1R0AL

Crystal structure of hiv-1 reverse transcriptase covalently tethered to dna template-primer solved to 2.8 angstroms
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
211
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCSASQDISSYLNWYQQKPEGTVKLLIYYTSSLHSGVPSRFSGSGSGTDYSLTISNLEPEDIATYYCQQYSKFPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonnucleoside inhibitor binding affects the interactions of the fingers subdomain of human immunodeficiency virus type 1 reverse transcriptase with DNA.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
molecule keywords 5'-D(*A*TP*GP*CP*AP*TP*CP*GP*GP*CP*GP*CP*TP*CP*GP*AP*AP*CP*A
total genus 46
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2003-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r0aL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r0aL01
1T22A 5DHYA 3PABB 1DVFC 1VKXA 4AT6A 1KLUB 4KI1A 1J1OH 1OAKL 3JSSA 2HFEB 5KVMC 3I6GA 3AB0B 4MXWH 1NDMA 2V2XB 3O6ML 3QIUD 4EI6B 1QSVA 1DCLA 3FN9A 2BVPA 3U0PB 2X10A 4G80B 1GGCH 1CQYA 5C92A 1K5NB 5JHDD 1AJ7H 3RWCA 4K71C 4PJHE 4XNMB 5LAXB 3B9KA 3G6JF 3SDCB 4N0RA 3ZKNC 4DW2L 4NO0A 4PJ7F 1QHPA 1KIQB 3L3GA 3MRLB 3DHJA 5IMLA 2NW3B 1WV7T 3EGSB 3PGCA 4XVTH 5ANMA 4MQXC 4FHBD 4MX7A 4Q58C 4K8RH 4S11A 3SJVD 5DLML 2NY1B 1MI5D 3H9HA 5IVXF 2HG5B 1Y6MR 3D25B 4N0FB 2Q8BH 5T1KA 2DQFB 3DX7B 3BKMH 3V0AC 4LARL 3DIFB 2HTKC 3QH3A 4PRHB 3TZVD 5TF0A 3MV9E 3O4OB 5D4QA 2JJSC 3FHQA 4U1JA 2OYPA 3WNOA 5DJ8A 1T0NB 1RHFA 3ARDD 3PHOB 4IS6A 3DBXA 5KSBE 1BX2A 4MLSA 3MYJA 1A7NL 3RL1B 1U8MA 2LU4A 3FRPA 1I9IH 1XR8A 5DC0A 2X05A 5H35A 2A74B 1UEMA 1Q94A 1CT8A 1KENH 1TCRA 1YZZA 3MRPA 3QPQD 3VFWA 4PREA 4Z0BH 5I1KL 3S36H 2FO4A 4Y1AE 1TJIL 5GGUB 1L0QA 5CJXC 5IR1B 3F7RA 1SVZA 5I2IB 1FORH 2HKFL 4POZC 4TQEL 5INDA 1K4CA 5LKNA 2IBZY 4RGMB 1MJ8L 2GW5A 4DEPB 3V0WH 1JWSB 2UY7A 2FX9L 3DI2B 3UZVB 4KK6C 1YEFH 1X5JA 3LN9A 1NEZA 5F7DA 1DBJH 5TDOA 4TUOA 5FHAH 2XN9E 4P5MA 4QRUB 3PF2A 3TT3H 1O7SA 2F58H 3BDXA 3HUJF 4F33B 5CJBA 3RVUC 1F4XH 1CGUA 4AJ0A 1KB9J 3BP5B 1ITBB 1HQRA 4YDIL 5C6WH 1U92A 3LPFA 4O5LH 4NM8H 2XZQH 4PD4K 1CF8L 3HUJB 5GZND 1VKXB 5TH2B 1IAIL 1WAAA 2BC4A 2XTJD 3L3IA 4JANA 4QOKD 1I3UA 1QBLH 5D1QD 1ZMYA 1K2DB 3BZDA 4KUCF 1HKLH 2E27H 5GGTA 5H2BA 5EO1A 4MDIB 1KFAL 5GGTL 1NAMH 1AKJA 2AK4E 1KLFA 1J0JA 1SYSB 3MLSL 4HIHB 4P4KA 1JZ2A 3CMGA 5C71A 5D1ZD 1S7VB 2VQ1A 4NO0B 5ICYB 4JKPL 4Z7WE 5DZLA 3IXTA 3HE7A 1KB9K 1T03L 1K85A 3RZCA 1BOGB 5DT1L 3FRPG 2YZ8A 1UB5A 3M8OH 5D7IE 5F3HB 5F7YC 2VLRE 1ZVSA 2OR7A 3L7EA 3LEYL 3KYOA 15C8H 2VQUA 3MRJB 3U9UA 4KRMB 5L7XH 2CRZA 1AHWC 4U1JB 1A7OL 1TITA 3EYFA 2APWA 4D9RD 1YPZF 5FF6B 5LBSL 2I9LB 2H2PC 3OX8B 4PJAE 1SQ2N 3UROR 1F4AA 5B39A 1WAAF 1AR2A 5IJVA 1EEYB 5KW9L 1OAZL 4OAWB 3X3FL 2HKHH 3V4UL 2W9DL 3WIHL 1DR9A 4PB0L 3CXHK 1CDHA 1NEZG 1KTDB 4PJDF 2HRLA 4OZHA 1ZHLB 5KSVB 4WWID 1VEPA 3C5ZD 5HYQB 5F3BA 2DOCA 1EVUA 2ESVD 1KPRA 3KPTA 3IDJB 1OGAA 3QO1B 1SJXA 5F7DB 2BRRL 5EC1A 3RDTC 3SPVA 4XH2B 3SHSA 2XZQL 4Y5XC 1AY1L 2PXYA 3WJLC 5CD5D 4FFZL 1NMBH 3CFDA 4I0CC 4Q9RL 2XIDA 1HQRB 4HQQL 4XB8A 3RX5A 1QFWH 1OSPL 4NDMB 3FT4B 1JNNH 5TH2A 5EBMB 2BVUA 2CMRL 3BH9B 5BMFL 2NY7L 1G0YR 1VPOH 2R1WB 3VJ6A 3SY0A 4Y2DB 4OFYD 3LRSB 1BZ9A 1ZHNB 3I9GH 3S36L 4P4KB 4L4JA 4U05A 2JJVA 3CVHH 5I76B 5I17B 4JZJB 5C07D 5JOFA 5SWZA 4Q2ZA 4WIQA 1A64A 2QQLH 3IXTB 4HC1H 3G5YA 4Z77A 5I1AB 2JB6B 1N5AB 3B8SA 3QDAA 2A9ML 4OZFA 2XTJC 5DJ2A 3RRQA 5IB2A 4NN7B 1JZ4A 1KCSL 4PJCB 2VLLA 4UAOB 3BKJH 4PGJA 3E8UL 2X09A 3LIZL 3MRDA 4WUUE 4JRWA 1P9MA 1NGXA 1NGZB 1TIUA 1X5LA 1AH1A 1JYWA 4G6AD 4FXKB 3BD4A 4XPBH 3SDDC 3T09A 3BWUC 2X4RA 4R0LA 4U0RB 1ORSA 4XNZC 4LCCC 4YHZH 3ZDZF 4MQTB 4YR6A 3V7AE 4HCRL 1QFWL 1OLZA 4RIRB 4ODTL 3IU3A 2WK2A 3AS0A 3W39B 5HHOB 3CGTA 3RAJL 1YY8B 1D9KC 2H26A 3KNBA 5F3BB 1OAKH 3O11B 4GRWF 4LLUB 2E7LA 2CDFA 4HUKB 5LGKA 3D0LB 4PG9A 1UWGH 1QSFE 4MNGB 4XNYH 1HINL 2AERT 2E3VA 4TNWK 3P11L 4BQ6A 3VXSA 3MJ6A 1ETZB 4WUUD 4WW1B 1KB5L 1NGQL 4H26B 5EZLB 5IW3A 4AM0A 4PGEA 5E2UL 3PWUA 5IQ9B 4QRSB 1JBJA 2JIXA 4MAYC 3M1BB 3TBTA 4EUPB 3D9AL 3BH9A 1U8HB 1QSFB 3IRZA 5TQ0L 5I1HL 4FS0A 5DR5L 2HKHL 3V4UH 1OAZH 1HN1A 2ADIB 2XWTB 4MJID 4NJAL 2VR9A 3D39A 3MRHB 2GCYB 3VD4A 2R1WA 5CEYA 4WW2B 5KTEL 3QNZA 3O2DA 5HVHC 1F4HA 2QADB 1JGLH 4J1UB 3MLWL 5HHVL 3S4SG 1DQQA 3CJJA 3SBWA 4V2BA 5CSGA 1K8IA 1AGCB 3MJ7A 4KRPD 2NXYD 3QXDB 15C8L 3FCTA 4K3JH 5J11C 6CGTA 3UX9B 3UYRH 3IDGA 3M8OL 4LSPH 4P2QA 4U2ZA 4LLDA 1KJVB 1DN2A 2NX5A 2QSCH 5I18L 3MJ8A 4MJ5A 4BQ9A 1IAKB 1INDH 1W72B 3FAWA 4JZOB 3IRPX 2ATKB 3FRUA 1YJDH 3O2WH 3GMLB 4NRYB 3T2QA 4BSWB 3ZKQD 5ALCH 4BZ1L 4F9LC 3CSYB 3OKDA 2E7HA 2A73A 4WEBL 3KHOA 1OAYL 1S7XB 2QQNH 4NN5C 3RQ3A 2X70A 2IC2A 4RDQG 4D94A 2XOTA 4AIZA 2Y5TA 3W9DB 3W0WA 3GKZA 4U1NA 3BPLC 4J4PD 3W9EA 1MLBB 4HUWB 1IGCH 3IDIA 4S1QL 5J89A 4L29A 1VADA 1Q9LA 1M7IA 3VG9B 3V52H 4YDIH 3QHFL 3CC5B 2BX5A 1CFNB 4X80L 8FABA 4RMWA 4NZUL 1DBJL 2NR6C 4I3RL 1JRHL 5T3XD 4LDEB 5D7IA 3I02B 4JM2B 3KYKL 4D8PB 1BD2A 3PWNB 3LD8B 1N4XL 4Z0XA 4PGEB 3PWUB 3JTSA 4QRSA 3GJFB 3N50A 3MJ9H 3VCLB 3QIWC 2WP3T 4DTGH 5I1KH 2QR0A 2R69L 2Q8AH 1GCFA 1DTUA 4ORGA 4UTBL 4D0DA 