4UU9A

Crystal structure of the human c5a in complex with medi7814 a neutralising antibody
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
b'EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDDDYEEWPWYYGMDVWGQGTMVTVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MEDI7814
publication title Structure and characterization of a high affinity C5a monoclonal antibody that blocks binding to C5aR1 and C5aR2 receptors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 29
structure length 123
sequence length 123
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uu9A00
5F88B 3E6FB 3PXHA 1F58H 1J10A 2NZ9D 3L3JA 1KNOA 4MX7A 2DLIA 1N26A 1QVOB 5C08E 4ETYA 4GRWH 3P0VH 4NOBA 3MO1B 4XNYL 3KJ6H 1XGQB 1JGUL 3OQ3B 4NWTH 5E2TL 5GRVK 4ZS7L 1LDPH 1RURH 4X0KA 5D7SL 1RZJC 1EEZB 3UTQA 1P1ZA 3VXSB 2R0ZL 2XTJD 3I02B 2J12B 4YHPA 1A3RH 4HMDA 2ORBL 2FJGA 1FP5A 3LB6C 4Z8FH 1CFSB 3O4LA 3SJVD 5E8OA 4OV5A 1YYLL 1CE6B 4FQLH 3T0XA 1KC5L 4LCUA 3U1SL 4NQCD 3N1QC 3FOMA 3RKDC 1MLCA 3AY4C 1EHAA 3GJFK 5ICZA 2HN7A 2DM3A 3KJ4B 1CGSL 1WC7A 4LHUG 4ZO8A 5T1LA 1MJ8L 1N64L 1XGTA 12E8L 4QRTA 5ACLA 1MCWM 3NABH 4U1HB 4BKLB 3CPLB 4F8QA 1B88A 1EHNA 2GT9B 1P7QD 1TZGL 3MRDB 1DCLA 5EZJA 1T5XA 3PGDB 4PJBA 4U1JA 5C07B 2G2RA 4JFZH 8FABA 3LEVH 3L3HA 3TBVA 2CR6A 2D3VA 5DJ8B 2QQLL 3FO9B 1A9BA 2GKIA 2IQAA 4DKEH 5GS1B 1QSEB 4LCCB 4QHKJ 5DI8B 1P7KA 4F7MB 5JORB 3OAYH 4MJIE 3T65B 4P4KA 5GGVH 3IU4L 5I8KL 3DX6B 2C3GA 3KPMB 3QUZD 4CDGC 4DZBB 1MF2H 3UZQA 4EDWH 4KZDH 4N0UA 4KROC 4XHQA 5CD5C 3PNWA 2R0KH 3KYNA 2Y6SC 4LVHC 2PO6A 4IIQB 1I9IH 2APXA 1YYML 4TRPL 5J8OA 5JXEA 2JK5A 3QDJE 4PD4K 5D93B 1S5IL 5IW3A 2F53E 1HH6B 2Y25A 3EJZC 5D7JA 5IV2A 4LF3A 5EOQL 1HIMH 2Z91A 3MBEA 1CF8H 3X3FH 4XVTH 3FFCA 2XG5A 2E7CA 2I27N 3MLVL 2DQHH 3VDBA 5JW4Q 3V52L 3TYFA 1F4WL 1S9VA 3JV6A 4OZGF 5LGHH 3OGCA 2GJ6E 4YEEA 2BX5A 3UJIH 4YPJA 4PV8A 4XP6L 4U0RB 1MPAL 3F7YB 2UV3A 4MNGE 5IOPB 2Y7QB 2APWA 3BKCH 4QOKA 5I1LB 4BZ2L 1OTUD 4Q7DA 3S5LG 4KKBD 5J3HD 3LIZH 1QFPA 3HS0B 4JFOA 1ZLSH 2YD1A 3TGXA 5CEZH 2CDFA 5TQ0L 1J1OL 4UB0L 1JUFB 4MNHB 2XTLA 2C3VA 3QIWB 3KS0J 5DTFB 1JFQH 3IFLH 2EDKA 4JKKA 4CW1B 2BDNL 1P4LB 3PHSA 3CFEA 1W2KT 3ARBD 5JR1L 1MFBL 4LLMB 2PTUA 3ES6B 1NGZA 1YEIH 1QEWA 3Q5OA 3WHXB 3QDAA 3AXLA 4MJ6A 3IJYB 3L3KB 5E6IA 1T04A 1G9NH 2WBJA 3LDBC 4WTZA 4URTB 3WFCH 1WTGT 2HFEB 2ARWA 4AL8H 4JCLA 1GSMA 1KYOK 4NKMA 2ZUXA 5TDOA 4DK6A 1AIFA 4OUUB 1CGVA 3U30B 3EW3B 3SGEI 2MQCA 1J5OH 5KOMC 4R6UA 4RDQG 2AJ3A 3WS6A 4EI5C 1TNNA 1OCWH 3N9GL 2BZDA 1WGOA 4M7JL 3C08H 3LV3A 3REVB 4HW6A 2X9WA 1CBVH 5DDHB 4R26H 5AG8A 2B1HH 5IIEB 3IDXH 4Y5XB 3S88H 4F33A 2BY3A 3WFHB 5F7UA 3O8XB 5DJZB 5LBSL 4C57C 3OKMB 5TH2B 4JFYA 3JWOH 4MLIA 1A9EA 1Q94B 1IAOA 2WIIB 4X7SL 4LEXL 1HCVA 4WTZG 5D7IF 4OF0A 1V5JA 2EH7L 2ITCB 4K7PH 4ZNCD 2A6DB 3BKJH 2FX8H 1WCQA 3ARDD 3WLBA 2H3NA 1Q0YH 4B5EA 1J86A 4EQ2A 4YC2B 4H5SB 2G60H 1QTYT 4Q97A 3VWKB 1H0DA 4M6NH 2ATKA 2VLKE 3MJ6A 4GBXA 5TFSH 2ZSVB 4X5WA 4PTUB 5D7LB 2GSGA 3MRJA 1BQHG 1MCHA 2BNUB 1G7PB 2GI7A 2VDLL 1FBIL 5E8EA 4ZFOB 3T8XB 3WLWC 1KCVL 3N85H 5BVPH 3P4MB 1FNEA 3O0RL 1ROWA 4PJGF 2WUBL 5DUML 4LSSH 5BQ7B 3GSVA 3LPGA 3UMTA 3JV4A 2CLRA 3ZE1F 1MY5A 4QTHB 1ORQB 2DI7A 4L5FL 1Q8MA 3BP7B 2J8UF 2VN4A 1SYSB 4F57L 4XB8A 3PP3K 4ZPVA 3FL7A 4J3XA 5GZOD 5IB5A 1RFDL 5JMOC 1JPTL 1MAKA 2GTWB 2H32A 2JJVA 4NQEA 3WUZA 4F2MA 5K33A 4PB9H 4H88L 2UYLB 4N5EC 3VWJC 2LTQC 4G80B 4DGIH 3Q5YA 1FDLL 2XZCL 1MIMH 3GSRB 4KKLC 4DW2H 4I0PA 1RUPL 2VDQL 4Q0XL 3GSWB 2ERJC 4R8WH 4MDJB 5FA3A 4E5XB 3DGGB 5AG9A 3BFOA 2VLRA 5EUOE 3ZE0F 2X09A 4JGJA 1REIA 3NAAH 4PG2C 4EIGB 1HYSC 4MQXC 5C2BH 1MNUL 5EG6C 3QO1A 1EJOL 4R0LC 2DB8A 4CVUA 3ULVL 1PSKH 3MROA 1A6AA 1HQ4B 2X10A 4Q9BA 4NDMB 3VXMD 5BS0A 2BVOB 3BRGC 3BPCA 3FB7B 3PWUB 2A77L 4QYOB 4U7SA 3LS4L 1MI5B 2AJZB 3LKOA 3HUJF 1CDCA 5EU6E 3C8DA 1Z0MA 4OKVA 1AXTL 1S7VB 1YDPB 1KT2A 3STLB 3MXVH 3PL6D 5IHZA 3BEVA 5DUPL 4TSBL 5HDOA 3UJJH 3G6DL 4G8FB 3IXTA 3S96B 4QWWC 3ESUF 2UWEF 4JO2H 1XF3A 3THMH 5EBWB 4FTVE 4HC1H 5HYQB 1SY6L 3H9SE 3CAFA 2OM5A 4ZQKB 3LH2H 4KK5D 5BRZE 4HK0B 2L4OA 1QLRB 5D2LF 3BSZL 4ZUSA 3TCLA 5LVEA 4ONFL 3BWAA 2XWTB 1FVDA 1SY6A 4NCDA 3SCMB 1XZ0A 4Z7VB 3H7BB 1OAKH 3MBXL 1S3KL 4LRIA 1CD1B 2A74B 1D9KA 2O26U 4K94H 3VCLA 5HVFB 1TPXC 2FLRT 4N8VA 4HUWB 1IGTB 5EOCH 1QRKA 1N3NB 4F7EB 3RNKA 4HS6B 3S7GA 5I6XC 5ID0A 3G08B 1GGIH 4LCWE 5HJ3B 3UDWC 1NDMA 2CUMA 5JW5A 2ADJB 4WDIB 1UC6A 1IC1A 4J4PA 2UY6A 4YDLB 5DJ0B 4RAUB 3WJLA 2JJTC 1EIBA 2PTTA 4ODWB 4Y5YA 2XXMB 3LQAC 5L0QB 5T1KB 1RV6X 4EOWL 1MCQA 5I19L 2ED8A 3K1KC 4CU6A 4ZSOB 5LQBH 1KCSH 3KPTA 3MRBA 3DX8A 4PJFA 2F54B 4YHMH 5I71C 4Y4HC 2KQMA 2ZOKB 1MFEL 3DPBA 4S1SH 1E28A 3BI9X 1GGBL 4NM8L 5L7XL 3EFFA 5C0AB 4NKDA 5C6TL 5F97E 2ICES 4JZOA 1RZFH 5TDNA 1YEEL 4GKZA 4PJXE 4QKXB 4M93B 4ZS6D 5D2NB 3BUYB 2OP4H 5JHDA 5ICXB 4HJGB 2NXYD 1OSPH 2HVKA 4LDLB 4GAGL 3MA9L 1OGTB 3QNYB 4XZUA 4BSWA 1EXUB 3P73B 4A6YB 1RIUH 4PRIE 3I6LE 5AEAA 4HKXA 2KL6A 1NGPH 1RK0B 3TEUA 3MRIB 4XXCC 3BEWB 2R39A 3HR5B 1F58L 3QUXD 4M7KH 4WHTA 2ZOLA 3SKMB 5BOZG 4AK1A 4F7PA 5CEXB 2CRZA 3KJ6L 4NWTL 3C60A 3QI9C 2VZUA 3V7MA 