4XP9L

X-ray structure of drosophila dopamine transporter bound to psychostimulant d-amphetamine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
213
structure length
213
Chain Sequence
ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIEGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein/inhibitor
molecule keywords Transporter
total genus 51
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp9L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp9L01
3X3GH 2FD6L 1OB1A 1IM3A 1TJIL 4Y5VB 3T77A 3DRTB 1N3NA 4OZHB 5IB4A 4K07A 3DPBA 4XPFH 4QRUA 3NIGF 4N90E 3F12A 4LU5H 1M7XA 1AGEB 2X7LA 4PTUA 3CX5J 1BAFL 2BSRB 2PETA 4U1GB 3MLWH 2NNAB 2PF6A 4LRNH 3BUYB 2GW5A 5DJ6A 4TPRL 4CVZA 1QRNB 2NTFA 4P2QD 3V52H 2F53E 5DUPL 2JCCF 3QQNA 1SY6H 3V4VL 2X41A 5C2BH 4P2OA 4PJGB 2I25N 3RIAK 3FCTB 4XB7A 1QFWM 4JJHA 1L7TH 5DT1H 3KYNB 5H35A 2E3VA 3MV7A 4K9EC 4I3RL 2C3XA 3I6KB 3U2SA 3JWOC 1WC7B 3UTSB 3OSKA 1OTTC 4YE4H 1UM6L 1NKRA 4JFEB 4LKXB 4M6AA 4M93C 4ODSL 1TQBB 4P5TD 1ZHKB 3T1WA 2G75A 5TE4H 2IBBA 4DTGH 1A7BA 5MEOA 5EU3B 1I7ZA 1R24B 4PJHF 2VABB 2EDEA 1EAPA 2PXYA 3KYAA 1LO3L 1N59B 5ESVB 2BK8A 1FFRA 3TWCL 4IRSD 4JFFA 3REVA 4YDKH 2JE8A 1MNUH 5F7FA 5B22A 4YHPA 5DT1L 2NY1D 4LLVB 1MFCH 4O2FB 5EUKB 1QFUH 1G6VK 4F8QA 4TTGA 2M2DA 2VLRE 4Z78A 1AD9B 5C1MB 4K7PX 5EA0H 1AC0A 4PJDF 3E8UH 5I16A 3BPOB 3VA6A 5F3BA 1G7HA 4IOFC 4PP2A 4DGIH 3ZHKA 5K9JH 3OJDB 3S35L 4L9LA 4YBLB 5JMRA 1E6OL 4I4WA 1GGCH 3GIZH 2VQTA 2DQFB 4BSWA 3WS6C 4WV1A 3VMPA 4GRLD 1JTOA 3BUTA 4PJIA 4BZYA 3O3BA 3ECBB 4ERSH 2QL1A 4NZRL 1UCBL 3WYRA 5C9KA 4OZIF 4LLQB 4B50A 4LLVA 4WU7A 2GTZA 4HIJA 5DLML 1CFSB 1MRFH 4OI7A 3IDYC 3BYYA 1AD9A 5F6HJ 2VDQH 4HXBL 2E9IA 4ZO7A 3OB0K 1G9NC 4WU5A 1E27A 2HJKB 3D5OF 1AGCB 3DBXA 4PJAB 2OK0H 4MA7L 3VXSB 2X1XR 1UM6H 3ES6A 5ETUB 4FFYH 1N7MH 2FEEI 2NY5H 3FN3A 3K8KA 1H3GA 5CHNB 1QEWB 1YEEL 4BSWB 1CDUA 2YMXL 4FTVA 2J4WH 3BIAX 3BKYH 1RIUH 2H6PA 1YEJL 2CPCA 5HGBB 3TWCH 4LEXH 1GHFL 4NUGL 4PY8I 3ARDA 5ITFB 3RA7L 3ZDYE 2E9WA 2GJZA 2JCCA 4JHAL 2B0SH 3TJEL 4WDIA 5D1XC 3HAEG 5IFAL 1ES0A 5EC2B 3V6ZB 3GSQA 2Z31A 2VDPL 5I1JH 4P23D 3WL9B 1CFQB 2V2TA 3GMPA 3HNSL 3M45A 1T22A 3T0AA 4KJQC 2ATKB 2DM2A 4O5LL 3BKCL 2F8XC 1OPGL 4R0LA 1FSKB 3WLBA 4FFVC 3GSNB 4MD0A 3T4AA 5DD6A 5BMFH 3JV4A 5DRWA 1KCVL 1EUTA 1OAUH 4G8IA 2ID5A 2P1YA 3NFPB 4KDWA 3IJHA 3G6AB 1QFWH 3SBWC 5LAXA 3PGFL 3X13A 4NJ9H 4LCCC 5CIPH 4AL8H 1ES0B 2D03H 1CICA 4M93B 4BFIB 4R7DB 1JRHL 4R97B 1CQKA 2BVPA 5HVGB 3IDGB 3QI9D 2GT9A 3NTCH 4NT6A 4B41A 3MJ8A 3QDGE 3BQUC 4NKIL 2XA8L 4LSSL 4LBEA 2ZG1A 3O2WH 4KQ3H 5T3XL 5MHSD 2YBRB 4R3SA 4IOIA 4Y16B 1MQKH 2R1YB 1MHPH 3KXFB 2Y7QA 4MDIB 4NBXB 4NJAL 4U6XA 2ZJSL 3OB8A 5TE6H 1DUZB 5I6XC 4PJCA 1PKQB 3C6LD 4E5XB 3RKDC 2X4TA 4G43A 1MIEL 2NY7L 3CXHJ 4P3CL 1CTNA 5TGBB 2ADJB 4PRHA 3DVFA 4OLVH 1QLRA 4RAVA 1NJ9A 2EDXA 2Z35A 4LCIL 1X5IA 4PJBB 1XF5B 5EO1A 4Z8FL 1RZFH 2H2PD 5ECJE 3Q5TA 3OR7A 3BKCH 1MJUL 4YJZL 5FV2A 2ERJC 4Y4FD 4M62L 3C5ZB 2BNRD 4MJ5A 2PNDA 2LVCA 1JHKL 4PY7B 3QEQD 2XTLA 1JGLH 4G6AC 2JIXB 2DBLH 4DW2L 1N6VA 2RR3A 5IROA 3GKWL 5CILH 4KAQL 3I50H 1KCUH 4OZHE 1B0WA 2CMRL 4OFDA 3RGVD 4WUKH 2X1PA 2C1OB 4ONOA 1S5HB 4DGVL 5ALBL 3UX9B 4KKLC 2QJDA 4QRSB 3NN8B 3RPIA 1T03L 5ENWA 5T1KA 2AEQL 4WO4D 1BVLB 5DZNA 1NC2A 1WEJH 4OKDA 5BQ7A 2DWEA 4NRYB 4S1RH 5GGQH 4WFEE 1IAKB 4MNQB 3FONA 1HSBB 1INQA 5FYLE 4JY4A 2UVFA 4HH9B 3WFCL 2ZCKL 4HPYH 4NPYB 1QVOA 1CD8A 1EJ6A 4QYOA 4PRID 3MJ7A 3RZCB 4F7MB 4JRWA 4G8GA 1LEGB 2IQ9L 1B9ZA 1WGOA 1A7QH 5JPMB 2CGRH 4ZAKC 3W0WB 1LP9E 3MUHL 3PHOB 5DEZA 3T65A 2Z91A 4WI4A 3R1GH 1J5OL 2VLJD 2E8YA 3Q6FA 3BIKA 5C0CB 4S2SA 3MBXL 3VXTA 3IKKA 1A21A 2DJ4A 4XNUL 4FZ8H 2Z93B 3H9SE 2ZOLB 1T89C 3NCYP 3LKOA 5FKAA 3ULVD 4MMZC 1UJTA 3ZTNL 4LQFL 4O02L 4CMHC 5B8CC 8FABA 2C4XA 3NPSB 4KK8D 5A2IH 3UPCA 2VDNL 2IQAB 3VFOB 4Y5YA 3IDXL 4N9GA 3CC5A 4NFDA 4CNIB 4HJGB 3K8LA 5F1KC 1MJ8H 4P46C 4I9WE 3CH8A 2EYRA 3GJFB 4J4PC 1KIUA 3VFTB 1NAMA 4X7TB 3BQUB 5F97E 2GY5A 2VE6A 5IMKB 3LKNB 4PJBE 2X05A 2H2SD 3CMOH 1QNZH 1D9KA 1JPSL 5C3LD 1DSFH 1KPRB 1T20B 2MOVA 5D9SA 2ORBL 3QDMD 1JHLH 1MI5E 3QUMH 4X4MA 4EKXA 3B9VA 4EN3B 2FECI 4Y19E 3KLHC 3B9EA 2E7BA 5KAQF 5H2BB 3SCMA 1P4BH 3DIFA 4D9LL 4PJ7B 3CVHA 2FJFA 3FJTA 2WW8A 1XGUA 2CXKA 2P7TB 1JYWA 2OI9B 2HLAB 1RULL 3IRZA 1T1ZB 3LN5A 4IHOB 1IKNC 4QKXB 4E41E 1CIDA 3MGTB 2V2WA 3TPKA 2D4FA 4DUWA 3LV3B 2DI9A 5DO2D 3IF1A 3FOLA 3LHPL 4HUXA 4Q0XH 5HDOA 3X11B 4BQ9A 1SBSL 1T04B 4HFUL 4MAYA 1MRDL 1H3WM 1FC2D 1KJVB 2APTA 2AI0L 2GJ6A 4HDIA 3E2HC 4OQTL 2VUYA 3DUSB 2AJXL 2OZ4A 5AUMA 3RKPA 2YKLH 3TESA 4LSUH 2IG2H 4YUEH 5IBLD 3NCEB 2BOCB 2ZNWA 4LRNL 1LP9F 2IADA 1SEBA 5J9PA 3OKNA 5F3HB 1OOAA 3WNKA 1IT9L 5C8JB 3EIFA 3S96B 3BSZL 3BPNC 4HJJL 2GK2A 4DN4H 3DURB 4YXLH 3BOVA 5IIEA 5B3JE 4JPWH 1JZ8A 1NUFA 2OL3H 2DQTH 3T77B 5FGCE 1QPXA 3D0VB 3I02B 1OGAE 4Z77A 1S5IH 4HK0B 3C60B 1HNFA 3TBVA 3GMLB 3ZDZF 4FQXC 2B1AH 2YC1B 1HI6B 1H0DB 1XGRA 4M5YL 3BXNB 5ICYB 2XZQL 2JELH 4JG0L 3RZCC 2R2BA 2FGWL 2X4RB 4RWHA 3RDTB 2IH1A 4ZAKB 4C83A 1UJ3C 4Y4KD 4Z7UF 2X9YA 2XNAB 5B4MC 1J12A 3WE6B 4NHCH 4PIRF 3QHFL 5EUOA 