4XP9L

X-ray structure of drosophila dopamine transporter bound to psychostimulant d-amphetamine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
213
structure length
213
Chain Sequence
ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIEGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein/inhibitor
molecule keywords Transporter
total genus 51
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp9L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp9L01
3X14B 4TTGA 1II4E 2R15A 5C08B 1RMFH 2LTQC 8FABB 2BK8A 3V5KB 4UMGA 1WIOA 4KUCF 4HV8B 1BOGB 3FTGB 4PGDB 4WW2A 3MV9D 1AGEA 4ZO7A 5C0BB 2AXGA 4NM4H 4R0LC 3FCTB 3PHOA 1A6VH 3MA7A 1I7UB 3PWNA 5DEZA 3FQWB 1XCTA 3RY6A 1GC1H 3CFBA 3GSUA 1BM3L 4NN5C 1G7JB 1KB9J 5JQ6H 1U8HB 1M7XA 3IDXH 4DZBA 2ADJB 1FFOA 2Q6WA 3HCVB 2FGWL 1I7ZA 2VZOA 1XF5B 5I1HL 5IEKA 5EBLA 2FRGP 3SKMA 1FAKT 3BKYL 4ZO9A 2Z91A 1I8KA 4EN3D 3MNZA 2ZCLL 5I1DA 2OSLB 1JZ2A 4ODVH 5D1XB 1KIQA 3ARDB 4NO3A 5ILTH 2GITB 3ZT7A 4D3CL 3EOTH 3SDCD 1ZHLA 5EWIH 1T03H 4F7EB 3S4SB 1IM9D 1M7IB 4M4RA 2R8SL 2AK4B 5I16B 1CDIA 1FFNA 4YXHL 5EUOA 3UC0H 4QYOB 2C5DC 4YHZL 3T8XA 1RUKH 4NDMB 4ODTL 4EI6B 3QA3A 4WTXA 5JIPA 2NY0C 2BNRA 3BOVA 4Z7VA 5I17B 1C12A 4PRPB 3V7AE 1A1NB 4G9DA 2RCSL 4KY1H 4TVSa 4KJPD 3FFCE 3OSKA 3RP1A 1QLFA 4WW1B 4L4TA 3FQUA 4XAKD 4Z7UF 4UIMA 5CJQH 3VH8B 4FQ2L 5DR5H 5C07D 1F3RB 4BZ2H 4LVEA 5IHBA 3LEXA 4G8EA 4GS7B 5FIEA 4HFWB 1KCKA 1IGTB 5EULV 3RWDA 1I1YB 5F1KC 5TQ0H 1LP9A 1U6AH 5BS0E 1U3HC 3RX8A 4K94L 2I9LA 1XF1A 3IDIB 1SYVA 2IJ0C 3SE3A 3HPJB 5FYJD 4DEPB 3T2NH 1LP9F 5IFHL 4R7DB 3QCTH 2F74B 2D4FA 2OTUB 4YDLC 3EOYG 5EO1B 5A3ID 5IQ9A 4OCLC 4W6XB 1G6RL 5DEFA 1AE6H 4APQA 3BVNA 2YZ8A 3PP3K 1A1NA 4G9DB 3DHMA 3F12A 5ERWB 3WUWG 3K0WA 4OLUH 4NQDD 2XA3A 3LKPA 3LZFL 4OZHA 4HIHA 1XR9B 3VGHA 1TZHB 4HG4K 4U6HB 2X5PA 2CMRL 3UROR 1LO2H 2J8UF 4XCYB 4WFFE 4DCQB 3MRKB 5J1AA 3VD9A 1N4XH 3VXQB 4YWGL 3WFDH 4EOWL 4XXCA 3P4NB 3V79C 3VXUA 2E9WA 2X1XR 2APWA 3KXFB 1Q0XH 1J7VR 1ONQB 43CAB 5ITFA 2JB6A 4LCWD 4AG4L 4JPKL 3MNZB 5ANME 3NZHL 1Y0LA 5T5FH 1XGPA 3UZQA 3SKMB 1KIRB 1PVHA 3QPXL 4GAJH 4YDKH 4KRPD 5F6HI 4HUXB 5JPMA 5C0RL 3WL9A 4UUJB 5FYKD 3CDCA 4XHQA 1RUQH 2O61B 1KYOK 4PR5B 1F8TL 3P4MA 1IM3A 1M1SA 3CFBB 1ADQH 4PJ8A 5C08D 3W9DB 5TDPA 1S5HB 4YHIB 1CFQA 4PGJA 1PAMA 3I02B 3T1WA 2BY3A 1T1XB 1IQDA 5E6IA 3BZEA 3OQ3B 4G43B 5C70A 3DARA 3V5KA 1IEHA 4MQXD 4YBLB 3OKLA 1FLRH 1RUAH 3BT2L 3GHBL 3MV9E 4HDIA 1D7FA 4Y4FA 5HI4D 3VCLA 1YUHB 2JB5L 5GGUA 2Z31C 1JZ6A 5F7DB 2XQYG 3SKJL 5ECJE 1BIIA 3EUUA 4IRSB 2R2BA 1D6EB 4BQBA 2AJUL 3CX2A 5TPWL 1L0XA 3VDAA 3TN0A 1D5BA 4M02A 3CVIH 4HUXA 4M5YL 4OLVH 5DWUL 4S1QH 2HJKB 2AEWA 2DQEH 4M9OA 3SGJC 4NJAH 3OB0K 4PJDF 3LRSA 4WUUE 2Q8AH 1EAJA 4YAQA 4EKXA 3JV0A 43CAA 4JO3L 1KN2L 2D7QA 5E7FA 1KENL 1IC1A 1AKJB 4L8SB 1I9RH 1S7SA 2OXHA 2VL5B 4KKCD 1NLDH 4E5XB 2H2PC 3BI9X 4XCYA 3HMXH 3O4LB 1MHHB 1SY6A 1NJ9B 2PXYD 4XH2B 3LKRA 1PSKH 3BN9D 3QZWB 1UXSB 2P7TA 5GGRY 4KKAC 4OLZL 1BIHA 1LDPL 2JELH 3W2DH 1AGCA 4L4VD 4PJXF 3OAYH 1FZOA 4QT5B 4D0BB 3ZYIA 4U1NB 1ZT7B 4PGCB 3KWWA 4PV8B 1P4BL 4DJMA 2YD1A 3NFNA 1N5YH 1H8SA 2FX9H 1U95B 1OAKL 4HC1L 3O45A 1OM3H 5IHUL 1VFAB 1NGQL 3VGBA 3L3HA 3MRBB 1WIUA 15C8L 5ENWA 1FV1A 2XZQH 3MACL 4LVNC 5I74B 2PETA 1DQLL 4Q0XL 4U2YA 1VADA 5IOPA 4TUOB 1QQDB 4LRNH 4UBDC 1BFVH 2ARWA 1OF2A 2UWEA 3DX9A 5EN2A 3BWAB 1A1MB 4NHCH 4I0PA 1YEJH 2BNRB 3FO1B 4EI6A 3T8XB 5DTFB 4LFHD 4U0RC 3NFPA 4K2UL 3DNKA 4PRBB 3RNKB 2VL4A 2GK2A 5HYJA 3HI6L 1TQCB 5KVEL 2KPNA 1M05B 4DTGH 1JF1B 3MCLH 1F4YH 1X5AA 5DT1L 4RDQF 1F8TH 2QSTA 1D9KB 5DVNA 5EZIH 2IGFH 2P8LA 1HHIA 3NIFF 2D7MA 1FNEB 3NIDF 2FJHA 1CLCA 1CU4L 2HKFH 2D0GA 3PWLA 5B39A 4DKDC 2AV1B 3X11B 2OJZH 3DO7A 5FUOH 1EDQA 4U3XA 5F7YC 3D39D 1C08B 1YJDC 3VXOA 1J8HD 2VNCA 4UT6H 4YFLI 3KPNA 5E99L 2GKIA 5C86A 2DQUH 3I2CH 5FKPB 1WZ1H 3MPCA 3PHOB 1MH5A 2I9TB 5EC1A 5T1KB 1AGEB 4Z77B 1GPOH 1JCKA 1RZ8A 3B9EA 5SWSB 3X13B 4EI5C 3SO5A 3ROOB 5C0IA 2YR3A 2EH8L 4LGRB 2NNAB 3EDFA 3HI5L 4P5KB 4P2RB 4X5LA 4WJ5B 5IBTH 2R0KL 3X14A 2ENYA 1OAUL 3BH8A 4J8RB 5C0AD 3ZKQD 2E7HA 5KS9B 3RPIB 3SDCC 3MRRB 1DQDL 2NW3B 4KC3B 5D1QB 3ARGA 2CIIA 3EYSH 5CD3B 4RGOL 3IDUA 3MMEB 4WTZA 1CE1L 5IR1A 1E4XL 4Q0XH 4Y5YA 3UTTE 4JPIB 1T22B 1S9YB 5F7EL 4BA8A 2W1NA 3MV7D 4F7TA 3RY5A 2AJZB 3ES6B 2VC2L 1I9EA 3G08A 4P0DA 5C0GB 3RIAK 2EYTA 3I75B 1A9EA 1NLBL 2DKUA 4XAWH 2DLIA 5DMYA 4TULH 5DUBA 2HT3C 4JE4B 1ZHNA 1QNZL 5AAMA 5F3HB 2IPUG 3O4OB 3GSXA 1RJYA 3KJ4C 2XKNB 4JFFE 4P2QE 4QCIB 2YRLA 2AGJL 1DBKL 2ID5A 1JRHH 5KVEH 5DUMH 3OJ2C 4RA3A 4KDVA 5F9WC 1E27A 1NCAL 2CLZB 1I3UA 3FT2A 5D1ZA 2IAMC 2NW3A 3O2WH 5DF0A 1KFAH 1JMZA 4NNPL 4U6VL 4HCRH 3KPOB 3UPRA 4E42A 2IFFL 4UQ3A 3D48R 5C07A 1YEHH 4LRIC 2ADIB 4G5ZH 3OX8A 4Y19A 1QLEL 3TFKC 5E6ZA 3K2UL 4ZS7L 5GSVB 4XPTL 4OJFL 4CW1B 2MNUA 3ARGC 2QKIA 5FHAL 1RIUH 4KROD 4KHXH 5J7CC 1FBIL 2C1PA 5MEQA 1FFPB 15C8H 2FR4A 2R2EA 3MGOA 5JDSB 3O3UN 5EBMB 2AJYH 4EVNB 1DBJL 1NMAH 5I1JL 2XWBA 3ULVE 4UDTB 2B1HH 9CGTA 2PNDA 3QNYA 4U1HB 4X4XA 5C7XH 1LEGB 3P30H 3NIDE 1JZ3A 4PJ7E 4P5MB 4P2RE 1UWEL 5FOJA 3ZKMD 3QAZB 4KK6D 4ZTOL 