3WKMH

The periplasmic pdz tandem fragment of the rsep homologue from aquifex aeolicus in complex with the fab fragment
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
222
structure length
216
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYLHWVKQRPEHGLEWIGRIDPANGNAKYDPKFQDKATITADTSSNTAYLQLNSLTSEDTAVYYCSNRQLGLRGYYYAMDYWGQGTSVSVSSAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative zinc metalloprotease aq_1964
publication title A Structure-Based Model of Substrate Discrimination by a Noncanonical PDZ Tandem in the Intramembrane-Cleaving Protease RseP
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 46
structure length 216
sequence length 222
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wkmH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wkmH02
4E41E 4Y16C 3GO1H 3CX2A 3EYQC 1X5LA 4XP4L 4XBPB 2VLRB 4XBPA 2VLRA 2ZUXA 2NX5E 3CMGA 4HS8H 2F74B 5E8DH 2F74A 2PYFB 2PYFA 4KKLC 1AXTH 1BD2A 3LHPL 3LD8C 1TQCB 4KKBD 4Z7NF 4Y4FC 3S3JA 1DBJL 5KJRH 4JM2C 4A6YB 2WMPA 1F13A 4KRPD 4A6YA 1MFAH 2XZZA 3DMMC 3DHJA 2W9DL 5E00B 5E00A 1UKSA 2FL5A 4JJHA 3UXFA 4JRWA 2CIKB 4NP4H 1P5VA 3CU1A 4BFBD 1EEQA 3MXVL 3UEZA 4WUUB 2AV7B 4HPYL 2AV7A 4XNZC 5D1QB 4S1SL 4ZO8A 2X4RB 2X4RA 3A6CL 1KUMA 4Z18A 2KPNA 1R3HB 1VENA 3HLAB 4HC1H 3HLAA 4PJHE 3FQRB 3FQRA 2CKBB 4DVRL 4CMHB 1QSFB 3DHMA 4L1HA 2D7MA 5EIQA 2VLKA 3S8WA 3WFBL 3RPIB 2JIXB 3U4EA 1AXSB 3VRLE 1I7ZB 1I7ZA 2GITB 5KSAC 2GITA 2K3TA 5IEHB 5IEHA 1L4IA 1AD9B 3WJJA 1AD9A 2OR7A 1U0QA 2GUOA 2XTJB 4OM1H 5A2IH 2O5YL 3SCMB 3SCMA 4HBQA 1I1AB 3ZE2F 4F37F 1I1AA 1ZSDB 1OP9A 1ZSDA 2DI7A 4G8GE 4QF1B 4XCYB 4XCYA 2H32B 4FFVD 2H32A 5JQ6H 2KL6A 4JFZL 3MREB 1BZQK 3MREA 3LMJL 3FN0H 3K46A 5GS0C 4OCXH 2R0ZL 4YDIH 1X3DA 2HKHL 2HKFL 3ZT6A 3BEVB 5ADPH 4HWBH 5CSZA 3C6LB 4POZD 3C6LA 4U7SA 1U3ZA 1ZANL 2MKLC 1TQCC 3DV6B 1JZ5A 3DV6A 2V5SA 4JCLA 3MO1B 4QXGH 3MO1A 3CSBA 2EYTB 2ZCKL 4LL9A 4X9FA 4LLMB 2EYTA 2QHLA 3SGDH 4LLMA 5L0QB 1X5IA 1IC7L 3T3PF 1UM5H 1JRHI 3SKJL 4FQ2H 4NZRH 1HHKA 3QO0A 4JPKL 4DTGH 3PXHA 4ZNCD 1OB1B 2WWMD 2YUWA 5E08H 1OB1A 5DJDA 4V1DB 4V1DA 5ANMB 2W91A 3SDXF 5ANMA 1OVZA 3MLUL 3T1WA 2DQCL 3MROA 4KROD 3KDMB 4Z95L 2NMSA 1HE7A 2IFFL 5D1QC 3U6RB 4KUCD 3L6FB 1ZOXA 3L6FA 2BRQA 3C8DA 4XP1L 4WO4B 2EDFA 4WO4A 2W59A 5F9AC 5E2TH 2AJSH 3ALWA 5IB5B 5J0BA 3VFRA 5IB5A 5C07B 3CVHB 2EYRA 3CVHA 1BEYL 1CVSC 4I5BB 4FZEH 1VGKB 4I5BA 4CMHC 4ODVL 1B6UA 3TCXA 1BBDL 4JGMA 1U91B 2UVEA 3NFSL 5FYLH 1U91A 5MENE 2X4SB 3IDJA 2X4SA 5C09D 2CRZA 4KC3B 4ORZC 1UB6B 4KVCL 1S9XB 5EC2B 5JW3H 2WV3A 1S9XA 5EC2A 4D0BB 4QT5B 1EHLL 1AIFB 1AIFA 4FQ1L 3WJJC 2P46B 3CZJA 3EFFB 4MA7L 2XTJC 1O7VA 3EFFA 2J1KA 4Y8AA 1JGLL 1U8NB 4Y7MA 3SCMC 4JFPB 5I76B 1U8NA 2IQ9H 5I76A 4JFPA 1UZ8B 1TETH 1I1AC 5ICXB 5ICXA 3OMZA 5IESH 4O02L 1QSEA 3E2HB 3ZYIA 4HIHB 4JM4L 3VI3F 2X42A 1OD9A 5T3XE 5IBUG 5F7NC 2VR4A 3BWUC 4HUWA 4ZFZB 2NY4D 4U2ZA 4ZFZA 2HTKC 5F3BB 1IGIH 1MCRA 4C4KT 3TO4D 5F3BA 4XC1H 3UZEA 1MI5B 1MI5A 5IW3A 1HWHB 2ESVB 2ESVA 4DGIL 2W0FB 2W0FA 3C6LC 5I16A 2JKXA 1F45A 2P43B 1M4KA 3IFLH 3T2PA 5HPOA 3MLRH 5IVXF 4XVJH 5GSRB 5HGDA 5L6YH 1E6OL 5GSRA 5T1LB 1N64H 3HI5L 3KYKH 3V6FB 5T1LA 5F6HJ 3UC0H 2ICES 3V6FA 5CEZL 5DS8B 5D7LE 5DS8A 4OLYL 4LQFH 1NCCH 2VLJE 5FUZH 3K8KA 4OCRL 5GHWH 5L0QC 2VISB 2VISA 3GSNL 5LJYH 3I9GL 3ULSB 3ULSA 1B2WL 1MCNA 1XGYH 3FQTB 5E6ID 3FQTA 3X11A 3X11B 3UTSB 5A3ID 3UTSA 3V8OA 1IRAY 4TUJB 3L3DB 4TUJA 3L3DA 1KJVB 2ICCA 1TZHB 1OAKH 1TZHA 1CL7I 4U6HB 5TDOA 4U6HA 5IBTH 3SKMB 1G9ML 3SKMA 2FX8H 4JAMB 3DGCR 4JAMA 1Q9WB 4MXQD 5D2LE 3NZHH 3CFBA 1YQVH 4ZOBA 4AIZB 4WO4C 5GJTL 4AIZA 2VR5A 2GAZB 1CU4H 2GAZA 3LPFA 2H3NB 3PHSA 4HGWB 1YY8A 2H3NA 1U3YA 3RAJL 4ZSOE 2DOCA 4XTRD 4QHKJ 1M1SA 2NXZD 2YN3A 5B3NA 4YPJA 2P1YA 3S6CA 4X4ZA 1OARH 3PGCB 3D0LB 3PGCA 5FDWA 3OKNB 1FNLA 4XPGL 3OKNA 1J8HD 4GS7B 4BFEA 2F58L 3EJZD 5JTWA 4MLSA 3MOAH 3KLHD 4H25B 1QLEH 5E2VL 2ZUTA 1V5JA 1A7PH 2AW2A 3CX5K 5CUSL 2OXGA 5GGTH 1YJDC 4W4OA 4PRIB 5CAYB 5C0FB 5C0FA 1RK0A 4XI5C 3GBNH 4P9HC 5I8EB 2UWEB 5I8EA 3D9AH 2UWEA 3WDHA 4IOFD 4QXUL 1V7ML 1XF1A 3MLYL 4TPRL 1DVFD 4PS4H 1CI5A 4RZCB 1GSMA 4RZCA 1BP3B 3H0TB 5CP3A 3H0TA 5D72L 1IKFL 2IH3B 3D39E 3GZKA 3FO2B 1C1EL 3QULB 3FO2A 2O93L 5JR1L 1EAPB 1EAPA 1M7IA 2CMRL 3L3JB 5IMOB 3L3JA 5IMOA 1JZ6A 2D7TH 3WNLA 1WCQA 4XNYH 3TYGH 5GGSY 1WGOA 4XP4H 1ZGLP 4V2BA 4ZOAA 2PW2A 3ZDZE 4B0MM 1EA9C 3G04B 5CS7A 3G04A 2F54D 5DMKA 1GGIL 3KR3H 3WKNA 3CC5A 3LHPH 4XB8A 5DQDL 4WGVB 15C8L 3OAUL 2Z35B 2Z35A 5TH2B 2RHEA 5B3JE 5TH2A 3ABZA 4KU1A 1DBJH 3M45A 5CINL 6FABL 2GKIA 1EJ6A 2I9TB 1UA6L 2ED8A 5DFWH 2I9TA 1M6OB 1M6OA 5GZOD 2W9DH 1QEWB 1NEZG 1QEWA 2XZQL 1YN6A 3CUPB 3EW3B 1EHXA 3CUPA 1KIRB 4MNQD 3VFVB 4BUHA 1KIRA 4M48H 5KSVB 1FL6A 5KSVA 3V8CA 3O0RL 3W0WE 1CLOL 4OGYL 3MXVH 5FYLD 2V17H 5C2UB 4HPYH 3F5WB 4QRPE 3F5WA 4QRTB 4S1SH 5FCSH 5ICYA 4QRTA 2NXYD 4S0SD 3HRPA 3LB6C 3A6CH 5LKNA 5ISZE 2A77L 4GS7C 5JHDD 4WFHD 3ZE2E 3BN9D 3O3BB 3I75B 3O3BA 2R2EB 3I75A 2R2EA 4Y0GA 4HLZG 4W4OC 3K1DA 5IW6B 3RUGB 4D9QE 1AC0A 5IW6A 3RUGA 2BHUA 3WFBH 1WV7T 1T2QH 2CLZB 2CLZA 5I17B 5KVGL 2CGRH 5I17A 3SJVE 1U42A 3BD3A 1IAIM 4N9OB 