3WKMH

The periplasmic pdz tandem fragment of the rsep homologue from aquifex aeolicus in complex with the fab fragment
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
222
structure length
216
Chain Sequence
b'EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYLHWVKQRPEHGLEWIGRIDPANGNAKYDPKFQDKATITADTSSNTAYLQLNSLTSEDTAVYYCSNRQLGLRGYYYAMDYWGQGTSVSVSSAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative zinc metalloprotease aq_1964
publication title A Structure-Based Model of Substrate Discrimination by a Noncanonical PDZ Tandem in the Intramembrane-Cleaving Protease RseP
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
total genus 46
structure length 216
sequence length 222
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wkmH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wkmH02
1TJIL 2NY4B 5BXFB 2OK0L 2WV3A 1LILA 1E4WL 3I3BA 3EO9L 1WFNA 4RAVB 3QULB 1F3JB 4PRID 5GGSA 1TITA 4OLYL 1C5DA 3H2WA 1H5BC 4JO1H 1MQKH 2Z31B 5JQHC 1DR9A 1RZGA 2X6MA 2KDGA 4YDIH 2Q87A 4IDLA 1KJ2H 4X6FB 1KC5L 4G8FB 3BESR 4GBXB 1Q94B 4M61B 1NFDF 2VC2H 1SHMA 4P46C 2NW3A 1MRCL 4ZFGL 1T89C 1VB9A 1YEIH 3MUGB 3NH7H 2CR6A 4IRJD 3R8BB 3E1F1 3QISA 1JRHL 2NY5H 2YZ1A 1BQSA 2JCCF 2Z92B 1N5YL 5KN5B 1IBGL 4LCYB 5FHBH 4M5ZH 2A38A 2W65A 4HSQA 1JPGB 4ZDHB 5A2KH 3OKYA 1R5IB 1QLRA 3ULVD 4P3DA 3QSKB 2FLRT 4KDTA 5EOTB 5A2FA 2C1OA 3CVHL 1ZHLA 1VACA 2X4TB 3ZDZF 1AGCA 3DSFH 3W0WB 4QRTB 2BXZA 3OL2A 5CLTA 1G1YA 3ARGA 5F93C 4WI9A 4HS8L 2WP3T 5D7KD 5LGKA 1UA6H 2ORBL 1LO0L 2AGJH 4KVCH 4CN1A 4Y19D 1BVKA 5FGRA 3UJJH 2BOBB 4LPYA 5FDYA 5DRNB 4YUEL 5JO5A 4OCXH 2X9YA 4PJ5E 4HJJH 1LGVA 4U1GB 4ZUVB 3ULUF 4PJFF 3WFHA 1U3JA 5C0IB 4OZGF 3WUWG 3WXVL 3P9MB 2VRAA 5F1IA 3FONA 5MP6H 3SGEH 1YPZE 3KNBB 1AJ7L 1QSEB 3OJDA 3OXRB 4K2UH 4P4RB 4KGLA 3BH9B 2W9EH 4URTB 4JB9H 1BOGB 1S9VA 3OR6A 5IQ9A 6CGTA 2ESVA 2XIDA 5INDA 1S7VB 1RJYB 3BVNA 5T1DH 1EPFA 5I16A 1TXKA 1G7HA 4Y5YA 1G7JA 2ADGB 5B39G 3QDME 1I9IH 5HHME 2DTMH 3O9WD 4IRJC 5D5ME 1MFEL 1P2CA 2MPAL 3JWOL 5D1XD 5I1HL 4Y4KD 2CK0H 2IC2A 2V9RA 4GW4A 3KAAA 3GIZL 1NMBH 1P84J 1VEPA 2Y5TA 1UKTA 3W5MA 4N0CD 3C5ZD 1HYSD 4MDJB 4LKXA 5D9SB 1AR2A 4YXHL 4F7MA 2R2EA 3ULVC 3LEXB 1E27A 1XIWA 4AM0A 4Q6IC 4IM8A 1MCIA 4X83A 3MRCA 1MI5B 1EBAA 2R29H 1U8HA 4PS4L 2LQRA 4EIZC 2VKWA 2CIKB 1V5JA 4HGWA 4DJMA 1MSPA 1I85C 4PJAB 3CZJA 1YJDL 1K5NB 4FG6D 4GRMA 1DLFH 4GG6A 5DI8A 2ICES 3CGTA 4JKKA 3FB5A 1YYLH 3NCCB 4N9GA 3RWIA 4G8IA 2X1XR 1YC7A 1JWUB 2YK1H 5LAXB 2VN4A 5EWIL 3G04B 5CD3B 2R0WL 5I1KL 5E99L 3KS0H 1XF4B 3VXOA 3BD5A 4Z7QE 2GJ6D 2QKIB 2XFXB 5DEFB 2DQFA 2J3SA 3BGMA 2VUOA 5H37H 4POYA 5T3ZD 1PZ5B 5CUSL 2COQA 2G5BA 3O9WC 2GCYA 5ALCL 4Y4KC 3KR3H 5JA8B 2XG4A 5CP7B 4HKXB 1GJIA 3BWAB 3PQYE 4WWKB 5EZJA 4U0RB 3BP5A 5LWYH 4TQEH 4N0CC 3C5ZC 3UPAA 4PJEA 1QLFB 2CIIA 3B9KA 3NIFE 1NEZG 4JLRB 3U0PB 1CICD 4KKAD 4NN5C 4X5XA 3QJFA 3U9PL 5J56B 1WTLA 4Q9QH 1MCDA 5C6WH 4NJ9L 3BZ4B 5CKAA 1V7NL 3UJIL 5JIKA 2AEPL 5L8JB 2OX5A 5TQ0H 4YNYA 3P4LA 1PD6A 3L5JA 4YWGL 4I0PB 1I7RA 5TDPB 1KIRA 1G7QB 3U4EB 1L7TH 3HLAA 5FOJA 1QBBA 2UYLB 5DR5H 1LHZA 3VI4E 4N8CH 1YN6B 2NMSA 1RIUH 3W9DB 3LN4B 3ZL4L 2ZUQB 2UWEE 4DEPC 4M1GH 1WK0A 3SDDC 3C5JA 1IC5H 3MOQA 4M1DL 4ALAH 5D71L 1U92B 1UWEH 2DLHA 1NPUA 4OIIH 4RRPG 1DEEB 1YPZB 2Y6SD 4YQXL 4WCYH 3DXAD 1A1NA 4JFFE 5IVZB 1DL7H 5F88B 1NLBH 4NGHL 3WN5A 1Z2KA 2VZSA 3X13A 2DWEA 3VE0B 1F4AA 2BVOB 5GSVB 1KN2H 4HS6A 4WJ5B 4XBPA 1N3NA 1A3RH 3PGDA 1I1CA 1IGIH 5FK9B 1AGFB 1I9JL 5SWQA 5HHMB 4FQ2L 3O6FA 5CEZE 1J0IA 4OB5H 2PXYC 1RAMA 5K9JL 2VDMH 4X0KA 3S35H 5L0QC 1R3LB 3VFOB 4S1QH 1B3JA 2ITDA 4QRUA 2ATPA 4QHLA 3QIBD 4UQ3B 1VCAA 3K4DA 3RVXC 5BVJB 4MD4A 1KTDA 4Z78A 4LKCA 2HA1A 5BS0D 1XH3B 3HKFA 4WI4A 3S9DB 2HVJB 2VAAA 3CIQA 3ISWA 1YMHA 1CBVH 3DBXA 4K71C 4EDWL 3D3VD 4JFQA 3QXTA 4YHKL 5AG9A 3LIZH 5T33L 2P5EE 4K7FA 4RWHA 3E0GA 5DT1H 4YHPB 1NFDE 1Q0YH 5L8KB 3ZYJA 4MB5A 4XMPL 1CS6A 2ENYA 1NGQL 1JTTA 5IM7B 5LQBH 1TFHA 1YEKH 5CJXC 3MLXL 5KSVA 2JCCE 4FS0A 5ICYA 3NPZB 4RAUA 4R7NB 3QEHA 2Y6SC 3TC9A 1I8LA 3R06A 3MNZB 1IC4L 3GBML 5HYJD 1KCUH 1UC6A 1LK3L 4KH2A 4RFOL 1QUNA 3GHBH 5KSUA 5GGQL 4ZUTB 5GS1A 3TN0A 4AQOA 3WBDA 3CNKA 3LEYL 3ZDZE 5KJRL 3O3BB 3RTQA 5F3HA 4JFDE 2H26A 4MQ7A 5LBSH 1JZ5A 5J8OA 1NSNH 1QP1A 3KHQA 1P7QD 1CXKA 3FO9B 4MD0B 1U8LB 3PQYB 5IVXB 4UTBL 4U1JA 3GI9L 4EUPB 5ADPH 3QIBC 3ZDXF 5DJ6B 4LLAA 2QHLA 2DQTL 3ULUE 1GGTA 5E8PB 4LNRB 4PJFE 4FTVE 4OZGE 5C0BE 3HR5A 4FHBD 5JLZA 1W72H 4YEFA 1U3YA 3C08L 1LEGA 5E08H 3QXDA 4Y1AD 5D7JD 2XWJA 4Z5RA 1NC2D 4LSDA 3QPQD 3MO1A 5IOPA 5E2UL 4IOSD 2OR7A 5D72L 4JVUA 2RAMA 3SDAA 2QQNH 5B8CA 3IDJB 3LDBC 1VDGA 1XT5A 3MJ7A 2X89A 3G6AA 4KKLD 1QPXA 2AEQH 4JG0L 5FO9B 5IT2H 4HKBA 5INCA 5LKNA 3I75B 2F53D 1FSKB 5J11C 1BQUA 1BM3H 2F5AH 4E0RB 1GAFL 4ODHL 5D93B 2Y06H 3SQOL 4ZQKB 2FD6L 1MHHA 4YR6A 4RGOL 3VFGH 3QDJA 1JI1A 4MQSB 5GPRA 4LEOA 3PWPD 2NW2A 3V5DB 1T7WA 3BKYH 4DKAA 4G6JL 3DOSA 1AXSB 3WYRA 1INQA 2XRAL 4NZJA 1X44A 3B83A 3KJ6H 5AZEH 1GGYA 1R3IH 2GJJA 5GS0L 4YPGA 2FB4L 4ODXA 1QFWM 1V3LA 3EFFB 5I15H 4NYLA 3OJ2C 5D7IF 3RL2B 4NFDA 4PUBH 2D7NA 2B4CH 3DPBA 2BMKA 2CDGA 4D3CL 1UJ3A 5B4MC 