVH 4PJBB 1MNUH 1CF8L 1H3GA 3SGDH 4HUXB 2IADA 3OAZH 1A7PH 4XMPL 4Y5XB 2D2OA 3TO4D 1RUPH 2QEJA 1Q9KB 3BKML 4GKSB 4WI6A 4D0DB 4OFDA 1JZ8A 3UTZA 3I6GB 3O8XC 1RUPL 1ZHBA 2BFVH 2OLDA 1ZSDB 1U8LA 2AV7B 1DSFL 2AEPL 1DDHB 1QFWL 2JJVA 2W60A 2GITA 4P2OC 1P2CA 3H9ZA 4M7KH 4XMKL 3TA3A 4HGKC 1H3UA 1MIMH 4WEBL 4OQTH 5ICZB 2JK5B 2Q86B 2X1WL 4TOYL 3WXVL 2MQ3A 3FRUA 4NNYB 1RZIB 2R23A 3BEVA 1OARH 1U8HA 3QI9A 1IC5H 3H7BB 3IKCA 3RL2A 3T65A 5AG9A 1J0HA 1XIWD 4L8DB 3SOBL 3EGSB 2AJSL 5IEKA 1G6RB 2GTZA 5J0BA 1VCAA 1GOGA 1OAXH 4OTXH 3LKSA 4Z7NE 5BQ7B 1IAKB 4DTGH 2X4UA 4PJDF 2DIAA 3QZWA 5FB8B 5M95B 2XRAH 1YNTB 2OR9L 2R23B 5DO2C 1DEEA 2W9DL 1K2DA 1Y18A 2F58H 3T65B 2ESVB 5GISH 4K71B 3VRJB 1I85A 2NXYB 5MERA 4WFGD 3IDXH 4E9LA 4P5TC 1F42A 2XKNA 3GRWH 2YUVA 3VE0A 3QRGL 3MRNA 4EN3A 1JI2A 4NO2A 3OSKA 1WITA 1KB5H 1A7PL 1AC0A 2CUIA 3C8KB 2CIIB 1T03L 3RY6A 4OF5A 4RCAA 1WSST 4JY4B 3NOIA 1WVZA 2YC1B 1OCWL 3KJ4B 4OCXL 1MCIA 2DQFA 1KLGA 2VDQL 3QIUD 4D8PA 3U6RB 2GT9A 9CGTA 4K7PL 5ISZB 4ODTL 2R1YA 1D5XA 3B4NA 1MJUH 3IDMA 4N8VA 3FQRB 4DEPB 2P8MB 4X6BB 5T3XD 4PJ8D 4S11A 2FL5B 1V3LA 1A1NA 4XC3H 1XMWA 5EZIH 2PYFB 4Z7UE 8FABA 2AQ3A 3V5DA 4UDTB 2PXYC 1OHQA 1HHIA 3ULUF 3HZMA 3OJ2C 1GPOL 1CDBA 1GJIA 4MB3A 1I9IL 3RVXD 2H45A 4I18A 2JELH 1M7IA 3BE1H 4KK9D 4FFWC 1F8TL 1CFQA 5F44A 3P4OB 4BK5A 4FXLA 1NFDA 3CXDH 3U4EA 4HS3A 2A1WL 2DJ4A 4KV5E 3RWFA 3RUGE 3UROR 2EE9A 1MAML 3L7FA 5BO1H 3I84A 2PXYA 4J6RL 3QZWG 1P84K 1KN2H 1X5YA 4BH7A 2DWDB 4XB8A 3FO9B 3MLXH 4L3CA 4X80L 4DGVL 3MZTA 4Z7OE 4MNHB 5DK2B 1NBQA 1OAUL 4DZ8A 3LDBB 4Z7OF 4DCQA 3KLAB 4OCSL 2NQCA 1JHLL 4OZHB 1Q94A 3ARVA 3MOBH 4Q9RL 5GS2H 5DD5L 5D1XD 5EBWB 1UM5L 4QHLA 4M62H 3VWJC 1S7UA 1QRNE 5T1DH 1C12A 5BQ7A 3RNQB 4KDTC 3RY4A 2NY2B 1JNLL 2O5YL 1XGTB 2WIIB 2WV3A 4L1DA 1LK3H 5KSAC 4JKWA 3HUJF 4F3FB 1V3KA 4ZODA 1UACL 4J3SA 2DQTL 2IFFH 3GK8L 