4YIQB 3VRLF 1RURL 1BHGA 2UUDK 1F6AB 1S7TB 3SQOL 4CVZA 4S2SA 1S7SA 4IMKC 4MJID 1A3RL 3AS3A 5ESQA 4Z8FL 1EUTA 5DQDH 4Y88A 5ERWB 4WO4A 3HHRB 2EIBA 3KXFB 5L2KB 1OAYH 1U8KB 2BNQB 5DO2C 2VXQH 3QDJD 4YPGB 5F7DB 1JTTA 4R4ND 2F53D 5IROA 2R1XA 3P2TA 5F9JB 3WHE1 5KVEH 1HI6B 3TZVA 5EU7E 5HDLA 4DEPC 1FL5B 3RPKA 3RUGA 3VFTB 3FAXA 4F3FA 1IC7L 1TJGH 1U8LB 4JFZL 4ESKA 2RQ8A 4OCRH 5DJAA 3WMSA 4OGAC 2GJ6D 4K9EC 1JYWA 3I85A 4LDEB 1J8HA 1CLYH 1OT2A 4MCYB 4HGKC 2YD4A 1W72L 4TNVK 5CSGA 2XICA 4GFTB 2X4NB 3RDTB 1OB1B 4P2RA 4OAWA 4J12A 4M1CC 5JDJA 1TVBA 3I6KA 4GKSB 5ANMB 1W72A 2NY2C 4B0MM 4BFBD 4EDWL 3ILPA 2NW3A 4DQOH 4QXTB 2R0KL 3EGSA 1ZVSB 3RI5K 5D1XD 4KK9D 1I9IL 2ZCLL 1OSZB 3MV01 4M7LL 1M7XA 4KTEH 5DR5L 5IMKA 4YZFE 2K9UA 4YHIB 1X5AA 2VLJB 2X40A 5SWSA 5HYJA 4W68A 2QADC 1YN6A 1HEZB 4QF1A 2QQQA 4NN7C 4Y1AE 1CF8L 3X3FL 5C6PB 5J1SC 3RL1A 3IVKA 2HJKA 4JFHE 2DQHL 4I0CC 1KJVA 2X6MA 3KLAA 1J1XH 4WI8A 5KTEL 4UIMA 2HT4C 2V5TA 3DRQA 3HC0B 5F6HJ 5CZXD 5E4IA 3LMJH 4B7IA 4M7ZB 5A2JH 3P40A 2Q6WA 4L4VE 3P9LA 3MLTA 3D2UA 4YE4H 1MOEA 1FVCB 3QUYA 1PW3A 1ZEAH 1QBLH 3RWIA 2F8OA 3B9KD 3VRIB 1XIWA 1IM3B 2F19H 4YWGH 1PFCA 4WW1B 3B5GA 4P4KC 2XY1A 3VMNA 3OJVC 1WBXA 4OF3A 7FABH 5FECA 5C0DB 1M7IA 4X6BA 2UZIL 3QRFM 3L1OH 1CD0A 3D39A 4YK4C 2PO6C 2H41A 3MUGA 1YEIL 4JE4B 3D85A 1XR9A 4ZOEA 5JXEC 1VHPA 1EX0A 2R9HD 1D5ZB 1MELA 3FQTB 5CMAB 1QZ1A 1GPOL 4FG6C 1G9NL 3DXAB 2BSSA 5D7JC 2J3SA 1GL4B 3WFCL 5JNYB 3OKEA 2D0GA 5B38B 5DFTA 4UIKH 4XP1L 2DKUA 5FAAA 4MXVF 3MBEC 2PYEE 4TYUA 1HXYA 3IDMB 3TESA 1HWGB 1G7MA 1NSNL 2VLKD 4L4TE 2DQJH 5D5MF 3FO1A 3CCHA 4S0SD 1CZ8H 5AUMB 3ULUH 1JGEB 1T0NB 4Q74A 5F3HB 4RQQB 3INUH 4ZUTB 3HB3C 4HH9A 3E6HA 2X4OA 3VW3H 2H6PA 1KN2L 5T1MA 5J6HA 3IDXL 3S88L 4G9FE 2IH1B 1INDL 1U6AL 2GW5A 1HZHL 5JDSA 1JMZA 3BKML 4IEFB 3C5SA 5EIIB 3VFSA 4BQCA 3V4UL 1HILB 1SJHA 1BD2B 3JWOL 4DVRH 2V17L 1AD0A 4PJEA 5EA0H 1GOHA 3QIUD 2V2XA 2LABA 1VFMA 3BIBX 3W0WB 1UH3A 4Y2DD 1NFDF 4S1RH 2FX8L 3R06B 5KSUA 3LZFH 4P2OB 4G8EB 1Q0YL 3OXRB 4GRLA 1QP1A 3ARED 1ZHBB 4TSAH 3SDXB 5C2UB 4BH8B 5K9JH 1DLFL 5TQ2L 4KRPB 5E6IC 5IMOB 3B3IA 3OXSB 5TFSL 2WBJC 3UTSB 4OLXL 3PG2A 5JO5A 5ILTH 2X4RA 5SWZE 5EC2B 3VE0A 4DKAA 4R97C 3Q5TA 4NO3B 4QHNA 2LE9A 3WS6C 2DL9A 5EB9A 4ODHH 2P5EA 5DZOA 3O45B 5K9OA 3QDGB 3WCYA 3RNQA 2VQTA 3RZWA 5FM4A 2DQFA 2AV7A 2NZIA 2AXFA 3HKFA 4ZXBD 4E41E 3U46B 2IJ0C 4JO1L 4G8IA 5EU6D 3UAJD 1X3DA 3DBXB 3KLDA 4PB9L 1TETH 3BH9A 4P59H 5TJWK 4NQSB 1JZ8A 3ALXA 2OZ4H 1MIML 1VERA 3WE6A 4DW2L 4X99A 2BC4A 1C12B 5HI5C 2HLFD 4PG9B 4ZTOH 4XWGL 1KTDA 3H9SD 4KDWA 4G8GE 4IOFC 4YO0A 3VXRA 5BRZD 3S35H 2GIYA 1WBYB 2BNRB 3LN5A 3PWPB 3MCKA 3VXNA 3I3DA 1ITBB 1PKQA 3FONB 3HE6A 1LK2B 2AGJH 3ARFA 4GBXC 4OZGE 4LNRB 3PP4L 2XI9A 2XWJB 4HDIB 4NKQB 4QRPB 4A6YH 3F62A 1GOGA 4NN6C 4S11A 3JTSB 4LU5L 4PRHB 2OMBA 1IGMH 3MQIA 2X44D 3I9GH 1UXSB 2GCYA 2XWBA 3PQYA 3TIDB 5CZVL 3CU1A 3EDKA 4NM4L 1ZHLA 1WV7T 1B90A 3MRMA 1T1XB 4LCWD 3F5WB 5CSZB 4G7VL 2YOCA 3E6FA 3GSNL 5F88A 5D1ZB 1EO5A 4TSCL 4JEGB 4M1DL 2A2QT 3P11H 3VXQA 1W0WB 3OAUL 3MO1A 2C3WA 1XGQA 3NZHH 3BE1H 4ZFZB 3GSQA 3UJJL 4PRDB 1EEZA 2E6PA 3VXSA 3AUVA 2X1OA 4P99A 1FH5H 2OYPA 4P5KB 4U1LB 5CIPB 1ITCA 1NCBH 1MRDL 3NCBB 4I0PC 1ZVYA 4WI5A 3O2DH 1DBAL 4KWUA 5CHNB 1T7YA 4P46B 1CE6A 1U8QB 1HDMB 3B8SA 3C6LB 4LSDA 1OAKL 4QGTA 5TE4H 4DVBA 4C58B 1BQSA 4K94L 5KS9B 4U6XA 1IM9A 3ALWA 5F6IB 2IANE 3MNWB 2JIXB 3QB7C 4U1HA 4PJ5A 3CPLA 2PXYA 4PRID 1BAFH 3I6LD 5DZNA 4U6YA 1I4FA 3CDYA 5FOBA 3ULVC 3P9MB 3GK8L 3PGDA 5C07A 1U8IB 1Y6MR 1I7RB 1KJ2B 1QHOA 4XTRD 1II4E 1DUZB 5DJ8A 3LS5L 3FO9A 4JKPL 1X4XA 3SKJH 5JOPD 2MSPA 4TUKH 3PWLA 1KCSL 3PWJB 3MODL 1WSST 5D7IE 3GRWH 4MD5A 4F7MA 5JORA 4WTXA 1I1YB 3PDOB 3DX6A 3KPMA 1KGCE 2DTSA 3RX7A 3ZKSD 5HVHB 4ZG1A 2B5IC 2YUVA 1WAAA 4PLNC 4NO0A 4NZUH 2VDRH 5I1JL 5E2WH 2NPLX 2L7JA 1HH6A 4PJ9A 4LRIC 1D9KC 1I9RL 4HZLA 1MCRA 4OSUL 4PJGE 4PFEA 4WI6A 4HJ0D 4EN3A 1A7RH 3BGAA 4Y19E 5KSVA 3UYRH 3ZE1E 1KTLA 4M7KL 2EIEA 4ZFFA 1OGAB 4OT1L 2OK0H 1XEDA 5FYJE 3BKYH 2J8UE 4FS0A 4J4PC 4XVUD 1T83A 2BRQA 1G1YA 2CKBB 4OGYH 2OL3B 3MXWL 3WJLC 5IOPA 1P2CB 3VGDA 2Z8WC 4Y5YC 2OR7A 1M1SA 1CTOA 1OOAA 3GMQB 43C9A 5C0JB 3GBMH 4IDLA 4TTGA 3HS0A 5I8EB 2FIKB 1YPZA 3WKML 2FLBT 1JUFA 4M6AA 5DJ6B 4QXGH 1E6OL 2FNBA 1I1CA 4CW1A 1YY9D 3FN3A 3ARGA 3MR9A 1OAYL 3KDMB 3TN0B 3ZE0E 1A1NA 1I9JL 2CD0A 4D8PA 1VACB 3ES6A 4W81A 5D71H 3QPXH 3NIGF 2PCPB 4N90E 5KVEL 2FECL 2EZ0C 3WHXA 4KVCL 3IJYA 3L3KA 2DYPD 3MFGB 4JFHD 1UM5H 3RVVC 4Z7UF 2HFEA 1TJGL 4UT7L 4LLAA 1BX2B 3GUTB 1AHWB 3KG5A 1G6RL 4ZAKD 4OUUA 3LPFA 3V0WH 3A6BH 2BHZA 2IGFH 3HUJE 1A7BA 4JFFA 2NNAB 4L3CB 3A6OA 4H25B 3C60C 1A6TB 1S7RB 3MV7B 5DDHA 5D8JL 1V7NH 4Y5XA 2XN9D 2E8ZA 4WVRA 4KTDL 2UWEE 4LDOB 2VTFA 2P24A 5DJZA 5ENWB 4WI2A 1U8JB 1OAXL 2NY0C 1YEJL 5IKCB 2LAAA 1TCRB 4Z0BL 1UM4H 3QPQC 4F9LA 1UWXH 4WO4C 2G9HB 5D2LE 2WIIA 5KSAA 4K3HA 3RJQB 4RMUA 2ITCA 4TQEH 4UDUA 5KN5B 1UVQB 2BY0A 2Y4SA 2A6DA 1PD6A 4HXAH 2R0LH 1JNHB 5JHLH 4H5SA 1J1XL 1FPTH 3GMPB 3K7UA 4JRYB 2CLZA 3TZVC 3VWKA 4ZFOL 2PYED 3D69B 5K9QI 1BFTA 5HDQL 2VXSH 4L4TD 2ITDA 5D7LA 1I7TB 2NXZB 2BNUA 1G7PA 3GIZH 4XPFL 4XNZB 