2ICEA 5BQ7B 2EC9T 5CIPH 3BT2H 4LAJH 4EJ1C 2DRUA 4XPGL 5HVWA 5E9DE 3QQNA 3U4BL 3MRPB 5DJYB 4X4MA 2VL5B 3GSOB 4Z7VA 1AGEB 5D7JC 3EDJA 3MCLH 3QPQC 4DCQA 1FBIL 4K3JL 2AJVH 2AK1H 4PYHA 3VFWB 2AJYH 2EDKA 1OW0A 1ORQB 3QEQE 1CR9L 2WWKO 2VDKL 1UG9A 1OLLA 4XNQB 4KKLC 4WY7H 1U8OA 5DQ9A 3UTSB 2P5EB 5I6XC 1UM5H 3DVGA 5HI3D 4IMKA 5ECJE 1CE6B 4WGWB 4OFYA 1T1XB 4H20H 4LCWD 3EIFA 1CD8A 3NGBC 2QSVA 5E24E 4OAWA 3REVA 1ERNA 4HFUH 4ELMA 4XH2B 4I77L 4PJBA 1OPGL 1CE1L 3ME0A 2VAJA 3S97C 5C09A 4ZO9A 4QXUL 4XBGA 4ZO6A 1NUNB 3PHOB 5C0GA 3H0TA 5JW4N 3MACL 4LCIH 5TPWH 2AEWA 4JFDB 2A74A 4TNWF 4DW2L 2Q86B 4YBHA 3FRUB 2B1AH 4L8SB 1U93A 4JDTL 4OGXH 3CD4A 3GKWH 4GJTB 1JRHI 4BA8A 4EI6A 3RZCB 3MRDB 1AI1L 4D9RE 3R1GH 1Z0MA 3O3DA 1I8KA 2QQKH 2VLRE 1SJXA 4MCZB 3OG4B 5F71A 5TF0A 4G7VH 2NY1D 4PJFB 5I75C 5C0BB 1J86A 4RWYH 5I1EH 5LXGH 3CZFB 3WJLC 1UB5B 1CFBA 4JRYB 5HHPB 1WZ1L 1FLRH 4IIQC 3QQ4A 2X1OA 5D7SH 5IBUB 3WHXB 4RA0C 1NBYA 3OB8A 4U1NB 5E8DL 1IKNA 1K4DA 4WFHE 2BSSB 3SKNA 1CFTB 2VLMD 3RWGB 1AFVH 3V6ZB 2DTSA 3LS4H 4NN7C 5IB5B 3OAUL 5HVHC 3H7BA 5EZOH 4J3XA 5EZLB 2ZCLL 3RUGB 1YN7B 3GMMB 4CW1A 1JGVH 1AE6L 4PG9B 5DMKB 4BSWB 3T2OA 2JELH 3O45B 3RGVB 4DKFL 4FQXD 3ROLB 3M45A 3MLSL 1UGNA 1EJOH 1C12A 2C26A 1J18A 3VWJD 5IGXH 1A7PH 2IPUK 3QCUL 3B43A 5ICZB 3BMVA 3W39B 4RDQF 4JM2A 2D2OA 1A7OL 2VLJD 3QUXB 2VQ1B 3VGAB 2DQCL 3MNVB 2XQYG 5IB4A 1BWMA 2W9DL 3WIFA 2Y7QB 2WZPD 5IIEA 3CU1A 1XMWA 4X8JA 4NIKB 2EDTA 2CLZA 5DHVH 4Y4FC 5F7MC 3MXVH 5L9DH 1KJVB 4YHYB 2NY1C 4N90D 5E9DB 4LCUB 4HV8B 2E6QA 4X6CE 2BOCB 5FYJU 3T8XA 5K33A 1PY4A 3IKCA 4GRLB 4G8GA 5T1KD 3VFNB 3LHPH 4MSWA 4HCRL 1G7LA 1RJZA 4OLWL 4NQED 5ICXB 1JMZA 3GSUA 2W1NA 1C8PA 1N7MH 3BGFB 2VDPH 3QEQB 4TRPL 4WTWA 1SMAA 1FG2A 2DBLH 3G5XB 5GRUH 4UV7H 5GGRA 3K2UL 5DXWA 4JHWL 4JCMA 3Q6GH 4ODSL 4UIMB 4F37F 1IMHC 2DKMA 3QUMH 5JDJA 3TYGL 1YEHL 4Z0BL 2IQAA 2FEEL 3FB6B 4RQQA 1J1PL 1FNHA 2X4PB 3ZDXE 1H3VA 1S3KH 2HFFB 4FQXC 3BI9X 1VHPA 1A8JH 3CX5J 4HC1A 1HIMH 3VWJC 4D0DB 5EG6C 1RUQH 5EUKB 4TVPE 5C7XL 2XWBB 4V1DE 3BP6A 2IALA 5CHNB 1OB1A 4JFOB 4NHUA 2E8ZA 2NY4D 1S5HB 1A2YB 2YZ8A 2ZKHL 4ONFL 5HYQA 3AAZB 3QZWA 3QG7L 3PJSA 5FYLH 3MRGA 1EFXA 1LD9A 3BP4B 3T4AB 4X9FA 2I24N 1N5AA 1YEGL 4LNVA 2BNUB 4JPWH 43C9B 1F6AB 1UVQA 4NKDA 2LV4A 2IPKA 2VLRB 2B1HH 3PDOB 1WFTA 1FC1A 4X6DF 5FECB 5T1LA 2IEPA 1URLA 4FFWD 4HWZA 3SKMB 2A73B 3QXUA 1A6TB 3GO1L 5GXBB 3L9RB 3U83A 5IESL 1Z6JT 1NC4D 4XMLH 1UACL 2DM3A 3QA3A 2CJUL 1I4FA 4PGCA 3SDXB 2YRZA 4H5SB 5ABDE 1LNUB 4UOJA 1S9YA 2A6DA 2FR4A 4X5WA 3QUKA 5D2NC 3MGTB 1HSAA 3SKJH 5D7IE 2WBWB 3CFEB 4QTHB 1JV5B 4PJHF 1U58A 5CJ5A 3MFFB 3EYFB 5FIEA 3MLTB 1N64H 2VDLL 4PP2A 3U82B 3VXPB 3W0WD 4ZS7H 5DK2A 2WK2A 4HX1B 2MNUA 3QHFL 1H3PH 1E4KA 5D7LA 3VGEA 2KH2B 1IGTB 2EO9A 3STZB 4OQTA 3BYTA 4NWTH 3HC4H 4MJIE 5CJOL 1TZHB 5C6TH 4X4YB 4Z8FL 4POZD 3T0EE 2NY4C 3RY5A 3DX6A 4NT6B 2BRRL 4LMQE 3KYAA 4GXVL 3WNOA 1QSED 4BK5A 1BZ9A 4GAJH 1SYSA 2EEDA 1A7RH 2Z31C 5DEGA 2FYYB 3GJFB 4MNHA 3OF6D 4HLJA 2A83A 4L1DA 3EUUA 5FUZH 3GRWL 1QSFA 5DQJB 4XCCH 5HYSA 1MIML 2WIIA 4FNLH 3F6LA 1J05B 1MWAL 1MRFH 3WXWH 3U2SB 4X6CB 3FKUS 1BEYL 5DRXB 5DTFB 4RMSA 2GTWA 5I1DB 3MOAL 1FVEB 1RZKL 1JZ2A 5FM4A 4M6AA 1ZHNB 1QFPA 5IKCB 3VXUD 4HUVA 1A21A 3S88H 4AIZA 3VDCA 1NFKA 2BVUA 3VCLA 4JO2H 5KVFL 3G5VB 3QWRA 2DJUA 2YPKB 3FCTB 1JGDB 1N59A 3KDMB 2SEBB 1K2DA 3VMOA 3L1OH 5DWUH 2VQUA 3LKPA 2OYPA 1X5AA 4FFZH 1MI5D 1PLGL 2NR6D 3BUTA 3EYOB 4M7ZB 4XBEH 5I1AA 2VDNH 3HPJA 1I1AB 1RZIA 1PAMA 4W6XB 4E41E 1BVLB 3OKKA 2L0DA 4U0QB 3ZKQD 3ES6B 3NCEB 1U91A 1RUAL 2EDEA 2XXCB 3ARDA 3C8KB 3CFDA 1MNUH 3JV4A 4PB0H 4ORGB 5IW6B 1JF1B 4B41A 5F9DC 3CVIH 3TJEL 4POZC 1NEUA 1S7RB 1ES0A 4V1DB 3VFTA 3IF1A 4RMVA 2CO7B 5ANMA 4PIRF 3MR9B 5BV7H 2AAVA 1T2QL 5IP4A 1ZHBB 4KRPB 4UUJB 2VISB 4KC3B 1IGYA 5IFJA 2ZCHL 4UU9A 2X42A 1G7MB 4DZBA 2WAHA 1ZANH 2JJTC 5EA0H 3B5HA 2F5BL 3U0WL 1CGXA 4ZXBB 5JNYB 4ETYA 2OZ4L 3UX9B 4XNZB 4WI6A 5DJXA 3MV8A 4F7PA 2BJMH 1NMAL 1AQDA 3HUJA 3DV6B 3I6KB 4ZS6D 5GS2D 4HXAH 1KIPB 3AS3A 4Q58C 3OMZA 5HHQA 4PD4J 3BEWB 2B2XH 4I1NB 2YD9A 4O4YH 1TPXB 5GGUB 4MMXC 3ARBB 2X9WA 1T83C 5BRZE 4YK4B 4CU7A 3N50A 4C57C 5C8JB 2NR6C 2R0KH 5IV2B 4D0CB 1D5IH 1ZS8A 1VFAB 4JKMA 4ODUA 4Q9BA 2A6IB 1NQBA 2HH0H 1WC7A 1OSZA 1IAIM 1T66D 5J4MA 4R8WL 1HKFA 2XXMB 2A6KB 3A6OA 3UTOA 4BKLB 1SJEA 2BSTB 5EC2B 4PJ5D 4XRCA 4PGBA 4PGZA 4FABH 2Z35A 3U46B 5DJ8A 1LP9F 2HAZA 4ODTH 5ETUB 1MF2L 4U1HB 5D4QA 5DUMH 1KJ2B 5CKGA 4Y8DC 1XR8A 3VWKB 5B3JF 3PHQA 2A9NL 2J4WH 3RWFB 1K85A 4J3OC 1NGWA 2R1WA 1D5MA 2DI7A 4AL8H 1BF2A 3C6LB 4Z7UA 3WFBL 2VSDA 3DRTA 2EE6A 4NKIL 1Q9OA 3DYPA 4O2CA 1CLOL 4HG4J 3JVGA 4QY8B 3QDMD 5J6GB 2HFGH 4WEUD 3WKNA 3KPRE 3TZVD 3Q5TA 2GQHA 5MERA 3IVKB 4X4XA 4HPOH 1ZOXA 2C7UB 4CJ0A 3PWJB 2Y07L 3QDGE 4LQFH 4MA8H 4ZS6C 3BIBX 3IXAA 5M94B 3FTGB 1EEYA 3VD7A 4FZEL 1T0NB 1EO8H 5MHSD 3EYUH 2G2RA 4KUZL 4X6BA 1FIGL 2CDEA 1EX0A 3WFEH 3DO7B 5IVOA 3CVHA 1ACYH 1Z5LA 3HZVB 4KRNA 1DANT 4KTDL 2J8UF 3QIWD 4IHOA 1KELL 4JKPH 4M93B 3EBAA 3IT8D 3IFLL 4X6DE 5CEYA 4K8RH 5ISZE 4E41B 4JPKL 4MDIA 3QEGL 1G6RH 5JZ7D 4KUCD 1FL5B 4RMWA 4P5KB 1V7ML 3O2VL 5JXEA 2DM2A 4JRXE 2C4FU 2E7CA 4Y16B 1U6AL 