4UU9A

Crystal structure of the human c5a in complex with medi7814 a neutralising antibody
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDDDYEEWPWYYGMDVWGQGTMVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MEDI7814
publication title Structure and characterization of a high affinity C5a monoclonal antibody that blocks binding to C5aR1 and C5aR2 receptors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 29
structure length 123
sequence length 123
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uu9A00
1RZKL 3O2DH 4GG8A 5H2BB 1YUHB 2WBJD 3RVTD 5I16B 3CH1A 4WI8A 5MEND 2IBGA 4XX1E 3BT2H 4EVNA 3OKOB 4X6EA 3H9ZA 1U8NB 4HW6A 1PX4A 4FQXC 3RY6A 4U1LA 3PL6D 5FYLD 1ZA6A 2BDNH 1DLHB 5DD6B 2KUTA 5C0RH 2NXZB 3TM6A 4P2QD 3W0WE 2NY6C 3BGMA 5IHZB 3FKUS 1YNKH 3KVQA 3NN8B 1VESA 1J05B 5IWLA 3GSXB 3O4OC 1BVZA 2J8HA 2NW3A 4E5XB 3D69B 12E8L 3I6LE 2BNQE 5I9QB 4R4FH 1UA6L 4YDVA 4JFPB 2AI0L 4ELKA 3RKPA 4P5KA 1S7QA 3L5WA 4P5TA 2V2WB 5EDXA 5C09E 6FABH 3UO1L 5H2BA 1YUHA 5FXCH 3LIZH 4NCC1 5AZEH 5I16A 2R2HA 1CXIA 1XGYL 4HBQA 4U1GB 5TPWL 3PWPD 4N0UB 1DLHA 1IEHA 1HWGB 5IV2B 1XR8B 1F4XL 1LMKA 1BEYL 4CDHA 4Z76B 2F9BT 5IHZA 1LP9E 1VEPA 3MLVH 2VQTA 3NN8A 3GSXA 4UTAH 5FYKD 1M71B 2FWOB 4UT7L 3D69A 2FBOJ 4M7LT 5CBAB 2VDOH 2C3GA 4LGRB 4DN4L 5IQ9B 1G6RB 1OSPL 2WNGA 3CVIL 4WY7H 5D7SH 3TBSB 5GS1C 1WIOA 4MJIB 4POYA 4LKXB 3KPRD 4Y88A 1WCBB 3LDBB 3VXMD 4P46C 2V2WA 2JF1A 5DC4B 1XCTB 4RWHA 2FH8A 2P24A 3LAFA 1F3DJ 3B5TA 1VA9A 2RJMA 4RGOL 1N59B 1D9KC 3NFPB 2A6KA 4DGVL 2DI7A 4Z7VB 1FGVL 3E8UL 3FQRB 1JFQL 4N0UA 4GMSL 5IV2A 1XR8A 2EYSA 3NH7L 2IFFH 4PB9L 3VFUB 2IBBA 1J0ZA 5SX4H 2IFGA 4Z76A 1JPGB 3NGBB 2BJMH 1M71A 2XXMB 3EHBD 1IC4H 1CLCA 2FWOA 2VRAA 3GMRB 4KFZC 1C1EL 4LF3B 2UZXB 3OJVC 3RBSA 5IQ9A 5GZNC 1G6RA 3BZ4B 4NWUH 1EZVX 3TBSA 4NGHL 1X6NA 2AXGB 3RX8A 4MJIA 1PG7X 3MRFB 4TSCH 4LKXA 1VGEH 3UJTH 1UT9A 3OX8B 3D18B 2VLKB 5IB3B 1BIIA 1T5XB 1N59A 3NFPA 4Y4FA 3QQ9C 4JR9L 1UEMA 1V3KA 1X9QA 3B9AA 5GRJH 3FQRA 1F3DH 2E6JA 4N0UE 2OR9L 3ZTJG 3FL7A 4E9LA 2X2YA 2X6MA 1JPGA 1CDYA 4UNUA 3U0WH 2DM3A 4OGYL 5GJTL 3MNWB 2B5IB 1EEZB 1MVUB 3GMRA 2OK0H 3K8KA 2X1QA 4PFEA 4JM4L 4LF3A 2CUHA 1DBBH 3MACH 3JXAA 5F1KC 3SDYL 5JA9A 3BZ4A 4DKEH 3AUVA 5I75B 1Z9LA 3MRFA 4OQTA 3WHE1 3JVGA 2FATL 3OX8A 1I4FB 1XGRB 1REIA 2AQ2A 1NBZA 3D18A 2VLKA 3E2HC 1E0OB 3VXSB 4JFHE 5IB3A 1T5XA 1LK3L 5CS7A 4XHQA 3CMGA 5HY9B 5GGTH 5E5MB 2EH8L 3ULUE 4Z7VE 5IBLD 4R7NA 1TDQA 2BSTB 2R15A 1IM9D 3DVIA 4YXHH 1ZSDA 4RNRB 2ARJB 2PO6D 2R1XB 5DXWA 1PVHA 2HRPH 3MNWA 1EEZA 1MVUA 1CD1B 3U48A 5I1AB 3FRUB 1M6OB 4R3SB 3CDYA 2EXWC 5D5MB 5DK2B 5CJ8A 2BDNL 3OHXB 4LKCB 5T5FH 3S9DB 2J7LA 2YUVA 3HN3A 1NCCH 4BKLB 1I4FA 1R3LB 2HT2D 1MCEA 4L8CB 3GMPA 3VXSA 1WWBX 2BY2A 2VLKE 5HYSB 3ZE0E 3MBEC 3P11H 1FVEB 1MPAH 5HY9A 5C3LD 5E5MA 3OKEA 2I07B 2WSKA 5FA3B 4RNRA 2ARJA 2R1XA 2KZ1B 4JRYB 6FABL 2KKQA 4BFIA 1CD1A 1DEDA 5AZEL 5I1AA 5FYJH 3H3BC 2VSCA 4U7SA 5E0QA 3FRUA 2IAND 1M6OA 4R3SA 5I75C 1CICD 4PRAB 2YEZB 5D5MA 4J3SA 1LGVA 1MFBH 4LKCA 3GRWH 5KSBF 2DQIH 2W07A 4NNYA 2RR3A 4BKLA 1T6VN 2DF3A 3MLVL 4HS6B 2JJSC 1R3LA 4K94C 4HULB 4L8CA 2C4XA 4JFQB 2GJ6D 2ZCHH 4MA8L 4U6YB 1C16B 5HYSA 2XXCB 3TH2T 3VXSE 2VDOL 5I18L 4XMKL 3UDWC 4WY7L 2I07A 5D7SL 4D9RD 3HNVH 3FQTA 1QA9B 4OCRH 1OAQL 3INUL 5HYSG 2GT9B 5FA3A 1QBBA 5DFVD 3WN5C 1YEHH 5CEXB 4JRYA 2COQA 2EC9T 3S5LB 3BSZH 4MQTB 4MA7H 1UWGH 2V9TA 1DQJA 4KC3B 3Q6GH 4PRAA 2YEZA 3U7AA 5FUCC 5D5ME 1ZTXL 2E27H 4WO4A 2VOTA 3VI4E 5I8OL 2AAVA 4KJYB 4LEOB 5FV2A 4S11A 1MFNA 1OTUD 4HS6A 4WHTB 1BECA 5CINH 5GGVH 4JFQA 1KJ2H 4U6YA 3VD5A 1C16A 4P2YA 2NY2B 3BI9X 3QH3B 4ONOA 1RUQL 5T1DH 1SVZA 4LPTA 5I15L 5H37G 5BV7C 3W5NA 1QA9A 5B8CB 3IYLW 3S35L 2F5BL 3H9SA 4TSCL 2BSED 1HOCA 4KK6D 3SKJH 3EBAA 1IE5A 3HR6A 1JNLH 4CU7A 1NMCB 1JRHH 3N1PC 2A1WH 3OKMB 5LGKA 3GSNA 4HZLB 3S5LA 1YECH 3O6FD 5GSVB 3TLRA 3QIBD 5F3BB 4BK4A 3NABL 1WEJH 4K7FB 4BK5A 3S5LG 1JN6B 1WZLA 5GRJL 3P0GB 1B90A 1QSFD 1NC4D 5IJKC 4GS7C 1QKZL 2IPUG 1BF2A 4KJYA 1V8HA 3GMOB 4LEOA 1GOGA 3MODL 5BW7A 4OQ1A 3U0WL 1F3RB 1W8NA 3QPXH 4KK8C 3CFEB 4PLKD 4WHTA 4HSQA 5C71A 4H26B 4JO4L 3QH3A 1JPSH 3WFZA 3N85L 3DSNA 1PZ5B 5B8CA 5DQJB 4ZUTB 3PDOB 2H45A 1Y6MR 1T20A 1EH9A 3HNTH 1CT8B 5I19L 1CTOA 5JUEH 2DB8A 3OKMA 5K59E 4HZLA 2YRPA 4PJ7F 4YFLI 1FDLH 4LCWB 2PCPB 4LARH 4M1DH 5C07B 2I5YH 3CFKB 5GSVA 1RULH 5F3BA 3W2DH 3R4DA 4K7FA 4N90E 4RFNC 2YR3A 5IGXL 2QQKH 5CEZH 4HX1B 2HKFH 5EZJB 4HFUH 4YXHL 4P2OB 4JANA 3HZMB 3CFEA 5KJRL 4Q6IB 4W4OC 4XBPB 4WVRA 5MP6H 2DMKA 1MFCL 1H8OA 2YZ8A 4PGDB 4JN1H 2E9BA 4ODWA 3FT4B 2B2XH 2IPTH 1QFPA 1PZ5A 1M4KA 5DQJA 4ZUTA 3PDOA 3HRPA 4M4PA 4MS8D 1NCCL 1CT8A 5E2TH 4JPVH 1DN2A 2YD8A 1Z2KA 5DGRA 4LCWA 3TN0B 2PCPA 1CBVH 1UM4H 5C07A 3CFKA 1D6VH 1JHKH 3P11L 3BN9D 4Z6AT 5FIEA 5I6XC 4LRIA 4HX1A 4Y8AA 5EZJA 2YKLL 4W6YB 3QWOB 5JXED 4P2OA 4F7TB 1I8LA 3HZMA 4KROD 1O5DT 4Q6IA 3QXTA 1TCMA 4NBXB 3GEWB 3NCYP 3TF7C 4FFVC 3KJ4B 1S7RB 2ESVB 2BP3A 4PGDA 1ZLWH 3C5SA 5I73C 1DE4B 2BOBB 3DV6B 3GM0A 3S4SG 4KK5D 4NUGL 1BLNA 3OJMB 3GRWL 5DRNA 5FCUH 2C4FU 2EKJA 1YMMD 5SX4I 3TN0A 1JL8A 3L5JA 4LCWE 1JIBA 