2AI0L 4AQ1B 5CJOL 3UCRA 5CKGA 3S96B 3WO4B 3S96A 1T1WA 3HFML 4U1JB 4U1JA 5JW4R 2O5YH 4P59L 2FIRT 1HINL 4JGJA 1OP3K 3ULVL 3MOQA 3L3GB 4LBEB 3L3GA 4LBEA 4YNYB 4PRPD 4YNYA 4XB7A 3UMTA 4JFZH 1JYNA 1NANI 3PXJA 2J3SA 3M07A 4NC0B 4P2QD 5F7KC 5L2JB 1KLFA 2R0ZH 1IC4L 1HDMA 5HY9B 3V4UL 5HY9A 4YDLB 2HKHH 2HKFH 1FRGL 3PP4L 4NQTA 4W6XB 1ZANH 3IJSB 3HMXL 2J8UE 2IJ0C 1KCUL 2GW5A 4ONHB 4NWTL 5FM4A 4ONHA 2LAAA 2ZCKH 1XFPA 3G6JF 1A6UH 4XHJD 2FO4A 3O6FD 4KKBC 4CVUA 4UDTB 1IC7H 4NQCE 1IAII 4JPKH 3T0WA 4LCWD 5K93A 1R3IL 4G6ML 2C3VB 2C3VA 4DKDC 3MLUH 3MV01 2DQCH 3L7FB 4XWOC 1LD9B 4Z95H 5GXBB 1LD9A 2E7LA 2IFFH 4X4MA 5F71A 5MERB 5MERA 5EU7C 3ZE1F 2KUTA 4XP1H 1PY9A 3VRIB 4KROB 4KPHL 3VRIA 4NN6B 1GC1H 2VZ3A 3MNVA 5DK0B 1I85A 2AJ3B 2C7UB 5DK0A 2AJ3A 2C7UA 1OL0A 1A1NB 1BEYH 4RCAA 4ODVH 4UOJA 4NHCL 1XAUA 1BBDH 2BHYA 1BPVA 1YMMD 1TJIL 3NFSH 1VERA 4ZO6A 2DYPD 2BSSB 4KVCH 4N0UE 1P6AB 2JCCF 2P42B 3OX8B 2PYED 3OX8A 3CFKB 5TQ0L 1K9TA 3CFKA 1JWSB 3WO4C 5DXWA 2NY3D 4FQ1H 4QHUB 3BZDA 2R0LL 4QHUA 4JRXB 4JRXA 3MLZL 4MA7H 4PRHE 3HC3L 5B39G 3NACH 1CGSL 4TNVK 4NNYA 4LIQH 5FGSA 3RP1A 4O02H 1I1FB 4PJAB 2OBGA 3K4ZA 5F70A 3Q6GL 4JM4H 4MZ3A 4Z7OF 4KUZL 3Q5TA 4XAKE 5JW4M 4X7DC 3X13B 2R39A 3EYFA 3X13A 1N5YL 1R5IB 1MEXL 4YDLC 1FHGA 3DURB 4GQ9L 3DURA 1BGXL 3R4DA 4J12A 1JHLL 5I1IL 4FTVE 4DGIH 3OKDA 4L9DA 4PTUB 4OKVB 4DVBB 3HI1B 4OKVA 4DVBA 1S7TB 3HI1A 3TO4B 1S7TA 2YA0A 3T2NL 4M9OA 3TO4A 1QHOA 1E6OH 5M94B 5FYKU 3HI5H 3U7AA 5CEZH 2Q7YA 4POZC 4OLYH 3DX7A 4OCRH 5HI5C 3MV7D 1T7WA 3GSNH 3I9GH 4YJZL 2EE6A 1B2WH 3HUJE 3B43A 4KTYA 1IAOB 1T03L 1IAOA 2EYSB 2ICWI 4GSDH 2EYSA 4QEGA 2F8VA 4M7LL 1FG9C 4G6AD 4TTDC 3BIAX 4JLRB 5E6IA 3GEWB 4JLRA 4NT6B 1G9MH 3MCKB 4JKMA 3MCKA 4R4FL 3MRKB 2E7LC 3MRKA 1LK3L 1OGAE 4HZLB 3BRDA 1NUGA 4HZLA 4OLEA 3IDMB 1J0KA 4QCIB 3IDMA 1S9YB 4QCIA 1C16B 1S9YA 1C16A 2FYYB 5GJTH 5D70L 2FYYA 4KROC 1JRHL 1E27B 1FNSL 1E27A 4NN6C 5CKAA 3HNSL 1I85C 3RAJH 1ZGLM 4S11A 4X4XA 4HC1A 1OPGL 3ARGD 5CJQL 5H2BB 5H2BA 3VCLB 2M2DA 3VCLA 4HKZB 3MUZ1 5EDXA 4Z7VB 4HFUL 4Z7VA 5EZOL 5I0DA 3WCYA 4XPGH 2Z8RA 3WLWD 5L2KD 4FXLA 2Z0BA 4X7SL 3GRWL 2BY2A 5KVMC 4ZPVB 1IC5L 2X4OB 3R0NA 4ZPVA 2CO7B 2X4OA 5E2VH 1J8HB 5CUSH 1J8HA 4KWUA 4WJ5B 4WJ5A 2EDEA 1XIWB 4YHOL 1XIWA 4JFED 4HH9B 1MIML 4HH9A 4ZFGH 4WI3A 1QR1A 1V7MH 1JZ7A 3MLYH 2AEPL 1P4LA 4CAGA 3S35H 4L9LB 3AU1B 1TJGL 4UU9A 3AU1A 2JTDA 1DVFA 1U93B 3VRJB 3NZ8A 3MFFB 3VRJA 4OIBA 5HYEA 2LFGA 2C4FU 5EU6D 1C1EH 5JR1H 4YGAB 3VD4A 2CMRH 1TITA 3TO4C 4HWBA 3VFTB 3O3AB 4GXUM 4N90D 3O3AA 5C6PB 5C08D 1S78C 1J86A 1EX0A 4ZS7H 2YD4A 5ITFA 3P9WB 1RHFA 5BMFL 4N5UA 5GZNC 1R3KA 3OR6A 4LSTL 3BE1L 4LGSB 1GGIH 5DQDH 15C8H 2F54B 2F54A 3GHEL 2R29L 5CINH 5IMMB 5HHQA 5IMMA 3TT1L 2VXQL 8CGTA 5A3IC 5LGJB 1UA6H 3L5XH 3FB7B 5J4MA 3FB7A 3KGRA 1RI8A 1LQSR 5EG6C 2XZQH 1L9NA 4M03A 5E8OB 3GUTB 1CDUA 5E8OA 4JVWA 3GUTA 3C87A 4U6VL 2C3XA 3DX8A 3O0RH 1FO0L 4MXQC 4OGYH 4I9WE 1BX2B 4Z9KB 1BX2A 4XPFL 3U83A 4C54A 3KAAA 1CL7L 1IC1A 3OAZK 2P5EE 4XTRC 2W60B 2W60A 3LQZB 3GSUB 4MXWL 4M1DL 1BWWA 1UZ6F 1S9VB 1EEYB 2DAVA 4JQXA 1S9VA 1EEYA 1V7NL 1J88A 1LMKA 3SE3C 3VXNB 2I07B 4U1IB 3VXNA 2I07A 4U1IA 1AI1L 1CYGA 1HH6B 3UZQA 1HH6A 2CLRB 2CLRA 2FWOB 2P8LB 1RJYB 2P8LA 1AGEB 3UTPE 1RJYA 3KLHC 1XIWC 2ADJB 4S1QL 1CGYA 1YNLL 1AKJB 5KVGH 3CFIC 2XQBL 3G5VB 1QRNE 1Q9OB 5CJOH 1Q9OA 1CE6B 1MIEH 1CE6A 2HT4D 3HFMH 2EDNA 4F57L 4L9LC 1PLGH 4P59H 3P9LB 2NY6D 4UNUA 1DVFC 1HINH 1IJ9A 3BJ91 3ULVH 2FNBA 2BNQE 1IGYB 4OUOA 4DK6A 4Q9RH 1IGYA 1HH9A 2IGFL 2DM3A 1T21B 3T77B 1T21A 5CEZD 5EO1B 3T77A 3R06B 5EO1A 2GJ6D 3VFMB 4PRPB 3VFMA 4PRPA 3V4UH 2CQVA 3L9RB 5F9JA 3L9RA 7FABH 4ZFOL 1FRGH 4P2QA 3MRHB 3MRHA 3PP4H 4P2YA 4ZUWB 4ZUWA 1NMAL 2F8OA 1KCUH 2Y23A 3ZE1E 4GKOA 4NWTH 4X6DE 4HLJA 3P0YL 5CEXB 3HE7D 1MFCL 1MCOL 1FE8L 5CEXA 1Y6KR 4ODSL 1RHHB 1RHHA 3GMPB 4ONFH 1MCSA 4NKDB 1LP9B 1VSCA 4NKDA 1LP9A 5I1GL 3IDUA 3FONB 1NCWL 1QFOA 4K3EL 3W9DB 2VSCA 4EOWL 3W9DA 4JM2F 3QHFL 5F9DC 1OY3B 2QBWA 3AS2A 1R3IH 4G6MH 4LMQI 3GFUA 2J4WL 3L3IB 3L3IA 5D7JB 3VXUD 2JCCE 5D7JA 1XGTB 4LCWA 2VDML 1XGTA 3H3KA 3QIBB 3QIBA 4FRWA 4MAUL 4LLWB 4LLWA 1HHGA 4DUWA 1UH2A 4KPHH 5JDJA 4YBHA 4JQXC 4R7NB 4QGYA 4R7NA 2FIKB 2FIKA 5MI0B 4OGXL 1R3LB 4FABL 4LU5L 1R3LA 4BYHA 4JREB 4NHCH 4Z0XB 2H6PB 2PXYB 1JV5A 4F7CA 2H6PA 1TJIH 2ZNWA 4M00A 5GGTA 3Q1SL 1T1YB 1LVEA 1T1YA 2VWEE 1A3RL 2WWKO 1KXVC 1YMMB 1K4DA 3IFNL 1YMMA 5TQ0H 4U6XA 4RAHA 2R0LH 1T89A 4S1DD 2AJUL 2DYPA 2NYYD 3MLZH 5EIIB 1MCLA 5EIIA 2PYEB 2PYEA 1BF8A 1CGSH 4GUPB 2NY3B 2WAHA 4GUPA 3DUUA 4W81A 1KPUB 2W92A 1KPUA 1CXEA 5F8QC 4GXVL 4EI5B 4KUZH 4EI5A 2V5YA 5F96L 2I60L 1DEEB 1DEEA 4EN3D 4FQHB 1N5YH 2XKSA 4FQHA 1MEXH 4GQ9H 2RGSA 1JHLH 3BKCL 5HSFA 5I1IH 4HGMA 1MHPL 4RGOL 1ZLSH 3EOAB 3EOAA 3T2NH 4XVTL 4KI5E 4GW4B 2HG5A 5IJKA 1RUAL 4GW4A 4F33B 4F33A 3QCUL 3ZT7A 2VDLH 2A6JA 5GS2D 1HNGA 1NCBL 4U3CA 2VKXA 4JR9L 3PWPB 4YXLL 3PWPA 2Q8AL 1TZGL 2X5PA 3HKFA 1J7VR 3E8UL 4LCUA 5FAAA 2A2QT 1T03H 3VE0B 3VE0A 4XHJC 3GMLB 1EIBA 3EOTL 3GMLA 2BHZA 4M7LH 3MV7B 3MV7A 4MQ7A 5DJ2B 5DJ2A 2ZOKB 1CT8B 2ZOKA 3THML 1CT8A 4GT7A 1OWWA 2UYLB 2UYLA 3BRFA 2IBZY 4R4FH 5D7JC 4JB9H 3T0ED 