3DECA 3CFJA 4ZTPL 4ZFOA 1DLHA 3O3AB 3U0WH 4J8RB 4AEHL 3QQ9D 2IMNA 3QEGH 1VENA 3P4MA 3V79C 2HFGH 3BYYA 5BQ7A 4HMEA 4CU8A 3DSFH 3V6OE 2P4AB 3V9FA 3DV6B 5DMKA 2NTFB 3QH3B 4G9FD 4QTHA 1B3JA 5I17B 5GJTH 1WZ1H 2QR0B 5IT2H 2C4FT 3L3IB 3C8KA 1ZANH 4Z7VF 1R3HA 1DEDA 1XF2B 3K3QA 5FV2A 2A38A 1XGYH 3IKKA 5D1QB 4G80A 4HIJB 4L1HA 3LRSB 5J1AA 4OLUH 1UB6B 4FABH 5IQ9B 3H3PH 3GSWA 3FO0L 2YXMA 3UXFA 2XG4A 4E5XA 2DQJL 3U6RB 2H2SC 1N8ZB 3ARUA 1YMME 2DQDH 2DF3A 5SWZD 4QTIH 4LPCA 1Q1JH 5FYKE 4HEME 4P23D 3HI5H 2EDFA 1FNSL 4Y2OA 3VD7A 3VW3L 2VUOA 3HLAB 2ENYA 2Q87A 3LEYH 1LD9A 2V5SA 2FX9H 2D4FA 3VRLE 3KR3H 1WUNT 1C16B 3QUYC 2XTJB 2DKMA 4NDMA 1I8IB 2BVOA 3TM6A 3PHQB 4Q6YA 3ROLB 2C3XA 1AXIB 5EZLB 4NZJA 2WBWB 1MI5A 5EA0L 3VI4F 2AJZA 4WUUA 4NSKA 3SJVB 4E41D 3FHQA 3DVNB 5MP6H 2HJLB 3UZEA 5FM8A 3SGDI 3STLA 1T1YA 4NQCB 3RIAF 1UKTA 4L3EE 4XP4H 1MUJA 3TBWA 1BOGA 2XFXB 5HHPB 5CIPH 4XNQA 4JY4B 3S96A 3PXJA 4IHOB 4EVNA 3ARSA 5EBWA 5HYQA 3HPLA 1P7QB 4KK8C 3G5YA 2Y5TB 5EU5A 2XIDA 4G8GD 4HK0A 1NBYA 2MCPL 3ZTNH 3EJYD 1QLRA 1HSBB 4JRXE 3SCMA 1G9NC 4G6MH 2O5XL 2YD2A 2MTPA 3EDFA 1CD1A 1GAFH 4UAOB 4X6FB 2A74A 4Y4KA 1ZVHA 3VG9C 4JM2D 1MFCL 1JYXA 3VD3A 1N3NA 4IOIB 2YKLL 4UT9L 4MA1B 5HJ3A 2DIBA 1H3GA 4NQUA 3OX8A 5ALCH 1KJ2H 3QUZB 5F3BB 3HZVB 1MWAB 2ADJA 4WDIA 3RY5A 1NQBA 4UOW1 5D6DA 3KYAA 4NO2A 3IFOB 1IEAB 4RAUA 3LKSA 5DJ0A 3TYGH 2IADA 4I5BB 4ODWA 4YHNA 1SYVB 2AV1A 1TETL 3L3DB 1GGYA 1A5FH 4WY7H 2OZ4L 4LLQA 3V8OA 3JWOC 2AI0H 3V4VH 2F54A 5DC4B 3IRZA 5D9SB 1A7PH 4GRLC 1FQ9C 2R2HA 5F7FA 5CBEB 3R1GH 1JK8B 4M61B 2OZ4A 1DEEB 4RZCA 4APQD 4I18B 2AGJL 4FQPA 2Z9TA 4KQ4L 3AVEA 5FKAB 2IPUG 1JV5B 3L3OB 1CXFA 2XXCB 3MGAA 5GISH 4A6YL 2VL5B 5D2NA 3BUYA 2A1WH 4HJGA 1FZJB 1LP9A 2IAND 3C6SA 1UJTA 1ONQB 3WNMA 1OGTA 3VFMB 5T3XH 1EXUA 3P73A 5H35A 4A6YA 5DQ9A 1A7OH 4XAWH 1J0KA 3S3PA 1QFWH 1RK0A 3QUKA 3BEWA 4LAJH 1NBZB 2CKBH 4YR6B 1AE6H 2OL3H 4J3SA 35C8L 5IJKA 2HH0H 4U49A 4OZFA 3VFVB 1OY3B 3P11L 3SKMA 3IB4A 3NCCB 3ARBB 4OLYL 2PTVA 2CDGB 1O0VA 2AABH 3BE1L 1JCKA 5EBMB 4MGXA 3FZUD 1F6AA 1S7TA 2E7LA 5J12C 1F6LL 2MKWA 4P9HL 4NQVB 1GC1H 3RP1A 1OP9A 2BVQA 4YDVB 3IDGA 1KGCD 1BIHA 3NCEB 5KSBA 3S3JA 4MXVE 4PY8J 5EH1A 5ISZD 1U3HD 3MLXH 4WFGE 4YXKL 4K3DH 1FJ1B 1NAML 2NY7L 3H9ZA 2IAMD 4RNRB 2BNQA 4JZJA 3RBSA 4JR9L 5D5ME 2ZCHL 5F7DA 2D0FA 3IDYC 3ARFC 2HVJB 5I1KL 3QDHA 4RFOH 1Z3GL 5F9JA 2IQ9L 1NAMA 4TUJA 5LCVH 5EORL 4OZIB 4OLZH 4Z18A 1HI6A 1L0XA 3V6BR 2HTKD 4OZFG 1GGUA 2B8OT 3VFTA 2X4UA 4KJYA 4Y19D 1B0RB 5EPMA 4XXDA 1NGQH 4OI9A 1F00I 1FFPB 2IBZX 2QSQA 2Z31A 2RCSH 5FYJD 2ZUVA 4PJCB 1SBSH 1WICA 4MCYA 2I07B 5IB2B 5GS0L 1RQ5A 2YXFA 3BAEH 1KBGH 5EDXA 5TF1H 1ZE3C 3AM8A 3GMNB 3RDTA 1OB1A 4LRNH 3ARDB 1NFDE 3NACL 2V2TB 4GKSA 1RK1A 3QXDB 5IBLC 4QXTA 1CU4H 5A3IC 1ZVSA 4NZUL 2VDRL 5E2WL 5BVJB 1OSZA 5KVDH 1IJ9A 5ESVB 4FXLA 3DO7B 1RJLB 1F97A 25C8L 3Q0HA 2JJSA 2F58H 3CSGA 5JZ7C 5DJCB 2EYRB 1S78C 4PJDB 1T6VN 4MXQC 3F58L 2ICWI 4N90D 1UZ6F 4EDXB 3DURA 1F2QA 4MHHI 3KJ4C 2VZOA 1P4BH 4PY7A 3UYRL 1FORH 4MD4A 4YBLC 2PXYC 2DI8A 4K94C 4XGZB 2OK0L 3LVEA 5CKGA 1WLHA 3BKYL 5E56A 3HI6L 4OGYL 1NCAH 3PWVB 3WV0A 4Y0GA 3QQ3B 4PV9A 4HXBL 1FVEB 2MKLC 3GBML 4PGEB 1H3XA 1JWMA 2XZQH 5HHNB 5CGYD 3VRIA 3T4AB 1IM3A 4HUUB 3M17B 1UCBH 4WW1A 3TBSB 1EH9A 2W65B 3KGRA 1QA9B 3RVUC 1Z2KA 4P3CH 2L7UA 4JM4L 5DMGC 4HGMA 5AYUH 1AQDB 5JQ6H 2H2PC 5C0DA 4IRJA 5IVXA 1A6VL 3SGJA 1FLRH 5FM5M 3MRLB 3MLYL 4N8CH 5D71L 4K7FB 3QPXL 1IAMA 1UM6H 4ZOCA 1YECH 2P48B 2NY1D 1D5ZA 3FQTA 4HKZA 5CMAA 5I76B 4TVPH 1WFOA 2EDRA 4YAQA 2V9RA 3DXAA 4PJ9C 3VXMB 3OKDB 3WN5A 5K59F 4GXUM 1HN1A 3FT2B 1QRNA 1A6UH 3EO1B 4DUWA 1EFXA 3RVWD 3IDMA 4GOSA 4X6EB 4EN3C 4U1GC 3UPAA 3A6BL 4ZYKA 5AUMA 3WEXB 5HGHA 4Y4FA 3SDDD 3PL6B 1ZXQA 4RQQA 1CK0H 4ZUTA 1T83C 4U0RC 3CMGA 3RZCD 5E9DE 3VXTB 3WL9B 1N6UA 2H9GA 4XWOD 3WNNA 1PBYA 6FABH 3ZDZF 1V7NL 2YUWA 1TLKA 1UKSA 4P3WA 1CDJA 1FCGA 3LQMA 1S7QB 5I74B 4XMLL 3RGVA 1A1OB 1CIUA 1BD2A 1X5IA 2OSLB 4E42A 4NNYB 4IJ3B 4OFDA 1JNLH 2QTEA 4L9DA 3W0WA 3HTLX 5ADOH 5HYIA 4P2OA 4PB0H 3OXRA 3CGTA 1ZHBA 3SDXA 1F4XL 2YN5A 3VFUA 4BH8A 1FPTL 15C8H 3BZFA 4WI3A 3L5HA 3OXSA 1OVZA 3D3VE 2AJSH 2VXSL 2ADGA 1PX3A 4GKNB 3NH7H 5IESH 1NC2D 1YMMD 1QFWI 3C2AL 5EC2A 3U0WL 3QEGL 5FYKD 3U30C 3L3GB 2C5DC 4NO3A 4ONGL 1MWAH 3MGOA 1BVKB 3VFPA 1BFSA 2CIKA 2OJZL 3ETBF 5E94A 2M26A 1TVHA 1MFAH 3QHTC 1T66C 4KI1A 1F8TH 5GJTL 4WW2B 5IT2L 4Y5XC 3MRPA 3CX2A 1ZANL 3U46A 4DK3A 2FIRT 3O8XC 3AU1A 1KENL 2NYYD 1XGYL 4PJIF 4F9LC 5HHOA 4L3ED 1DQLL 1OWWA 2NXYB 5KSAC 4LPWA 4QXUL 3H3PL 1C12A 3NIFF 2R4SH 4PG9A 3K8KA 2Z93B 4LKXB 4ZMAT 4ZO6A 1VFBB 1JVKA 1K6QL 5CJ8A 4YXHL 5LWYH 2ZUSA 1WBYA 3PWPA 3QUXB 5E2VH 3VWKC 2HTLD 4JRXD 1LK2A 1EO7A 4NKOB 4QTIL 1Q1JL 2QQKL 4LNRA 2XWJA 4HDIA 4D9QE 4QRPA 1C5BL 2VNCA 5HHME 5C09E 3BDYH 2ICWA 1I3GL 3LEYL 4P5MB 3JTSA 1MFDH 2FX9L 5FEBA 4GG6A 1M7DB 1IC5L 3KR3L 3BYTA 3TIDA 4X4ME 3ARWA 4MJIB 1T1ZB 3X12B 4LQ1A 1GGTA 3K4ZA 3F5WA 4M6OL 5HI4C 5KG9A 1V7ML 2JCCB 4OBSA 5LXGH 5MP6L 5D1ZA 2ATPB 3KAAA 3LQZA 5CD3A 4XP4L 3T77B 3QDJB 3ZHLA 1U8PA 2XKSA 4LP4A 3EYSH 4EJ1C 2F53B 4MLSA 4PRDA 3FB5B 3S4SG 2VKXA 3NIGE 1JPGB 