5HYJA 3C5ZC 3HZVA 4L4TD 1KLGA 4QRRD 3TT1L 5CEYB 2R0LH 5DJZA 1FVDB 4JN2A 3MMEB 4K2UL 3MZTA 4NQSB 4WUKH 1FV1A 1RUQH 3OR7A 5ELIA 2AQ3A 5E6IB 2UVEA 1AQDA 4N8PA 3E6FB 4P3DA 3SJVB 1QVOB 2IQ9H 2Q8BL 3OGCA 1ZV5A 1RJZB 2Z31D 5ERWB 5C6PB 5IFJB 4KK9D 2CLZB 2ICCA 1RUAH 4K8RL 3Q6FA 3RNQB 4IIQA 3FMGH 3LMJH 4GG8A 4BFIA 3GI8L 3I75A 2FWOA 4KXZI 3JWDC 1A0QL 4G7VL 4RQQB 1LEKA 3R4DA 4M93C 2Z92A 5F9JA 4BSVA 1KJ2L 1NMCC 3CZFA 3JV4A 3TCXA 2CXGA 3VFRB 3FB6A 2BSRA 1E0OB 3DRQB 2LU3A 3VXNA 5L0QC 2EEBA 3GMRA 2VABA 4OF5A 1S7RB 4MXWL 4HK3J 5CEXB 3O3AA 1KN2H 5JOPD 3LKSB 3HMXA 1MOEA 3AC0A 4XXCC 5GRXG 1FCGA 1VADB 4Y5VB 4JFDD 5JIKA 1CR9H 3VXRA 1J10A 5E95B 4EVNA 2YUXA 1RJCA 4YQXH 3RP1A 3OB0H 1RZKC 2AEPL 4ONFL 3T4AB 5EULV 4PJ8C 1QR1A 4MQ7A 3HE6B 2KKQA 3HB3C 3A6CL 1T83A 3UYOD 4UDTA 1H5BA 4HXBL 4YK4C 3RIAF 2YRPA 1JWUB 5F6IC 3UTZA 3FO1B 3DSFH 5I71C 5IW6B 4QWWC 43C9B 4OQTA 1Q1JH 1H9VA 3DX6B 2Z31C 3QIBC 4Q74A 3WFEL 2CH8A 4CKVX 4JRYA 3BDYH 3BQUA 3SDAB 4ZFFA 3OKKA 3HG1E 4FZEH 4KKCD 5GRVK 1OW0A 1QSFD 2GJZB 2EKJA 2NNAB 3PL6A 1LDPL 2XICA 2P46B 1MJJB 4PRPD 2DTML 5GIRB 1UG9A 2VZ1A 4JEGB 4L4VB 3ZKMD 5AYUL 3H8NA 2YD3A 3V5DB 1Y0LB 4Y5YB 3ZDXF 4X7TA 4HS6B 1L0XA 1G9MH 2PTVA 5B38B 1VEMA 3RIFF 5EBWA 1UKSA 4J3WA 3K0WA 1T1XA 4M6MH 4ALAH 2R4SH 5HVGB 3HPJB 4XNXH 5MP6H 2BOCB 2EO1A 3BPOB 4PJDB 5DQDL 1RJZA 5ERWA 3L3OB 4NYLA 4PJ5B 3QEHA 1JVKA 1T3FB 3BYTA 1G7JA 2CLZA 4N68A 3WV0A 3CXDH 3D3VD 5J6HA 5IFHL 4PJEB 4MXQC 1IGFH 1QA9A 4F7MA 2C1OA 2DTSA 3CFCL 4LSTH 4L3EB 1QRND 4CU6A 3RVVC 4QLRA 4O9HH 4JY6A 2FBJH 5BS0D 1FNGB 2Q6WA 1OVZA 4DN4H 3WUWB 1QUNA 1E28B 1NDGA 1A4JB 4NQDA 3DTXB 5DRZA 4FQQB 3KXFA 4NBXB 5J13B 2O5XL 3LKNB 4GMTH 4YEFA 1ACZA 4JKMA 1JGVL 4X4YA 1AD0B 1C8PA 2ICWB 3OAUL 3T3PE 2X9XA 5DJAA 4NCC1 4KMTL 1FJ1B 4Y5VA 2FNBA 3WFHB 3GMOB 1F58H 1TPXC 5T1DH 1I1AB 3MRRB 5GXBB 5FK9A 2Y9RT 3SN6N 5DHVA 1TQCC 1JF6A 2EXYC 1JGEA 4MD4A 1PDKA 4Y4FB 1GAFH 2LTQB 1RZJC 2GIYA 4H0IA 1IMHC 4Y16A 43C9A 5GRUH 4M7LH 1MHPL 4H1LB 1RU9L 4ZO7A 1DE4B 2AGJL 1AXSA 4BA8A 3OB0K 3EYUH 1DQDH 1ES0B 4JAMB 2H41A 5D1ZA 5BOPA 2VDNL 4OFYA 3PIQB 1QPXA 1PG7W 3T65B 4JY4B 2BNRA 4E0RB 1FL3B 1N6QH 3W0WE 3MV9D 5LXGL 3D0VB 2CGRL 3N06B 5HHMB 1D7FA 2VDPH 4IOSD 2WAHA 3QDMB 2FLRT 4NKDB 1A14L 5EBWB 1MAKA 3E2HC 3O6LL 4Y19D 1CS6A 2WBJC 3HPJA 5DD1L 3C6SB 2OM5A 3IKCA 4UIMB 4JDVB 1EERB 3GK8H 4FG6C 4P3CL 1RFDH 5C0JA 4XX1G 5DUBA 1F8TL 3EDFA 1MHHB 2CRMA 2O5YH 2VSDA 2LVCA 4NO2A 2EECA 4UOJA 1KGCE 2QTEA 3MV7E 1YC8A 4HH9B 2Q6WB 4KDVA 5D8JL 3BMWA 4ZPVA 1QEWA 5C0NC 3BPCB 5H8DA 1DBKH 1LP9B 3RGVB 2VLRB 1S7UB 1NAMB 1IC7L 2ZP0T 3CFKA 4OLEA 2AQ1A 1XGQB 2BJML 4GAGH 1NLBH 3MUY1 1YNLL 1PW3A 4HKBB 4L8SA 4M3JA 1LNUB 4AEHL 3U2SA 5C8JB 4GT7A 4NM4L 5JHLL 3HI5H 1OTUC 5A2IH 4HT1L 4PJHB 4GG6B 4Y4FA 1UM6L 4GW5A 4CVWA 1F97A 4DN3L 3BO8A 4OF3A 3MOAL 2VDPL 5B3NA 2DQTL 3O6KL 1FYHB 5JPMB 4M7ZC 1A6VL 3L95A 3A67L 1W8OA 3RUGE 2B2XH 1GIGL 5D71L 4JAMA 1NMAH 3D6GA 2VDNH 5DMIL 3MBEB 1AGEA 3GNML 3O4LE 4X6BB 2BNRB 4E0RA 5C07E 1C5BH 4RRPA 1RZIB 1XIWD 4PLNC 5L8LB 3MRIB 3DURB 4MX7B 5EBLA 4WHYH 1MHPH 2Q76A 1T7WA 1WC7B 4F57L 5MERA 4NKDA 3RIFK 2KPNA 1ZGLB 2CLVA 4Q0XL 1BGXH 3VDAA 2NTFA 1FDLH 2ZCHL 4MAUH 5DC9B 3VI3E 1I4FB 5D2LF 3ULUL 4JQVA 1JHLH 5DFWH 4HULB 1CE6B 1UYWL 1JP5A 3MODH 4XMLL 5KVFH 4KDTC 5CEZD 3ARYA 4JFFB 3F6IA 5C0BB 3C9NB 5C7XH 1EBAA 3HN3A 3Q5YA 2B39A 5GGSB 1IEAB 3SDXA 3MRPB 2B7DT 4WWKB 5HGAA 5D1QC 5B3JF 5F44A 5C1MB 5IR1A 5IVOA 5MENA 5IROC 5EPMA 5I2IA 4ZPVB 4D9LH 4PJ8B 3ILPB 1B4JH 4ONHA 5EU7E 5BJTA 3FO9A 1EPFA 3S96B 2ZG3A 2EYRA 3EO9H 3H9ZA 2IPKA 3QRGL 4G6MH 1GC1C 3TBWB 1C5CL 3CFCH 1LO0L 5GGQH 2XWBA 4HKBA 4G8GA 2EDHA 1IM3B 4P5MB 4QRUA 4WGVB 1IFHH 1T20A 4JGJA 4I2XB 4ZUTB 3U2SB 1U91A 3EOAB 4G8FB 1CZ8L 3MUZ1 2R2HB 1IAOA 4QF1B 3IJSB 4HGMA 1Q9WA 4ALAL 4CAGA 3P4OA 5F1NB 3B2UC 2EDQA 3BWAB 2JCCE 3UBXB 4ZAKD 2IANB 5H2BB 4NZRH 3IFOB 3GGWA 1QNZH 1CE1H 5ISZA 3ULUC 1U8IA 5CWSB 5DJ6B 5JPMA 3RGVD 4UU9B 1YEHL 3KYNA 4NQTA 2DWEA 4HAGA 4YNYA 5LWYL 3JTTB 5KOVC 3T0EB 4EXPX 1MREL 4HF5H 1JGDA 2VUOA 5DK0B 3P77B 2YPKB 1IAMA 4PB9L 2EDJA 1KTLA 2VDOH 1OCWH 5DEGB 4Z7NE 4YXKH 3TIEA 2NY6C 1X5IA 4TVPE 1SY6L 2VJXA 2G9HB 5HYJD 5B4MC 5GS0H 2JTDA 3KPSB 2Z31B 4Y4FD 1CE6A 1BAFH 1OY3B 3P30L 1DN0B 2FB4L 4XCNA 2ICWI 4XCCH 2XTJE 3RWHA 4G6KL 2YZ1A 2Y36H 3QIUB 4XBGA 1RURH 1ZA3B 3ILQD 4P46C 4X98B 1SEQL 4WTWA 2FEEL 3WHE0 5L8KB 4PJIE 1DUZA 4YGVB 4ZAKC 1ACYL 3TJHD 3PWPB 1N3NB 3NIDF 1WBZB 5CAYB 5KSVA 1KG0B 1NGYB 8CGTA 5F7KC 4MXQD 1DQLH 3GMPB 1BVLA 3L3HB 2EYRB 1B2WH 4H1LG 3MGTB 2XQBL 1HXMA 2ZUXA 4CN6A 4P9ML 2P42B 4AY0A 1MRCH 4X9BA 3BGAA 2OZ4A 1FZKB 3R06B 4OIIH 3EOAA 1VHPA 5GGRY 5JXAL 4YHIB 3MREB 4QCIA 1PZ5A 3EOTL 2NPLX 3OTTA 3K4ZA 3I6LD 2CIKA 3G6JB 1W72H 3UBXA 3ARVA 2GK0B 3MLVL 4WUKL 3O3UN 2ZNWA 5F7EH 5L8JB 4Z8FH 2YD2A 4K7PL 1UB6B 4JHAH 4WO4C 3DVNB 4UV4L 2MHAB 4XTRD 1AXTL 1FHGA 1X5GA 3TM6A 4Z5RB 2R69H 2P8PB 4P46A 4YHLH 4P23A 4CADB 2V9TA 1MNUH 3T0EA 3DXAD 2E9WA 32C2A 3N9GH 3FL7A 1H0DA 1KC5H 2DKSA 4U1SA 4MHHI 5AYQA 5JOFB 4XVJH 1EHXA 5I74B 1ODAA 3V8OA 1KTLB 3FTGA 4DJMA 1S9VA 4TSBH 3KPQA 2D0HA 5DWUH 1D9KD 1RVFH 3O8XD 3IAGC 4R4FH 1CGSL 2NR6D 2VNCA 3BEVB 4OZ4A 2J88H 4PTUA 4M03A 