4ZOBA 3QIWD 1XF4A 1VGKA 4M6NH 1DCLA 1SY6L 5D6DC 5MENE 1AGFB 2VDKL 4Y7MA 1KB5H 4HMEA 3MV01 1ZS8A 1WAAE 5DR5H 2ERJB 1RVFL 1TVHA 2L4OA 2CKNA 3EO9L 1EA9C 4NN6C 3C5ZC 4WEMB 1MFAL 3VXTB 3FFDA 5ID0B 2EH8L 4HIIA 3LPWA 1YN7B 3KS0J 4D0CB 4JJ5A 2QLVB 3VFVA 3MGOA 3QH3A 3K80A 4JHBA 4FQIH 2IG2L 4U0RC 2GTWA 4PRPD 2X4RA 4BM7A 4HT1L 4FQ2L 3WFBL 2X1QA 4MXQC 4KK6C 3W39B 3G5ZA 1V3LA 2R56H 3RFZC 1GGIL 4OGAC 3E1F1 4JRYB 4NQCA 2NYYD 1DVFD 1GZPA 1A14L 3QQ9D 5TE7L 3VI4F 4FQCH 5IM7B 4YDVB 1S9XB 1QFUL 2GFBB 3VJ6B 3W2DH 2QQLH 2VLJE 1UXWA 5HPMA 5E2TH 2MFNA 1RK1B 1TCRA 3ET9F 3LEYL 3VFWA 5CP7A 5KSBB 4G9FE 3KXFE 4XBEL 5F1NB 1M05A 3ALPA 3GO1H 2J6EA 4AEFA 4RGNE 1AHWC 1QSFB 3WIIL 4Y16D 1NFDE 3H3KA 5IB5B 3UZQA 4HPOH 3LPGA 1FYTB 5IF0A 1LP9A 2B1HL 4NCC2 1X5ZA 3GSXB 4Z7UB 4KZEL 1UCBH 1IQWL 1UWEL 5EBGA 3IU3B 1GSMA 4ZPTB 1OVZA 4OF5A 3STZB 1DEDA 2J8UB 1K5NB 3F7VA 1NEZB 4LIQL 4LAQL 1CBVH 3E6HB 4WJ5B 3MRCB 5D2NB 4DOHB 3QZWG 2XZAL 4Z76B 5L2KB 1VADB 1OP5H 1XR9A 4XVSL 5D72H 5HYQA 1FAIL 3QXVA 4LCUA 1PZ5A 4P57A 5AZ2L 4GW1A 4XB8A 2Q87A 4PJDE 1NUDA 2P42B 4JANA 4MA7H 4U05A 4RA3A 4I77L 1YEEH 5C0NC 3RY6A 4L29A 5JHLH 4HC1L 2YXFA 1HYSD 4ZUWB 1BLNA 5CEZD 1GIGL 2O5ZH 1CU4L 2DDQH 4LPCA 5JORB 1C7TA 4OLWH 1UACL 4ZYKB 2ATKA 3PWJA 3EYOA 3RWEB 5D2NE 1CDIA 2ZKHL 4ZFFB 1VADA 3KYMB 4KK5C 1WUNT 4GBXD 1A5FH 3UTPE 3P77B 4Y2DC 43CAB 3SJVB 3OPZH 4ZXBD 4LSVH 4PJ9D 4MNQD 2VDOL 2VSDA 5I1LA 1NBVH 1XF2A 1U41A 1XH3A 4K7PL 4D9RE 2Z4QA 4NGHL 4OFIA 1PKQA 5I75B 1NLDL 1CDYA 4PRIB 1FFNA 5ILTH 5JNYB 5GIRA 4LHUA 4NO5B 5IP4A 1J8HD 5FA4A 3CX2A 3E2HB 4N0FB 4HK3J 2H26A 2ENYA 4JE4B 3QRFM 3MOBL 5EZLB 1WVZA 3HE7C 4LLMA 2EKSB 5LKNA 3DV6A 5C6PB 2VQ1A 4U6VL 2XFXA 1RPQA 3HZMA 3VD7A 1VFAA 1NPUA 3NIFF 4Q9BA 3QULB 3LIZH 4JHWH 3V8OA 1A4JB 2NY2D 4CAGA 3RWDB 3P73B 1S9WA 1HQRB 2E7LC 1RJYB 4ZS6D 4AY0A 2FYYA 1F11A 3KLAB 5J06A 4YWGL 4HIHB 4DTGL 3NZ8A 1N0LA 4R8WL 1K8DB 4HS3A 5EOCH 1UG9A 5EU6E 3SDCC 5DEFA 1XGYH 4JPKH 1FPTL 4H1LG 2KQMA 3AXLB 1IE5A 3DROA 4GLRH 5E5MB 2AEPH 3UO1L 2E7HA 4M1CC 3R06B 3Q3GA 2VR5A 4QHNB 2I9TB 4FABH 2BCKB 4NNYA 1AKJB 2DRUA 3UYRH 3IXAB 4XMPL 4KV5F 3TVMA 1UJ3B 3GHEH 1N6UA 3ZE2E 1QSFA 5I18H 1H3VA 1L9MA 1UXSB 1I7UB 2EICA 2Q3ZA 5I8CB 1NGPH 1QLEL 4PY7A 4OZFB 4Q9QL 3JV6A 1KB9J 5E4IA 1P7QD 3PIQB 4I0PD 3CFJA 1MCRA 1F6AB 4QYOB 1JNJA 3WJLC 1TQCC 4I18C 3MJ7B 2W9EH 2Y6SC 5CS7A 4P59L 1FNSL 2F58L 3BZ4A 4KROC 5D2NC 5HGDB 4EBQH 5ILTL 2A6IB 3GSUA 3RWGA 3L5XL 3HHRB 3V0WH 4NJAH 1LEKA 5F3BB 3DYPA 4XP1H 3DX9A 2QADC 4Z7QF 3RHWF 5HYEA 4J6RL 1TJGH 4CUCA 2NQCA 2DD8H 3K8MA 1XGQB 3ME0A 2Z93A 1B4JL 4OLZL 4YQXL 5E08H 5FM5O 4L4TA 4XWOC 2Z8WC 1LK2A 4HGWA 1U3HD 1F8TH 1ZT1B 1NGZA 2VH5H 4ONHA 5FOBB 1HQ4A 2AEIT 2FIKB 5A40E 5T1MB 2DQUH 4UBDC 2ZCLH 1D6VL 4F8TA 3QUYB 4UQ3A 3D25B 4PV8A 2DLEA 1CGVA 1E4WH 3WN5C 5F9DC 2IEPA 1GAFH 3RWGB 1A7QL 1FBIL 1IGTA 2COQA 2GEEA 4WEUD 4OZHF 3P4OB 4XC3L 2AKRA 1MWAH 1EMTH 1HWGB 3WLWD 2EDNA 9CGTA 3C60D 4U1SA 2AXGA 1LMKA 4FQLH 2HFFA 2VLRD 2DIAA 5B8CA 2BY2A 2F5AH 5T3ZD 3P3YA 1SY6A 2NW3B 1CDCA 5C0FA 1AI1L 3RTQA 4LNVA 1DL7H 4AYFA 2I27N 2L0DA 2PW1A 2FJFB 1FFQA 1A9EA 5ACMA 3CFBA 5HDBE 3C8KB 3B2UC 4Z9KB 4OCYL 2YHGA 4M1GL 5GGSB 3NACH 1Z0NA 4Y1AE 4GH7B 1U58B 3VXNB 3GMPB 4NO3A 1X5XA 1OAQL 2FZ3A 1C12A 2YEZB 3CVHL 5EBWA 4OCLC 2XI9A 3U4EA 2GJ6B 3AC0A 2BHYA 1HK6A 3VXRB 1MELA 3IVKA 4ZQKB 3ARED 2IANA 1S9WB 4OLZH 4GRLA 3TZVC 1OTSD 2DL2A 1KYOK 1FN4B 1T0MA 1YY9D 2WIIA 4HV8B 4PJ5A 4HUVB 4K8RC 3MLYH 3I85A 4TNWF 2VTFA 3QIUD 2EO1A 3G5YA 4L3CA 4L8BA 1D9KD 3HPJB 1GGYA 1R3KB 1B4RA 5IIEB 5GS0D 1X5JA 4NZJA 3S36X 4LLDA 1CN4A 2XIDA 4HX1B 1U58A 3FT4A 2HFEB 4Y1AD 1TZHA 3QIUA 4WWKD 2DTML 5DWUH 4KKCC 3TO2A 3FRUA 2XG4A 4MD5B 4NQCE 5EU6B 1AQDA 5BW7C 3MBEC 4RA0C 5I75C 4YIQA 1C08B 3C2SA 4W6XB 4BZ2H 2QHLA 3QNYA 4KROB 4PGEA 4HV8A 2W65B 2ZUYA 2ZG3A 5IB1B 3X17A 1FYTD 4GAGH 5EO0A 4GQ9H 4CMMA 1CLYH 15C8H 2QADB 4XHJD 4OCYH 1NCBL 4E0RB 5CP3A 3H7BB 3PP4H 1FNAA 3EGSA 3VRIA 4GKZA 1L0XA 3O0RH 3GSRA 4U49A 5EO1B 3FL7A 5C9JB 1D6EA 1HOCB 2NW2A 4F33B 1C16B 1P6AB 3M17B 1X4YA 5DURD 1MVUB 4XBGA 3RVVC 5BOZG 1G84A 4GLRI 1D3CA 4P3DB 3QIBC 3WNPA 5FECB 3BVNA 4C58B 1G7JB 3GK8H 5IB3A 4F3FA 5EU4A 3F7YB 1MEXL 4NFCA 4R4BA 2RFXB 5J3HC 2PUQT 4FTVE 1D5BB 3DHJA 1AGFA 2YPKA 2YPLA 4O2CB 3S37H 3IAQA 5J4MA 1HXMB 3BGAA 3RIFF 5AYUL 3F58L 5JHDA 3TO4B 1YNKL 3ZYOA 3MPCA 2H3NA 3FMGL 1OCWL 4S1DD 4JJ5B 4MMXC 3TT1H 3QIWA 1VKXB 4KRPD 5CD5D 2AI0H 1KEMH 3D85D 3QUKB 3CMGA 3EJZC 4LDEB 3SPVB 2AJZA 4H1LA 3GBLA 1UKTA 2YA0A 1BBDL 3P4NA 4GKSA 3TIDA 1IJ9A 3BRGC 5DD3L 3TT3H 1MQ8A 1BFVH 4YDVA 3QNXB 4ODTH 3FB7B 2VUOA 3L6FB 3JTTB 1NMCC 1EEQA 2O61A 5JO5B 3BW9B 4FQCL 1KLUB 4EVNA 1QHOA 1ZHBA 5EU3A 5C7XL 3ZKMD 2FATL 4Y5VA 5J6GA 4OFKA 1HHKB 1ZA6B 1OGTA 5T1DH 2WAHA 1BVZA 3ARPA 3V4UH 2A9NH 2VN4A 1U8IA 2NZ9C 4ODUB 4XCEB 1HH9A 1W72A 4I77H 3HB3C 1P9MA 4U1NB 1YQVH 4PJGF 5JA9A 2FX9H 4V2CB 5BO1L 1NFKA 1OWRM 5C08D 1RUPH 4HPOL 3BUYA 5DJ6B 3RWJB 3KWWA 4C57C 4LFHD 1QRNA 5IESH 4Y2OA 3A6OA 2D7PA 3DXAD 3V6OE 3V79C 5A2KH 3OJMB 3VXMB 1E27B 2HJKA 1NBZA 4PRHE 1AKJD 3U0TA 5I2IA 3U9PH 3W9DB 4IDJH 3RUGE 1BBJB 2CLVA 1A1OA 3W2DL 1KENL 