3KJ6L 1DLFH 1BGXH 5C07E 3MRKB 4AEHH 5T1LD 1Q0XL 1VACA 5EC2B 4TUJB 2FO1A 3PJSB 3HNVL 1LO5B 4JHBA 4QXUL 4RIRB 1M05B 5DSCB 3UXFA 3QWOA 4F7TA 3HZYB 4I0KA 1FP5A 3TBTB 3BSZL 4ZO6A 2X9XA 3LS4H 3CXDL 1S7RA 4JM2C 2ESVA 4U31A 4CN6A 4MXVE 2BOBA 3DV6A 4G8EB 5D7IF 2EDRA 2AJVH 3PWNB 2P8PB 5FGRA 3NIDE 5EU7C 3VG0H 4HWBA 1NGPL 2I25N 3FO2B 4K8RL 3X3GH 3SGDI 1UM6H 2EDQA 5A3IC 3OJDB 1ZS8B 1HHHB 2E9JA 5EU7E 5GGVL 4IMKC 4CKVX 4HUKB 3MRKA 1ZHBB 5T1DL 4Q58C 1QSEE 3D85D 5EC2A 3T3PE 4TUJA 3U1SL 3PJSA 1DQTA 4RIRA 4BZ1H 1M05A 5DSCA 3ROLB 3QAZB 1KSRA 3HZYA 2HWZH 1JRHL 3V52H 1NFIA 3TBTA 2FLBT 2E6QA 1YECL 4FOMA 5LGHL 1PX3A 2VAAB 2DICA 2ESVE 2YUXA 4WENB 4G8EA 5DD3H 1K3ZA 2X4TB 1UM5H 1VSCA 2P8PA 3JUYA 3TA3D 5DJ2B 3NPSC 3TYGL 5E5RB 3STLB 3FO2A 4NHUB 3B9VA 5F89B 1K2DB 3QPXL 3C9NB 3OJDA 1ZS8A 1HHHA 3EYQD 1L4IA 5JHLL 1FLRH 3PWUA 1JPSL 2LE9A 3C6LC 1EHAA 5DR5H 2NY7H 2O5ZH 1F8TH 3F7QA 3ROLA 4D0BB 4DK6A 1GOFA 3BKJH 3QNZB 5GRVL 5JUEL 5GGRY 2IPUK 4FXLA 4M1DL 1RIUH 3IU3B 2X89D 1OD7A 3KLSA 4X8XA 1X5JA 2X4TA 3FB7B 2NMSA 5DJ2A 3Q5OA 2HKFL 3VXNB 3X13B 3STLA 3QA3A 4LRNL 3OB8A 4NHUA 1GC1H 2HFEB 1K2DA 4PV9B 2ORBH 3C9NA 4KY1H 3BDXA 3KPNB 4M5ZH 5DC9B 3NACH 3I84A 3K7UA 4HMDA 1H5BC 5JIPA 4V1DB 4K71C 4JN1L 2VDQH 3QHZL 4WFFD 3T0BA 4Z7NF 5D1QD 1VFUA 1E4WH 4D0BA 3ARBB 3CCHB 3QNZA 3WDIA 4TQEH 5E2TL 5HI5C 1I1CA 3ZKNC 1YMHA 1DQML 1DVFD 2BNRB 2OTPA 3EYVB 5EB9A 3FFCB 3MZGB 5ESQA 4Y16B 3IU3A 1FFOB 1EJ6A 1D6VL 1AR2A 2GCYB 3J8F7 3V4VH 4XP9L 1TVDA 3FB7A 5BZWB 1NQBA 2VJXA 3VXNA 4W70A 2V17L 3X13A 1MFEH 3OAYH 2HFEA 5DT1H 1LK2B 1EGJL 3JWOL 4PV9A 2CR3A 5C0JB 3KPNA 5EZIL 5F7DB 1BBDH 3QFJD 2Z0BA 4NJ9H 4V1DA 4UB0L 1X3DA 3VDAA 1NAMB 1QUNA 4TVPE 1KT2B 3QEQD 4JDVA 1ORQB 3ARBA 3CCHA 5FCUL 4YHOL 4J4PA 1WZ1L 2YHGA 5CFHA 2BNRA 3JWNC 4HUMB 3EYVA 3CSBA 3FFCA 5DVKA 3O3EB 5CMAB 4Y16A 4ZNEA 3DHMA 5BRZB 3KHQA 1T83C 3KDMA 2GK2A 2DBLH 5BZWA 3BMWA 3ARGA 5F7EL 1MCBA 4ZQKB 1HHJA 4HJ0C 4JVPA 5MENB 3IKKA 4NN5B 4I3SH 5DK3A 5L8KB 1LK2A 5IFHH 2Z31D 1XF3B 4IRSD 3ZKMD 3PL6B 1DFBH 3MRBB 5C0JA 3LS4L 5F7DA 1RUPH 4Q9RH 2NZIA 5CJQL 4P2QB 1NAMA 4V1DE 1PBYA 1KT2A 5DEZA 3VG0L 3WV0A 3BQUB 2JJTA 3PHQB 1ORQA 2Z9TA 5CILH 3X3GL 1I7UB 5IEKB 4NRYA 1TQBB 2EDEA 1H3GA 4ZD3H 4KMTH 1S8DB 3MXVH 4AY0A 3O3EA 3U46B 1V7NH 4KKAC 5CMAA 3FFCE 5BRZA 1IGCH 1XIWC 4OCYH 3O2VH 4H20H 1JI2A 1KN2L 3CX2A 2PXYD 3MGAA 1RUKH 2ICWI 5HVHC 4ZQKA 4I3GA 4BZ1L 2XWBA 5FYJD 5K9JH 2R69L 4NWTL 2HWZL 3V52L 3ZLQC 1XF3A 3UTTB 4N5UA 3MRBA 4LQFL 1B3JA 1RAMA 3LD8C 4ERSH 5HDQH 2DQTH 3K1KC 3MA7B 5DD3L 5DMGC 2IBZX 3X14B 5DA0B 1ZLSL 1T80A 3BQUA 4GG6F 2D7TL 3PHQA 3WSQH 1T21B 5IEKA 1NCBH 1S7VB 1S8DA 3QIWB 4XXCC 3U46A 3P9WB 1EJOH 5DGQA 2FZ3B 3FQUB 1TZGL 5F9JB 3S7GA 2WBJC 3RVTC 5L9DH 1A7OH 3KPRB 4RMVA 5F1SA 2Z35B 5BRZE 4ZUSB 4C4KT 5K9OB 5DR5L 1BWWA 1WBZB 2XWJA 4JFED 2WWKO 3G5VB 3PL6C 5B38A 2WW8A 1B88A 2AJ3B 3W9EB 4M6OH 4HWEH 1SEQL 5MENE 3UTTA 1QRKA 4KVCL 5B38G 1PEWA 1VDGA 4HXBH 4K7PH 1BVKB 4P2QE 3MA7A 1TQBC 2VXSH 2NQCA 2OTWB 2WM0A 3C8HA 4RA0C 1KCRL 1A0QL 3PHSA 1GC1L 4FP8L 2Y1VA 1Q94A 1S7VA 1KELH 3QIWA 4KY1L 3BIKB 3W81A 2FZ3A 3FQUA 5F9JA 1WITA 3SDAB 4DOHB 3NZHH 1NDMA 4Y5VC 3MV9D 3RGVB 3RL1B 3CK0L 1YJDH 2Z35A 4ZUSA 5FO7B 4YPGB 3VXRD 5K9OA 5J11C 4RMTA 1WBZA 1E4WL 3QDJA 4HDIB 3G5VA 1I8MA 1OGTA 2CK0L 2AJ3A 4J8RB 5TF0A 4MVBC 3FTGB 3LHPH 1XT5A 5HHVH 2GJJA 3EYSH 2GYSA 1CD0A 4TUOB 4XVTH 3RUGF 3UTTE 4XZUA 3RDTB 1LDPH 3I6KB 3V4VL 2NLJB 1BVKA 4M1GL 2OTWA 1IAIH 5L2KD 1NDGB 2CPCA 1MFEL 2AGJL 4DK3A 1IC7L 1GOHA 5TE7L 1FNSH 3GBNH 3F65A 2AEWA 3SJVD 3GO1H 3QSKB 1BBDL 1JPTL 1AD0A 3BPNC 4U4BA 2W91A 3SDAA 5JORA 4EZMA 1A6WH 3RGVA 1EFXD 3RL1A 1U58B 2DD8H 3DURB 3KPRE 5FO7A 3ZL4H 4DKDC 2DM4A 3X3FL 3HMWL 4PS4H 4HDIA 1FFPB 1HWHB 1RUAH 3VXOB 4EDWL 4QHKJ 4J8RA 4LASH 1BQSA 3PGFH 1T4KB 3FTGA 3GMMB 3QO1B 1JGUH 2KZWA 4TUOA 1Z0NA 1E4KC 4NT6B 1NCAL 5CEZD 2HT4D 2QQNL 3RDTA 3EHBC 1X5AA 1SJEB 3I6KA 2PO6B 2NLJA 2VUOA 4LVOB 4EN3D 4XC3H 1WTLA 1TQCB 3CAFA 4LCCB 5DQ9B 1NDGA 3FOMA 4M62H 3W39B 4PG2C 1TNNA 3QDAA 4NCC2 4ODVH 2ARJQ 3IGAB 2FD6H 3OKDB 5JXAH 3FRPA 3P30H 4Q9RL 5DJXB 5C7XH 1A5FL 5IBTH 2Y07H 1Q1JL 4Y19D 4ZUUB 4DOHE 1U58A 3DURA 3M8OH 4ALAH 4JKWA 4NN6C 2DLHA 1R3HB 3FRPG 1FFPA 5IT2H 3VXOA 1QR1B 5T33H 1EZVY 1T4KA 1A6PA 3GMMA 4ZD3L 3QO1A 1NGWB 2YUZA 3MXVL 3IXAB 4UAOB 1V7NL 4NT6A 2XA3A 3FJTA 5TQ0L 3TVMA 4LCIH 1CLOL 3A6CL 3V5DB 1AC0A 1SJEA 3RZCD 4OCYL 3RVWD 3O2VL 4WGWB 4NC2B 3OG6B 4AQOA 2BNUB 3O9WD 3A67L 5IMLB 3LPWA 2CDGA 4LCCA 5DQ9A 1DQQB 3D39D 1BM3L 1P9MA 4RMWA 1P7QD 2IANB 3WXVH 2HMID 4PJFF 2AK4D 3FAWA 3IGAA 4R2GB 3OKDA 4BFGA 2ADFH 5DJXA 4HK3N 1NBVL 5F6IB 2V9RA 3EIFA 4ZUUA 4JDZB 5HDQL 3PP4L 3BYTA 2H32B 1R3HA 4YHZL 2AK1L 5IK3B 1IKNA 2FIRT 3EJJX 3V6BR 1QR1A 3WSQL 3VGFA 3O0RH 1VPOH 4DFHA 2FEEI 2MQCA 1NCBL 3CVHB 5DHVH 4U49A 2PO6C 1NGWA 2NXYB 5ICZB 3IXAA 3BW9B 5CUSH 5GGQH 4JN2B 4MZ3A 4M02A 1D7FA 2YMXH 4WFED 1QPXA 3RGHA 4J3TA 5E99H 2BNUA 5IMLA 4RAVB 1FG9C 1DQQA 2D31B 3C8KB 4KQ4H 5GSRB 2V2TA 4M6OL 4XNYH 4H8WC 4HWEL 1J8KA 4WW2B 2XG4A 4NP4H 2GJZB 2IGFH 2HT2C 2Y7QB 3DX6B 1RIVL 5EU6B 1IZJA 4JDZA 4NZUH 3P4MB 2H32A 5D4QA 5F3HB 4G5ZL 4QWWD 