4NKQB 4NWTL 1F3RB 3HRPA 4LVNB 3RWGB 4JY5L 3B6SB 3QHFH 4F8QA 4MVBC 3V52L 5A2KH 4GFTB 2UWEB 3X13A 1WIOA 4P59H 4LU5L 3THML 1SMAA 1EBPA 3UJJH 4APQB 1BIHA 2X4UB 3PWPA 1MCQA 4TVSa 1ORQB 4XT1C 1N2RA 1ZKAA 3IU3B 4MJ2A 2MPAL 2BY3A 1MI5A 1ZEAH 1HHJB 4Q9BA 4EN3A 1A3RL 2AXFA 4PYHA 3I6KB 5FCSH 1P4LA 2F53D 4K23L 4LLWB 4EDWL 3MRGB 3JWOC 4FQIL 1WTLA 4J8RA 3CFBA 2KDGA 4UT7H 4GG6E 1ETZA 4WW1A 4WHTB 3B9VA 3WIFA 3CFIC 3S34H 1XIWC 4WU5A 4HZAA 2B1HH 4NBZB 2CR6A 2WW8A 3OB8A 4KHTH 5ESVA 5E94A 5CSBA 1U58B 2ADIA 3WFBH 1R5VA 3C60D 5IROA 5KTEH 4WI5A 3D39B 1IE5A 4JDZA 5HI5C 4WHYG 2F53A 5DGQA 3KPRB 4NJAH 5ID0A 3MNVB 3HCVB 3LKRA 5MENE 4K9EH 1BQHA 5DR5H 5FYJD 3UMTA 4BQ8A 4E41E 5TQ0H 4NRZB 1N5YH 1MCOH 1G0XA 2RR3A 1RJLA 3K8MA 4X7SL 2PYED 2VIRA 1OARH 4OQTH 2AABH 1K5NA 3JUZA 4TTGA 1G6RH 4LPUA 5I1IH 4N0CD 2EIZA 2OTWB 3DV6A 3MJ8B 3GJFH 2UWEF 5BS0E 3L3GB 3FRUB 3IFNH 1U93B 3FOMB 2D9CA 5E03A 4I9WD 3OKOB 1Z9OA 2B5IC 3TV3L 2ITCA 2IFFH 2GAZA 3WLBA 2UWEA 1P6FA 3VXUE 5E8NB 3VXMD 1V7MH 1MSPA 4PJGA 4L5FL 2EH8H 1PX4A 1L9NA 3QI9B 2VAJA 5I8EA 5HHOD 3DRTB 4QRTA 2IFFL 2ADFH 5TGBA 2E5EA 4IS6B 5HHQA 3AMLA 2DQIL 4CL7A 4UQ3B 4JFEE 4H0HB 3IFNL 3T0ED 1IM9A 4Y4HA 1DFBH 1WITA 1DLFH 2VKXA 4LSRH 4NP4H 4OF0A 3O4LD 1T04A 3SQOH 2OCFD 4MB5A 4F2MA 4TPRL 4YK4B 3LIZH 2WBJD 1G1CA 4OIBA 4DZ8A 3BKJL 2RFXB 8FABB 3DMMC 3G04B 4QXGH 4MMXC 4X7SH 2A9MH 2V5TA 5DJXA 5FIEA 4WV1B 3PHSA 4HWBL 1JWSA 3RA7L 4DFHA 5AUMB 3EDDA 3TPUB 3GJFA 1T1ZB 5CP3H 1J05B 3J7HA 3CVHL 4NFCA 2WZPD 1XCQA 4ZXBB 2QHLA 4KKBC 4PJFF 2FSEB 3SJVE 4OZIA 4KHTL 4XNZB 4M6OL 3FB7B 3LKOB 2YD7A 3OJVC 4JRYD 4C83A 5AG8A 1F00I 4BM7A 4YHKL 1MWAL 1KN4L 1NFKA 5HBBA 3VG9C 3KYMB 3LKRB 1NBVL 2AV7A 3IAPA 1FV1B 1T0NA 5D7LB 3MYJB 1CLOH 2PF6A 4OGXL 1PD6A 1MAMH 1D5MA 2DQUH 3WO3B 3OGCB 3QEQB 1FNFA 4P2OB 4KFZC 3VFWB 1R3IH 2PO6C 3DUUA 4I8DA 4Q9RH 4E5XB 1NMBL 4FFZH 1OGTB 5I1CH 1F4YL 4GG6F 4U6HA 4POZD 4WUUB 4IIQB 5CKAA 1D5IH 3ARED 2FWOB 2EKSA 4HEPG 2GQHA 1XT5A 3H0TA 4IRSC 1A1MB 1CXIA 3MNWA 3RZCB 2VQTA 4XGZA 5DTFB 2P24B 4MNQB 5FV1L 3CLFH 5DQJA 3VU2A 1B9ZA 5MI0C 3FB6B 2WP3O 3QDME 4P59L 4XP1L 1ZSDB 4H1LH 4CW1A 4QRPD 4KH2A 4TSAH 4Q6IA 5FM5O 4CN4A 1MLCB 1P2CB 2PUQT 1RHHA 3LKSA 4NWTH 4MQXD 3EJYD 4MAYA 5LBSH 4Z7QF 4LHUB 3D48R 1I1YA 3T0EE 5HYIA 1RVFL 2YKLL 3FT2B 3I2CL 4M1DL 4TVPL 3T4AA 4IEFB 5F9OH 3HE6A 3ALXA 3B9EA 3TA3C 3WD5L 5DVLA 4N1EA 1GSMA 4NFDA 1M6OA 5HYQA 5DUMH 3FO1A 4JFHD 4XP9L 2MJWA 4NCC2 1BIIA 5DT1H 3SGDH 5EORL 5DQ9A 1SJHB 2OX5A 3RWFB 3VFPA 4M8QA 3MLUH 3ROOB 4XI5C 5GS3A 5D1XD 2VLKE 4HAFA 3QUMB 4G8EB 4GQ9L 3ZMRA 2EXWC 4EOWL 3CFDB 4A2LA 4TRPH 4JZJC 4L9LC 2FH8A 1NEUA 4R96A 1MJJA 4HIIA 5HI4C 1NAML 3PWPE 1IAIM 2DS4A 2Y25A 4MNHB 1F02I 1B0GB 3TH4T 4HPYH 5IHZB 1P9MC 3PQYB 1IAIH 4LVNC 3RKDC 1UQSA 3RVXD 5TDPB 3GIVB 1B6DA 3KWWB 3B9KD 3VD9A 3T0VA 2IFGA 3L3OA 3VWKA 1G7JB 1OGTA 2V17L 1QSED 3MV8E 3LH2L 2OMNA 3TNMB 1DQLL 1GGUA 3TT3L 1OLLA 5FHAL 1F3JA 4F7MB 3DGGA 2K1MA 1YEFL 2A6DB 4XWGL 2YUZA 2NYYD 4D0BB 4LBEA 1HYRC 1UXWA 3KLSA 3IDJA 1L0YA 1CXFA 5IB2B 3OBAA 5EU5A 2Y07H 2FATH 2XT1B 5IIEB 4Y2DD 1CD8A 3WUWG 1E4WL 4YE4L 4GBXA 1W0YT 3C5ZB 3ZTNH 3R8BB 2F53E 4Z0BL 4ZFZB 4GKOA 2V5MA 5I1DB 1XIWA 4JM2F 4FXKA 2PETA 3TWCL 1I9IL 2BMKA 4PJFA 3NN8A 5C2BH 5LJYH 5EU3B 3DO7A 3QIBD 4OZHF 4M5YH 3TCLA 1JPTL 1YN6B 2C3GA 1MEXL 1FFOB 1IARB 1FBIL 1XF2A 5FV2A 1BF8A 1H8SA 3MV01 4KY1L 4PB9H 2J7LA 1UFUA 5T1MA 3X3GL 2HWZL 1CBVH 4HMEA 4Y5XA 4WENB 3K46A 2EEAA 2FGWL 4Y2DA 5JW3L 3HI6L 5CGMA 2W60B 1NUFA 5C0AB 2VE6B 5HPOA 4KKAC 3BW9A 3TC9A 5CUSL 3KG5A 1DE4A 2A9NH 2EC8A 4PJ5E 4QRPB 3E1F1 1CE1L 4F80A 1A4KA 5IKCA 5TE6H 4NZRL 5GRWA 3G5YB 4PRBA 2ZPKH 5L2KB 4FQCH 2FJFB 2OI9C 1DLHA 2ESVB 4E41B 5INCB 4FMKA 1EUUA 4R7NB 4EIGB 1X7QB 4JPKL 5KSBF 2GJ6A 3MPCA 2GCYA 2R9HD 3RBSA 3MR9A 3GIVA 4YO0B 4U1LB 5CLWA 3V95A 4OZGE 5JR1H 2WV3A 3U9PL 2RGSA 3ARBD 1OT1A 1VERA 4WFHD 2R8SH 3U0TB 4NKIL 4FQJH 2R2BB 2DQDL 4X6DE 1K8IB 1IVLA 4RA3A 3NFPA 1DL7L 3O6FB 3T0EC 4LSSL 3O3BA 3IDGB 2FLBT 5IT2L 2H2SD 3VXMB 1A22B 3S4SB 4YHNB 2NY1C 4AENB 5C6TH 4MJ5B 1DBML 3QJHB 4JZOA 2XZZA 1U8KA 3UTQA 3WS3B 3WN5C 1WGOA 3FQRB 1OTTC 5EUKB 3ROLB 3OKDB 3C08H 1S7XA 7FABL 1FG2A 4KAQL 1UYWH 2YPVH 5EZLA 4HS8H 3CDYA 2CKBH 4LQFL 4OGZA 4XBEL 1U8LA 2HLFD 1N64L 2NZIA 2RCSH 3M1BA 4NNXA 3DO7B 3WLWC 4ZS7L 3PJSB 3TA3A 4HIEA 1NBZB 4ODUB 2ZG1A 4L3AA 5A1AA 3FHAA 1PEWA 4NQEE 2VN7A 1OAQH 1YPZA 4HFUH 3UJIH 5BZDB 2HH0H 1REIA 1FG9C 1XFPA 4NT6A 4K3DL 1BLNB 2R0ZH 3P73B 2P8LB 1V5JA 1XEDA 1NMAL 3C60B 3FZUD 1NFIB 2ZOLA 3C09C 4ELMF 2R23A 1MRDL 1FSKB 4JB9L 3KJ6L 4KK8D 4L8BA 1AP2A 2FHCA 2DQTH 2OJEB 3EFDH 5F1SA 4X9FA 5EO9B 1I3GL 5CINL 4XPHL 5F6HI 3U4AA 3FQNA 2F19L 3F7PC 3I50H 4Z0XB 5J13C 1W72A 4MAYD 3LPGA 3MRKA 5IB5A 3LQZB 3UPRB 1RZIA 3FOLA 4KV5F 1T6VN 2W91A 4TNVF 4JO1L 1RZ8A 1EJOH 3VCLA 1XCTA 2Y7QA 3QQ4A 5BOZG 5MERB 2V2WB 3L3JA 1A9EA 5FYKD 2PYEB 4F7EB 5IVNA 2XA8H 1FGVL 3STBA 4Y4KA 1KJ2B 5I19H 4AIZB 4YDLC 3C2SA 1PEZA 4P9HL 5I9QB 3V5HB 4TUKL 1UADC 2DQGH 4PPTA 3V6FB 1EH9A 4QT5B 4X8JB 4G3YL 4FZ8L 3WSQH 1IC7H 4L3ED 4CN1A 4GAJH 1GH7A 4U1MA 4M61B 5D8JH 1H8OA 4OGYL 4ENEC 2V2TA 4DVBB 3LSOB 4G5ZH 1IT9L 3GSOA 5SWQB 2VAAB 1ZE3C 4QTIH 5MENB 