2BK8A 2A9NH 4LOUD 2JK5A 1ZT1B 5H35A 3BH9B 1VEOA 1JCKA 4ZOCA 3WLWC 5F6IC 5I74C 4HK3N 5IQ7H 2ZUXA 3ZHDA 3VGDA 4LSDA 1WT5C 2LE9A 5DFWH 5CLTA 5DA0B 1AP2B 3MRQB 4TUKL 4YXHH 1QZ1A 4O9HH 3UO1L 4BELD 2XWBB 1KB9K 4LCYA 1XGPB 1U8IA 1KJ2H 1LEKA 4MDIA 3ZYOA 1XIWC 4NJAL 5JZ7D 1AGCB 3HI1B 2BDNH 5IB3B 3FRPA 1Z3GL 3JSSA 3ZE2E 3ZYZA 5HDOA 1MRDH 4C58B 4LKCA 2DOCA 5ISZA 2Y36L 4WI8A 5D7JD 3RIFK 4H0HB 1FG2A 3SGKC 3TJHC 3ZDYE 5IHZA 2F8XC 4PJ8C 1NCBH 2Q86A 4HKJB 4FQXC 4Z7NF 5IBUB 5K93A 4DUWA 1LEKB 2F74B 3MRNB 1B3JA 2AVGA 5C07E 1FGNH 1DVFB 3TBTB 1S9YA 1INEH 3V4UL 3QUKB 4B5EA 4OZIF 2HVJB 5F88A 2QQNH 4K94C 5D5MA 4RSVA 4JFXA 1WWBX 3L3HB 2MCPL 3LHPL 2GJ6D 2AABH 1A7NH 2GFBB 3LN5B 4WW2A 4G5ZL 3IFNL 1FNFA 3HAEH 4ZOBA 4YHYB 5GGRA 2CMRL 3S3JA 4GG6F 3K8KA 4ZXBC 2MQCA 3WNOA 4L4VB 4PPTA 2ZCHL 2VIRB 3KPSA 4GG6E 3V0AC 1H3PH 2AK4E 4YZFE 4NRXB 4W4OA 2X4TB 3NAAH 3V6OA 4LLUA 1C5DB 5F1OB 4WTWA 1J12A 5C2UB 5BJTA 3RX8A 3J7HA 1A7QL 2XKSA 4XNUL 3RNKB 2HFGL 3DPBA 4WHTB 4PJCF 5F7FA 1WCQA 7FABL 4NBZB 5H8DA 5TF1L 3PWVB 2EYRA 4Y16B 3MRDB 1ZA3B 5TE6H 4I48A 3KLAA 1FIGL 3RZCB 1NGQH 4X4ZA 2P5WB 4PRPD 1WV7T 2R9HC 4LASL 4NQDA 2HTLD 2CK0L 4PIRF 4GG8B 3LB6C 1OTUC 1T5XB 3MBXL 1DQTA 1N0XL 4JHZA 4XTRC 4X6EB 3FT2B 4NZJA 2NTFA 4KK9C 5TE7H 1JNNH 3VD4A 3EDJA 4WTXA 1I1AB 4Y4HA 2B0SL 3V4UH 3O4LE 2X40A 3HE6B 3RDTD 3TC9A 1FPTL 1FZOB 3O4LD 5J9PA 3OXRB 3ZKSD 2FX9H 2A0LC 1ZT4A 3DYMA 3WFHA 4L3CB 2AP2A 3V52L 1L0XA 3C6SA 4OZGA 2BRQA 2CR3A 1ZAGA 4PJ7F 4JFZL 2V2XB 3E6HA 1DUZB 4U1KA 1N64H 1CQYA 1GZQA 5I6XC 3ARFC 5CJOH 2R0WL 3V79C 1UWEH 1HHJA 1MJ8H 4EDXB 3LKPA 4LSSL 2X4RA 2VWEE 5EO0A 5EU4A 3OQ3B 2ARWA 4MMXC 4TN9A 3L7FB 2XG4A 1L7TH 1MREH 4MLIA 1HHHA 3CSBA 3NN8B 4LNRB 4I5BA 4U6HA 5E2VH 3VI4F 1UXWB 4MS8D 3BW9B 4Z95H 1RHFA 1OM3H 5ENWB 3BPOB 3X11A 4F7PB 2JF1A 3MNWA 4G6ML 3BKJH 2R39A 2BNQD 2AQ1A 2DQHH 3L7EB 2QSVA 