4XP9L

X-ray structure of drosophila dopamine transporter bound to psychostimulant d-amphetamine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
213
structure length
213
Chain Sequence
b'ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIEGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transporter
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein/inhibitor
total genus 51
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp9L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp9L01
2CR3A 1Q9OA 5JNYA 4WGWB 4OZ4A 2UYLB 3GIVB 1OAZH 4OF6A 4UIKH 4ZSOE 1A1NA 1PG7H 2YA2A 3EYOA 1AQKH 1L4IA 1UCBH 3O45A 4LHUA 4I2XA 1Q9KA 3MBXH 2ESVB 3L5JA 4TSBH 4Q9RH 1Q9OB 4Y4HB 4I8DA 4NUGL 4OZ4B 1R3IL 4PJBE 5EO1A 4L3CB 5F89A 3U4EA 1RI8A 1KLFA 3T2QA 2DQDH 4LMQI 4JAMB 4RMRA 1A1NB 4NHCH 4P9HC 1U8IA 3JV4A 3U46A 3O45B 4LHUB 4RGNE 2NLJB 3B5GA 3MLWL 1Q9KB 1FORH 2XQYG 4AG4L 3LEVH 4XMPL 3AB0C 3D25A 5L9DH 1HDMB 5F9WC 5EO1B 3AAZA 5F89B 4AEIH 3U4EB 5GRVK 3C2AH 1NGYA 3QULA 3RWEA 1U8IB 3TT3H 3L3KA 3QNZA 3U7WH 3JV4B 4F9PA 2EEBA 3OGOE 3U46B 4M1GL 3WIHL 4M8QA 1CVRA 2OBGA 1XF2A 5I8EB 1ZHKA 2F8OA 4OLXH 1NGYB 4ELMB 3QULB 1LDPL 4HQQH 4PJGF 3RWEB 4GMSH 2FBJL 3QNZB 5ID1A 2FB4H 1CGUA 3RDTD 4M8QB 5D7IF 1D5MA 1TXKA 4JFHE 3DUSB 4K2UL 1XF2B 2O26U 3FN0L 1ZHKB 4DKEL 3E6FB 2VXVL 2PN5A 4U1MA 3Q3GB 4MLIA 5HYFA 1PY4A 3RVVD 3QEQD 3VU2A 2LTQB 4NO0B 4MX7A 1NCWH 2GFBA 4BQ6A 4HIXH 5HDOA 3MA9L 5D96B 5ID1B 4IMKA 4U05A 4Z78A 4JLRA 4H8WL 4QT5A 4U33A 4AEFA 3RZCA 4LBEB 3I02A 4LSQL 5I1GH 5LXGH 3DJ9A 3WE6A 4U1MB 5CFHA 4UAOB 1SHMA 3PGFH 3REVA 2YK1L 3LQZA 2J12B 3GBLA 2GFBB 3K2MC 4NOBA 3G5VA 2X4UB 4MZ3A 2IAND 2M8XA 2XA3A 1OHQA 1ED3A 4S0SD 1DLFL 3WFZA 3MROA 1ZLWK 2C9AA 3VFWB 3WE6B 