3T0VA 3DX9B 4WCYH 1FAIH 4RFEB 3J7HA 4MAYD 4X7EC 2GSIB 3CVHA 1MEXH 5FUOH 5ICZA 3BW9A 1S9WB 2L0DA 1KACB 3KPOB 4JN2A 5FO9B 1FH5H 3RPIB 4WU7A 5KSUA 2J4WL 3LKNB 2EYRB 1YJDL 3AROA 3MRQB 1CICC 3KPPB 1IT9H 1CXEA 5JO5B 1LEGB 3TIEB 2D31A 5GSRA 5HI4D 5HHVL 4WW2A 2IANE 4CAGA 1N5YH 1OP9A 4D8PA 4XVTL 3EZ8A 4XNZC 3WS3B 2GJZA 1KJVA 2Y7QA 1CFNB 3DX6A 5F7HA 5EU6A 3DXAB 4NO3B 3P4MA 1HCVA 1SHMA 4JQIL 3WDJA 3P3YA 3IT8D 1ZK9A 5F3HA 3JTSB 5BS0B 1IAIL 2DIAA 3DX9A 4F37K 3OSKA 5KZCB 4RFEA 1BD2A 2GSIA 2ZUVA 3OAUL 1N64H 2Y4SA 1FNSL 1FORH 2PTVA 5DFVC 3OB0H 1S9WA 4TUKH 3GO1L 3KPOA 3R8QA 2UUDH 3GHEH 1AI1H 4U1SB 5FO9A 5I8KH 3RPIA 3L3HB 3LKNA 2EYRA 3JBG7 2DD8L 2H2PD 3ZL4L 3MRQA 4I3RH 1YEJH 4YBLC 1YYMH 1IEBB 5JO5A 1AHWC 1LEGA 1AC6A 4JRXB 3TIEA 3F12B 3PGFL 4L5FL 1NLBH 1JGUL 3HUJB 3OXRA 2VLRB 1OTUC 3MNZB 3WS3A 1IFHL 1CFNA 4UOW1 3DXAA 4HT1H 3T0XA 4NO3A 1FIEA 5EU6E 3JTTB 1CS6A 4XC3L 5BS0A 1YYLH 4W6XB 3IAGC 4M62L 4OGXL 4OFVA 2JLLA 4KK6C 4ODVL 2ZUTA 3EKCA 4RGMB 1AKJD 15C8H 5C6WH 2FD6L 4PV8B 5C86A 4N0YH 5A40E 4GO6B 2Y07L 3L3HA 3OR6B 5KSVB 3O6FC 2M2DA 4ALAL 4FQIH 3QIBC 3H3PL 1VFBB 1IEBA 5TE4H 2ZZUT 4MLIA 4JRXA 4JCMA 5T33L 1G7LB 4QTIH 3F12A 3B9EA 3E0GA 4KJQD 2OTUB 1KIQB 1ERNA 5KSAD 3HUJA 2VLRA 3MNZA 3HLAB 4LCIL 4PLKC 2L4OA 5JOPD 3GBMH 1II4E 3DXAE 4KROB 3JTTA 3CUPB 3UTZB 1OTSD 3DHJA 1MY7A 1I9IH 1Y0LB 3FB6B 1CL7I 2IH3B 5BS0E 2NTSP 2HH0H 3QUXC 5LAXB 4I4WB 2AJYH 3WXVL 3QRGL 2O61B 4J2XA 4PV8A 1FPTH 4EJ1C 4FHBD 4ZFOB 2VB5A 3OR6A 5KSVA 1NEUA 3BGAA 1G9NH 3EO0B 5BZDB 3HA0A 4GRLB 1VFBA 2QTEA 3SO3C 4MNQA 1G7LA 4IRJB 1VPOL 4JRXE 3WHXB 5CJXA 2OJZH 2OTUA 1KIQA 2AJXL 3BGFB 3HFML 3QXDB 4FQHB 5T1LB 2P5EB 4I5BA 1DCLA 3SEPA 5I17B 3W11D 2VLRE 1UACH 3WJLA 5EIIB 1BF8A 4Z9KB 3RKDD 3WS6C 2IALB 2MTPA 2EDJA 3VFMB 1Y0LA 5GRWA 3FB6A 1T5WB 1ZEAH 2IH3A 3B8YA 4KQ4L 4PJHF 4XWGL 4YHPB 4K9EL 3QCTH 2E8ZA 3WIIH 3VH8G 5LAXA 4I4WA 1K3IA 4MS8C 1RD6A 4YHLH 1FYHB 1W2KT 4GW4B 4NP4L 1MCLA 2MMXA 4OLEA 3D48R 2IGFL 4ZFOA 4NPYB 3EO0A 2QV2A 4GRLA 3B4NA 3TJEH 2MHAB 5MEQB 3BN9C 4UU9B 3TPKA 2YRZA 3G9VA 4C56D 5BCAA 4WCYL 3AY4C 4IRJA 4FG6D 2HFTA 3K4DA 4FFYH 4PJ9D 5FUOL 5JXEC 3QXDA 4FQHA 5T1LA 2P5EA 3H8NA 4MDIB 5I17A 2EO9A 4NC0B 3BMVA 1FH5L 5CZKA 5EIIA 1HSBB 1VFMA 4QRUB 3P9LB 2IALA 4JZNB 5DI8B 5E8NB 3AS1A 2DTSA 1OL0A 3RWCB 3HC3L 1T5WA 3ARED 4OZGF 2EDLA 4X9GA 5GRYA 4GW4A 4WV1B 1GGCH 3HB3D 3LOWA 1TJIH 2IEPA 3LSOB 5B3JE 2XZAH 1N0LA 1TENA 1Q38A 5MEOB 2MHAA 5MEQA 4UU9A 2D4DA 2YSSB 5BMFH 1QNZL 1MJ7H 3D25B 1QD0A 1QFOA 4HCRA 1FORL 5EBMB 3VI3F 4MDIA 5J13C 3G08B 3GHEL 2P5EE 1C5CH 1NEZB 1HSBA 3GJFB 4OCLC 4QRUA 3P9LA 1KXTB 4JZNA 5DI8A 5E8NA 3BZDA 2FHFA 4MXQC 3RWCA 4F9PC 1YYML 4YDLB 4PPTA 3SKMB 4KV5E 5CJ5A 3EUUA 4IRZH 3HR5B 4NSKB 3PHOB 5DURD 2R4RH 1RFDL 2VLJB 1JZ2A 4WV1A 4X7DC 4G7VH 1MUJA 4FQJL 5K33A 3ZYZA 1UKTA 4CMHC 3LSOA 4NO2B 4KVNL 4HT1L 3RZWA 4R90H 2HG5B 3FB5B 5MEOA 4MQ7B 2BVEA 3UDWA 2YSSA 5I2IB 3SCMB 5GS0L 3L5IA 3VWJD 3D25A 3D2UD 5CBEA 2GKIA 1E27B 4XVSH 5EBMA 3H7BA 15C8L 3SE3A 3G08A 4L4TD 2AJSH 4N0YL 5C08D 1NEZA 3GJFA 2A73B 5DRWB 4FQIL 4M1CD 4LMQI 1BFSA 3DYOA 3JV0A 3K0WA 3SKMA 3TA3C 1NEZG 1U8OB 3HR5A 4NSKA 2JIXD 3PHOA 2VLJA 32C2B 1KTDB 1U8JB 5K9QG 1IAOA 4NO2A 3EYQC 1U91B 2HG5A 3FB5A 1HSAB 4MQ7A 1M7IB 4LVEA 1RIHL 1P84K 1LO0L 4R97C 4JZJC 5I2IA 1I9IL 3O2WH 1CU4L 3ABZA 3SCMA 4HKBB 4DW2L 2IF7A 3QFJB 1AY1H 5I1KL 1MRDL 2HH0L 4PRID 2WINB 4IOFD 2AJYL 5KBNC 3S3PA 1E27A 3MJ7B 5IHUL 2Y23A 3WXWL 2BVYA 4IJ3C 4QRRB 1WSST 1RZJL 4LLWB 5D72L 1U3HC 2A73A 4BZYA 1JZ3A 1G9NL 1CDIA 3CFBB 1LP9F 2P47B 4LIQH 2MWCA 1MAMH 1FNGB 1JWSB 4PR5A 1U8OA 2O5YH 1L9NA 2OJZL 1SVCP 3GGWB 4IS6B 32C2A 3UPCA 4HBCL 2ATKA 1T2QH 1KTDA 2VLJE 1OT2A 2CSPA 4IIQC 5CIPH 1UACL 3CFCH 1LEKB 1JK8B 4LHQB 1U91A 3KYOB 4K7PX 4LPYA 1YEEL 1HSAA 3B3IB 1M7IA 5FYKU 4IRSB 5CP3A 3L3GB 5D1QC 3MOQA 3QFJA 4G6JL 1OAUL 3WIIL 5HYJB 4YHLL 3MJ7A 2VZUA 4TTDD 2G60H 1WAAA 4QRRA 2D7QA 1DVFC 2CKBH 4LLWA 2IAMD 2BFVH 3QJFB 1JYNA 3CFBA 2H2SD 3BPOB 2OXGA 4UV4L 4PJCB 4Y5YB 3LRSB 1FNGA 5KOMC 1ZANH 4YHYB 1JWSA 4NC1C 1MCRA 2XZQH 4OZHE 4OFDA 4IS6A 3QDGD 3T0DA 1MI5D 3WKNA 3ARPA 1LEKA 1H3UA 1SMAA 2F15A 3KYOA 5C3TA 4WW1B 2LU7A 3B3IA 5DRXB 1WFTA 2Y5EA 2PYEB 4DVRL 3RQ3A 3L3GA 2E7LC 2AKRB 4LLAA 5HYJA 5DMIL 3QFJE 2VZVA 1ACZA 1GGCL 3MLTB 1TJIL 4URTB 1WAAE 3LZFH 5HTSA 2A38A 4LSUH 3QJFA 5GQBA 5F70A 2Z8WC 3T2NH 5BMFL 4Y5YA 3LRSA 3L7FB 1MJ7L 4X7CC 1QQDB 4ZOAA 2ERJC 2VDNH 2VE6B 4BSVB 3FN9A 3EFDH 3C08H 1J7VR 2Z31C 3GIVB 4Y2DB 3ZKMC 2PUQT 4KDTA 1GHFL 4Z7UB 4Y4HB 3UTPE 4WW1A 5DRXA 5TQ2L 2PYEA 1D3CA 4U1JB 2CRZA 2C3VB 4I48B 1IAKA 2AKRA 4IRZL 3FB8B 4PD4K 5HYJE 1QYGH 3MLTA 2I60L 1BJ1H 1YNLL 4Z7VF 3WFCL 1QRNA 1VGKB 5KS9B 4KHXH 5FGBC 4PUBH 2PXYC 3KHOA 3L7FA 4PJCE 9CGTA 3CU1A 4YHNB 4LK4A 1S9KC 4Q97A 1QQDA 4PJAB 2VE6A 2FBJH 1HH9B 4AEFA 1EO7A 3GIVA 4Y2DA 4Z7UA 4Y4HA 2OMBA 5EO0B 5FYJE 4YR6B 2F8VA 4OSUL 1F42A 4I2XB 3U30C 2VZSA 5H35A 4U1JA 1HQ4B 2DQGH 2C3VA 2PYEE 4I48A 5HYFA 4F7PB 2JB5L 3FB8A 3VD7A 4NZJA 3RTQB 1Q8MA 3T65B 1M7DB 3ZE0F 2J1KA 4LFHG 5L2KB 1JZ6A 4XTRD 2HJKB 3BDBA 3ARSA 5FKPB 5HVFB 3RFZC 1UADC 1VGKA 3SDXB 3SJVB 3O2WL 5CCKH 1AY1L 