1F58H 3ZTJH 2NX5A 4I18B 1K4CB 1NDGA 3CH1B 4PJHE 3F7VA 3IDIB 2BVYA 4YDVB 4LBEA 5I30H 1CL7L 3TBVB 4P99A 1AQKH 5D8JH 4PRPE 1RY7B 2BSRB 3H9SA 4OJFL 4U1LB 1FORH 1WIUA 1IT9L 3T1FB 3TZVC 5EC1A 4YIQA 1H3UA 3H3KA 5CFHA 3HNVL 1N2RB 1OAYL 1FPTH 4NCC2 2C4XA 3NFPA 3MJGX 1S7WA 1F4WH 3IFPB 2OI9B 5TDOA 2VQTA 2X4RB 3V6FA 3G6DL 1GL4B 5D1ZD 3VRJB 3DUSA 3EGSB 1VSCA 2OTUB 5DGRA 3NA9H 3HHRB 5FGSA 5F9JA 4O9HL 1CDBA 4GKSA 4BH8A 5BRZB 3RJQB 3TBYB 1RIVL 1ZLSL 2GJZA 1DE4B 2ZOLB 1H3TA 1CGSL 1NAMH 1NCNA 3KYNB 4Y2DB 1RQ5A 3RU8H 2X09A 1XGPB 3QAZB 4HHAA 3PWNB 2VIRA 4PV8B 1IFHL 4JQVC 3MODL 5GHWH 3UBXA 1M05A 2AJUH 2PKDA 2P7TA 5HJ3A 5JZ7C 2FH8A 1SBSH 4Z76A 2PTTB 2VZTA 2HJFA 3HMWH 1DUYB 2JIXD 5E00A 3ZZ1A 4M6NL 1IC7H 1XFPA 2OQJA 2ZSVA 4F33A 5JOFA 3NCYP 3GUTA 2HG5A 1WFUA 1AGBA 4LOUD 1CT8A 5I66A 5JW4R 1Q8MA 4LHQB 4JFFD 1QBLL 1NGYB 1BD2A 3JWDL 3VD3A 5EO1A 3P4OB 5CSZA 3D69B 4GS7C 2H3NB 3C2AL 1MHCB 1IAOB 3V9FA 1VKXA 5IMKA 3MV01 2F54A 1PY9A 2CRZA 5EOQH 2AEIT 1W8NA 2CRYA 3SE8H 4QXGL 1G6VK 3HE6B 3T3ME 1OSPH 5CEZD 2GFBA 1QVOB 3KPRB 5IMLA 1CXLA 1KFAL 4OFIA 4CVXA 2DLGA 4EUPG 2WBJA 3QQ9D 4ELKB 5AD0A 3S7GA 3CLFH 1DUZA 4Z7OF 3OKLB 3QDGB 2I9TA 5LGHL 4K7PL 3FQNB 1X5ZA 3W9EA 5D1ZC 1HZHL 2VR4A 1FO0B 1TLKA 3VMNA 3KXFE 4IS6B 4G43B 4NQSB 1J0HA 1ZHKA 4TUKL 4LP5A 2F8VA 3B2VL 3THML 2C3VB 1I8MB 4NRXA 4L4TA 1KTLB 4G9DB 1LDPH 1F97A 4K9EH 5EN2A 3D85D 2P5ED 5ISZB 2Z8SA 2K9UA 3MBEB 4LVOB 5KOMC 1KLFA 2YKLH 4OD1H 1RUKL 1HQRB 1E0OB 4YXKH 1A1MA 3HRZA 2ERJB 3UC0H 1FZKB 4KTEH 5C0RH 4LPVA 1U8KA 2DMCA 4U31A 5TJWK 4R90H 1DSFL 4HW6A 4PB9H 4OLUH 3U6RA 4LOUC 4F2MA 2Z4QA 4OLZL 3FO1B 3OZ9H 1F6LL 1WAAF 3H3BC 3LKOA 3TNNA 1H5BA 5GJTH 1WWCA 4G6MH 3UTTA 3IGAA 4NC0B 5KOVC 5JDSA 3LKRA 4LLUA 1TJHH 2FX7H 2FIRT 4JFDD 4PRPB 3ZT6A 1G0XA 3CFBA 1MRDH 2CPCA 4P46A 5HHNA 2V2TA 4Y4HB 4NQDA 1DVFB 1FYTA 3P30L 4MXWH 5FB8A 2J8HA 3ESVF 3OKNB 3RZCD 2X1WL 1J7VR 1KNOA 4LSSL 3QXVA 4UOW0 4RFNB 2AV7B 3VXSA 3ZDYE 5C07D 4IMLB 2IANA 2IQ9H 3KPNA 3ULUD 1GGIL 4FTVD 5C0BD 4HLZH 2LU7A 1S7TB 1JPTL 2J6EH 3IDGA 5F7YC 3X12B 1GH7A 3BD3A 2R4SL 3RKDD 3VFUA 2DWDB 5KAQF 3HI1A 1PW3A 5B3JE 2GSGA 2YD4A 1SY6L 1PKOA 1OY3B 5IQ7L 4BFEA 4RAHA 3L3IA 1G9ML 3STLB 1UXSB 1ZA6B 3RWCA 1BZQK 1W0YT 4LHUB 3B3IB 1EDQA 4H8WL 3SGJC 4WW1A 3P9WB 1PG7X 2CSPA 3EZJB 3HN3A 4M5YL 4MAYD 3MUY1 5A43C 2NQCA 3I9GH 5AZ2L 3CFCH 3FFDA 3GMQB 3GSWA 3O6KL 1IM3B 4P59H 4OUUB 3OAZK 1HHKA 2R1YB 1HK6A 2J88H 1MUJB 1SYVB 2G75B 1T5XA 4P9ML 3SDCD 3WDJA 3JUYA 5E1HB 3SY0A 5A3ID 1FAIL 3U36B 3U4AA 1RHHA 1QRND 2E9IA 2H32H 4OCRL 1O5DT 2J8UE 1E6OH 4PRDA 4RZCB 4Z0XB 2PO6A 3ILPA 1P53A 5J1AA 4L9LB 2OTWA 4LSUL 5B39A 3D48R 4GMSL 4IRJA 3MRQA 3Q2CA 3RZCC 4FXKA 3V4PH 1KPVB 4WTZG 4D8PB 1W72B 4NQUA 4DN4H 1BJ8A 5F7UA 3ULUC 1A9BB 5DJ2A 2B5IC 1GSMA 3JXAA 4JFXA 2O61B 4XPFH 4PLJD 5ESQB 3CXHJ 1SVZA 4GRLD 3RKDC 4G6KH 4Q6IA 3FT4A 1MHPH 1REIA 2W0PA 4GOSA 5IBUG 2GK0B 2R0LH 1RZ8A 4M02A 5E94A 3F12B 3U7WL 1DBAL 5HYIA 1I85A 4XMKH 1BQHB 2P5WE 5F8RC 4AIXA 3TESA 4OD3L 1U41A 1NLDL 4JJHA 1YNLL 1YY8A 4ZUUB 3SOBH 3FN0H 4JFZL 1ADQH 4MAYC 1M7XA 4ONHA 4S1DD 4LLMB 2H9GA 4JANA 4UT9L 5IG7B 1A0QL 4GAGL 4JKWA 4WW2B 1VGKB 4HEME 1FZMB 4M6OL 2CLRB 2IAMD 3JV6A 3SDCC 4Y88A 4KXZH 1RMFH 3RX5A 2FGWH 2HRPH 1FNSL 1XEDA 3Q3GA 1FFNA 3DUUA 5EO0B 4LRNL 5JPNA 4OUOA 1AH1A 4UIKH 4HUNB 3VGAC 2FL5B 1G7IB 4KQ4L 4U1MB 3ARUA 5GGVL 5CZVH 4MX7A 3ZSTA 1UXWB 2IG2L 5CIPB 3O9WA 3RZWA 5J6HA 3F5WB 1OGTA 3TVMB 1N6QH 5D1XA 4R2GB 3PDGA 3S4SB 3QO1A 5MEQA 1OGAE 3O4OB 2JJWA 1XF3B 1NCWL 2EYTB 4BH7B 2VLKE 3WUZA 4YHYC 2VLRD 3C5ZA 3TIEB 1NEZA 4PLJC 4HS3A 4GRLC 1RURH 1FHGA 4NQTA 3SGEI 4JZJB 1YYML 1X9QA 4NO0B 3I3EA 3MRBB 4M48L 4HQQL 3JTSB 2HKHH 1JBJA 35C8H 3FT2A 4WFHD 4S0SD 1P9MA 2APVA 1KTRL 2EH8L 2XA8L 2I27N 4YZFE 5IB1A 1E6JH 5C2BL 3VXRB 4BQ6A 1FVDA 3E6HB 1ZTXH 1NFIB 2Q76A 4S1DC 5H8DA 1F2QA 4HMCA 3NFSL 4ZYKB 2V2XA 1L0XA 3UXFA 4TUOB 4S1RL 1KV3A 1WITA 3VFRB 4Z7OE 3N9GH 1IL1A 3LMJL 2WW8A 4HWUA 2H1PL 2P48B 3BXNA 3QCVL 2IAMC 3V6BR 5JQ6L 4RRPA 1D9KB 2GJ6A 2FECL 5KSBF 1U8NB 4X7FC 5FYLE 1FDLL 2GITB 1NCCL 3AFLA 2EYSB 1JNNL 5I1LB 3VH8B 2YUVA 2FRGP 4OCLC 3S34L 3DHJA 1YNKH 4I9WE 4RMTA 1BIIB 4OF6A 5CBEB 1T1YB 1WTGT 5FCUH 5CEZL 5EORL 1I7UB 4CU6A 4YFEA 4LSTL 3RHWK 2P24B 2R2HA 1JNHA 5MENE 3RBSA 2XY1A 1WT5C 3DURA 1RJLB 4IRSD 2R8SH 3BQUA 1JZ4A 4GW1A 4OCMC 5F7WC 4RNRA 3I02A 3PNWB 4PJDA 1CICA 4WI2A 3DI3B 5ESAB 2Z91B 5FO8B 3CFKA 4HDIB 4OLXH 3EYVB 1WAAE 4X7TA 4DZ8A 4D94A 2O5YL 1RK1A 3AC0A 2IH1B 4QXTA 1I7ZB 2P45B 3BRDA 5HYFA 2DLTA 3LV3B 5CEXA 3ALXA 1BFVH 1ZMYA 1A9EB 2P5WB 5AYQA 4JEGB 4ZFOB 5GGSY 4MYWB 5C0EB 5IB3A 4HWBL 3ZKMC 2ZUTA 4LP4A 3DX8B 3IAGC 5EULV 5BO1L 1PEWA 2GAZB 1ZT7B 5L7XH 3VFPA 1OCWL 5D96C 5SWSE 5EOCH 5CJXA 1HNFA 1JK8A 1RZJH 5BJTA 1LO5A 4OZIA 4OI8A 4R26H 5EDXA 5I74C 2XNAA 1H0DA 2ZUVA 5B38A 1VGEL 3NTCH 3UPRA 3S96B 1BLNB 2XTJE 2WWKT 3QNXA 3L5WB 1IKFH 2R69L 4TVPD 3PP4L 4V1DD 3L3KB 3O2DH 4W4NA 1QPPA 1WUNT 4JPIB 4DKDC 3MJ9H 1T1WB 2EYRB 3WS3B 3MRNB 1BZ7B 4OFKA 2Y23A 4WUUE 4KRPD 4JY5H 3KLAB 1C08B 3OB0K 1KCSL 3MGAA 4MZ2A 3P77A 5IR1B 1EGJH 1G7PA 3OHXB 4TULH 2QQLH 4JHZA 4YBLB 1VFBA 3ZE2F 3LN9A 2IH3A 2XZAL 4IRSC 1OP5K 2VLKB 3MLWL 3QIBA 