1RZFL 4HWBH 2ORBH 4UT6L 3REVB 2EEAA 3LQZB 4NM8H 1FZJA 4F8TA 3GO1L 5D1XD 4JZJC 5DD0L 3ZE1F 1ZV5A 4P2RE 1IBGL 1BBDL 1VB9A 1ED3B 1T0MA 4J8RA 5B4MD 3MROB 4JM4H 2XXMB 3MUGA 1F11A 3RWFA 5HDBF 5A2LH 2G5RA 3SKMA 3SGEI 3C60A 1FZJB 3SO3C 2DQFA 1CQKA 1RK0A 2AXFB 3B5TA 3UAJD 1QSVA 4JN1H 1CS6A 1X5KA 2HN7A 3BESR 4BZ1L 2ZUYA 5CKAA 1T0MB 1KPVA 4J8RB 5CP7A 3RVVC 3I85A 3MUGB 2GTWA 5DD5H 5KSAD 3SKMB 3C60B 4KVNH 1IARB 5I15L 2DM7A 2DQFB 2EECA 1PX3A 1O7SA 1TETL 2EDWA 3FB8A 2HN7B 5BV7H 2BFVL 5CP7B 5C07D 4QHLB 4M5ZL 3OG6B 1B6UA 1KUMA 2GTWB 3EFFB 4F37F 4ZO8A 2XTJB 1RJYA 2D0HA 4PGJA 2HRPH 2W9DH 1JMXA 4JFYA 1MJ7H 2DD8H 1X5JA 2A9MH 2P48B 3D9AL 5EC1A 4DTGH 2OR9L 3LN4A 3F58H 1ZE3C 3HPJA 3FB8B 4XX1G 2BC4A 1HHKB 5FYKH 5D8JL 1QBLH 3LKOA 1NCNA 1C5BL 1T1ZB 4KDTC 4I3RH 1RJYB 4Z7WF 3RWDA 4JFYB 5A2FA 3EZJB 1J8KA 4XNUL 3RHWK 3MX0A 1MJUH 3R1GH 3RY6C 3FHAA 1D5XA 5ISZB 3VDBA 3HPJB 3KPLA 5B4MC 4S1QH 1E6JL 2BC4B 4HX1A 5I19H 5BMFH 3LKOB 3S97C 4IMLA 4JFDE 5AEAA 5F8QC 1A1MA 1KBGL 2DQUH 3RWDB 4K55A 2G60L 3UAJC 3SE8H 3R0NA 1D5XB 3TLRA 4KPHL 5SWSD 1H8OA 2UZIL 3KPLB 5A16A 3MV9A 1QFUH 5KSAC 4IMLB 1KELH 1A1MB 4WW2C 4GW5A 5D7LA 4Z0XB 5KVFL 2AJSH 4MA7H 4KRNA 4CN1A 5JW3H 4LPYA 1Z3GL 3WXWL 3X3FL 5I1CH 3V5DA 3BWAB 1FLTX 2YPVL 4NQTA 3B2VH 4XC3H 4GW5B 5D7LB 1IFHL 2HTKD 3GSVA 4XVSH 3I6KA 3BIKA 5EO9A 3LQAC 1T6WA 5MP6L 3HG1D 3V5DB 4YHYC 2DQHH 2YUXA 5JW4M 1NUNB 2OI9C 4FNLH 3O3DA 1S7XA 2W0KA 3GSVB 4RMSA 3I6KB 3KYNB 5JIHA 1U8PA 3BIKB 4YDIL 4GKNA 4OUOA 2ED7A 1HQRA 3VRLF 2Y07H 3QHTC 1WZMA 3HUJB 3STBA 3WSQH 4KTEL 3ZTNH 1NGXA 5EA0H 1S7XB 2JJTC 3O8XA 4RISL 4AQOA 4ZOBA 1U8PB 5KOMC 3SE4C 2WLYA 4GKNB 5DT1L 1R3KA 3D87B 3A67H 1HE7A 3LIZL 1DSFH 1WT5C 4NFBA 3LH2H 1RULH 2V2XB 1HEZA 1J0HA 1SY6A 3ARWA 4CW1A 1S3KL 