2XI9A 2XN9D 4POZD 1K8IA 4RZCB 3B6SB 3FN0H 5IB1B 1NGWA 3LQZB 5KVFH 3E8UL 3AMLA 5IBLC 4JY5H 4FG6D 5C09B 1EXUA 3L1OL 3HE6B 4NCC1 3AS1A 4X7SH 4HIIA 4J4PD 1TCRB 5F9OH 1D5MA 1U3HA 2Q76A 3FOLA 3VGGA 4PGBB 4JRWA 3RQ3A 4JO3H 4BQ6A 2VDKH 4Z0BL 2ERJB 1KENH 1XZ0B 2W0KA 3CH1A 4DGVH 5T1KD 3QPXH 4YDKL 1VPOL 4MAUL 1N64L 5H37H 5F8RC 4LEOA 2P8PA 1KLGA 5D7JC 5GZOC 3HNVH 1UADC 5EZJA 5ENWB 2E5EA 1KPUA 5GS1B 1OP3H 3IF1A 3V4VH 5JR1H 1MIML 1KJ3H 3FZUD 1QEWB 1G7QA 5F88B 1ZAGA 3P0YH 1IT9L 1LO0H 4LCIL 3VFSA 2WUCH 3SKJH 3QO0A 1SJXA 3L6FA 3NFNB 2F19L 3D39E 1LO2L 3IAGC 4WO4C 1JF5A 3SBWC 1IKFH 4P4RB 3RVWC 4WI5A 1BD2D 3JV4A 2HN7A 1P1ZA 3RTQD 5T1MA 1QSZA 4ODUB 6FABH 2ZOKB 2GUOB 1SJHB 1G7QB 1IFHH 4Q9RH 3O6LL 1ORSB 2OX5A 4QRUA 3BXNB 3K4AA 4GO6B 4GKOA 4PJGE 5IVXE 5IB5B 4JZJB 4EUPG 4MA3B 5KBNC 3MRJA 1FZKB 4E5XA 1M71B 1U8PA 3MBXL 2AABH 2YPLB 4JVUA 3ZYOA 4Z0XB 3PL6A 4J6RL 2N1KA 1ADQL 1EERB 5CMAA 4BFGA 1UWGL 2NW2A 4I3RL 1EX0A 1RUQL 2A6IA 2H41A 1S8DA 3GO1H 3HE7C 4WI7A 3L3JB 2YMXH 1OPGL 4YAQB 3VWJA 4QTIL 1WITA 1N6UA 3FOLB 4RBPH 1A6ZB 4LSSL 4W6WB 4X9BA 3MOAL 2DQJL 5LGHL 1XF4A 1PFCA 3P9MB 1CGVA 2R9HD 4M61B 1BAFL 3C09C 4HW6A 4M7KL 2OL3A 2VDRH 5C09A 5F6HJ 3CVHL 3U9UA 4ZUWA 4BYHA 2A6JA 3KYNA 4LPTA 3EKCA 1S3KH 5MI0C 2EDTA 5HY9B 1SBSL 3I50L 2DLGA 5CGYD 1MPAL 1WZLA 4ODTH 4X6FA 5FECB 2WQRA 3KPSE 2FO4B 5GJTL 3MXWH 1NCTA 1UC6A 4OZIF 3QNYB 4U1HA 4X4XB 4OF8A 5EU3B 4GKSB 5ADOL 4LLDA 5KSVB 2JJTA 3DJ9A 3QUZD 4NIKB 5C0FB 4JZOA 2UUDH 3EW3B 4JFFA 4P2QA 1BEYL 2YXMA 5MEQB 3AMKA 4JO2L 1OHQA 4R4BB 1AQDA 1MHCA 1S5HA 5I76B 3DROA 2IH1A 2D9QB 4Y8DC 1MQKH 4NKMB 2Y7QB 3MLTB 4WUKH 4UQ3B 3QQ9C 3QDGA 4C4KO 4UV4L 3L3OA 4JFDD 1UT9A 3PWPA 4IDJL 1A2YA 1B0RA 4PJ9C 4JFOB 4R4FH 2A0LD 2V5TA 2WP3O 1QRNA 5FV1L 2CK0L 1NDMB 1U93A 4U6XB 3ET9F 1G7LB 4FZ8L 1CWVA 1AFVH 2UWEE 3KLHC 2CLZA 1T4KA 4PLKD 4J4PA 5LBSL 1NGXB 3HC3H 3J7HA 4RRPA 3STLB 3UEZA 1NAML 1EUTA 3P4OA 1KNOA 3L3KB 4H1LG 3BIKA 5TGBA 1ZHNB 3TYGH 1A7QH 1SQ2N 1XR9A 1FC1A 5CP7B 3S36X 1BJ8A 5KZCD 1NL0L 2OZ4A 5ESAA 5L88L 2EZ0D 2VDOH 3NACL 1T7ZA 3Q3GA 3VMOA 4K23L 4AM0B 5I8OL 4PJHE 3ARPA 1HQ4A 4D0DA 5EO0A 1YMHA 3BUTA 5DA4A 2BSRA 4L4JA 4NOBA 5JZ7C 4OLEA 3RNQB 1M6OB 4DKAA 2FGWH 5I1HH 2BVYA 4KAQH 3DX8A 2ZCKH 5H37G 2X42A 2EKSB 4C57C 3O6LH 3QI9B 2CIIB 1NFDE 3C2SA 1I1YA 1CDHA 4HS6A 1I9JH 5F21B 2DM3A 4JRYE 3MQIA 2AI0H 1LEKB 1S7QB 4RGMC 3ZE1E 2YSSB 4G8GA 4RGNB 4RNRB 4RWYL 3MJGX 4XNZB 4FRWA 2X4NA 4MD4B 4WW1A 5SX4H 4R2GD 3MLPA 1Z9OA 3CFCH 3NAAH 1IEBA 4XCCL 2V2TB 3GK8H 2DIAA 5IFAH 1LGVA 2ZCKL 5K59E 3DXAE 2AK1L 2C3XA 1KEGL 1JYNA 4KMLB 4LPVA 1VEPA 4NDMA 5DJCB 1I1AD 4JRXD 1NGZA 2FJFB 3ILQD 4GQPH 1NFDA 3MV8D 4JJ5A 3HB3D 1QSFE 4BJLA 1I3GL 4HF5L 1K8DB 4MCZA 1U8NB 4PRIB 3MLUL 4CN1A 1MFBL 3PWLB 5IW3A 4XNUH 1KIQB 3ARDA 5DURB 3QUML 1MFAL 4L9LC 3KPPA 4LVOC 3ULUC 4ONHB 1J18A 1IBGL 5JUEH 1RZJL 4WI2A 5CD5D 1I8LA 4ALAL 1KJVA 1FFOB 1UKSA 2ADJA 3D3VD 5ALBL 3W0WE 4F2MB 3IJYB 3O8XA 4LDOB 4YDVA 1YA5A 2NQCA 1WTGT 1QR1A 5TQ2H 3TZVD 1DQQA 1MVUB 3O9WB 4XVTL 1N8ZA 4HQQH 4I77L 2C7UA 3GJFA 3MV8A 1J0JA 5F3BA 4UI2A 5ICXA 2Y06L 5IGXL 5D5MA 4XPBL 1FNFA 1QSFD 3BEVA 3SDYL 3L3DA 4GMTL 4UIKL 2DDQL 5JOFB 2P1YA 4PV9B 4QRTB 5HYIA 1DL7L 5I6XC 1NLBH 1Q0YL 5HPMB 2B5IB 1CICD 5FO8B 3S8WA 4Y4HD 4ZUTB 3V4PL 5FV2A 4NRZA 1HQRB 2ADFL 1IC5H 5DHYB 4LK4A 5DC0A 2CR3A 1F4WL 1QFWM 1LNUA 1NMBL 4X7TA 4ZFFB 5I0ZA 3MV01 1JGDA 1MEXH 4PJAA 1PJ9A 4LLVB 1CXEA 1IKNA 5ABDE 5D7IB 2VLJB 4U1IB 3TBVA 1CF8H 3P77A 3O3AB 4JQXA 4QRPE 2VL5A 4X6CB 1S7SB 2IPTL 4LKXA 2I07A 3QDJB 4XB8A 1BZQK 4G6JL 2BOBB 3G5YB 1LO3H 1UH4A 1WAAE 2IALA 2D31B 5AZ2H 2VDML 4ZOCA 1HK6A 3JVGA 4R6UA 1ULVA 3X3FH 3BPCA 3BSZH 2O5XL 1PYWB 5DK0A 5E5RB 4GG6B 3H7BA 4LDEB 4UQ2B 3QQ3A 1W72H 4FTVE 1P6AB 2NY4C 5F96H 1I8LC 4I5BB 4FQ1H 1E6OL 4Q7DA 4N90D 4XP1H 4PJBE 4G6JH 4GRWB 2VZSA 2MJWA 4NO0B 1U8KA 5F1IB 1RD6A 3NVQA 3ULVD 3VWJC 4HK0A 4NHUB 2XQBH 3VWJD 3QUYB 5DDHA 3IETB 1PQZA 1F58H 2Y5TA 5E5MB 3MUY1 3QXUA 5EWIL 3UTOA 3DURB 5DMGD 1A3RH 2LQRA 3MYJA 1K3ZA 3SQBA 5F3BB 1NMBH 2WWKT 3MV8B 1AE6L 3OKOB 5CJXC 4IIQA 4MSWA 3ZL4H 1U8OB 3O3EB 3OG4B 1T1XA 4JGJA 2QSVA 4G8IA 4MNHA 5E6IB 4I3RH 5HGAA 4XNQA 3RVVD 3ZSSA 1MREL 1ZVSB 4NHCL 5KSBE 4KK9D 4UILH 2NXZD 4P4KC 3HS0A 3SDCA 3JUYA 3K8KA 3P9WB 3IGAB 2IADA 2EE6A 3GKWH 1KCSL 2WM0A 4U1GB 3SE8H 1JFQH 4A6YH 2ATKA 4OIIL 3G5XA 2VISA 3PP4L 5MENA 4KVCL 2VLRA 2BNRD 1RVFL 4W4OC 3SCMD 5BCAA 2HKHH 4HC1H 1OAKH 3PE9A 4HBCL 2P46B 4FFVC 3BQUD 2JB6B 4GRWH 4YNYB 4F8TA 2LV4A 4FQCH 4M8QB 1FVCA 1WAAF 3U48A 1RIVL 1G9MC 2R23A 4GXUN 2EYRA 2A77L 2ZKHL 1MNUH 1VGKA 4PY7A 1CBVH 1E4XI 3GSNB 2DQHH 1FIGL 2X41A 2PO6C 3WSQL 4DK3A 4NPYB 3Q48A 2CKBB 1CGSH 3U6RB 1WLHA 1UZ6E 4YH6A 1E28A 4ALAH 3UYRL 1Y6KR 2GJJA 2W9DL 4M7ZB 4HS8H 5GGQH 4R7DA 5IESH 3RL2A 2ZG1A 3KLAA 1ODAA 3JBG7 4XP5L 5D70L 4IEFB 4KQ4H 3EJYC 1LEKA 1FPTH 4OZ4A 4WFGD 4ZS7H 1TZGL 3SE9H 1CFSA 4RMQA 4DUWA 4AT6A 2YPVH 1BVZA 1TJHL 4LHUG 4LSRL 3TPUB 3QZWG 4OAWA 1A5FH 1JYXA 3CVIL 4WI6A 2QHRH 5BO1H 5LAXB 2H2SC 4OKDA 25C8L 2BERA 2EZ0C 3KYOA 4OLYH 2DWDA 4HKZB 4XCCH 3E0GA 1FCCA 2P24A 4LMQE 3QEUB 3WKML 3Q5TA 5MEPA 4CNIB 5ESAB 1REIA 