3P0VL 4NP4L 1L7IH 3T0VA 3LD8B 3V6ZA 4V2CB 5DJ6A 4BH8A 2ARJQ 3MGTB 4QOKB 5J1TC 4NKMA 1CU4L 4WU7B 3VXSB 4LRNH 3B5TA 5GZND 5I8KH 5IFHL 4CL7A 4MA1C 3SDCA 3V5HB 2QQNL 3U30C 1BFSA 4FQPA 4PLJC 2YWYA 4HIJA 4UOW1 3QEGL 2CDEA 3W5NA 4F7EB 4ZUVB 3B2UD 1NJ9A 4KUZH 1QSEA 2WINB 3VH8A 3JWDH 1A0QH 1SBBA 1T4KA 3BZ4A 4G80B 5IW1A 3IS0X 4ZUTA 5KVEH 2ED9A 1JYWA 5GGUB 1TXKA 4DUXA 2LFGA 3LVEA 5GS1B 2Q6WB 2DQEL 1H15A 3G08A 1YEJH 4XVUD 3S6CA 1S8DB 5HHPB 3Q6FB 5SWZE 1VGEH 1CFSA 4FP8H 3RZCD 2AXFA 1R3JB 3C60A 4Z7VF 3GB7A 3UTSA 4ZS7L 1L4IA 1NANI 3OKLB 2F5AL 5E8OA 1UB5B 3D2UD 4JDZA 3MRPA 3WNKA 4LSPH 3IDNB 1MCOL 4MA3A 5DD3L 3TT1L 2HVKA 1VFBB 3GSVA 5FYJH 1NBVH 2JELL 3K0WA 4M43H 1U3ZA 1CDIA 4YIQB 1MFDH 4AY0A 2ADIB 4KC3B 5C6WH 2R0ZL 2EECA 4X6DB 3UBXI 4P2QE 5J7CC 4XVJH 2C1OB 3SDAB 2WUBH 3TJEH 1LK3L 4KV5F 1CI5A 1A14H 2DQDL 3L3DA 4XPFL 1ZLUK 4Y89A 1FGNL 5FGBA 2IQ9L 3EFFA 1CICD 1H8OA 2J6EL 1UZ6F 1U92B 2AJXL 4NQXA 3N1PC 4NKOA 1CDUA 5IESL 1XCTA 3SDCD 5F7DA 2FX7H 3QCTH 1T66D 1D9KB 1XF5A 4G6AC 1Z6JT 2MNUA 2DI7A 5FF6A 1ES0A 1YMMA 4N8VG 3G5VB 4I0KA 3U9UB 4N90E 4ACPA 1AO7D 5A1AA 4KK5C 1FFRA 4OF0A 2BVPB 4S2SB 3WKMH 2DDQL 4XTRD 3D69A 2FWOA 1YJDL 1H8NA 5CBAA 5I8CB 1BOGB 2WQ8A 2XFXB 2X4PA 4K9EL 1ZGLA 2HJFA 4HUXA 4HF5L 3KR3L 5KTEL 2VQTA 1NSNH 4UU9A 3HR5B 3RJQB 4XBGB 5IV2B 4APQB 1MI5B 4BH8B 4OZHE 4LPYA 4QHMB 4L29B 5EU3B 3BRFA 3NFPA 5D7KD 3BAEL 2J8UA 1GPOH 3BDYH 5D7KE 3MNVA 5CJBA 4IRSB 3F7QA 4TSCL 4JPKL 2GY5A 1DANU 4L4TD 4I5BB 1Z9MA 2YD1A 3O6ML 3WFEL 2Q8BH 3ZE2F 2IALB 3WFCH 3UTQA 3FZUC 5KZCD 5DUMH 3C5ZA 1U3HC 2VLJE 1JWMA 2X70B 4X80H 3FAXA 5EA0H 3V0VA 3OMZA 3DYOA 2D7MA 3N50A 2G5BA 3M1BB 5SWQB 4NO0A 3L5JA 3HNTH 3CFJA 2MQ0A 3PL6D 4MAYC 5F1NB 3B2VL 4S1DD 4WWKC 1RFDL 5ESVB 3ZTNH 1EFXA 1X5AA 2GJZA 4GAJL 1ODAA 4WO4A 3AB0C 3V6FA 4PG2C 2YD8A 2E9BA 2O5ZH 1N3NB 3MR9A 4Y1AE 1TENA 5AZ2H 3GRWL 