1NGXB 2F19H 5D2LE 3O8XB 4MWFA 3ZKQD 1NCAL 3S36L 3UTTD 1R3KB 4YO0A 1FNFA 4XCYA 3SKJL 4PJBA 3C5ZA 1CLYL 3ISWA 5DEGA 5IBTL 1XGPA 2EDDA 1AJ7H 4J3UA 4D3CH 1MJ8L 2HTKC 1LE9A 3ZDZE 4CW1B 2YKLH 5IFHL 3E8UH 1P7QD 3SCMD 3UTSA 4BFBD 2QSCL 3QUZA 4LLQA 4YO0B 4MJ4A 4XCYB 3BSZH 3C5ZB 4FFZH 3ZHKA 2I60H 2CRZA 3NFPA 4OBRA 2Y36L 1XGPB 4GKOA 4YXLL 3C8HA 3O0RH 1LE9B 5GISH 1OP3H 4RGNB 3SJVE 1MREH 2AERT 2DOCA 3T09A 3UTSB 4GAFB 4BSWA 5B3NA 5CUSH 4LLQB 1DUZA 3NFPB 3PXHA 1NDMA 2Z8WC 4Y8DC 2BNQA 4XPHH 1L9MA 4OCRL 3CFDB 4EOWH 3PP3H 2CIKB 4K9EC 5C9JA 2W0PA 3IB4A 3GNMH 4X4ME 3ULUD 3VFPA 2CXGA 4BSWB 3DHMA 3ROLB 4U6YA 2MFNA 5DMJB 3WIIL 4KTDH 4MHHG 1DUZB 1NDMB 2EYRA 2BNQB 1F58H 4ODHL 4UZGA 5C9JB 1MQKL 4J6RL 3O4OC 2BHYA 4U6YB 3FMGH 5F7NC 3ZZ1A 4NWTL 4M9PA 3LMJH 2V5YA 1SM3L 4LSSL 4N8VA 4YHPA 4ZFGH 5F9OL 3KJ4B 3SCMC 4GBXB 1SY6L 3V4UL 2ZOKB 4EI5B 5I1AA 3ARZA 1OWWA 3ILPB 4XPAH 2EYSA 4Y16A 4I9WE 5HGBA 3RY4A 5I30L 1J0IA 2VH5L 2BVUA 2NY2C 4N8VB 3VI4F 4YHPB 4S1RH 4NBYB 3EJJX 4P2RA 5J7CC 2IAMD 1MWAA 4F37K 3MGAA 1TNNA 4A2LA 5FECA 5I1AB 3U7AA 4M6MH 5ADPH 4NO5A 2EYSB 5FYJU 4Y16B 1CDYA 4FQIH 1YA5A 2XI9A 4R97B 2BVYA 4XP4L 3N50A 3KLAA 3IFNL 2IMNA 2J6EH 3MRQA 1CFQB 3QUMA 2BVOA 2VDML 1MWAB 1SYVA 5FECB 2W9EL 4FQHA 4JPIA 4WI7A 4XVUD 1BD2D 1F45A 4NO5B 5BZDA 3QHFH 1AR1D 2I5YH 5DMIH 4X9FA 4J7RA 1RIVL 4UI2A 3MRQB 4KV5F 3TT1L 4MXWH 1FZKA 3EOAB 3QUMB 3WFHA 5FFLA 1A1OB 1JHKL 3M8OL 4OZGF 3WXVL 2VE6A 5IROA 2AAVA 4FQHB 4IIQA 5BZDB 1BQUA 3L7FA 4HJ0D 3DO3A 2VKXA 4JRWA 2HA1A 2J88H 1FZKB 2VE6B 2C7UA 2NY4C 3BKYL 3MXWL 4IIQB 4P2QD 3NOIA 5TE6L 3QZWB 1CK0H 3RU8H 1QR4A 3CSBA 4X99A 4JFFD 4LVOC 4XWGL 4FFVD 5HI3D 3AM8A 1URLA 3VWJD 2IAMC 3BKCL 2AQ1A 1J5OH 4LLDA 2EICA 3K3QA 2C7UB 3K1DA 1PBYA 1T1XB 2DQJH 