1EGJL 2VLJD 4IMLA 3QZWA 3AM8A 3VWKC 4JQIL 3FQRA 2GFBA 5HDBF 5DMJB 3WL9B 3VFRA 5GJTL 5KVDH 1U2CA 2EDWA 4ZOEA 1A6WL 2DMKA 1DVFA 3MGAA 4N0YH 1N59A 4ZUTA 3I3EA 3U48A 1NBZA 4F8TA 4XZUB 4OCXH 3MUHL 4HV8B 4B50A 4OD1H 3TBVB 4BZ2H 5IEKA 5KZCB 3OAYK 5LXGH 1Q9WB 5CEZE 1R3LA 5F1NA 3PWJA 1N6QL 1R5WA 1YYML 1ZS8B 3GKWL 1XZ0B 5T1KD 5CZXC 2LAGB 3WNPA 2R4RL 5ISZB 3WBDA 3BRGC 3EO1A 2AGJH 3E6FA 3IJYB 2A0LD 4H25B 1JWUA 2HA1A 5D1QA 1C1EL 1BVKA 5I1GL 1RMFL 5GRUL 5IHBA 5DUPL 2FEDC 4IJ3C 3RX7A 1KCRL 5EB9A 3P0YH 4NKOB 4GG8B 5C0ND 5TF1H 4ZSOB 2EXYD 5E6ID 1RZ8B 4OF6A 4YHPB 4LCYA 3P9WB 4NO5B 2AJYH 4J4PA 3TIEB 4IHOB 3ARGD 4C57C 4HUVB 1BFOA 2YD1A 4NGHL 2FHBA 2YA0A 3OG6B 4Z76A 2G9HA 1JI1A 5F72S 3UTSD 3VXNB 3MOBH 3AREA 2NY5L 4MNQE 4OZFH 3GMRB 5I73C 2VABB 4QT5A 4X8JA 2JJUA 4X7TB 2YPLA 1W0WB 5IBUB 2NQCA 3HA0A 1F45A 1TETH 2BDNL 1JYXA 3S3SA 2FBJL 4IRZL 4JM4L 5MEND 1G9NL 4PJ5A 2XFXB 3QB7C 1MJUL 1IEBB 1VFUA 1HOCB 2VAAA 3I85A 3LS5H 4S2SA 2PCPA 1BQUA 3UZQA 4OLZL 1YYLH 3RY4A 5DS8A 3GMPA 1UJTA 4JO3H 2EE9A 4K7FB 5BW7C 3T0XA 4Y4FC 3STLB 4XNXL 2F8XC 3SDAA 4ZFFB 3P2TA 2IAMB 3UTPD 3UCRA 2EDTA 3MLYL 1YEDB 3H3BC 2EZ0C 4FQQA 5B8CC 1WSST 3VGHA 4L3EE 1YYLL 4HV8A 4S1DD 4KJYA 1BBDL 3LS5L 2OI9B 2VC2H 3DV4B 4URTB 1NCTA 2NY0D 2E7BA 5EN2A 3RBGA 1RJYB 3AXLA 5ICZA 4I0PD 1ED3B 2BFVH 4PFEA 4XP5L 4TTDC 1T1XB 2X89D 2DM7A 1UGNA 4LDLB 1A7QL 1JI2A 2OL3A 4AT6B 5H37G 3BDYL 1ZTXL 2BOCA 1U95B 5I8CA 3P40A 5D70H 2CJUH 4I0PC 3CMOH 4XX1E 1Q1JL 4OQ1A 1ZT7A 4M5ZH 3UJTL 4HS3B 2IMNA 2PR4H 2EIDA 2BVPB 3U0PA 4JFDE 2V5RA 1OB1B 4UDUB 2C1OB 3A6CH 5T33H 4LLQB 4F9PA 3DLQR 3SKNA 4LCYB 3HNSL 3O9WC 4YAQB 1CXEA 1WTGT 3T65A 1YY9D 5JZ7D 2Z35B 1HSBA 1P1ZA 5F96H 4X9GA 5CZXD 4D9RE 1JNLL 4I13B 1YEEH 3RWGA 3LKNA 4WWKD 1C1EH 1G7MB 1G9NC 4KXZH 2KL6A 3Q5TA 1FNEA 3RGHA 4PJCE 4RMTA 2NXYB 3T4YA 4HFWB 3TBSB 3ZT6A 4ZYKA 3QXAA 5J1TC 5AEAA 1A0QH 5SWZD 1U3HA 5HY9A 3VA2C 4LCWA 3PDDA 2CDGA 1I85C 2W9LA 5DUBB 3WFCH 4NQCA 4OCXL 1J11A 5BZWB 2HFEA 3I6GB 1E6OL 4EI6A 3EJJX 3LQAL 4U7SA 4K94L 2FIKB 4RMRA 1QLRB 4RCAA 1A6AA 4R9HA 2EC9T 5KVDL 1VFBB 3B3IA 5HDLA 5GRJL 1CFBA 3V0VA 4WV1C 1K4CB 2HT4C 3I3BA 3OGOE 4JJ5A 3B9KB 3ZE1F 1A3QA 2ZJSH 3RY6A 5DVNA 1T0MA 2F15A 1LO5B 1KIQA 2R0LL 3B2VL 3MRLA 4NZTH 2YK1H 2APFA 4ZXBC 2BVEA 3EGSA 4DKFH 2NZ9C 2ATPB 5KSBB 4G7YH 2JJTA 2BP3A 4X6EB 3V6OE 5C8JA 4ZTPH 3AXLB 4XWOC 5IBLC 1HHGA 2XN9D 4YDJB 2FH6A 2DKUA 4PJHA 4LF3B 1NLDL 2DI8A 4ODHH 4YFEA 5EUOE 5I8CB 1N4XH 3FAXA 5IW1B 4NRZA 2Q7YA 4UI2A 3IKCB 4FZ8H 3KYKH 3S97C 1FH5H 5GRYA 4I3RH 1JMZA 1FP5A 4QHNB 4QRQA 4GW4B 1Q94B 1FGVH 1BZQK 3WKNA 3BPNC 2Y4SA 4DK3A 2FO4B 2HN7A 4LCUA 2A77L 4GBXC 4JO1H 4JFZL 5J1SC 3TFKD 4HWZB 3T8XA 4EN3D 2B4CL 4QNPE 3ARQA 3CFKB 2Y06H 4OCWL 2ITCB 2NY3D 5E9DE 3S88H 3QUYD 1CTNA 5ADOH 4XCYA 4PJGB 4Y1AA 1LNUA 5SV3A 3BGFC 5I8EB 1JZ3A 5C07B 4WY7H 3MLRL 1BBJB 4WEBH 4ODVH 2CIIB 1R3HB 4Z95H 4BZ1H 4M7JL 1CDJA 1H3PH 3FQTB 4RSVA 5FHBH 5L0QB 1WFUA 2FCBA 3GZKA 4C54A 4XCEA 4LSVL 1INQA 1IGIL 3K7UA 3QDJB 4LFHG 4N1HB 2HP4A 4ZS7H 2HT3C 2D7MA 3S6CA 3D85D 4EI5A 3KPPA 4LQFH 4IOIB 4PJ8A 2VXTL 4JR9L 3C8DA 4HIHA 2IPKB 3GSNA 4AL8L 1S7VA 2VQ1B 1MH5B 1B3JA 1TENA 4KVNH 3GSQB 5AUMA 5DGRA 2XNAA 3SPVB 2YPLE 2FX7H 4ZXBA 2X7LA 3ABZA 1U91B 1A5FL 2GT9B 2IPTL 4YXHH 1N7ML 2UZYB 3WS6C 2CLVB 4JGUA 5DRWB 4MD0B 4P5KB 4C83B 4OLVL 4WEUD 2C4FU 4HK3N 4NDMA 5E2UH 1XF4B 5D72L 2B8OT 4PJCF 2GJJA 4FQJL 5IB1A 2D4DA 4JRXD 5KS9E 4NO3A 2V7NA 3H3PH 3U9PH 4NQUA 3F8UB 3MACL 5B39B 5CP7B 4GW4A 4HLZG 1UWGL 1NJ9A 1EEYA 1KIPB 3S7GA 3KYNB 4FQXD 3DUUB 4K7PY 4HG4K 4E5XA 3U4EB 1EXUB 5AG9A 3H2WA 1KTDA 2ZUQB 3H9SD 4F15C 1KELH 3F5WB 4ODTH 3GO1H 1N0LA 2P7TB 4OCYL 4Q2ZB 2ZCLL 1AQKH 3MCLH 2OR8A 3NGBC 5TE6L 2P24A 5FYJH 4A6YA 1IL1B 2VXVH 4P5TD 4OCSL 2A6IA 1FO0B 4OBSA 1GYAA 3CXHJ 4CW1B 5JUEL 2AJSL 2Y1VA 4HKXA 4YDVA 4XCNB 4KK5C 1UJ3C 2X41A 4QXUL 4I3SH 3JV6A 3GHEL 4PBXA 2HWZH 5EBMA 2D7OA 1DANT 3HG1D 4HC1L 4LKCA 1UZ6E 2GHWB 1EX0A 3GGWB 4YR6B 5LQBL 4EI5B 1MCSA 3QA3A 1TZGL 2WBKA 3EW3B 2H3NB 5TPWH 4GRLA 1YY8A 3KNBB 2ZWLT 5IJKA 4C4KT 4PLJC 3FN0H 5MEQA 3QEQE 1MH5A 3RVWD 4CU8A 4TNVK 3RVTC 1MVFA 3VFOB 1KXTB 5JLZA 3NPZB 3S37H 3P9MA 5IJKC 4GRLC 5CIPB 4UTAL 5BMFH 2CMRH 3UTTE 1JNNL 4PJCA 3NCEB 2MWCA 4LLMA 3KPSA 2V17H 4TOYH 1CDCA 2RQ8A 5MEOA 3NFSL 4NO3B 5AWNH 4ZOBA 4U0QB 1UQSB 1DEEA 5JA9A 5TDPA 5CP7A 2IANE 3N1QC 4U6XB 3SKMB 3QXWA 4DCQA 2J1KA 4JG0L 4RBPK 1U8PA 3FJTA 3KWWA 2YBRB 5I1EH 2DWDA 2CKBB 4J12A 2AJZA 3KR3H 1J0HA 4YGVA 1RI8A 4R4ND 4ODWA 3ZKXB 1WEJH 3MJ7B 3LB6C 4F58H 4AG4H 3F5WA 3GBNH 1P7QB 3FFDA 1H0DB 3SDAD 4RIRA 3DGGB 1E4XL 1Z5LB 1O5DT 3O11A 4LLUA 4TRPL 3KLDA 1J12A 1FYTD 1S8DB 3LKQB 4FNLH 2KQMA 1WICA 1J1XL 3V6OA 2ADJB 2VDMH 2I27N 1YMME 4KJWC 2NLJA 4MSWB 3RU8H 4V1DD 3CPLA 5IVXA 2DN7A 2X4TB 3H3KA 4ZFZA 3QFDB 9CGTA 4AM0B 3ULUF 4O51B 1PKQE 3JV6B 3OPZL 5DUML 5J3HC 1NL0L 3OPZH 2DICA 3G6JA 4HUUB 1X9QA 5CZVL 4MXVF 1YN6A 3EFFA 1U8HA 1QSFA 4K71B 1F90L 3O9WD 4RFEB 4LLAA 3EBAA 4Z7VB 1M7DA 3RU8L 5LCVL 5DHYB 5FCUL 1IGMH 1UB6A 2VDML 3WO4B 3RFZC 4U4BA 2AK4D 2HT3D 4O2FB 3QNZB 1LO4H 4PJIF 2LU7A 4N5UA 4EN3B 1H3WM 2NW2B 5D7IF 2VE6A 2YD5A 5D2NB 1AGCA 1J1PH 3O3EA 3S35X 1WT5A 32C2B 4QOKE 5E9DA 