4U7SA 4J23A 1I8MA 4XMPH 3B5TA 3NCJH 2XZCH 3T09A 3VJ6B 2YC1B 4V1DD 1VFMA 1HHGB 2NY1B 4MVBC 4ZAKD 1SY6L 1WWAX 4MVBD 4F15C 4PG2C 4JFQB 1NC2B 2EDKA 5FA4A 4OUOA 3HZMA 4KVCH 4NCC2 3SDDA 1I85C 1BBJB 2OL3L 5DJAB 5D1XA 3MFFB 3T0EC 5H8DA 1IAOB 4KHXL 3KLSA 5D7SH 3H42L 5HGDA 1G9NH 4D8PA 1RJZB 1BD2B 1KCVL 2NY6B 3HAEH 1YMMA 4Z76A 1E4XH 1I1AB 2OXGA 4B7LA 1U8QA 3VFPB 3DVGA 2X4PB 1L6XA 4CMMB 1ES0B 2ESVB 3SN6N 1NGYB 1T66D 4HX1A 1JHTB 2BDNH 2ZUQB 2CDEB 1LDSA 2H6PA 1S9XB 3L95A 4G7YH 1RSFA 1AGDB 1WWWX 5GRXG 2XQBL 3TIDA 2NTSP 3Q1SL 5C1MB 2UY7A 3U4BL 3VXMD 2YUZA 1EMTL 1BOGA 2D7OA 3HC3L 1NGYA 2BY1A 4WHYH 4Z7WA 5GRJH 2XNAB 2AJSL 4X8JA 2VR9A 3NA4A 3D3VB 5KS9E 4UT9L 3CDGA 3EO0A 4NZUL 2HFFB 3WFEL 1FVEB 1LO5A 4D8PB 5J6GB 3MNVA 4IRJB 1S7UA 4M48L 4LARH 1L6ZA 5FUZL 4MGXA 3Q6GH 5DFWH 5HY9A 3M45A 1NEZA 3BH9A 1MWAA 4EDXA 5BRZA 1IAKA 3VRJA 5HSFA 5AZEL 3PV6B 3F7PC 2QL1A 4JG1H 2XV6B 3GBNL 4PRAA 4M61A 1ZXQA 2J6EA 3TVMC 4GLRI 1XF4B 5M94B 1ETZB 2RJMA 1AIFB 3NCCB 2R0LH 5I71B 5KN5B 3QEHB 4AEEA 3LS5L 4M6MH 1UA6L 3H6JA 1QFWL 2EEDA 4JANB 4EBQL 5JORA 5EIIB 1DBML 3I3EA 1CF8L 2P24B 4LARL 2OM5A 1ZTXH 4WWID 3QXDA 1G9MH 3BEWA 4UTBL 1A64A 5E9DA 3WHXA 4HGMA 3WS6A 3BO8B 3WN5A 1F58L 2DI8A 1IGFH 3Q6FB 1FG9C 5JPNB 4OAWB 3QG6B 1AC6A 1YY9D 4D9RE 3MBEC 4RX4A 1ORSA 4JG0H 1ZGLP 4LOUD 3IDGA 4KMTH 4EIZC 1DLHA 3BRDA 3ZE2F 4OZ4B 5D1XC 3ARQA 3ARDC 4U1MB 4S1SL 1DVFB 2GT9B 5CZXD 5L8LB 4NQSA 1A4JA 2F9BT 4RQQA 1EGJA 3KYMA 1T0NB 2ED8A 3WFEH 2FX9L 4IDLA 4YPGA 3KPLA 3T04D 1ZSDA 3D9AH 3RGVA 3U2SA 5C0CD 4Y89A 4X9HA 5GS1A 2X4RB 4HLZH 4IS6B 3L7EB 3CC5A 4ZO8A 3WNNA 3GFUA 2FHFA 2BMKB 4X6DF 4D0CB 1XIWD 2FZ3A 4NQCE 1QO3A 3QXTA 4TSAL 4IOFC 3RIFK 3IRZA 3K8LA 2R23B 4X7EC 4QWWC 3O6KL 1HDMB 2QADD 3B2UC 5FYJL 3DRTB 2R1XA 2IMMA 2H1PH 3SKUD 1X6NA 1PY9A 4KTYA 4YDIH 1INQA 2CRYA 2GFBA 4RWHA 4LF3A 5F97E 3WHE1 1D5MB 1NCWH 1U3HB 2Q76B 2QQLH 1OGTB 2VISB 5MENB 5F1OB 3WIHL 4OCSL 3DRQA 3MRGB 4HIIB 4F3FA 1WT5A 3K1DA 1FIEA 1UACH 4MXWH 5FOBB 1Z3GH 4PJFE 4BSWA 4N0FB 1K8IB 2QQQA 2Z4QB 1PG7X 2ZZUT 5CLWA 4CJ1A 4FQXD 3BP6A 3MGAA 3C9NA 4K7PH 4ZXBD 5DJ2B 1FNSL 5BV7C 2VDKL 4PS4L 5L2KD 2YD8A 5CBAB 3MZTA 1U8MA 4MLSA 3DXAD 5KG9B 2XXCB 1J0YA 3WIHH 3U36B 1G84A 3VXRE 5AYUL 1Z0NA 5E8PB 3IU3B 3PQYB 1BREA 2R4SH 1BJMA 4HK0B 1LDPH 1GRWA 4KK8C 5I15L 1MCWM 5IROA 5AAWA 1VFOA 1UH3A 1IEAB 3CFDA 4FMKA 4FZEL 4QRRD 3QXWA 3OX8B 1LHZA 3ESUF 4XCEA 1RZFH 5DZOA 3VXTB 3E8UH 1N6QL 3FB6B 1BZ9B 2IWGA 1KF9B 4LPYA 3WO4C 3RL1A 4KRPB 3OKDA 3BYTA 3ZKNC 1A0QL 3F7YA 4PJXA 2C3WA 1AGBA 1T2QH 4QXUL 3C5JB 5C8JA 3Q5YA 2SEBA 1PZ5B 2V7NA 3CCHB 4PJDA 3UTSE 4E9LA 5ACZA 2PXYC 5IMLA 4JY6B 2BOBA 3G5YA 2G5BB 1S7WA 1TVHB 5A2JH 2I25N 1H15A 2XTJC 3ARSA 4P23B 3BPLB 1KXQE 1BQUA 5SWQA 4G5ZL 4HUWA 3MJ7A 2CLRA 1DSFL 1T1ZB 4TTDD 4XPTH 4JG0L 1XGYH 4MJIA 3ZE2E 5BMFL 4JQIH 4JM2B 2AJ3A 1QUNA 3SJVB 4NFDA 1T2XA 1C16A 1RIVH 5KVDL 3QNXA 5ANMB 4JAMA 4KMQA 2AQ2A 4OCYH 4AENA 5JW3H 4DZ8B 2BOCA 3FRUB 1W0WA 2B2XH 1Z6JT 3TPKA 4DGIH 3P11H 4Y19D 3ULUH 2KZ1B 2VSCA 4KPHH 4ZUTA 4IJ3B 3LS4L 4OCXH 4XTRD 1OTUD 3LS5H 1G0DA 3BMVA 1NCDH 4EZMA 2A6DA 5A40E 4KZDL 3DV6A 4QXTB 1G7HA 5JOFA 1JL8A 3BH8B 1OP5K 4LHUB 3BPOB 5ELIA 4WY7L 4HWBL 1IMHC 2QBWA 3EGSA 3S37X 5ADOH 1JWSA 4V1DE 1P7QA 4OZGE 2C7UB 3KPRB 2ED9A 3HI1B 3BGFC 3HG1A 3C08L 5B38B 1XIWA 1T1WA 4OV6F 3V2AR 4X5XB 1AY1L 2Y25A 3S36H 5GS0L 3AGVA 1WF5A 4MXVE 1A14L 2ZNXA 5IM7A 4YDVB 3TBSB 3NZ8A 2CMRH 4CVUA 2VQUA 1IGFL 2AV1A 2FHCA 5J89A 2F5AL 5GRWA 4H26A 4YQXH 5IM7B 2YWZA 5CIPA 1JPSL 5ADPH 2VLKB 5B38A 2IAMD 4JFDE 3ESVF 4WHDA 4WCYL 2P8LB 4LIQL 1D9KA 3QWOA 3K1KC 5J12C 3OKMA 4FQPA 4F7CA 2KQNA 3EGSB 5HYFA 1HKFA 4OI9A 3BZ4B 3CLFL 3RNKA 3NTCL 2WBJD 5JHDA 5EU7C 2J4WL 3MRHA 5DJCA 4C54A 3NOIA 1KCUL 3VRLE 3BAEH 1PD6A 4X98A 5I75C 5F93C 2WBKA 4WGWB 2Y6SD 3Q5OA 3NCFB 3FT4B 4K07A 3ARBD 3IFNL 2UWEB 4XBGA 1J1XH 1RI8A 3K46A 2VZVA 2BNUB 4LPCA 4XPBH 5J8OA 3H2WA 1Q9LB 3LQMA 3OB0H 2IQ9H 5DD6A 1OAYL 3V0VA 1P5VA 1QSEA 1V3MA 3HZKB 2VR4A 2NTFA 4APQC 1L7TH 4TNVK 5M95B 3EYOB 1IAIL 1CQYA 5SWQB 3ORJA 5CWSA 5E9DD 4FG6C 2E7LA 5KSBF 2W65B 5ACLA 1IM9B 1QHOA 1F3JA 5ISZB 4AENB 1ZHBB 2YD6A 4DN3L 2NLJA 4F8QA 2V17H 3QHFH 1HHKA 1PZ5A 2V7NB 4PJDB 2N7BA 3QT2A 1ORQA 1XGYL 4GUPB 3C5JA 3DYPA 5HHME 2P5WB 4YDJB 3IVKB 3VMNA 3H42H 3UTQB 5DD5H 4OLWL 4EI5B 2IANE 1RZIA 4P23A 2NY5L 4ZG1A 3ZTNH 2GTZA 3KYAA 3LKSB 5DHVA 1NKOA 2EDFA 1WISA 3C5SB 1T4KB 2P5EB 2K7PA 3B2UD 1VEOA 2SEBB 5C8JB 4KV5F 3L5XL 1R3JA 3NIFE 3SGEI 1YN7A 2ZUWA 5JIIA 1AGBB 2Y9RT 4UZGA 4JFOA 3FQRB 4LU5L 2VABB 4R26L 1B2WH 3O3BB 2EXYC 5JA8B 2IFGA 5JZ7D 5CBAA 1UZ6F 2P44B 3UXFA 3WKMH 4ESKA 1NQBA 1BIIB 1T7XA 4ENEC 4IOFD 5GJSH 5HHOB 3EYQC 3EDDA 1JGUH 3CSPA 1KB5H 1TFHA 3MUZ1 5BOZG 3RTQA 1Q72L 4PJ8C 2ADGA 1T04B 3EFDH 2X9WA 2XTLA 1A9BB 5DMIL 4DFHA 4DN3H 4KHTL 4KUCD 3RGHA 4Y4KD 5IFAL 4KI5F 2LAAA 5JLZA 3ZSTA 3LKOB 1PW3A 1KFAL 5AD0A 5GJSL 3TGXA 2FX7H 4Z78B 2A74B 2V7HA 4GW4B 1IQWH 4GQ9L 2O61A 5FOBA 2HT3D 1WT5C 3D85A 4IRJD 1MNUL 1QO3B 3OHXB 3DRQB 3T77B 1NUGA 5KSAD 4U7KA 5IMOB 3RJQB 1JBJA 5ACMA 2QEJA 4P46A 5JXEC 2CD0A 4DUVA 3VG0H 4NQXB 2D03L 3MREB 3DRTA 2YA1A 2QSCL 5DQDL 