3TWCL 3BKML 3KVQA 3UTZB 5HGAA 3O3AB 5L6YH 5E1AA 1MH5B 3OKOA 2V2WB 1MCNA 1QNZL 5BS0A 1JP5A 4O58L 3EO1B 1D5ZA 1KGCE 4HCRA 2NY0D 3RWDA 2VXTL 4IOIA 2CR3A 2J5LB 4ZOBA 2A1WH 2DM7A 3PGCA 3D3VA 3VMPA 3QUMB 2NY2B 5ILTL 4LASH 4HKJA 4ONGL 2HJLA 3OGCA 3V0VB 1MIEL 1GZPA 3ZHLA 2B7DT 4CNIB 4A6YL 1DBML 4NRYA 4WU5B 2X40A 3ARBD 4NHCH 3CSYA 3BKCL 4H26B 1RUMH 5HHVH 5I1JH 2LE9A 4P2RE 3TH3T 1QR4A 4FQLL 4X6EA 1ZA3B 4JPVL 3UAJD 1MFCH 1XGUB 3VA6A 3NFNA 5EBMB 1S9WB 2YXFA 5CAYB 5HYJA 3OPZH 3V0AC 5IHLB 1F90L 1CU4H 3HAEG 1TTGA 4MJID 5FO7B 1QO3A 3UJTH 3E8UL 2AI0H 1TTFA 3T0ED 1BAFH 3IS1X 4XP6L 1XGYL 3BZEB 1DBKH 4KRPC 2MQ0A 1S5IH 2YA0A 4PJ9A 5GRZA 1ORSA 1IM9B 5KS9F 3KYKH 1P7QA 1WVZA 3VWKD 1GGBL 4DN3H 2YA1A 2CKBB 3CCHA 5MENB 3KPSE 3LH2H 3WKML 1X5GA 3C6LD 1A6ZB 2FGZA 3GMPA 4N8VG 5CGMA 5AUMA 5IF0B 4KK5D 1O7VA 5IHZB 1AD0B 2MOVA 4XNZC 5D1QB 5F7EH 1WIPA 2V6HA 1NCDH 3KPLA 4Y1AA 4K3EL 1EUTA 4XCFL 4M3KB 1NC2A 1RULL 2NY0C 3VGDA 2JE8A 1HXYA 5JTWA 3V0WH 5KW9L 2HWZL 1S9KC 3F6IA 5C3TA 3LN5B 4BZ2H 4NJAH 4P2OD 1CFNA 1TPXC 2AXHA 4LFHG 3VRLE 3ARBC 4JREC 2X4UA 1TZGH 1V3MA 3M1BA 2F53A 3QIUD 3TO2A 5D2LA 4PREA 3HE7D 3UAJC 3QR2A 2IFFH 3MLRL 5C0FB 5CINL 4HWEH 1A4JB 2QADB 4NDMA 4E41D 3VG0H 3PWPA 4MQTB 4FXLA 3CSPA 4GG8B 4AEHH 1N0XL 2DIBA 1HQ4A 4G7YH 2XTJB 4XVTH 3HMXL 1U95A 3T0EC 3L7FA 1TCMA 1OQXA 3T3PF 3DVFA 1D6EA 2KPNA 4L8BB 1AD9B 3LS5L 5F1NA 4EEEA 3MYJA 4NRZA 1MHEB 3PXHA 4WU7A 4Y16D 1J8HA 4TTDD 4WUUB 1T80A 4QHMA 3T2PA 3VWKC 3MLZH 4GRWB 1JL8A 2FEDD 2HLAA 4JFEE 4FP8H 1JGEB 5F70A 3O8XD 3C6LC 2GEEA 1S8DB 1GGCH 2NY5C 2X41A 5H2BB 2FJGB 2VTFA 5DD0H 1DBJL 2A0LC 3B5GA 1KLUB 1MWAA 2AJZB 4KK5C 4DGYH 1I9RL 3BRFA 3L3JA 3QQ3B 1N4XH 3RAJL 2E7MA 1O0VA 4XPBH 4YDLC 4ZD3H 1MY7A 1A3LL 2D7TH 1R0AL 2YA2A 5KSBE 4OSUL 3TO4B 2DLFL 1D5XB 4L3CB 3AMLA 4UT7H 1JHTB 4M7KL 4PRHE 4CN6A 4P2OC 4PJEF 3ZT5A 3AS2A 1GVIA 4HC1H 2AERT 4MQXC 3HZKA 4ODWB 1KENH 5BRZD 2VZ1A 3AREB 3QIUC 1IZKA 2YBRB 2ZCKL 5F7KC 5HI5D 2ARJB 2Z8RA 4LSPL 1CLZH 4CAGA 1F3RB 4LCWA 4P2QE 3HE7C 2QLVB 2ICWB 2NY6D 3G08B 4JDZA 1JWMA 4QRRE 5JHLL 1FJ1A 3TBSB 1L4IA 2QV2A 2HJKB 5EPMB 3WFCH 2FJFB 5JXAH 1T1ZB 4XTRC 1TZIA 1HILA 5EZIH 3MRLB 5JIHA 5BV7B 2O5ZH 4OF3A 5L2KE 1QBMH 4QF1A 1WCBA 3GBNL 1B0GB 1JN6A 3K4AA 1IQWL 5KBNC 5DSCA 1DQDH 1QA9B 4M7JL 4Y16C 5EIQA 5BVPL 1FNEA 1UYWL 4TTDC 5E8NA 3L95A 4Z7NF 4QHUA 4I18C 4ZO7A 5I9QC 2A9ML 1K6QL 1X5HA 2FEDC 4NM8L 2D4FA 2PYFB 3O8XC 3NCJL 1W0VA 1P1ZA 1FE8L 4WHCA 1ZWIA 4JJ5B 2BNRE 3WO4C 4EXPX 4JCLA 3F62A 2P8PA 3GSNH 3S8WA 4F3FA 4NM4H 1UM4L 4NKMA 4R97B 2OZ4A 2BFVL 2FBOJ 1RFDL 3KPRD 4JN1L 1IILE 1P4IH 1FZJA 1PG7H 3BOVA 3BH8B 4J12A 5DD1H 1S7SA 1TVHA 3QDGD 4XCNB 4GUPA 2OI9C 4RDQG 4I3SL 1XZ0A 5C0JA 3C09B 4NBZB 1JHKL 4PJGA 5E8EA 5JHDE 1YQVH 3O4LB 3PXJA 2P46B 1FL3A 4KHTL 1T21A 4DKEL 1BOYA 4UTAH 3LSOB 4QTIH 1YEDA 1PSKL 1UWGL 3IU4H 1QFWL 4S2SB 5HI5C 2VXSL 2YC1A 2BCKA 2E9WA 2YRPA 3N1QC 5TE7H 3PDDA 2NY6C 3AU1B 4JR9H 3ZE2E 3SJVE 3WIIH 3BD4A 2AKRB 5DD6A 5GIRA 2RCSL 2WP3O 3I84A 1MCOH 3BIKA 2W91A 1NJ9B 4FQXA 5ISZD 4BSVA 3MBED 3MRMA 1MCPL 4EN3A 1J10A 4QHKI 2HKFL 3K1KC 4AMKH 2D31B 3VWJA 3UPCA 4TVPL 4ZPTA 4PJXA 3T77B 4ODVL 4XP5H 3H7LA 2VLJA 3RA7L 3MV9A 1HINH 3DIFB 1INDH 1I3UA 3ET9F 4JRXD 4XCYA 5E5MA 5H37G 5JPMA 1T0MA 4OFVA 3ULSB 1UZ6F 5I76A 2XZQL 3IFNL 1KG0B 2VDOH 3GGWA 4UINH 2VABA 4JFEB 3TCXA 3IJYA 4X9IA 1INEL 2FATL 5CMAB 3RVTD 2JB5L 3NCMA 1MEXH 2I26N 2DIJA 4PRPD 3Q1SH 2GUOB 4L1HA 4LEXH 3L3HB 4Y4HD 1DVFD 5D70H 2W92A 5T1KA 43CAA 1UCBL 5KTEL 4OV5B 4XNMA 1LEKB 5EU3A 4IRZH 2ZP0T 4NQEA 2JF1A 1T04A 4OZFH 1ZEAH 4P57A 4ZUWB 5KSBB 2O5XH 3W2DH 3KG5A 5FXCH 3QNYA 3MRJA 4E5XA 5D2NA 1XGRA 2E7LC 3V52L 3MV11 2QR0B 1M7DA 3U7YH 3FO2A 1JGUH 4HEPG 4P2QB 1C16B 1A14H 5C0AD 5E2VL 4ZMAT 4QRRB 3T4YB 3DTXB 4MA3B 1KB5B 3MBEC 4LVOC 3QI9B 2V7NB 4F80A 2I9LB 2FECI 5TDNB 2JTDA 3PWLA 1PQZB 1R3KA 5GISL 4J6RL 1MQKL 5FHAL 3GJFK 3TV3H 1KTKE 5FYJH 4BFIB 5HY9A 5K9OB 1HHIB 1SEQL 3C5SB 3QFJA 3QULA 4NPYB 5C3LD 4O02H 3EKCA 1A1OA 3OX8B 5TFSL 4F15C 3P0VH 4C55A 1R5VA 3EW3B 1AGDB 2VC2L 4QRSB 5CP3A 5JMRA 3RVTC 1FIEA 1W2KT 1KLGB 1T3FA 3WLBA 5DVNA 1JVKA 4R4FL 2VITA 4M61A 3NA4A 4MJ6A 4Y4HC 1JYNA 1DVFC 5I8KH 3MCKA 3BW9A 2YD1A 3O2WH 3AB0C 4JY4B 2Y9RT 4M5ZL 1P84K 3F58L 3IFOB 1NC4A 4RFNC 3ARRA 4PTUA 1WCQA 2Z92A 4XVSH 1G9NL 5ITFA 1FNGA 1PX3A 3K1DA 3GM8A 4N68A 3T3PE 1UQSB 3L3DA 1F4HA 5JHDB 1R5IA 3ZHDA 1NAMB 4XNMB 5DO2D 3LRSA 3KXFD 5EOTA 4TSBH 3RDTD 4YE4H 1UA6L 2X4TA 5GGSB 2VLLA 1C5DB 3QCTH 5DK3A 1OP3K 1TJIH 4YDJA 2OK0H 3OAZH 4NUGH 3DROB 1RSFA 1RZGB 1Q9WA 1M6OA 1T20B 1QRKA 4OLYH 1SJVA 4XZUB 1SQ2N 1C5BH 3BO8A 5MP6L 1HH9A 2NW3B 4ZTOH 3B8SA 3HC3L 3S6CA 3O6ML 3P9MA 3JSSA 1KC5H 1FAKT 4HUKB 4CDGC 1MRCH 1QSEA 4ZFGH 5T1DL 4PJEE 3QG6B 4G9FD 3BH9A 4PJBF 2ENSA 1BOGA 2J12B 1M1SA 1JRHH 2W65B 1LO4H 1I9IL 1QLRB 2DTML 1S7VA 4P3DB 1IGFL 1IBGH 2JJTA 1FFOA 2C1OB 2Q3AA 1CGTA 1VACB 1ZHLB 1AGCB 1KCKA 4L9LC 3ZT7A 2OL3L 4H88L 4I5BA 3WHE1 3D87B 1GZQA 3ARGB 4NFCA 3QEUB 3LQAL 3TVMD 4OBRA 3CVHH 3IDYB 3OWEA 3FFCA 1MJ8H 4AEIL 2F19L 1Z3GH 3VXUA 2Z0BA 1BVKB 4AZ8A 4GKNA 4O00A 4M4PA 5JO5B 3ALPA 5DO2C 2HT3D 2V5TA 2X1QA 2ORBH 3WFHB 1LO0H 4Z7NE 4FMFA 3FONB 4M8QB 3RDTC 