5ALBH 4HJJH 4NJAL 1MRCH 2Q7YB 2P8PA 1DZBA 1UQSB 3S97C 2HRLA 3VXUE 1GCFA 2ICCA 4Z7UE 1KEGH 4XP9L 5CZKA 5CHNA 3RTQA 4KKAC 1A47A 4P46A 2GJ6B 1U8QA 4G6ML 1LK3H 3C6LA 1OAUH 3SKOB 1GAFL 4MNGB 4HIHB 5I73C 5KS9A 4KPHL 2Y6SD 5C0FB 3JSSA 3MNWA 2EO1A 5DC9B 3VFGH 5KVGH 4J6RH 5EFIA 1A6ZB 1KJ2L 3EYQC 3HNSH 3ULUC 1TVDA 4FQIL 5TF0A 3TIEA 4Z7OF 2R1WA 4XCFH 3U7YH 1N5YH 3L7EB 5D1XB 3TYGL 1U8IA 3BJ91 1I7RA 5GGQL 2AJXH 1KJ2A 1P5UA 4ZD3L 5IQ7H 1DUZA 3LCYA 3RHWK 4XCYB 1R6VA 5AYQA 1CICA 3PWJA 2ZG2A 2AI0L 3S34H 1RZKH 1QYGH 4XNMB 1A7PL 4S1DC 1I1YA 3PDOA 1J05B 3R1GL 1FAIH 2Z8VC 1U91B 2DWEB 4PIRF 1KB9K 1EDQA 3RVTC 1UXWB 1K4CB 1J9CT 1FG2A 3EYVB 4WFGD 4L8BB 5JUEH 2Q7NA 1CDGA 1R0AH 2P8MA 4UQ3B 1KIQA 3C5ZA 3WDJA 2A1WL 2PW1A 3RKPA 3SCMC 4TNVF 2HMID 4Y4KC 5T3XL 3FQRB 2NY4C 2OX5A 2B4CL 3B9KB 3NA9L 4JB9H 3W9EB 3O6LH 1A8JH 1QFWL 2E6QA 1AE6L 2OL3L 2VO5A 3RI5F 4AZ8A 5IMMA 1GRWA 2FRGP 1Q72H 4YDLC 4GW4B 2C7UB 2OL3A 2DLFL 4Z7VE 1N5AB 4OGZA 1JF1B 4MA3B 4RAVB 4XB7A 1PG7W 1H5BB 3D6GA 2E3VA 4KU1A 2FEDC 1QBAA 3T1FB 4JLRB 4QRUA 1UB5B 1IGCH 3BGFB 1CFVH 2DKSA 1VADB 4PJBE 2FIKA 3TT1L 2FSEA 2ZUQB 1UACH 4JHAL 1P69B 2RFXA 5DJ6A 5CCKL 4MSWB 1PZ5A 4K3DL 1ZLWH 2VLKB 2IALB 4NFCA 1ODAA 1U8OA 1AGDB 4N0FB 3VD9A 3KDMA 3TN0A 5AD0B 3VGGA 5BMFL 2VQ1B 2JF1A 1FSKB 3U82B 5IB1B 1VACA 2PETA 5C0IA 4QCIB 2FZ3B 4RFOL 1NBQA 4MQ7B 5LCVL 1CYGA 4M93C 5D2NC 4N0UE 5FYLD 5A2FA 4M5YH 1QO3B 1ZT1B 2WQ8A 4DCQA 3RWEB 1SEQH 5JPNB 1BX2A 4OTXH 1QBBA 3O3BB 1AHWA 4JHWH 1SBSL 3VI4E 3VD5A 4G3YL 4BM7A 5IJKC 3QIUB 5IBUB 2NY5H 3GM0A 3BAEL 3FFCE 2NNAA 1LEIB 3BN3B 4G6AC 5IVOA 5B39B 4Y2DB 1HK6A 3TBTB 4LRNL 4PJHA 1OLZA 1JWSA 1S7RA 2A0LC 3AREB 5T33L 1JHTA 1RJZB 4LQFL 1BPVA 1KV3A 5IVNA 1JGLH 4V1DD 2E7LC 3GNMH 1CU4L 4G6JH 5ENWA 4PP2A 3P0GB 5KVDL 5IEHB 5IKCA 1IVLA 5GRJH 1NCDL 2IBZY 5EUOB 2F58L 4FXKA 5ETUB 2D9QB 3TC9A 2G9HA 4OD2B 4CN4A 4P9HC 2IPKB 4JANB 3QCUL 3CFBB 4JZJC 4PJ8D 3VXPA 3WO4B 1RMFH 3AS1A 3MLUL 5KN5A 1UVQA 3F7VB 3UTTA 4Z6AT 3MA7B 1P4BL 3IJHB 1DQTA 1ULVA 1JNHA 1QPXA 1KLGB 4PRNB 3IJSB 3GMPA 2EDJA 2CMRH 3X13A 4N1EA 3V0VB 1K85A 3VWJD 5C0EB 2W38A 4WEUD 4FZ8L 2YZ1A 4ZXBB 5I75B 3RPIB 1NCAL 4XVSH 1Y6KR 5EU6B 3MNVB 5L2KE 3T3MF 4AT6B 4OCYH 2FHBA 3CSBA 3B9EA 4OCXH 5KVMC 4J8RA 3S36H 5E9DD 1W0YT 1LO4H 5CP7A 3KPLB 2D7QA 1EVUA 1HYSD 2FH8A 4MQXD 3AM8C 5FDWA 3RDTC 3VA2C 2NTFA 4C56E 4JJ5A 3FB6B 3G5VB 1CVRA 3H9SB 4K2UL 4P3CL 1WWCA 5AYUL 5D72H 5BRZB 5GS0C 5JQ6L 5LGJA 3V6ZB 1BEYH 1HH9B 3T1WA 1QR1B 3M1BB 4HIEA 1XH3B 1AP2B 3OKNB 1XF2A 3W2DH 1YECL 2JJSC 3ZDXE 4XCCH 5D1QA 3V4PH 4XMPH 4OM0L 3LRSA 1UB6A 2VLME 3O6FD 2NQCA 1R5WA 5ANME 3BP5B 4AH2B 2YPLE 3U4BL 1A6UL 2R23B 4LCWB 3FT4B 1ZTXH 3N1MC 3DROA 1BFOB 3D3VD 1CLZH 4HBCH 3TBYB 2A9NH 3U6RA 4LKCB 1GHFL 2V2WB 2ZKHH 4W70A 3KYOA 2EE9A 2VLJE 3MJ9L 1CK0L 1TJIL 1I85C 1M05B 3IDNA 3RWJB 5AAWA 4M7ZC 3HLAA 3FT3B 2PW2B 2Z4QA 5ID1B 3TT3H 2X42A 5B4MD 3MJ9A 3ZKMD 1I8IA 3OBAA 3PHQA 2GITB 3ROLA 3RRQA 3KWWB 1JZ7A 5EZLA 1H8SA 3FAWA 3TF7C 2VXUH 3BZ4B 1DBBH 2E7HA 3SJVA 1JNLL 3EO9L 4WU5B 1P4IH 4KHTL 1BLNB 1FYTB 4I3GA 5ADOL 1B2WH 4GQPH 4N0CD 4PJXB 4BFIB 4IRJC 3SGJC 5DURD 4PB0L 1B9ZA 5F21B 3FB8B 1NBVH 2B7DT 3CVIH 4HUXB 4ZO9A 15C8L 3GEWB 4HKBB 5E08L 4PRIB 3P4NB 2VB5A 1D5BA 1K8IA 2NW2B 4IBLT 3WN5C 4U0QB 2Z0BA 3WXWL 5C0CA 2YA1A 3NH7L 5BZDA 2I9TB 3Q6FA 1GZPB 1DQMH 2QSTA 4CUCA 5DMYA 4RMVA 4RGOL 4KI5C 1HSAB 4MA7H 4NWUH 4D9QD 5HHMD 5C09D 4Y4FC 1PVHA 4YGAB 4WWKA 1YEGH 1MJJB 1MFAL 1HINL 2IMMA 1PG7X 4JREC 4IOIA 2ADFH 4X7TB 2YA2A 1I3RB 3FCTA 3RBGA 3QUZA 5BCAA 5I30H 3LKRB 3SE3A 4H8WL 1NC4D 2JTDA 5CBAB 1XGPA 3IFOA 4RISH 3RGVC 5HGAB 4I5BA 3JBG7 5AWNH 1SYVA 4K07A 4BYHA 4NRXB 2APFA 3B43A 4F7CB 1EERB 3L3DA 4H0IA 1AC6A 2AEQH 2OR9L 3MFFA 1UZ6E 4LLYA 4P2OC 1SEBB 3RWHB 5CJOH 3G6JA 4FFWC 5DRXB 5LWYL 5C7XL 5A2IH 2I24N 3E2HC 3MOBH 3TLRA 3H2WA 3VXUD 3X17A 3HI1B 4XBEH 3GM8A 5HHQA 4KRPC 3D25A 4I18A 2XPGB 4RMRA 1JHKH 5FUOH 1JV5A 1DQQB 2X7LB 3VMPA 4QRSA 3KPSA 3BDYL 2VL5A 3SOBH 4OB5H 4M5ZH 2BHUA 1CT8A 1ONQA 3MYJB 4JRWA 1R3JB 3VFMA 4O58L 4ZNEE 5DO2D 4BA8A 3JWDH 2LQRA 1NBZA 3I3BA 5LXGL 1FIGH 3BIAX 3WIFB 1NCWH 2P44B 1NEZB 1D5IL 1PG7L 3VFVA 2J4WH 1U2CA 3QZWA 3H42L 1P6FA 5E8PB 3EYSL 3ARBA 3L7FB 5JIHA 1CFNB 4R4BB 4G7YH 5ALBL 4LHUD 4AM0A 3SDCA 1MRCL 2DYPB 2D7NA 5DRZB 5KANG 2FO1A 5I1DB 4YDVA 2WUCH 5K59E 4NC0B 1MCJA 3FTGB 3RWFB 3CLEH 4ZAKB 1LK3L 3CLFH 1FJ1A 2YRLA 5ADPL 4RNRA 2NY2D 1HHIB 2WIMA 2E6JA 2HVJA 5DHYB 5IBTL 3VFGL 5B8CB 3RU8H 3BPOC 1ZGLP 3KLSA 5ACMA 3LY6A 3QNXA 4OF6A 2FGWL 3HNSL 4OZIA 3W11D 4NT6B 1MCKA 2PN5A 5HGBA 3ZDZE 5EU3B 2XN9B 2BMKA 2ESVA 1EAPB 2IFFL 2H8PA 1YN7B 4FMKA 4XC3H 4P2QE 4WWID 3WFBL 1FFPA 4X7FC 3WS3B 5IQ7L 4PJCA 5TDPA 5D7KE 5IB2A 2EYSB 3NVQA 3LN4B 5D1ZC 2Q8AH 4P2YA 3F7QA 5EN2A 4EUPA 4NBXB 5DC0A 1RZKL 1PY9A 1QYGL 3GMNA 2DM2A 3ARDA 1T03H 2CRYA 2V2TA 2DMCA 3TFKD 3QXDA 5KW9L 3HE7A 3ISWA 2VDKH 2ILLA 3DMMD 1K2DB 4LMQE 4MJ4A 1X5KA 4ONHA 2PYEB 1NGWA 3IYLW 4AMKH 2FH6A 5ESVA 1F3JB 2JLLA 4L4TB 3MRGB 4FQ2H 1CD8A 5E70A 43CAA 4P46C 1NL0H 3C6LC 1CDBA 3L9RB 4PJDA 4CGTA 1HCFX 1MCDA 4EDXA 1Z9LA 3O6LL 5F6IC 1JP5A 4H20H 4G9FB 3SKNB 2P43B 1K5NB 3KPQA 3TWCL 5D6CB 