4YHNA 4XBGA 4OCNC 4RX4A 3QNYB 2PR4L 4OJFH 4PJAA 3S98A 2Q8AH 3SQOL 1BFVH 1HH9A 3QEUB 3GJFK 2D03H 2HVKB 5F9OL 3TCXA 4JFEE 2EECA 4NQEB 4NJAL 5EO0A 4YR6A 4Z7UE 2ILLA 4I2XA 3MA9H 4QRQB 1HQ4A 1CFVL 3G6DH 3QIUD 5CEYB 4N8VB 4F7PA 1FVDB 1TJGH 3BUTA 2E5EA 3RTQA 5L0QC 4F15C 2ZJSH 4M48L 3U4AA 1G6RH 1KEGL 1M7DA 1T2QL 3Q1SH 1QR4A 5E6IC 5DD0H 1J8HA 2HJKA 4Q9BA 2B39A 5FKPA 2FNBA 4FNLH 4YHMH 5D6DC 4G80B 2BX5A 3SDXA 3V95A 3VGAB 5KS9E 2FECI 3ZTJH 3MLZL 3ULUH 3QNYA 3S34H 4MCZB 5I1GL 3VRLE 1A47A 1NKRA 2G60L 4PJAE 3QEUA 4LU5H 2CKBL 1HILB 4CVWA 4YQXL 4ORZC 2XTJD 4GT7A 4NQEA 4PJXB 3QWRA 2EICA 4QRQA 2NY3C 4I2XE 3MRMB 5CEYA 4N8VA 4X6BA 1FVDA 2XZQL 2V5TA 2LU3A 4TNWK 3GM8A 5ACLA 4N8VG 3S3SA 5JW4M 3HI5H 4OQTH 4XT1C 5IF0B 5L2KE 3DMMB 4L1HA 5C9JB 4G80A 2AK4B 2BY0A 2DQDL 1RVFH 1IZKA 3SDXE 3SJVE 3D3VB 4WEUD 2C26A 4MCZA 3P0VH 2F54B 5EIQA 2XY2A 5I66B 1XH3B 2GFBB 4PJXA 4LGPB 2HT4C 1N26A 4AT6B 3DJ9A 2F53B 3T2NL 3MRMA 2VDKL 1U42A 4ZODA 3HNSH 4EN3C 4YHKH 5CEZE 4APQD 3ARUA 3V0VB 5I1HL 2VDNL 3DNKA 4K07A 2VDMH 1J1XL 1IL1B 1QLEH 1HQRB 3WNLA 1GSMA 3DMMA 1CDUA 5B21A 1Q9KB 1NBQA 5C9JA 1HKFA 5EZOL 4ZAKB 3VXUB 4YC2C 3D3VA 1QFHA 3ESUF 3UBXI 5I30H 5D7LB 1QYGL 2F54A 5IQ7H 5I66A 1XH3A 1OAXH 1CG9B 1AP2B 2GFBA 2JCCA 5DD5H 3WLBB 4MAYB 3TEUA 5C0DB 4AT6A 2ZCKH 3BRDA 5T3XE 3RZCC 4PJXE 5SX5K 2F53A 3VDCA 3ZKXC 4PUBL 4Z8FH 2DWDB 4QXGH 3O9WC 1Z9OA 2R2CA 1MCQA 1RURH 1QLRB 1RK1B 3UPRB 2FRGP 4PTTB 5HGGS 2HMIC 1IL1A 1HQRA 5D7JB 1QSVA 4TN9A 2R1WB 3WFBH 5J0BA 1VFAB 1Q9KA 4OFPA 2EKSA 2DQJH 5F8RC 2AK4E 4V2BA 4ZAKA 3VXUA 4I18B 4XP1H 2P43B 1U2HA 3D3VE 4WTZA 3BDYH 5D7LA 1KLFA 1CCZA 3BP5B 4JKPH 5D1XD 4DUWA 1CG9A 1AP2A 1IBGH 3HC4H 5C0DA 3WLBA 5DJ8B 2EYTB 3SDDD 1HH6B 4WTZG 2G9HB 1U8KB 5FHAH 4QOKB 2G75B 2I27N 3HE6B 2F53E 2DWDA 3G6JF 3NCMA 5IROA 4EI5D 3VMPA 4LP4A 1QLRA 1RK1A 2LVCA 3UPRA 4GRWB 4PTTA 3C2SA 4YUEL 5B4MC 4ZMAT 3MLXH 4WGVB 1YQVH 1BFVL 3WIHA 2D03L 4M93C 1DUZB 5D7JA 4F8TA 2R1WA 5I0DA 5JQHC 1VFAA 2WLYA 3O6LH 3MA9L 4ELMB 1WT5A 2IQAA 2QEJA 3G6DL 4BQ9A 1TITA 4I9WD 1TJGL 4G8FB 4MAYC 4YWGH 2ZJSL 1FNFA 5D7LE 3BP5A 5HPMB 2YBRB 1A1MB 4PY8J 5DJ8A 2EYTA 4GXUM 4OV6F 2XN9D 4L3CB 1HH6A 3UJJH 4RAHA 1KB5A 2EIDA 2G9HA 1U8KA 3S36H 4FNLL 1A6ZA 4YHML 1YEFH 4QOKA 1AKJB 2G75A 3HE6A 4U1NB 2EXYD 2BY3A 1S9XB 5EO9B 5JLZB 1MIEH 3ZE1F 3V5KB 3ULUL 5HI4C 4FTVD 3O3BB 4MXVF 1S7UB 3N50A 3NA9L 5SWZB 2NY4D 3MRIB 2XQYG 4EOWH 2OL3L 3NIDF 2XRAH 4JM2F 4ELMA 4PGEB 5EPMB 2NPLX 3TPUB 5KSAB 2X5PA 1KN4L 2FO4B 4JEGB 4X4YB 1NSNL 2QKIB 3TZVD 3SPVB 1CE6B 1D5MB 1G7JB 4G8FA 4TOYH 2BMKA 3ZE2E 3IDYB 3B8SA 4WWKD 1OAKL 4JFFD 4NHCL 1K6QH 2DYPD 5HPMA 3VWKB 2YBRA 4GAYA 5DEFB 5DMYA 3HI5L 1A1MA 2FX7L 5GHWL 3T3PF 4L3CA 4K3GA 3SY0B 3CSGA 3CX5K 4XNQB 2QLVB 1RVFL 4GAGL 2H2PC 4QOKE 5A1AA 1EO8H 3SE4C 4WHYG 1S9XA 4IEFB 5EO9A 4BQ8A 2CK2A 5JLZA 2A6IB 3V5KA 3DVGB 4PJ8D 5D2NB 3O3BA 4GRWE 1UH3A 1WBXB 1EUUA 3GHBL 1S7UA 1I1AB 2Z93B 5SWZA 3MRIA 5MERB 5M95B 3SGKC 1BX2B 1MY5A 1FZJB 3GUTB 1JNNL 3B5GA 4PGEA 5EPMA 3TPUA 4LOUD 1U3ZA 2FO4A 1GC1C 5GRUL 4ELME 4X4YA 3HNSL 2QKIA 1XF1A 3SPVA 1CE6A 3S88L 1G7JA 4BJLA 25C8H 1IMHC 3VWKA 1CFTB 5DEFA 2R0ZH 5GIRB 3GSVB 3BE1H 3QXUA 4S1QH 3SY0A 3F5WB 5I0ZA 5HJ3B 4NKDB 4XNQA 4NM4H 4U6VL 5ID1B 1J18A 5C0BD 1DQLH 2A6IA 2V9QA 4NN7B 3DVGA 4GBXD 1B0GB 4K94L 1EBAA 5D2NA 5E2VH 2P42B 5AWNL 5E6YA 3UAJD 3C09B 4JKMA 4KJQC 1WBXA 1I1AA 3K1DA 2Z93A 5MERA 5DD5L 2C9AA 1BX2A 1FZJA 3GUTA 1ADQA 1T7XA 4N8CH 1J1PH 2CUIA 5ADOL 4Z8FL 5F1IB 1OTSC 1RURL 4E0RB 2P49B 4MQXD 5KANG 5E2UL 5JOPE 3REVB 1SBSH 4KZEH 1CFTA 1R0AL 5GIRA 3GSVA 3I6LD 2BNQD 3AREB 4OIIL 3VD9A 1OB1B 4X6CB 1EMTH 4E42B 5HJ3A 4NKDA 3VGGA 1B0RB 1F45A 2EIZB 4H1LG 5E9DB 4DAGL 5ID1A 2R8SH 1R3KB 3H6JA 2E6PA 4Y5XB 1EXUA 5C09D 1B0GA 3MSPA 3BDYL 4JDTL 1D5IH 5D2NE 4JKPL 1EVUA 5F7LB 1N4XL 3HC4L 4K3JH 1OAYH 3W11C 5BV7L 5FHAL 3QRFM 3IVKA 2X1WL 2DQEH 1P4LB 1P53A 3RKDC 5IB2B 4P57B 4XC1L 2X7LB 3BZEB 4E0RA 3TBWB 2NNAB 3TT3H 4JG1L 4EXPX 4UV7H 4HUXA 3REVA 4CL7A 4WFHD 2VC2H 5DUMH 1QBMH 3CIQA 4PJEB 2B1HH 4HWBH 1CD8A 3KS0J 3AREA 4U0QB 4X6CA 5DURB 4E42A 2FJHB 1B0RA 2EIZA 5E9DA 3IF1B 2JB6B 3FMGL 3DGCR 1G9MH 1R3KA 5SV4A 4Y5XA 1J88A 4P5TD 1N6UA 4FG6C 2LTQB 1PAMA 3QUMB 4PJ9C 2E8YA 4LLQB 4CW1B 4Z5RB 3UJJL 1IGTB 4MD0B 3VWJB 2Q76B 3RAJL 1F58H 1P4LA 5I1JL 5IB2A 4H0IA 4P57A 2W9EH 2X7LA 5D70L 3BZEA 2NXZD 2NNAA 2RIKA 1MIEL 3HI1B 4FZ8H 3TBVB 1V05A 1CVSC 4JB9H 3WIFB 4JPKL 4PJEA 3BKMH 3MROB 4M7ZB 2AJUH 4EOWL 5I71B 1GXEA 2X4RB 4CDGC 2XRAL 1UG9A 3KLHD 2FJHA 4X6CE 3V6OA 3IF1A 1EEUA 2JB6A 3KS0H 4G3YL 1LHZA 4F58L 4O58L 5F7WC 5E9DE 5CSZA 4PTUB 1JWUB 1KENH 5DQDH 1YC7A 2HT3D 3K2MC 4LDLB 3QUMA 5DDHB 5ALBL 5DJDB 4MA3B 5A2KH 1KPVB 1FIGL 4LLQA 4CW1A 3HMXL 5EUKB 1IGTA 3VWJA 5HI3D 1CGSL 3QUZC 2OI9B 1OGAA 3GFUA 5D1ZA 4OF0A 5IW6A 1INEH 3HI1A 2ZPKH 3TBVA 4XWOD 4N0RA 3NAAH 5EG6C 3WIFA 4BQBA 4U7MA 4WUUA 3HCVB 1OARL 3LPGA 1BQLH 4HC1A 4NFCA 3IXTB 4YEFA 3MNVB 2HKHH 1DQDH 3V6OE 1OHQA 4MJID 4U6HB 4PTUA 5TDOB 4TVPH 3I50H 25C8L 1SYSB 3CC5B 3I3EA 3F7PC 5CJOH 5DDHA 1KGCD 1YJDC 3L5XL 4JFHD 1A2YB 4M7KH 4MA3A 5DJDA 4JREC 1KPVA 5KVFH 2KDGA 5EUKA 3BE1L 4X5LA 3VD4A 4S1QL 