3IXTA 1T83A 5CBAA 3L3GA 2EDJA 5C0ND 3OJDB 4YUEH 4NO0D 1MI5A 4MXVF 1TDQA 1JZ7A 3OR6B 3WE6A 5IQ9B 4HGKC 1YYLL 2R1XA 2BY2A 1OAKL 2ESVB 3D39E 3TF7C 1TMCB 2X1PA 1AJ7H 2DIAA 1GRWA 3BVNB 5I16B 4H1LA 1G7HB 4Y5YB 1TETL 1G7JB 2F15A 1EO5A 2YR3A 5DEZA 1P2CB 2IADB 2DLIA 2ADJA 5IHBA 2EE9A 5CD3A 4GW4B 4GSDH 7FABL 2Y5TB 1T6WA 4I48B 4YPJA 1MFEH 2MPAH 1JYWA 1CI5A 4U3HA 2UV3A 4LKXB 4F7MB 1I9EA 2R2EB 3MA9L 3GIZH 1XIWB 2B4CC 2DMKA 4LLQA 5IMOA 3MRCB 5C0CE 1Y18A 3WEXA 1IJ9A 4F9LA 5LWYL 4YXHH 1U8HB 4TQEL 4KJYA 4LGSB 3TVMC 4HGWB 3S4SG 1EEZA 5DURB 3O4OC 1WBYA 4HKXA 1L9NA 5DI8B 4GG6B 4PS4H 4Q9QL 2XN9D 2ICWI 1KCVL 1QLFA 4N9GB 3RWIB 4G8IB 1YJDH 2EDWA 1RK0A 3HNSL 3WD5L 5DMGD 5HDQL 3SO5A 3W11D 4AENB 5C0NC 1OQOA 3VXOB 4PG2C 4HH9A 1L7TL 5EWIH 1SY6A 4KU1A 5FM8A 1KJMA 5I1KH 2DQFB 2WLYA 4XPAL 3BGMB 1HE7A 4M1GL 4N0YL 2LTQC 4PJ7F 4K94L 5LG1A 2M2DA 2FDBP 4OIIL 3MJ8A 4WCYL 1YEEH 2GCYB 4ISVA 4PJ5A 5FUOL 1L0YA 5JW5B 5HSFA 1NLBL 3R8QA 1EEUA 3GSRB 2YWZA 3BP5B 5HDOA 1KN2L 4N9OB 5DUBA 5C2UB 3ALWA 4PJEB 5ALCH 2CIIB 3B9KB 1ONQA 4JM4L 2IBZX 4QRQA 2WUBH 3QJFB 2EDRA 3UTQA 4DGVL 4OB5L 3VH8G 1DBBL 5FK9A 2VDML 3QDMA 5LCVL 4YNYB 4ZODA 3U9PH 5D5MA 4Q9RL 4NJ9H 3TZVA 1V7NH 3M8OL 3UJIH 1I7RB 2RIKA 2AS5M 1KIRB 4QEGA 3G9VA 1OGAD 2AEPH 3HLAB 3RL1A 3AS1A 3QJHA 1NGXB 2KQMA 1GGUA 1ZVSA 4YWGH 1CBVL 1J12A 5DMGC 3TA3A 3W11C 3C5JB 4G5ZL 3QDJE 3W82A 4CKVX 1IVLA 3ZL4H 1A1NB 2B8OT 3QIWA 3N0PB 1AC6A 3JV5A 4M1DH 3WN5B 3D39B 3X13B 5D71H 2DWEB 5LQBL 4JQVA 4YQXH 4XBPB 1N3NB 3PGDB 1ZE3C 2WBKA 4W81A 4NGHH 4RGNB 5SWQB 4Y2OA 3O6FB 4MWFA 5TE4L 3RWHA 2YD2A 4BJLA 3GHBL 1W0WB 4EUPH 4W70A 3OB0H 4FOMA 5FGBA 1F4XL 1OAXL 4X0KB 1I9JH 2ITDB 4QRUB 1B6UA 3LRGA 4QHLB 2BY3A 3V6OA 3DUHA 4AH2A 1UM6L 1OP5H 4XNUH 4MD4B 1KTDB 5LBSL 4LKCB 4Z18A 4Z7VE 5FYLD 2I25N 4P23D 2VAAB 5GRVL 4HULB 1H8SA 4LIQL 2X4NA 3DBXB 5HPOA 4GW5A 5ADPL 4F58L 4JFQB 4I9WD 1IM9D 2PYED 3GIVA 2XA3A 4K7FB 4C59B 4WTXA 4EDWH 1IAIL 5MEND 4LK4A 5J12C 5E08L 2CDFB 1WIOA 5JOPE 3HNTL 3DX7A 2EXYD 5T33H 5D1ZA 4UNVA 4XAKE 2WUCH 3E6FB 2DQDL 5KSVB 1ND0A 5ICYB 5D1QD 4F57L 4RAUB 1QFWI 4PJBE 3BDYL 2QQNL 1CLYL 3QEHB 3R06B 1NGQH 2FZ3A 3OV6A 1AO7E 3CMGA 5C09E 2XKUA 2D9QB 1TVDA 3MLXH 3NABH 5DMIL 5KSUB 2XPGA 5E03A 5GS1B 3TN0B 2VR9A 2X7LA 1BM3L 1MJJA 5EIIA 3RTQB 1IC4H 3GBMH 5FO9A 3EDDA 5F3HB 1LK3H 1X6NA 4RFOH 2H26B 3ARYA 3KPMA 1M7IA 1EHNA 3O3EA 4MQ7B 4JE4B 5I71B 3LEYH 4CL7A 2UWEA 5SWSD 5KJRH 5DVKA 1JF5A 2JIXA 4HBCL 4U1JB 1R24A 3FHAA 4HJGB 4M9PA 3V5DA 2NNAA 4AT6B 4JFFA 3UO1L 1AXSA 3HR5B 4BFBD 5JLZB 1YQ2A 4UTBH 4PUBL 3GI9H 4P23C 1LEGB 2B4CL 2EXWD 3QXDB 4MXVE 4XXCC 1BWWA 2XWJB 4Z5RB 4HAGA 3MO1B 5IOPB 2R2CA 4LDLB 3KLSA 5B22A 4R3SB 2J2ZA 1NCBH 3C08H 3SHSA 4DTGL 3MLUH 3SDAB 5B8CB 3MJ7B 3G6AB 1NBVL 5E2UH 3MZTA 4L8CA 4HKBB 5D72H 2Q3ZA 3PABA 3CX2A 4I4WB 3MCLL 2EXYC 3MA7A 4GFTB 4LAQL 3NBNA 3MRPA 4R6UA 4OQ1A 4M7LL 1S7QA 4WV1C 1G1CA 1QEWA 5D1QC 2Q7NA 2AQ3A 4O51A 1AGEA 2BY0A 1MHHB 4YR6B 3IJSA 4HH8A 2KUTA 3QDJB 1KGCD 4LEOB 1J0YA 3MLYL 3EDEA 1IAKA 4ODHH 2CRIA 3OXSA 2ZSWB 3SQOH 1INQB 2FD6H 3HUJF 4H20L 4RGOH 5K9KA 2CGRH 2CH8A 3FRPA 3D85A 3QO0A 4ODXB 3VXNA 1NFDA 4EDXA 2Q8BL 4G6JH 4HWBA 3MUZ1 5F7HA 3ARED 1CE6A 3S3SA 4NYLB 1T1XA 5F6HI 1U8MB 4P2RD 3IDXL 5GS0H 2CDGB 2FB4H 3WNLA 1UJ3B 2VMFA 2JCCA 4NSKB 5F96H 5LJYH 4XH2A 5DC0A 3G6JF 4D3CH 3JUZA 5F7NC 4PTTA 2XTJC 2C1PA 4U1SA 5HHXH 2N7BA 3PHOA 2EXWC 4Z7VB 3D0VA 2L7UA 4OGXL 4YHLL 4XPGH 5C86A 4JFDA 3U4BH 3R1GL 2Q86A 5EU6D 2QQKL 3ZYIA 3SDYL 5GRYA 2VXUH 4U49A 4WO4D 4H25A 1CGYA 4PJ7E 3RZCA 1U8OB 1CZ8L 5DQ9B 2R2BA 4K3JH 5LXGL 1P5UA 3DVGB 3KPSD 5KZCD 1CR9H 5C07A 2D9CA 3E2HC 2VDKH 1DLHB 4L3EE 5D7SL 4PJFA 5HDBE 4FTVA 1HWHB 3DX9A 4OZGA 1BBJA 4OAWB 3REVB 3PGFL 1UB5A 2KZ1B 4YLQT 4ELMB 1A22B 4TUJA 4PJBB 1AFVL 2FWOA 2X4QA 4MLIA 3LS4L 5C09B 4U1NA 4NZTL 1FFPA 4J4PA 4XBGB 3P73A 1CGVA 5EZOL 3P9LB 5SX5K 2PUQT 5C0GB 4I77H 3H0TB 1OPGH 4QGTA 3V5KA 1JGVL 3JBG7 4A6YA 3S37H 1U8JA 3AREC 2EEBA 4PJAF 2A74B 4HGMA 4QXUH 4LLWA 4MAYA 2PTVA 1U93B 3MACH 4PLOB 4EI6B 4GO6B 3LEVH 3CX5K 2HYMA 1I8IA 2BC4A 3I6GA 3O3DB 4P2CG 4U1KA 1I8KB 5DD5L 1CG9A 5BV7C 4JDTH 3SE3C 3ILQD 5EB9A 3SDCA 3WS6C 1I3VA 1KBGL 1WF5A 1AI1H 3V8CA 3F7PC 1X6LA 3IETA 2MMXA 3QQ4B 1TVBA 1QRNA 2DQUL 4XVJH 1B4JL 1GC1H 1NGPL 4EOWH 1NBYB 1PFCA 4NO5A 3G5YA 1K4DB 1WZ1H 3SKNB 4L4VE 4ZUSA 2UZXB 4P5MA 5E8DH 1X4ZA 3H7BB 2EIDA 4HV8A 2EIBA 3ARFD 4CW1B 4ETQA 3V7MA 3U0TA 4UQ2A 3VFSA 4GRLA 2A6JB 2W9LA 5GRUL 3KYOA 5D7LE 3Q6GL 4K7PX 3C8HA 2ZCLH 4N8PA 5ICXA 3C09C 1S9XA 2ARWA 4PRHD 3IB4A 3HB3D 4AIOA 4DKFH 1JI2A 4JM2B 5I1CL 1JCKA 1S3KL 3HRPA 1V3KA 4KMQA 4K8RD 3WIFB 5IBLD 5IIEB 3K2MC 4QRRD 2BNQE 1F11A 2DQCH 3BGAA 3FQRA 4X8JB 4X80L 2CLZB 2W9DH 3TPUA 3ILQC 2IAMA 5BZDA 3HC0A 5IB2A 5L2KD 5MI0C 1YPZF 1P7KB 1JPSL 3HMXA 5E4EC 3T8XB 4FZ8H 2J8OA 4G8GB 1NDMA 4MSWB 1G7LB 1RJZB 1T22A 1ETZA 4J2XA 2HT2C 2XWTA 4OLWH 2AK4E 5HVGB 3SPVA 1X4XA 1WT5A 2BNRD 2VLRA 2BX5A 5ENWA 1Z9OA 3K2UH 4RQQB 3VGGA 4JHWH 2PTUA 2W38A 3T1WA 1EA9C 2G5RA 4R9HA 1AKJD 3LVEA 5HGHA 1YEHH 4Z0BH 1FH5L 2ILLA 1CQKA 1J1PH 1KCRL 4P3WA 2P42B 4H5SA 3KPQB 2P49B 4YAQA 1FNLA 5ERWB 5GRJL 4KXZI 2IALB 5ANME 1OB1B 4RSVA 4ZOAA 4NHUB 1T7ZA 