3JTTB 1LK3H 5E2JA 2I5YL 5FHAL 3QIBC 1CD0A 3TBTB 4YHKL 3TBTA 5D70H 3VFNB 4YHZL 3VFNA 1JRHH 5HHNB 1FNSH 5HHNA 5LBSH 2IPUG 1ZKAA 4LLQA 5MI0C 4TN9A 1OPGH 3O2WL 5CJQH 4JREC 1JGDB 4JZNB 1JGDA 4NQVB 4JZNA 2PXYC 4HFUH 3OJVC 2P49B 2FGZA 4M7ZB 5EZOH 3ARGB 4S0TD 3ARGA 1BAFL 4G43A 5SWQB 4UIKL 3VGDA 3WNMA 2R2CA 5CIPH 3F7YB 4BFIB 2AEWA 3EUUA 3F7YA 3GRWH 1QQDB 1BREA 1D6VL 4BFIA 1QQDA 5J12B 1IC5H 3N1MC 4U4BA 2MPAH 3C2SA 3ULVD 1WICA 3H6JA 4YHOH 4IHOA 2NY3C 2AKRB 1MIMH 2AKRA 4Z78B 4Z78A 4QYOB 4QYOA 3FJTA 4QRRE 4JFEA 4EI5C 1HSAA 2C4XA 1PJ9A 1TJGH 5B38G 5E2WH 1I7UB 1TCRA 1I7UA 1BZ9A 3WEXB 4PJ8D 3WEXA 4LNVA 1UM6L 4U1MB 2Y6SC 4JRYE 4EVNB 3DNKA 4EVNA 1JJUA 3TFKD 1KN2L 5IJKC 5EU6B 5CFHA 4TULL 4HKXB 5EU6A 3S4SB 4Z7QE 3TBVA 3QR2A 3S4SA 5HXMA 4KJQD 2MFNA 2ID5A 2B0SL 4KK8C 1CZ8L 4QY8B 1P2CA 3NMEA 4QY8A 5C08A 3WIHL 3BE1H 2JJWA 2DQHL 2IADB 4IOIA 2IADA 3C8KB 3ZTNH 4NQDE 1KJMB 1KJMA 1T0MB 3UBXG 1T0MA 3GHEH 2R29H 4L3EE 5D6DC 3TT1H 5GGQL 2VXQH 4HS6B 4HS6A 3O6LL 4OF0A 1HHHB 3MYZA 5M95B 1F3RB 4JKKA 1S5IL 4PJ5E 1NBYB 1NBYA 1R0AH 4LSPH 1CGUA 3O11A 1UENA 1NEUA 3C2AL 3WUWB 1FNHA 1U41A 3WUWA 1J0ZA 1FO0H 5HHVL 1U8MB 3K81A 3I2CL 1U8MA 3AAZB 2EXYD 1MRDL 1U8OB 1CWVA 3AAZA 5J13B 1U8OA 2BY3A 4XPFH 2GTZB 1P9MC 1KELL 2GTZA 3UTTE 1CL7H 4M62L 2FR4B 4QHMB 2FR4A 4QHMA 2D7NA 1SJHB 1SJHA 1NCAL 4M7ZC 1EJOL 3TVMD 3ARGC 4MXWH 4M1DH 2GK2A 1IKNA 1ZE3C 1GHFL 5J12C 1V7NH 1CFQA 1AI1H 3WLWC 1WT5A 1KFAL 5I1KL 3ETBF 3QRGL 4S1QH 2XA8L 3LQMA 1YNLH 1CGTA 4OI8A 5GGRB 2XQBH 5GGRA 2ITDB 2ITDA 2OJZL 5BRZE 4R7DB 5DHVB 1VFMA 4K7PY 4OLZL 1E28B 4R7DA 5DHVA 5I75B 1E28A 2GK0B 3D87B 3JWDL 4F57H 2GK0A 1BWMA 3BJLA 2V6HA 4NKOA 4JJ5B 4JJ5A 1KTRL 4EXPX 1G1YA 2Z93B 2Z93A 1UXSA 4NO2B 5I19L 2IGFH 3RWJB 3I6KB 3RWJA 2NY6B 3I6KA 3QQ3B 3QQ3A 1JNJA 1VDGA 5AG8A 3CDCA 5J6GB 1RIVL 4DKEL 3NIFE 3QWRD 3MNZB 3WJLA 2CJUH 3KNBB 3MNZA 1ZT1A 3KNBA 5CLTA 3TBWB 3TBWA 1J1OL 4JY6A 1MRCL 4WU5B 4YFLF 3WDJA 1FZMB 4WU5A 4Y89A 3OAZH 3GSNB 1NMAH 3GSNA 1FJ1B 3V7MA 1FJ1A 2ADFL 3U30B 1BQHB 1BQHA 1YEJL 4OLVH 2AXJA 5DD0L 5FKAA 5L88L 4WDIB 3U0PA 1I9EA 1XR8B 4WDIA 3GKWL 4KVNL 1XR8A 3P0YH 1FIGH 1I3RB 3TJHD 1I3RA 1MCOH 1G7QB 1FE8H 1G7QA 4ODSH 4AM0B 4RAVA 2DKSA 4NKMB 4NKMA 5I1GH 1TNNA 3ZL4L 1NCWH 1J8KA 5IVNA 1KPRB 2IANB 4EOWH 1CE1L 2IANA 4N8VG 3QHFH 5ENWB 4JKLA 5BS0E 5ENWA 1LO5B 2ARJQ 2J4WH 1LO5A 4PJ7B 4PJ7A 2HT3C 5JMOC 1YA5A 5J13C 1ZS8B 4OBSA 3UP1A 1ZS8A 4ZTPL 3TIEB 4U33A 2VDMH 2A9ML 1H3GA 3QZWB 4MAUH 4DGYL 3QZWA 3IGAB 1A14H 3OTTA 3L5JA 3VXUA 1IKNC 2EDQA 3B9VA 4LSUL 4OGXH 4FABH 3QDHA 1IGFL 3ZKSD 1WT5C 2ZZUT 3NFNA 4IRJD 3QXAA 1X7QB 1VFAB 1SY6H 3Q1SH 1VFAA 1SJEB 4ZXBD 1SJEA 1WFTA 2CUMA 2WQRA 3FB8A 4HIXL 4N0RA 2XA3A 4Q58C 4ODTH 3GMRB 3IFNH 3GMRA 5EUOB 5EUOA 1CFVL 3MOBH 5I75C 1JF5A 2UWEF 5HTSA 3QNYA 1XGRB 3BAEL 1XGRA 1X4ZA 4JE4B 3RTQD 5HDBF 2BCKB 2VLRE 4H88L 4HKBB 1T22B 3D1MC 2HT4C 4L4VD 1T22A 2IPUK 3UDWC 1X4YA 4AJ0A 2P8MA 1BM3L 1BD2E 5T33L 1VKXA 4K55A 2NY6C 3PWJB 4X7EC 2N56A 5CEYB 1W8NA 5CEYA 4GXVH 2VXTL 4TQEL 1ZHKB 1QLRB 4J3SA 1ZHKA 3RJDA 1XGQB 5F96H 2I60H 4OIIH 1PY4A 3WJLC 2WANA 5FYKL 3ZE0F 4NO3B 1SJXA 4FFWD 3ARQA 3SQOH 1B3JA 4NO3A 1Q1JL 3BKCH 1U6AL 2GSIB 4Q0XL 4RGOH 2CDGB 2GSIA 4EN3B 4EN3A 3U4BH 2EH8L 1WAAA 4XVTH 3EDEA 4G7YL 3ZYOA 1RUAH 3U30C 5ADOL 5FFLA 1M05B 3KYAA 3QCUH 1M05A 2APFA 1NCBH 3LS4L 2XIDA 3K74B 4JR9H 3DVFA 4YLQT 3HZMB 3HZMA 1G9MC 2Q8AH 4TUOB 4TUOA 1TZGH 3E8UH 2Q86B 4P5KB 2A6KB 2IQAB 3EOTH 2A6KA 2IQAA 3HS0B 4XBEH 3HS0A 3TNMB 1KLGB 3TNMA 1KLGA 3RFZC 3THMH 1U2CA 1CXLA 2ZSVA 4LVOB 1LWRA 4PGBB 1N0XL 3H9YA 1F4XL 4PGBA 5EZIL 4OM0L 4OCNC 5CZXD 3LAFA 2NW2B 5FHAH 2I5YH 2OYPA 2NW2A 2VLKE 4O9HL 4PJFB 1VADB 4PJFA 1OCWL 1VADA 4YHKH 1FL3B 1G9NL 2H2PD 1CGVA 1FL3A 3KLDA 4YHZH 1PW3A 3T0EB 3T0EA 2I26N 1P7HL 3JXAA 3STLA 4U2YA 4ZODA 3O2WH 4G8FB 1LDPL 2XTJE 1MCPL 1TZIB 1TZIA 4NSKB 4NSKA 3OKMB 3OKMA 3ZYJA 5AYQA 4UIKH 1NAMH 4ZO7A 5AZ2L 5MEPB 3WLBB 5MEPA 3RUGF 1D6VH 1RURL 5F7UA 4CN6A 4WI8A 3QIUB 5DT1L 3QIUA 3Q2CA 4CW1B 3V0WL 2EH7L 4CW1A 3MV8D 2K1MA 2QKIB 4J3XA 4S1DC 4ZO9A 5IIEB 4OCLC 4CU7A 2Y5EA 1N2RB 1TVHB 1N2RA 1TVHA 1FFQA 1UH3A 4F7TB 4F7TA 3D5OF 4XMPL 5DJXB 2AV1B 5DJXA 3KXFD 2AV1A 3TH2T 4PJIE 5E5MB 1UM6H 5E5MA 3LIZL 1P69B 2DTMH 1FFPB 3DX9B 1FFPA 4G8GB 4EN3C 3R0MA 3DX9A 2BRRL 3CSGA 2DTSA 2V9TA 3NOIA 4I1NB 1KN2H 4TULH 1KB9K 5IP4A 4GRWH 4NM8L 4YXKL 4NDMB 2A6IB 4V1DE 3HMXA 5ANME 3S37X 1UKTA 2XN9D 2B0SH 1CZ8H 3F7RA 3WIHH 4Y4HB 4OAWB 2DQHH 3F12A 1IARB 5LXGL 3HR6A 3VMNA 5LWYH 1KCLA 3Q5YA 1NQBA 3DYPA 1KYOJ 1ONQB 1ONQA 5D1XB 4LPYA 1TDQA 2E8YA 5D1XA 5GGQH 4IMKA 4NKQB 4OZ4B 4LVOC 4ODWB 4OZ4A 3O6LH 1EERB 2W9EH 4ODWA 4H1LB 4H1LA 3UPCA 2ZCHL 2NY0B 1S5IH 2F19L 3VD3A 5EB9A 1UM4L 2WQ8A 1CR9L 1D3CA 4WRLA 3C2AH 2OK0L 5M7QA 3W9EB 3T0EC 3W9EA 5JNYB 5JNYA 5HHVH 1QO3B 5F7FA 1QO3A 4MJ2A 2V7NB 3I2CH 4DEPB 2VNCA 2V7NA 1MRDH 4FS0A 1G7MB 4BH8B 4X8XA 1G7MA 2YSSA 4P2OD 4NGHH 1KELH 2D03L 3TJEL 4M62H 1IGML 4OQ1A 1B0GB 1JK8B 4M93B 1B0GA 1JK8A 4KUCF 1BVZA 1FP5A 1NCAH 3LKNB 1QSEE 3LKNA 5CBEB 1X5FA 2D9CA 3GSRB 4M5ZL 4TTGA 1WCBB 3CLEL 4D9LL 5DA0B 1WCBA 3IRZA 4WWKD 1CLYL 1IAKB 3MLXL 1IAKA 1IBGL 2DMKA 3QG7L 4R26L 2G5BB 