2VLMD 4JFDA 5F9AC 1AR2A 1PSKH 4RGOH 2FSEA 1A02N 1L7TH 1I85C 4JR9L 4P57A 1JZ6A 1H3GA 1W8NA 3ROOB 4JQIH 4YC2B 4PIRF 1A7NL 5EB9A 4LLDB 5JHDD 3ULVD 5BOZG 1IGFH 2AGJH 5EUKA 3T0XA 3UPCA 1Q9LA 1MWAL 4FP8L 4XAKD 1S7RA 2ZCLL 4JFEE 1MIML 3DIFA 5C0AD 4FQCL 2FSEB 5IMKB 2EH7H 1Q0XL 2FX8L 2HMID 2G2RB 3BDYL 1JF5A 4Z9KB 1MFCH 1A4KA 1FP5A 3EBAA 2ZCKH 3QUML 4L8SC 4P2YA 5EUKB 1F13A 4D0CA 1Q9LB 3L3GA 1S7RB 3C6LA 2XG5A 1UCTA 4KI5F 2XWBA 3HNSL 2AJVL 2E9WA 1QFWH 4MD0A 1A4KB 4FXGB 4IOIA 2R1YB 3KHQA 3KYAA 1INDH 3QUYA 4D0CB 3L3DA 3L3GB 4XNXH 4FFWD 5LAXA 4E42B 2VR5A 2A74A 4N0FA 5DF0A 5HI3C 3VXQA 3W2DH 3VWJC 4HAGA 2NYYC 4XNYH 2IH3A 5D7JA 3T77A 3FRUA 1ACYH 4MD0B 4IOIB 4M03A 1AXTL 4YZFE 3QUYB 1OAXH 4UILL 5CSBA 4Q74A 1PG7W 1MFAH 1OAQL 5LAXB 4HGMA 5KW9H 5JHLH 4PP2B 3NIFE 2A74B 4N0FB 3MR9A 5HVHC 5D7JB 3FB5A 3T77B 3QQ4A 3FRUB 3ZDYE 1FYTE 1NANI 1BIIB 3FQNA 4LEXL 1A47A 4LEOA 1KENH 3QCTL 3BN9D 1YNTB 4OZFA 3PWJA 1H9VA 2NW3A 1JNLH 1R5WA 4OAWA 1OY3B 2VITA 5DHVA 3MR9B 3G5ZA 2R29L 3V5KB 1SJEA 4JY5L 2HMIC 1NJ9A 1I1AB 1V5JA 3FB5B 4HIEA 5E7FA 3QQ4B 1KEGH 1GYAA 4BQCA 4KQ4L 1KJ3H 1YY9D 1J1OH 3MUJA 3MTRA 4LEOB 5E6IB 3GMPA 4OZFB 4XGZB 1TZIA 3PWJB 1D6VL 4LIQH 4JDTH 4GJTB 5DJYA 2ATKB 3STLA 1R5WB 4OAWB 3SGKA 5HYJD 2H6PA 3FT4A 3G5ZB 1YYMH 1SJEB 1NJ9B 1Q8MA 4HIEB 1OPGL 4O9HL 2Y23A 3UCRA 4X6CE 4G3YL 2YMXL 1YYLH 4OCWH 3RNKB 3MJ9A 3T2OA 3MLYH 1LHZA 1RUPH 4XBEH 1GL4B 1Q94A 4FFWC 1TZIB 4JO2H 4V2BA 4BFEA 4Q2ZA 5FM4A 1WFTA 5DJYB 4JVWA 1JN6A 2OL3B 2H6PB 3FT4B 4MZ2A 4L3AA 4N1CA 1OTUD 1KNOA 4XC1H 5D1ZD 3SJVA 3TYGH 1XGUB 4RNRA 3AMKA 1GXEA 1YEJH 2NY0B 1IAMA 4NT6B 1BWWA 1CFNA 1Q94B 1T03H 1J10A 3VWKA 2BXZA 4R7DA 2KQNA 4H0HB 2E6QA 2DQEL 3CFKB 1JN6B 1LGVA 4LMQE 2IC2A 3SJVB 4X4MA 4RNRB 3I2CH 3BN9C 