3OKKB 1UEMA 5IR1B 1IAIL 3EHBD 2WNGA 4FZEL 5LAXB 4M6MH 3DUSA 4EUPG 3BRDA 2AERT 3BGMA 3T0EE 3PWVA 4Z77B 3QQ3A 4LCIL 5I9QB 2M1KA 3FFCD 1UYWH 3PV7A 3RWCA 1TTUA 3UPRB 1NCUA 4PGEA 4PJIE 3U2SA 1CFVL 2FHCA 4HUUA 4CN1A 1UACL 4C55A 1ZWIB 4CJ1A 4HUNB 4NBZB 3TBSA 4LPTA 3NIFE 1CTNA 4R3SB 2W65A 3HB3D 1LNUA 3AGVA 4P48A 2K3TA 1AQDA 3IDIB 2JB5L 3EOBB 2O5YH 4LLUB 2AQ1A 2QJDA 5JW3H 1DVFD 5SWZB 3GHEH 4L8SB 1X4YA 4K7FA 4QHMB 2AQ3A 4G42A 2AK4E 4P23B 5T5FH 5I76A 1PAMA 5ITBH 4M5YL 3VXMA 3OKDA 4WW2F 2Y23A 3RQ3A 3FT2A 3DETD 3S36X 3LKPB 1NAKH 5HYJE 3UTPE 1KN4L 4X6EA 3V5KB 4O2CB 4E41B 2B2XH 2FO4B 2XOTA 2XQYG 5DXWA 5FGCB 2LU7A 2NY5L 3WEXA 2B4CC 5L2KD 4OCSH 3PL6A 5J13B 4HWUA 1H3PL 4MQTB 5E6ID 1JI2A 3VXTA 4CNIB 1NUNB 1BGXH 2RJMA 4Z9KB 4ELMA 1NFIB 3RAJL 4TNWK 3HNTH 1KF9B 4G6JL 4C56D 4UUJA 2YR3A 1BZ7B 4G8GB 1A1OA 4F80A 5GRJL 1LP9F 1Z0NA 2GFBA 1OGAE 2OSLA 4H26A 1H3WM 3OPZH 4NNYA 3EOYG 4LSRH 4OQTL 3OKLB 5FHBL 5TGBB 5FO9B 2DQUH 2LU3A 3TN0C 4Y16A 3MRKA 4JHZA 2CSPA 5EC1A 4JM2B 4KMTH 2DDQL 4OQTA 3TO4D 2DD8L 4DGYH 4L4JA 2VLMD 1KCRH 2CMRL 5MEOA 2YPLD 1YNTB 2JCCF 2EDLA 3GO1L 2CO6B 5HHVH 1U41A 3MSPA 4GMSL 5DYOB 4ENED 4Z7OE 2HLAB 4GKNA 1UWEH 4NRYB 4L9LB 4JVUA 1AHWC 4OCYL 3QFDA 5DMIL 1FO0L 1JNNH 5C08A 3S36L 1ORSB 3O2WH 3L3GA 3C09B 1F90H 2DM7A 2ICEA 1S7UB 1W8OA 1BVKA 5E5RB 1KCUL 2HFFB 3RJDA 1F11A 1ZT7A 3G04B 3S37H 1FO0A 1FN4A 3LHPH 1KIRA 4XX1G 3SKUD 2XA3A 1RU9H 5D72L 4M43H 2EDXA 3V95A 1XCQA 1Q9KA 4APQB 1TZHB 5JOFB 5CS7A 2AJVH 3RWDA 2WWMC 3W2DL 2XQBH 1A6PA 2VXVL 4KRLB 2HKHL 1MEXH 4H1LA 4KK6C 4YGVA 1QNZH 4P57B 4XPAH 2IANB 1D6EB 1FL3B 4XNXL 5FB8B 3MV7E 3C8HA 1VEPA 3NGBC 1MIEL 1XGRB 5E0QA 5ITFB 3P0YH 4EI6B 4LKXA 5CILH 1VFBA 1MCNA 1RZIB 3QO0B 4MD0A 2A9NL 3U4AA 2ZKHL 1GVIA 1AO7E 5M94B 2DN7A 1QSVA 5BO1H 4JPIB 4WFHE 1P5VA 3REWB 3E3QC 4I2XA 5C9JB 4K23L 2NXZC 4I0PD 4P5MA 3U4EA 2J1KA 3EDJA 2BVUA 3JVGA 2FYYB 1IZJA 3OF6A 4HUMB 5IW1B 1RAMA 5D7IB 5BZWA 4I3RH 5C3TA 4WGVB 4MJIA 1T1ZA 1A7QL 1QFUL 3X12A 2EDHA 4JRYE 1ZGLB 4G5ZH 4H1LG 2AQ2A 1RUKH 1P4IL 1RZ7H 2VDOH 1U3HB 5ISZB 5IFHH 4PR5A 2IAMB 2R69H 1B2WL 1PY4A 3BJLA 1RUML 5A1AA 3T77A 2ED7A 1Q0XH 3QDJA 1NBVL 4N8PA 3CC5B 4JY5L 4LFHG 3NPSC 1H8NA 1IEBB 2JJUA 3W5NA 1A4KA 4XPGH 5GGSA 1JPGA 5EU4B 4ODUB 2GHWB 5D1QC 4O02H 3L95A 4PJGB 1Y0LB 1UQSA 5DJXB 1TENA 4K3GA 4Y19B 4POZC 3BISA 1LDSA 1JHLH 2COQA 1DSFL 5DA0B 2J8UB 3H9HA 4MA7L 5DD3H 4JO4H 4Y5VB 3SKOA 1MQKH 5JW4R 2NZ9C 1SJVA 5C0FA 4YHOL 4AG4H 3ZTJG 3VXRE 2ID5A 4KKNA 5EO1B 5I1HL 3QHZH 5IVXF 1A6ZA 3WIIH 3RX5A 2XTJC 1BM3H 3T3PF 4UTBL 1AQKH 1G9MH 2NX5E 3BT2H 2BSRB 1D9KD 4OD3H 1ZA6B 2R29H 5EOTB 1EBPA 1K4DA 1QUNA 2D03H 3CIQA 4XCYA 1AGBB 2VZ3A 4DZ8B 3NFNB 3OR6A 4WNQA 4PJAF 5I8CB 4BFGA 5GGTH 1M6OB 1G7JB 4J4PD 1OTTC 4LIQL 4XNMA 1J05A 1J7VR 1G7HB 1LO3H 3GJEB 3MOBL 2P7TB 4XBEL 2X4TB 1EO8H 5HPMA 5TPWL 1KELL 1UXWA 1K4CA 2X9YA 3I75B 5L9DL 3EYVA 5FUOL 3T2NL 1T0PB 4L8BA 1FRGH 3KYMB 1BIIB 2Y07H 1KFAL 3HUJB 2AXGB 3LEXA 5FUCE 5C0GB 3T3ME 3G6AB 1DBKH 2N4IA 4PGZA 4UTAH 3EYFA 1HKFA 4DN3H 2I5YH 2VAAB 4UAOC 3B9KA 1B4RA 3TJEH 4NKIH 3JWDL 2CGRH 1FIGL 2UWEB 5ACZA 2XZAH 4FFZL 3QUZC 4P2QD 2J4WL 2GYSA 3D0LB 4D9RD 2ICWJ 3SE3C 1TQCC 4GW4A 5D2LB 5D7KD 3I2CH 1JF1A 4NUGH 4PJ5E 4KMQA 4RAVA 2NY1B 2NY6D 3T1FA 4H8WC 3FN0L 5SV4A 4JLRA 2RB8A 1VADA 2X1QA 3NCJH 3F12B 5IGXL 2VL4A 2JB6A 5DT1H 5MERB 3JZ7A 1YNKH 3IFNL 3CLEL 3MOQA 2FEEI 2VLLA 3EZ8A 2FHFA 2EEAA 1HHGA 1AGDA 4N0FA 1GGCL 4A2LA 5FA4B 5AD0A 4YDKL 3SDDB 4I18C 5F7EL 5IB1A 1OP3H 4GRMB 4QCIA 2FZ3A 3RZCB 3ZYZA 2WWKT 3HAEG 2IC2A 2ZPKH 3OB8A 4WV1B 4BSJA 3W82A 3QPQD 1OTUC 3HA0A 2R4RL 4IRSD 3IETB 3RWEA 5FKPB 3WHE0 5JPNA 3W5MA 3OKYA 1RJCA 4YBHA 1OARH 3UBXB 4XAKE 2XRAL 3T0ED 2J5LB 1K3ZA 4NJ9H 1LEIA 9CGTA 2YBRA 5E8NB 5B39A 4Y2DA 3TBTA 3ARBC 3MREB 4XP5H 3RGHA 2X89D 2QQNL 5GIRB 3BHBB 5A2LH 1RJZA 2VDKL 1WEJH 3O3DB 1HNFA 4X6DF 3SDCC 1A14L 2BXZA 5GHWL 3ZYJA 4AMKL 4M1GL 2D31B 5IEHA 4GXVL 3HFML 3FJTA 2O61B 4HPYH 4FQ2L 1S9YB 3KPRA 5ETUA 1T7XA 5H37H 3MRFA 4LSQL 1BBDH 1NC2B 1YA5A 1YMMB 2EDYA 4OD2A 4P2RD 3PIQB 1NL0L 1OTSC 4JVWA 4HUVA 2AK4D 2IPKA 4RAHA 4A2MA 4PLJC 4PRPE 1YEDB 2AXHA 3F7VA 4UNVA 4NHCL 4KJQD 3MA7A 5DS8B 1FGNH 4KAQH 4L8DB 4XBPA 1MHPH 1DL7L 3PGFH 2FDBP 1NMAH 4K71B 4YHZH 3V0VA 4M6ML 2Y9RT 5HYJD 3UTPD 5TE6H 3U7WL 1UJ3A 4FXGB 3MV11 5EU6A 4AT6A 1KJMB 1FZKB 5CGMA 4L3EB 5DJ2B 3RL2A 5GGRA 3KPLA 4IRZH 4JAMB 2H2SD 2GY5A 1VPOL 1IFHH 5F8QC 4J3OC 3MRCB 1EV2E 4FTVA 3ARDC 3FB6A 3G5VA 2QEJA 3H9SA 5BOPA 2HG5A 5FCUH 4JFFE 3HE7C 3V6ZA 5FF6B 1RZKC 5JW3L 4JRXB 4MA8L 3QUYD 5E03A 1XH3A 1AP2A 3OKNA 3PV6B 1XIWD 2J6EH 5BV7L 2RHEA 3OZ9L 1MHCB 1IAKB 1AY1H 3QWOB 4NP4H 4CL7A 5ITBL 1JZ6A 4ODSH 1KXTB 4WJ5A 1I8MB 5E5UB 4AH2A 1PKOA 1NAKL 3AMKA 4X4XB 2I26N 1BFOA 4WENB 3F65A 1J0YA 5E4EC 2YPVL 4YLQT 5E5MB 4OFIA 3WFEH 1RHHA 1UA6H 3SBWA 1DBMH 4PBXA 4ALAH 2RAMA 2D9CA 4GSDH 3R8QA 4FQQB 3DV4B 1M05A 4NUJB 3RWJA 1TJHH 3F7PC 2ARJB 5EBLB 3FT3A 2Y06H 2YHGA 2PW2A 2DRUA 4RFEB 1X6LA 3AROA 6CGTA 5L6YH 3T2PA 2CUHA 3BMVA 3KWWA 2DLGA 2JJTA 1UWGH 2X4PB 4WU5A 4YFLI 5FGRA 1ZKAA 4GG8A 4W4NA 5DEFB 5CLWA 5IEKA 2DQUL 4ZDHB 4PJXA 1E4JA 2KPNA 2YSSB 5GSRB 5I1GH 