4WFGD 2EE9A 1D5XA 4JY5H 1AR1D 1FFOA 2QSVA 1HCVA 4LVNB 4ODUA 1Z6JT 2AVGA 5DFTA 1E6OH 1YJDL 3WFEH 3HCVB 2Q6WA 3V5HB 5TPWL 4W4OA 4I5BB 4ZMAT 3P4MA 4PS4L 1HHIB 3F6LA 1ZHLA 2J8UF 3NA4A 4HWBA 5DC0A 3MXWL 5FCUH 5FO7B 5EZLA 5C0DA 2Z8SA 3U79A 1NAMH 1ZSDB 1FO0H 1IQWH 1UWEH 2PR4H 3MRBB 2GJ6E 3KDMA 5ETUA 5EG6C 1FFPA 1F5WA 4G7VH 4JPWL 2FHCA 3BP6A 3JV4B 3KPQB 3BT2H 3GDBA 3O4LD 2G9HA 2EDJA 4J23A 2I60H 3HC3H 3SDCA 3OPZL 1MJJA 4QRPA 2GJZB 3G04B 3S8WA 5FO9B 1G9MH 2X09A 3T0ED 1DQTA 4ODBD 4L8DB 3CSBA 2Z31B 4U2ZA 2YN5A 2IBZX 3W5NA 2YRPA 2BSTB 5E5MA 3KPMB 2FEDD 5E1AB 4Z7VB 1BOGA 4XNQB 5FGCB 1U6AH 2ADGB 3HZYB 3L3KB 2NY5C 3GKZA 3LDBB 3IFOB 4UT9L 4OIIL 1I7UA 2NZIA 1MHCA 1NSNH 2BDNH 2ZUVA 4KJPD 2P5WB 2HT3C 4OJFH 3P4NB 4GW4B 5LGHL 5FHAL 5HYSG 4GBXA 5DK3A 4G9FD 1E4KC 3VDAA 1EHAA 4D3CL 4NKDA 4N0UB 2C3VB 5C09B 1SJEA 1MIML 1T1WB 3Q3GB 3L5XH 1DQJA 4YO0B 1ZLWK 2BCKA 4NNYB 4JFPA 3V0WL 2X70A 3ARVA 3VG0H 2Z8RA 3SY0A 2GJ6D 5GGTL 1BZ9A 4M6OL 2Y07L 3B8SA 3CSYA 2VXVL 4PB0H 1TNNA 5GRVK 5D96B 2OTPA 5E08L 1FIGL 3DI2B 4UOW1 4KK9C 1RUML 3TNMA 5CEZH 3NIDE 3QFJD 5GZNC 3NIFE 2ITDB 5AAMA 3M07A 4NGHH 5IVXE 3TO4C 25C8H 3BE1H 1KN4L 5TGBA 5ICZA 4PJ5E 4HMDA 4YH6A 1Z5LA 4I18A 5HPMB 3ZLQC 2VLJA 4HFWB 1CLCA 1LEIB 3NFSH 4ALAH 1EX0A 1AQKL 4WEBL 5KSAD 1PG7H 3HAEH 4X6DB 1T5XB 1IM3B 4WI5A 3T2QA 3MOAL 2EDQA 3EOAB 4WUUB 1NC4A 3DNKA 5IB4B 3GBNL 4R7DA 5I19L 4A6YA 4R96B 1Q1JL 5E8NB 2DQEL 5EFIB 2YXMA 3HCVA 2Q6WB 4IRJA 2VDOH 1RZJC 2DQHL 2F19H 3HI5H 3ULSB 5TQ0H 1NMCB 1EZVY 4APQD 3MYJA 4O9HH 1RJCA 4NNXB 2EZ0D 4CU6A 4TSCL 4MJ2A 2LU4A 2P43B 5INDB 4G6KL 4XX1E 1BZ7A 3FCTA 4QHMA 5CILL 4XVUC 5GJTH 3UBXI 5BS0E 1MCEA 4HJ0D 5HJ3A 1LE5B 4JRYD 1CU4H 2DDQL 2R9HD 2AXHA 3VRJB 8CGTA 1EMTL 1MWAL 3QWOB 1JPTH 3O8XA 3FFCB 4P2RB 4JFQB 4Z18A 3DRTA 4XP4L 2JJWA 3GFUA 5FYKH 4XBPB 2GTZB 2JTDA 1EH9A 1KIPB 3E3QE 5BZDA 1S7VA 4H1LH 4L4VE 4MQXD 5JXAH 1W0WA 2BSTA 1IC5L 5JA8B 3OKOA 3ARBA 1K2DA 3MJGX 6FABL 3MNZB 4NO0A 3PGCA 4QXUL 1OAUL 3IFNL 1PKOA 3MV9D 3KVQA 1A02N 5BVPL 3I2CH 3DO7A 5CUSL 3UYOD 2KBGA 1YNTA 1LE5A 4GG8B 2W9DH 1SMOA 2PYED 3D0LA 3K4ZA 2QTEA 3GHEL 3LAFA 3RPIB 4YHYB 4M6MH 4AM0A 4JDTL 5D70H 5JXAL 1RURH 4PR5B 1FLRH 1JP5A 2XA8H 3D18A 2P8PB 4ZS7L 3U9UB 4AEHH 3RY6C 5HY9B 4NQDE 1CGTA 2H9GB 1FZKA 2WWMC 3DUUB 2DM7A 3B83A 3X3FH 1XIWB 3OKKB 4F7MA 1FBIH 5DEGB 2XA3A 3D2UA 4P46A 4K94H 3SE4A 1BECA 1JGDB 5MEQA 1NC4D 5TDOA 3MUZ1 1RJYA 4PJ7A 3GJFK 5HYFA 3ARGB 4ELME 5I16B 5D7SH 5D1ZC 5IB2B 3VA2C 3BN9D 2IMNA 1FYTE 4V2BA 4YHOL 3E6FB 4AEHL 3QDMA 3E0GA 5DJDB 1B6DA 1UWGH 3DO3A 15C8L 5T3XH 4JGUA 1XT5A 1S8DB 1HXYB 2NW2B 4MNGA 4X7DC 4NKOA 1E4WL 2JCCB 4TUKL 5L9DH 4X83A 5F71A 4JFXA 1QSED 2ZUUA 1AGDB 3L5HA 4R96A 1OT2A 4ZXBA 3F7PC 3QA3B 3RDTA 4F7TA 1QKZH 5E2JA 4PJXF 4I48B 5IMOB 1WBXA 1UA6H 4MA8L 5SWSA 1ZGLB 5IKCA 4OQTA 2NX5E 3SDYH 2R0ZH 5C08A 1T1YB 1YY8A 3AS3A 7CGTA 4Q7DA 4GXUM 1RD6A 4LSDA 4RAVB 4M7ZC 5D7LA 1JGUH 2H41A 3N1QC 1UB5B 5TFSL 4P2QB 5D6DA 4G8IB 3WFCH 5HXMA 4YX2L 5D96C 1OF2A 4HIIB 3BKMH 4NFBA 1BQHA 3V6FB 3TN0B 4XCNB 3DMMA 3EOYG 4MJ5B 5D7LD 1KEGH 3BEWA 3ULVL 3ARFB 5D5MF 4AT6B 3PL6C 4X7FC 2Q7NA 4ODWB 5FHBL 5A16B 1F4XL 1P4IH 5JR1H 3G5ZB 4MVBD 1FV1A 4HXAH 5E03A 3B9DA 1K2DB 2EXWC 5HYJB 5H35B 2KQNA 1BQLL 3L7FA 5ALCL 5IHZB 3H9HA 3BESR 1RZGB 3K4AA 2DQJH 3HI1A 2R1WB 4AEIL 3GI9L 1J0HA 2CDFB 3DOSA 4IIQB 4CDHA 1BP3B 1WLHA 4MQ7B 3OKLA 2CLVB 1MUJB 5GZOD 1P9MC 4ZUVA 3BRDA 2VLKB 3MLSL 1RZKH 3MODH 1T0NA 1WWAX 4U1JB 5DJYA 2P5WD 2MQ0A 4HKJA 1IGML 2X4SB 2AK4E 1NDMB 1BX2B 1ZA3A 5KOVC 4F9LC 1CI5A 3RWJA 1FVEA 1SEQL 1HIMH 1S7TB 3AU1B 3O9WB 1RZKC 1I1AA 2A74A 1DBML 3ULUC 3ZTNH 4JKWA 3M1BA 4D0BA 4L8SA 5CSZB 3VE0A 4OB5L 3OKMB 2J6EH 4NSKA 3HE6C 3S88L 3LEVL 2P48B 1QBLH 4MA3A 3VG9B 3IDIB 8FABB 4Q6IC 1F2QA 3DX7B 1GC1L 1KFAH 5CMAB 4DAGH 5D6CA 2FLRT 1AE6L 2VLKA 3QIBA 3WSQH 4UINL 5JIKA 2BSRA 1NDMA 1UB6B 4H26A 4LNRB 2YZ1A 3WV0A 4UZGA 4XPFL 4YGVA 1JF1B 3ESVF 4O4YL 1IKNA 3EUUA 3L9RA 5A2FA 1UC6A 4KMQA 3RGVA 2KZWA 3B6SB 3CFKB 2NY0B 1BAFH 5IMKA 1TZGH 2C7UA 4E42B 3L3GB 1XR9B 2BERA 3O3DA 2D7TL 1KPRA 3F8UB 4LHUD 5HYQB 2BNQD 5MERB 4KRNA 3FOMA 1KLGB 2FJGB 4S10A 4HUKB 4IRZH 4MSWB 5T33L 2YZ8A 4UAOC 1FGNL 3F65A 1G6RB 3MRPB 1C5CL 1ZANH 5IJVB 1A2YB 3LSOB 4WWKA 5D1QB 1IL1B 1OCWH 1PDKA 1CXIA 5FUZH 3VFGL 2HG5A 4OF8A 1NMBL 2BVEA 2CIIB 2EKJA 5T1KB 2AQ1A 3D3VE 5HVHB 1OAKH 3S35H 2I60L 4LEOA 3WUWB 3PP3K 1QO3B 3TV3L 4ODSH 4OM0H 5IB5A 1ITCA 3BD4A 1VGEL 3IJSB 2RCSH 1BQHB 3M8OH 4N0CD 4PJ8A 3V6FA 3ARFC 3BH8A 1I9EA 1ND0A 2J88H 2ARJQ 1K9TA 3ZYZA 2XTJD 3IFOA 3C5JA 3T0EA 4XP6H 2GHWB 2XZCL 4YHIB 4QXTA 3D69A 5GS0H 4NBZB 4Y1AB 3H42L 3KPRD 2FD6H 4F7PA 1A2YA 2E27L 4WWKB 4I0PA 2PR4L 4YXKH 3TNMB 2HP4A 1CZ8L 5IJKC 3EYUH 2R23B 3LB6C 4TTDC 3HI6L 3PWVA 2P45B 1K8DA 1HXMA 4Z77B 1T5WB 4OUUA 5BRZA 2XZQH 4BFGA 4OZIA 4I0CC 4GW5A 3QCVL 3KXFD 3DV6B 1BBDH 4NQSA 1U93B 4M1DL 1H8SA 4GMTL 3HUJF 4ALAL 3EO1B 4CW1B 5HGAA 4HIJB 4G9FA 4OD2B 3U7WH 3MLXH 2XQBL 1KJMA 3OL2A 3L1OH 1NGXA 5JDSB 1IM9A 4H1LB 3NPZB 3EFFA 2JKXA 4XPTH 3CH1B 4OKVA 5K9OB 3KXFA 3G5VB 3U46B 4PBWD 3O9WC 4M7ZB 1UGNA 3P11L 4GRWF 2BHUA 4L9DA 1AH1A 4CL7A 1OPGH 