4NQED 1P5UA 5DGQA 3CU7A 2EECA 1C08B 4K94L 3QIUC 1KFAH 2AEIT 5I1KH 1MI5E 1URLA 4PGZA 5F7EL 3QRGH 2XA8H 3SGEI 3MUY1 1KN4L 4MDIB 2ESVE 1ZA3B 3ULVC 1ZA3A 3UPRB 3UPRA 4M1CD 3L95A 1T4KB 1A6VL 5IBUB 1T4KA 4FFZL 4HWZB 4OZHB 4G3YL 4OZHA 3JWDH 2Z4QB 3MA9L 4PJAF 2Z4QA 3KYNA 3X12B 3X12A 3L3KB 1KB9J 3L3KA 3KPTA 5BVPH 5I19H 4JO4L 4NKIL 5E24E 2DWEB 3TA3B 5KW9L 2DWEA 3UTSE 3TA3A 2OJEB 5I74B 1RIVH 3LN9A 5IBLD 3QHTC 3GSXA 4DKEH 1CXKA 3QDMD 4GAYB 4GAYA 4Y4KB 1N26A 5ABDE 3TFKC 1J1OH 1BQSA 5JW4Q 4H8WL 1MRCH 4KJQC 4Y4HC 4HD9A 3TESA 3QWRA 3WFDL 1G6VK 4YPGB 3C6SA 4YPGA 3F7VB 2ADFH 3F7VA 3TBSB 2WP3T 3TBSA 3WE6A 1YEJH 1ED3B 1ED3A 5DD0H 1G0YR 5L88H 4PG2A 5D1XC 3GKWH 4IMKC 4KVNH 4KKAC 5D7LB 4OGAC 4FZ8L 5TDPB 2E7HA 2VLJB 5TDPA 4OFYA 3WBDA 1Z3GL 1J1PL 2NY0C 1TENA 2B4CL 3ZL4H 4WHDA 1AQKL 1CE1H 4RMWA 1KSRA 2I9LB 2L0DA 2I9LA 2VL5A 1MOEA 3VFOB 3VFOA 4DEPC 3RIAF 5E9DD 4ZTPH 3MRRA 1HWGB 2A9MH 4ENED 4M93C 3DSFH 4DGYH 1OAZL 1WSST 4OFVA 2APBA 4WWID 3KPQB 4F2MB 4F2MA 1NPUA 5D2LB 1YEKL 5HDBE 2EXWC 2N1KA 3SO3B 4Z7VF 4K3HA 2GJZB 5CIPB 3B3IB 5CIPA 3B3IA 5HYIA 1IGFH 3GRWA 5C8JB 2XY1A 5C8JA 3JWNC 2RFXB 1IEHA 1EH9A 4MAYD 3NPSB 2VDPL 3E1F1 4HIXH 3TV3H 3SY0B 4IEFB 2OTUB 5JPMB 3N50A 2OTUA 1DANU 3KPRD 4LHQB 5JPMA 4FFYL 5JXAL 1CFVH 3H3PL 1KG0B 1KG0A 5I1LB 4ZXBB 5I1LA 4ZXBA 4H0GA 3LKSB 1QA9B 4YWGL 3LKSA 1QA9A 2QLVB 2VXVL 5T1DH 4H88H 3K1KC 3WHXB 3WHXA 4FQXD 1OWRM 1F02I 1T80A 1RZKL 3FQUB 3OXSB 3FQUA 3MPCA 1BM3H 3OXSA 4K3DL 3JV5A 3RTQB 5T33H 5TQ2L 3RTQA 3TA3C 1WZ1L 5I74C 2VXTH 3H9ZA 4L4VB 4TQEH 4L4VA 1J0YA 5F7DB 5GIRB 4DUVA 2ICEB 4Y4KC 5F7DA 5GIRA 2ICEA 2SEBB 2SEBA 4PGCB 3UX9B 3MRDB 3MRDA 5FYKH 4MB3A 1LE9B 1IGJA 1LE9A 1BFTA 1MCQA 1Q1JH 1U6AH 3HZKA 3D39B 4NO0D 1T20B 3D39A 4Q0XH 4O51B 1T20A 3U2SA 3OKOB 4O51A 3OKOA 5SV3A 4G7YH 3D69B 3D69A 3TYFA 5ADOH 4FOMA 1EXUB 1EXUA 5F9WB 1NLBH 4PG2C 4OFIA 3LS4H 3QXUA 3C9NA 4UINH 4CADB 3G5XA 1S9WB 1ZHBA 4CADA 5HD8C 3GJEA 1S9WA 2C3HA 3GB7B 5EU7E 3GB7A 1KCRL 5C92A 1NEZB 5TE6L 4MMZC 4XVSL 1XZ0B 4UT6L 1XZ0A 1NBZB 1NBZA 5IB4B 5IB4A 1KPVB 3B9AA 1RY7B 5E8EB 2E5EA 1T7XA 2AS5M 1FO0B 2X44D 1FO0A 3RZWA 1N0XH 5EZIH 4OM0H 2R4RH 4Y5YB 4Y5YA 4HUMB 3RUGE 5C70A 4O9HH 1A47A 1OCWH 1F11A 4LP4A 1G9NH 3RI5K 3MRNA 4JG1L 1I3VA 3ARSA 4OLXL 4RFOL 1I1YB 3CNKA 1I1YA 3PP3K 3SO3C 5KG9B 4C56D 3NFPB 1LDPH 3MV9D 3NFPA 5D5MF 3UAJD 3BHBB 3BHBA 4N1HB 1MCPH 5H94B 5H94A 3NPSC 4F3FB 3VXMD 4QRPB 4F3FA 5IW1B 5FO7B 5IW1A 4PLKD 5FO7A 1RJLB 3RVVC 1RJLA 1G7JB 5EORL 1G7JA 1ZVHA 5AZ2H 2UZYB 2WLYA 4CDHA 2QQLL 1HILA 1RURH 2AXHA 3G5ZB 3BKYL 3G5ZA 1ERNA 5F97E 4ZXBC 4WI6A 3VWKD 5HDQL 4H5SB 5DT1H 2OL3L 4LCCB 3V0WH 2EH7H 2BX5A 1C5CL 3BOVA 3P4OB 3OXRB 3P4OA 4OZIB 3B8SA 3OXRA 3HZVB 4OZIA 4KK6D 3HZVA 2DN7A 3RTQC 3SHSA 2QQNL 1T0PB 3O4LD 3KVQA 1H3VA 2G60L 1MHEA 4JO3H 1MCEA 3B4NA 4XMPH 2APWA 3PJSB 4N1CA 3PJSA 1KJ3L 5C0CD 35C8L 5ALBL 4ZFOB 1C5DA 4ZFOA 1ZVSB 1ZVSA 1DBKL 3K3QA 3MRGB 4KRLB 1CLCA 3MRGA 2MQCA 3KXFA 4NM8H 4YXKH 1PKOA 3FN9A 3X17A 1I8IA 5F9WC 2D7OA 4I18A 1J87A 2XG4A 3P3YA 4AH2A 4ZDHB 4ZDHA 1J18A 4LGPB 2Z8SA 2B1HL 2OMBA 4X4ME 1B4JL 5DSCA 1QOKA 4I13B 4MWFA 4Z7UB 4Z7UA 4BJLA 5LXGH 1JE6A 2XN9A 3QDJD 4MNHB 4MQXD 1F4AA 1BFSA 2Z8VC 1R5VB 1Z6JT 1R5VA 5JOPD 4IS6B 1GOHA 2J8UB 4IS6A 1LP9F 3ZMRA 4YO0B 3BPNB 4YO0A 2CLVB 3QSKB 2CLVA 3RKDC 4Y5YC 1CS6A 2ZCHH 4YUEL 1TLKA 1AY1L 2C9AA 2G75B 1U8KB 1CR9H 5IQ7L 1I7RB 1I7RA 2OK0H 5CZXC 1EK3A 4NBYB 5DTFB 5DTFA 1DQLL 3D0VB 3D0VA 4R8WL 5EU3B 5C09E 4JRXE 3P4MB 3BDXA 2D03H 1NFIB 1NFIA 4J3WA 2ZUYA 3FFCD 3U0TB 1RVFL 3U0TA 1P1ZA 1A6ZA 3VWJD 2NZIA 4P2OB 4M5ZH 4P2OA 5EU5B 3CLEH 4D9LH 3FTGA 5EU5A 3RA7L 1ZAGA 2OLDA 1CLYH 2PTUA 3MLXH 1F4HA 1IBGH 2AXFB 2HA1A 3QG7H 4N9GB 4R26H 4N9GA 1NGXA 2P4AB 4WWKA 3BN3B 4K94H 4OD3L 4LCCC 5F7EH 5HJ3B 5HJ3A 5JIPA 4NQEB 4NQEA 4DKFL 2OCFD 4UB0L 3NCJL 3SDYL 2RQ8A 4N0UB 2FLBT 1A6VH 1MJUL 4FFZH 4GRLB 5FYKD 5I30L 4JHWL 4G3YH 3MA9H 4WHYG 4QOKD 4YE4L 1UJ3B 1BZ7B 1UJ3A 1BZ7A 4DW2L 3MRBB 3IS1X 4Y19B 1ZHNB 5DJZB 4Y19A 5DJZA 4JO4H 4NKIH 1MCIA 4TSAL 2HN7B 2HN7A 4ZUTB 5KW9H 3U46B 4ZUTA 1I8KA 3U46A 2R1WB 3B83A 3KPLB 3KPLA 1N8ZB 1N8ZA 2ZOLB 2ZOLA 4YHPB 2QQKL 1WIUA 4YHPA 3P0GB 1MRFL 1S8DB 3DI3B 3QDMB 4OLWL 4H8WH 3QDMA 3WFDH 4FTVB 4P46D 2NQCA 5EC1B 4LAJH 5EC1A 5C0EA 5HGAB 1BF2A 1YEIL 5HGAA 4EDXA 4NIKB 1VGEL 4LLUA 3B2VL 5LGHL 4O58L 3BPNC 2IG2H 2BVEA 1UWEL 2A9NL 5H37G 4FZ8H 4Z7VE 2EE2A 1IEAB 2B4CH 3RZCD 3RGVD 2DQFB 3D48R 1AQKH 2DQFA 1Q9KB 3HUJB 4J4PA 4JQVA 5CZVL 4KZEL 4YC2B 3JV6A 4JPWL 1G9EA 1NUNB 1U2HA 3QUML 1J8HE 1RZGB 1RZGA 1FNAA 1Z9LA 2BC4B 2BC4A 3FT2B 1N0LA 3FT2A 1CGWA 1U9KA 1OGAB 4LPUA 1OGAA 5DVLA 4P2OC 5E9DB 5E9DA 1YEKH 5IFHL 3PUCA 4NZUH 3T08A 5IB3A 4HK3J 3VDBA 1FVCB 1EUUA 1FVCA 4CGTA 1A6WH 1U3HD 2OX5A 4BH7B 4BH7A 2R1XB 5MEOB 4PUBL 2R1XA 4HX1A 5MEOA 2VDPH 3A67L 4NRYB 3IFOB 4NRYA 3IFOA 2MWCA 3BKJL 4MAYA 3SE9L 4FFYH 2Y07L 3MRMB 5JXAH 1ZT4B 3MRMA 1ZT4A 3H3PH 1MJJB 4KDTC 1MCFA 1MJJA 2DQJL 4GRLC 3RIFK 3SGKA 1A7RL 4P5TB 3KPRB 1UJ3C 3KPRA 4YWGH 4M1CC 1A9EB 1H3WM 1A9EA 2ZNXA 4QNPF 1WWBX 1BVKB 1BVKA 4FMKA 4HT1L 1RZKH 1FLRL 1CXFA 2W07A 4K3DH 5ALCL 3BP4A 5E03A 5IVOA 4WCYL 2J88L 3UTZB 1WZ1H 3UTZA 2IH1B 