1CGWA 3T04D 4Y4FD 3ULUD 3IAPA 1QFWH 1CXLA 4M1CC 1RZIB 1T0NB 3TNNB 4HUWA 4M7JL 4MAUL 1DQLL 4R6UA 4L4TE 2IAMB 5TDNB 2XQBL 4HLJA 4UINL 3KR3H 2VITB 4G43B 5C08E 5E2VL 4WI4A 4PJDB 2WIIA 5T3ZE 1FFRA 4HFWB 4RAUB 2F74B 4JO3H 5ILTL 1JF6A 3HCVA 3QI9B 4NKMA 4XP4L 3IXTA 1J1PL 3MNVA 3D9AH 2VDLH 1H3TA 2CLZB 4U6HA 4K3DL 3C60C 5TDOA 1Y6NR 1S7XB 5K9KB 1CI5A 2FH6A 1SYSA 5IB1B 3CC5A 3S96A 4IOFC 1GGIL 1A2YA 4KTEH 1H8NA 2YS4A 3FO0H 5C2BH 35C8H 4PG9B 4F80A 1RZIA 5FCSH 1T0NA 3TNNA 4L8SC 4XVUD 3BISA 2R8SL 3RVXD 4PLNC 1JGEB 5TDNA 1X4YA 1KCSL 2VITA 3WJJC 4PJDA 1D5IL 4LAQL 2F5AH 1P6FA 4HFWA 2BK8A 3MJ9L 4RAUA 4K3JL 2F74A 5E00B 2CRIA 3I85A 2DS4A 3QI9A 2NW2B 4X6DB 3QUKA 4MXWL 2RAMA 1YPZF 2Q1EA 4U0RC 2AV7B 1NAMH 1S7XA 3X12A 3QUXA 1L7TH 5IB1A 3SGJC 4UV7L 1C5DB 2OJEB 3B9DA 4G6ML 1I1YB 5DUML 1QBML 5CSBA 2B1HL 4HWBL 3QHTC 4PJGB 2IMNA 1A7NL 2Y36H 1IKFH 4N5ED 3BUYB 2IAMC 1CGTA 2DI9A 3GSWB 4PG9A 2H2SC 3WDHA 4K7PY 2M8XA 4IHOB 1JUFB 2SEBB 2HA1A 3F6LA 5CHNA 3TESA 4FFZH 1H9VA 1CDGA 2H41A 4PJDE 2OBGA 3O3UN 1HYSD 5DTFB 5E00A 4R96B 4J6RL 4QXTB 4PRPB 3PP3K 4FZEH 2CKNA 3HC0B 5INDB 4X6DA 1F58L 1E4JA 3O8XC 3OPZH 5DUPL 2W9EL 3QDGE 4HZAA 1GGBH 2AV7A 4FZ8L 4PY8I 3RI5K 2ZKHL 5CJBA 3BOVA 1C5DA 2OJEA 4HLZH 1I1YA 2VXQL 1I85A 2X10A 4PJGA 3BKML 4KHTL 2FHCA 3BUYA 2VH5H 3GSWA 1XMWA 4LMQE 4YBHA 4GUPA 1FCGA 4YAQB 3QP3A 4IHOA 1JUFA 2SEBA 3O6KH 5DQDL 2WUCL 3DO3A 3V7AG 4JRYD 3KPMA 4P4KB 4B7IA 3ES6B 4R7DB 5DTFA 4OFKA 4XPHH 4R96A 1UCBL 4DTGL 4QXTA 4PRPA 4OLZH 3HC0A 5INDA 4DVBB 4M9PA 2ZOKB 4NNPH 4X6DE 4O51B 4WO4D 1R5VA 4UNVA 5LCVL 3P4OB 2ZG2A 4J3WA 2YXFA 1INEL 1LILA 1BZ9B 2ZPKL 4UQ2B 3O6ML 2E7MA 2MCG1 5DZOA 3CFJA 3LQAH 4L4VA 4PJGE 3RI5F 1G84A 1I9JH 4NO5B 5D2LF 5I74B 5JDJA 1RI8A 2GEEA 4PGZA 3V7AE 2XOTA 4J3UA 4ODUB 4YAQA 4G8GB 1OTTD 1DBML 3H9SD 4TVPL 3V5HB 1MOEA 3I50L 2AXFB 5CJOL 4IDJH 4P4KA 3TC9A 3ES6A 4M7KL 1P7KB 4AG4L 3LS5H 4NZTH 3ARDC 4EBQL 1MCDA 3RBGA 3EDEA 3V4UH 4PRPE 3V8CA 1OPGH 4ZXBD 2ZOKA 1QFWL 2CR6A 3O41B 4LVNB 3BFOA 3P4OA 3QCUH 2EDFA 1BZ9A 4UQ2A 2EEBA 3NCJH 3VG9C 2IJ0C 1ETZB 4NKIH 3ECBA 4POZC 3OF6A 2NY2D 4NO5A 4XTRC 3VA6A 1N6QH 3WYRA 1ITCA 2GK0B 3BAEH 3D9AL 2YUWA 4ODUA 4G8GA 1KB9K 4PBXA 1CXKA 3DBXA 3V5HA 4OFIA 5T5NG 1CTNA 4M5YH 4P9MH 1P7KA 4KTEL 3RU8H 3FO0L 5C2BL 1T2JA 2B7DT 3AS3A 2LAAA 3O41A 5FV1L 3UYPA 3O81A 3QIUC 3V0AC 2F5AL 3CLEH 5E1AB 1ETZA 1IGML 1ITBB 4JRWA 1F4YH 3DVNA 1JF1B 4F3FB 1UYWH 5GJSH 4UUJA 5EOCH 5IMOB 1P2CB 1CDHA 2GK0A 3WO4B 4Z7QE 5IKCB 2WAHA 4JY5H 3VGEA 3MV7B 4G8GE 3ZMRA 1PSKH 3OQ3B 3TV3H 4LCWD 4P9HH 3MGTB 1U3HA 2RBLA 1IKFL 5BOPA 2CRMA 2XTJC 4WWID 2V6HA 1Q9LA 2NYYD 4IOIB 1NFKA 3TFKD 1PLGH 5KAQF 4FMFA 4ZUVB 4OF5A 5TGBB 2BC4B 2YPVH 4P2OD 4FFZL 3GSRB 2BY1A 1AQKH 4HIEA 3UC0H 3KPLB 3SBWA 1TCRB 4JQVA 2FX9H 5E1AA 4N0FB 2B0SH 3VW3H 3SE8L 1JF1A 4FZEL 5IMOA 1P2CA 3BJLA 4G6FB 5IKCA 5F97E 2W65A 1SBBA 4U05A 4JAMB 4ONGH 2X9YA 3MV7A 2ZG1A 1J86A 3SHSA 2ZP0T 4IDLA 3TJHD 4AEEA 2YPKB 3TN0D 2X40A 1G9NC 1PG7L 5HDOA 2YWZA 3MGTA 1FGNH 4JFYB 2X42A 4MSWB 3STBA 4WRLA 2Y06H 2AEQH 2VH5L 4IOIA 3GB7B 2R4SH 5D1XB 4MQSB 4LSTH 4ZUVA 5FDWB 1Q9WB 5TGBA 3SDDB 2BC4A 1NC2B 4HHAB 1RJYB 3GSRA 1JGLH 1XCQB 4EEEA 4APQC 3KPLA 1TCRA 1ND0B 4XPHL 4X83A 3ZYJA 1NKOA 4GQ9L 2H6PB 4PRHB 1V3JA 4OLZL 3R1GL 1KLGB 1UB5B 2APBA 1MWAB 2W92A 4HIJB 3P2TA 4JAMA 2EDHA 5F1NB 1AFVH 1C08B 4KI5D 3MV7E 2H32H 4EQ2A 1GGUA 4D2NA 2YPKA 3U9UB 3RJDA 2EEAA 5MHSD 2DQCL 3LQAL 4O9HH 2AEPH 1MQKL 1PZUB 5GS2H 3CVHH 2YK1H 3VXTB 4MSWA 3IFPB 5CD5D 6CGTA 5KN5B 3GB7A 2A9NH 5FDWA 1OOAA 1V7ML 1NC2A 1E6OH 2DLIA 4HHAA 1RJYA 2P8MB 1XCQA 2IPKA 4IDJL 1ND0A 4QNPF 1JTTA 3QXWA 5EOTB 1F13A 4HH9B 2BHZA 3T3ME 2H6PA 4PRHA 2O5XH 3QEGL 3EJYD 1KLGA 1UB5A 3I75B 1FLTX 1OPGL 1MWAA 5FUZH 4HIJA 5DJCB 5ICYB 1H0DB 3QCUL 3UBXB 1P84J 5F1NA 4ONFH 1G7IB 1C08A 5E4IA 3NCJL 3RL2B 4RFOH 1KJMB 4LAJH 3U9UA 2APXA 5LXGH 2OM5A 3MRCB 5IVXF 5D1XC 2ED8A 4GH7B 2VLLB 3VXTA 3IFPA 5DA4A 1N6QL 3SDDC 3BAEL 4WWKB 1DL7H 3CFDB 4JFFB 2DYPB 4OTXL 5L7XL 1ZOXA 5C0AD 4EI5C 1D6EB 3MV8B 1JNJA 2P8MA 4TPRH 2C3HA 4PYHA 4MMZC 2V7NB 5EOTA 4AL8H 2WZPD 4P0DA 4HH9A 5LJYH 2HTKD 5KVMC 3ULVD 3UROR 3JV6B 3I75A 4PRHE 4XPAH 5DJCA 5ICYA 1JV5A 1T03H 1H0DA 1NAKL 4OT1L 5EOQH 4RGNC 5DLMH 1OQOA 3BPLC 1I7ZB 1G7IA 2R56H 3MGOB 5C0EB 5DHYB 3RL2A 1FYTB 1KJMA 3CLEL 4OIBA 3MRCA 3KXFB 4LSRL 4K3HA 4LPVA 2VLLA 3RHWK 1J9CT 5SV3A 4TVPD 2PW2B 5AD0B 4I9WE 3U7WH 1S5IH 2XZCL 1TXKA 4WWKA 1W0WB 4JFFA 3CFDA 4D9QE 4JY5L 3LB6D 5FA4B 5ABDE 1KULA 2EXYC 1ZLUK 1D6EA 4ZOBA 3MV8A 5EUOF 1PSKL 2FB4L 4PLOB 3TV3L 4ZFGH 2BSRB 3GKWH 5FO8B 3JV5A 3JV6A 1JGVH 2NY4C 1NGQH 3BD3A 3CJJA 4KV5F 1LWRA 4RMUA 3T0AA 4JFXB 1I7TB 4NNXB 1J0KA 1I7ZA 4YFLF 2YPVL 2IMMA 3MGOA 3TZVC 5C0EA 1QSZA 3UC0L 5DHYA 5KSBB 1FYTA 2B0SL 2MCPH 3VW3L 1OM3H 3C5ZB 3QWQB 3KXFA 3UEZA 5CGTA 3U83A 5GGSB 2PW2A 3MO1B 5AD0A 5F7YC 5H8DA 2CH8A 1W0WA 1YN6B 4HG4K 4O02L 3PWJB 5FA4A 4JFFE 3UCRA 3GKZA 4D3CL 3ARBD 3SKNB 4J4PD 5J1TC 1AGFB 4PJ8C 2BNRD 5INCB 3FFCD 2X1XR 4I0PB 2GSGB 2UWEF 4BZ2H 2BSRA 4Y16D 5D7KD 4F57L 3DUUB 3B9KB 5FO8A 2WMPA 3ESVF 3LEVL 5BO1H 2Y06L 2AEQL 3S8WA 4M03A 1FL3B 4JFXA 1I7TA 4NNXA 3ARGD 