1MHHB 1MREL 3SJVA 2V7HA 2A38A 2YUWA 3HE6B 2B5IB 1GYAA 5D93B 1YEIH 3ZE2F 1DBAH 4NO0D 3S36H 5FUCC 4YFLI 2FWOA 5CJ8A 1NBVL 4OF3A 3WN5A 4POYA 5HHPB 3VGGA 5HDBF 5KBNC 3G6AA 4IHOA 3SCMC 2WZPD 5GSVA 4XZUA 2K3TA 4Y19B 1C5BL 4HC1A 5SWZD 2IPUG 3GSVA 4FABL 1HHHA 4U6XB 2YD1A 3MOAH 1ZLWH 5D72L 4TUJB 3DHMA 1CD1B 3RPKA 1JF1A 1C5DB 5E8DL 4JZNA 4N5UA 5DD6B 5DHXB 4F57L 2NY1C 1Y6KR 3RHWK 2M26A 4XNZB 2ADFH 3OAUL 1DBJL 5C08E 3U82B 1OLLA 5DDHB 4KI5C 3ALXA 3HAEB 4JDVA 4K9EL 5GS1C 5SWSE 3BHBA 32C2A 4LVOC 4CN1A 2JJSC 2P8LB 1IKFL 4X4YB 3WJLA 3W0WD 2DMCA 3D87B 4JB9H 4JQIL 1MIEH 2XRAL 4ZUSB 5DYOB 3SDDC 4RIRB 2O5YL 1A3RH 2HVKB 5I1AA 2VNCA 3HFML 1S78D 1L7TL 4PJFB 4AM0B 1YPZA 2V6HA 3IU3A 2QQKL 1C5DA 4XRCA 5DSCA 4QNPF 2IMMA 2OQJA 4IOIB 4Y16A 2NY4D 1R6VA 3STLB 4K7PH 3V5DA 4PTTA 5FK9B 3QUMB 4XPGH 5IR1B 1AXTL 4PGDB 4JCMA 4LCUB 2X4NB 1T21B 1FAKT 1ACZA 2DLGA 4KMTH 4TYUA 3N9GH 4LPUA 1NEZG 2BJMH 2XPGA 5C0FB 4PJIB 1FNGA 2GFBA 2FB4L 3VJ6A 3FO9B 4EDWH 2HKFH 5ALBH 4QHKI 4Q6IA 2R0LH 4WHYH 4QHLB 2IAMC 4OZFG 3T1FB 3QAZC 1ZT7B 4NO3B 1PBYA 4OSUL 5SX5H 4CU7A 4WW1B 5IVZB 1FZKB 4WU5B 1I9JL 1ZT1A 1EO8H 4ONHB 4UAOB 5FKPB 3SKNB 3X12A 4ELMA 1AXTH 1G7IB 1RJLB 5K9KB 1KN4H 2F53A 1PVHA 3CPLA 5D7IF 1IMHC 1NBYA 4TVSa 1T20A 1RQ5A 3VXQA 1BVKA 1CGYA 2J4WL 5F1IA 4X6EA 2AJUL 3MRDA 3QUXD 4HBCL 3PNWA 5GSRA 2H8PB 4BUHA 3PUCA 1GZPB 3RA7H 4Q2ZA 4FFVD 5GGRB 1S9XA 3OXRA 4XH2B 1WBXB 4GS7B 2E7LA 1K4DA 4ZG1A 3UYRL 4ZTPL 2VISB 4I4WB 4NHUA 3CC5B 3N0PB 3QI9A 5I19H 3U7YH 1GPOL 5L6YL 3PABA 4K2UL 4EUPG 4DZBA 1HSBA 5C0BA 1TTGA 1WEJL 4DK3A 5IVOA 4HH9A 5I1IL 4LQFH 4WGWB 1U36A 4QT5B 1JGUL 3O6KH 4NKOB 1FGVH 1MQKL 3SY0B 1MJUH 3MBEA 3O11B 3WHXB 3DX6B 1J7VR 3L5WB 4QF1B 3QULA 2RHEA 5BVPH 5B21A 3QI9C 1E6JH 1G0DA 3LQAH 3PWPA 4Z7NF 3VXOB 3WS3A 1N8ZA 2DBLL 4Y4KA 5EBWB 2DYPA 3H9ZA 3UO1H 3FT3A 2ILLA 4E41D 3D2UD 5I1CH 1JPTL 4I3GA 4M6ML 1YEHL 4F58H 1R0AH 4GXUN 1I8MA 3DROB 4RMVA 2XWJB 4Q97A 4NWTL 4OIBA 1FVCA 1QSEA 3WO3B 3R06A 1YPZF 4WV1B 4JGJA 2IWGA 4OLYH 3RDTD 4MAYB 1FL3A 3ESUF 4MA1C 4UT6H 2IF7A 4PLJC 1K8IB 3MRQB 3VXSE 5KSVB 1MFBH 4M4RA 3R4DA 2CDEA 4O9HL 4NZTL 1MCOL 2YSSA 3BXNA 3VD9A 1CL7L 2H2PC 1HSAB 5IMLA 1IAIH 1F00I 3SE4C 4M03A 4P48A 5KN5B 2F74B 4ZYKA 4ZFZA 2NY3D 2DTMH 2EYTB 4ZDHB 1RZ7H 3O4LE 3T4AB 5T1KD 4OZ4A 1KYOJ 1GVIA 4XPBL 4YAQB 3MROB 2VDML 4ONFH 3TPUB 3VDBA 5EOCJ 3STLA 1CDBA 2DAVA 1L6XA 1VSCA 3SCMB 2LV4A 3B9KC 4QRUB 3U48A 1B6UA 4ENEC 4DFIA 1RJZB 2CUHA 2F53D 2QR0B 1F8TL 2VH5L 3ROLA 4HK3N 1I3VA 3U1SH 4PRIA 2HT2C 4D9QE 5KVGL 4L4TB 3VGFA 1FNFA 4RQQB 4OUOA 4UTBH 2JCCE 3QUXA 4WO4C 1F4AA 2YRZA 5CBAA 4HUXB 3RVWD 4BYHA 3MCG1 3ZHLA 1S7VB 1FHGA 1T4KB 5E6ID 4LFHG 4JZJA 5D7IB 5IG7B 4H8WL 3KPSB 3VFUA 3WDIA 2Y23A 1G7QA 1J8KA 1I1AB 4ZNCD 3EYSL 2ICWI 1JMZA 1T03H 1EGJL 4NCC1 4PYHA 1F4XH 4MJ6A 3IFLH 4UILH 4YK4C 2IPUK 3GK8L 4PJ8D 5JLZB 1KULA 1D5BA 1FZMA 2MSPA 4H20H 4LF3A 2YA1A 4OFPA 4U1LA 5C0EA 4M6NL 3LEVH 3QXTA 3VD4A 2JK5A 2FCBA 3L3JB 4M5ZH 2OP4L 5IW1A 3ULVC 4TOYH 4U1GC 4QHNA 4FQQB 3I50L 5E7BA 3UEZA 5LGKA 1F4HA 1DZBA 3T8XA 4LSPH 3PHOA 4KKAD 2NXYD 2WBJD 4OLUL 1KNOB 1INDH 5D5MB 5HGHB 1OARH 1IGMH 5DFVC 1QR1A 3SGEI 1G7HB 12E8H 2W0FA 3OJDA 1CLYL 5FKAB 5ISZE 3OX8B 1XGTA 2WMPA 2HJFB 3KYNA 2HTKD 2C1OA 1R3JA 5GRUL 2XZCH 3IDNB 2QSCL 2CQVA 3OR6B 5KVDL 1GOHA 1CE6A 4X6CB 5E94B 1AFVH 4LSPL 2R0WH 1X5YA 4PP1D 5FYKU 3NA9L 1CFVL 1KFAL 2A6KB 4MAYC 5J6GB 1NEZA 3R0NA 4H0GA 1T5WA 4OUUB 4RMUA 3T2NH 1BHGA 4XNQA 4LU5L 4WI3A 1A1MA 4GAYB 2CJUL 3T0WA 2Q7YA 4JFXB 1JGVH 1D7FA 2AJVH 4H8WC 4WNQB 3MLWL 5E1HB 1X44A 2XKNB 5BS0B 4KZEH 1LD9B 1V3MA 1IEAB 1F3DH 3L1OL 4PGEB 3KNBB 3S7GA 3OR6A 1K6QL 1P5UA 2RBLA 1ZVYA 1GC1H 5C0CA 2JIXD 4OTXH 4R7NB 4R90H 3EOBA 3ZT7A 3G5XB 5LGJA 4PRBA 1EEUA 1R3LA 2C9AA 1RIVL 3L3OA 5D71H 2P46B 5CJBA 4X4XA 3U6RA 5IT2H 4GAJH 4QEGA 4O4YH 5J7CC 5CCKH 4NBYB 3VDCA 3SKUD 2P5WE 5CZXC 1LO2H 2OR7A 1BQSA 2GSIA 2D9CA 1CQYA 3CFDA 5FGSA 5KSAA 3UDWA 1R3KA 1RIHL 1BZ9B 3L3HB 3GBML 3VI3E 4X6DE 1QQDB 1OTUC 3GJEA 7FABH 4I5BA 3VFTA 3TBWB 2FL5B 4FQXD 2V9TA 3PWJB 4JO4L 3Q1SL 2APWA 2A6JA 4RFNB 4YHNB 4LAQH 1NMBH 4YIQB 3MRHB 4UU9A 4Y4KC 3NA9H 1HYRC 2YS4A 4AIOA 4FQXA 3PHQA 5I6XB 5HSFA 3K0WA 1T3FB 1KJ2A 2DJSA 5D1XB 1JL8A 4Z95H 4L29B 2X9XA 1XCTA 1FFNB 3LQZB 3MJ8B 1G9ML 3HPJA 5GSVB 1PJ9A 4LBEB 3H7BA 1G9EA 4R2GD 1AO7A 3GSVB 3HZVA 4NZRH 1W0YT 3MO1B 2PN5A 3MOQA 3BD5A 4X7TA 1K6QH 1FG2A 4DN4L 2LQRA 3PDDA 4N1EA 2JLLA 2XOTA 3VGBA 3CDGB 2FNBA 2N1KA 4PREB 1LK3L 4NNPH 2I5YL 3H9SD 4KK6D 2XY1A 4XPAH 4EI5B 3M1BB 4HQQH 5FYKD 5BRZE 4OGXH 1T1XB 4OZGA 1Q8MA 2X4UB 1JWUB 3HAEA 4JDVB 3V5DB 5IR1A 3QO0A 4ZFOA 3CU7A 1J10A 1KV3A 1VFOA 1F2XK 3FB5A 1LNUA 3MSPA 4S11A 4MS8C 4P5KB 1JNLH 3OAYK 4DGIL 4NO5A 3LQZA 4JFZH 5I66A 3TF7C 5BO1H 1U0QA 3NIGE 5JIHA 1I1YA 2AK1H 4P4KC 2HJLA 1NGZB 1JVKA 4JQIH 5HI3D 3QXAA 3AROA 4IRJB 4Y16C 2O5ZL 1IARB 2XV6B 4C54A 5IJKA 3CDGA 3HFMH 4OV5B 3M17A 4KI1A 3ARBB 4XPAL 5IM7A 1OM3L 3FO2B 1IGTB 1KENH 4EQ3A 4OCSH 5GRZA 4N8VA 2XTJE 5L7XH 2NY6C 4G6FD 4JN2A 4JDZA 1CD9B 1MLBB 3BDXA 2EXYD 3VWJC 5ERWB 5FGRA 3O41B 1NCWH 2ADFL 4GOSA 2E6JA 4EBQL 3PNWB 3OKEB 3L6FA 1GIGH 5DJAA 4O00A 