1OAXL 4YBQD 3K8MA 1IAMA 1T0NA 3VFTA 4MX7B 5CMAB 1WIPA 3NPZB 1R3KA 4WI8A 5IG7A 5J1AB 2ITCA 2XG4A 4JR9H 1FL3B 4A6YL 1Z2KA 1A7QL 1RUPL 4G8FA 2J8HA 5LQBH 3FO2B 5J3HC 4QRUB 1C5BH 3C5ZA 2HLAA 4OQTL 3SDAC 5FK9A 4UT7L 4N0CD 5BJTA 4W81A 4QHLB 2QR0B 4M43H 2A38A 4Z7VE 3CLFH 4GG8B 2CLVB 5C92A 3DTXB 2CXGA 3HE6C 3L9RB 1AI1H 2IG2L 3WS3A 5IBTL 3D0VA 5E9DE 5ICYB 1FVDA 3IDIA 1NCCL 1R5WB 3QWRD 3U1SH 4KKLD 3RWEB 1KPVB 1EV2E 2V5RA 4B5EA 2AV7A 4NN7C 1XCQA 1MAML 3H9HA 1JTOA 2MPAH 5DHXB 4CMHC 5IKCA 3ZLQC 1MWAB 4NYLB 1XZ0A 2Z92B 4U2ZA 3QUXD 1GIGL 2VLJD 3B9AA 3V9FA 4H8WC 3BZFB 2J8OA 5I17A 1KSRA 4OI7A 2CRMA 4M48H 3H0TB 3KS0H 3OF6D 4YX2L 5HDLA 1I8IB 4M6NH 2V2XA 5C6TL 5FYLD 3VE0A 1Z9LA 4XPHH 1JWMB 4ZAKA 1ZHLB 4GRMA 2IMNA 1LO3L 1K4DB 4ZODA 4XGZB 3O81A 4KI5C 1I7TB 4QY8A 1NEZB 2B20A 2MCPH 1CXIA 3D39A 3O11B 1DZBA 1MCWW 3FHQA 3ULVL 4WW2C 4JB9H 4EUPH 3BIBX 1JF6A 5JW3L 4QHKI 3RVVC 3RU8L 5ALBH 1CDYA 1OP9A 5JIHA 1U8QB 1UVQB 4FQQA 3DETD 4YZFE 4EIGB 1F4WH 4EVNA 2E27L 5HDQL 3GSUB 1D5ZB 4MQSB 1TTGA 4H5SB 1C5BL 5E8NA 1H3VA 2B1AH 4JKPH 5FYKU 4HUUA 3T4AB 2NX5B 3MOQA 1S9XA 3L95B 5IB2B 1KLUB 1PLGL 4LSUH 3RZCB 5GSVA 1KT2A 3C6LD 1RFDL 3JWOH 5LWYH 3ILQC 4NZRH 8FABA 2O5ZH 4N1CA 3WNLA 3R0NA 5KJRL 1C5DA 1I1AA 2FEEI 1HHGA 2I5YL 2EIEA 2ATPB 4ONFL 4XZUA 5K33A 1X9QA 4R0LA 3DIFA 5TDOA 2VXUH 4U31A 1KC5L 1Q9KB 2FD6H 3WFCL 1I85A 4WEMB 2BSSA 1BBJA 3IT8D 1GSMA 5D7LE 5DC9B 3NN8B 2NMSA 3HZMB 4OV5B 2A73B 5FDYA 25C8H 2JCCB 1R3IH 3E2HB 2JK5A 4MNGB 2BNQB 1XCQB 2YHGA 1RJYB 5HVHC 3G04A 5D2NB 3MROA 2W38A 2YC1A 3FAWA 4JGUA 2FIKB 4ZUVA 5GISL 3GSNL 4QRSA 4YFDB 1IRAY 2NYYC 5CINH 3B2VL 4AT6B 2X7LA 2XQYK 4PJBF 5JUEL 3C6LA 4OB5L 2EYTB 3I75A 5C0GA 4XPGH 1A6TB 4PJBA 3HLAA 3KLAB 3OMZA 1TJIL 3V7MA 4CL7A 1TIUA 3DUUB 4Y5YB 4HLJA 2GCYA 4YGAB 4CVXB 3FFCA 2KKQA 4PJ9B 1OCWH 5FK9B 4YE4L 3TO4C 2OR9H 1CFSB 3PABA 5FA3B 2RR3A 1DN0B 3QYCA 5KS9A 4UU9A 1CLOL 2AAVA 4XPGL 3GSNA 1K2DA 4OB5H 1LWRA 3TP4A 5IESL 2R1YA 5F6IB 1R3KB 4JN2A 4YHPA 5HJ3B 1Z5LB 4LASL 4KTDL 1FH5L 1MUJB 4M8QA 4U1SB 1KUMA 4YR6B 2K1MA 1JTPA 2BFVL 2YKLL 4XNXH 3M17B 2YRPA 1JUFB 1H3PH 1MHEB 5IB4A 2UYLB 2PCPA 5DJYA 4Y2OA 4A2MA 2A77H 3PWUB 3SQOH 5JIKA 4KAQL 3X11A 3TT3L 3CXHK 3CDFA 5DRWA 2EE9A 5I8EB 3L5IA 5INDA 4HEPG 1G7PA 2CO7B 4G42A 2V7HB 1S7RA 2WINA 4YC2B 4JO2H 3S98A 4HBCH 4ONFH 5DJ0A 4M6NL 2HLFC 2GSGA 1N7ML 3LN4A 3VG9C 2R9HC 1MF2H 2Z8RA 3G9AB 3FQXA 2X44D 5E70A 4BZYA 2Q8BL 3SE8L 4RGMB 5C0NC 1ZEAH 4OZFH 4HXBL 2HG5B 4J3VA 1CE6A 4XWOC 3RA7L 3RJDA 1XMWA 1MPAH 3JWDH 1X7QA 1FGVH 5E2WL 3RVTD 3OR7B 3EO9H 2EXWD 4UTBH 4OGYH 5IOPB 5GZNC 3SY0A 4WUUB 5JHLL 2VABA 4PJAE 1Q9WA 1S9VA 1U58A 3UTPD 1YYML 4ZYKB 1VACA 4P9ML 4TUJB 3BHBA 5C0CE 4L9LB 3S35X 2PKDA 4KXZI 1B0WA 1QA9B 3AS3A 5I1KL 5KSAC 4XT1C 1KEML 1AO7A 5DGQA 1WAAA 4JN1L 5C6TH 5GGTH 4WFED 1DE4A 2YBRA 2I07B 4N0UE 1OAQH 3KVQA 4I5BA 5LXGH 5GGRA 3ZE1F 4L5FH 1OOAA 5L2KE 1FZOB 4S2SB 2DRUA 4YHOL 1DBBH 4P59H 1J5OH 5F9AC 5K9OA 1D6VH 3CZJA 5FGBA 3RX5A 1KTRL 5D96C 1X5FA 3T3MF 4QNPE 5DD0L 5FUZH 1WCBA 4PJEF 3S5LB 1XR8B 4KJQD 5K59F 1R5IB 4JPVL 4UNVA 3SE4C 5HYQA 4S2SA 3QHZL 5C0DA 5HBBA 1F6AA 4NN6C 1IAIM 3DSNA 2ZUXA 1ZLVH 2EIZA 4X6CA 3T4YA 1CDUA 2XWJB 3MRCB 3MLRH 3JXAA 1WGOA 3LS4H 4OCXL 3RA7H 4JQVC 5E0QA 1JK8B 2VOTA 3C8KB 4O2FB 4HAFA 2NY4D 4OT1L 5GHWL 3W82A 5J11B 3IFLH 4I3GA 1BGXL 1UKTA 1T6VN 1N7MH 4ZFFA 3NABH 3T0DA 3QCVL 3VD4A 3PWVB 1SEQH 5TF1L 5DMIH 1D5BB 1BP3B 1P84K 4MAYD 4NUJA 1YY9C 4KI5D 3FT4A 2IGFL 4HIEA 1CR9H 1YNTA 4G6FB 4NZTL 1VB9A 3QO1B 1JPTH 5GGSA 5IBUG 1UKQA 4AIZA 1A6VL 4J3OC 5JQ6L 3ZDXE 4NWTL 1H3PL 2XZCL 4ZQKB 5JHDB 4OUUB 3BEVB 3O8XD 3IJYA 3BKMH 3TA3D 4BK4A 3O8XC 4I0PD 5ICXB 2BCKA 4MQTB 2CSPA 1SYSB 3INUH 3DX6B 4EI5D 2XN9E 4TNVF 4FQJH 2D7TH 5IT2H 1F3DJ 3BZDA 4XVUD 3W5NA 5JR1L 3LHPH 1JPST 3L3IB 1S7XB 1RK0B 3O4LD 2DWEA 1NAKH 4OZGA 4U7MA 1S7RB 2ESVD 4LNVA 3LEVH 5DRWB 2BXYA 3U82B 1T03L 4JJHA 4MNQB 2QHRL 1EZVX 4MJIE 4PJEE 4RISH 5CJ8A 4OF3A 3MO1A 3RDTC 3AROA 2AP2A 2EKJA 3TH3T 4FTVA 3HG1B 1KACB 4TVPH 5FXCH 3HA0A 2XIDA 3QQ4A 1HHJB 5KW9L 2MHAB 5E03A 4PRIA 4Y16B 1OARH 1HSAA 2X09A 1YNKL 3QUYD 1KJ2H 3UAJD 1Q9OA 2R1YB 4K3EH 4OLVL 4DCQA 4HJ0D 1OY3B 4ZXBB 5GISH 4JFYA 4HLZG 1ZLSL 1EJOL 5CEZH 3RGVC 2YA2A 5CP3H 5T33L 2VN7A 1C1EH 1VFUA 3MRMA 2J7LA 3S3SA 4YPJA 1JTTA 4EQ2A 4U1JB 3N1QC 4JY5L 4ZTOH 1J87A 5T3XD 1NUDA 4CVXA 1YDPB 4LPUA 3CU7A 5DA0B 4JLRA 2W92A 2WBJB 4MD4A 4OLYL 1B2WL 1GXEA 1FNGB 3KPSA 5IEHB 4JFDB 2EDBA 3NGBB 2R2HB 3GSVA 1BVLB 3PP4H 3FL7A 1HQ4B 2I9LB 4DOHB 1ND0A 4JVPA 4YHLH 2EYSA 2AJXH 3W0WA 4XVJH 4MJIB 5FHAH 4NQCA 1T1YB 2D7NA 1BPVA 1PLGH 5KW9H 4OZIA 1OW0A 4JO1L 5DD5L 3P4OB 4NP4L 5C2BL 3VXUE 1GZPA 1OGAE 4OCSH 4O58H 5C0BE 4MNGA 5F7EH 1JGEB 1S7WB 1TVHA 4XCFH 2G5BA 3QIWB 3DMMB 2DL9A 4OJFH 3W81A 4X4ME 2O93L 3OGCB 2HRPL 4XMLL 4OT1H 5GHWH 5TDOB 3NZHH 2NR6C 4PJXB 4MCYB 3MOBL 3OKDB 3DGGB 2OI9C 1NANI 5SX4I 4J1UA 4MJ5B 4M7ZC 4YQXL 3BDYL 5EOTA 2C26A 3VXTA 3LB6D 4HKXB 2GTWB 4P57A 4L1HA 4GRLB 1OAYH 1KT2B 2UY6A 5DVLA 1Q8MA 1FSKB 3QDAA 1I4FB 2IPKB 1G7LA 1KCRH 1WZ1L 4Z7WE 5D6CB 3PGDB 2HKHL 2Z93A 5IWLC 1D5ZA 1I9IL 3IDYC 1W72L 3PIQB 4MAYA 3SDXB 