4HQQH 5F9WC 3WD5H 4LOUC 3T2PA 1RY7B 3QUYB 4X6EB 1JGLL 4OB5L 1Z9MA 1DBKL 1UKQA 2FX8L 3GZKA 5KSBA 1KNOB 3CNKA 1YNTB 4WI6A 1L6ZA 3C5ZA 1BAFH 1FYTE 2W0KA 1JZ4A 3MLSL 3KXFE 5GGSA 4JPWL 3BGMB 3MO1A 1A6VL 3QR2A 4X5WA 1JYWA 1YN6A 1MHPH 3PWJA 1AH1A 4XP6H 4FABL 3U9PH 1DSFH 3ARFB 1AGFA 1P5UA 1ZA3B 4GBXC 4XCFH 5INCA 3R0NA 4I0PA 3UAJC 3ZYIA 2GSGA 3MCKB 4O9HL 3DUUA 3B9KA 3CVHL 2YK1L 1S7QB 4OCXH 3VCLB 1FG2A 1FL3A 3ZO0A 4GQPH 3N1MC 4LNVA 2R2HB 2Y9RT 3E3QE 3QUYA 4ZS6D 2ED7A 1EFQA 3NIGF 4LHJB 1A3RL 4MQXC 3BP4B 4KWUA 5D96C 4B7LA 1KNOA 4P2RB 1YNTA 3BPCB 4JHWH 1S78D 5KSBE 1BHGA 3QZWB 4WDIB 3W82A 3BQUD 4JQXA 3SDCB 4P49A 4F7EB 4X7SH 4DEPB 4DZBB 2YRLA 4OKDA 2XKNA 3ARFA 4YZFF 1ZA3A 2ED9A 3MCKA 5LXGL 4WEMB 4XMPH 1BQHA 4AENB 4R4ND 1YA5A 2DAVA 2E3VA 2AEIT 2J6EA 3MJGX 4HCRH 5KOVC 3VCLA 4AEIH 3KPQB 4CUCA 1DL7L 4OZHF 3RY6C 2P24B 1EGJA 2DTMH 4P23B 1BQHG 4JPIB 4S1DD 2A6KB 4FRWA 4TPRL 2YN5A 3BP4A 4FQCL 3UTTD 4HPOL 4P2RA 3BPCA 5IWLC 2H3NB 3HPJB 3ALPA 3S3JA 3E6FB 4AL8L 2EYSB 1F6AB 3QZWA 2PKDA 4WDIA 4M00A 1J5OH 4XPAL 2P44B 2ZUQC 1CXFA 2FDBP 2Y6SD 4WFHE 5DLML 4QT5B 1S3KH 3SDCA 5HYEA 3QZWG 4F7EA 3I9GL 3ILQD 4WI5A 1E6JH 4DZBA 1KCVL 2J88L 2IADB 4P5TC 3QIWD 5HGHB 5DYOB 4FA8A 3VFSB 4YGAB 1MIMH 2FR4A 1UXWB 4AZ8A 3A6BL 3HG1B 4AENA 4PJ7A 3KPQA 3U7WL 1S5IL 1S9VB 3KYKH 3WNKA 3CDFA 3V79C 3EFFB 2Z92B 5I8EB 1RMFH 3QDJD 4LSSL 1WWWX 1X4XA 2CDFB 4GAJL 3GJFH 4P23A 3QYCA 1BIIB 4JPIA 4JO2L 5F72S 3GI9L 5DFTA 1RU9H 1UZ8B 2NXZC 4JKKA 4Y4FB 3DTXB 4ZFGL 4H25B 1MVFA 2H3NA 3HPJA 2GY5A 3E6FA 3GKWL 5DJAB 1F6AA 4P2RE 1NGQL 2D9CA 2AABL 2EO1A 4MJ2A 3QJHB 3CDGA 3RIAF 2DQUH 2DMCA 1I3GL 4OD1H 4LCUB 5I9QC 3KLHC 5TDPB 3ZT5A 4D9LH 4QT5A 3U0TB 1IARB 2IADA 2EH7L 4ODSL 3CLFL 4QF1B 5HGHA 5DYOA 2HT3C 4F8QA 3H42L 3VFSA 4XPBH 2MCPL 2Q8BH 1UXWA 3TYFB 3SDAD 5AZ2H 2WQRA 2YPLD 2I26N 3HG1A 1ES0A 1FE8H 3RGVD 4DN3H 1FC1A 3B2VL 2B1AL 4PJCF 1S9VA 2DLFL 3EFFA 2Z92A 5GGSY 5I8EA 1VENA 3CZFB 1NBZB 3AFLA 4U1GC 2CDFA 1SJVA 4POUB 1UZ8A 2NY1B 3DTXA 3BN3B 1WWAX 4XWOC 4H25A 4I13B 4BZ2L 4R7NB 4W4NA 5DJAA 5ERWB 3RDTD 3SGDH 1JYVA 3T0EB 4PJIF 1MF2L 1ZSDB 1IGIH 4U6XB 4KPHH 3QJHA 1J11A 1W8OA 4LCUA 3IFNL 5TDPA 3TO4B 2EEDA 4ZTOL 1GZPB 4JO1H 1KF9B 5D7IB 2Z8SA 4U2YA 1RZFH 1U6AH 3U0TA 1WV7T 5CP3H 4QF1A 2BHUA 4MD4B 3LDBC 3Q48A 4MNGB 3X11B 1BAFL 1GYAA 5E4EB 3TYFA 1PDKA 1MLCA 3AVEA 2E7BA 4MJIE 4OBSA 3HG1E 4PRNA 3GIZH 2DKSA 4Y4FC 1OAZH 3ULUC 1MHPL 3CZFA 3QBTB 3GMPB 1KGCE 3U9PL 2X4SA 3QCVH 3UTOA 1DSFL 2C1PB 1ORSB 1INDL 2R2EA 2VO5A 4XCFL 2CIIB 2EDNA 3OKEB 3NGBC 4HJJH 3TVMD 1J1OL 5ERWA 3D6GA 4ZUWB 3T0EA 5DFWH 4U6XA 4WJ5B 4R9HA 4OCXL 1HIMH 4W81A 4DCQB 3O2DL 4BFIB 3TO4A 1ZE3C 1GZPA 5D7IA 1NCNA 3BT2L 1HHKB 3BH8B 1GJIA 1TNMA 1YEIH 5EULV 4MD4A 3JVGC 4CADB 4MNGA 3MOAH 3X11A 5C0RL 3MUY1 3I6GB 3VXPB 3H0TB 4NNYB 4UNTA 2APWA 5GRVK 5KS9F 1YNKL 4JFDB 2ENYA 2J8UF 1QHPA 4X7SL 4XVUC 5J1SC 2C1PA 4R4FL 1ORSA 5DS8B 2CIIA 4OBRA 5F7UA 2WIMA 3MTRA 3OXSB 5SX5H 3REWB 3DWTA 1QBLH 2B5IC 3FQTB 5DC0A 5AG9A 4ZUWA 3IJYB 2XA8H 4WJ5A 3GNMH 4HCRL 3LY6A 4AEIL 3WBDA 4DCQA 5ALCH 1T3FB 3LIZL 2PNDA 2DTML 3DYMA 2XPGB 1DQJB 1HHKA 3BH8A 2PETA 3KYNB 5D7IE 2FGZA 4PYGA 3PQYB 4ETYA 2XY1A 4R2GD 4CADA 3IB4A 4WO4B 4NM8H 3VXPA 3I6GA 2VR9A 4MNGE 3H0TA 4KAQH 4QO1A 1OT1A 3MUJA 3RNQB 1GAFH 4DJMA 4NQDB 4JFDA 1CGVA 1HYRC 3MX0A 4N5EC 4UTAL 3AB0B 2V5SA 3BYYA 2VL5B 2IWGA 1CGUA 2R1YB 3RX7A 2NCMA 1E6JL 5GS2D 2ZCLH 2EC9U 1UEYA 3F6IA 5DS8A 2NXYD 3VDBA 3OXSA 3REWA 3HRZB 1MIML 3K4AA 1HYSC 3IJYA 3H9SB 3NBNA 1HOCB 2CJUH 4JHZA 3GSNB 1T3FA 1RMFL 3ARVA 2XPGA 5E8EB 1J0HA 3KYNA 4ZXBB 3PQYA 2APVA 4PGJA 5KTEH 4HK3J 2IFFL 4L3EA 5EU6D 2B4CH 3RNQA 4NQDA 4AH2B 2DQUL 2BJML 2ICWJ 1IC4L 3CX5J 4JFDE 5FM5M 2VL5A 3ZTNH 4DKAA 2VXUH 2R1YA 1BD2D 3RY4A 2OZ4A 4TTGA 3FOLB 3T8XA 4NWUL 3HRZA 1G1YA 3BHBB 4XPBL 4X9IA 1WFUA 1UZ6F 2DM2A 5AZ2L 1T20B 1FE8L 2DL9A 1VGEL 2DLTA 3UJTL 4OLUH 3GI8H 4JRYE 5J1AB 2ICEB 1T1XB 3MREA 3D5OF 5F8QC 4WO4C 4GLRH 5E8EA 1F97A 2CMRH 1L6XA 4ZXBA 4ZOCA 3QG7H 1IGIL 3DXAD 4CN4A 4AH2A 4QEGA 1HEZB 2J2ZA 4JANB 4NQDE 2VKXA 3ZKQD 5BS0D 2OK0L 1N7MH 4JO1L 5KZCD 4FQLH 5IW1B 1DBBL 3MACL 1U6AL 3ZYOA 3FOLA 1AJ7H 4ODWB 4Z7NE 4AYFA 2APFA 2KPNA 4G9FD 1I8KB 3BHBA 5D9SB 4DKEL 4X8JB 4KQ3H 5IHLB 1ROWA 1D9KD 3H9SE 1Z0MA 2RCSH 3GIZL 3QUZA 1OAZL 5E94A 4P3CH 2DM7A 5J1AA 2ICEA 1T1XA 4JRXD 1PFCA 4YBQD 3O11A 5IFAH 3O45A 2OR7A 2BXYA 5GGTL 5BW7C 2VLRD 5MI0B 5J3HD 4HJJL 4HWUA 3QXVA 3QG6B 5C2UB 4HMEA 3QDMB 1A22B 2NY2C 1HEZA 4JHAH 2HRPL 5GZND 5ENWA 4HPYH 4L9LB 3S4SB 4U33A 3DSFH 3IAQA 5IW1A 3SGEH 5JW3H 5B8CC 3C5SB 4C55A 2NX5B 1YEIL 4HMCA 1TETH 4GG6B 1I8KA 5EH1A 1NMCC 1BLNB 3MOAL 5D9SA 1BFOB 5T5FL 4J23A 2B8OT 4X8JA 5DRNB 1QEWA 2Y72A 4Q0XH 1CQYA 1PW3A 4MB3A 4KTDH 5T3XH 4MNQD 2J12B 5JHDB 1T0PB 1MPAL 5DMKA 1FHGA 3THMH 4DUXA 3DX8B 1VACB 2NZ9D 2YWYA 3QG6A 2XA8L 3QDMA 4KRPB 5EO1B 1VEMA 5ALCL 4XGZB 4L9LA 3S4SA 2QHLA 5FYJL 4ZS7H 3ZDZF 2NX5A 1N5AB 4X7TB 2EDTA 4GG6A 2DLGA 1MFBL 1A6AB 3AXLB 1HK6A 1BFOA 4NM8L 2DQIL 1UWXK 4KAQL 2GIYA 2QHRH 1HN1A 5K9QI 4L4JA 2BVOB 1PKQA 4GRLD 1JE6A 2D7OA 2NYYC 1X5IA 3TFKC 2ZCHL 1MFDH 4MJ6A 4S1SH 4IRJD 5JHDA 1U2CA 4LRIC 