3DXAB 5M94B 3CD4A 1Z5LA 4OGAD 2EDJA 2X9WA 1G0XA 4KHTH 3ZYOA 1BEYH 1NCDH 4HLZH 4ALAH 2GK2A 2QHLA 5IW1A 3T0ED 1UM5H 4ODBD 1YY9C 4OF8A 1Z6JT 1MH5A 4MNGE 3TH2T 3FTGA 3CDCA 3FRPG 4NZJA 2DIAA 1Z5LB 1TIUA 1IZJA 4LPUA 3MV7E 4O2FA 1L0XA 2R4SH 5CJOH 1DVFA 4LPVA 2VZTA 3ARGB 3Q1SL 2DQTH 2DQGH 4MYWB 2Y9RT 1UJ3C 5IW1B 3PXJA 5JIPA 4OD1H 1NMAL 1MH5B 3OL2A 5GRUL 3FAWA 5HHME 2ADIB 2PW2B 4PJFA 2FECL 3EDKA 4O2FB 5BXFA 2R4RL 1DVFB 1OTUC 2GYSA 4L3EE 2BOBA 5CJ8A 4Y19A 1DLHB 1KEML 4PB9L 4HF5H 1C08A 1A6VL 5B8CC 5I8OL 4HUUA 2YWZA 3BRFA 1EZVY 3VG9C 1FO0A 4EIZC 3MJ9L 4PJFB 4L5FL 1BQSA 3P0VL 5E08H 4U0RC 5GRYA 1PZ5A 1FLRL 5IMMA 3QHZL 1YMMD 5ESAB 2BOBB 1H3WM 4Y19B 1RUAL 1GPOH 5TH2A 3AFLA 1C08B 1VFMA 1Q0YH 4OGAC 5GGVL 1P6AB 2RIKA 4HUUB 5D4QA 4TQEL 4NKIL 2H3NB 1FO0B 5EU5A 1A3RH 5D7SL 4X80L 3R8BB 5BOPA 3KYOA 2FX7H 1XIWB 1PZ5B 3EYFA 4B0MM 5IMMB 2NW2B 4RDQF 3T0EC 4PRPE 3IGAB 5E2WL 2B39A 3CAFA 4N8CH 4QHMA 5F9JA 3KS0H 5TH2B 4HW6A 3IJSA 1CDJA 4ZUSB 1WEJL 2FLRT 5EU5B 2Z8VC 1R3IH 4XAWH 3KYOB 1N6VA 3IDXH 2B8OT 3EYFB 1A7OH 1QKZL 3HZMB 4MJ2A 4PGCA 2V9TA 1NKOA 1JJUA 1NC2B 5IMOA 3X14B 4JRYD 1MIEH 1IEAA 2GK0B 2R8SL 2R0ZL 1J1XL 4UT9L 2HFGL 1VENA 3L1OL 3B9KA 4AK1A 3OTTA 4W6XB 1UA6L 3FHQA 4E9LA 1HHIB 4U1GC 3P40A 4PS4L 2AEPH 1VA9A 5IMOB 1RMFL 3GBMH 4H88H 4RFNB 3TPUA 3TESA 2B1AL 3UX9B 3CPLA 2FZ3B 2B5IC 4R90L 3C8DA 4UB0L 5GGRY 3B9KB 3QFJE 2H2PD 4UBDD 4XCCH 3QA3A 1X5IA 4PJHB 2FBJH 4ZTOL 3CGTA 3TIEA 3TPUB 4I13B 1JPTL 1IGTA 1YEKL 1LK2A 1EO8L 3RGVA 1FO0L 2VXVH 7CGTA 2PR4L 3PQYE 3HNVH 2JCCA 1I7TB 3FFCE 4LCYA 5I9QB 4RMWA 5IMLA 2VDPH 4FTVD 4HBQA 3ARBA 5DRWA 4IRJA 1IGCL 3TIEB 4YXHL 4OZHF 1IGTB 4DW2L 3VI3F 1LK2B 4PG9A 3HE6D 2X40A 3RGVB 3QO1A 4RRPG 2JCCB 1WFUA 1CE6A 4LCYB 5FYJD 5IMLB 2WV3A 3QDGB 