5FOBA 1ZVHA 3P0VH 3KJ4C 4U6HB 1MHEA 5CJOL 1RIUL 4PLKC 4FMFA 2UY7A 3U4BL 5FGBA 3TJEH 1OM3H 1IC7L 4XMPH 2R39A 2AJZB 5K9KA 5AZ2H 3HI6H 3JZ7A 2LFGA 5TDNA 2HLFD 4D8PA 4ZOAA 1BIIB 4P9MH 5E5UB 2ICWJ 3WUWG 1QQDA 3D39D 1NCWL 1KPUB 5I0ZA 5ERWA 1ETZA 4P46B 2EC9U 5B3NA 3Q48A 1XCQA 4HWZB 5MEQB 1JFQH 5IBTL 1QLRB 4PJIF 1MHPL 3UBXA 3MV9E 4CBPA 4HUVA 3K2MC 3OXRB 4TSAL 4XH2A 5D7JC 4QRPB 2IFFH 3C6SA 5DJCA 4ZXBC 3GEWB 3S34H 2HKHH 2LU3A 4YDKL 1OSZB 3LRSA 5ACZB 3E6FA 5F1OB 1E28A 1ULVA 1YN7A 3QDGD 1MH5A 5CIPA 5KAQG 1LK2B 5ESVA 3DGCR 4HEPG 4OIIH 2YEZA 1GPOH 4X0KB 3HMWL 1YMHB 3W11C 2IAMA 1QRKA 2Y1VA 1KF9B 4OZGF 2VDLH 5T1LB 1OY3B 3G6JA 5ITBH 1J1PH 4DKEL 2NLJA 1T7YA 2AABH 3ULUH 4KDTC 1JK8B 3KWWB 3EDDA 3PGCB 4ELMF 4WI2A 3OGOE 4JREC 4PRPB 3WIHL 1OAYL 5KN5A 3FO0H 5F89B 2YD6A 4L3CB 2ZP0T 5HYIA 4HZAA 2KPNA 1JTTA 2GSGB 5BQ7B 4DQOH 2NY2C 4PREA 5EORL 5B8CB 5DURB 1U8OB 4TQEL 4FP8L 3CIQA 4XAWL 4J2XA 3IF1B 3FT2A 2EKSA 5C07E 1RJZA 2WIMA 3O45A 1AXSA 1EZVX 2CD0A 2FJHB 2FR4A 4JFDE 1HCFX 4KUZH 2NNAA 5IGXH 5J0BA 4M62H 1G0YR 2ADIB 5SWZE 3Q6FB 2VE6B 3NACL 3CK0H 3MCLH 4N8CH 2APFA 1AQKH 3ARWA 4I0PC 3SO3C 2HKHL 4P3WA 2FX8L 1PQZB 4Z7NE 4GW1B 1BFOB 1BEYH 2VL5B 5IHZA 5D7LE 4X5LA 4M8QB 3NGBC 4BZ2L 2FLBT 1A3LH 4WTWA 3RVUD 4MA8H 3O2DL 4JFOA 3VI3F 1JZ4A 1G7PA 2HVJA 4Y0GA 1X3DA 2HLAA 5I1GL 2AERT 1CYGA 1VCAA 3HS0A 1TNMA 1MUJA 3QEUA 4ZUTB 3ULUL 4ZUVB 1UWGL 4XPGL 2ESVE 4QOKB 5EO9A 4P5TB 1TVBA 3O6ML 4L5FH 3WLBB 4JR9L 4ZOEA 4YHML 1U3HC 3QDHA 2D7OA 2OTWB 1FYHB 4ZTPH 4PJXE 2R2EB 1VB9A 5A2JH 4Y4HC 4KDTA 4U3CA 2W0FB 1CLZL 1QPPA 4X9IA 5ADOL 5E6IA 4LVOB 2PYFA 2LABA 5L88H 1P4LA 3BZFB 4PRHD 1KIRA 3IXTA 4P4KA 5DD0L 3WLWC 3HRZB 1JYVA 5IMMB 3RU8L 1LEIA 3P9LB 4TVPE 1JHTA 3MRMA 5J56B 4YO0A 2VXTH 1VEMA 4WUUE 4R9HA 4R0LB 5ADPH 3QNZB 1CFVH 3RVXC 5E8PB 4D0DB 5F7DB 3QUKA 1CLOH 1MFDH 3AY4A 4ELMB 4HS8L 2IAND 5IB3B 4XI5C 4LGSB 3QHZH 1A3QA 2MQ3A 3TFKC 5F7EL 4NWTH 1TCRB 3VFWB 3WE6A 3HNVH 1XGTB 4JAMB 2V17L 3SKMA 4NC0B 4YDLB 1IGYA 1CDHA 3GSUB 3S5LB 3ZYJA 1MCFA 4IDLA 3OZ9H 4NQDD 1G6RA 2HRLA 3FQWA 1EJOH 3MTRA 5LWYH 3AXLA 3VFSB 3DX9B 1I9IH 5JHDB 3HRZA 3QJHA 3EBAA 1LQSR 2D0GA 2HG5B 3AREC 4NHUB 3UJIL 3AM8A 1D5ZB 3BFOA 1D6VH 2QEJA 1DQQA 4N8VG 3PWLA 1T7ZA 2CLZA 5EWIH 5C6TH 1YY9C 3WEXB 4K8RD 3SGKA 3VFNA 4PRDA 3K4DA 4POUB 3ARQA 5LVEA 3A0OA 3HUJA 3QAZB 2NTFB 2BX5A 4QGYA 5C0IA 2C7UB 2BVOA 4P2OB 5DZLA 2XQYG 3T2NL 2R0ZL 4P23B 1I4FA 3NCBB 3GSNA 4MD0B 1CCZA 4IS6B 3LY6A 4WWID 5A2LH 4NKMA 2UWEA 5EU7E 2NR6D 3GHBH 4JZOA 4WW2C 5HHMD 1UEYA 3MBED 3LEXA 4QCIB 4OD3H 4X9HA 2YWYA 2R23A 3I6GA 1AHWB 3A6CL 4NZTH 1IBGH 4YHNA 1A7NH 3QQ3B 1BFOA 4NN7C 4ZFOL 4FTVD 3JWOH 3RTQB 3VXUE 4YFEA 2YPLE 3ARBD 1BPVA 1IC4H 1AFVL 1FVDB 1S9VA 1KT2B 2BVYA 1CLOL 3CGTA 3GMMA 2VDRH 3MCKB 1OGAD 4PJGA 1KJ3H 2Q76B 3BH8B 5EZIH 3STBA 4DK6A 3L3HA 3HR5B 5F7EH 3ZSSA 3BZEB 5BZDB 2ZSWA 4PJXB 2P8PA 2N7AA 1LO0L 5I8OL 2V5SA 4NC1E 4OIAA 3Q0HA 4ZTOH 2L7UA 4M5YH 3ILQD 3U46A 3IDYB 5FO7A 5C0DB 3UAJD 3VXPB 2Y7QB 3A6CH 3EYVB 3B9KA 3RI5F 3O2VL 4KZDH 4KXZH 4DZ8B 1NUNB 2FEEL 5E1AA 3JSSA 3REWB 1J8HE 3BO8A 1YUHB 1DBKL 3QXWA 2DWDA 3BMVA 3C8DA 4MJIE 3V0AC 2Y25A 5EOQL 3EDKA 2BVQA 2I9LB 4X6CE 3HZMB 1JWMA 1H3UA 1KTDA 1O7SA 4YHLL 4Z5RB 5T1DL 2Q86A 1KOAA 2X1WL 3EHBC 4YGAB 4NCDA 4IMLB 1JV5B 4S1DC 5J12B 1RAMA 5HI4D 4KRPC 3FRUB 5IFJB 4Z0BH 3S88H 2UUDH 4KI5F 4PJAA 2P8MB 3UZEA 3BIKB 3C08H 4PJEB 1BF8A 4ODVH 4WHCA 2KH2B 1IAII 4YXLL 2XN9D 3MXWH 3SGJA 3LH2L 4EN3A 3VXME 3TEUA 3FKUS 4I18B 4HIXH 3RX7A 1CXLA 3BPCA 2W9LA 2BC4A 5JW3H 5IKCB 4YHZH 4LLQA 3E8UL 3RWHA 5IB2A 1OAZH 5I74C 3UMTA 4YHLH 1MVFA 5INCB 1NGQL 3G08B 2OXGA 3GMNB 1CD0A 2JELL 4JG0H 2CDGB 2I26N 5TE4L 2FBJH 3VWKD 4JFPB 4FG6D 4FXGB 2V9QA 4QHKJ 3MUJA 3Q1SH 1NGXB 1GOGA 2C5DC 5K9OA 3KPLA 5DUPH 3SDAA 4OTXL 1BZQK 1QFOA 3VGEA 5D1ZA 3ORJA 1GH7A 4P2RD 3BPCB 3ZYIA 1K3ZA 5C7XH 3VCLB 2VLLA 2HJFA 1DP0A 3BGFB 3V4UL 4ZFGH 1P69B 1QSEE 3MGAA 4M7LH 4K8RH 3H9HB 1FL5A 3OKEA 1XEDA 3UJTL 5DJAB 2AXFA 4YEFA 5HD8D 1PG7W 3GBMH 1R5IB 1U8NB 4KGLA 4PGBA 1HZHL 1D6EB 3MV9B 3BWAA 1YEJH 4WFED 4JO1L 1IAOB 4XPHL 1F42A 2V2XA 1A8JH 3RWDA 4YDLC 3L3GA 5CJQH 1I3RB 4OZFA 5E7FA 5KTEH 3D1MC 1NFIA 2GCYB 1PYWA 4YBHA 2E9JA 3OAYH 3LOWA 1A1OB 1RIVH 1ZS8B 3FFCA 4P9ML 2Y06L 2BOBA 4NO2B 1S7WB 4U3XA 1JNHB 5DTFA 4Z7WB 1P84K 1DN0A 3QEQB 4R8WH 2FX9L 1IFHH 3GIZL 3C2AH 3BWAB 3D6GA 4I3SH 3EDJA 5IW6B 5EORH 1GXEA 4WFGE 5ICYA 5GJSH 1CBVL 5I1AB 4M3JA 4H25B 4EUPA 1A3RL 2EO9A 1JTPA 3ARTA 3DYOA 3CLFL 3CZFB 4WW2B 4GMSH 4RGNB 2P4AB 3C5JB 1T04A 2FEDC 1MCPH 2X4TB 4KQ4L 4NN5C 1ZEAH 3B2VH 3LKRB 4IRSC 3MJ9A 4PRHB 1S7TA 3RAJH 1HILB 4M7LL 5E6ZA 2FGZA 3VXMA 5TQ0L 3DARA 1FH5L 2X7LB 2P44B 5C8JA 5CD3A 4FQPA 4PTUB 3O3AA 4FA8A 1TDQA 5BS0D 5J1AB 4OAWA 1QLFA 3C5ZA 1S9KC 4IOFD 2J7LA 1T3FA 3N1MC 5FF6B 4M02A 2UZYB 5C0JA 3IAGC 2HKFL 3BJLA 4JCLA 2ED7A 3QCTL 2AS5M 1A9EB 5AWNH 5K33A 1NGYB 1W0WB 4X99B 2APVA 1P53A 3OKOB 3QJFB 4OCSL 3ZE0E 4FQJL 2GK0A 3HZVB 1U8HA 1S7SA 5K9QG 4XT1C 2BNUA 2W60A 3OGCB 2QKIB 4HUMB 2EDOA 1C12B 4EZMA 5T3ZL 2AKRB 1AIFB 3CJJA 3O6MH 1TZIB 5KVEL 1K4CB 4JFZL 3X14B 1F90L 3DSFL 2ZOLA 3VI4E 5LXGH 4YNYA 4JR9H 4NM4H 