2KZ1B 3RWGB 2FEEL 2QKIB 1WFNA 4HF5L 4LVHB 1D7FA 1ES0B 4JZNB 4HUXA 3WNOA 3HMWH 3GMOB 4LHJB 1U3JA 3P4NA 3GBNL 1JTOA 2VIRB 5FYJH 1UGNA 5HHVL 2NW2A 3FO2B 5JIKA 4MB5A 3VFRB 1UWEL 1JRHH 2I9TA 3MRNA 1AO7D 5EZOL 4D2NA 4UILH 2FD6H 1QR4A 1JNNL 3TCXA 1L7IH 4GRLD 1HSAA 4OM1L 4WFHD 1F90L 4N5UA 4JFEE 5DRNB 5ESAB 3BH8B 5J9PB 2DICA 4QO1A 3PL6C 1YZZA 3JV5A 1MJJA 5I18H 3HC4H 3GSUA 1IGIH 3LHPL 3BPLB 1I3RA 1NCNA 2HJFB 2NY5C 1EMTH 1T4KB 1YEKH 5C0RH 3LKRA 4NZDA 4HFUL 4PUBL 3WUWB 2W59A 5CBAA 1B4JH 2AJVL 5KJRH 4KK5C 4K3JH 4UV7H 1QHPA 1N2RB 3KNBA 1AXSB 1MEXL 2V7NB 5SX4H 4IJ3C 2ZNXA 3O41B 5D5MB 1QNZL 5LG1A 4F7CA 4I4WB 3DYOA 1D6VL 1HXMB 3VGBA 2A83B 4UZGA 2K7QA 3GI8L 4U33A 4ETQA 1TTGA 3QJFB 3QG6A 4JN2A 5CILL 5GGSY 3RWHA 5DRXA 1J18A 4I48B 3QAZC 4J23A 4U6HB 4Z5RA 2UZYB 4PJHF 3HI1A 3MX0A 1FLTX 1KLUB 4YHLH 2XPGA 4WEMB 4C59B 1DBJL 2I60L 4J1UB 4JN1H 1BFVH 3RIAK 1DQQA 2X7LA 1RIVL 1C5CL 1ZLUK 1RJYA 2D7OA 3MYJA 4K9EL 3VXRD 1R3JA 1NFDB 2M2DA 1N7ML 4CDHA 4G5ZL 3HE6D 1RUKL 1LE5B 4KRNA 1ACZA 4PS4H 1NEZA 1H8OA 5IFHL 2EEDA 1DANU 1JZ2A 2NX5D 2Z35B 1EHLH 5EIQA 1Q0XL 2G75B 4QT5B 3D1MC 5F7NC 3N1GC 3QXTA 2DI9A 4R4BA 5JMRA 5MENE 4Y1AA 4Y8DC 4O02L 2EDEA 4KV5F 4Z0XB 5MEQB 1KACB 4O2FA 4PRAB 4MXWL 3VG0H 1JHLL 1LILA 1FNHA 3RWFA 3MLPA 4X9GA 4ZAKA 1N6QL 5DD3L 1YMHA 1MQKL 1BVLA 1HHIA 5IBLD 1U8NA 4L4VA 1O5DT 5DHYA 2VDMH 3IF1B 3PGCB 4I3SL 2EIZB 5IB4A 3U36B 4IS6A 2LVEA 4QHKI 3JVGC 4YDIL 1CCZA 1IBGH 5EU3A 5JZ7D 4V1DB 3V5DB 2DS4A 1BM3L 1S78D 1RUAH 3EOAB 1MJ7L 4I77L 3SY0A 4MXQD 4OD3L 2CRIA 3QEUB 1LWRA 1HHKB 1IM9D 1LP9E 5IVZB 5BXFB 4G9DB 1I1FA 3LN4A 5B3JF 3BPNC 4PJ5D 3DTXB 5ELIA 1N59A 2PXYD 5HTSA 4LCYB 4PJ8B 5GGTL 4RFNB 5IFJB 3CMOH 4R4NC 3CK0H 4HLZH 1BQUA 2QL1A 1LO3L 1K8DB 4M62H 5FYJU 4BH7B 4N0YH 1K2DA 1EO8L 4OLVH 3VH8B 2PYEA 3WXVH 2OJEB 5GGTA 1G0XA 4OFVA 3VWJB 2JCCE 4LSUH 4YHKH 5FYKH 1T22A 4QHLB 2Y07L 2ARJQ 4TTDD 5HYSA 1BQLH 5JOEA 1BJ1H 1DBKL 1XGUB 4R7NB 3FQXB 4HS3A 2CK2A 2R2EB 1ZHKB 4O9HL 3L9RA 5E9DB 2I5YL 5DMGD 4XRCB 5AZ2H 3SDYL 3O6KL 3B9DA 4MB4A 4YX2H 5GZND 2OQJA 4OCWL 5KSBE 2PR4H 4ODVH 4NKIL 4NO0D 3KPPB 2YEZB 4R0LB 5HVWA 2X4QB 4M3JA 1K5NA 1PQZB 3OKKA 5IJVA 5IR1A 4XVJL 5LAXA 4K8RL 3OJDB 3VFNA 5HSFA 4XAKD 1QACA 4PJ9D 1OAZL 3I2CL 4NUGL 4Z77A 3GHBH 3MGTA 4JM2F 3JXAA 1AFVL 4EN3D 1MCBA 1T2QH 2XT1B 3O6FB 4PLKC 1RZJH 1ZWIA 5DT1L 3WFDH 1MHHB 5HYSG 3AAZB 1S7WA 4P3DA 3D3VB 5F89A 1QQDB 5C8JA 3BO8B 1M71B 1U8HA 3EOBA 3IDIA 5HD8D 4LLUA 5E6ZA 1RUQL 1CE1H 4L8SA 5IF0B 4YFDB 4QHMA 5CZXC 1U92B 4P23A 5B21A 5CUSH 2IBBA 1PLGH 2VJXA 1JRHI 4PRPD 2W92A 2BOBB 4HGWB 5F9DC 4F15B 4D3CH 1S9WA 1JL8A 3ARGD 5CJQL 3B9KC 1IQWH 4Z7QF 5ICYB 3LKPA 5DEZA 3B8YA 3NZ8B 5DUBA 3V5KA 4O2CA 5GJSH 2H1PH 3GB7A 4NIKB 3MRRA 2E8YA 3TA3D 1AH1A 4XMKH 2IPTH 1JPSH 5CJ5A 3MJ8B 4KXZH 5E24E 2OTWB 3ZKQD 1MJUH 1C8PA 1YJDL 2F8XC 3DRTA 4X6CA 2DQCH 4NRZA 5DURB 3B2VL 3JWDC 5F9WC 2BFVH 4YQXH 1E6JL 3IDJB 4NCC2 1NFIA 2FJHA 4PBVC 5F1NB 5FUZH 5B3NA 4LL9A 5SX4I 2WMPA 2EE2A 1T1WB 3BGFC 5DK2A 2V9QA 3R0MA 5HDBF 3BP6B 3BQUA 4G8GA 3ULSB 2ZUQC 4JFFD 5DSCB 1KXVC 3T2QA 3BXNB 3FOLA 3D0VB 1BBDL 3KPOB 5JIPA 4OZGA 3L6FB 5I71B 5TGBA 1V3JA 1N4XH 5HHMB 2BOCA 4OF5A 5C09B 3K4AA 4LGPB 3TNNB 4OGXL 1JNJA 4KAQL 2C1PA 1C1EH 4PJ7A 3I50H 5HHXH 3QHFL 1NMAL 1YNTA 2CUIA 2QLVB 3MRHB 5IVXE 5MEPB 5CKAA 1YY8A 2W9DH 3WBDA 5KSAD 5TE6L 1NC4B 4DN4L 3MLRH 2P5WE 4OZHA 4NRYA 3T3PE 4NFDA 1U3ZA 3HCVB 3KPNA 1ORSA 3QIUC 3NCFB 2I9LB 2VH5H 1QRNE 2HFFA 4Y2DC 3EKCA 3DIFB 4PJAE 2UVFA 4HIIB 1QBML 4WHYH 1IARB 5EIVA 1WZKA 5FYKU 3FFDA 1FFQA 3VXUB 1CS6A 1LO2H 4Z7UB 1DR9A 3IFPB 2VITB 3LRHA 3IKCB 3W39B 4MCZA 2J6EL 3IU3A 4JKMA 1AY1L 4NP4L 5DHXB 1WBZB 4P57A 2X70B 4UINH 3GGWB 3G5XB 5FB8A 3HRZB 4XCNB 2J6EA 3QXAB 4OJFH 1I1AA 2WLZA 4OIBA 4FN0A 3WFEL 2BVEA 2IG2L 3T0AA 3UJTH 1DBML 2YD5A 4ALAL 1UEYA 1G1CA 1T0MB 4RA3A 5IB3B 2UZXB 3GMLB 2W91A 4D0BA 3L5XH 1CFTA 3UBXI 5I75C 1TJHL 1UJ3C 4BQ8A 4JPIA 1RIHH 2GQHA 3ROOA 5C9JA 4JFED 1OD7A 1NCTA 2FYYA 3KVQA 1A4JB 3U0PA 4LHUB 3BD4A 5KBNC 4LPVA 3WSQL 4RGMB 4KY1L 5J89A 4M9PA 3L3JB 1AJ7H 2B0SH 4XCEB 4X9BA 1U3HA 5GQBA 4U7MA 5BJTB 3CSYB 5FYLH 2NY2B 4X0KB 3UTQB 1P1ZB 2RIKA 3MLWL 2KBGA 1PZUB 4DAGL 4CBPA 1WTLA 4YHPB 1QKZH 3F8UB 5SX5K 5EU4A 2V6HA 4ODUA 5E8OB 4PJGA 5I15H 1CL7H 5DMJB 4R96A 4Y19A 3ZHDA 1JRHL 5BV7C 3BN9D 3GMRB 1HQRB 4UILL 2FD6L 2QHRL 2HN7B 4RMWA 2APVA 4LVNC 4Y5VA 4UT6H 3SBWC 1XGTB 5I0DA 5DGQA 5DVNA 4XPBH 1AGCA 1IGJA 4X5XB 5I18L 1IGIL 1AI1H 4U05A 4PRBB 1T5XB 4PJBB 4U1JB 2G2RB 3V7AG 4QRQB 8FABB 5C0RL 2ZP0T 3DMMB 2EC9T 3DHMA 5T5NF 3L3HB 3TBVB 5KJRL 4K3JL 3Q1SH 4X6DE 2AJUL 4Y4KD 2NY4D 2BSRA 1A9BB 4JQIH 1ZA6A 4JG1H 2IQAB 2CDEB 4HPOH 2YD7A 1P7KB 1A7NH 3LKNB 3MUZ1 4UOW0 4HV8B 3DYPA 1AGBA 1G84A 1FZMB 3ARXA 5DD0L 3U9PH 2R8SL 5MEND 3O2VH 4N0UB 3S5LB 3U48A 3DSNA 1M6OA 4X4YB 3PNWB 3KYNB 4CMHC 1DQDH 4Q9QH 3GJEA 2VXTH 2OI9B 2EKSB 4HCRH 1DN2A 4PGBB 2X4TA 2JK5B 1J87A 4HUKB 1S8DA 3MLZL 4CADA 4ELMF 3OSKA 4JQXA 5IV2B 4LF3B 3RVXD 5T3ZE 4N8VG 1FIEA 5C0BA 2Z91B 1FYTE 2AXGA 1FC1A 4FRWA 3FFCB 5DWUL 5C0GA 5CEYA 3WD5L 2EH8H 3G6AA 3CFCL 5E00B 4XTRC 4HAGA 1E4KA 3TVMA 2A9ML 1OP5K 3TYFB 3EIFA 3VRJA 3JV6B 1WWAX 