1QFPA 3GBNL 3ES6A 5D7IB 4JM2A 3QP3A 2N1KA 4GXUN 1BD2B 4M1GL 4PRPA 2ED8A 2ICEB 1DLHB 5E4EC 3CK0H 4EI5C 5IEHB 3PGCB 2H2PD 5ANMB 2X44D 5FGCB 4KV5E 1I9EA 5D93B 3QJFA 4O5LL 4PGCA 5C0EB 5GS0D 3HC0B 1IZJA 2WIIB 1AD9A 3MROB 2QR0B 4U7MA 2F58L 2GJ6B 2I24N 5ACZB 2XTLA 4ERSH 2C4FT 2NX5E 4OF7A 1U8PB 4OGAC 5DHVH 4JN2B 1S9YA 3P9LA 4AMKH 2HKFH 3RL1A 1AQDB 2D0FA 2A74A 5D9SA 3V8CA 2NY3B 1HQ4A 2UYLA 3S4SA 1GL4B 2EIZB 2OTWA 3C6LC 4OTXH 1TZGH 4BFIB 3T08A 3EYVA 1FFQA 1U93A 3U7WL 5MHSD 4NHCL 4CMMA 5E6YA 1FYTE 4HWBH 5IVXB 2IH1B 4KPHH 2GAZB 4QRPE 4WHTA 3DETC 5IUSA 3HG1B 4O51A 3QCVH 2IQAB 2HTKD 4LARH 4TUOB 3MGOA 1U8LB 3BKML 3LZFH 4A2MA 4HUUA 1X4ZA 4NNXB 4QXUH 5ESVB 4JFFD 4PJ9A 2AJSH 4P23C 5CP3A 4NP4L 2LVEA 4XCFL 4KROC 1GGYA 5HYJB 4QGTA 3BQUD 2YRLA 4OCSH 3L3IB 3F12A 5FXCH 5H94B 2LFGA 4ZFGL 2NW2A 2ADFL 2BOBB 1PG7L 3G5VB 4OV5A 3O3EB 1AJ7L 3GO1L 5DSCB 2ZUVA 4LRNL 3CZJA 1JZ7A 3KPMA 5K93A 1PYWA 3O3DB 4HSQA 3O6MH 3WNNA 1SYSA 3PGFH 1MFAH 3NMEA 1TJGL 4FFWC 2MMXA 4WV1A 5JIPA 4JRYB 3N1MC 4KKNA 2ICEA 3MRKB 2O5ZH 1RUKL 3I75B 2UY6A 4UB0L 1G7PB 5GZOC 5JQ6L 1FZJA 3MNZA 4HJ0C 5F9JB 4IIQC 4RX4D 1G6VK 4OZIB 4J23A 2ED7A 4PJGF 3NIFE 1HIMH 1U3HC 3PL6B 1UT9A 5DO2D 1G6RL 2DMCA 4LKXA 4Y4KB 3K2UH 1OARL 1D6VH 4CDGC 3F7QA 1NCDH 1BFVH 4U1GC 3QI9A 4R3SB 4XVUC 1S3KH 4OCRL 1EZVY 4JPWH 2Q20A 4N1CA 4UQ3A 2OZ4H 3AS2A 4ORZC 4JREC 2I9LA 3OX8A 1WK0A 2G75A 3QEQA 4P4KC 4NQDD 4Y89A 1Q72H 3RL2B 4JR9H 4DKEL 1KACB 4G43A 4OZHB 3CU7A 4LHUD 4W4NA 1DQTA 3QZWB 5DVMA 3C5JA 1DZBA 3VXQA 5AZ2H 3UDWA 1JTPA 4UT7L 2GSGB 3D85B 4HIXH 2Q86A 2M2DA 3TH3T 4EDWH 2IQAA 4XH2A 3OKKB 3ZT5A 3MRNA 1XCQB 2EH7H 2Z9TA 5HGGS 2ZUQC 1PGRB 1X5FA 1RPQA 1JZ8A 2WLYA 4WY7L 5K9QI 4NRXB 3VWJA 1WFNA 1V3KA 1S5HB 1AD0A 5MEPA 2YUVA 4LAQH 2JK5B 2QSQA 4HG4J 1ZS8A 5T3ZD 5EZIH 1I3RA 4QHKI 3WDHA 3R0MA 5D7LA 4O00A 1QO3B 3MV9B 1LMKA 4OI9A 2ARJB 1ND0A 3VXPA 2L0DA 5FB8A 3KPMB 3BYYA 2Z93A 3HNTL 5F89B 3DETD 5I8KH 3L6FA 2ESVE 1U6AL 4Y16B 3GFUA 4L4VE 2MCPL 1X6NA 5IVXE 2SEBA 1FPTL 4P5TA 3SDAC 3BDBA 1FVEA 4MYWB 4UV7L 3H0TB 4KTYA 3SDDB 5KAQF 1FZJB 3PP3H 1T1WB 2JCCF 4JY6B 2A1WL 4XGZB 5DTFA 4X4XA 1QFUH 1FL3A 2QHRL 1I1AD 4U3HA 3WUWA 1KEGH 4HBCH 3QUZD 1MY7A 1WLHA 4ISVB 5IMKA 3W11C 1NDGB 3AREB 4NC2B 5TE4L 4QXTB 3LY6A 3TJHC 4XP6L 4JHZA 3KXFB 2ENYA 1XGYL 1SYVA 2G5BA 1AXTH 4QHMA 1BJ1J 3QO0A 4G7YL 4WDIA 3B2VH 4KK6D 3QG7L 1IZKA 3V4PL 2ZJSL 1WVZA 3BPOC 3MA9H 2IWGA 4LHJB 2L7JA 5A3ID 1B88A 1B90A 3KPRD 2HFFB 5T1LD 3SE3A 1ZANH 2W38A 2ENSA 4GH7B 2GITA 3LN5A 5E1HB 5JXAH 4C55A 2DQCL 1CFQB 4P57A 5HDBE 3U7AA 3WFCL 4EQ2A 3VW3H 4NSKB 1OD7A 4FFYL 2XQBH 2XWJB 3DUSA 4LOUD 5I9QC 1C7SA 1C08A 2E7LC 3LCYA 2D03H 2AJUH 5IQ9A 2XG4A 1LQSR 5E2TH 3WDJA 4XPTH 1ACYH 1L7IH 3QIWA 1UM4L 1BQLH 2BNRD 2VZVA 1MCNA 2HMIC 3JWDL 1IBGL 2OP4L 4LCCA 4D9QD 5F96L 1D3CA 2F8VA 1CICA 3HI1B 2BNRE 3O8XC 1OGAD 3VWKB 3HNSH 4QY8A 4PGDB 4CDHA 4DGVH 1FYTA 4ELKA 5T33L 2SEBB 3FCTB 5J3HD 4QRPA 1AHWB 1CDYA 4LLQA 5ILTL 3I3DA 4ZDHB 1SY6H 2P5ED 3SKNB 4RGOH 5GPRA 1LHZA 3DX8A 1VACA 3MBEA 1U0QA 1NC4B 2FJHA 2NY3C 3KJ4B 2BNUB 4X6BA 3BHBB 2FJFA 4X4XB 1LEIA 4OJFL 3C6LB 3ARWA 4Z78A 3S5LA 2RIKA 3MX0A 5JXEC 3SDYL 2FHFA 2YPLD 1MREH 1ADQH 4NRYA 4F7TB 3SE8H 3EYOB 2VLRA 5DRNA 4D3CL 2JJWA 5GQBA 1X7QA 5AAMA 4WEMB 1NCAH 3QO0B 1HH9B 5JXED 4WDIB 3DARA 3IDYB 1RIUH 4PUBH 2HJFB 4JKLA 3NN8B 1FNEB 4ZTOL 3W0WB 4PJAA 3S35L 2I5YL 1A47A 2R2BA 4ZYKB 2PW2B 3TBSA 4DQOH 5KOMC 1LP9E 5CJ8A 4Q9QH 2FECI 4Y5XB 1R0AL 1K8DA 4X0KB 3MA7B 3VXMA 1GGBH 4ZFOL 1FQ9C 4NQCB 4NZDA 5HGAB 1IKFH 3HHRB 4YXLH 3BN3B 2J6EA 1EEUA 1GPOH 1RZGA 2GTZB 3ZYIA 4TUJB 1QSZA 2X1QA 3RWDB 2OJZL 1U8KB 4PJXE 3UTQB 3B3IB 2XY1A 2AJVL 3MRFA 1LO0H 4FQ1L 4JFFE 3V0VB 4OB5L 1A6ZA 3OAYH 1A4KB 4PJ5D 5IKCB 2R0WH 5EIVA 4N9GA 1AR1D 3RVVD 1X5YA 5C08D 4XPAH 1LO5A 3JTSB 1TETL 2BDNH 2IEPA 4PV9A 1HKFA 2W07A 5ISZD 1T20B 3DURA 1JIBA 4L8CA 1MQ8A 2NY0C 1IAOB 3BUYA 1MFEL 4UZGA 4YDJA 4S0TD 5KS9B 2D4FA 3HR6A 4PRNB 1XF5B 1E4XI 4QEGA 1FVDA 2P8LA 5BRZE 3SKUD 1G1YA 4MZ3A 1D5BB 1U8IB 3GBML 4LHUG 2AVGA 5CWSA 5DJ6A 3U1SL 2FO1A 4GKSA 4IRJD 1AHWA 4P2CG 2IBGA 1FDLL 5F7MC 1UWEH 1IQWH 5EO9A 1TVHB 3QG6B 4F15B 4F57H 1VB9A 5HJ3B 3DPBA 1JGDB 3T0BA 3KPSD 3ULUE 4P2RE 4KGLA 2GKIA 1P7HL 3G08A 3FO9B 3SEPA 1GGIH 1YY9C 2W0KA 4R0LC 5TQ2L 3HC4L 4HXAL 4KI5F 5DRXA 2F5AH 4ZTOH 1FG2B 1OL0A 4F7EA 1A6UL 2HLFC 2B2XL 4ETQB 3MLXL 3VFSB 4BZ2L 3DXAB 3FN3A 4PRIA 2EDBA 3PWPD 5JW4Q 3PJSA 1FFNA 4ONGL 1QYGL 2EYTA 2VERN 5FO9B 3SE8L 2PW2A 1UM6H 1MCHA 2KBGA 2W0FA 1AGBA 2YWZA 3PE9A 1E4KC 3BWAA 3VXRB 3MCG1 3C8KA 1JFQL 4LSDA 4EUPG 1KEML 3K2MC 1LO3L 3C60A 5EOQH 1ZA6A 4AEHH 1BJ8A 3LRHA 1KG0A 5CCKL 4TUJA 4L8BB 3BZEB 4HW6A 2OJEA 4CVXB 1IT9H 1YNLH 43CAA 2VDQL 3MLZL 1NLBL 2BJMH 1FO0H 2DWEB 2J2ZA 2JCCA 2OSLB 2EICA 1JUFA 1Y18B 3TESA 3LQZA 3O45B 2WWKO 3OKEB 3FOLB 1S5IL 3P77A 2Q3ZA 3BVNB 2QADD 4JPVL 1TCMA 35C8H 1XCTB 3D2UD 1FO0L 1UM4H 1CDUA 2V2WA 3WXVH 2GJZA 4WFEE 3ILQC 4P46D 5I75C 3IDMA 4P9HH 1RFDL 5TFSL 2HTLC 5FOBA 1WCBB 1OWRM 1YC7A 5IBLD 4TULL 3D39E 5EOQL 2IG2L 4I18A 4HS6A 1OT2A 5DDHA 1S78D 5BXFB 5HDQL 1MCKA 4PD4J 4FFYH 1OM3L 4LK4A 3VGEA 4ZNEA 1IRAY 4WI4A 4GS7C 3MFFA 1ZA3A 1JPGA 5F7FA 1CGYA 1TFHA 