2VQUA 1T1WA 2AJUH 2WLYA 4YXHH 4G6KH 2O93L 2D31B 1F4YH 1HXYA 4HWBL 4MJIA 3MV8E 2V9RA 4W4NA 1GGTA 2YR3A 5I1CL 1NH6A 1DEEB 1UACH 3ARRA 4JVWA 2VDQL 1X7QA 4HXBH 1NCTA 4FQJH 2A6DA 4G5ZH 4UB0H 2NXZD 3NFNB 1K5NA 5IHBA 4GW5B 4OLYL 3LVEA 3KYMA 1IGJB 2WQRA 5D1XD 3WJJA 4JN1H 3MBEB 1DFBH 3WFHA 3WCYA 1TXKA 2KZ1B 4FTVB 4UDUA 5LQBL 3DV4A 4RX4A 5FA3B 1NKOA 3O8XD 5AAWA 1KC5H 1KACB 1SYVB 3OHXA 4N1CA 5AEAA 3SDAC 4F7CB 4X9FA 2C3WA 4PGCA 1RK1A 3UXFA 5KSBA 2DKSA 3MRIB 2HMID 3BPNB 1PG7X 4HJ0C 1NAMB 1JHTB 3IETA 1NMAL 4NQEE 5ITBL 5CKAA 1N59A 1PLGL 4O02H 3GSRB 4PJDA 5F7UA 2NX5D 5I1GH 2VZ1A 2W0KA 1FDLH 1VDGA 4WHTA 1D5ZA 3TJHD 5HYJA 3WFHB 1IQDB 3QG7H 3PXHA 1JUFA 3WEXA 5BV7C 2QSTA 4ZNEE 1F90H 4NOFA 1MCOH 2NTSP 2Y36H 3KJ6H 5CUSH 2AJ3A 4QWWC 2FX8H 1NFDF 3KLAA 3QEGL 2PYEA 3L5IA 1A6WL 3U36B 5CAYB 1DANT 1MFDL 4PP2B 4Y8DC 4QNPE 1LO5B 3JWDH 4WUKL 1KXVC 2YPLB 1UADC 1XGPB 3DECA 4N0UA 3LZFL 4P2QA 2H26B 2NY0D 4FZ8L 3C6LC 4NDMB 1X4ZA 1CE6B 1WJ3A 3LS4L 4K71C 4X6CA 1WWCA 4OM1H 5FYKE 4LLMB 3PDOB 2ZNXA 5BMFL 3QIWB 1ZT7A 2YBRA 4R3SB 1BOYA 3DYMA 1RUAH 3ZKNC 4CN4A 1VKXA 3BH9B 3GMRB 4P99A 1X5AA 5H94B 2AJ3B 3FN0L 5J9PB 1NANI 4Y19A 3EDFA 1A1MB 1A6WH 3LQAC 4LKCA 5D1QD 5FYJH 5H8DA 5MI0B 4KKBC 4DQOL 2XNAA 4JZJB 5D7IA 4M7JH 2CR3A 5MERA 4UV7L 1KLGA 2FJGA 1S7SB 2WWMD 3I3BA 3AU1A 3O9WA 4XXDA 3X13B 3OAZK 4Q2ZB 5DD5H 3P77A 3D0VA 3I02A 5I8OH 1R5VB 1YN6A 5FYJD 1INEH 1J86A 4DVRL 1RURL 5JIIA 5E2VH 4DEPB 4D0BB 3LN4B 5DD0H 5HHXH 4PR5A 4CADB 5GRYA 2EC9T 3IXAA 4KKLD 3O4LA 3IFPA 3T3ME 4LSSH 4GRMA 4U7SA 1A4KA 4WY7H 4UIKL 2X42A 4CVZB 4U1HA 5CMAA 2GIYA 4XCYB 2RAMA 2R1YA 3WL9A 2V2TB 4TNVK 1CGXA 2BY0A 3TBYA 3BZEA 4OLXH 3W9EA 4XPBH 3CDFA 5EC1A 3TH2T 1CE1L 3IGAA 5SX4H 3OV6A 1EBAA 1UM4H 5GPRA 2V7NB 4OLVL 1INDL 2P24A 5E2VL 5C0BE 1YN6B 4YDIH 4JREB 3VWKA 4MX7B 3KPPA 3OKMA 3O3DB 1YECH 2OBGA 4LRIC 1TFHA 3V2AR 3R8QA 1MFBL 1SVZA 5C07D 2OL3A 2DB8A 1E0OB 3BSZH 3VH8B 4U1HB 3L95B 3UC0H 1K4DB 2IQ9H 4P2RA 3SBWA 5KVDH 4HGWB 3BDBA 3C8KA 1LDPL 1KCSH 1X9QA 1RK0B 1ZLVK 5FB8B 1KXTB 4HHAA 3QEHA 3LN9A 1T83C 2W92A 3PP3H 4Z7VF 3P4MB 1YEDA 2DQCH 2A9NL 3HC0A 1WAAA 3RUGA 4L3EE 2DS4A 4NO0B 1UXWB 4FQIL 1ITBB 5D2NA 3ZL4L 4OM0L 1HDMB 5FKPA 4OQ1A 3GMQA 3L5WA 4XNYH 2FGWH 3PL6D 5C6WH 2XKNA 3AMLA 2H2SC 5IESL 1P1ZA 5CZVL 2A0LC 5F9WB 4UIMB 5KG9B 3RBSA 3ISWA 4WHYG 4UTBL 4Y19D 3D85A 4TOYL 5F9OL 3NGBB 1QBMH 2IQAA 3VFOA 1FYTA 2CK2A 5GGRA 5IF0B 4XVTL 4XCNA 1FNEB 5AG9A 3NABH 4IDJL 3KLHD 1R3LB 1F58L 2GQHA 4TUOB 1FL5B 4RFOH 2R29L 4F9LA 4K8RL 1JPSH 3OG4B 2Z91B 3V7AE 3CNKA 1O5DT 5LG1A 2X5PA 1I8IA 4ZTOL 1MEXH 2CKBH 3MLZH 1NDGA 3V4PH 2MCPL 4RFEA 5JPNB 3QNZA 3BP7A 3HZKA 2BY1A 5MI0C 3GRWA 1MY7A 3TIEB 4QF1A 5D5ME 1BIHA 3MA9L 3SDAB 4PS4H 7FABL 1P7KB 3FQXA 3O6LL 5IW3A 1QBLL 1P1ZB 1R5WA 4B5EA 4Z0BL 1MCSA 1BWWA 5SV4A 4LSTH 4X5XA 1VEOA 4JN2B 3ULUD 1DBKH 1EVTC 3UTQA 2R0KL 3S5LA 5B3JF 4PG2A 1QSVA 4X6DA 4ZSOA 2PW2B 4J1UA 3MRJA 1C5CH 3EDEA 4HS6B 3FOLB 3NIDF 3H9SA 2NMSA 4FQQA 2X6MA 3FQNA 4UI2A 5EB9A 1MFEL 1S9YB 1YYMH 2X2YA 3TO2B 5GHWH 3S98A 5SWSD 5JW4N 4YDJB 4Y88A 4OZFH 5FECA 1MHCB 3MNWA 5D8JL 4HKXA 4OCRL 1L6ZA 1P4BL 2PXYD 2X4PA 2A1WL 4JPVL 3GI9H 2VR4A 1GCFA 5IG7A 2G5RA 3MLRH 3RZCD 2VAAB 5B39B 3FO1B 2VJXA 3DVNA 4ZD3L 4CMMB 3ROOB 3LKRA 1OAZL 2BRRL 5B4MD 1U8KB 4ORGB 3MODL 4JFEE 4OJFL 3KPPB 4BFIA 1DQJB 2VDRL 2ICEA 2NXZB 3PWNA 4HK0A 5JDJA 4NYLB 3C60A 5DDHA 3T0EE 1YC7A 3LQMA 3JVGC 5F88B 4MZ3A 4X6FA 4LLYA 3L9RB 3H3PL 3KYOA 5E00B 2X44D 1CR9H 3B6SA 3CFKA 2JB6B 4LARL 4XWGH 4RQQA 1YEFH 3EOAA 1IGIL 4XNMB 4B0MM 5C0GA 1JYNA 2EDKA 3S9DB 4HKJB 4LHQB 3SKNA 2X4PB 2VZSA 1TZHB 3OKNB 5F3HA 2Q8BH 2ZSWB 4PJXA 4F15C 4P2OC 5GJSL 1J0JA 3VMOA 5DEFB 2VXUH 4POZD 2WP3O 4XPTL 3DETD 5D9SB 1OLZA 2A77H 3H2WA 3MYJB 3O6FB 4TN9A 3ARFD 4DKAA 3QUYC 1XIWC 2CXGA 1J88A 5GGRY 4LOUC 1UENA 2ICEB 1EEZA 4OGAD 4UV4H 3CLEH 5CCKL 3BHBB 2NYYC 2R1WA 3QQ9C 35C8H 4M61A 4RRPG 1F3JB 5MENB 4X4YA 2ED8A 5GGVY 4CVXB 5FF6A 1B88A 2V2WB 5C0BB 1EFXA 4UUJA 3NCJL 1I7RA 1T0NB 3EO0A 3C08L 2OCFD 3C6LA 4YR6B 1HQ4B 1I3GL 5JXEA 3HLAA 3VG0L 2HYMA 5GRJL 4DCQB 4E41B 1A14H 3BWUC 5IFHH 4YHIA 1A1NB 4XRCB 4GKSB 3TIDB 5DRXB 3RNQA 3FFCE 5KSBE 4WFHD 2VXVH 4PB0L 2BMKB 2DMBA 5DQJB 2Q8AL 1OGAB 2G5BB 1XGQA 4TSBH 1A6TB 2SEBA 1M05B 3MR9A 1EO5A 3UJTH 1V8HA 4Y4FA 1EFQA 5IHLB 4OCWL 1SYSB 1F3JA 1KCRH 2OX5A 4PBXA 4Y8AA 4ZSOE 3KNBA 4JFFE 1D5XB 1FIEA 1NGWA 1YYLL 1XGYL 4JPKL 4XP1L 4Z7UA 5KSVA 2FB4H 1TPXB 4ZPTA 3GMNA 2YWZA 2FO4B 5DGQA 4BA8A 1H5BB 5L6YH 4QXGL 1V7NL 5F7HA 3JWNC 4XVSH 3CCHB 1HYSC 3QT2A 3SCMD 5J12C 5F9WC 2DIJA 4C4KO 3SQOL 1Q1JH 1NBYB 1PLGH 1WIPA 4YZFE 5DFWH 3EFDL 4DN3H 5CP7B 3MFFB 4BUGA 3F5WB 2F19L 2IALB 1YY8B 1MCIA 5D1ZB 1OQXA 1UB5A 1A64A 1V3JA 5E8OB 4TSCH 5JOFA 4LAJH 1LO3H 2O5YH 5I71C 3F12B 4PJ9C 3A67L 5E6IB 4P2RE 1CXFA 5EU6D 1BEYL 4KI5D 1MRFL 3UROR 1NJ9B 4WTXA 1IC7H 1BOGB 3O3EB 4L3EB 3RI5K 1A3LL 1AP2A 1XF5A 1HKLH 3C9NA 1A7RL 2Z9TA 4YC2B 4L3AA 2MPAL 5HYSB 5ISZD 4Z6AT 4PJ8B 3SDDD 4JY6B 4P0DA 1JZ2A 3IVKB 4UB0L 5FM8A 4KJWC 3GI8L 3IDJB 3BP6B 3F5WA 1EO8L 1FH5H 1J0ZA 4LPTA 1PYWB 2YN3A 5E95B 3O6FC 5JLZA 2BSSA 4K3DL 4ELKB 2YPVL 2ZJSH 1ZGLA 