2PCPA 3CFEA 3FN9A 5HYQB 3QZWB 1H3PL 2GSIA 4K8RC 3GJFH 3MRGB 4OF7A 1EFXB 1LD9B 1N5AB 4NWTL 4OTXH 2A77H 4OLVL 1F4YL 3P40A 4HX1A 2ZKHH 3SJVD 4ONFH 3QG7H 1UVQB 2AW2A 4NKDB 2AJSL 3FOLA 2IPKB 1XGQB 5EU5A 5FYJE 2MQCA 4D9QE 1TZHA 4HWZB 3M17A 3ZTJG 3K3QA 1JMXA 2UUDK 3QA3B 4PGCB 2FBJL 3HUJE 4MNQA 5D6CA 5CZKA 3GO1H 4WUKL 1S9YB 2A6DB 2FR4B 4X5WB 2OMBA 3QUKB 5IESH 3QP3A 4KZEL 1HHJA 3SGDI 1U58B 4CADA 3MRRA 3QUYB 4IRSA 1B88A 1MCRA 1I3RA 1LDSA 4PP2B 5IVXF 3U2SA 3EOTH 5DK2B 2YD6A 3BISA 3G6JE 5DRXA 2BZDA 5I1DA 4JO2L 1OP3H 1ZK9A 5D7LB 2P8LB 3PWVA 2VDLH 2DYPD 1XCQA 4I0CC 1MFBL 1ZHNA 5FF6A 4PD4K 3QHFH 1UEYA 3DRQA 3RVWC 1JYVA 3MROA 4QT5A 1EAJA 3DX6B 1MAKA 3HI6L 4OD2B 1BZ9B 4Z8FH 3D5OF 1QFUL 4NP4L 3EYOA 1MNUL 4UI2A 5DEGB 5T1MA 4MNHB 4UMGA 3TJHD 3VI4F 1QKZH 4GXVH 1FN4A 4NO2A 2A83B 4WI8A 1QSFB 4NZDA 4Z7UE 5HYSB 2Y25A 2WIIB 3AVEA 5DMYA 2OMNA 1X5XA 3HAEA 4V1DA 2B39A 2GTWB 3GRWH 1H8NA 1MIMH 3T0AA 3DMMB 1ZANL 4I0KA 4HUVB 4AIZB 2OJEA 3BRGC 3VCLB 3MOAH 4RGMB 4A2LA 4P9HL 1RZKH 4PJAE 1IAII 1N59B 4HG4K 1R5WA 1K2DB 5FA4B 1CFSA 3LKPB 5KVFH 2BJML 2RB8A 2E27H 3ARGC 5MEOA 3DARA 4RA3A 4N8VA 3FHQA 5I1AB 1RZIB 5F7DA 1G9EA 4RFEA 3MZGB 3OKKB 1U91B 1PLGH 3ARDB 4O4YL 5DDHA 4ZOCA 4EI5D 3CFDB 1VADA 3JV4B 2DQEL 3DV6A 1LO3L 4WHYH 1Y6KR 5KSAB 4YFLF 1ES0B 3VFTB 4N1CA 4LGPB 5IEKA 5ANMB 4CVUA 4ZG1A 5JIPA 4FFVD 5D7IA 2HH0L 5C08E 3V4UL 3ARBA 1FVCA 4K9EC 3TJEH 1EIBA 3FQTB 3K4ZA 2OTPA 2NX5E 5IFJB 4UU9B 3TJHC 2P4AB 3PL6B 4MLSA 4DZBB 1OTTC 2YD5A 1T2QH 4OM0H 3GJEA 1TJGL 2ZCHH 1U3HD 1MREH 4PGJA 3BPCA 3Q5OA 4QWWD 5FM5O 4MJIA 3FQWA 5T3XH 5B3NA 2BSTA 2CO6B 5IK3A 3T0EA 1RD6A 2QSTA 4FQHA 2F5BH 3U0WH 5DJXB 3MV8B 1JZ8A 5GQBA 4F7PB 1AQDB 3X11B 4AL8L 3HUJB 1FGVH 2OZ4H 5DJZA 3RPIA 3VWKA 1RPQA 5HHQB 1XIWC 3RWFA 1NMAH 2HFGL 3ZYZA 3LD8B 3C6LA 3OKEA 4AEFA 1ZS8B 1YECH 5I1IL 4MA8L 1ULVA 3G6JB 1WC7B 1OSZB 4NQCA 3LY6A 4HLZG 4EI5C 4JFHE 3EYUL 1AR1D 5FV2A 1ACYL 4R8WH 2PW2A 4XRCB 4KY1H 4P2OA 2CQVA 4PGBB 4FFVC 1C5CH 5IFAL 2Z35B 2D7QA 4PV9A 1A47A 4ZO8A 3QIUA 1T2XA 4K8RL 4G42A 3F7RA 3HE7A 1XR8B 1G6RL 4JGUA 2IGFL 3D39D 3PHQB 5HGDA 3QB7C 3O41A 3RUGF 3HG1E 1NGWB 2R1WB 2W0FA 1D5MB 4E41A 1OHQA 2ZJSL 1MF2H 2FHCA 4NN6B 4Z7UB 1U3HC 3DRTB 3WSQL 2F54E 1Q9OB 3LQMA 4O2CB 4QWWC 1U2CA 1HSBA 4WEBH 2A9NH 4MA1B 2BP3A 5MERB 3DYMA 3WFBH 2DM4A 1T7VA 4ZNEA 4NKIH 5HDLA 4Y16A 5I0ZA 4UAOC 1IQDA 5D8JL 2JLLA 3IXAB 1EEYB 3RWEA 1I7TA 3CH1A 2AP2A 2Y07H 2NY7L 3O8XA 2G2RB 3CFIC 4X6BB 2YWYA 2CDEB 4F7EB 1EJ6A 4LVEA 4Z77B 3CVHB 1GOHA 1Z5LB 3VJ6A 3BHBA 4J3WA 5C0CD 4FZEH 4NC1E 2OL3A 3O6LL 3IAQA 1CD1A 1F4WL 1FIGH 2R4RL 3OSKA 3B9VA 5CEYB 2D0HA 3WNNA 3SDDD 1F42A 3NA9L 3ZKXB 5J1TC 4KTDH 4MDIB 4UB0L 3A67H 4KV5F 1AR1C 3NZHL 1KELH 3SCMA 3OJMB 1VFOA 4GXUN 1K8DA 3IFLH 4BQBA 1DFBL 1Q1JL 3ROOB 3EGSA 4HK0A 1GCFA 5ELIA 2YD3A 4JPKH 5SWZE 5C08B 5GHWL 3TBYA 1HXMA 2IPUG 1CXHA 4PY7A 5A1AA 1DE4A 5ESVA 1V7MH 2NX5B 4O2EA 1N6UA 1HEZA 1NDGB 5TQ2L 1G84A 3F7VB 3UTTE 4PV8A 4LBEB 1CD9B 2PXYD 1U6AH 5IVXE 1TTUA 4LPXA 1J1XL 5CP3H 2RR3A 1IC7L 5DFVD 4OI7A 2PTTA 1FYTE 5DRZB 1CL7H 3RVXD 2BDNL 4LVNC 4ZFZA 3TT1L 3D2UA 4CBPA 4OJFH 4YHNB 1IT9H 1PKQA 3NFPB 1S7WB 1FO0H 1WBXA 2VOTA 5TDOB 1BF8A 3V6FB 2DDQL 3DUSB 1NGYA 4DFIA 3P4OA 2N7AA 4O2FA 5I8CA 1HOCA 5F9JB 2XI9A 4GKSB 4BH8B 1MHCA 2HFEA 3TM6A 4NFBA 2GJZB 3G6DH 2YEZA 4OI9A 4XPTL 4FQJL 4HHAB 3SDAD 1QVOA 2VIRB 3KPRA 4JO4H 4EBQH 3UBXB 4MCYA 1M05B 1RIVH 4HZLA 1ZLWK 3GHEH 3QNZA 1ZLSH 4ELKA 5HJ3B 1ED3A 3BPNB 4Z76B 4EIGB 2CMRH 1IFHH 3RP1A 3MODH 1WLHA 3SDXF 3ZLQC 5E00B 1UJTA 2E7LA 3NZ8A 4G43A 1I8LC 2OQJB 4F33B 5JOFB 3GUTB 2HG5B 5IEHB 1CT8B 4J8RA 5I66B 5GS1C 3EYSL 1I8MA 4KK8C 1BD2B 4QRPE 4B53A 4OZ4A 3CK0L 5EO1B 4DQOL 3PUCA 4G9DA 5CSZB 4JG1H 3HG1B 3BYYA 4X6DA 5ISZA 4KI5F 1BFOA 1IGJA 3MBEA 1EVUA 1BFTA 5C0RL 1VKXB 5IMKB 2P8MA 2IPTH 2F54B 1F3DJ 2APWA 5DFVC 1OLZA 3JWDH 5I71C 4OLUL 1B90A 2EDXA 3T2NL 4ZAKB 2GFBB 4C83A 2R15A 3RFZC 5IMLB 3C2AH 4CVXB 4QKXB 5AD0B 3E3QE 4G6ML 4JRXA 1DUZB 3RNQA 2DF3A 5GS3A 4QXGH 5DLMH 4PBVC 3ARTA 1TJHL 1KPUA 3W9EB 1KFAH 2DQHL 1F13A 3AGVA 4PJHA 1FQ9C 3PWUA 3BDBA 3UTSE 1KYOJ 3MREA 5LGHH 4HUMB 1ZHKB 4XNYH 5EFIA 3VW3H 1KXVC 1HZHH 3U1SH 4KZDL 4G8EB 1MFDH 4WVRA 4Y7MA 4NRXB 3SDAC 4L4TB 15C8L 1ROWA 5B8CC 5FDWA 1NANI 4TUKH 3FO0L 4X6CF 2C9AA 3B2VH 5DQDH 2ADIA 1ZT1A 3THMH 4IMLA 5DYOB 5JOPD 5I1GL 2AXFA 3CXHK 2BVPA 4HIEB 3HRZB 2GTZA 4XAKD 2M26A 4H1LH 1U8KB 2YMXL 1QZ1A 5SWZB 5E2WL 2MTPA 1CN4A 5DHYA 3U6RB 4F2MB 4PY8J 1AO7D 2LABA 2OR9L 2Z4QB 4U6YA 1YDPA 4DVBA 3HZYB 3SO3B 3QRGL 1RU9H 5A2IH 3LKOB 5C0AA 1VESA 2IBZY 2I5YL 5DZNA 2V7HB 3UTTB 3IGAB 1MJUH 5BZWA 5JDSB 5B4MD 1L6XA 3LKRB 2D3VA 1RZJC 3MLVL 3CFCL 3VXME 2EC8A 3CFBB 3RKPA 5HHNB 2V2TB 4NQDB 3OG6B 1FYTB 4LU5H 5FB8B 2J88L 1ITBB 3ULVL 4JRYE 1KNOB 4PRNA 3UZQA 3VXSB 1IM3A 1RHFA 2Q8AH 3VFVA 2IANB 3KPNB 3P30H 5E70A 5CSBA 3MRFA 3EOBA 1ZVHA 2DQJL 5H94B 3IDGB 3WIHH 2ED9A 4RZCA 4Z0XA 1GGIH 3VFUB 4JRWA 5F89A 3V4PL 2GSGB 3K7UA 1OW0C 1NBZA 3RUGE 4H0HB 4DN4L 4CMMA 2EIZA 1JPTH 5E56A 3QUZA 3L3IB 1KEGH 2R4SH 1Q72H 4J3UA 3RWCB 5FOBA 2XKSA 4WI3A 5F9AC 4WW1B 5SX5H 1CK0L 3B6SA 5IQ7H 4G6KL 4AK1A 1WWWX 1G9MH 4I3RL 1X4YA 4KMTL 4H8WH 4L8DA 