2IH1A 4PJGB 4GAFB 2F54E 4PJGA 3G08B 4GRWB 4UQ3B 4ZTOL 4YBQD 3DECA 1JGUL 5HBBA 4PTTB 1UVQB 4PTTA 1UVQA 1X5JA 3WIHA 3L1OH 4IRZL 1NCNA 1G1CA 5ECJE 2B2XL 4X0KB 4X0KA 4RFEB 4Z0BL 4JGUA 3M8OL 3MJ6A 4ZAKD 4MNQE 3BIBX 3STZB 3STZA 1JNLL 3BUTA 5TE6H 2V9RA 4JFHD 1K85A 4R4BB 4XVSH 5FYLE 4UT6H 4G6JH 2V2WB 3K8LA 3BD4A 4J4PC 2V2WA 4YC2C 4PJCF 3T65A 3E3QC 2ILLA 4PGEB 4C55A 2VDRL 3GIZL 4IDJL 5JHDE 4WFHE 2MCPL 1P7QD 1MCDA 4PYHA 4AENB 4AENA 1H15B 5EPMB 1H15A 4IIQB 5EPMA 4C57C 3HB3C 4IIQA 3VU2A 4P5MB 4P5MA 2B8OT 1FN4A 3WNOA 3QFDA 4OLXH 2A38A 4RFOH 4ENEC 1Z9SA 1S5HB 1F2XK 5HYSG 1LO3H 3QFJD 1KGCD 4WI2A 4Q9BA 3WKML 4X99B 3OAYK 4X99A 4U1LB 3SKNB 4C56B 3SKNA 1Z2KA 4C56A 5DJCB 3AMKA 5DJCA 5DUBA 4XP6L 2EDTA 5C9JB 2QQLH 4N8PA 5C9JA 3BKYH 3SGKC 4P3WA 4PRPE 4P5TC 5HDQH 1FBIL 1HKFA 2XYCA 2OL3H 1JHKL 1PX3A 4RBPK 4QTHB 2UY6A 4P2QE 5EA0L 4TUKL 2GSGB 2APVA 2GSGA 3VWKA 1S7WB 1S7WA 1WIOA 2QQNH 2VKWA 3TM6A 3M17B 1GGCL 3M17A 1QRNB 1K5NB 4GAJL 3TPUA 2H9GB 5E94A 2H9GA 3RL1B 2A0LC 2R0KL 3RL1A 3JUZA 5JLZB 5JLZA 3J8F7 4RDQG 1KJ3H 3O4LB 4U3XA 35C8H 3O4LA 1SJVA 2R23A 3QA3B 2H8PB 5ALBH 1ITCA 3QA3A 3RWIB 2H8PA 1I3UA 4EUPG 1B6DA 1LP9E 4M5YL 4XGZA 1WWWX 4PBVC 5C0CB 1T66C 5C0CA 3LPWA 3LS5L 2GY5A 2W0PA 1AGCA 5ICZB 3ZHLA 5ICZA 5MP6L 5CBAB 2XWTB 5CBAA 5CMAA 4JZJB 3WN5B 4JZJA 3WN5A 1ZGLA 4LCWE 2B1HH 4BKLB 3HNVL 4KV5F 5CJXC 1W0VB 3DETD 1W0VA 3DIFB 3DIFA 1NAKL 5DJAB 3C5ZB 4K8RD 5DJAA 1JPGA 2EDOA 3QDJB 4M7LT 5EZLA 4WI4A 3QDJA 4AK1A 3GM0A 4YUEH 2NW3B 4PJ9D 1AY1H 2YXFA 4PJ7F 2NW3A 4IIQC 5F7YC 1EO7A 5IQ7H 3NAAL 5DRZB 5DRZA 1JYVA 1YMME 5SWSD 1J5OL 1DQLH 4U1NB 4U1NA 4OCWL 4R8WH 4OJFL 1WBZB 2BSTA 4M8QB 1WBZA 5E2UL 4M8QA 4HUVB 1SQ2N 4HUVA 4KGLA 5DK2B 4JHAL 3AUVA 3O2VL 5DK2A 1CXHA 2PYEE 1RVFH 5F3HB 3BQUD 5F3HA 1A3LL 3RA7H 3OBAA 3QWQB 1CF8L 2Y06L 5HDOA 5CD5D 5JUEL 3VWJB 4B50A 3AMLA 3VWJA 3QEHA 1XEDA 4DZBB 3JWDC 4OD3H 4X6CB 4DZBA 5EUOF 4X6CA 3KYOB 3KYOA 2J8OA 2EEBA 2BVTA 3DXAD 4DKFH 5IROA 1AQDB 2CSPA 4UB0H 1AQDA 2DQIL 3NCJH 4FP8L 2D4FA 3SDYH 1HQRB 4I0PB 1HQRA 1DTUA 3IDYB 5I30H 4JHWH 5HYFA 1JZ3A 4JO2L 4UTAL 3EOYG 5E99L 3UYOD 4YE4H 4DW2H 3OKEB 3OKEA 5IHBA 4M6AA 4P3DA 4QOKA 4TSAH 2QADB 1DLFL 5FEBA 2K7PA 3MV7E 2GT9B 3FRPG 2GT9A 4R96B 2QQKH 4R96A 4UZGA 5L9DH 4XNQB 1RUML 4JZJC 3HAEA 3WN5C 1WAAF 5EZJB 5EZJA 1MRFH 5J9PA 2RBLA 2YA1A 2BK8A 4MB5A 4AIOA 4APQD 3MC0A 4MA3B 3UZVB 3S88L 3QEUB 1YEIH 3C5ZC 3QEUA 4HWUA 1MHCB 1MHCA 3B2VH 5LGHH 5EO9B 3C09B 4P46B 5EO9A 3KYMB 4P46A 4GH7B 3KYMA 1UWEH 2A9NH 4GW1B 2ZG3A 1R6VA 3LKPB 4GW1A 3LKPA 2P45B 1FDLL 2ED9A 3CFCL 1MJ8L 2DLEA 4KZEH 5CZVH 4AYFA 1YUHA 4M4PA 3U79A 4JPWH 4Y5XA 4PJFF 3RZCB 3RGVB 3MR9B 3FQXB 3RGVA 3RZCA 5IWLA 3MR9A 1EAJA 3QUMH 5L2KE 3QB7C 1K3ZA 3CK0L 3OHXB 3OHXA 1D9KD 4PYGA 4JFFD 4P2RD 4OV6F 5IFHH 1CTOA 5C0ND 4EIGB 4MS8D 2VL4A 1HYSD 2JJTA 4PLOB 1EEZB 1N7ML 1QBBA 1EEZA 4JFEE 1T1XB 3VWJC 1T1XA 1FVEB 1FVEA 1LEGB 3MTRA 3IDIA 3X3FL 1LEGA 5IJVB 5T1MB 4PUBH 5IJVA 5T1MA 4PREA 3DX6B 4XMLL 5T3ZD 3DYMA 3DX6A 3IETB 3A67H 3IETA 1U3HB 3IXAB 1U3HA 3IXAA 2ZG2A 3AC0A 3BKJH 4CMMB 3LRSB 5IROC 2PN5A 4CMMA 3LRSA 4XPAL 3T04D 5AZEL 5SX4I 1CDIA 1J10A 2Y07H 3SE9H 3JSSA 4I0PC 3N1FC 2DQJH 5DRWB 5EU6E 3IDYC 3S5LG 5DRWA 1LDSA 1A22B 1A7RH 5CP3H 5B38B 5B38A 3ULVF 1PD6A 4P2CG 2E3VA 4P99A 3VRLF 3QBTB 4YX2H 2K7QA 2R2BB 4N90E 2R2BA 3SDCB 4R2GD 5C08E 4HT1H 3T4AB 3T4AA 1FLRH 5ALCH 4MD4A 4DAGL 2QADC 3SGEH 4WCYH 1P4IL 2J88H 3IXTB 3IXTA 3B9EA 1KNOA 1QR4A 1C7TA 1GPOL 4QRRB 2X70A 4JFQB 1UXWB 4QRRA 5J7CC 4JFQA 1UXWA 4M43L 4ELKB 3BDBA 4ELKA 5GS3A 1I75A 4ZTOH 5T5NG 4Z76A 1JGUH 4TYUA 4L5FL 4PFEA 2CK2A 2VQUA 4IRZH 2B2XH 4B7IA 1KEML 4C4KO 4JRYB 3UBXB 3UBXA 1N6UA 3L5WB 4G9DB 3L5WA 3QUKB 4Z0BH 4G9DA 3QUKA 1FG2B 2Z92B 3M8OH 4KI5C 3BMWA 1FG2A 2Z92A 3S97C 4ISVA 1YYML 4JCMA 4OQTA 3C09C 4EBQL 4UBDC 4P46C 5ACLA 3VJ6A 1C8PA 9CGTA 4JY5L 1W8OA 1JNLH 3LKOB 3S7GA 2GYSA 2WIIA 3LKOA 4UT9L 1FVDB 1MQKL 1FVDA 1D7FA 4ZAKA 3TPKA 1G9NC 1GOGA 3U4AA 3KWWA 2VDRH 4IDJH 4NQDB 4H20L 4LLDB 3RZCC 4LLDA 3RGVC 1QP1A 5IWLC 5ITBL 4L3EB 2MCPH 5E1AB 2PO6B 4ODUB 5E1AA 4ODUA 1F58L 2YRLA 3BO8B 4LEXL 3BO8A 5GJSL 4YFLI 5TJWK 3FFDB 4FQLL 3FFDA 4PJ5B 4N0CD 4PJ5A 4PV8A 3T0BA 4JDVB 1MFEL 5GGVL 3B9KB 3CDGB 4IJ3B 4JDVA 5I1AB 3CDGA 2HJFB 3HCVB 4W70A 5I1AA 2HJFA 3HCVA 3KPMA 3OKKA 2HTLD 2HWZL 1CFBA 1OF2B 2WW8A 3WKMH 4G9FD 1UH4A 4ERSL 3DO7B 5FDYA 3QEQD 3DO7A 1GJIA 4E0RB 4E0RA 1YECL 1U3HC 2ATPB 2ATPA 1NUFA 3QFJB 3QFJA 2O5ZL 3CSYA 1QNZL 1GCFA 1UEYA 1G6RL 1VEPA 5DURD 4JG0L 1FBIH 1NMBL 5CEZE 3QO1B 1JHKH 1D5ZB 5HHMD 1D5ZA 3SDCC 5J3HD 1T7ZA 4TUKH 4OZHF 2DJUA 2UZIL 2V5MA 1J0IA 2CRIA 2DL9A 1GGCH 4GAJH 4KQ3L 5CCKL 5BRZB 3UJTL 4F9LA 2R0KH 4PPTA 5SV4A 3E6HB 3E6HA 1LNUB 1RUKL 1LNUA 1R24B 3KS0J 3TN0D 1R24A 4JFDD 3G6AA 1I8MB 1I8MA 1LHZA 3EO0A 1L7IL 2DQTL 2EC9T 3LS5H 4YBQC 3TC9A 1J0JA 2BJML 5ESVB 4J3UA 5ESVA 4PJ7E 5MP6H 3LOWA 2JJSA 32C2B 1P4BH 4HDIA 32C2A 5LQBL 4BQ8A 3HNVH 1T5XB 3OAYH 3PQYD 3VXUE 2VR9A 4OT1L 1ADQL 5CGYD 1NAKH 4AT6B 1WWCA 2D0HA 2YKLL 2FEEI 2XV6B 3NABL 3HA0A 2PO6C 1GAFL 4TNVF 5HVFB 1EZVY 3UYRL 4YDKL 2JB5L 3K2UL 3K4DA 4RBPH 3NAAH 4NHUA 4HEME 2XOTA 2M8XA 3VGBA 3AGVA 5EUOE 4GKZB 