3I50L 4HKZA 3D18A 2ZSVB 4Y2OA 4ZO9A 1G7HA 4CADA 4BKLB 5J6HB 4ONOA 3RZWA 4PJEA 1MIEL 4X6CF 3W2DH 2J5LC 4HWEL 3QUXD 1UM5L 3IT8D 4HXAH 1FAIL 2R0ZL 2F8OA 5CILL 3V4PH 3WL9A 4A6YB 2BSTB 5FFLA 5JIHA 4PJDE 5FGBC 1A4JA 2HRPL 4NQDB 4UIKH 4HKXB 1XGYH 1CLZH 2RJMA 4KC3B 3FO2A 1R24A 3MFGB 5J8OA 1PZ5B 5DD6A 2X4QA 4HS8L 3PWJB 1EAPB 4WVRA 3IFPB 4JGMA 3WFHA 7FABH 4O2EA 3C08L 1F58L 2XFXA 1XZ0A 4LKCB 1LILA 2VDLH 5HHXH 1T22B 1N2RB 2M8XA 2I07A 1SBBA 1E6JL 5CMAB 4ZUVA 4Z7UA 4GMTL 5K9OB 2G5RA 2MCPH 1BVKB 1NUNB 1NFDA 1U6AH 4R97C 5DJ0B 4KRLB 1JWMB 3KDMA 4H1LA 5IB3B 4LP4A 2Y6SC 4LSSH 5KVEL 1EEZB 4U6TA 3RWCB 4U1HB 4P23D 5FUZH 3NIGE 4J8RB 4NJ9H 4N5EC 4IHOA 4FQ1H 1Z0MA 1K6QH 2AJVH 2Z8WC 5T1LB 3VWKD 4KROB 2OJZH 3T2PA 4OZ4B 4N0UE 3V7AG 3QFJB 4FQ2H 3ZKND 5C0IA 1WF5A 4JQXA 5DDHB 5BXFA 2A0LC 1YJDC 3BIKB 4G6JH 1QLFA 2VRAA 4LRIC 1BEYL 2XKNB 4WHCA 4APQA 4RWYH 3C6SA 3QUZA 1BQHB 4M62L 3BP4B 3C6LD 4M6NH 1MCCA 5AZEH 4G9FD 5HSFA 2BNQA 1FNSH 1M71A 3GSVB 1I8IB 4HD9A 5K33A 1I7TB 2DTMH 1EDQA 1OAXL 5CUSH 3WFZA 5DS8B 4DKEH 3BN9C 3DO3A 2XN9B 4D3CH 2AXFB 1QPPA 1RZKH 2CO6B 1DEDA 3VXTB 1ADQL 3M17B 4F9LA 3ARPA 1X5AA 3RPIA 1LDSA 3F7VB 1QEWB 1NCWH 4OJFH 4UT9L 2AXJA 1PSKL 4JFEB 5GGRA 1AR1C 3LOWA 4OCRH 4M5YL 4QWWD 1MI5E 1BFVL 3VD3A 5HPMA 5ILTH 1D6VL 3HLAB 3GM0A 3EIFA 4WU5B 5EOCJ 1WQVT 1EAPA 4PY8J 4WFHE 4KKLC 3HC3H 4O2EB 3SBWC 3BIBX 1Q0YH 4JZNB 4ODXA 3QXAB 5I6XC 4MB3A 4GG6A 3CFEB 1RUKH 3KPRA 1IBGH 4GW5B 4WWKC 4JO4H 3HCVA 3QULB 4HH8A 1T04B 1K2DA 1BQLL 3IKKA 3KPNB 1ZT7B 1L7IL 1UEYA 3DECA 3IFLL 3IDYC 4HIJB 5ESQB 5EU6A 5ADPL 1VFBA 1K3ZA 2D03L 4JLRA 4EJ1C 3AS3A 3EO0A 3ZO0A 4FTVD 4JJ5B 5CGYC 4B53A 1CFTB 1PZUB 3QDMD 5C86A 3UC0L 2BZDA 1TZHA 3JVGA 5ICYA 3TPUA 2NXZB 4XMPL 1F6AA 3QCTL 3VI4E 4J3TA 2WIIA 5JW5A 3P4MB 3QNXA 4JFQB 1ZGLA 2CQVA 2VMFA 3BD3A 3FB7A 2H2SC 5E8NA 4U1GB 1FSKC 2VL5A 2VR5A 3MRJA 3U9UB 2D2OA 4UBDC 4DFIA 5IBTL 5M7QA 3HZKB 4H88L 4YHML 3P9LB 3QG7H 4NHCH 4RAHA 1BD2D 1GRWA 2MSPA 4Q9CA 2DQJL 1S9WB 4R4NC 1IEAA 4IOFD 4DUWA 4V1DB 4YWGH 1TJHH 3SCMC 4DTGL 1HWHB 1ZLSL 3MJ9L 1X6LA 4DZ8B 4M00A 2ICWJ 4GLRI 5I8OL 4HBCL 3GRWA 3L5XH 3KLHD 3V9FA 3AGVA 5DJXB 4JFEA 4HHAA 4PRHD 1R3KA 1KPRB 3W5MA 4OGAD 5BV7L 1INEH 3PP3K 1L4IA 2BSED 1IM3A 1G7LA 1U2HA 5IHLB 3AAZA 3T3MF 5C0BE 2DBLL 4YPJA 2ZOKA 2C1PB 4G8FA 1RHHB 2NMSA 2CRYA 1A6TA 3MJGX 4QF1A 4S1QH 2DD8L 1UZ6F 3CK0L 1FZMA 4YBQC 4LF3A 1CK0L 3MRQA 2DB8A 2C3WA 2Q7NA 5F9AC 2BY0A 5H94A 3MCKB 3QULA 1OP3H 2Q7YB 4PJBE 4OV5B 4QXWA 4HJJH 3CDCA 1OPGL 2DJUA 4LAQL 5DURD 3DMMB 3F7YA 4JLRB 2BCKB 1F4YH 5EH1A 3BP7A 3MV11 4XRCA 1H15A 4OUOA 1SJHA 3RWFA 4DOHB 5KN5B 5EUOB 5D7LD 1JHTA 2HVJB 1MAML 5FCUH 1KV3A 1YJDL 2XRAL 3IF1A 3WKMH 2H32A 2WBJB 4I0KA 4HWZA 3T8XB 4MDJB 3PGDA 2ILLA 4JJHA 5I16B 4FQLH 5CJQH 1CG9B 2AEWA 3G5ZB 3QWOA 1VGKA 4LSPL 5DRWA 4JQXC 2DYPD 2R2EB 1QSEA 1W0VB 5DD3H 1JYVA 4N8CH 4M6OH 1C5DB 1RZ7H 3KPLB 3HKFA 4R3SA 1Q72L 1B0GA 4J7RA 1X5ZA 4GRLD 4XP4L 4UT6L 3HZKA 3QUXB 3DYOA 5IHZA 5GHWL 1UCTA 1LK3L 2X9WA 4YJZL 3WS6A 1H3GA 4LDOB 3EDEA 4WI9A 4FNLL 4X98A 5SX5H 1U41A 3FT2A 5BRZD 4V1DA 4X99B 2C4XA 1C7TA 3EKCA 3RL2A 2DYPA 2VH5H 2YXMA 3VXSD 1NCDL 1DJSA 4MGXA 1NGYA 4IMKA 2HLAA 3VXRD 4G42B 1T2QH 4F58L 1OQXA 2P7TA 3ECBB 3VXQB 3MV7A 1OP3K 4LBEB 2H26B 4HHAB 3CDGB 4IDJH 3VFPB 1I1CA 3P11H 1P69B 2ZUTA 1HINH 4R7DA 3GSQA 2F74B 4PJIB 2XNAB 4UB0H 3BRDA 4MNGA 3L3KA 1CL7L 2P5EA 2GK2A 2IALA 3AAZB 1V05A 3T2NL 3TEUA 1I7UA 1J8KA 4MCYA 3K74B 3R06A 1L6XA 4PRAA 4U7KA 1JTOA 3RAJH 3MREA 3OMZA 4LIQH 4HIIB 1V7ML 3G6AA 4JPIB 2BNQE 3NCJL 4OLYL 3TCLB 1ULVA 1UH2A 2H1PL 1I8LC 4YUEH 3ZL4H 4NO0D 3TV3H 4ZFGH 2CKNA 1IJ9A 1ND0B 3GSWA 5FB8B 3MLTA 3DVNA 1SJEB 3WJJC 1KF9B 1GC1H 2UZIL 5FO8B 3L6FB 3BP7B 1ZOXA 5TPWL 5KN5A 5IFAL 3HZMA 3TYFA 3E8UH 1G7QA 3DGCR 2AABL 3U30C 5A2JH 4HWUA 4PYGA 3QISA 4ETYA 3ZKXC 1S9VB 4I77L 1N5YL 3HTLX 5SWSE 1NGWA 1IKNA 4NN5B 3K1DA 1I1RA 4C56D 5GZOD 3I6LE 4I18C 5DZNA 4D0CB 3GHEH 4PTUB 4ZAKA 4PJBF 3WFBL 4I5BA 1FFRA 4EKXA 3ULVE 5CJXA 1MUJB 3D39D 1SYVB 2G5BB 1RK0B 3VFVB 5E8OA 3RI5F 3VD7A 3IETB 1HH6B 1KPUA 2B1HL 3SGKC 1RV6X 4U6XA 3SKMA 4DCQB 3EDJA 4PRID 4AMKL 2O61A 3UTTB 5KBNC 5EU6E 1IKNC 4C59B 5ALBH 4ODWB 5I1JH 1UA6H 3EYQD 4GW1B 2JJSA 4HMDA 2OTUB 2WQRA 3JUYA 4K23H 2HLAB 3NTCL 5TDNA 1D5XB 3ECBA 1Q9LB 1TTFA 4OIAA 2H3NA 2VLME 4NC0B 3S9DB 3I6KA 1ZEAL 1CFQA 4N0CC 4P57B 4L1HA 2F54A 3ARDB 1CFNA 3FFCA 2ADJA 3KAAA 1PLGL 2FYYA 3MRMB 4LQ1A 5DHXB 5HHPB 2VWEE 1KSRA 1A9BB 3H3PL 5D7JA 3ROLA 5JOEA 4OKDA 5CSZA 5EFIA 2ZUUA 4CVUA 2YC1B 3E3QE 4LU5H 3THMH 3QUYC 1J1PL 2J8UE 1RK1A 4H0GA 3QIWB 4BH8B 5MEOB 3O41A 1U58A 5GS1C 2W9DH 4YXHL 1ADQA 3NGBB 2E6JA 1LO4L 2JB5L 3X3FH 2A6KB 4LCCB 2J88L 2FX7L 3PWVA 4AK1A 3HZVB 3VXSE 1CICB 4GBXD 4TYUA 4ODSL 3EDKA 2YS4A 1XR9B 4TSBL 3ZHKA 3FT3A 3GRWH 4RX4A 4QY8B 4XAWH 5CZVH 5D5ME 5DMGD 1D9KB 5E6IA 3W11D 4XC1L 2EC9U 1G7QB 4NKMA 1NL0H 1KC5L 3FQWA 1J18A 1RIVL 4S1SL 3QZWG 3ES6B 1GOHA 3DX8B 5ITBH 1MVUA 3J8F7 1NC4A 2FJHB 5F7NC 5DFTA 4HX1B 1IGIH 2R1YA 2JELL 4HDIB 2J8OA 5IB5B 3FO0H 5DFVC 2J8UF 1WISA 4JHAL 3S5LB 4PS4L 1MCIA 2NLJB 3BE1L 4X7EC 4ZAKB 5F7EL 3OKOA 2NY4D 3MLRH 1Z9SA 3QFDA 4LMQE 1E4XH 3DUHA 5E8OB 1W72L 4P2QE 4WFGE 1A1NA 