1LDSA 2ZCLL 3IS0X 2FCBA 4S2SA 1GVIA 1ZWIB 5IB5B 2P5ED 3DX8A 4P2OC 3X17A 1I8LC 2ZNWA 4OCRL 4NO0D 4Q6IC 4QRPA 1O0VA 2CJUL 5EO1A 1YEHL 2P45B 3RUGB 1QHOA 5IM7B 1NFIB 4QHLB 4XGZA 3F7RA 3NCBB 4N68A 1RZ7H 4HIXH 4LGSB 4MA7L 1UWGL 3KGRA 1P4IH 3FT2B 3Q6GL 1ZV5A 1TPXB 4UZGA 1N5AA 4X7TA 4K3EH 4HF5H 2GITB 4X4MA 2NX5E 3EZJB 1A6AA 3AXLA 3T0WA 5FK9B 2E27L 5KTEL 4GG6E 4M6MH 3TN0C 5IJVB 4JGMA 2B4CL 2ZUUA 2BVOA 5HHXH 4EQ3A 1IC5H 3K2UH 4UOW0 1VERA 5CINL 3DLQR 2VXUL 3BKYH 1KJ2L 4HAFA 4C54A 3C87A 3PWUB 5JHDE 4N1EA 1ZWIA 5IB5A 4Q74A 1JZ7A 5A2FA 2CXGA 1QZ1A 5AYUH 2OX5A 4Y4KB 1A14H 3SKJL 5C0AB 3KJ4C 1JNLL 5EN2A 5FKAB 3RUGA 5IM7A 2A1WL 3WIHH 1MJUH 4QHLA 3O8XA 3TO2B 4G9DB 3ISWA 4PREB 3FT2A 2CMRL 1WEJL 4PRDB 3MV11 2GITA 4KI5C 5FK9A 1SM3H 2BOCB 5IJVA 3IDNA 3QA3B 3QG7L 4M9OA 2K1MA 5ISZB 1E4XI 1G9MC 1MREH 5DJZB 2A9MH 4KI5E 1FCCA 1N7ML 1MCOH 1JPST 3ALWA 5C1MB 1LO2H 4FQLL 3DETC 5MHSE 1KB5H 5CP7B 4Z7WF 2CO6B 4RZCB 1UKSA 4D0CB 5TE6H 1CK0H 3V4PH 1U95B 4UQ3B 3MRDB 2X05A 4Y4KA 4GRWH 3HNTL 4KQ3L 5C0AA 4NKQB 5FKAA 1KYOK 3JWDH 3TO2A 1YMHB 3RUGE 3EJYC 1FDLL 4LARL 4G9DA 5ESQB 2I5YL 1MJJB 1RK0B 4PREA 1F6LL 5IFAL 1B4RA 1RULL 4YXLH 3W2DL 4PRDA 3GMNA 1CDBA 2VLJD 2QQKL 2VZ3A 5CEZL 1X5XA 1OWWA 1XGPB 2BOCA 4HFUL 5TF1H 1EEYB 4PJFB 5ISZA 5C6PB 5DJZA 4JHAL 1HZHH 2NY0B 3S6CA 5F71A 3BP7B 4WHYH 2X1OA 3SCMD 5MP6L 5JW3L 2GW5A 5CP7A 4AIOA 2JJUA 4RZCA 3QAZC 2B2XL 1TETL 2IPTL 1S9YB 3NCYS 3T08A 5LQBH 4D0CA 3NIFF 2J5LB 1U95A 4JDVB 4UQ3A 3MRDA 1R3JA 2BERA 1BPVA 2V5RA 4WEBH 4Q0XL 4JPVL 2HTKC 5AEAA 5C0AE 3DX7B 3UMTA 1CGXA 2QADB 2BRQA 2N56A 1W72B 2JTDA 1CBVL 1U0QA 1UM4L 4KTDL 1MJJA 5T3XL 1RK0A 1OW0A 1JHKL 5F96H 7CGTA 5SWSB 1T7WA 3KDMB 3ULVE 3THML 2OP4H 1KTLB 3ARGB 4KJWD 1XGPA 3V6FB 1TZIB 1HHJB 1EEYA 4PJFA 43C9B 1U8HB 5ISZE 3NCEB 3BP7A 2QL1A 3LB6C 4JGUA 5CZXD 5DD1H 1EK3A 1S9YA 3GSQB 4ODTH 4QRRD 3LVEA 3UTQB 4NRYB 1SJHB 2B20A 3DX7A 1CLYH 4ZPTB 1W72A 3MLPA 1MFDL 4S1SL 2MQ3A 1DLFL 1BGXL 4Z7OF 5SWSA 1ADQH 5T1MB 4AEHL 4P3WA 1KTLA 4HIIA 3G04B 2F19H 5J4MA 3V6FA 1TZIA 3UTPD 2XWBB 5JIIA 5IOPB 2YZ1A 43C9A 5ACMA 1CXHA 1H3VA 4PJFE 1U8HA 1J0IA 2D7MA 2Q3AA 1NMAH 4H5SB 4WIQA 1WF5A 1DP0A 4KDVA 2F58H 4TSBH 4HIXL 1QACA 3HE7B 5HYJD 3ARBC 3H3KA 4GLRI 2R2BB 2AJVL 3GSQA 5BJTB 4J4PC 4DGIH 3UTQA 4PRBA 4HUNB 4Y16C 1UM6L 1SJHA 2X09A 4TNVF 5HHXL 3K2UL 4ZPTA 5JR1H 2BNRE 1C5BH 3ARGC 4ZNEE 1A6UH 2EIBA 5D7KE 3B6SA 5T1MA 5SWSE 3K81A 1OSZB 3PP3H 1CWVA 3LQZB 3OZ9H 3G04A 4R0LB 1FC2D 2XWJB 5B38B 5IOPA 1TMCB 1O7VA 4OZIF 3WIHL 1NMBH 2PYED 3EDFA 4H5SA 1X44A 2PYFB 3VXQB 3MPCA 1BMGA 3HE7A 1KV3A 1AD9A 2JJTC 2RB8A 2NR6D 2R2BA 4GMTH 1UM5L 5BJTA 4OFYA 4XRCB 4YXKH 5EORH 1SY6A 1SM3L 5AYQA 1G9EA 1M1SA 1QRND 1Q94B 5A43C 2E7HA 4OM1H 4AK1A 4W6WB 3OL2A 1FLRL 5T1KB 3KAAA 3N1QC 2Z4QB 1NDMB 5BOZG 1XZ0B 1CGYA 3SGEI 1OSZA 4NN5C 1CL7H 4EIZC 3LQZA 4ZS6C 5TE6L 3V4PL 1A9BB 4R0LA 2NY7L 2O5ZL 1F8TL 2UYLB 3QDJB 4Y2DD 1P7HL 1I8MB 1OGTB 3BKJL 5KVEH 1S78C 4Y4HD 1H3WM 1L9MA 3JWDL 5C0IB 3BZFA 3VFGH 3RVVD 2PYFA 1U8QB 3VXQA 4LFHD 1RIUL 4XAWH 4XZUB 2YN3A 1CR9H 4OZFA 3BQUC 2FGWH 3FQWB 1WFOA 5C0GB 3OAZK 1G7MB 1KB9J 1X4ZA 4XRCA 4CGTA 2ENSA 2FEEL 3PG2A 4M6NH 3BO8B 4OZFG 1NUFA 4QHUB 4O4YH 1HZHL 3QUMH 2VIRB 1A64A 3H2WA 4R4NC 2ORBL 4UIKH 4OGAD 4M5ZL 5FM8A 4ACPA 3NACL 1AD0B 5T1KA 5JORB 4P59H 2YPLB 2Z4QA 4RX4D 3WE6B 1XZ0A 2GUOB 2VDQL 2NY5H 5LBSH 1DR9A 5LQBL 1A9BA 2XI9A 2UYLA 1YEDB 4KKBD 4CBPA 5T3ZH 4WEBL 4TQEL 4QCIB 4PJ5B 1GZQB 5C0IA 1MCWW 4TULH 4DGYH 5I1CH 1U8QA 4JKLA 1B2WH 5LVEA 2W9LA 5F96L 4P2CG 4HC1H 3FQWA 4LLUB 5JPMB 3LQAC 5C0GA 3RTQD 1G7MA 1GGTA 1NCTA 4R26H 3ILQC 4PJHB 1RZKH 1J8HD 3QIWC 5LG1A 3FOMB 1F2XK 3BO8A 3NMEA 1UJTA 5DVOA 2IG2H 4QHUA 5DT1L 2VIRA 5H94B 2ZOLA 1VFOA 1A7PH 4NJ9L 8FABB 2YPLA 3WE6A 1A6TB 2GUOA 5JW5B 4YK4B 4P48A 2EDOA 1A8JH 5L88H 5TJWK 1YEDA 2P5WB 1JPFB 3QDJE 4NQED 4QCIA 4PJ5A 1GZQA 4RMQA 3QWRD 12E8H 2OYPA 1FL6B 1UA6H 2K7PA 3U36B 3TVMB 1IGJB 3OV6A 2PN5A 5JPMA 4LLUA 1CDJA 1GL4B 2DBLL 5E8PB 3IETB 4PJHA 2CDGB 2F19L 4OZGB 3ZZ1A 3UO1H 4MLSA 1NUNB 1EHLH 5F6HI 4I3SL 3SDAC 3WL9B 1XGYH 2PTTB 4NRZA 5H94A 5IFHL 3RGVC 1NMAL 1T04B 1DFBL 3OB0K 4HS8H 4TSBL 1FZKB 2X41A 1RUPL 1Z3GH 8FABA 4U1HB 3BD5A 1R5IB 1A6TA 1AXTH 1F4XH 3AAZA 2YPLE 5JW5A 1UJ3B 4I8DA 1BEYH 1T89A 4XNMB 1I1FB 4NQSB 2P5WA 1B6UA 4L8DB 1BREA 1JPFA 5T3XD 5CILL 3RDTC 3IFOA 5HYIA 2VR5A 4KMTL 5EBLB 4QXWA 1FL6A 3U36A 4DN4H 1C5BL 1IGJA 1OSPH 1N2RA 3CVIH 1KTKE 4M7LH 5IEHB 1IGCL 1IILE 4EDXB 1NH6A 4H20L 1KTRL 5E8PA 1INQB 1RUKL 2K3TA 3IETA 4OZGA 2Y5TB 4PJHE 5D93B 5K9JL 2V2TB 1BZ7B 3JSSA 1JTOA 3DMMD 3WL9A 2PTTA 1FSKB 1T04A 5JZ7D 1UCTA 1JHLH 4DGVH 2W0LA 1FGVH 1FZKA 3E8UH 3D3VD 4KTYA 1JFQH 2W38A 1D5ZA 4U1HA 4P9HC 1R5IA 3NH7H 4ERSL 2DQTL 1UJ3A 1URLA 2F54D 4XNMA 2VYRE 1I1FA 5ESVB 4YDKH 4NQSA 4L8DA 4GRMB 5IBLC 3TVMC 2P5WE 1A4KB 4LDEB 2F53D 3MCLH 2YXMA 4XH2B 5EBLA 4JLRB 1DANT 2ATPB 5HBBA 4LVOC 1EJOL 1DN0B 1KG0B 4LCCC 1TQCC 2OCFD 4HJ0D 1AGBA 5L9DL 4WU7B 4OF8A 4J3VA 1A7OL 2GHWB 5IEHA 4EDXA 5KSUB 1P9MC 5KW9H 4XXDB 4RDQF 2VTFA 1GH7A 1CL7L 3R06B 4MHHG 1INQA 4FQXB 1MCFA 2Y5TA 3L3IB 4Z7QF 1BZ7A 4OZGE 4NKOB 3QB7C 2NY6B 4AQ1B 2CD0A 