2L7JA 4Z8FL 3HCVA 5FHBL 3A67L 2VAAA 5KG9A 3CVHA 5I2IB 3QDGB 3NIGF 1I3VA 3WUWB 1OTUC 3UJIH 1WZKA 3TA3B 3MA7B 1H9VA 3IJSA 4K3JH 4XHJC 3BAEL 5E8OA 2Y4SA 1F4HA 3V6FB 1NAMA 2CRZA 3DUSB 4WFHE 2VZ1A 5IF0B 4ZUWB 4LEXH 4HSQA 4DTGL 4JCMA 4GBXB 1A3RL 5C08A 5F70A 2VXTH 4F15B 3GMNB 2GI7A 2OQJA 1AI1L 1J0HA 2IG2H 5KSUA 5DMGC 5E4EB 1WSST 5DK3A 5F72S 4R90L 1AQKH 3S96B 4PRHE 5C0ND 3T0EB 1QBBA 1A14H 4NYLA 4PP2A 3T2NL 3EOBB 4P2CG 2OL3B 2DQDL 1M71A 5FM5O 4O58L 4YHOH 3WKNA 2BDNL 1ZEAL 4JZJA 2GK0A 1RUPH 2HRLA 2ZUQC 5J0BA 1N3NB 4N5UA 3BSZL 5HGBA 5IHZB 2R56L 3T0ED 4N8CH 5T1MB 2QSCH 2HN7B 5GRJL 1EK3A 2XWTA 5EG6C 4UOJA 5CEZE 5E2VL 3DTXA 4M00A 2BJMH 2AABL 3DPBA 3QJFA 3HI6H 4PD4K 1FZJB 1DVFA 2EDYA 2IH3A 3N0PB 1FZKA 4M1CC 3MRJB 4C56B 4POZC 4Z7UE 2DMKA 2DKMA 3CFJA 1G6VK 3P9LA 3QO0B 4WFGE 2A9NH 3N50A 1JNHB 4L4TE 4NZDA 1IL1B 1YMMD 2F54D 4PJ5B 2CO6B 4YZFF 4RRPG 1KJ3L 3MJ6A 1FGVL 5JXEA 1ZVHA 3VXPB 3WDIA 1K4CA 5DEGB 1GYAA 1KLGB 2P8PB 1LP9E 5BS0A 2YD7A 5I1IL 1DSFH 3GSOB 2PYFA 1J86A 2B7DT 3VRIB 3GGWB 3VXMA 2FYYA 1YJDL 5D71L 3QXAB 1W8NA 5F88A 1J8HE 5C09D 4HUMB 1FQ9C 5I71C 1NH6A 4PGBA 3ELAT 5L8KB 2B8OT 3F7QA 1A22B 5L2JA 3QEQA 4M6AA 1JI2A 4XWGL 2QADC 1U8LA 1TJIH 1EXUB 1UACL 4MXWL 3UZVB 5TE7L 5C6WH 4R2GC 5IGXH 3QUKB 4GMSL 4Y4HC 3UTTA 3HRZA 5D7KD 3AREB 1ED3B 1MY5A 4G8GE 1UG9A 2R0ZH 1G1CA 1RU9H 5AEAA 4TTDC 1GGBL 5FO7B 1B3JA 2XTJE 3V0WL 1ZT1A 4CUCA 1BFSA 1I9JL 1IGYA 3OKEA 3BQUA 5K9KA 4XMKH 3UJJL 1DVFC 4PB9L 3RBSA 4X0KB 5ESQB 1TETH 4XP6L 1WWBX 1NAMB 1OGAA 5F7NC 3U46A 3TNNA 2R0ZL 1TZGH 3SE9L 5HHOA 3RWJA 3WLBB 4RX4D 2Q8AL 5IV2A 4U6YB 3QEQD 2FO1A 2CDEA 1I9RL 4K23H 1SEBB 2J88H 2ESVA 1Y18B 4M3KB 4UDTA 3CVHB 3OG6B 5TE7H 4E42B 3UPRB 2VB5A 3GMOA 5FYLE 4G3YL 1YN6A 5FYLL 3FN3A 4BQ8A 4Z76B 1JYWA 3ILPB 1YEFH 5B8CB 4HWEL 4F57H 3FQNB 4LCCA 5L88H 3MUJA 2RGSA 5DQJA 4PJ8D 3C5SA 4O4YH 2XRAH 5TPWH 3QH3A 1RV6X 4R4NC 3WFBL 5FA4B 1IVLA 4X80L 1MSPA 3GHBH 4RFEB 4DAGL 4MJ5A 3T08A 3WJLA 2DBLL 3EFFA 2P5WA 4YDJA 3RVTC 4ZTPL 3ZT5A 3PHSA 1I8MB 3KJ6H 4GAGL 4XBPB 3QUMA 5GZND 5IW1A 5GS2D 5MEPB 4U0QB 1E27B 3SCMB 3G08B 3OAUH 1UENA 1GOHA 4K7PY 4O9HH 4ELME 4WVRA 4FOMA 4N8VB 1QP1A 1S9WB 3CGTA 4NSKA 5E1AA 5LVEA 5ICZB 2FH8A 3CFKA 4U6TA 3QUMB 5CAYB 3DX7A 4HIXL 4C56D 4WI9A 3EAKA 4X4YA 2QTEA 4OF5A 4X9IA 5EUKB 2R1WA 4H0IA 3CK0H 3UPCA 2XFXA 3O3DA 3TN0D 3C60D 4L4VA 1J8KA 5IEHA 2VJXA 4YWGH 3WFDL 4EOWH 1N5AA 3BQUC 4FFVD 4MA7H 4FN0A 3O6FC 1BX2A 1YNLH 1T0MB 3QIWD 4QNPF 3T3ME 5FO9B 1MCLA 2EE3A 2X4OA 4ERSH 4H0GA 3C8HA 2CKBA 1AHWC 3UMTA 1PG7H 1AQKL 2JCCF 3UTZB 1OSZA 5EU4A 3U4BH 1AFVL 1KN4H 2AXHA 1MH5B 4O02H 1PG7W 5EA0L 3S36L 2G5RA 4BSVA 1FAIL 1X5ZA 3ARDD 2DQJH 5LGHH 5EOCJ 3RWGA 4G6FD 1WBZA 3BX7C 3P0VH 5CZXC 5ID1B 2MMXA 3SKOA 2ZOLB 4PY7B 4IDJH 2VDRL 4YXLH 5I18H 4P2RA 4P5KA 5KVMC 2OJZL 2VQTA 4ZPVA 1EFQA 3ROOA 1SEBA 5SWSA 5D6DA 4K3JL 1RZ8B 4QRRA 3RFZC 1T21A 1MJ8L 4L4TD 5IUSA 2Q3AA 4JO1H 1EAPB 1EPFA 1QG3A 3CIQA 3MO1B 4J3TA 4ZOAA 1C5CH 1EFXA 1P4IH 3MBED 4DK6A 5L0QB 1RY7B 2OTPA 3B9DA 3U30C 3MGTB 4JRYA 4HKJA 5I66B 1DQJB 4IJ3C 3HS0B 1KULA 4XP4H 1QSFA 3VG0L 1IJ9A 4WHCA 1JWUA 4UV7L 2RCSH 2QSQA 5DSCB 1P7QB 3TLRA 1EMTH 4X99B 1IC5L 4Y4KB 3VXME 4RFOL 3QFDB 4KJPC 1M05A 4M5ZH 5GGVL 1L0YA 4WTZG 4P2OD 1FV1B 5BO1L 1YEDA 5AG9A 2PTVA 3OXSB 1RZ7H 3AB0C 4X6DB 4ISVB 4HG4J 1GHFL 2A6DB 1LO0L 4LCIH 1ZANH 5H94B 2ZCLH 4P46C 4ENED 3L3GB 4I0PB 1OPGH 3QXAA 2BVOA 2FYYB 4ODVL 3VXMB 4HIEB 2VQ1A 2W0LA 4WTWA 4KVNH 4KQ3H 1KXTB 4OZFB 4X6EA 4DKFL 5C2BH 1A4KB 1DQLH 1A7PH 4HGWB 2EICA 2HYMA 3MRPA 1YMME 5L7XH 3VXPA 3L3HB 3MRBA 2C9AA 4HQQL 3GB7B 4KROC 2VLLA 5EO9A 3SPVA 4XPFH 4FZEH 1H8OA 1BQHB 2CLRB 2BC4B 3CFJB 4LQ1A 4C56A 1ZT7A 4X7SL 4QRQA 1R3IL 3T0EE 3HG1D 1FLTX 4L3EE 2VAJA 4JY6A 5IMLB 2VLJA 4U1IA 5D7IA 3GM8A 3TBVB 4JKLA 3BJLA 1L7IH 2OTWA 3CCHA 1R5IA 1CFTA 1KC5H 3VGFA 5I75B 3WE6A 1CD9B 5EOCH 5IJKA 3RVXC 2AI0L 3C8DA 2H32B 4JGMA 5T3ZD 2IBZY 4OFIA 2AJYL 1GGCH 1H0DA 1JPFB 4OM1L 1QSVA 3TN0B 1JFQL 2YBRB 3RX7A 4L8SA 2BVTA 2D3VA 3CMOL 3D69A 5FCUL 3CFDB 4PGZA 2WAHA 1Q1JH 4WO4D 1ZLUK 2H32H 4AZ8A 2B1AL 1Q72H 4FFZL 1YUHA 1VACB 5DD3H 5DYOB 1HKLL 3DUHA 2H45A 4EN3C 4ZAKC 3LQAC 4U6VH 3FB5A 4OKVB 1DVFD 2IFFH 4Y4FC 4ZFZB 4LSQH 4M1GH 5CILH 1FORH 2FDBP 3U0TA 4PLJD 2DQHL 1U91A 2LU3A 4FFYH 2PYEE 2R2BB 3U9PL 1X7QB 1T6WA 3WSQH 1FG2B 1S78C 4TUKL 3T0XA 4OM0H 1EEZA 4XC3H 3LHPL 4O51A 3IKCB 1CFQB 4X6CF 3H9SE 4LHJB 4F7PA 4Z7WF 4JPVH 1HEZB 1QR1B 3HZYB 4RMRA 3N1MC 4HIJA 5IBLD 5SV4A 4B50A 5JPMB 5KJRH 3BKCL 3RIAF 4XRCB 1E6OH 3NPSC 5HHMB 3RZWA 4BUHA 3SE3C 3MLWL 1OGTA 3AC0A 4H1LH 5F89B 2FSEB 1WEJL 4E0RA 2W0FB 2QQKH 5EZOL 5DK2A 4AG4H 1RUML 1A3LL 1ONQA 1JPTL 3W9DA 2EO9A 4JN1H 5EZLB 3VXUB 5I1KH 2G9HA 4NQVA 3QCUH 4NRXB 1U8NA 5F7UA 4JPWH 5C0RH 3FRPG 1INDL 3QCVH 4QF1B 3SGJA 1KCLA 2J5LB 1KIRA 4PUBL 1MHEA 3UTTD 3CDYA 4E41D 1MCNA 3D0LB 3B3IA 1TNNA 4DOHE 3BISA 1NBVH 3HE7D 4RDQG 5LJYH 4WCYH 1V7MH 1ZSDB 3EYSL 3GMPB 2C4XA 2AQ1A 2DLFH 1MCJA 5GJTH 3OGCA 3GHEL 5IQ9B 5TDNB 2EH7H 2BY0A 4OCRH 2X89A 2J6EL 2XICA 3SGDH 4XP9L 2GT9A 3WHE0 3HI5H 4MZ2A 2VXVL 4ORGA 2ZUVA 3RVWD 4U6HA 4OQTA 4ZSOE 4HIHB 4JZNB 3LKPB 1IC7L 1T1YA 