5ESQA 1I1YB 3GNMH 3KXFA 2Q7YA 1AHWA 2LVCA 2DD8L 4M5YH 4XMKL 3FFDB 3GSWB 4TNWK 3RDTA 3P2TA 1DJSA 1N6VA 1HHKB 1F6FB 5GZNC 2NTFA 1T5XB 1OAZH 5AZ2H 3SY0B 4QRPB 1GOFA 3IRPX 4N0UE 1E4XL 3O6KH 4N0FB 4LVHB 5DMJB 2VZOA 4PRDB 4WFFE 1IGMH 2PO6B 1RZ7L 3L6FA 3ILPB 4HUXA 1CIUA 1IARB 1RUPH 2BVTA 2DAVA 4ERSL 5J1AB 1A6WH 1FAIH 1CVRA 4NZUL 2OTWB 3KJ4B 4IRJB 4FXKB 4OCRH 2FGWL 2HRPL 3ECBA 4KV5E 5E6IB 3WL9A 2AXGA 4LSUH 4UIKL 2DB8A 4G9FA 4IBLT 5DJ2B 4GMSH 4HIJA 4KK9C 2OP4L 4JFXB 4PJDE 1MAML 4U7KA 3SE4A 1P4LA 4HK3J 5GSRB 4E42A 4W6YB 1CFVL 5J1SC 2MKLC 4ORZC 5M7QA 2FL5A 4Q6IB 3FT4B 3GI8H 1RZ8B 5CIPA 5E94B 3TVMA 1D5BA 3S4SA 5J57B 4J1UA 2EEAA 5FYKD 3I6LE 5C9JA 2EYTA 2I07A 1YY8B 1RURL 5EUOA 3U7WH 5EH1A 1J88A 4FQIL 4L3ED 1Z9SA 2H9GB 1FL6A 1LP9A 3MV7A 4OD3H 1NLDH 1YNLH 5KANI 4JFZH 2ZPKL 5T3ZL 3SKOA 5FA3A 5GZOD 3ZYOA 2IFGA 4UT9H 4PG2A 1E6JL 1A0QH 3JV6B 1DQQA 4GAGH 2OBGA 4U1IA 5DUPH 3CDYA 2VDRL 1DTUA 3Q3GB 3DUUB 5JPNB 4LPUA 4M6OH 3ZSSA 4Y4FD 4MX7B 3HI5H 3VXMB 4NNPL 4DAGL 4H0GA 5DJDA 5J6HB 5F7LB 4LRNH 1OGTB 5D1XB 5ID1B 2BHUA 4NNXA 4R0LA 1YEJL 4OFDA 4TUOA 3WLWD 3QO1B 4KQ4H 4KROB 5GGVH 1B0RA 2MHAA 4GMTL 4PJCA 4YHZH 4BUGA 4Y5XA 3C5ZB 3SDXE 1DN2A 4LLVA 4M6ML 1NEZB 1NCWH 4HS3B 1XGTA 1YNKL 2GY5A 2Y36H 1MVUA 2CD0A 2RHEA 3NN8A 1J5OH 2J8UA 4NUJA 5H35A 3QDHA 3WNMA 4KI5E 3FT2B 1BBDL 4YHOL 1YYMH 4L4VD 5IB1B 4XPHL 3VGHA 1FVDB 4M48H 4HQQH 4R96B 5L2JA 3QUYD 1BQLH 2XN9A 2Q76B 4WEMB 4HZAA 2HRLA 2V2XB 4YH6A 2DI9A 4HF5L 2EH8H 1AP2A 2XA8H 4DEPB 1L7IL 1A4KA 2NZ9D 1IL1B 3EYVA 1A6VL 5GZOC 3BXNB 3CDFA 5D7LD 5HYJE 2WSKA 3GBLA 1JHLH 4LSQL 2GJ6B 1MQ8A 2PR4L 4S1RH 5L7XL 5EU4A 3LMJH 2H1PH 1B4RA 4L29A 3QCVH 4N0UB 3V79C 2EDQA 3QZWG 5JQ6H 5FKPB 4YC2C 3N1PC 1RZJL 4PGEB 2LFGA 4U33A 4R26L 2PW1A 1QQDA 2GAZA 2UUDH 1J0ZA 1FDLH 1RZFL 2C3WA 3WLWC 1K3ZA 5K9QI 1JNHB 2BNQD 1JNNH 4NQVA 3DURB 3OKDA 3S34H 5IHUL 1U8QB 3MJ9L 1OAUL 3AMKA 4JHAL 3BQUB 4GW1B 5EORH 4LSTH 4RNRB 2YRLA 1UKQA 3I02B 4PJDB 1LE9A 1CICB 3UBXI 1CGWA 3CFKB 3MXWL 1JUFA 4LSRL 4X7TB 4TTGA 4DZ8B 3DMMD 4K71B 4QXTB 2GI7A 1BZ7A 5CD5D 2DQIL 2XICA 5DHVA 3O0RL 1C08A 1OTSD 5CEXB 1OGAA 4RIRA 5CSGA 5L6YL 1MVFA 5IB3B 2AK4D 3QUYC 4TYUA 5IBTL 5I18H 8FABA 3VFPB 3FAXA 3MC0A 2MFNA 1MCWM 2V2WA 2NZ9C 1JK8B 3B2UD 4HWBH 5BJTB 1LO5B 4OZIB 1SVCP 1LK2A 1KACB 1E4KC 3HFMH 2XNAB 2R9HD 2MCPL 1H0DB 4UDUA 5DZLA 5DC4B 3PWPE 5B38B 3ARDD 1OCWH 3EOAB 3PHSA 4GH7B 4TNVK 4FRWA 5EBLA 4KVNL 1FV1B 4XP9L 4NHCL 3PIQA 3V5HA 3QNXB 1JF6A 1HI6A 1RUML 1WWBX 5KSAD 5I1JL 2Z31D 5AYUH 3S98A 3JWNC 2EZ0D 1CXEA 1VGEH 3UZVB 1MFCL 2XZZA 3H8NA 4PR5B 1J8HE 2GW5A 4U7SA 2OS7A 4FQPA 4GBXD 1R6VA 2CKBH 3U9UA 4UT6L 2QSCH 3PL6D 3P77B 1CU4L 4MA7L 1G7PB 3QBTB 5ADOH 4AY0A 3UJTL 2L4OA 1VFBB 4HFWB 5HYSG 3UDWC 2IH3B 3O11A 1C7TA 3QIBB 3ARWA 4Q6YA 2OSLA 2W0LA 5HGAB 5CJBA 2JJSC 5E1AB 3OKOB 1QHOA 5EBGA 2XZAH 3TH2T 4P23A 3MLWH 1CXIA 1D5ZB 3L3OA 3TWCH 4DN3L 3DMMC 4K7PY 3RWDB 4IOIB 5CD5C 1OTSC 3D3VB 3PGCB 1X5FA 4RGMC 1QNZH 4W4OA 2V17H 1IM9A 4FQCL 2PYEA 2HJLB 3OGCB 4NKOA 4YGVA 1GZPB 4JFYB 3C9NA 2ZUXA 1PG7W 2VXTH 4KKCD 3TBWA 3DHMA 5F7EL 1NCDL 2X4SB 3CSYB 3PV6A 4KTYA 5ILTH 4OZFG 2JB6B 4ONGH 3FB7B 3B9DA 4QYOA 1I1FA 3OKMA 5J11B 4Q97A 1MIEH 5C9KA 2J1KA 3B2UC 4X6EB 4EVNA 3V0WL 4WV1A 3PG2A 2R9HC 3NFNB 3A6BH 3BKCH 4NJAL 1N8ZB 3ARDC 4YX2L 4JZOA 1WAAA 4X98A 4DGIL 5HYJB 1HDMB 4Y8AA 5K93A 3QPXL 4JPVH 1SJHA 2MCG1 2EKSA 5F1SA 5KSAC 2EZ0C 1MCLA 2ID5A 2QTEA 4U3CA 2IFFL 3OTTA 2E7BA 1AIFA 1KEML 3EDFA 4GBXC 4GRWH 3E8UH 4PJ9B 3BJ91 5KVEH 1ORSB 2DQGL 3PL6C 5SWSA 4AEHL 3I50L 4XP6H 1P7QB 4F9PC 2H6PB 1WQVT 2MQ3A 3BKJL 3CCHB 5T3XE 1KB9J 3DLQR 5AG8A 4IOFD 1GGBH 3T04D 1FFRA 3BJLA 1U8PA 4K23H 3INUH 3WKMH 1OTUD 4ONOA 3KPLB 4Y1AB 1K8IB 3GSVA 2HN7A 4FXGA 1MHEA 2ZWLT 1HXYB 1GGCL 2UZIH 4XHQA 2VXQL 3VU2A 4K3EH 4XCFH 1DQLL 1CFNB 5FYKL 5L88H 1FLTX 4KKCC 1N4XL 4JQXC 3S35X 3LD8C 2X4UB 4P0DA 3MRKA 2ADFL 2VO5A 3T3MF 2ICCA 3BPLB 5KW9H 2APXA 2HWZH 3L5XL 3TO2B 5TF1H 5D2LB 5JORA 3MMEA 1IEAA 1X5JA 4OGYL 1QYGH 4PREB 4U1GC 4XX1E 3QQ3A 4UT7L 4NDMB 1A3QA 3U79A 1PYWA 3PWPB 4HPYH 2ZG3A 3MLRH 1HQ4B 1EZVY 1XF2A 1OARH 1U95B 5CWSA 5F97E 4P48A 5CINH 5E2JA 3L7FB 4JQIH 1D6EB 4YFLI 3MV9E 5F1NB 5C08D 4ODWA 1N0XH 2DI8A 3MYJB 5JXED 3DGCR 4LARH 3AREA 4NRZB 2F74A 3T0XA 3I2CL 3S36L 1J8HB 2KBGA 3MTRA 4M3JA 4QHMB 4P2RA 1AXTL 2NX5D 2ZG2A 2QHRL 1HYRC 3LS5H 2HLAB 2HJKA 1CDYA 5JR1L 5GJSH 4WWKD 4IOFC 4WW2F 1DQDL 3JVGC 5GRWA 1MWAB 3AY4C 5I75B 4MA1C 1CF8L 3WS6A 1ZSDA 3L3JB 3SE9L 1OTUC 1U9KA 4OCYL 2WWMD 4LRIA 3TT3H 4OLEA 1DBJH 3B5TA 4IDJL 1I9RH 5EU6A 1S7XA 3VFMA 4S0TD 1IGCH 4WO4A 5E6ZA 1JNJA 3GSNL 3L7EA 1A3LH 1R0AH 1MCEA 4OSUH 4I0PD 3HZKB 4N1HB 4X9HA 12E8L 2NPLX 3KPSA 4NN7B 2DLFH 3EJZD 4OCNC 3CMOL 5DJCA 1TNMA 4LCWB 3CDCA 4JDZB 1JWMB 3ZDYF 1FJ1B 1PBYA 4S1SH 2VDQL 5KVDH 5CJQL 3CDGA 4LSPH 2GT9A 5EO9A 3BH8A 4JFHD 1TZIB 1HILB 2P43B 3RVVD 3ORJA 4MAUH 1HHHA 5JHLH 3IU4L 3VGBA 2IMNA 4QF1B 1WCBB 4HK3N 1JN6B 2DKSA 3MOBH 4LDEB 5TE7L 1I75A 4LL9A 1HKLH 3NACL 5DSCB 4BUHA 1NL0L 5JXEC 3QFJE 1FNEB 5ITBL 3GBNH 3EJJX 3L95B 5E8NB 1I3GL 4M4RA 4QHUB 4DOHB 1IQWH 2Z8WC 1MLBA 4AMKL 5HHMD 4HBQA 2AKRA 4M7JH 1EEQA 2XQBL 4HKZA 5GGVY 5BVPH 1UYWH 3HG1D 