1J5OH 4GKZA 3JVGC 1A0QH 2VAAA 4R3SB 4IJ3C 4R3SA 1K3IA 4BELD 4OCWH 4OJFH 1ZHLB 4TSCH 1ZHLA 5E2UH 2GHWB 1WZLA 4LOUD 1HQ4B 3T0DA 5D2LF 1ES0A 5SWSB 5SWSA 2Y25A 12E8H 4HUXB 4K94C 4HUXA 4NBZB 2X4QB 3SO5A 1CF8H 2Y06H 2X4QA 5GRZA 3HPJB 4DN4L 3HPJA 1WZMA 5F21B 1MJ7L 5JUEH 2DBLH 3QHZH 1DN0B 1DN0A 5FM8A 3CD4A 1XGUB 4UUJB 1RJZB 1XGUA 4UUJA 1RJZA 4HCRL 3W11D 5JXED 4PJXB 1HHIB 4PJXA 1HHIA 1AFVH 2P24B 1U8QA 2P24A 1HCFX 3JTSB 4PY7B 2DQIH 2LTQB 4FP8H 1WAAE 1EHNA 3I6LD 1BQUA 4RISL 1UT9A 3ISWA 3U7YL 3DXAB 4X80L 4F9LC 1SYSB 3DXAA 4JO2H 4M61A 1SYSA 3IS0X 5E99H 3HTLX 3VXOB 5SX5K 3VXOA 4H8WC 1ZLVH 3DRQB 3DRQA 1TTUA 1DLFH 3AROA 1BD2B 2LVCA 5IV2B 5IV2A 2PR4L 5C0RL 2FHCA 1RUMH 2GCYB 2JJSC 3CLFL 4EI6B 1IM9D 2GCYA 4EI6A 3FRUB 3FRUA 4XCNB 4XCNA 1DE4A 4JPVL 4AL8L 4PJFE 4U0QB 1M7XA 4KFZC 1V3MA 2B4CC 3T8XA 2YD5A 4J23A 3T0EE 4RNRA 1Z0NA 3S88H 1UCBH 1Q0XL 2FL5B 5JQHC 3ZDZF 2I25N 2I24N 2LU4A 5H37H 4LLVA 4APQA 4NOBA 3DETC 4LSSH 3WFEL 4P4KD 2OQJB 2OQJA 1FDLH 3CFCH 1MJ8H 5B3JF 2EDLA 1FZKA 3U48A 1B9ZA 3MV11 1CIDA 4MA8L 1NDMA 3ZKNC 5HGBA 4X98B 1YPZB 4X98A 1YPZA 4I48A 3CK0H 2KZ1B 2YPLD 2YHGA 3EO9H 4LLYB 4LLYA 4F7PB 4F7PA 2VLKB 2VE6B 3B5HA 1OAYL 2VE6A 4XNXL 3ULVE 4KHTH 3U4EB 1D9KB 2A74B 2KKQA 1D9KA 1N7MH 2A74A 3CMOL 3LEYL 5HHOD 4P2RB 4P2RA 4MJID 4IRSD 2MSPA 1OAUH 5CD5C 2GUOB 3BGFB 4XMLH 1GGUA 2OL3B 3MNWB 5FA3B 2OL3A 3MNWA 5FA3A 2AK1L 1INEL 2XZAL 1HNFA 4AG4L 4XPAH 5AZEH 4YIQB 1RZKC 1JI1A 3BESR 4YIQA 2LTQC 2XXCB 3TEUA 1SEQL 1B88A 4OZIF 1T1ZB 2EIDA 1T1ZA 3INUL 5DJYB 3HZYA 2EEDA 5DJYA 4PY8I 1JTPA 4WFED 5FGCB 5F89B 4PB0L 5F89A 3VFGL 4OKDA 3QUZD 2LV4A 1P4IH 2G9HB 5CSZB 2G9HA 4M6ML 1PVHA 3BWAB 4R2GB 3BWAA 3VW3L 1QBML 1WUNT 1DBBL 2X89D 3VFPA 2CDEB 4M43H 5KOVC 2CDEA 4ZYKA 3IU3B 2J6EA 3IU3A 4LFHG 3DJ9A 2FHFA 5EOCL 4QLRA 4PJIB 4L5FH 3BP7B 4PJIA 3OL2A 4Q9CA 3BP7A 5K9JL 1IEBB 1RIHL 1IEBA 1KEMH 1HHKB 3QO0B 4MHHI 5MHSD 2CKBL 1YMHB 1YMHA 1F6FB 2QEJA 4Z7UF 5DJDB 5EOTA 1YYMH 2GQHA 4EBQH 1FYTD 3DRTB 2FECI 3DRTA 1M71A 2BVQB 1SBSL 1J11A 1D5BA 2BVQA 4JY5H 5KAQF 3DLQR 3MROB 3DROB 5C0AD 3HNTH 4UT9H 2CXGA 3DROA 1DBML 4H1LG 1MQKH 2J8UF 4LDLB 5EOCJ 3EZ8A 2PNDA 3RY6A 4QKXB 3OB0K 5J57B 2PETA 1MF2L 5B4MD 5EIVA 1QFWH 1S3KL 3P0VL 3VFRB 4H20H 3N85L 2Q87A 5ITBH 4D0DB 1SVCP 2EYRB 4D0DA 4OFKA 3EAKA 1F58H 1MFBL 4LEXH 4FQLH 4GBXD 3IDJB 5FHBL 5GGVH 1MFEH 1MQ8A 1D9KC 4KI1A 4MJ6B 2HWZH 4OZHE 4YDJB 4MJ6A 4YDJA 2VN4A 3LRHA 1A7OL 1S7RB 1S7RA 2ZKHL 3NCBB 5DD3L 3BGFC 4ERSH 1YECH 3F65A 1QBLL 2O5ZH 1QSEB 1KC5H 3V6ZB 4G9FB 3V6ZA 1QNZH 2A73B 2BVUA 3F7PC 4G9FA 1IT9H 2A73A 3QEQA 1G6RH 4JG0H 4AEIL 2AAVA 2DIBA 2Y1VA 4EQ3A 1NMBH 1K2DB 4HUWB 4PD4K 1MVUB 1K2DA 4YHIA 1VEOA 1MVUA 4PLJD 3BZFA 2EDHA 5DURB 3KG5A 5CGTA 2YD6A 2UZIH 3ARBD 5B8CB 3ET9F 5C1MB 5B8CA 2W1NA 5I0ZA 3ARRA 5IKCB 2FLRT 5I16B 4KQ3H 5CCKH 5IKCA 4HJJL 4R2GC 3D85D 5JZ7D 5E95B 3UJTH 4U05A 5HGDB 3GDBA 2VIRB 3GSWB 2VIRA 3GSWA 4EUPH 3VXPB 3VXPA 1RUKH 5L8KB 3W5MA 2BSED 4M7JL 1WFNA 1J1XL 1YY9D 2DQTH 3ZLQC 5FCUH 4ESKA 3GMMB 5DEFB 4U6TA 3GMMA 3TN0B 2BJMH 5DEFA 4JFDB 5DJ6B 5E6YA 3TN0A 4JFDA 5DJ6A 2N7BA 1YQ2A 5TDOB 1AXIB 5LQBH 2D2OA 2VH5H 1EO8L 3FL7A 4BSVB 1OM3L 4ONOA 4BSVA 4OF3A 5DRXA 2VDKL 4QRQB 4YZFE 3N06B 3EZJB 4QRQA 5TDNA 1GOFA 3RY6C 3CFBB 3VXQB 4OT1H 1ADQH 3VXQA 3MGAA 2IBZX 5DGRA 5ID0B 5ID0A 3H9HB 3H9HA 1YY8B 2YKLH 3PQYA 3NABH 3VD7A 2AK4D 1KIQB 3HUJF 1GAFH 1KIQA 3QUMB 1F3DJ 3QUMA 2WK2A 5LG1A 2E9IA 1BOYA 4AZ8A 5ERWB 4YDKH 5ERWA 3K2UH 2JB5H 1CD1B 5D8JL 1CD1A 2YPKB 3HG1D 2YPKA 1DQTA 4UMGA 5KVEH 4I2XA 4CJ1A 5FDWB 1KIPA 4NZJA 3K0WA 4YXHL 3FT3B 3P4LA 3FT3A 3SGDI 1F97A 1WC7B 1WC7A 4X6BB 5GSVA 4X6BA 5FB8B 5FB8A 5K9OB 1PGRB 4ZUSB 5K9OA 4EZMA 4ZUSA 3QP3A 3SN6N 3KHQA 4CL7A 1N59B 1N59A 2VSDA 2HTLC 1RK0B 4P23B 3EFDL 4P23A 2WINB 4PD4J 2WINA 1YEDA 2VITB 4DN4H 2VITA 1MJ7H 4L4VE 4Y88A 3AS0A 3IYLW 4UOW0 4HCRH 5BV7L 2P47B 3BYTA 2BVOB 1JPTL 25C8H 2BVOA 4I8DA 2DI9A 5FOBB 3PHQB 1LO2L 5FOBA 3PHQA 3FMGH 5DMJB 4TNWK 5B8CC 3UO1L 3DUSA 3CSPA 1M7IB 3TH4T 4RISH 5J3HC 3U7YH 4X80H 2C4FT 2MHAB 2MHAA 2D3VA 1U36A 2HFTA 3GSQA 5E7BA 5C0IA 3VDAA 1WISA 1JF6A 1MREL 4OCYL 4PJGF 3LEXB 4LCYB 3LEXA 2PW2B 4LCYA 4GRWF 4BM7A 5HI4D 5DMKB 3PE9A 4L4TB 4Y1AD 3CC5B 4L4TA 2YK1L 5MEQB 4TRPL 5MEQA 3TN0C 3GM8A 3O8XD 2HYMA 2PR4H 4JDZB 4JDZA 5I1EL 4HZAA 2R4SL 3CLFH 2PCPB 2PCPA 3B6SB 4GMSL 3B6SA 3CGTA 3VGGA 4X7FC 2X2YA 4JPVH 4AL8H 4BSJA 4HIJA 4JN1L 3RDTD 1IM9B 1IM9A 1U8LB 4UILL 5E0QA 1U8LA 1I9IL 1YN6B 1T04B 1Q0XH 1T04A 1JBJA 4KRPB 1FL6B 3HPLB 4DGVL 4P48A 3HPLA 5ETUA 4XXCA 4CDGC 2HVKB 2HVKA 3WFEH 2G5RA 3VFUA 5CP7B 5ICYB 5CP7A 2F53D 1BFOB 4K7FB 1BFOA 4K7FA 2C26A 3CX5J 5DQJA 1N6VA 5DMGD 4P4KA 1F6LL 1JUFB 4N68A 4KK9C 1JUFA 4MA8H 1B90A 4I4WA 4V2CB 4DVRH 4R90L 2BY1A 4KDWA 1NKRA 2FEEL 3BPCB 4JANA 3BPCA 1OAYH 4P23C 4OZIE 4XNXH 5J11B 4LOUC 3S34L 2YPLA 2Q76B 4M3JA 5JHLL 2Q76A 3MV8E 3CMOH 3GI8L 4PR5B 5EU4B 3LEYH 4OGZA 4PR5A 4QHLB 5EU4A 4QHLA 1BIIA 2YD7A 1T1WB 4YFDB 5HI3D 4I77L 3O9WD 4RGMB 3ARXA 3VGAB 1QYGL 4K7PX 5HHOB 5HHOA 1ZWIB 2AK1H 3ESVF 1ZWIA 4L8DA 4G7VL 1INEH 3ZYZA 2XZAH 5C0BD 2FATL 3LY6A 4AG4H 4MJIB 3W11C 4IRSB 5JORB 4MJIA 2F9BT 4IRSA 5JORA 2EDXA 3QISA 