1X5AA 3DYMA 3ARBB 4IRJB 1HHGA 5MHSE 1FAIL 1RK1B 2XN9E 4PJ9D 1ZANL 3FONA 1RJLA 1UXSA 1AE6L 5EUOE 4PG9B 2CSPA 4YBLC 1DBBL 1UB6B 2BRRL 5EOQL 3BVNB 1FH5L 3QO1B 4JRXB 1HH9B 2FHCA 4JZOA 4DAGL 1EO7A 1T83C 1HHGB 1RU9H 2C3HA 2H2SD 3PHQA 3FONB 1BBDH 1RJLB 1UXSB 1AGFB 4DN4L 1AGEA 4UBDC 5DI8A 3DGGA 2NY6B 3IDIA 4JZOB 5LGJB 3KPMA 4E5XA 4YPGA 1FYTA 4BKLB 2HVKA 5CP3H 2APWA 2CUMA 2X70A 4G8GB 4G6KH 4NRYA 1S7WB 3B9VA 5A1AA 5DI8B 2QBWA 3DGGB 3MLSL 1FPTL 3PABB 3IDIB 3TJEH 1E4XL 3KPMB 4E5XB 2EDHA 4YE4L 5I15H 2HVKB 4GXUN 4XXDA 2IBZX 1TTGA 3WUWG 3HE6C 3CLEL 4BH7A 3HC0A 4QOKD 4ZAKC 3CMOL 1K6QL 4LFHG 5CJXA 2N7BA 3SKOA 1Q1JL 1OP5K 3RA7H 6CGTA 3PWPE 1CGSH 4X4XB 3NZHH 4X6CA 3H7BA 4PR5A 2OR9H 4PJ9C 4EDXA 3ARDD 1IAIM 1WCQA 1T04B 4I5BA 4WO4A 4G80A 4BH7B 3HC0B 3O9WC 2DN7A 4OLUH 2VDRH 1YQ2A 4JO4H 4V1DB 5CZVL 5GS0L 3H7BB 5FYLH 4D9LL 2Z8SA 2H2SC 2NY3B 4EDXB 1AI1L 2Y4SA 4ODVL 4I5BB 4MA1B 2A1WH 2IG2L 4G80B 4WO4B 4Z76A 2FD6H 4XPTL 1MVUA 4P9ML 4TSCH 5JMRA 4NZTL 5CBEA 1OF2A 4YFLI 5F6HJ 2HWZL 1TFHA 4X6EA 2R15A 2X1QA 5TF0A 2VXTL 4KPHH 4F33A 3MRGA 4G42A 3AXLA 3ILQC 4U31A 2WBJC 1EMTL 5F7FA 4QTIL 1OF2B 1ZXQA 2D03H 1ZLVH 3L3JA 2L0DA 4PJ8A 1IT9L 4X6EB 2QQLH 3LHPH 5FGCB 1QEWB 4MNGA 1EPFA 2JB5L 3WXWH 3X3FH 3SDXF 4UV4L 4F33B 3MRGB 4KQ3L 1HXYA 4G42B 5E2VH 1BM3L 3DOSA 2VABA 4RDQG 1GGCL 3OAUH 3L3JB 4OD3L 4PJ8B 2XZAL 4NJAH 5GXBB 1KB5A 2P24A 5D7KD 4D8PA 2BDNH 3MCLH 3VGAC 3U1SL 2VABB 5F7MC 5HYSB 3A6CL 3UZEA 2GY5A 3GSXA 2P24B 4D8PB 2BNUA 5FHAH 5LGKA 1RURL 3D0VB 4ZS6C 2ADFL 2C1PB 3MNVA 5F6HI 1HOCA 3JWOH 5HYEA 2W0FB 3GSXB 2RAMA 2LU3A 3QWRA 1U9KA 4LAQH 4RAVA 1I8IB 5I18H 3CX5K 3PL6C 5FUCE 5BQ7B 1TTUA 3T3ME 1CGVA 1WTGT 1W2KT 2MKWA 1JMZA 4WTXA 4G8IA 5T3XE 4JM2F 1HOCB 4PJDE 3VXOB 2CDFA 3P77A 