3QIBD 4CVZA 1UQSA 3BDXA 2XY1A 5HYJD 4HFWA 2R56H 4WRLA 3REVB 2VLRE 2GYSA 1I9IH 3QG6A 1CDJA 2DQTL 3FRPA 4HK3N 1WQVT 1EUUA 1K9TA 2OCFD 5LXGL 4HMEA 1YDPA 4WW2F 4LLWA 4NUGH 3QIUC 4AEIL 1P7HL 2XKUA 5AZ2L 1A8JH 2PXYA 3Q3GB 5TQ0L 4O5LL 3OJVC 4ZMAT 2D03H 3QEHA 1QKZL 4P4KD 2GJ6A 1MELA 3GZKA 4ISVA 3QA3B 4QRSB 5AWNH 5D1XD 4ZXBA 4KRMB 5EUOB 3G04B 5D2NA 3WDHA 1FL5A 2ICCA 2VIRB 1MCDA 3MCLL 1R3HB 4L3AA 1LO4H 4ODXA 5DUPH 4ZSOB 5ETUB 3ZMRA 2VXTL 4Y16A 4X99A 3MJ9A 4J12A 3P11L 2GITA 2DBLH 1WBXA 3KPRE 4NO3B 3QIBA 3LVEA 1WZMA 3S9DB 3QP3A 1CICB 1FZMB 3D85D 3G6JA 1U9KA 4IRJA 4OQTH 1CLOH 4RGNE 2HFFA 5HGHB 4JPWL 3EJYD 5I1EL 2DIJA 3L7FA 5K9QI 5EBLB 2Q8BH 5I16A 5E95B 2Q6WB 4L8CA 1JNNH 2MOVA 2HH0L 4I3SL 4JHAL 1U8HA 3AXLB 1P4BH 4P2RD 4NQVB 1EFXB 3DROB 3JZ7A 2FWOB 2NX5A 2OSLA 5I1DB 1CU4H 2WNGA 3FTGA 2P48B 1JHTA 2OJEA 4BQCA 4HHAB 5F89A 3F65A 3ISWA 3HNSL 2R4RH 4YHYC 2Y06H 3B8YA 4PJCE 3TT3H 4LLDB 1T5WA 5KSVA 3HPLB 5GSRA 1XEDA 4K71B 3BDYH 4ZQKA 3HMXL 4X9FA 4L4VE 1S7TB 5IVZA 2DKSA 1PSKL 1UXWA 4X6FB 4FQXC 1OSZB 5EU4B 3UTZA 4OLZH 3WNPA 1I7TA 2YPVL 1A5FL 1EO7A 3HE7A 1BF8A 4HV8A 3LPFA 4LSRH 4MAUH 1RMFL 4JFQA 2DTSA 4ZUUB 5DO2C 2NY5H 2I60H 4Z7VF 4LASH 2Y36L 2ZWLT 1WCQA 3P9MA 1X5JA 5EU7E 4CN4A 3PP3H 1I8IA 3H0TA 2YWYA 4TRPH 2V5MA 1VA9A 4X7DC 5GS0C 4L29B 4CNIA 4P2OC 4TSBH 3LEVL 1AXTL 3UYRH 4JRXE 3HR6A 5T1DL 3MRCA 3QG7L 1T5XA 2EIZB 1QR4A 3VWKA 1YY8B 2HP4A 2E27H 5HHVH 2Y36H 3TPUA 3SCMA 3CPLB 2XY2A 2H32A 5HI5C 3JTTB 1W0YT 2AK1H 2VWEC 2WBWB 3BXNA 5HI5D 4I2XB 5C0EB 4JFXB 3HFMH 3TCXA 3RZCC 1Y6NR 1ZT4A 3RHWF 3S3JA 1CD8A 4TSAH 3BT2H 4QRQB 4RMUA 3UTSA 4GG8A 3VXNB 1DE4B 1I3RB 4MQ7A 3BRGC 1CR9L 3WD5L 1U92B 1BQHA 1HSBA 4FXKB 4UAOC 3L5WA 1CIDA 4MD0B 3SO3C 4DWHA 4AH2A 1UWXH 1EEYB 4OF0A 1MAJA 2IAMA 3IF1B 4K7PL 1U58B 1S9VB 3ILPA 2X70B 4GAJL 4BFEA 1FL3A 4X6BA 4HULB 4FFWD 4HGWA 5E7BA 5IG7B 1G9NC 4LBEA 4F7MA 1ZLVK 2EYRB 1AO7D 3LY6A 1KTDB 5D2NC 4R3SB 5D7LA 2VDPL 2ZUYA 3F6IA 4OZGF 1P2CA 3TC9A 5F7HA 2HJLB 1HH6B 3G9VA 2ICWJ 5HHNA 4MWFA 1LK2B 2NZ9D 5ESQA 3OHXA 1RZKC 5J9PB 1UCBH 1K5NB 5TE6H 1U8IA 3BMWA 3U83A 3EDEA 5DLMH 4XB7A 4IMLB 4Y5YC 2P49B 1DDHB 4ZFOL 3LD8C 3GJEB 1UA6H 2ZUTA 5IMKA 4BELD 5DJ0B 5FCSH 4PLNC 4Y2DC 4L8DA 5JLZB 2O5XH 4V1DA 1NC4B 1OT2A 3ZDYE 1QFWH 3H3BC 4EBQH 4XTRC 1FN4B 4QRRE 3PXJA 3MYJB 1DQML 5J1TC 4HWBH 2GJ6E 2Z35B 4JFEA 5F6IC 5KOVC 1PDKA 1T7YA 1U8LB 1RJCA 3LB6C 1HYRC 4UT6L 3EZ8A 3GUTB 1JUFA 2DJSA 3RTQB 2J1KA 1DLFH 1UM4L 5HHNB 3SOBH 3I6GB 5D2LA 2VXQH 1BEYH 4JCLA 5F1IA 1BGXH 4NO0A 3Q6GL 4R9HA 4KY1L 3GGWA 3VRIA 5HI3D 3PL6D 1J1PH 3PF2A 5E2WH 3GSOA 4ZFOA 3M07A 3OKNB 3KPSD 3QJHB 3EO9L 4F7MB 5HJ3A 1HHHB 2NPLX 1A7BA 5TE6L 3SKOB 5CGMA 4AMKH 3H7BB 1WBZB 2DMBA 3S35H 5I9QB 3QI9D 3GIZH 3D18B 3PABB 1R3JB 4LCCC 3WIFB 5BMFH 4YC2C 4MNGE 4OLUL 1ZTXL 1HSBB 3MRFA 4FXKA 1TDQA 3VG9B 3ARBC 2D31A 2Q87A 2IALB 3ZZ1A 5IIEB 4D3CH 4LKXB 4JREB 1FZJA 2XA8L 3QJFB 3ARXA 4KJQC 4L5FL 3Q2CA 5JDJA 3W9EB 5T1LA 2UVFA 4PTTA 4CADB 1K3IA 3TWCH 4LLVA 5CKAA 1MCQA 2W59A 3PXHA 5LQBL 1E0OB 2GIYA 4NO0D 4QXUH 4M6OL 2ZPKL 4N5EC 3OPZH 1HHKB 2ARJA 1MI5B 2FIKA 4ZNEA 4B41A 4NP4H 1KB5L 5EB9A 3P2TA 3MLSH 5ITBL 3VWKB 5F9DC 1T5XB 4KK8D 1T22A 3NN8A 4ELMA 2BSSB 5TQ2L 3OV6A 3F58H 3BIAX 3K4ZA 1A6AB 1B4RA 1IGCH 1DUZA 1KELL 2EDJA 5JW5B 2NYYD 4C59B 4ZFGH 1IC4L 1KJ2B 2F19H 4J8RA 3OJDB 5D72L 2PTTA 1C5DB 5HVWA 4WV1B 5JO5A 1T83C 2O5YH 4LSPH 4RIRB 2B1HL 1UJTA 2BNQD 3IKKA 4KH2A 3MLUH 4H0HB 1OCWL 3QUMH 3X13A 3NFSH 5CUSL 1UJ3C 3ARFB 2E6JA 2I9TA 5IVZB 4P3WA 1NFKA 5FGBC 5HYSB 4YO0A 5FGSA 2QQNH 1C08A 5TF0A 1VPOH 2D0FA 2CR6A 2DYPD 3EFDL 4NN6B 5FCUH 5I1IH 3WD5H 4JQXC 2GQHA 4HHAA 5HHQA 1QFOA 1HOCB 2B39A 1IKNC 5DQ9B 2DQGL 4U6YA 3V6ZA 1JV5B 4P4KA 4K3HA 3VFOA 5JOPE 3KYKH 4AEHL 2OP4H 5MP6L 5DMKB 5J11C 5C9JB 4NN5B 5CIPB 4G80B 4XGZA 3AXLA 3LIZH 4X83A 4H26B 4QLRA 3MSPA 4HBQA 1FDLH 4LU5H 1NC4D 5K9KB 2AGJH 4HWUA 1SVCP 4H8WL 1NGZB 2FJFA 4PRBA 3AAZB 3OKEB 1OSPH 4G9FE 5D7KE 4L3CA 4HJJL 1XIWB 3VA6A 1PKQB 3QFJE 2Z31A 1AXTH 4ZDHB 1O7SA 1TJHH 2BZDA 4Q6IB 1QSED 4Z7UA 5ITBH 1SVZA 3DMMA 1XFPA 5I8OH 5GRZA 1JHLH 3T3PF 4NZRL 1JGEA 3NCYP 3H9HB 3HAEB 3D25B 2RAMA 4LHUA 3ZTNL 2YRZA 2BVPA 2EDLA 3VFVB 1D5XB 2QLVB 2X4UA 4YHMH 5CBEA 3QEQB 2NXZB 3K2UH 5KAQG 2HT4C 4NQEA 3MV7B 2RHEA 4N8VG 1HI6B 3ULVC 4ZD3H 3QEGH 1CFVH 3MRNB 1R5WA 4KJWC 3VXSA 4HCRL 3IDJA 5IHLB 5J6HA 3JV6B 1VFBA 4GW1A 1M6OA 2UVEA 5FDWA 3FO9A 4QT5A 3EBAA 4QKXB 3FT3B 5HI3C 2F58L 4ZPTB 2A9NL 4BM7A 4TPRL 3RDTB 2RFXB 3ROLA 4LNRB 3DVNA 2FBJH 1P7KA 1GC1C 1F6LL 2R0LL 2ZPKH 4DEPC 4JFYB 3R1GH 3VD3A 4XH2A 1QNZH 3O4LA 1XGQB 1QSEE 2W91A 2ITCB 4H1LB 5I1LB 2GY5A 5BZDB 4UNUA 1NEUA 3PQYD 3MJ9H 3KR3L 5EBWB 3FO0L 1T7VA 1CD1A 4OIIH 1UM4H 4NQXA 1F42A 4L3EA 1MLCB 1LVEA 2B0SL 2NY2D 3RPKA 2CDFA 5J06A 3LN9A 1A2YB 1PEZA 2WK2A 5B22A 7CGTA 3T77A 3V5DA 4EXKA 3FB6A 1FJ1A 1I1FB 1P9MA 3UBXG 2HAZA 5A2KH 4GW4A 4LLUA 1U3YA 3QQ9D 4PD4J 5EZLA 4N0YH 1AQDB 1NBVL 5EIVA 3U1SL 5E1HB 1C7SA 1NBQA 5F7DA 5J4MA 1FAIH 4WWKB 4ZUSA 4C58B 4HPOL 3MOAH 2VUOA 5IFHH 5J13B 1UB6B 4M8VA 1ZOXA 4XRCA 2AJVH 2EH8H 2AEIT 5JXED 5AZEH 1YNLL 2ADGB 3DMMC 2XYCA 1MJUL 3RWCA 3MR9A 