1ZWIB 4WWKC 4U0RC 4NZRH 5E0QA 2AV1A 3SBWC 1Q0XL 2VE6B 2A9MH 4MJ4A 1K6QH 1WGOA 2F54D 3ARVA 4NM8H 4UV4H 3TYFA 4IJ3B 3P0YL 3NCJH 4NKMB 2WWMC 1FE8H 2FNBA 3MCG1 4ZAKD 3G9AB 1X7QB 5DD3L 1FZJB 4UINL 1SM3L 2NYYD 5F7FA 1ZLWH 4GUPB 4JGJA 1UM4H 5C0JB 1XZ0B 1T6VN 2BFVH 4XC3L 1RFDH 2FO4B 3LZFH 1C7SA 4JN1H 1MCCA 3Q1SL 4PJGB 5E8EB 4JY6A 4LEXL 3IKKA 4I0PC 1FL3B 5K9QG 3DVIA 1BGXL 1T21B 1A7QL 3EJZC 5JW3L 1GIGL 3C6SB 3KWWA 1EERB 4IRZL 2BCKB 1ZEAL 1T5WA 2ZUQC 1KB5H 3ARFA 2D7MA 4C58B 3L3HA 4KHTH 4PPTA 4XNXL 5E2TH 4DKEH 4J3TA 2JJVA 1YJDC 4LCCB 5GIRB 1QFWH 2OM5A 2VXSH 1NAKL 4FQXB 4BSVB 3MRMB 3RVVC 4EN3B 4XB8A 3GMLA 4CMHB 3VWJB 2WANA 5FEBA 3MNWA 4PRHA 4ZPTB 3UYOD 4PJXB 3OJVC 4PP1D 5F3BA 1EAPA 2IBGA 1MCPH 1WZMA 4APQB 2HKFH 2VLJB 3MV9B 5SWZD 1MPAL 4XCYB 3MRIA 1WEJH 4JAMA 5JPMB 1T0MB 4YJZL 2K1MA 2IMMA 4ZOEA 4ODVH 4KK6D 1YZZA 5BMFL 4WNQB 5I76B 1G6RA 2E6PA 3GGWB 3RA7H 2VABB 5D6DC 1U8IA 3IJYB 4GAFB 4X8XA 4YHIA 3PQYD 4CVWA 1QACA 2XZQH 5C70A 3IFNH 3VXQB 4D2NA 5L2KA 5F6IB 4D9LL 2Q20A 1INEH 4ZAKC 3OGOE 3TFKD 3QH3B 2JB5H 5T1KB 3TBTA 1OF2A 43CAB 3FFCE 2C4FT 4GKOA 2NYYC 5EU3B 4NQEB 1MLCA 4P57B 1T04B 5TE6H 3SEPA 5K9OA 1F02I 4E9LA 2K7PA 3MRJB 4P49A 4JZNA 4E5XB 1UCBH 1T4KA 5KTEH 3DJ9A 5D2NB 5I8KL 1XGRB 3OR7A 4DK3A 1FNFA 5T5FL 3C2SA 2BNRA 1M7DB 3FO2B 4Z95L 4NC1C 4M62L 3R0NA 3V52H 3P11L 1AKJA 3F7YA 1CFQA 3GMOA 3REWB 3T0WA 4Q2ZA 4DUXA 5I2IA 1A5FL 4YE4L 1CQYA 1Y0LA 1MJ7H 3D9AL 4PP1C 3UMTA 1R3KB 4NUGL 5I8OL 5HY9B 3RI5K 3QFJB 3SO3C 1A1OB 4KK6C 4YZFF 1C5BL 4KKNA 5GISH 4J6RH 5FHAH 1R5VB 3SJVA 3KPPA 4QRPD 3DROA 4ZTOL 1SEQH 1T20A 4Y0GA 4Y5VA 1Q9LA 1T3FB 3WLBB 4XZUA 5TFSH 2VITB 2PO6D 3ZMRA 4KGJA 4MJ6B 3MCKB 3BW9B 3TFKC 4UDTA 3KHOA 3U48A 4R4FH 1NC4B 1LO4L 5E6ID 4PTUB 5EIVA 2FEEI 3UYRH 5ITFB 1FNGB 3QG6A 4IEFB 1JWSA 4JFPA 1KOAA 3F58H 3L3DB 3JTTA 1H3WM 4WRLA 1CVSC 4P3CL 5IMMA 3PF2A 1FGNL 3LRSB 3UTSD 5DGQA 2CKNA 1G9NH 2YOCA 2Q6WA 4QHNA 4DWHA 4AG4L 1OOAA 2G9HA 2VLLB 1FSKC 1MJ8L 1Z3GL 4GAYA 4CVZA 2JJUA 2GHWB 4YDJB 3QEUA 5D93C 1MAJA 1KIQA 4O5LH 5F44A 1Q9WB 1M6OB 3QFDA 1L6ZA 2DYPA 2H8PA 2WINA 5DK0A 3HR6A 3BO8B 1E28A 1HH9B 3P4NA 4H0IA 5KG9A 2DJ4A 4HUWA 4R7DA 4KI1A 1VEMA 25C8L 2B20A 2HTKD 4M8QA 1CDUA 4ZSOA 3R4DA 4LGRB 5KS9A 4HUUA 1D7FA 1TENA 2JK5A 3EFDH 4HXBL 3H9HA 5MEPA 4OZHA 3HC3H 1T89A 3O6MH 3BN3B 3ZO0A 4LVHC 2R0ZL 2XV6B 5GS0D 1FFOB 2PO6C 5F72S 4MJ5A 5DA0B 2FCBA 4GSDL 3IDNB 1J1OH 2FJHA 4XCEB 3VD4A 4OCSH 4I5BB 2N56A 1GZQB 3VXMD 3KJ4C 3WNKA 2QL1A 4XXDA 2IADA 1IGFH 5E6IC 4KROD 1KT2A 3FFCB 4JRYD 4XP4L 2XKNA 1S7UA 3D25A 2VKXA 3E3QC 3FMGH 2OL3H 4H88H 1QR1A 3TH4T 3VXUB 4I48A 3LQAH 4GKNB 1F8TH 2QJDA 3BMWA 1HH6A 3DECA 4X7SL 5MHSE 4AEIH 5CILL 2F19H 2FX9L 1BJMA 3IXTB 3VXRE 5CBAB 3L3GB 4GRWF 3UTPE 4HT1L 3X3FL 4LDOB 4JO3H 3WE6B 4U6XA 2R1XB 1MCSA 2OCFD 4XC1H 3VRIA 5E8OA 3LKSA 1MOEA 4G6FB 4EI5A 3WUWA 4H1LB 5HPMA 2J6EA 3RGVD 4OGZA 3NAAL 4PRIA 1OAKH 5DJAB 4LSVL 1BX2B 6FABH 1CDCA 2ADJB 1HN1A 5I19L 2HTKC 4RISH 4AENA 2YSSA 4HIXH 2CXGA 1TETH 1BJ1J 3QUXD 1EMTL 4XWGH 3V6OE 4DUVA 4ZTPL 4L8SC 3ESUF 1H15A 5E7BA 4WHTA 1GYAA 3GB7A 3CLEH 7FABH 1YEEL 3DNKA 5GS0C 2CXKA 4P4KB 4LLQB 5IMOB 2E3VA 1VEOA 4WFFD 1U3HA 4HMEA 4YHMH 1Y18B 3WEXB 4X99A 4KJYB 3MA9H 5E9DD 5D1XC 5EBWA 5AAMA 4Z6AT 1EEZB 5JW5A 4KROC 1WBYB 2WUBL 1DQJA 3GSRA 5J9PA 1RIHL 1WV7T 4TOYL 1UWXK 4X9GA 4A2MA 1HYSC 3TCLA 3BQUD 2CRMA 1KJ3H 2H32A 5C92A 3QDAA 32C2A 3QEQD 1RK0B 2HVKA 4BK4A 3CPLA 3X14A 4LPTA 1NGZA 1KCVH 3DETD 5DFWH 4Y19A 4HH9B 2APBA 4TPRL 3HNSH 3WD5H 5HDQH 1P9MC 2CLVA 3HPLA 1DDHA 1KJMB 3WFDL 4M43H 4QOKE 4FG6C 5F9OH 4JHBA 1LE5A 3I6LD 3RGVC 5ALBL 3GK8L 1NGXA 4JGMA 3MJ8B 3IU3A 5JUEL 5KVGL 4ISVB 4PJ5B 4XPAH 4N0YH 4K94H 1XF5A 1ACZA 3NCBB 2EDLA 3QUXC 1U2HA 2EE2A 5DUBB 2B0SH 5FUOH 3VRLF 1ONQB 4QRQB 4TSCH 1ADQA 3D39A 1DQTA 4Y4KA 2C3GA 3UTQB 4D9RD 2WQ8A 4JM4H 4U6HA 1OM3H 4EQ2A 3QDMB 5D5MB 4DGVH 4I8DA 3TZVB 3ZTNL 4F7CA 1PDKA 1W0WA 4KAQL 1DBBH 4XNUL 3AXLA 2AJ3A 3RL1B 2V5RA 5LCVH 3BQUC 3N1FC 3QJHB 3BGFC 4Q9RH 1ZVSB 3RY6C 4BZYA 2G60L 1GC1C 3M8OH 4N1EA 4WWID 1CICC 4KKAC 1JE6A 2R39A 3TA3B 3SGDH 3DETC 4YDKL 4BQ9A 2X5PA 3ZKMD 4XGZA 5C0CA 4U4BA 1FC2D 3BEVA 3F7QA 4P5TB 2ITCB 3QIWB 1NCTA 5T5NF 2EDYA 5TGBA 4G5ZH 4KI5D 4ZFFA 3FT3A 2GYSA 2WUCL 3SDDA 1F5WA 2ZOKA 1GHFL 2CDFA 4V2BA 1JGLL 4PY8I 4MWFB 3RWHB 3E6FA 4YXLL 3NABL 4WGVB 4JVPA 1UCTA 5B38G 3MBXH 3ABZA 5HGBA 1DZBA 3DGGA 4NC2B 5TE4H 4AH2B 5IW3A 3DV4A 1F4XH 1KUMA 1OAXH 2EDNA 3WO3B 2PXYA 1UH3A 3S3PA 3TP4A 2FIKA 4GS7B 3GSXA 2X4NB 2CK2A 1UM6H 4GW5B 1KCLA 3GKZA 4K3DL 2XT1B 2ARJQ 1V3JA 4PJ9D 4UOW1 1UT9A 4XAWH 5E7FA 3A0OA 3GIVB 4LIQH 3G5ZB 3HCVA 2AQ2A 5C07E 3X3GH 4F58H 4HJGA 1ZGLP 3DX7B 4AT6A 4GLRI 5D1ZB 3QHZH 1UZ8A 1IAIH 1ND0B 1R3JA 1NCBL 3CC5A 2AJXL 1DQML 3MLUL 1YUHA 1YMME 3HNTH 2FZ3B 3LKQA 1WBZA 2EDOA 2DQDH 2I60H 4R3SA 4OIBA 2XPGB 4KI5C 4F57H 1M71A 1ZT4A 2X7LB 3BDYH 1CLYH 1MJJB 4QOKB 1I1AD 5EIIB 2E5EA 5FYKU 3KS0J 3KPMB 5DMIH 3FQUA 1M7IB 4I4WA 3DXAA 4NNYA 2EC9U 3O3EB 8CGTA 5GGTL 2UWEB 3BP7A 1CL7I 2JIXB 4PGDA 1QLEL 2VXVL 1VPOL 2Z93A 3P0GB 2D03L 2CGRL 2WMPA 1R24B 2NNAB 1QSVA 2ZSWA 4JFFB 4HBCH 4GRWE 2AVGA 1EHXA 3BPOB 3ELAT 1QRNE 3FQXA 5F96L 3UO1H 3CUPB 3ULUL <