4OLZL 2VZVA 4NRZB 3U46A 1JFQL 1MCRA 1IKNC 1U3HA 4R4FL 3C8DA 5M7QA 5FUOH 3AGVA 4DN4L 3DROB 5IJVB 5DJYB 2GKIA 3OR6B 4KFZC 3DX9B 4P4KC 2PF6A 3G6JF 2IWGA 2EC9T 3BMWA 4DGIL 1MQKH 5DMGD 5GJSL 1W2KT 3ARED 3QFJB 4XZUB 4YZFF 4X0KB 3TVMD 4QYOB 1EO7A 1JE6A 1T0NB 4R7DA 3S98A 3U36B 3S34L 2Q7NA 3DIFB 2DLIA 4M8QA 2P8LB 2P44B 4UDTA 3VFOB 1XH3B 5MEPA 1OAZL 4K23H 4YO0B 5KSVA 2EDJA 1WZMA 1A1OA 4NC1C 5GGRB 1UG9A 5DVNA 3D69B 5IR1B 1HI6A 2VLRD 1T7XA 3IVKB 1J1PH 4PG9A 1NGYA 5IROC 5JXEA 3QHZL 2Y23A 3P9WB 3TZVA 2EYTB 2AK4A 4EI5A 6FABL 5L88L 5EU6D 1JPSL 5DDHA 4LLYA 5GRYA 1FN4B 3KHOA 4POZC 3DRTA 4P3DA 3DSFL 1JRHL 1NAKH 1SYVB 3N1FC 1FNHA 4NN5C 4ERSH 2B4CL 4WEMB 3BZEB 5DR5L 5BW7C 4JZOB 4WW1A 5ADPL 3UTOA 3IU3B 5GS0D 1X5HA 1D5ZA 1LEGA 1NCUA 2XY1A 4DJMA 4HXAH 2Z92A 2QQKH 1R0AL 1RJYB 3BESR 5HYJB 4I9WE 4MSWB 2Y6SC 1I85C 5DRWA 3HI1A 2C3VB 2E9WA 3X3GH 4AIOA 1IGJB 2P5EB 4RISL 1LVEA 1OP3H 4F9LC 4GMSL 3PL6C 4MAYD 4R8WH 2CJUH 3X3FH 5IB5A 5DMIL 4CMMA 5HD8D 3FMGH 4RX4D 4KTDL 2BCKA 5D71L 5DUBB 2NNAB 2Z4QA 2W60B 3MCKA 5L8JB 3G6DL 1N59B 1DQQA 1BFOA 4IOSD 1C12B 3EYUH 5GGSB 4JRXE 2PTTB 3UX9B 5D7LE 3I85A 2V17H 2ZJSH 3HI5H 1PZ5A 1G1YA 4PV9A 3HHRB 5IT2L 2J8UF 3BIAX 5E2UH 3MRGB 1KXVC 2EIEA 2XICA 1QQDB 1M6OB 2NW3A 3WUWG 1I8KA 3G5YB 4X4MA 1XGUA 5IEHB 3Q6GH 5D70H 2V5MA 5I19H 3PHSA 4JJHA 3VRIB 1JPGB 2OJZL 5SWZA 4HGMA 4GKNA 4Y5XC 3SGJC 4YDKH 5CKAA 4PGZA 4I2XE 3IDMB 4FFWD 1SM3L 2VZ3A 4NQSA 5DD3H 2LVEA 3TT1H 2P43B 1E6JH 2BVEA 4GRMA 4J3TA 5EU7E 2NY6C 2ZP0T 4Y4FD 4NC0B 1BM3L 1XR8A 5C0CB 4NWTH 2IH3A 4KJWD 3RKDC 1YQVL 3V6FB 2DLGA 1IGCL 1T1YB 2HKHL 4CVXA 1BVLA 4JFYB 1FO0H 4WY7H 3PWJA 3BGAA 3SGJA 3OKNB 3VWJA 1QQDA 3DURA 1P4LB 1OAYL 4JDTH 4WI3A 1FYTA 3WHE1 2BY1A 5I1LA 5GHWL 2PYEE 3R4DA 1P4BH 3EJYC 1MCWW 3PHOB 4X6EA 2NY0B 5I17A 1P1ZA 1YDPB 1T3FB 1HHGB 3FL7A 3MRKA 5FM5O 2RCSL 3C8KA 3WIIL 2IG2L 