4KXZI 4JHBA 3OGCB 3MZGB 4W6WB 4AIOA 1LO0H 4PV8B 3HC3L 5I2IA 2UWEA 4PS4L 4TVSa 4RX4D 3HG1A 3QUMB 2W9EL 1ADQH 5I16A 3D0LA 2Y72A 4Q58C 2QSCH 1DVFB 5D2LA 1A2YA 4JFOB 4PGDB 3P0VL 4CVWA 2CDFB 5JOPE 1BZQK 1ZK9A 1DANT 1LDPL 2C3VB 4NGHH 2DBLH 3UO1H 3PJSB 4YBQC 4IMLB 3CFEB 5MHSE 5EU7C 1FC2D 4HJ0C 5AAMA 3P4OB 4FQLL 2A0LD 3OR7B 3TV3H 3IS1X 2BJMH 3SDDA 1QEWB 1ERNA 4MJ6B 3CH8A 5E6IB 2VDML 4GRMA 1FFNA 3L5WB 4JFDE 4WV1A 1R3KA 4QHUA 3O11A 4U1KA 3SGKA 3NABL 3W9DA 1IBGL 3V6OA 3GJFB 1QSZA 3DNKA 4BZYA 1T3FA 4C56B 1CGXA 4LPUA 1G0DA 4Z7WF 5FKPA 3OL2A 1P84J 1RZGB 2PNDA 4AEIH 2KZWA 2VN7A 3GSOA 3LEVL 5GRUH 3LV3B 1P53A 1YY9C 1BQHB 5CAYB 5DRWA 3OAZK 4DKEL 1X44A 2VC2H 1U0QA 5GS2D 3CMOL 4KFZC 5C71A 4F33B 4JPVH 4M62L 4JPWH 1FGVH 3TO4B 3BHBA 5GGVL 1WCBB 5FIEA 4RIRB 4N0YL 2DJ4A 3MNZB 4KZDL 2YPLB 2Z31D 1MF2L 3O3DA 4LP5A 1KJ3H 3WXVL 3NFPB 4C83B 4YHKL 1MHEB 3NFSH 4J3WA 5FYKL 1JF5A 5J11C 1S9YA 3GI9H 1NC2A 1YMMA 2C4XA 4ZAKC 3WLBB 5DJDA 3B2UD 5GS0D 3MCLH 1HIML 1A6WH 1ZA3B 4OD1H 4ODVL 2R2CA 1UG9A 2W0FA 4XVTL 3E0GA 5DS8A 4GBXB 5IMLB 2XKNB 1T20A 3TNMA 4TNWF 4X5WB 4L8DA 3DUUB 4GW5B 3O4OB 4TUOB 3MRJB 1OWRM 5DHVB 5E8EB 1RVFH 3TH3T 5LGHL 1KPUA 3UJIL 4NZTH 4FQJH 4LNVA 1IQDA 4FXGA 4R9HA 1FNEB 5HGDB 3OTTA 1LO5B 3GHBL 1S9KC 1CD9B 1MRFH 1FZKA 3JV4B 1CGYA 3BKCL 2CLRB 3HZMA 4L3EA 3CFKA 4DTGH 2PUQT 1S5HA 3LIZL 1G9MC 2DWDA 1ZLSL 2R2BA 5CEZL 2C4FU 3I6GA 4AYFA 3WFDL 5E2UH 4ZPVB 2XN9E 1I7UA 3NOIA 4PP1D 1XCTA 5HGGS 1JFQL 4K7PX 3IFLL 3RFZC 4OFKA 4OLWH 4F2MB 2E27H 4JDTH 2YC1B 1CE1L 4PJHE 4JRXA 3SE4A 2GSIA 2J88H 3PV6A 4ZOBA 1KG0A 3FKUS 3QCVH 4I0PB 1IAKA 3QWOA 5I1AA 5FA3B 3QQ9C 1ZGLM 4KZEH 4D3CL 2DIJA 1IQWL 4WI7A 4AL8L 2HRPH 4IRJD 1J8KA 4X4XA 5J6GA 2I25N 5E7FA 2H1PL 5E5MA 3JTTB 5IG7A 3T0BA 2P5WD 4C4KT 5JLZA 1JZ5A 1MJUL 4GQ9H 3UTTE 1CDHA 1J5OL 4FQQA 3DV4A 4K3EH 2DQCL 3EUUA 1OCWL 4NUJA 2EDTA 2ARJA 1U8MA 3C08L 5EBLA 1JWUB 3BPCB 4O00A 1QRND 5I9QC 5FUZL 1YEHH 1IT9H 1CBVL 2O93L 4R26L 2B1HL 2E9BA 4O4YH 1ZHNB 4K8RC 1VKXB 2P1YA 1IKFH 4NPYA 4OKVB 5EO0A 1KCKA 1KT2B 4Y4FD 1LHZA 4LSPH 4KV5E 5IHZB 1SBBA 4OFYA 2X4PA 4BQ6A 4EXKA 5IW6A 2DOCA 3BEVB 4XNYH 5DEFA 5E2TH 5EBGA 5F1IB 4ZS7H 4ZDHA 3SDAA 3PDDA 5GSRA 2B5IB 3FQNA 4L8SC 4K7PL 2R0ZH 5F7WC 3RWGA 3UZVB 3BD3A 3BKJL 5C1MB 2QKIA 4P23C 1C1EL 1U95A 3RGVD 1ES0A 3MUHL 4CU7A 5DVKA 1A0QH 2ORBH 3MC0A 2G60L 3GMOA 3TCLB 4M6NL 3FO2A 2Q8BH 3VFRA 4ZUVB 1IGYB 2X1PA 1DFBH 1D9KB 1NLBH 3VCLB 3S9DB 2FJFA 2R56H 2Q86B 3BESR 3VGHA 5DRNA 5ESAA 3N85L 1MJ8H 1N64H 2VH5L 12E8H 2Y1VA 3BH8A 5BVPL 5ID0B 3O3UN 5B3JE 4NQDA 1CDIA 1E27B 1QFOA 4LSSL 5DEGB 1TZGH 1F13A 4NN5B 1LO2L 1YQ2A 2PTTB 4HWZA 1YJDC 2EXYD 4GAJH 1BP3B 4R2GD 3WUWA 5I66B 1R24B 3N06B 3MRQB 2QQLH 3BQUC 3ZDYF 4EXPX 5FGCE 3HZYB 1N2RA 1AXSA 5LGKA 1BOYA 4YFEA 3MRBB 5D5MA 3DX8B 2WV3A 3HZKB 4DGIL 2A83A 1E28B 1F02I 5IHBA 4S10A 4E0RA 2HWZH 4R8WL 1KB5B 4U6HA 5TDNB 2XV6B 4JKWA 4P2QB 5IHUH 1PGRB 4LVOB 4P5TA 3NAAL 5HHOD 1S5IH 5C2BL 1WFTA 3MV8A 2X1XR 4J1UA 5F1SA 2HVKB 4PREB 4QNPF 3VA6A 1RIHL 3BD5A 1PSKL 4BSWB 1MFNA 5J06A 4JFXB 1ZLUH 2LFGA 2NY6B 4ODXA 1NFDA 3QUMH 4HHAB 4TN9A 3V52H 1F4WH 4WHTB 1AGEB 3BZEB 4B7LA 4HULB 1KTRL 1AJ7L 3JV0A 1LE5A 5GGUB 4KUCD 4XP6H 1H15B 3GMMA 4H0GA 2Z35A 4MWFB 5INDB 3MXVL 2G75A 4BZ2H 4QT5A 4QGYA 4S2SB 5E95B 1QVOA 2X1WL 2DQIH 5D96C 2GUOB 1J1OH 4UB0H 4JO2L 3THML 4HC1L 5I15L 4IRSB 1Z5LB 1T7VA 3LH2L 5IUSA 2GTZB 3I02A 4BQBA 4PRAA 2KQNA 4MNQE 1I1AC 3EYOB 4Z7QE 1CFSA 4HWBH 2VDPH 4HC1A 1MFBH 2DJSA 4W6XB 2PYFB 4NNXB 4UT6L 5T3ZD 3T0EB 2CIIB 2P46B 4QRRE 1FYTD 3GJFH 3MTRA 3ZKND 3SHSA 1JPST 3Q2CA 1AI1L 3SQBA 3PGCA 4GS7B 2EIZA 4PJIB 5EOCL 4F3FB 5GRWA 2C26A 1GGIL 3FZUC 3RTQD 2ZNWA 4BKLA 3V5DA 2GT9A 3BW9B 2OS7A 3WJJA 2M8XA 3OKOB 3Q1SL 3KPSE 3MRDA 3QISA 1NGXB 3QEUA 4KKCC 5HDBE 1HHKA 4HPOL 1MCEA 5IVZA 1A7NL 3N9GH 3QEQE 5BXFA 3EDDA 4G9DA 4M7JH 4P2RB 1U3HC 2AK4B 3I6KB 3U9PL 1W72B 3ILPB 2NW3B 2CQVA 5IFJA 5LQBL 5GS1A 1QSEA 4LCCA 1DQDL 5DI8A 1K8DA 4YHML 3T65A 4S1SL 4BH7A 3VH8A 2ED9A 5CGTA 4DZBA 3ZT7A 2OJEA 2HTKC 5MHSD 5HYJB 3H3KA 4X7SH 3IXAB 5ISZE 4LEXH 1YN6B 4IIQA 1RZFL 1CICD 4QF1B 2EH7H 3I3EA 4WIQA 3MZTA 4ZPTB 3RL1B 3QT2A 1XGUA 2OP4L 2HJKB 3QRGH 4R7NA 2R2EA 1L0YA 1ZHKA 1F3DH 1OSPL 4Y5VC 4JFDD 3STZB 4JY6B 3KLAB 5DHVH 2YN3A 5SV3A 1NMCC 4TULH 1RIUL 4UIMB 1LO0L 3KPPA 1NGPL 1ADQL 3C5ZD 2VDLH 1F3RB 2AKRB 2QSCL 1KCVH 3QUYB 4KJWD 3F7YA 3O0RH 1XIWB 1ADQA 3IGAB 2Y7QA 5I1LA 3UO1L 3O6FA 1MQ8A 5FECB 2FX7H 3NPZB 1M7IB 4F57H 5DQDL 4MNHA 2VWEC 1RFDH 3QIWA 1IGFH 3D3VA 1QQDA 5DTFA 2A6IB 3BO8A 3TV3L 2BVYA 3DVGB 5F72S 5GGVY 1P4LA 2DQTH 5FV1L 4H88H 2VXQL 4DKFH 3QIBD 5CWSB 4JQXC 4LLMA 4Z7NF 3OKEB 1FDLH 1O7SA 4MZ2A 2BOBA 1HXYB 5DJYB 1E4KC 3TVMC 1T5WB 4KDTA 3FO1B 5ICYA 1AKJD 4AEIL 3NZ8A 1NGYB 4OCRL 3VG9B 1PJ9A 2DL2A 1I8LA 3AS0A 4X80H 1CLYL 4HG4J 4HH9B 4DUXA 2OTWA 1GYAA 5T1MB 4UQ2B 5J6HB 4O51B 4OI7A 4JPVL 4JPWL 5JDSB 3REVA 3L5IA 4HBQA 3VFSB 3IDJA 2NY1C 3LS4H 2V5YA 2IEPA 4PJEB 5DFVD 4OCLC 4DQOL 5IIEA 3ZKXC 3WFHA 3BP6A 3O8XA 2V2XB 3ULSA 4KTEL 3BXNA 5IM7B 3DOSA 3OKMA 3D0VA 5TH2A 3RVWC 1AO7B 3FHAA 1Q94A 2Q76B 2YA0A 3DLQR 4GRLB 5DUPH 4FFVD 2E7MA 3G6DH 5C09A 3SDDC 