1MCRA 5F88B 4AG4L 1PG7X 4XPFL 4OFPA 1B0RB 3A6BL 5HI3D 4HIEB 4ODUA 3ZZ1A 4OIIL 1QBLL 3O3AB 5FGCE 5I1EL 1V7NL 4JG0H 5FYLL 3WNMA 2YUWA 1FIGL 1ZLVK 4YBQD 3VFNA 4JFZH 1CF8H 2X5PA 1IM9B 4Y4HB 5BZDA 4AH2A 1OWWA 4JFED 2V2TB 5D1XA 1N6VA 2W65B 3QFJD 1NCCH 2K9UA 3NFSH 3ULSB 5SWQA 3Q3GB 1HZHL 5DJCB 3BGMB 3QEGH 1A1OB 3P3YA 4PTTA 4EQ3A 3V6ZA 1JZ5A 3V0WL 1QSEE 1MJ8H 4UTAH 3ARZA 1UJ3A 1KB5B 3MTRA 1FORL 2VSCA 3FB5A 3TA3D 2R0KL 4W70A 1GVIA 4WHDA 4PGCB 5C0EA 4S1RH 4YIQA 5FUCC 1NGPH 4RNRB 3VG0H 1I8MB 1A2YB 3N0PB 3TBVA 1MHCA 2FBOJ 2LV4A 2M1KA 5E2VH 3ZT7A 3BSZL 1P4IL 4RFNC 1WFTA 1S7TA 3X17A 1A7NH 1H3TA 2E9BA 2HYMA 3PNWB 5F1KC 4YXKL 2AV7B 3QDGE 1XR9A 4U1MB 4HK0B 2J8UB 4LPWA 1G9MC 1QBAA 4Z18A 1MFBH 5FUOL 3UTSA 4NYLB 2BVOA 2P5EE 4HX1A 5E5MA 5JUEH 5D2LB 4NKOA 1YEHH 4HDIA 5F9DC 4HUXA 4HPOL 3S3JA 3SE4C 3G08B 1CICC 4CMMB 4IBLT 3VRIB 3D3VE 3P0GB 4FQXC 5EZJB 1AQKL 4YPGB 1A1NB 4H20H 5HI5D 1Q9KB 5C09E 4ELME 1WWBX 1DVFB 1KELL 5C0DA 3DTXA 3LQMA 1N59B 4XVSH 1CZ8H 3EHBC 4MWFB 1RIHL 1FFNB 5DK2B 2R1XA 2NYYC 4O4YH 2DLTA 5FA4B 1MPAH 1TQCB 4RISL 2QEJA 4AH2B 1JK8B 4LEXL 3L5WB 2QKIB 2W65A 3LKPB 4G6ML 2CK0H 1BFSA 3OF6A 2G2RA 1I1AA 2VZUA 3Q5OA 2D9QB 1FAKT 3NIDE 2ZCKL 5GGVH 2Y6SD 1M7XA 4OLVH 5GS1A 3T0AA 1M6OB 1RY7B 4CVXA 5D1QB 3SE3C 2PW1A 4M5ZL 4K7FA 1PBYA 2GSGA 2CJUL 3WEXA 4ZS6C 1A5FH 1B6UA 1UJ3B 3L1OL 4OSUH 1MCWW 3TFKC 4X5XA 4YDKL 5JDSB 4KVNL 3QUMA 4G8EA 4YZFF 3U36A 1M1SA 3UAJC 1F11A 5D1ZB 4OZFG 1NQBA 3AY4A 3TZVC 3KLHC 5FDYA 4Z76B 5CEZH 2DAVA 2V7HB 6FABL 1BBDH 4MAUL 2DI9A 2JK5A 1HYSD 1BGXL 1ZHBA 4DZBB 2FX8L 3IDXH 1ED3A 4LOUC 1X5KA 4EUPH 2IGFH 2C7UB 3NCCB 1H3PL 1C5BL 2OL3B 1XF3B 2F54E 3FFCE 1A02N 1RZFL 3GM8A 1MRFH 1G9EA 3CLEH 4JO2L 1OAUL 3NVQA 3D2UB 3SDDA 5BS0A 3GMMA 3O2VH 2Y06L 4OCWH 4IRZH 4KRNA 1NPUA 5E8EA 5E2WH 4GKZB 3BP6A 2XKSA 3C5SB 1GHFL 5FYLE 1MFCH 3ZYOA 3SOBH 3RI5K 4L1DA 4C58B 3HI5L 2Y5EA 1P7KB 4CVZB 4PJGE 4HMCA 4FP8L 2DM2A 2IADB 5HHNA 3BISA 3GHBL 2NY5H 4PY7B 4GS7B 4JG1H 3RPKA 3CDFA 1QKZL 4TN9A 2DQHH 1U42A 4OFVA 4C56B 5H37H 1S7QB 4FXGB 2D0GA 3T4YB 5F7UA 3LN4B 1XGRB 2YA1A 3RVUD 4RMVA 1U3HB 3PL6C 5TF1L 4OCMC 5I0ZA 4ZFOA 2I9TA 1KT2A 2GITB 3LN5B 4MA8L 2QBWA 5DUPH 1T5XA 4ZTPL 2DL9A 4M48L 3TPKA 1A7RH 2IMMA 3GK8L 2X40A 4UDUA 4QTHA 4U6YB 2IPUG 1EZVX 3EOYG 3IU4L 4GSDH 4PRBB 4UQ2A 1DBAL 2A2QT 5K9JL 5D2NC 3VE0B 5E6ZA 5FYJE 1UCBH 2QL1A 5IBUG 4KZDL 3VGFA 4QYOB 4R7NA 1URLA 2QSTA 3WO4C 3LQAH 1P84J 1OTUD 2AI0L 1NUGA 3PDGA 4MS8D 4BQBA 1A6WH 1I4FA 3TVMC 3ULUD 5GJTH 1Z3GL 2ZKHH 4JFOB 4GSDL 4LCIL 3WCYA 4EBQH 1M71B 3ARGA 4OI7A 5C3TA 1Q9OB 4YZFE 2B4CC 3RKPA 4H5SA 5BS0B 4G5ZL 4MVBD 2HFGL 3R1GH 1JNLH 5E8EB 4MHHG 1CICD 2VTFA 3RVTD 4OT1L 2WUBL 3MV7D 3TF7C 1F42A 3E6HB 3WUZA 3CVIL 4ELMB 1PAMA 3WSQL 2ERJC 1P7KA 4CVZA 3JWOL 3NACH 5HPMB 3G9AB 2YD6A 4XCYB 1QKZH 1J8HA 4JG1L 2YD8A 3T2OA 3DVIA 4Y1AB 2HJFA 2PKDA 3GHBH 4IRJA 3QUML 4GAYB 1EJ6A 3VFGH 3RWIA 3ZDXE 1R3HA 1QFOA 1OOAA 3SGEH 1EJOL 3IJSA 5JQHC 1A7QH 1UVQA 2WIMA 4NT6B 2APTA 3LDBC 5IW1A 2BFVL 1BLNA 3P73A 3QDJA 2JE8A 4MA7H 3ZDYF 3IS1X 4HIJA 4PGDA 1JGUL 3ZSTA 4FRWA 2WWKT 3KPPB 5HGHA 2NY5C 3QQ9C 3ZE2F 1AP2B 3GUTB 4QTHB 4UU9A 3TYGL 3DYMA 1EAJA 4NNYA 4U6VL 2HN7B 1QRKA 3FQNB 4RGND 2HH0L 1AE6H 3UJIL 3A0OA 4KMLB 4M6ML 2YPKA 4F7TA 5D2NE 5J7CC 2X7LB 2Y7QB 4J6RL 5JW5B 3LRGA 4JFYA 4MA3B 3L3JB 3MC0A 2XPGA 4MD0A 4P2RD 1EUTA 3QWQB 5E2JA 5M94B 1XF4A 2DL2A 5C07A 4PJAB 3MUJA 4JM4H 4JFOA 3DYPA 4PJXB 3GIZH 1NMCB 3RWHB 4LSUH 1NAKL 3NABL 4X6FB 1Y6NR 1EMTL 4JM2C 4L9LA 3TVMB 2VWEC 2NXYC 4O2CB 1KIPA 2XQYK 1INQB 1X5HA 2CXKA 3QUMH 1Z6JT 3MOBL 1EFXA 3VRLF 3DMMD 4YGAB 3RWDA 1H3UA 1DP0A 5E8DL 2WUCH 1MQKL 2EE3A 2DQDH 1BVLB 2GFBB 1SHMA 2R8SL 3NH7H 1F4WL 4X9IA 4NOBA 1DBBL 1YECH 1IL1A 4X7FC 1HXMB 1RSFA 1AIFB 3HE6C 1FO0A 1U3HD 4IRJB 4O4YL 4YC2B 2ZOKB 2C1PA 3HMWH 3MRQB 4HBQA 3NAAL 1XF5A 1NBYB 4HLZH 4EBQL 4AIOA 3U83A 5J9PB 3MJ9A 1Z3GH 2E8ZA 3TIDA 4RRPG 1YYMH 4MD5B 1UACL 5JIIA 2H9GA 5B4MD 4H8WC 5L9DH 2A9NL 1I1AC 3IJYA 5D6DC 3FMGL 4OD1L 1T1YA 3RWJA 5KG9B 5HYSB 43CAB 4Z5RA 4NNYB 1ZGLM 4XRCB 1TVHA 5E8PB 3HI6H 4CU7A 2FGWH 1MCJA 2MCG1 2X9YA 3CD4A 2IQ9L 1H3XA 4N0YL 5C08E 4G8IB 5D96B 4KZDH 4RGMC 3BVNA 1UCBL 5ISZE 1RUQL 3FTGB 1FBIH 5CIPA 3RTQA 2WLZA 1IC4L 1G6RA 2A83A 3P0VL 1DQJB 1JPSL 3VFSA 1QSEB 3BAEH 2DLEA 1EGJH 3VD5A 4QTIL 2X1PA 3TNNB 2OK0L 2C5DC 2X1XR 2EYTB 3QDHA 4YE4H 2R0KH 3BH8A 5DURB 4JCLA 1DEEB 2A6JB 4UILL 2W0FB 2N4IA 3KS0J 2NX5D 4X4ZA 3D18B 2DWDB 5C0CE 1WUNT 3CFJB 4APQC 4J2XA 3WLWD 1EK3A 1JRHH 5FGSA 5SX4I 5HD8C 1NSNH 4IDLA 2DQHL 5E56A 1P7QA 2DM4A 3MUGA 4NWUH 5I19L 3QA3B 2W0PA 4WNQA 1LGVA 3ALPA 3LH2H 3MV7B 5F7HA 5FAAA 1HHJA 2EDOA 4GMSH 1KIUA 3CDGA 4OFDA 2K3TA 3JV5A 1S8DA 2CR3A 2AK1H 5I15L 3OJDA 2RHEA 1MFCL 1JCKA 1GHFH 4PJIA 4DUVA 1IGCL 3QRFM 4LLWA 1F3DJ 2P5EB 3VFOA 3P9MB 3PWLA 1AI1L 3C09B 4M9PA 5ETUB 3WIFB 4XPFH 3TN0B 3ZE0F 3GSNL 1OAUH 3QQ3A 2PYEE 3LEVL 2CPCA 3CLEL 1MRFL 3IFPA 3MOQA 4OCLC 4ZSOE 1YPZE 5J9PA 3MRCB 5DK3A 5I66A 5ALCL 2J6EL 1CXKA 5LGHH 1BZ7B 4HFUL 1ROWA 3MFFB 4PS4H 1CU4L 1OAQL 2I07B 2YBRA 3PDOB 2DI7A 1U95A 5K9OA 3DX9B 5ITBL 1RJLB 3L5IA 4FTVE 4S1SH 2V5SA 3Q1SL 5E99L 4XBEH 3UYRL 4K3JL 1LE9B 4U1HA 4XAWL 