1KJMB 3LV3B 5FYKL 4MYWB 3ULSA 1FFRA 2BP3A 1SMOA 3I6KA 1A21A 3P4MB 4PR5A 2DOCA 4NUJB 5E2TH 1FJ1B 4UUJA 5BW7A 3HHRB 4F3FB 3H9SA 1F11A 4TNWK 2AJSH 3JUZA 3FO0H 4EN3A 2Y23A 1MFNA 3PIQA 4MAYB 3ARVA 3RWIB 1Y0LB 4NQDE 2Z93B 1INEL 3CD4A 1KG0A 3W2DL 1NCDL 3ZYJA 1BM3H 2FBJL 4HFUL 3GHEH 3I6LD 5E08L 2NW2B 4ODWA 3IDYB 2HA1A 3PL6B 2VXSL 4I0KA 4Z0XA 1LK3L 4N1EA 5EOTB 5EORL 2PW1B 1VKXA 1FE8H 3SBWA 4H1LA 3DVIA 1TQBC 3GI8H 1F6AB 2FH6A 3KPMB 3L7EA 4XCFL 1F2QA 3UTQA 4D94A 4JO4L 4NQCD 3TA3C 1UB5B 3QEGL 3F12B 5ERWA 4ZD3L 4OI8A 3BVNB 4Y5VB 4B7IA 3TFKD 1N6VA 1FHGA 1GGCL 1SHMA 1XGRB 3LN5A 5I1GL 2BXZA 4PRDB 4YBHA 4NQSB 2EEAA 2FECI 3SEPA 2DDQH 1GZPB 1FYTA 3SE4A 1I3GH 1SYVB 3TCLA 1WK0A 5E4EC 1YEKH 3MRNA 2NTFB 3RI5K 1RHFA 1MHPL 5DQDH 2EYSB 3W0WB 1NCWL 5I30H 3LEXB 4N9GB 3VH8A 2R2HA 2FATL 1BOYA 5JPNA 3D25A 1UEMA 1CBVL 1LEIB 3HG1E 5BVPH 1HILA 3MLYH 3WN5B 4XP6H 3VW3L 1FLRL 4FFYL 4LSTH 3SKNA 4U1JA 2HT2C 3MJ8B 5C6PB 1YEKL 5C7XL 3WLWC 4J3UA 3ARRA 1PZUB 1S5IL 4UINH 1AHWA 4XPFL 2FX7L 2DJ4A 3ETBF 1MFDL 3O6MH 4NJ9H 4X6DA 4L3CB 2ZP0T 1ETZA 1OLLA 3MXVL 3CXDL 1IGIL 1N2RA 3IXAB 4G7VH 5AYUH 3HE6A 4P48A 1CL7I 3WMSA 5I8KL 1IAKB 1MFBH 4F7CB 2V17L 1R0AH 1BZ7B 5LGJA 2FEEL 3KGRA 2XN9B 3OL2A 2I5YH 3U0PB 3N9GL 2VKXA 2Q86B 4UTAH 1E6JL 1MCHA 1NL0H 3QPQD 1A7OL 3NCYS 1QFHA 3JWOL 1G7PB 1WTLA 4G42B 1IAIH 5I8EA 3TZVB 4JRYB 3MGTA 2XNAA 1AXSA 3MLRL 1MWAL 1GAFL 1UGNA 5KOMC 4KKNA 4DGYL 5AYQA 2R2EB 3MGOB 5JDSA 3BP7B 1NGPL 5IB3B 2NXYC 4XP4L 5A1AA 1CS6A 4FZ8H 4KTEH 3TIDB 1D5IL 4UV7H 1IC4H 5C71A 1NDGA 4WDIB 3MLZH 5FUCE 1CYGA 4PJHB 5EH1A 3IXTB 4X5WB 3VGAC 5DJDB 5TFSH 2HH0H 4Z7QF 5CFHA 4JFPA 4RFNC 4Y4HB 4LL9A 3AREC 2AERT 4NRYB 3FFDB 4NKDA 1UJ3A 4O2CA 5TE4L 3MFFA 2C3HA 4BH7B 4BH8B 3RIFF 4KUZH 1G7IA 1CTOA 4OZHF 2EXWC 5FKAA 5D93C 3WIIL 3LSOA 3NABL 5FF6A 4URTB 2IPTH 5I18L 2XKNA 3HLAB 2W60A 2ARJB 3A6OA 3RUGF 1OT1A 4X4YB 4QHNA 2NY7L 4H25B 4LKCB 1MEXL 3CFKB 3LH2L 1A9EB 4PJFF 3MLVL 4ZUVB 4NC1E 5T1LB 2VDQH 1HXYB 3MCG1 1X4XA 3QHZH 5DRNA 2EH7L 3GMLB 2VERN 2H8PB 4FQ1L 4AMKL 3CUPB 2R8SH 3EOAA 4KZEL 1J05B 4ETYA 4G9FD 1NCCH 5E99H 2VITB 5HPOA 3C08H 2FB4H 3TT1H 2YMXL 5ALCH 3WIFA 3QDGE 1HXMA 4U3CA 3A0OA 4LSSH 2G60H 3PNWA 1X5GA 2W9EH 4DVRL 1HH9B 1Q38A 4IHOA 4EEEA 4FHBD 5EC2B 3GBNH 1DQMH 3I3DA 4QOKA 4XCEB 4OFKA 1U42A 2ORBL 2YK1H 5F9WB 1J9CT 1E28B 5MEOB 5A3IC 4AIOA 3U6RA 1MFCL 5K93A 1XGTA 3U4EB 4Z77A 2EDRA 4JM2F 4CKVX 4LPXA 5E8NB 3BP7A 5K9QG 4OCYL 2EDNA 2B2XL 1TNMA 4M4PA 3HZVB 1QFUL 3SY0B 3BUYA 1Y18A 5FGRA 3TZVA 5B39B 3FB7A 1FH5H 3VD7A 3CJJA 3NCMA 1MJ7H 4HK3J 1AC0A 4YXHH 1H5BB 3C87A 4F9LC 5ISZE 3MRQA 3OGOE 4YHNB 1NCNA 3V7AG 3U46B 1OGAB 1QVOA 2PTUA 1IQWL 4Z6AT 5EUOE 1GGTA 1RHHB 2XOTA 4WU7A 5CZVH 3MRGA 3MRLA 3BQUB 2BRQA 2IADB 2RIKA 2ZSVA 3O6FB 3MFGB 1IGYB 2EIBA 3MV11 3FQXB 3CSYB 4Y2DA 3LN4B 3QAZC 1AHWB 3V8OA 2MQ0A 5D7SL 5KANI 4XNQB 4XNXL 1HDMA 5SWZB 3AREA 4IIQB 4PBXA 4IRSD 4AY0A 3QFJB 4PJ7A 4P49A 4TUOA 2UZIL 2FECL 1TETL 2V6HA 1CIUA 1OWWA 2PCPB 5DJYB 2NR6D 1XF3A 4DGIL 4X6BB 3O6FD 2X4RA 1I1CA 2DICA 3OBAA 4RMVA 5L9DH 2R4SL 4RMWA 5GXBB 5BXFA 1UYWH 3AFLA 3THMH 4MQ7B 1CZ8H 3D0VB 5ICYA 1FNSH 2NXYD 3WS3B 1JNLH 5DD1H 3VXNA 1MFEH 5L0QC 3QG7H 4JN2B 4YHPB 1YEEL 1MCRA 3MNWA 4K8RD 2OYPA 2G75B 5DWUH 3HNVL 3A6CH 5BJTB 4G3YH 2F15A 3NFSL 4UTAL 1LD9B 4NM8H 4OGXL 2YPKA 2C3VA 2JCCE 4LVHC 4MNQE 1UXSA 4GRLD 4PJ9A 3BW9A 3C60A 4TVPL 5SX5H 1NJ9A 1MHHA 1J05A 5JXAH 5GGQL 3VDBA 5INCB 1UEYA 3I9GH 5HDBF 1YY8A 5A2LH 3LDBB 4LAJH 4LSVH 3K80A 1CVRA 2XWTB 5F9OL 3RUGA 3WHXB 3ZDZF 4UDUA 3FAXA 4CU7A 3BPNC 3F58L 1ZANL 1CQKA 1MRCH 2H1PL 1GHFH 3AB0B 1N0XL 3WLWD 5CD5C 3ZO0A 1S7VA 2CJUL 3D3VE 2MQCA 1KG0B 1J1OL 4P46B 3VXUD 4JZJC 5F1NB 3HUJB 2JIXB 4FQLL 2JJTC 3QWRA 3UJTH 2NX5E 2JCCA 4UV4H 3WS6C 3G6AB 4PY8J 3INUL 5FKAB 2LTQB 2A6KB 3EO1B 4YIQB 1TXKA 4P2OA 3SDXF 2FX8L 3HE7B 3MODH 2A74A 5HPMA 3M1BB 5E5UB 3PGFH 1A6WL 4KV5E 4NRYA 4R0LB 3HUJE 2YS4A 3VCLB 3PDOB 1EZVY 1DCLA 3L5HA 2JIXD 3C09B 1W0VA 4X8JB 3LPWA 3HPLA 4NQDB 1QD0A 3IXTA 1MRFH 4X5WA 4NGHH 5HDQH 4PJHA 4JKKA 3BD3A 1LMKA 2JJSA 4QXWA 1JP5A 4G6KL 4LAQH 5IB2A 3AU1B 1DQDH 1AGDA 4Z95L 4Q58C 3SDAD 4FQIH 4M1CD 5CKGA 3TA3A 1EBPA 1QRKA 5CGTA 1IM3B 1I1RA 3NA9L 3WUWA 4PP1C 4WHTB 1CDGA 2ENSA 3H7LA 1J1PL 2R0KH 4Y5XB 5E6YA 1KB9K 3P0VL 1KIPB 4L8CB 3G6DH 3OB8A 4M7JH 1H8NA 5DZLA 3REWB 3L7FB 3LMJL 3TN0C 4N0YL 5EIQA 1DTUA 2G2RB 3EYUH 3PGDA 3EJZD 4QHUA 4O5LH 3RVUC 1A1OA 2BSED 3JTSB 1BMGA 3P40A 1YYLL 2F8XC 4OD1H 1WUNT 4C4KT 5DHVB 4HKXA 5FHBH 1PBYA 3ARYA 1K8DA 4ZSOA 5ETUA 5ESVB 4MDIB 4X8XA 4ZAKB 3BP4A 1EH9A 4G8GD 5FGCB 4FQ2H 5DR5L 3MBXH 2X2YA 1XGQA 2ZNWA 3KR3H 4P3DA 3VJ6A 3PQYE 5EU6A 4UT9H 5HYJE 2GJ6B 1I7RB 2A1WL 4JM4H 2M26A 3BZFA 5D5MF 3HKFA 1IFHL 2EDOA 2HKFL 5EA0H 1V5JA 2Z92A 1ZS8B 5DEFB 3QDJD 1UM6L 3FT3A 5EO1A 4OQ1A 1ZHBA 3C2AL 5SWSE 3FO9B 1U3ZA 5FDWB 5LAXA 4Q9CA 1FNAA 5CHNB 2YSSA 4G8GB 2X4QB 1NCUA 3NPSB 1OWRM 3F7VB 2RB8A 4BUGA 4OZIB 3QEQE 3UC0L 1TLKA 4G7YL 3HZKA 1UQSB 5BV7H 1QSEB 2EKSA 2OBGA 4M6ML 3IFPA 4QHKJ 7FABH 1YEIH 3F7VA 3O0RL 5GGSY 1BVLA 3W39A 3I9GL 3L9RA 4HD9A 4O2EA 3FQUB 5GRVK 3W0WD 4XBGB 1QLFB 1N64H 1EO5A 2ADFH 