3KXFE 4NZTL 4RAUB 5C0GB 4RAUA 3MACL 5DDHA 5C0GA 4HQQL 5GS1B 3LMJH 5GS1A 3EJJX 3INUH 5I8OL 1NC2D 1FNFA 1YNTB 2A6DB 1YNTA 2A6DA 1HDMB 1DN2A 4YDVB 4PB0H 4YDVA 3VFGH 1EO5A 4Z7UE 1RQ5A 4N5ED 2XN9E 5A2LH 5DC9B 2FCBA 5IFAL 4M6MH 2HMID 2HFEB 1L0XA 2HFEA 1CQYA 4MSWB 3VW3H 4MSWA 1WTGT 1QBMH 1DBBH 2DI8A 4NN7B 3QUZB 3EOBB 3EYOA 3QUZA 3EOBA 4YHLL 2Y7QB 1CTNA 2YZ1A 2Y7QA 3QRFM 5E8PA 3PL6D 2BVPB 5EOCH 1JN6A 2BVPA 2FO4B 3ZSSA 4F7MA 1J05A 2X89A 5KS9B 5K9JH 5KS9A 3HRZB 4RWYL 3HRZA 1RIHH 3SKJH 4CU6A 4MD0A 4GO6B 1KCVL 4UOW1 4KRPC 5KAQG 4TVPL 2YD2A 1SBSH 4NFBA 2YD3A 1DUZA 1DBMH 1KCKA 3RWGB 4FMFA 3RWGA 3IB4A 1FYTA 4XCCL 2DIJA 1IILE 4OZFG 4X6DF 5C0AB 1MF2H 5C0AA 1S3KH 1W72L 3P0VH 1OSZB 2W38A 3N85H 1OSZA 3MNVB 1K8IB 3OZ9L 1K8IA 4OLUL 3VXTA 1MFBH 4HEPG 1AE6L 4QHNA 1HCVA 2YUXA 3SKUD 4NQEE 1F3JB 1F3JA 5FHBH 2ZPKL 5J11C 1ZXQA 5F1NB 2VRAA 5F1NA 4HG4K 3IT8D 1BFVL 5IMKA 3QQ9D 3IAQA 4NOFA 5AUMB 5AUMA 2ADGB 1EHLH 4GBXB 5HDLA 2ADGA 4GBXA 2FX7L 5C09B 5AAWA 3RKPA 4RGMC 5C09A 5DD3H 2Q3AA 3VGAC 2EE3A 4Y19E 1PZUB 1JGLH 4WW2B 4WW2A 3ARPA 2WUBL 4NNYB 5KVDL 3G6JA 1QBLH 3GGWB 4ORGA 2AERT 3GGWA 3QDGD 4IRSC 3UTQA 3GSOB 4JM2D 4JHZA 4X6CF 1I9JL 3GSOA 5DHVH 1EFXD 2YOCA 4HK3N 1II4E 1QFUL 2XPGB 2XPGA 4AEIH 5GS1C 1KB5L 4UV4L 2DLTA 3CCHB 3EYFB 3CCHA 1CFSB 3KPSD 2R8SL 1CFSA 1WK0A 4FFVC 4RRPA 3QDME 2RJMA 3RPKA 5C9KA 2NY4B 3KLAA 3OKDB 1FH5L 5IMLA 3QJHB 3QJHA 4HJJH 1E0OB 3ARBB 4MCZB 3ARBA 4MCZA 3MA7B 4HK0B 3OB0H 3QUZC 4NN7C 3H3BC 3MA7A 4HK0A 4GOSA 3QPXL 1E4XI 2Q7YB 3D85B 1GVIA 5BS0D 3D85A 3DX7B 1FC2D 4M7JH 3T3ME 1J1XH 1IVLA 5T1KD 1YN7B 1YN7A 1TTGA 3PGFL 1W0WB 1W0WA 3E3QE 3ARWA 1I1CA 3VXSD 1MNUL 2OS7A 4S10A 4WGWB 1F3DH 3H7BB 5KSAD 3H7BA 5DEGB 5E6IB 5DEGA 3S36L 1UKQA 1EO8H 2FD6L 2F5BL 3VI4F 2KBGA 1OM3H 2O26U 2BOBA 2WWMC 4KI5F 5E7FA 5LCVL 2VDKH 5F93C 1U8IA 2HP4A 2EIEA 4PY8J 5E9DE 4OF5A 1NUDA 3RIAK 3MGOB 3MGOA 1FNEB 4MNGA 1FNEA 2CDFA 4X4XB 4HG4J 3FO9A 1DQDL 5B4MC 2FECL 4LPWA 4PRBB 4PRBA 2DL2A 5D8JH 2AK4B 2NLJB 3S37L 2AK4A 2NLJA 4YXHH 4UNTA 2NXZB 2MTPA 3GJFK 2F58H 3WL9B 3WL9A 1Q72L 4B7LA 1X5HA 3GMOB 3HG1B 4YEFA 3GMOA 3HG1A 4GBXC 5FV1L 2XKNB 3KPRE 2XKNA 1FL5B 1FL5A 3EDDA 5IEKB 5IEKA 3BISA 4WW2C 1HSBB 3EFDH 1HSBA 5D96B 2FB4L 4Z7WB 3PWLB 4Z7WA 2DF3A 3PWLA 1JYXA 4QXUH 5IG7B 4L1DA 1QR1B 5IG7A 3LEVL 4KGJA 4ELMB 4PGJA 4PJGE 4TPRH 4ELMA 1N5AA 2OI9B 1P4LB 4GRWE 1JGEB 2RB8A 3CDYA 1JGEA 5EBGA 5JIHA 4CVXB 1KULA 5D72H 4CVXA 1IKFH 1JPTH 4UU9B 4YEEA 1DVFB 2IFGA 1LO2H 3NZ8B 3V6OA 4ZG1A 1TMCB 4CVZB 5EBMA 1KF9B 4WUUD 4CVZA 2NY4C 4B41A 2DLGA 4PLJC 5D1QD 2V9QA 3P77B 3P77A 3ARBC 3QAZB 3WIFB 3WIFA 4OZGB 4OZGA 3K7UA 3BXNA 5ITFB 1MREH 1U95B 2BNRD 4OCYH 5JZ7C 1U95A 1R3KB 3GIVB 3OR6B 3GIVA 2D4DA 2YR3A 1QSFD 4IMLA 2YN5A 1NKOA 1TXKA 5I71B 2YK1H 4TRPH 3NBNA 2X40A 2JIXD 3OAUH 5I1EH 1YY9C 2R4SH 3LQAL 4Y1AB 5HHQB 1JNHB 4GMSH 4HUKB 1JNHA 4Y1AA 6FABH 1VCAA 5E6IC 2GTWB 2CK0L 2BNUA 2GTWA 4MA1B 4FA8A 5F6HI 5GS2H 1B0WA 3SQBA 4Z7QF 1ORSB 5CSBA 1ORSA 4UILH 3I3DA 1I9IH 5J6HB 5JO5B 5J6HA 5JO5A 1HIML 4DGVH 3RDTB 3DX8B 4NC1C 3RDTA 1CLOH 2FDBP 4OM1L 1UWXK 3WNKA 4P0DA 4MNQB 4MNQA 1MCCA 3OV6A 3TLRA 1ZLUK 4C56E 2HTKD 3I3EA 3P11L 3MV9E 4KHXL 3CXDL 5AWNL 5DF0A 2X4TB 4LVNB 3VFSB 2X4TA 3CDFA 3VFSA 4WV1B 1Z9MA 5EBWB 2A77H 4WV1A 5EBWA 2NXZC 5HYSB 1BECA 1UJTA 5HYSA 2F53B 2NXYB 3RBSA 2F53A 3R8QA 5J89A 2V7HB 3HI6L 4JO1L 2V7HA 1OW0A 2R69L 4R90H 4DUXA 4GMTL 2E9WA 3ECBB 5IHUL 5JHDB 3ECBA 1FGVL 3DO3A 5JHDA 3EJZC 2QJDA 5D96C 2NZ9D 4TSBL 2YBRB 5JHLH 2YBRA 4L29A 2WBWB 4LASL 1A1MB 2AI0H 1YC8A 3GI8H 1KCSL 1A1MA 1VFBB 2KQNA 5FECB 1VFBA 5FECA 2OI9C 4N1EA 3O3DB 3O3DA 1G6RB 4I77H 4IOFC 1G6RA 1G0DA 1QYGH 3O4LE 5FKPB 1NFDB 2XFXB 5FKPA 1NFDA 2XFXA 3V6OC 1HZHL 4G7VH 4NZRL 4XBGA 2X05A 2FATH 3O9WB 3O9WA 1A21A 5IT2L 4M02A 4OCMC 1HH9B 5C0CE 4NZTH 1EMTL 2IWGA 5IB1B 5DFTA 3MACH 5IB1A 4Q97A 4LGRB 4HQQH 1BMGA 4J3TA 5C0BB 2C3WA 3QAZC 4GRMA 5C0BA 3EDKA 4EUPB 4IBLT 5DWUL 1HXYB 4EUPA 1IC4H 1NFKA 1HXYA 5F9JB 5C07D 1LO0L 2LU7A 3I50L 4P2QB 5TE7L 3ZKQD 1NC2B 1NC2A 4XCEB 5IFAH 4XCEA 5I71C 1K6QL 4OV5B 4OV5A 1EHAA 3HMXH 2QSQA 2R0WL 4YHLH 3QDJE 3OJMB 3JZ7A 2J8HA 3TGXA 3TF7C 5JOPE 2Y4SA 4EIZC 4MA1C 4HH8A 4S1RL 4E42B 4E42A 3NIFF 5C0DA 1PX4A 1KCVH 4U1SB 3O6FB 4U1SA 3O6FA 1ADQA 2BVYA 2NCMA 3RDTC 2Z31D 3OKLB 3OKLA 5GZOC 4H1LH 5KANI 4I0CC 5GRVK 7CGTA 2JB6B 4LCWB 1GZPB 2JB6A 1GZPA 1NGQL 5F1OB 1CN4A 4XCCH 5FXCH 1HHGB 2CPCA 1BBJA 4LVNC 3FFCE 1OP3H 4JY4A 4WV1C 1W72H 1A02N 5DR5L 1ROWA 2MQ3A 5DZLA 2NXYC 5EOQL 4F7EB 5FO9B 3A6OA 5FO9A 4F7EA 1OW0C 2JELL 1D6EB 3OZ9H 4KRMB 4OLUH 1LEIB 1D6EA 4CRPA 1LEIA 3BPOB 4XC1L 4X4YB 4X6CE 4X4YA 1KLUB 1KLUA 1AE6H 1AO7D 3Q5OA 3X14B 1JV5B 4F7CB 1H5BB 4X5WB 3X14A 2F15A 1H5BA 4X5WA 1HOCB 4HV8B 3BN9C 1HOCA 2ZPKH 4HV8A 5FYJD 3P30L 5L6YL 1BFVH 4HKJB 1AJ7L 1K4DB 4HKJA 4MDJA 5A1AA 4U6XB 2DYPB 4QXWA 3H2WA 1DCLA 2JF1A 4HCRA 5FYKE 3O6ML 3HC3H 4H0IA 1IGCL 5HVWA 2MQ0A 4QOKE 5KVDH 5HI3C 3DUUB 5BVJB 3O9WC 5BVJA 1I9JH 4WFFD 2B39A 1QFUH 4LHJB 1KEGL 5CGMA 1XMWA 3Q6GH 1KACB 3RHWK 5A43C 2OTWA 3QCVL 4UV4H 5IBTL 3MUJA 1LEKA 1G7HB 1XCTA 3MRLB 2FX8L 1G7HA 4U1GB 3QDGA 3MRLA 4JM2A 2R8SH 1EFXA 3BEWA 5CJ8A 1AD0B 3NTCL 