3VFGL 1UB6B 3O4OB 4D8PB 1G7HB 1WICA 1KJVB 4ZAKD 3VXUD 1IKNC 3IRZA 3DRQB 3QHFH 2FGWL 4HXBL 4K7PL 1X5YA 2N7BA 5D7LD 2WLZA 2OR9H 4RA3A 3ZHLA 2VXSL 4LPCA 5ESVA 1NLDH 4UAOC 4M6NL 1FJ1B 4GRMA 5GJTH 1BD2B 4XAKE 1CDCA 4O4YL 1A4KA 4JM4H 3VI3E 3QUML 1WTGT 3QQ3B 4XH2A 1KELL 2OSLB 4JLRA 2ATPA 2FEDD 1DN0A 1KG0A 2VAJA 4P59L 4XX1G 1WFNA 1T1ZB 3NZHL 4XXDA 1LP9B 3M1BB 2NTFB 2NY5L 3R06A 4FQXA 5DO2D 1HHIB 2W1NA 4RMRA 1EUTA 2MKWA 5HDBF 4R2GC 2M26A 3F62A 5D7JD 3L3IA 4NKOA 1XGQB 5F6IC 3LHPL 2LQRA 4LLMB 3EYSL 4GKOA 4TULL 4EUPA 5DF0A 1LK3H 5DMGD 1UB6A 5I1CL 4QYOB 1G7HA 3OXRB 1BWMA 3DRQA 1LDPL 5DRZA 5CWSB 4EUPG 1U8MB 2GI7A 5KANI 2NXYC 1FJ1A 5GS1B 4XCNB 4KKCD 2IG2L 3UPAA 4Q7DA 5ACZB 3GBNL 4P46B 3QQ3A 1MCNA 4QOKD 1JYXA 2OSLA 3HE6D 4G9FB 4NQCD 1A7PL 3EOBB 1T1ZA 1A6WL 5C92A 1D9KB 1LP9A 4TRPH 3M1BA 1MH5B 2NTFA 1UWEH 1WC7B 4KRMB 1HHIA 5L88L 4OZ4B 4WW2C 4PS4L 1RUAL 5AAMA 1QP1A 5FF6B 4LASL 2AXJA 1XGQA 2C1OA 4LLMA 4QYOA 4PLJD 4WHCA 1I7RB 1QLFB 4RQQB 4HG4J 4H0HB 5CWSA 2XT1B 1U8MA 1CE1H 5GS1A 4XCNA 1EHLL 4BYHA 2KBGA 2VZ1A 1BD2E 5EBWB 1ZLUH 5ACZA 4P46A 3OKOA 4KDWA 2V5YA 3NFSH 4G9FA 1U8NA 4HS8L 5JXAL 3P30L 3EOBA 4GXVH 1Z3GL 5C7XL 5IBTL 4NZRH 5DD6A 3FO1B 4KKNA 1IVLA 4Y2OA 1LEIB 1AXTL 1D9KA 4MVBD 3GJEB 2IC2A 3M8OL 5I1LB 1MH5A 3T3MF 4M8VA 3T77B 1WC7A 3MLYH 4OZ4A 1J05A 4LBEB 5SWZD 5IT2L 4MNQB 5FF6A 4MA8H 4E5XA 3IKCB 5I18H 4I5BB 4N1CA 4XMKH 1I7RA 1QLFA 4JFPA 4M7LL 1TZHB 4RQQA 5E08H 3VH8B 1OAQH 3INUH 3QPQD 4G7YH 3O4LB 3VWKD 3JUZA 1OLZA 2AXHA 4U3CA 3WNOA 1R24B 5EBWA 1JHLL 4UI2A 3E2HB 2ADFL 4G9FE 1WIPA 1ZTXH 3FO1A 4YBQC 1LEIA 3L1OH 4K23H 5HHNB 3GJEA 4BQ6A 5I1LA 5I8OH 3T77A 1JZ5A 4XPGH 2OL3B 4LBEA 1I1AD 4YDKL 5J3HC 4OCSH 1XR9B 3O0RL 4WUKH 3MCLL 5CBAA 3VRIB 3IKCA 1RUQH 3HUJE 5CUSL 2ARWA 5GGQL 4CVZB 4NO0B 5BVJB 5I15H 1TZHA 3MFFB 2YMXL 5KW9L 3VH8A 3S35H 2F5BH 2XNAB 4YNYB 5E99L 1OP5K 4ETQB 1WCBA 3O4LA 3CSYB 1YZZA 2H1PH 3D0VB 3OMZA 4RGMC 4WI7A 1XCTA 4XNYL 1R24A 1X5KA 4E41D 1F02I 4N8PA 5CZVH 3NABH 4Z7VA 2K9UA 1T6WA 2HLFD 3QHFL 4M8QB 5B39B 1QKZH 3MBEB 5HHNA 4NZUL 4N9OB 3VFUA 5CJXC 3MODH 4KXZH 4ZO7A 1NFDF 2OL3A 1NLDL 1D5BB 3CD4A 1ODAA 4ZFZB 1FAIL 1XR9A 2NZ9C 1EIBA 1NCDH 4JO4H 4MNQE 2H8PB 4YHIB 3WJLC 1MEXL 4Z95H 1TFHA 3VRIA 4KROC 3UJIH 4CVZA 1I75A 3N85H 3ARXA 4NO0A 3MLUH 5BVJA 3MFFA 5BXFB 2AXGA 3PWLB 2XNAA 4YNYA 4ETQA 5I19H 3CSYA 1N6VA 1IT9L 1AIFB 3D0VA 3O4LE 3IJHB 4KK5C 4PJBF 3ZDXE 2P48B 5ITFB 1N5YL 2EE3A 5E9DD 2VZOA 3QQ4B 4GRLC 1MUJB 3MV01 4BFEA 5IGXH 4M8QA 5B39A 7FABH 2N1KA 3MBEA 4IRJC 1VB9A 3U79A 3BGFC 1BFTA 1D5BA 4ZFZA 1X6LA 5KJRH 5B39G 4A6YB 1N64L 2H8PA 4YHIA 5CBEB 3WN5B 1MFCH 1TLKA 3H7BB 4TUKL 3P0YH 1IAMA 1AI1L 5I8KL 5BXFA 2BZDA 5HHMB 1I3VA 1MWAH 4TRPL 3PWLA 4I3RL 1YEJL 1UWEL 1AIFA 1XGRA 3IJHA 4RBPK 3PV7A 4KMQA 1NLBL 2YD4A 5ITFA 1MCJA 2JJSA 3QQ4A 3IDMB 5EIVA 4C59B 4L29B 3OKNB 1KCKA 1NANH 1IAOB 2EC8A 5C0FB 1IM3B 3RWDB 3TBYB 5FFLA 2BSTA 2YKLH 2D3VA 3NCCB 1YYLL 2V5MA 3LN5B 5BV7B 1A7BA 1CE1L 2YC1B 1MRCH 4A6YA 5DJYB 3K3QA 3WN5A 2HJLB 2OR8A 3NFSL 1OGAD 2CLRB 5D1ZD 5DK2A 3WUZA 4GXVL 3SO5A 3WUWB 2D0GA 3ZT6A 4NUGH 4NZRL 3OHXA 5F7FA 5T3ZD 4WNQB 3MLYL 5TE4L 1SMOA 4WV1C 4GS7B 4WUUD 4BELD 4BQCA 4N0CD 3DECA 5TFSH 4PR5B 4QTIL 3UTSB 5F88B 3MRGB 4KUCD 1MAKA 2I24N 3KJ6H 1BOYA 1FVEA 2ATKB 2X44D 3IDMA 1QBAA 4Y1AB 4L29A 3OKNA 1Q0XH 5C0FA 3LMJH 5E08L 1IM3A 3RWDA 3GBML 3TBYA 4QXUH 3O3DB 1WZMA 3SN6N 5JIKA 4G7YL 1T7ZA 3WEXB 1KC5H 3LN5A 2YC1A 3KPSB 1IEAB 1EERB 3SE3C 1A9EB 5DJYA 2RHEA 3CXDH 2HJLA 2Q7NA 2CLRA 1FPTL 3MUHL 4M61B 3WO3B 1AQDB 4YDLC 3WUWA 4WNQA 3L1OL 4K23L 2ZUYA 5EA0H 1NGPH 5HHME 4RFNB 1KIPB 4K8RH 4XPGL 4AMKH 3MR9B 4M43H 1U8IB 5IJKA 5J12B 2DMBA 3WUWG 4LPWA 4OCSL 5FUCE 3UTSA 5F88A 3MRGA 4WUKL 4N9GB 1MRFH 3VGBA 4XCCH 4Q9CA 4Y1AA 2P8LB 1OQXA 3U1SH 3SCMC 1AO7B 3O3DA 1JP5A 2GT9A 3FN0H 4OV5B 5CEXA 3WEXA 2H1PL 3L3OB 1IGYB 5JQ6H 1ZEAL 3KPSA 1IEAA 2O26U 1A9EA 3QCTL 2WWMD 3T4YB 1WQVT 5LGHH 2Y25A 4P5MB 5CZVL 4M61A 3UX9B 1AQDA 2BXZA 1U9KA 3TYGH 3G6JB 5A2LH 3TJEL 1KIPA 3MR9A 1U8IA 2DKUA 5I6XB 1NCDL 3QI9D 4KJWC 3NZ8B 4N9GA 4FFYL 1A3LH 5JHLH 5D71H 4Z95L 3UTSE 1K4DB 3N9GH 4XBEH 4W4OA 3ARRA 4M3JA 2P8LA 4ODHH 3UJIL 3Q2CA 3MLUL 4Y1AE 1J12A 1AO7A 3QUXD 5GGRB 3L3JB 5I73B 3HMXA 4OV5A 2FECL 5CZXC 3WLWD 3L3OA 2IQ9H 1IGYA 3ZSSA 2A0LD 2PF6A 1IAKB 1MAJA 3T4YA 1BJ1J 3KPSE 3MRJB 3BVNB 5B3NA 4P5MA 3M45A 1P69B 1JN6A 4QRRE 5J12C 4YX2H 3VRJB 7FABL 1FNEB 2XZAL 3G6JA 1QRNB 3GMOA 4LRNH 4M4RA 3N1FC 4H26A 4ESKA 2XACC 1TTUA 3NZ8A 4XB8A 3K46A 1K4DA 3P0YL 1HNGA 3CPLB 3QHZH 1B4JH 4IRSC 2LVEA 1C5CL 4JM2B 4HS3B 5GGRA 3L3JA 1MWAL 3BEWB 3GK8H 4Y89A 3LH2H 1SQ2N 1AO7E 4MCYB 5H35B 1MCKA 1U8LB 1DQMH 4CU8A 1MCPH 3BEVB 3FO9B 2DKMA 3MRJA 3BVNA 2R4RL 1NPUA 1IQDB 3T2QA 4OI9A 1QSEB 4G7VL 4U1MB 4XP9H 3BPOC 3ZT7A 5JPNB 2CRYA 4LHUB 3ULUF 4Y5YC 3VRJA 2J6EH 4YHYC 1FNEA 4R90L 2V17H 4HGKC 1OY3B 5F7MC 3G6JE 1EGJH 4QGTA 3JWOH 2V2XB 1MRCL 3PNWB 4XBPA 5JMOC 5EZIH 4XBGB 4PRPD 1GRWA 4KDTC 3W9DB 4HXAH 4XVSL 4UB0H 3BKCH 3CPLA 2WP3T 3FT4A 2AJSL 3VFVB 1AGCB 1ZLVK 2UV3A 4I77H 1BIHA 4JM2A 5J7CC 4HS3A 4O2FB 5GRXG 3BEWA 2VL4A 4MCYA 4HKXB 2KQNA 4YHOH 3VU2A 1U8LA