5F9OL 3DROA 1YN7B 5KJRH 5KVGL 4NUJA 1NGWB 2AXHA 2YKLH 4M1DH 2E8YA 3LKQA 1SY6A 5D93C 3UP1A 2J4WL 4MSWA 1JMXA 3QJFB 4FXLA 5JMOC 1F6FB 2DJSA 5I1HH 2EO9A 3FKUS 2K7QA 5FO7A 3AU1B 1CGWA 2MFNA 3BH8B 3QAZB 1G7IB 5FYKE 5IT2H 3QDJE 1QLFB 3RIAK 1N8ZB 1RQ5A 1YQVL 1KIRA 1AXIB 4W6YB 7CGTA 3FQXB 2O61B 1KB5H 4PJ8D 5F7LB 1N26A 2GTWA 1EEQA 3BZFB 5HHQB 4XMKL 2VLJE 3IS0X 4LEXH 1I8IA 4KUZH 4EIZC 4Y2DC 1I7ZA 4XNYL 3W81A 4RISH 4LCWB 4WFGD 1D5IL 2KZ1B 2CRIA 2CDGB 1MPAL 4O2FA 4WTZA 1S78C 1PKQA 4F2MB 1KTRL 3QT2A 1G0DA 4XVSL 5D2NA 1WIUA 3GSXB 5E9DB 1QLRA 1NKOA 4OGXH 4HCRH 4PBVC 3T0WA 5HHPA 1D6EB 5J06A 4LFHD 4YHZL 1T7YA 5T5NF 1DANU 5EWIH 4POYA 4OM1L 1A8JH 5CSZB 5EFIB 2WINA 4YHKH 2X4OB 5JTWA 2ATPA 4PRDB 5KSBA 4X6EA 5F71A 1HHKB 4FTVB 1ONQB 1DSFL 3RJQB 3O41B 3ZYZA 3ZHLA 1HHGB 1SBSL 3HPLA 5ACZA 3OXSA 4DOHE 2XKNA 2ERJB 3RA7H 3F12B 5C0RH 1QQDA 2P8MA 1S9YB 1E4KA 1JPTH 1WBXA 4XVUD 2BNQB 4KZEH 1L7TL 4QXGL 4EDXA 4QHNA 3BSZH 5EU7C 2Z4QB 5E2VL 3TWCH 3O3DA 1PYWB 1LE9A 1QRNE 3MV8B 1J5OL 1BHGA 2VR4A 3DROB 4TPRH 3VG0L 3BGFB 4P2OC 3EO0B 1NGPL 1ZLUH 3SQOL 2XN9A 4KUCD 3STZA 1FNAA 4LCUB 4TNWF 4K7PX 3VXTA 4I0PB 5ACMA 2NY0B 3EYVB 3RPIB 1EHAA 2APXA 2FECL 1QHOA 2EKSB 4PGZA 3WNLA 2DLHA 4WI8A 1T21B 2WWMD 3MNZB 2NY7H 2IH1A 3WHE1 3IDUA 4JKWA 1AO7B 3QUKB 4MNQA 4N90D 2EH8L 4HKJA 4WTZG 2D7TL 3MGOB 4LIQL 2JJTC 1S7SA 5DJYB 4KRPC 4JN1L 1B0RA 2FEEI 1CFVH 4PG2A 4MXVE 4PJ9B 5C0CD 1CVRA 3A6OA 4MLIA 5HHME 4RMQA 1CL7H 5E08L 1CN4A 2BRRH 3CFEA 1KJMA 4MB4A 1MIML 2DM3A 3QIUC 4XCEB 5CKGA 1XMWA 4W81A 2BOBA 3A6BH 3Q3GA 2C9AA 5DSCA 4JVPA 4XNUL 2C3XA 3QAZC 2J8HA 4IOIA 4JRXA 4FABH 1FCCA 4R26L 1R3KB 5LAXA 3WIHH 4EOWH 4B41A 5KW9H 4LGPB 1TZHB 2WINB 2H45A 2NW3A 1F6LL 2LTQC 3FO0L 5IESL 3D87B 4AIXA 3T3PF 2VZOA 4W4OC 4OLUL 2GT9A 2P48B 5EORH 1GZPB 3QNXB 4JFQA 1HILB 2YXFA 4XP9H 4P5KA 3DX7A 1MHCB 1EFQA 4LKXB 4KJQD 3T04D 2D7QA 3BZ4B 1XGUA 5GJSH 3WD5H 1S7TB 3S34L 5DMKA 4OZHE 2FZ3B 2MKLC 3GRWL 3I2CH 4ODSH 3PQYA 3O9WA 4JKPH 1JL8A 1WZLA 3Q6GL 4WI6A 5IMMB 1B0WA 2JB5H 4NHUA 2EDLA 2BVOB 3JBG7 1EXUA 2MPAH 4I0PA 4P48A 2PTTB 2VZ3A 3QDGB 1HDMA 1BREA 3EZJB 1T89A 3TP4A 4L4VD 2VZSA 4LEOB 4Q97A 1VGKB 5JXEA 2Q86B 3W0WD 3T1FA 3UXFA 5EU5B 4M3KB 4BFBD 1CK0H 5E1AB 2A6IB 4KK8C 3O4LB 1G7LB 4ISVA 3S37X 3WIIH 5IMKB 1IAII 1FL5B 4TTDD 4NM8L 1J7VR 4GBXB 1LEGA 5I1CL 2VOTA 1P84K 5FKAB 1HHIB 3QUXA 1Z2KA 1U92B 5I1DA 4PJXF 1S5HA 2B20A 3D3VB 1INEL 1KJMB 1UA6L 3H7LA 1OP9A 2MOVA 4R4FL 2LQRA 3DJ9A 3MCKA 5EU3A 1KNOB 4QKXB 3AVEA 4K94C 3HR5A 3LVEA 2DYPB 4TQEH 4XVJL 2QADC 4DK6A 1AKJB 1TMCB 2Z91B 1MFDH 3IB4A 1KYOK 2W60A 1H15B 4ZPTA 3O0RL 4OLUH 1OTTD 5IQ7H 1OD9A 2OBGA 1ZT1A 4POUB 5MEQB 1UZ8A 4S0SD 4LSQH 4P5TB 2C26A 2ZUYA 1CGTA 4K7PH 3SGJA 5D7LE 2IALB 5JLZB 1T1WA 3MLVH 4PRAB 1GZPA 1ZVHA 1CD1B 3EJZD 5KSAB 1WWWX 4EXKA 2ESVA 3MRBB 4BELD 3BZ4A 4G6AC 1J0KA 2P5WD 1WWAX 3EYFB 5GGVY 1KCUH 2VLKA 3NCMA 3P4LA 4EZMA 4XMPH 1MRCL 3GSWB 2X2YA 4Z7VF 2D7PA 2CO7B 1M4KA 3HI1A 3DVFA 3UC0H 5IMMA 2DQIH 4NHUB 3L7FB 4YUEL 3ZL4L 4DGIH 3U0TA 2H1PH 4OLYH 3VI3F 5JPNA 5IG7B 1ZHLA 5F9WC 2D7TH 3O6FA 1VA9A 2FIRT 4Z7OF 1IGYA 4OZGF 3OG4B 1HDMB 3WN5B 1JNJA 1BM3L 3MXWL 3S98A 4KI5D 2GI7A 2Z8VC 4JO4L 3OSKA 5DJDB 2VITA 3RDTB 1HSAB 2APBA 2WMPA 2F74A 1C12A 3C5SA 4GXUM 4D0CA 5FKPB 4FQHA 2ZNXA 4Z7WF 2PXYB 3CPLB 4G6KH 1I7UB 3EYOA 3DUSB 5D7KE 1YNTB 4IDJL 1JHKL 3ARDC 2X4TA 2AW2A 2FB4H 3HC3L 5I1LA 3ZE0E 4PY7A 4GQPH 4HWBA 1T2QL 3X12A 5C0AE 3V6BR 4OQTL 3QDJD 4E42A 2VH5L 1JZ6A 4RA0C 1NC4D 4C56A 3VH8B 3ESVF 3TH2T 4K9EL 1OCWL 4Y0GA 5C0AD 3V2AR 5A40E 4Z7VA 1F2XK 1NCWL 4UT9H 3UEZA 3U6RA 2DMBA 3MLTB 4ZUSB 1J0IA 3SY0B 4X0KA 3QUYA 1SBSH 3AM8C 5D7KD 2I9TB 3LRSA 3HRZB 4UT6H 2VDKL 5FDWB 1NFIA 1FYTB 4ELKB 1RZ7L 4CJ1A 1RZGB 2GTZA 4RZCA 1BFTA 3BX7C 1QNZL 1A9BA 1FNSL 5D7JB 4DAGH 4OM1H 1I9RH 4RAVA 5EWIL 3MXVH 5I1AA 4M6NL 4FQLL 5CJQL 1EHLL 2BNUA 4FQIH 2W0LA 1U8OB 3UBXG 5B39G 5A43C 3ELAT 1CD1A 2IH3A 5KSAA 2UV3A 1BEYH 4QYOA 2CUIA 5B8CB 3G5XB 1MF2L 5DRNB 1A3RH 1BP3B 4GRMB 1A9EB 3QPQC 1RK0A 3VFVA 5E9DD 3EUUA 4FQ2L 1L6ZA 2IPUK 1HH9A 5KS9A 5SWSB 4JM2D 4PRNA 5JO5A 3V5HA 5FYKL 1NBQA 4HJJL 3L7FA 2BVQA 1YQVH 4GW1A 1B4RA 2DD8H 4H5SB 5D9SB 5E24E 1K8DB 1HQ4B 4GJTB 2OL3L 4WFFE 3QI9C 3QG6A 2QSVA 4DVBA 3LSOA 1SVCP 1T4KA 2DBLH 4RDQF 2AV1B 2VLMD 5HJ3A 2PO6B 4QGYA 3ALWA 3QWRA 2XKUA 4DVRL 3U0WH 1C12B 2J4WH 5FYJU 3MRMA 4YX2H 3QIBB 5T5FL 3MRFB 1YEJL 3E6HA 1CGSH 1E27A 3EYSL 4CBPA 2I60L 1KCVH 4R6UA 5KJRL 5I1LB 5KVGH 5F1IB 4ZMAT 3VXME 4H26A 1UKQA 4M7KL 3HNVH 3Q1SH 3RVWC 5F7WC 4E42B 3IJHB 4PJEF 1EO7A 4BH8A 4YWGL 3CH8A 1CVSC 2FR4B 4P3WA 3RZCD 2XWTA 4XTRC 2X1OA 3ARUA 1R3LB 5C9JB 1ZXQA 4Z8FL 3VH8G 2J6EH 5CILH 1TVBA 4XAKD 3HRZA 4R2GC 3G5VA 4P4KD 1QLEL 5IBTH 1UM5H 1D5BA 3ULSA 4HWEH 2ZSWA 3CUPA 4NQVB 3QXDA 5DJCA 4NKMB 4GKSB 3MBED 4PJ9C 4J3UA 4NQEA 4LVHC 3OJMB 3H7BA 4YHOL 5DEFA 3VMOA 5CJOH 3OR6A 1XH3A 2XZCH 4NPYB 1BPVA 2IH3B 1PQZA 3C87A 3FB5B 1OTSC 3GMLA 4L8DB 2WNGA 3CSYA 5ESAA 2AK1L 4GRMA 4MA3A 1B2WL 2E7MA 5C0BD 5EOTB 4NM4H 2IG2H 4F9PC 5JHLH 2DLFL 1KXVC 4U2YA 3KPSE 1A2YA 2IAND 3EAKA 2XI9A 4P9HC 1DDHB 1NSNL 2G60L 2HAZA 5E4EB 4ZD3L 5E5UB 1UXSA 1W0WA 3IVKB 2IJ0C 1SEQH 5CD3A 5ID1A 4JPVH 3KVQA