2ZJSL 5I74B 3EFDH 3BAEH 4RAVB 2CR6A 4XP1L 4LDEB 4YGAB 4ZYKB 4HH9A 3ZTJH 4GLRH 4LSRH 5I8CB 5ITFA 4WHYH 1DQJA 3BD4A 2PTUA 4ZFFA 1CD8A 2CDFB 5IFHH 1G7JA 1LO4H 1QQDA 3KPNA 5TPWL 3NH7L 2DLEA 3ZHDA 1JWSA 5JDJA 2R0WH 3DX8B 3VGEA 3VXPA 2FRGP 5ITFB 4EXPX 5FDWA 1DQJB 3O6KL 4ODXA 1RQ5A 3HC3L 4LARL 4OFIA 1X5ZA 3EO1B 5E8OA 3F12A 4WWKC 4WEBL 1G7JB 3U9PH 1QQDB 1NEZA 1QLEL 1X4ZA 3RX8A 2ERJB 1QR1B 1KB5L 3QFJA 1DTUA 3VXPB 2AVGA 5FDWB 4QYOA 4ODXB 2ESVD 5J13C 3F12B 5JLZB 1NEZB 3TBYB 4JY4B 5E1AA 4LPXA 5EWIL 1F6FB 4NZUL 1UWEL 3QFJB 1BVZA 5JZ7C 5T5FL 3PQYA 2UWEF 1RZJL 1N0LA 1F97A 2VJXA 4IDJH 4LHUD 3CCHA 4LPTA 5ICXA 2IJ0C 4ODHH 3FFCA 4WFGD 4JCMA 3TZVA 2RQ8A 5E1AB 2EDKA 4M7LL 1SYSA 3B2UD 1A7RH 2YD9A 1NGQL 4HULB 2FGZA 4OCXL 3KPSE 4MJ6A 3PQYB 2EE2A 1G6RA 3H9HA 5ICXB 4X7SH 1QUNA 3FFCB 1T7YA 2Y5EA 5EZLA 5ADOH 3MOBH 5DR5L 3V4UH 1ZLUH 5HTSA 3TZVB 5IGXL 4JQXC 2XN9A 3AS3A 1CR9H 3LD8C 3QCUL 1SYSB 5EUOA 4TPRH 3QWQB 3I50H 1RUQH 1FZMA 5IW3A 4MJ6B 3P0GB 3WFDH 1G6RB 1JV5A 3H9HB 3D5OF 4ORZC 3UBXA 3S36X 4MCZA 1Y18A 2XN9B 1U93A 5DJ0A 2D0FA 1FZMB 1ULVA 1QACA 2PYEA 3W0WE 3KJ6H 3NPSB 1JV5B 4WFFE 4Y4HC 3UBXB 5TDPA 5SV4A 1G7IA 4MJIA 5KS9E 5ALBL 1JPST 3GMNB 4MCZB 1KYOJ 5JTWA 2WBWB 5TFSL 3ECBA 1Y18B 1U93B 2W9EH 5DHYA 5E7BA 5DJ0B 3S3JA 4NQXA 4QHUB 2PYEB 5AWNL 5GIRA 2AI0L 3JV6A 4YLQT 3VXSB 4LOUD 4MVBD 5JXEA 1G7IB 1QFOA 4MJIB 3RZCD 4PJCE 1S7QA 4O51A 1FBIH 3MYJA 3ECBB 3FQUA 5DWUH 2DQIL 4LSUH 3MRNA 5DHYB 4GXVL 4BUHA 5C0BB 1ACZA 4NQXB 4GKZB 3LRHA 5FAAA 1L7IL 5GIRB 5L2JA 5DEZA 3PWPA 1N6QL 4S11A 4P5MB 1WBZA 5T3ZE 4LK4A 4Y89A 1S7QB 4O51B 2H26A 2KKQA 3MYJB 1HYRC 2YRPA 2NX5A 3FQUB 4NQDE 4OI9A 3R06A 4HXAL 5TE6H 5GZNC 1BX2A 4O58H 4F9PC 5J4MA 2IEPA 3QI9A 1UM6L 3PWPB 2HTLD 5HHNA 4N5ED 5MENE 