1MH5B 4OD1L 5FOJA 3RZCC 1F5WA 2VR5A 1BVZA 4XWOC 4WV1C 4X4MA 2Z8SA 4EQ3A 4LGRB 2DIAA 3SGKC 1X5LA 3BSZH 4KK6D 5FGSA 4GAYB 3V6OC 1SHMA 3X11B 4ORGB 4FQJL 1H3TA 1L7TH 2IPUK 2K1MA 3VE0B 3MBXH 4U31A 3LMJL 2ZSVA 1WWWX 4PTUA 1MRFL 3UTTD 1U36A 3T8XA 4U6VH 1Z9MA 4DTGL 3OB0K 4YE4L 2I9LA 5K9OB 1ZEAL 1QBLL 4KHXH 3ZLQC 1C5DB 2DQFB 2F19L 4YWGL 2EICA 1ORQA 3OV6A 3VXUA 4OLWL 4YXLH 7FABL 4Z7UA 1IEHA 2E27L 4JDTL 3BP7A 4YUEH 3PP3H 2VITA 1SYSA 3VMOA 2J8HA 3BH9B 4BJLA 3D9AH 2YMXH 3L1OL 4ELME 2GTWA 2YUZA 1J0IA 1EA9C 2Y36H 1WBZA 3QDME 1KB5H 1NANH 2UYLA 3KHOA 4PJBF 3VXRB 4YO0B 3G5XA 4MS8D 3FN9A 3HRZA 3QXAA 4UIKL 3GSRA 4XX1E 3HE6B 1NKOA 5C6TH 4MDJA 4K7PY 1YEEH 3DGGA 1X5HA 2NX5B 5D4QA 4RBPK 1CZ8L 4GQ9L 3ULUL 3UX9B 3GMLA 1X5GA 2XWBB 3INUL 4GAGH 3MA9H 4Z95H 1U9KA 4POZD 3U83A 2IF7A 4DOHE 2NYYC 4POUB 1V3KA 1A4JA 2ZSWB 2VQUA 4LHUA 2H45A 4YDJB 1IKFL 1HQ4A 5GPRA 2SEBB 3FB7A 3PWUA 4LSPL 4QYOA 1F6FB 4RGNE 4U1IB 3VXQB 4DVRL 1VGKB 4XCEA 1CXLA 1AGFB 5DK0B 1VDGA 5FM5O 5BJTA 3CSYA 3GSQB 3GSNB 1S7VA 1YDPA 2YWZA 4XI5D 2HTLC 3NTCH 3SE4C 3SQOH 3QFJE 4S1RL 3S35X 5HI3D 3LZFL 1XR8B 5SX5H 1INEH 4TSAL 1FNGB 1A0QL 1CGTA 4G8FA 5K9JL 1JTPA 3O9WD 2Q8BL 4ZQKA 4DVBB 1EEYB 1IMHC 1QLFB 5F9AC 1DFBL 4Z7WE 1NLBL 1SJXA 3GMRA 1HQRA 5ILTL 4U6XB 1IM9B 2R56L 1OTTD 1F45A 2XWTA 4RDQF 3K2MC 4Z7VA 3H7BA 4PJ5B 4YBLB 2ZCKH 2MFNA 2PXYB 4HT1H 4U6YB 4X5XA 1I4FB 3CXDH 1JE6A 4WHCA 5FOBB 4HUWA 1IGTA 4PRBA 5C0CD 1IC7H 4F7EA 4ODHL 4HS6A 3G08A 3MLSH 4QRQA 3DMMA 4GAJL 4NO5B 2EXWD 4N1CA 3VXOB 3GFUA 4I2XE 2VR4A 2DBJA 1W72H 3PWLB 4PPTA 2CDEA 4WWKD 4MD5B 3LKNA 4HV8A 4P59L 3P9WB 3BVNB 5T1KA 1FZMA 4NZRH 1ZV5A 3SDAC 2HWZL 3S5LA 4J7RA 5JTWA 4ZSOA 2APTA 4X4YA 4NO0B 4ZTOL 2WAHA 2EKSA 2DLEA 5IK3B 2ZCLH 5F93C 4X6CF 1A3QA 4M7LH 5DR5H 2ZOKA 4PGBA 3S35L 5IHUL 3FMGH 4MNQD 4ACPA 1JN6B 3F6LA 3O3EB 5C0AA 4PJ9B 3GKWH 4LPXA 4XPTH 2MQ3A 3H6JA 3ZDXF 4HZLB 4QRRD 2LAGB 2XACC 2MCG1 1QG3A 5E00A 3WNPA 2YD3A 5ICXA 1OP5H 4EN3B 4FMFA 4U1GB 1IGML 3I9GL 3QUML 5KSVB 1KTLB 3QNYA 1SQ2N 4ZFFB 1E0OB 3VGEA 3R4DA 5KTEH 2CRMA 2EKJA 3ARZA 2AEPH 3MRIA 3BPLC 3KPSD 3QUMA 4KJPD 1JIBA 2ZUYA 3HR5A 4PY8I 4PJ7F 4X98B 1NKRA 1DVFA 3QEQD 3QULB 5GRVL 43C9B 4PGDA 1YQVH 4FQXD 5CEXA 3K2UH 3NZHL 1FNFA 2DQIL 1L6XA 1C08B 1RY7B 1YPZB 4YIQA 2UUDH 3K8LA 2VUYA 4OZHF 4PRPB 3PJSA 4IMLA 2ZZUT 1FH5L 4HH8A 2HMIC 2MMXA 3ARGB 3MR9B 1V05A 1NCBL 2V5MA 1A1NB 2FCBA 2UZIH 3O2DL 2FBOJ 4HWBL 5ERWA 2VDPL 3P4OA 4D8PB 3RA7H 3OR7A 3TA3B 3KXFA 5TE4L 5C0NC 5F7LB 1JYNA 1L6ZA 5L2KA 4P5TC 1J0JA 1U8KA 4KRMB 4WHDA 3SDCD 3O2DA 2NR6D 4YPGA 1GPOH 4HWBA 3L5WA 1CGWA 2DLTA 5K9QG 4XP1H 2H26B 2BP3A 3CNKA 3GJFA 1BAFL 4LIQE 3DVIA 1NSNH 4C56A 1OTSD 1FL5A 1BBJB 3ELAT 1RZGA 4FP8H 2NY3C 4PLJD 4JFFB 1U8LA 2QV2A 1G6RB 1BQHA 4CMMB 4OFPA 3OAZH 3SKJL 1KN2H 4F8TA 4TUKL 2ESVD 3GRWL 2X4NA 1INDH 2P24B 1U6AH 3TO4A 1HZHH 3BKMH 1WCBA 4RIRA 3V4UH 5ANMA 3MNZA 2YPLA 2V17H 1I75A 3NFPA 1NANI 4C83A 1MHEA 2LV4A 1UWXK 3GRWA 3M07A 5KSAB 4G43B 3R8BB 1G9EA 4E9LA 4UDUB 4NC1C 4HMCA 3ARRA 4UOJA 4YHIA 1GH7A 2VLJA 3LPWA 3QRGL 1EEUA 3ULVF 2KDGA 5DD6B 3HE7D 1HEZA 5FYLE 1ZA3A 2CLZB 1ED3B 4TULL 1DLFH 2C3HA 4X83A 5TQ2H 3K80A 3ARYA 5IMLA 2XKNA 1F4HA 4OLXH 1A7RL 2ITDB 3DUUA 4GW5A 4TUOA 3DI2B 5DHVA 3EFDH 3DJ9A 4LMQI 3CFJB 4MQSB 1DLHB 1R3LB 3WJJC 4ZODA 3VJ6B 7CGTA 3HC0A 5F44A 1AD9B 2JE8A 2AP2A 1I85A 2CXGA 5HGDA 1LO5A 4WCYH 3UYPA 3ZDYE 2X41A 5DMKB 1WFUA 1FVCA 2HT3D 2FX7L 1PX4A 4PJ8C 2B1AH 1BWWA 4RFNC 3C8KB 5GS1C 4LCCC 4V1DE 1WZMA 4Y8AA 1CXEA 1R3HB 4JO1H 1IGFL 4QXGL 1LVEA 3VFOB 3Q6GH 1H3UA 3WDHA 2DQTL 2YC1A 1B0GB 4DKFL 3JUYA 3E8UH 5J1AB 4IIQC 1BZ9B 3P3YA 4QNPE 5C6WH 4JFEB 2JJWA 1Z6JT 4XBGB 5D93C 1ACYH 4XWGH 1UM5L 4XH2B 3WIHH 3EO0B 4Y7MA 5JNYA 3KPRE 5B38A 3ARQA 3F6IA 5FXCH 5I73B 3WNKA 4HS8H 3JTTA 3PP4H 4X80L 3V0WL 2IGFL 4PJFF 1LD9B 1S7XB 4BSVB 4LU5H 1JGEA 1T0NA 5GSVB 5F3HA 2ZUUA 5JQHC 5CZVH 1JWUA 1ZT4B 2X2YA 4NM4H 4UNUA 2BSED 4WUUB 5GRXG 4NSKB 5LKNA 1ZHNA 4OF7A 1VKXA 4G7VH 2IH1A 3GSNH 2JELH 3O6FC 1T1YB 5EIIA 4TSCH 1HILA 4MAYD 3VFWB 4M1DH 1X5XA 1VB9A 3TBWB 1MUJB 3OAUH 1UM4L 4GW1B 1BOGB 3QIWC 4U2YA 5F1IA 1LE9B 2OMNA 2XY2A 4XNQB 2EDOA 4Z78B 2WBKA 5FO7B 4EVNB 2P8LB 1FL6B 4TQEL 5B38G 3HPLB 4HKJB 3QDMD 4LAQH 2DLHA 3R06A 3G5YB 5EU5B 4G8EA 4HXAL 1NBYB 2R0LL 1MRDH 5JHLL 4ZNEA 3S6CA 1DBAH 5H94B 5B4MC 4F15C 3ZKMC 1L7TL 5F7YC 5IMOA 3M45A 4ZUVA 4KDTC 3UTSA 1IGYA 4WUKH 4Y4KB 5FGBA 2NY4B 3TP4A 1H9VA 4MVBC 2HT2D 3QNZB 4Y16D 1S9XB 4GRWF 3H0TB 4U6VL 1A1MB 2Q86A 3GIZL 4D9LH 1I8LC 1BJ1J 2CR3A 4KHXL 1ZS8B 3OX8B 2HFGL 1E27A 4N0CC 5MENB 5DEGA 3DSFL 4KMLB 4NO2B 3LKSB 3GK8H 2IADB 3O45A 4YXLL 3QDGA 1WZ1L 4YHNB 2AV1B 4RGND 4YUEL 3UCRA 5I66A 1MSPA 3D9AL 2YMXL 1R24A 5C08D 3LS5H 3MRQA 4JKPH 3HZYA 1X5YA 3LSOB 4LLQB 2Y36L 3MODH 5CINH 3RUGF 3DBXA 1KB5L 4C54A 2DMKA 3QFJD 4WU7B 3HZKA 1MCFA 2R2HB 4NQSA 4OLUL 4PGCB 1BF8A 4FABL 3GZKA 4RZCB 3D18B 3G9AB 4BK5A 4KTYA 1KB5A 1VSCA 1MLBB 5I1JH 2Z8RA 2IH3B 4U6TA 4BELD 1IRAY 4RCAA 4YC2C 4P2QA 2YD6A 3DI3B 3U9UB 2BNRA 3MV9E 3MJ7B 2DQDL 1LP9B 3C6SB 2LU4A 4DUVA 3FONA 4PREA 4Z95L 3HI5L 5H35B 4JFXA 1A64A 1I9RH 5DQ9B 4OSUH 3LB6D 4GXUN 4LFHD 1B6UA 2VZSA 3QUKB