3O41A 3VFPA 2MMXA 4RBPH 3I6LD 3DXAB 3D3VA 1QTYT 2CRZA 5GGTH 1ONQA 2FECL 5JTWA 4DGVH 5IROC 3QYCA 2ENSA 4M8QA 4BQ6A 3QO0B 4ZFOB 1EHXA 2AV1B 4FQLL 4UNUA 1FFOB 4J3UA 3G6DH 1XR8A 1VFAB 3UTPD 4CVXA 2ITCA 2BY3A 1BWMA 1DN2A 1ZGLM 4Z78B 2A74B 5DQDL 2VZOA 4PTTB 4AENA 3IYLW 2HJLB 1WBZB 1AO7B 4LKCB 1G7JA 3HG1D 1EAJA 1TLKA 5DRNB 3MO1A 1OP3H 2YMXH 4NM4L 1MAKA 4GUPA 2DBJA 5JNYA 1A7OH 3CVHH 1PG7L 4KHTH 1RU9L 4MHHI 4M7JL 1CGSH 5D6CB 1J0YA 2F8OA 4AIZB 2DLIA 4WVRA 1JN6A 2BNQA 1MLBA 3HI1B 3NMEA 5KOMC 4F9PC 4RGOH 3QUXC 2BXYA 5ACZA 3O6KL 4RDQG 1XR8B 2EDBA 2HFGL 1JPST 2YC1A 4PRDB 4PRAB 5HHXL 4QXWA 5L88L 5DQDH 4LCYB 3WIHA 1I9IL 4LDLB 1KXQE 2KKQA 4A6YH 3L3JA 4JQXC 4E42A 1FNSH 2F58H 2P49B 4UDTA 4HPYL 4RISH 3V6BR 3G6JF 1ZA3B 3ILPB 3MUGB 5C2UB 1LDPH 4G7YH 4NM8L 1FVEB 3LMJH 2VKXA 4F7EB 3WD5L 4IRSB 2XWTB 1E4XI 5LBSL 5SWZB 4AL8L 1HH6A 3FB7A 3T0BA 1QSZA 1QKZL 1QUNA 5E70A 5C0RH 1S3KH 4RGND 3MFFA 3WKNA 5D2LB 1P2CA 3SKOB 1UJ3A 4UNTA 4W6WB 5ALCH 1IEBB 2G60H 1M71A 3MQIA 1OGTB 1RV6X 1MCJA 2GUOA 4C56A 1HH9B 1CXEA 2VZUA 5KS9A 1DQQB 5K59F 1REIA 5C09D 1C1EH 5EWIL 4LVNC 4JRYA 3OAZH 1E4XH 1FE8H 4RRPA 5IQ9A 1RFDH 2A6IA 5DA0B 3D69B 2FX7L 3B2UD 4RNRA 4PFEA 3P30L 3P73A 4OD1H 1PX4A 4LCWD 3GMQB 1CLZH 1RSFA 5HPOA 2XWJA 4RFEB 5JPNA 5EN2B 3UTTE 3QEQE 3T2OA 1DSFL 2DQDH 4X4XB 1R3JB 3QFJB 1MRCH 4LK4A 1IEAA 2UYLB 1Z5LB 4GXVH 4X8JA 3KYKH 5DHYB 4PGCB 1B90A 4DUXA 2CIIA 3OXSA 4KJYA 2YSSB 1OTSC 1H3XA 3B9KD 1DVFA 2VB5A 3WDJA 2R2HA 3LMJL 1D9KC 2X9WA 1HHIA 1EHLH 3OKKA 1FZOB 1KCSL 1WCBA 3CFJB 4KVNH 5GS0C 3BP7B 1GGBH 1XGRB 4WUUD 5DMIL 1JZ6A 3PWPE 4OLUH 2DMKA 3RVWC 4TVPD 4IM8A 3T0EB 4WWKC 2RGSA 1P7KA 3FQXB 5MEND 4J3TA 4FQHB 4KKCD 4JFHE 1PKQE 2Z31D 5DMKA 3MYZA 2GYSA 1A22B 4LSQL 4HKBB 3PF2A 5D8JH 2BFVH 3ROLB 1QA9A 3EYVA 3BKML 1AD0A 4RMSA 1JHKH 4FFZL 4LEOB 5HI5C 4LVHC 4LLDB 1L0QA 4PJ8C 2K1MA 5E9DD 5JQHC 3P9LA 1V7ML 1YNKH 4H88L 4HS8H 2BVQB 2X89A 1UA6L 3EZ8A 3MRFB 2R29H 2Q86B 4EI5A 43CAA 1NANH 1QZ1A 2UVEA 3LD8B 2OSLB 4RWYL 3EYFA 2C4FT 3TBWA 5L8JB 1RIHH 4GRLB 2N56A 2Z92B 4G8FB 3QIBD 3DVNB 4OCRH 5I73C 3MJ6A 2P5EA 1ED3A 3PP4L 3O81A 5KS9F 4PJGE 4QRPE 5J3HD 2E9BA 1N4XH 4GG8A 3FHAA 2V5TA 4HKZA 3NBNA 3BI9X 4NO2A 3FT4B 2HTKC 5DR5L 1JYXA 3GSWB 3QWRD 4W4OC 4X6DF 3TN0A 2WWKO 5FUZL 3VFGH 1SVCP 5JW3L 4P5KA 4OQTH 3WXVH 1XZ0B 1P4IL 3CFBB 3MV7E 4NWUH 1HEZB 5C0GB 5C0IB 1IGFH 4Z7QE 2OMNA 1VFUA 1HSAA 4XP5H 4C56B 1NCCL 5T5FL 1DLHA 5CD5C 1FG2B 2D7MA 2VAJA 3VFMB 5EC1B 1U8LB 4WW2A 4FQ2H 4URTB 3MACH 3WFBH 3IGAB 4RMQA 3EJZD 3W5MA 1J8HA 1MI5D 5J1SC 4D9QD 3HE6A 5E2UH 1GGIH 5JW5A 2IGFH 3MRLA 3LEXB 1S7WA 5KTEL 3HUJE 4HKZB 3MRRB 4HGKC 5F72S 4D2NA 1ZT4A 5E8EB 2E27H 1RHHB 4JKPL 4LGPB 1CG9A 5EOQH 4YXKL 4BH8B 4HWUA 1OF2B 5FDWA 5JUEH 4MQ7A 3ULVE 5GS1A 4NQEA 3K2UH 3QDJA 4HIEB 5EZIL 3CLEL 1QBBA 3W81A 3ALWA 3BGMA 4X6BB 1HIML 5DJDA 2MCG1 4M43L 4GO6B 2Q76A 2B20A 4NUJA 3KR3H 5DK2A 3BN3B 2DIBA 4U6HA 1JRHI 4OGZA 1ZK9A 2F53B 3HR5A 1GC1C 1RZIA 1D9KB 3ZE0F 2E8ZA 1XCQB 4HWZA 3MREA 5CZVH 2FO4A 2V2XB 2EYSA 3L3DA 5KSUA 3UBXB 4JO3H 1MPAL 4KMLB 3BIBX 1FRGH 1IAIM 5EBMB 4XCCL 1CF8L 1OTUD 5BV7H 2QBWA 3ES6B 5FYLD 3TYGH 5JO5A 1G7LA 4BQ8A 1MCCA 1WCQA 1CVRA 5TDPA 5E8DH 5D71L 4KTDH 4PJHE 3QI9B 4G8GD 3CSPA 5A3ID 1OAKL 1FAIH 5GS3A 1NGQH 1V05A 3WXVL 3I9GL 4ZPVA 3BE1L 4LARH 4OCWH 5KSBF 1F4WH 4HZLB 1DBAL 2IAMB 2QSQA 4YE4L 2BRQA 3V4PL 3CFEA 2LTQC 5IVXA 4TUOA 1UVQB 4ERSL 4R4ND 5I76A 1NUGA 2JB5H 4NUGH 2A1WH 4JPVH 2WUBH 4XCFH 5F6IB 4RX4D 3T1FA 4TNWK 4GT7A 5DQ9B 4HJJH 5DJ2A 3TVMC 4LSTL 1QACA 3DGGA 5DVMA 1I3GH 1CZ8H 5I15H 3QWRA 3LD8C 1BIIA 5EZOH 5HDLA 5C0AB 5C70A 3BW9A 2ED9A 2FATH 2NLJB 2ICCA 2VDLL 4JM2F 5DHVH 5EA0L 3HE7A 4IS6A 2FYYB 1B3JA 1PW3A 2IH3B 4QOKD 3RJDA 5KVEH 4HAFA 3DTXA 2R15A 4GSDH 3CFEB 4MXWL 3ARGC 4JO1H 4N90D 4S1SL 4CVUA 1QYGH 1E28B 4EN3D 5J13C 3D18B 5DZOA 5BJTB 4M48H 2AEPL 4WW1A 1UYWL 5CJQL 2EDLA 4MS8D 3RGVB 1BGXH 3X12B 3PQYD 3T0EC 5DMGD 5CP3H 1U8MB 1SJHB 4GJTB 4IJ3B 5HYSA 5GS0L 2PO6C 3ZT5A 4OLEA 5IEKB 1WICA 2BNQE 3VRLE 5I1JL 2D4DA 2Y07H 2PTUA 4X98B 1KTDB 4Z5RA 3NCFB 5FYKL 4P4KD 1YMME 5CLTA 4UDUB 1T1XA 4Q9CA 3PHSA 1Q9LB 2QQQA 1OAXH 2R4RL 3RJQB 4ODXB 2HAZA 3LSOA 5D1QA 4HCRH 1CIUA 5FO9A 2AV7B 4NSKB 4WV1C 4L4VA 4FMKA 4KJPC 3DVIA 1YEFL 2Y9RT 2DQGL 5F7LB 2NY6D 1H8NA 2BVUA 2EDRA 4B53A 4DZ8A 1T7WA 4MA1B 1I1YB 2YPVH 4X5WB 1B0RA 1TVBB 1YA5A 5IFHL 4YHKH 3QISA 3TCLB 4I2XE 2YD8A 1V7NH 3K3QA 1NAML 1XCTB 1AXSB 1KN2L 4UT9H 2VXSH 1U8JB 2XZAH 2C1PB 2VXUL 5EU6A 4LMQE 2VRAA 3MRBA 1RZ8B 4OGYH 1PSKH 3LKSB 3EFFB 4HQQL 1OAXL 3EJYD 1GJIA 3QRGH 5IK3B 3OTTA 3HNTL 4N8PA 3IDUA 4FN0A 1H8OA 4LLUB 3VRLF 4O5LH 2F74A 2OLDA 1QD0A 5EO0B 4N0YL 2A6JB 2DQGH 1PQZA 4KK9D 2Y36L 1YYLH 1BM3H 3KJ6L 4MHHG 1M6OB 3CK0L 4XXDB 4QTIH 5GZND 4IOSD 5IEHB 1JN6B 2BNQB 3O3UN 4R4FL 1FL3B 4LCWA 1RU9H 1K8IA 5DJ8B 3BD3A 4FHBD 1SQ2N 1N2RA 1RZ8A 4GRMB 2AAVA 3GSXA 2VL4A 3V7AG 1A4KB 4ZUTA 1EERB 1J1PL 2H1PH 2FH6A 3EO0B 4F2MB 1NMAH 5D7KE 5J57B 2YUZA 2X40A 3HC4L 2VXTL 3SE3C 1TVDA 2I07B 3GGWA 5CFHA 5ICZB 1NLDH 5I8EB 5HVWA 2B4CC 3L7FB 1EFXD 1MAJA 3RTQD 5EULV 3GKWH 3EYQD 5I8KL 4HC1H 3A6BL 3S34L 1RZJH 2ESVB 3O3BB 