1EO8L 2J5LC 4D0DB 1JN6A 2CIKA 4KDTC 1CLYH 1G0YR 3ARGD 4F37K 4F57L 4HWEH 2EE2A 2HLAB 4Z7VB 5T3XL 1I7RA 4KI1A 4X98B 1NGQH 3FO2A 1OM3L 2NY3B 3MRHB 2XZAL 1KNOB 1G1YA 4RGNC 4XNZC 4Z7OE 4PJ5E 3BP4B 1GVIA 3L1OH 5KSBB 4XHJD 5ESVA 4OZIE 4XC1L 1EIBA 1VGEL 1JE6A 3BKCH 3OKMB 1L7IL 4WU5B 3NAAL 4V2BA 5SX5K 1GAFH 4YNYA 3U4AA 5C9JA 1O5DT 3RY6C 5BRZD 3RVXD 3KNBA 3EIFA 3LPGA 3GMMB 3IB4A 3VXRA 4X4MA 3RWIA 2HWZH 1MCBA 3V0AC 2HVKB 1KJ2L 1OTTD 4K3GA 4OIBA 4P5TB 2LU4A 4HWZA 1K6QH 4TSCH 4YBLC 3NZ8B 4OCWH 3MLTA 4HIJB 4KHTH 3AS2A 1K85A 3QIUB 3TIEA 4Z78A 1RK0A 5FGCE 3L3IA 3FCTA 3ARFA 4W4OA 2GW5A 1FG2A 5E8EA 3O3EA 1U8OA 1A3QA 1U91B 4MA1C 4IRSC 3M8OH 4PS4H 1NMCC 3LEYL 4M5YH 3ALPA 4NWUL 1JGLL 4NJAL 4NQUA 4OCWL 3QPQC 1BBDH 1NCBL 4WEBL 1QHPA 5CEYB 5DDHB 3O9WC 1RULH 5DYOA 1KJ2A 1J0ZA 1X3DA 3DV6B 2Q20A 3O4LE 3MRIA 5D71H 3O2WL 4N0UA 1UYWL 1T3FB 3QO1A 1CICC 2BNQE 2EDDA 3WBDA 3DOSA 1S78D 2M1KA 3V0WH 5F71A 4ELMB 3E1F1 1AJ7H 3LIZL 1MI5E 2HLFD 1DBKH 2Y72A 4HJGB 1H0DB 1AR1D 3D1MC 4XC1H 3QQ3B 3PWVA 4Q97A 3AUVA 3UDWA 3HUJA 5JHDD 2DQGH 4U49A 3WE6B 3L3JA 3H9ZA 2B5IC 3BPCB 3FOMA 5A2IH 2FJGB 4K3DL 1S8DB 2P5EA 2P43B 5E56A 1MCSA 1P4IL 3LKSA 4F58H 5LCVL 2V5YA 1H15B 4KQ3L 4DKFH 1U8PB 2J4WH 5IIEA 5KANG 1B4JH 2GSIA 4S1QL 4P9HL 3B5HA 3TO4D 1XR8A 4JPKH 5HHXL 3S5LA 4OBRA 1KGCD 1U0QA 4I4WB 1CGSL 5E00B 4FQXB 4K8RC 3FONA 3F7YB 4TQEH 4X7TB 1NBYA 1NC2D 2G75A 1LNUB 4U1KA 4M5ZL 5GGVH 4LVNB 2W65A 3VFGL 3QUZA 4HWBA 3U0WH 5FO8A 2NY7H 1H3TA 2BVOB 5BXFB 4GBXD 1QA9A 1T3FA 4S1RH 3MRIB 3QIBC 4TUJA 5DD0H 1AY1H 4NQEB 4NWTH 4ZYKA 5HHPA 1D5XA 2X4UB 2XZAH 5CBEB 1F4XL 2GEEA 2X10A 5D5MB 1U8MB 4DW2L 2VLKE 2KBGA 4J6RH 5DJ8A 2CKBH 1KCUH 2DTML 3C9NB 2B4CL 4L8DB 2G60L 4POYA 1V3JA 1QSFB 2YD5A 4GFTB 4IRZH 4N0FA 4LIQH 3O9WA 1CGUA 3CSYA 3G5ZA 1TCRA 1HIMH 3B9VA 5JHLH 1F4XH 5EOQH 1YECH 5J9PA 5JNYB 1LILA 3C5ZD 4GAYA 5FM5M 1LK2A 5IW6B 5DLML 1FRGH 3RY4A 2HVKA 3T3PE 3LQZA 5IB1A 1EAPA 1PEWA 5ADPL 2R0WH 4KTEL 4P99A 2DB8A 1JPGA 5DMKA 4UAOB 5GGTA 1GPOL 3SGDI 1DBAL 3SO3B 1Z9MA 1ZKAA 3RUGE 4P4KB 1H5BA 4JQIL 1KN4L 4Y1AA 3WFBH 1KTDA 4Z9KB 2WUCL 3DI2B 1BAFH 1KBGH 4U1GC 1WFTA 3V4PH 3NMEA 3HZVA 5IVOA 5T5NF 1P69B 3TBSA 5IB4B 1N0LA 3HRPA 4YO0B 1QBLH 3R4DA 5IBUB 1WEJH 4AH2B 4C56E 3N9GH 4QTIH 5CIPH 4L1DA 2VE6A 1XGTB 3JV5A 4BQ9A 4S0SD 3KPRA 1P53A 3DLQR 3TH2T 1JWSB 2EXYD 3SJVE 4G7VL 3PGCA 3N1PC 2X4NB 4KJYB 1N5AB 2JF1A 3KPOA 1OD9A 3ME0A 1D3CA 5CJQL 3W39B 3CZFA 2F58H 3O3DB 2PO6B 1DN0A 3IFPB 4IOSD 2FIRT 2H9GB 4LLQA 5E2UL 1DLHB 1NSNH 4NM4L 4KKCC 5HHXH 5H2BA 1N0XH 3FT2B 5D1ZB 5ICZA 4OD2B 3CLEL 4QXGH 3C6SA 2GCYB 3QDGD 3O4OC 1A7RH 3TBWA 1TJGL 2NZ9C 2VLME 3HC0B 4LRNL 5CHNA 3GMLA 3AVEA 2D9CA 1YMHB 4DAGH 5F3HA 4AJ0A 4DGYH 5FB8A 4AM0A 1IE5A 1PX3A 5J56B 1CGTA 1YEGH 2BHZA 1ZLSH 4JDVA 1B6DA 4LKCA 4H25A 4PJCA 2L4OA 5D4QA 5I1CH 1N59A 4I18B 1MF2L 2HTLD 1QRNE 5TH2B 3GSWB 1YEEH 3B9KD 1B6UA 5HDBE 4MDIA 2N7AA 2DJUA 5FF6B 5CCKH 1QLEH 3NH7H 4LCYB 2HT4D 5LKNA 5I9QC 3GSNH 3ARGB 1UXWB 3FQNA 4LCCB 1EA9C 1NDMA 1U93B 5CINL 1QRNB 3X17A 4XZUB 2G2RA 4JFPB 2NY1C 4HGKC 2ZSWB 3ARBB 3U7WH 5DJDA 2CH8A 2NY3D 1GOGA 3IU4H 4FABH 4LCUB 3BWUC 1T5WB 32C2A 4JREC 4Z7WB 2YA0A 2NNAA 3MLYL 1TTUA 5C0AE 4NKMA 2OK0H 4GW5A 5I76A 1UWEH 3ZKXB 3VFUB 1GGBH 1HINL 3CMGA 4R8WH 5I30L 4KXZH 3B5GA 4QRPB 4BFIA 2H6PB 3TO2A 3KPNB 4KGLA 4TOYH 4HX1B 1I1AC 2P42B 4FQCL 3VXOB 3OKKB 1JGLH 4FQQB 1UVQA 2HMID 4NQDA 2QHLA 3HNTH 2EDEA 4HF5H 2GHWB 4LLMA 1YMMB 1ZT1B 3A6CL 4MHHI 1KB5B 1R3LA 1EBAA 2E8ZA 3KLDA 3GJEA 1RIUL 1ZA6A 3QBTB 4XX1G 4M03A 5DJXA 2XN9A 1WBXB 4KGJA 1A7RL 3SDDB 2E9JA 5L6YH 4CRPA 4QXGL 5CJOL 1R3HA 1F45A 3GI8L 4WV1C 3WCYA 1TJGH 3ARUA 5D7JB 5DRXB 2PR4L 3IS1X 35C8H 2E7CA 4LF3B 4R4FL 4W4NA 1FC2D 2F5BL 1GZQA 5GS1C 1JI1A 2CK0H 4Y2DD 3H3KA 1A1MA 4N9OB 3ARFC 5MENE 2IEPA 4QOKE 3P4LA 5E08H 4J7RA 2ICEA 1DFBH 2UUDK 5IKCB 3ARED 1P5UA 3RUGB 1KV3A 2UZYB 1GGYA 1JVKA 5FAAA 5CZKA 3SJVD 1PKOA 1K4CB 5DEGA 3BW9B 5IB5A 2APVA 3VDCA 2C3VB 1UZ8A 3CX5J 2Z8VC 1A6PA 2YPKB 3KDMB 4AEIH 3U2SB 3DI3B 1KLFA 3AM8A 2GY7B 4YPGB 3JSSA 1RQ5A 5DGRA 1XF2A 3KWWB 3MXWL 5K9JL 2DQTH 2EEBA 3MCKA 4P4RA 4ODHL 2CLVA 1NAMH 4ACPA 4D0BA 4PRDA 3WJJA 5DT1H 3LKNA 4NC2B 2FLBT 1V7NL 1YQVL 1XF2B 3MBEB 3L6FB 2L7UA 2YD4A 4S11A 5D5ME 4TPRH 3VFSB 3V6BR 1GGIH 2P4AB 1UB5A 1MCPL 3LH2H 3JTTA 1WJ3A 3Q1SH 2DLFL 1ZGLM 2XT1B 5D2LE 5B21A 5C3TA 1T80A 1QZ1A 2DLHA 2EO1A 4M7LL 3QCTL 4QF1A 4PJ7B 3TBYA 4MX7A 1CDBA 3QXDB 5SWZA 3AM8C 1HN1A 2B4CH 4GXVL 5MI0B 1G6RB 1ITCA 1V7NH 1YQVH 4N5ED 6CGTA 2W0FA 4LIQE 1GZQB 1HNFA 2DQIL 5KTEL 4F58L 1RURH 3GMNA 3MRLB 4GAFB 4GXUM 4MNQD 4PRAB 1CN4A 1F11B 3H9SB 2WWMC 1JHKL 4YHKH 1WBYB 1ZGLA 2I26N 5D2NE 3HZYA 4G6MH 4W70A 3DUSA 3B6SA 3UBXA 4Q9RL 5IWLA 2QJDA 5E8OB 4YHNA 2J8UE 4Z7QE 1S7UB 2LAGB 4LLYA 3ZTJH 3MR9B 4KK5C 5J6GA 2DMCA 4XMPL 3U0TB 4OFPA 3S97C 5E2JA 3N85L 1H3WM 3DURA 4PJIE 5I2IA 3OKLB 1MWAH 2XWBB 5CJ5A 3S37H 4LSQL 3OAZH 2OJEB 4BK5A 2PYED 4NHUA 3GSQA 3WXWL 3I02A 5D6CA 1KGCE 4D9QE 1YEJL 2EC9T 4RAHA 5TDPB 3WJLC 4AQ1B 3UTPE 1G9NL 1CT8B 3X3GH 1CFVL 5MEOA 2H26B 5L6YL 2XZQL 3MACH 3DVGB 32C2B 3RWFB 1JPFA 1OB1B 5C3LD 4J1UB 4NOFA 1NUFA