3KJ6L 1AD0A 3U7WL 1BGXH 4I3SL 3IFPA 4JFYB 4BZ1L 4JFYA 3KPSB 3B9DA 2P48B 3KPSA 1FH5H 3EBAA 3FRPA 3VI4E 3LB6D 2HG5B 1J12A 4K23L 4N5EC 2A6JB 3G6DL 1QFHA 3GI9L 3HAEG 4WEMB 3IVKB 2HT2D 3IVKA 2YD1A 5BJTB 5BJTA 5DZOA 1VEMA 4LCUB 4PRID 3PGFH 4OFDA 2X9YA 1MNUH 3O6FC 2X1XR 3PWNB 3PWNA 3REWB 4MQ7B 1A7PL 3PNWB 3REWA 3OKYA 4N8CL 3PNWA 5T1KA 3G9VA 2YWYA 3ZHKA 4RWHA 3S36H 4LMQE 2FEDD 2FD6H 3VXSB 4CN1A 2F5BH 5IB2A 3VXSA 5LCVH 4AMKL 5KSAA 3PV6B 3L3OB 3PV6A 2WBKA 3L3OA 4PS4L 1MH5B 1DP0A 1MH5A 5C0JB 3DI2B 5C0JA 2P7TB 1IAIL 3CPLB 2P7TA 3CPLA 4YAQB 2AABL 1NCUA 3HNSH 5D7KE 4YAQA 5I15L 5JPNB 5JPNA 2VERN 4LLQB 3BPOC 1DQDH 1NCDL 4Y2DD 5D7SL 4ACPA 4LLAA 3OG4B 2V5RA 1H5BC 5I8CB 4KXZI 5I8CA 1LK2B 3S37H 2IALB 1LK2A 1YPZF 2IALA 2CKNA 1OT1A 2MJWA 3QUXD 2D7TL 3H9SD 3LSOB 1ITBB 4G43B 4BQ6A 4BQ9A 3LSOA 4YR6B 4YR6A 3RVXD 4NRZB 4X7SH 4NRZA 2Y5TB 1OAXL 3UTOA 2Y5TA 3D25B 1RV6X 4FHBD 4GFTB 3D25A 4NNPL 1T89C 1PG7W 2R9HD 5L2KB 2EC8A 1MLBB 4X9GA 5L2KA 1MLBA 3BW9B 3ZTJG 3QQ9C 3BW9A 3F6IA 3KR3L 2FB4H 4IHOB 1FSKB 2OP4L 3WYRA 4YK4B 4ZFFB 3D3VD 3LEVH 4ZFFA 3S5LB 3S5LA 1ZMYA 1O0VA 5CJ5A 1EFQA 2AEPH 4JFEB 4OF7A 2X4PB 2P5WD 1BOGB 4Q6YA 1HSAB 2X4PA 1BOGA 5SWZD 3V4VL 4DKAA 2WNGA 3BD5A 4NWUL 4U1GC 5TF1L 1TPXB 2XWJB 1TCRB 2XWJA 1BZ9B 4Q74A 4XWOD 1JCKA 1S7XB 4B5EA 1S7XA 4M48L 3VGEA 4LFHD 4EKXA 2CIKA 3VD5A 5I1CL 3FO0L 1LGVA 3TBVB 2V17L 4WUUA 3IDGB 3FAXA 3IDGA 3K4AA 5D1QA 4YQXL 5BMFH 2NY1D 1P2CB 5C08B 3RI5F 4LSTH 1Q0YL 4X6FB 4M6OL 4X6FA 1MCBA 4IOIB 2H45A 1CGXA 4FQJL 1R3HA 3ILPB 4TVPD 3NCCB 2BNRB 3ILPA 2BNRA 3ZDYF 1HN1A 3BH8B 4NZDA 3BH8A 2CKBA 1X4XA 4JFHE 4PJIF 1QSFA 3GJFH 3LQAH 1IQDB 5C6TL 1IQDA 4WENB 2CK0H 1T2QL 2JIXA 3RPIA 1E4XL 1AXSA 4G6AC 2CGRL 3NCEB 3OWEA 1ODAA 3ALXA 2LE9A 5IM7B 5IM7A 1KXQE 4Q6IB 5ESQB 4Q6IA 5ESQA 3O11B 3RU8L 1HIMH 4U6VH 3L5IA 5K59F 5KZCD 2IPTL 2NTSP 2WP3O 4QF1A 1NSNL 2LVEA 3IF1B 4PRNB 3IF1A 4PRNA 3P11H 4KHXH 3CXDH 3QFJE 5AWNH 5INDB 1KGCE 1UCTA 4HHAB 5INDA 4HHAA 3LVEA 3HI6H 4JO1H 2R69H 5DD5L 1CFQB 4PJDB 4GMTH 4PJDA 5IHUH 2ICWJ 1FGVH 3BEVA 1TJHL 3NCYP 1RJCA 3MUHL 4TSBH 1FSKC 4YK4C 1ZV5A 4LASH 5HI5D 1Q8MA 1KCSH 1DJSA 3VXRD 1RSFA 4YHNB 4YHNA 1A6UL 3PHOB 4NKOB 3PHOA 1TPXC 2BOCB 5JIKA 2BOCA 1HZHH 1RZFL 4TTDD 1UXSB 3L5HA 3ULUL 4HGKC 5IT2H 4HBCL 1CD8A 3EDFA 1EMTH 3QXVA 2WIMA 3KDMA 2FGWL 1YEGL 5DWUH 5F7HA 1ZT1B 3U6RA 3V5KB 3FB6B 3V5KA 1UWXH 1LO0H 3FB6A 2GJ6B 3I50H 5TE7H 2GJ6A 5FIEA 4JY6B 4EDWL 1WQVT 5I66B 5I66A 1ZLUH 1GC1L 5GQBA 1K6QH 1NGPL 5C07A 2VZOA 3RNQB 3RNQA 4KMQA 4PIRF 2P44B 2R0WH 1VGKA 5FKAB 3U0PB 1HKLL 1MFCH 4RAVB 4LCIL 4S1RH 4JRXD 4GG6B 2XI9A 3MRFB 1UB6A 5F7LB 5B21A 3MRFA 4GG6A 1W2KT 2DB8A 4Q6IC 2D0FA 4XHQA 4K3EH 3HE7B 4D0BA 4QT5A 4RQQB 3HE7A 5FGBA 4RQQA 2CH8A 3L7EB 2HLFD 3L7EA 4P4RB 4P4RA 1EV2E 4NFDA 5DMIL 5SWSE 3NACL 1UZ8A 4LIQL 4RIRB 2YUVA 4GLRI 4RIRA 4BA8A 1A4KB 1A4KA 3CFDB 2Z31B 1NGQH 2DMBA 1YEFL 3CFDA 2Z31A 4OZFH 43CAA 43CAB 2AJYL 1QTYT 1JF1B 1P6FA 1JF1A 4HIHA 4DN3L 3ILQD 1EVTC 2APTA 3VXUB 3ARUA 5DR5H 2X7LB 1CDBA 5EOQH 2X7LA 1UFUA 4XWGL 1KENL 2JELH 5CLWA 4LU5H 4FQIL 4PJXE 1NGYB 1S78D 1NGYA 3NFNB 2HLAB 3QXAB 2HLAA 2Q7NA 3WFHB 5TPWL 3WFHA 3EDJA 4ZUVB 2HH0L 4ZUVA 4ZMAT 5HYJD 1A3RH 5GZND 3FB8B 3P30H 1H3TA 3DBXB 3DBXA 1E6JL 3G9AB 1AO7B 1L6XA 1AJ7H 1AO7A 1J9CT 5DHYB 5DHYA 3DXAE 3WXWL 2NZ9C 5BXFB 2EC9U 5BXFA 3QNYB 2KDGA 4HFWB 3P73B 1F90L 2AJUH 4HFWA 3P73A 2FO1A 1DANT 2B20A 4AY0A 5BV7B 1CDGA 4KRNA 1CLZL 3O6MH 1IGCH 5IK3B 3VG9B 5IK3A 5JIIA 1OGTB 1OGTA 4GSDL 2P8MB 1VKXB 1KEGH 1KJVA 4ODHL 3QCVH 1QG3A 1XF4B 2E6JA 1XF4A 5DRNB 5DRNA 2WSKA 4WI9A 3MJGX 3NTCH 1Q9WA 3KJ6H 1U3JA 3U7WH 4I3SH 4BK4A 1X5YA 4BZ1H 1MHPH 3LDBB 4LPCA 3BYYA 4WI7A 1KT2B 4HGWA 1KT2A 3N9GL 4K23H 3Q3GB 3Q3GA 4POYA 1NANH 3G6DH 3N1QC 1FAIL 1A9BB 1A9BA 4EQ2A 5AG9A 3GI9H 4YXLH 2V2TB 1RZIB 4OIAA 1RZIA 2VZVA 2V2TA 3D0LA 5CILL 1A2YB 1A2YA 2Q1EA 2EDRA 1AR2A 1XIWD 3HE7C 5FGBC 4H25A 4N8CH 4XNUL 1BLNB 2RAMA 1BLNA 1YPZE 1AC6A 4PRIA 4RGND 2ZSVB 1PQZB 1PQZA 1QKZL 3V0VB 3V0VA 4ZFGL 2FBJL 2Z31C 4AMKH 2YRZA 3E2HC 3Q48A 1DZBA 1I3GL 2V5TA 3RIFF 4BUGA 1IAIH 2XKUA 4JFFE 3S35L 1V8HA 1AR1D 2AABH 4P2RE 1A6PA 5I15H 2IH3A 3STLB 3SOBL 2CIIB 4U7MA 2CIIA 1NCDH 4Z7NE 4D9RD 1BJ1J 5D7SH 3QULA 2MKWA 3MQIA 3BSZL 3NA4A 2ZG1A 2DICA 4DFHA 4LVEA 5D71L 1BAFH 3S9DB 4Y2DB 5FUOL 4JKWA 4Y2DA 5T3ZE 5E5UB 5GPRA 4ZS7L 4UV7L 1FZOB 1FZOA 1OAXH 4NNPH 1JIBA 3K8MA 3QUXB 1DQJB 3H9SB 2ENSA 3QUXA 1DQJA 3H9SA 4MQTB 5FGCE 5BV7C 2OP4H 3VG9C 1YNKL 5FM5M 2E6QA 2NYYC 1IE5A 2E6PA 3S36X 5DHXB 5JMRA 2C3GA 3V4VH 3ZKXB 1F8TL 2W9LA 3D3VB 4NWUH 3D3VA 5TF1H 3VDCA 1U58B 3L5XL 1U58A 1RAMA 4PJEB 3ZDYE 4KTEL 4PJEA 1EDQA 2P5WB 3STBA 3VG0L 2P5WA 5SWZB 3PABB 5SWZA 3PABA 1PKQE 5HHPB 3VFVA 5HHPA 3LDBC 2VAJA 5I1CH 4L3CB 4L3CA 3FO0H 4PJ8B 4PJ8A 4YQXH 3JV4B 3JV4A 1EVUA 1JHTB 5K59E 4X8JB 1JHTA 2L7UA 4X8JA 1Q0YH 3F12B 4M6OH 4FQJH 2NY1B 2X1QA 2HT2C 1AKJD 4OQTL 4JN2B 5KS9F 4JN2A 2EICA 5C6TH 5DUPL 5I6XB 3IKKA 4KJYB 1LILA 2E9BA 1E4XH 4KJYA 2AQ3A 3OGCB 3OGCA 1L9MA 4NQUA 4C59B 1OP5K 2OTPA 1OD7A 1MAJA 2HJKB 2FEDC 1MIEL 2HJKA 5C2BL 3RU8H 5ID1B 3CFEB 3LCYA 5ID1A 3CFEA 1W72B 1FPTL 1PLGL 1W72A 2GI7A 3MJ9L 3QQNA 2IPTH