1WBYA 2VITA 2BY2A 1QSZA 1AI1L 1KENL 1MCPL 2CLVA 4M5ZL 2MJWA 2FNBA 4WWKB 1MFAH 4GS7C 1GGYA 1BQUA 4GKZB 1NCCH 4LDEB 5A3IC 4MJ6A 4WVRA 3SO3C 4WV1B 2BMKA 1N2RB 2H3NA 5EZJB 2HFEB 4F2MA 4CVUA 5IM7A 2UVFA 2PW2A 1C8PA 1T04B 3DX7B 3RWJA 3PGFL 4YUEL 3K80A 3R06B 4J8RB 3NA9L 1B2WH 5BMFH 3REVA 5J57B 4KMTH 3HG1A 3QEQB 5JXED 4DKEL 3VD7A 3KPNB 1RZJC 2FLBT 2C26A 4D3CH 4QXWA 3BDBA 4MAUL 2A73A 1SBSH 3LDBC 4FFYL 2C9AA 5D7SL 4MDJA 4OD1H 5EFIA 2FBOJ 4EJ1C 2I24N 1IILE 3PGDB 1I4FB 3MRIA 5DA4A 4Y4KC 1UH3A 4FQ2L 3BWAA 5JW4M 3IVKA 2CXGA 1RQ5A 3BGMB 3DMMB 4FTVB 2WBKA 3GM8A 4HIXL 1ZMYA 3UC0L 4YNYB 1FZKA 4JG0H 1JPSH 4U1SB 1ZLUH 3RA7L 4NO3A 4YHZH 3L3GA 3O11B 1YMME 5ICYB 4NCC1 5TE6L 5ILTH 3X3FL 3R0NA 3QEQA 2ORBL 3CVHB 2DM2A 5KS9B 1PGRB 2VDML 3SN6N 3U1SH 4MQSB 2KQMA 1UCTA 4G7VL 2O61A 2Z35A 5J4MA 5IVXF 3G5XA 1TJHL 2OP4L 4NO5A 3UYPA 4TTDC 4P23C 2KQNA 1GZPA 4Z7QF 4LLDB 1FCGA 3P73B 2J3SA 3K3QA 1Z0MA 4M48L 3SDDD 2W1NA 1YMMD 1JNJA 3UMTA 4P59H 3UTSE 1F4XH 3FB7B 4Y4FC 4DOHB 5ISZE 1QFUL 2IANB 3DLQR 5DHXB 2GK0A 3V7AG 3MLWH 4PJ5D 3VXME 1IC4H 1GL4B 4G7YL 1I1AC 4NWUH 3W2DL 2UYLB 4BFIA 1FVEA 1U3YA 3K8MA 5JORA 2C3XA 3KPOA 1U8JA 4XXCC 2FHCA 1KIRA 4U1MB 4QHNA 3KPLB 4U31A 3SE3A 4X9IA 1JL8A 2EDQA 3MQIA 1IMHC 2IH3B 3CLFL 3BZDA 2RFXB 4QO1A 1QR4A 4H25B 1IAII 1RUKL 1VADA 4QTIL 4E5XB 4YGAB 1RHHA 1T2QH 1L6ZA 4PBVC 3RZCA 5IQ7L 4JFXB 5HDLA 1NC4D 4Z18A 3O3UN 3N1MC 1D7FA 3VFMB 3JWOC 2G60H 2R1WB 4L3EE 1NMCC 3VGFA 5BZWA 2B7DT 3MGOB 1FL3B 3MRBB 4LSRL 4J3VA 1IEBA 4XHJD 5FDWB 4APQA 4QTHA 5D7JC 3VGHA 4I3RL 1TTFA 4KRLB 3A0OA 1A6VH 2VDNL 5ACZB 4TOYH 3ZT7A 2OCFD 5T1DL 4OM0H 2X09A 2HKFH 3RHWF 3UCRA 3FB8A 1I7ZB 2YUWA 3WIHH 1Z2KA 5KBNC 5DF0A 4DWHA 4YGVB 2H6PA 1R5VA 3GSRA 1MRFL 3U30B 4LIQL 3TPUB 3RX7A 1RIHH 4LSQL 4XNZC 1LE9B 3G04B 5GS0L 2UWEE 2G2RB 4U3CA 1E6OL 4GRWE 4ZUUB 1U2HA 2GW5A 4H5SA 5AWNH 3VXQA