3IKCB 2DQIH 1DUYA 4APQC 1F6LL 2CLZB 3I6GB 2A83B 3S3SA 1MLCB 4NC1C 1CGSL 1QFWI 2XZZA 1JIBA 4LPVA 1W72L 4HUWB 4KH2A 4PJBF 4RGOL 1JNHA 3OZ9L 4S1RL 3OXSB 4KJYB 3KPSE 2O5XH 4X7SL 5CSBA 3UPRB 2ATPA 4LLAA 3T04D 3WIHH 3ZZ1A 5E8PA 3VFNB 3CCHA 3LDBC 4HBCH 3WFZA 5AZEL 4WI8A 3OJVC 1RZJL 2UWEE 1I3RA 2QV2A 3CZFA 1F4YL 4Y2DA 4OBSA 1A0QH 1YQ2A 4H8WH 3HMXL 1MY5A 4L4TE 1DQLL 1HHGA 2XN9A 3UTZB 2IPTH 2OL3B 3N1GC 1EGJH 3I6KA 5EIQA 2ZPKH 4UIMA 3FO9A 1BQLH 5IB1A 4RIRA 3PGDB 2A73A 2NCMA 4QHLA 4DFHA 4JM2C 2EDWA 3BDYH 4Z7WA 5DTFB 4A6YL 5E99H 4S1QH 3UCRA 4EDXA 2Y4SA 3H0TA 3LV3A 4LPYA 4TULH 3S37X 2BVOB 2XICA 1R3HA 4FQ1H 4PRPE 3GJFH 4JVUA 5DUMH 3WKML 5GGVH 5I9QB 3NCYS 1FNHA 1BVKB 4IBLT 4JRXB 1Q72H 4P3DA 1MWAA 5DVLA 3JUZA 2BOCA 4YZFF 2UWEF 3D0LB 1B4JH 2QKIA 1RUQH 3MRPA 1HNGA 4K2UH 2WUCL 1IL1A 3TM6A 1I8LA 3UYPA 3C5SB 3MJ9H 1BREA 5DMYA 1JWMB 2DQDL 1MCNA 3ZDXF 1EJOL 1T0PB 1CL7H 4OD3L 5D1ZD 5AYUH 4P4RA 4Q9RH 3MZGB 4R26L 1YUHA 1U95B 5TE6L 1DEEA 5SWQA 1N64L 2CMRH 4XAKE 2CO7B 4MDJA 2QHRH 1X7QB 4UTAL 4PJCB 1RK0A 4EJ1C 5LBSH 2FR4B 3RIFK 4LASL 4H88H 4ZO8A 4JQVA 4PV9B 4X80L 5J6HA 2CRIA 4MAUL 4BSJA 1UH3A 5DSCB 3U0PA 4F2MA 2CO6B 4IMLA 5AG8A 3MX0A 2N7BA 1LNUB 3LS4H 2P5EB 5JZ7C 1OB1B 5CGMA 5E99L 4BK5A 3TFKD 5KANI 3TBSA 1KBGL 4NP4H 1U8OA 1JI2A 2ZUQC 4ORGA 3WNLA 5BRZB 5JOPE 1CTOA 5D93C 3F58H 4EXKA 1QR4A 2BC4B 3I3EA 3JUYA 5DUML 4R90L 4XBPA 4PRAA 1FC1A 1ZWIB 1L7IH 3MMEA 5ICXB 5KVFH 4Z7OF 4PGZA 3QFDB 1S5IL 1PZUB 3MLSH 2CKBB 2AK4D 1KEML 3IFLL 4UILL 4WO4A 4HFUH 3V9FA 4JAMA 2EC8A 3FZUD 4GQPH 3Q6GL 5JXED 3B5HA 4YHOH 5L2JB 5T3XD 1DE4A 4WTZG 5CEYA 3U1SL 5KVGH 1P7QB 3TT3L 3U36A 1VEPA 2X1OA 5E2UL 4TUKH 5L9DL 1AO7E 1TETL 1U2CA 3LRHA 4NPYA 1CF8H 5SV3A 3UTQB 5BV7L 5LAXB 1ZANL 2Y5TB 2BSED 4YFDB 5HDQH 3RWCB 1MI5A 3QDAA 2HFTA 4P4KB 5I1DB 3MC0A 4HUNB 2FX7H 2H32B 4JFYB 4DZBB 4PJ5D 1OARL 2AXFB 1UM4L 4ZXBB 4I2XA 1BD2E 3QA3A 3FTGB 4Z95L 5CJXC 4PGBB 3BP5B 4Z0XB 4WHTB 1CD1A 3QUML 4S2SB 1GZQB 3BH9A 3GMRA 1IZJA 4YAQA 3KHQA 4H20L 4LP5A 1RUPL 2NY6B 3ZKSD 3RQ3A 3VWJB 5EU5A 3V4VH 1JPFA 1S7UA 1VPOH 3C6SB 3BRFA 1HWHB 1PZ5B 1FZMB 5C6TL 1UKQA 5D2LF 4ETYA 5I66B 1ADQH 5EUOE 3UAJC 1KEGL 3ECBA 3TNNB 1AGBB 3VH8A 1A6VL 3FQTB 5ESAB 4WCYL 1NGWB 1RMFH 4K7FA 4I2XB 5ANMA 2NY2B 2Y5EA 5F70A 3GO1L 1AJ7L 3FTGA 2G75B 3S3PA 1JMXA 1IILE 1RY7B 3K7UA 3DVGB 3Q6GH 4Y5XB 1JJUA 5IHUL 1KNOA 5GGSY 5IBUG 3QCVH 3MACL 4Z7VA 3C2AL 4JEGB 1LGVA 5B39G 2UZIL 1VGEH 1OGAA 4Z7OE 2J8OA 4HAGA 3QDJE 1O0VA 5FK9A 5DJXB 1A6TA 2SEBB 4O2FA 5HHQA 1A6AB 3W9EB 3EHBD 1T21A 3SDXA 5DS8A 3PWPD 4XVJH 1J1OH 5I15L 5TE7H 2OM5A 3IDNA 3VRJA 5F8RC 3H42H 3QUZC 4F37F 3DLQR 1CFTA 1WTGT 1CFBA 1WZKA 4P9HH 3BX7C 4G9DB 1DBJH 2ZUQB 4LKXA 2B2XL 5CJ5A 2DQFA 1HOCA 4C59B 1I9RH 4EOWL 3FB6B 5MENA 2F54D 2VERN 4GS7C 2GK0B 4NZUL 2N4IA 2ZZUT 3P40A 1F4WL 3P9MB 1EFXB 4UUJB 1MIMH 1FVDA 2W0LA 3NFNA 4RMWA 3AAZA 3TBTB 5JOPD 2ESVD 2BNRE 4JO4H 1TCMA 4I3SL 1N0XL 2AK1L 1EV2E 3N50A 4R4BB 3UBXG 3TBYB 1JZ7A 1OTTD 1FV1B 3VWKC 5F1IB 3DURA 2PCPB 4P5TC 2D31A 3HC0B 4N0CC 2MNUA 5M7QA 4FNLH 3ZE1E 2EH8H 3T0DA 3ZDZE 2XTJC 3PQYA 1QFHA 4KTEH 3NVQA 4F57H 5J89A 2J8HA 3O3AB 5I1HH 25C8L 1UB6A 4H26B 5C09E 4NZUH 3ZO0A 1ZHNA 2Y06H 2UV3A 5TPWH 3KR3L 3HS0B 2BVPB 4LVHB 4KTYA 1MAML 5JMOC 1N6QH 3IDGA 4LDOB 3FQNB 1IKFH 4XMLL 4O2EA 1KT2A 1XIWA 4HWBH 4HWEL 3DX6A 4LMQI 4X99A 4JFDD 5HD8C 5TF1L 1EEYA 1BFSA 1EPFA 5EZOL 5IFAH 4YK4B 3MLVH 3OWEA 1CT8A 3DXAE 5E9DB 1ROWA 4PRPA 5LCVH 5C3TA 2VLKD 4OGYL 5EIVA 2DQEH 4U1IA 3QNXA 4GRLC 3TZVA 3T3PE 1BMGA 3BZ4B 4ZFGL 5JUEL 2VISA 3LKPA 1JNLL 4Z7VE 3D3VB 3DMMD 3EOBB 4DN3L 1KB9K 1ACYH 2GAZB 5LGJB 1X5KA 4FFYL 3O9WD 4D0CA 4CRPA 1IZKA 3U0WH 3U6RB 4FZEL 3RP1A 4UMGA 2ZG2A 3CXHK 3WS6A 4PUBH 4JFOB 4X6FB 1U8IB 2ITCB 5TF1H 3ARDB 5ITFA 2JB6A 3GNMH 2R4SL 1CICB 2J3SA 1F13A 4EIGB 4WRLA 5EC2A 3QQ4A 2R2CA 2FBOJ 3QXUA 4HUWA 1AP2B 3AREB 1JRHH 4MXVE 2EDDA 2QQLL 4M9OA 2F54E 1HKLL 4I3RH 5IWLC 1XF3A 3L3IB 3WO4C 1OW0C 5L2KE 4DOHE 4CJ1A 4UV4L 2VO5A 5FDYA 2V7HB 1JUFB 3L3DB 4UNVA 5GRWA 3MNWB 4W81A 4L4TD 4JN1L 4QRSA 3TIEA 2HN7A 5CBEB 3C09C 3MFGB 4Z7UE 1N5YH 4P59H 3OB0H 2VLLB 1NC2B 4RZCB 1DR9A 2BSSB 4M1DH 1A6UL 4P23C 3SDXB 4CADA 3TA3D 3N9GL 2CUMA 43C9A 2HTLD 1LHZA 1LO5A 3U4BH 3WNMA 4RAHA 3KPSD 2W9DL 4N1HB 5HVHC 3MRJB 2GITA 1I1AD 4HZLA 1TIUA 1IAMA 1UWXK 2A9ML 1QO3A 4R0LC 4XAWH 3MRNB 3E6HA 3MV9A 1NSNL 2BDNL 2MKWA 4PJAF 2DM4A 5ESQB 1I1FA 3WNNA 1NFDA 5C07B 3ARXA 1IC5H 3DGGB 2EH7L 2IH1B 4ZAKA 3FQRA 2CK0H 3QPXH 2DQUL 3VWKB 2CR6A 4QTIL 4X9GA 3IU4L 3QXDB 2W1NA 2FHFA 4G6MH 3QEGH 1H15B 1S5HA 1Q72L 2R4SH 4MNHB 2YUVA 4U33A 3RX8A 5SX5K 2VXSL 2VDMH 3I84A 4V1DE 1KB5A 1G9MC 1XAUA 4NRZA 5HBBA 1T2QH 5D1XA 1ZHKA 3PWLB 4JVPA 4LLWB 1KLFA 3OBAA 1ZE3C 3V7MA 1FNLA 5L0QC 1KGCE 3RKDD 5K9JL 1NCDH 3HPLB 2IAMD 2EDFA 5ACLA 4QTHB 4UDTB 3WIFA 1MJ7H 4R26H 4FS0A 5EU7C 4G42B 3BKYL 4R2GB 5CEZE 4RMRA 4DW2H 3UTSE 3A67H 2P8LA 5AZEH 3UTTA 3H6JA 3MV7B 3CUPA 1DDHB 2JK5B 5DQJA 2W65A 4UV7H 3BO8B 4L9LC 1J1XL 2OI9C 2VDPH 4UQ2B 5AWNL 3K81A 5E56A 1MHEB 4P2CG 1S7RA 1M7IB 4JLRA 3S35X 4GRWE 4L4JA 2EECA 3O4LB 2F5AL 5FUCE 4OSUH 4QRRB 1QLFB 3D39A 2FDBP 1JBJA