5IHLB 1R3LB 1WBZB 4OSUL 1F4XL 1G6RL 1MEXL 2EC9T 3FO1A 5E5MA 2NX5B 1ZLSH 2LTQC 2YUWA 3U48A 3HMWL 2J3SA 3QEHA 3R06B 3C60D 1BX2B 5D96C 3QI9B 3ARQA 5HHNB 1EFXA 4HWUA 4JR9H 2QV2A 5J1AA 5E5MB 4UAOC 2V5RA 2XTJD 3QEHB 1C16A 4FP8H 4NNPH 3ALWA 2CRMA 5F1NA 1YMHB 4IMKC 4LOUC 2BNRA 2FIKA 5F3BA 4MVBC 2FJHA 2DWEB 5ALCH 1Q0XH 3BGMA 3ORJA 4I77L 1YEIL 3BDYH 5J1AB 3PWLA 4HFUH 3NCFB 1MCOH 1C16B 2RGSA 2APVA 1FG9C 5F1NB 2HG5A 5DURB 5F3BB 2BNRB 2FIKB 3LPWA 1TPXB 4XHJC 2FJHB 3PUCA 3BGMB 3SE9L 4QCIA 3HNSH 3BQUA 2YR3A 2AJVH 5B3JE 4XX1E 3FZUD 3P73B 5IG7B 4XVJH 1QNZL 4PV9A 5E94A 1MJJA 1U8NA 2PO6A 3MRBA 3KVQA 2HG5B 4K8RH 3LVEA 4R26L 1S9XA 1MFNA 3BQUB 4QCIB 3NFSL 1EA9C 3FN9A 4P49A 1DN0B 5FHBL 1JGEA 3WJLC 3C60C 1VERA 4JGJA 4UILH 4WW2F 2C5DC 4PV9B 2YD1A 5E94B 4F7EA 1MJJB 1U8NB 2PO6B 5IHUL 2D7OA 4X5WA 3NIGF 3BXNA 4Z7QE 3F7PC 4YHNB 3NBNA 2NR6D 2XWTB 5IM7A 1S9XB 4F7PA 3QIBA 4JFXB 4KRMB 1T89C 5TQ2L 3MV9D 4LRNL 1JGEB 2XTJC 3QCTH 4LU5L 5KSBF 4F7EB 1BJ8A 4J2XA 1UKTA 5EU6A 5D7LD 3QDME 4X5WB 3IXTA 5IM7B 3O6LL 3QIBB 3IAGC 1AC0A 4KQ4H 4Q9QL 3ZKND 4WTZA 2OZ4H 1HHHA 4X4ZA 5EU6B 1O7VA 3FN3A 4DGVH 3PDOA 2P8MA 1MPAL 3MRCA 4G5ZL 2CKBA 4LLWB 4O9HH 3FZUC 5CMAA 2AQ2A 5B39G 3JWOC 2N1KA 2P5WB 5K9QG 5K9KA 4C58B 3N9GH 4AEEA 2VQTA 1OGAE 4Z95L 1CTOA 2GJZB 5T1DL 1JGVL 1FSKB 2P8MB 1T1WB 3MRCB 4DFIA 2B1HH 3EJYC 5CMAB 2GEEA 1IRAY 5F7KC 1CGXA 3S8WA 5K9KB 4OZIB 1CXEA 3E6HA 1OAKH 3C8KA 3T3PE 1YEHL 1FL6A 1T4KA 1S9WA 2E5EA 2MHAA 4HJJH 3O8XD 1GGTA 8FABA 2VDKL 4WI9A 2EDOA 1DQTA 2EYTA 3GGWA 4KY1H 3F7VA 1DBKL 4U6TA 3HE7B 5IB1B 5L88L 1P4BL 3TO2A 5GZOC 4L4JA 3C8KB 1MCIA 1A14H 3WNPA 1FL6B 4Z7UE 5MI0B 2M1KA 1S9WB 1ES0A 2MHAB 4MCYA 3SDDA 8FABB 2EYTB 5BS0E 1CF8L 4QF1B 3LKRB 3GGWB 1TJGH 3F7VB 4TTGA 1L6ZA 3C5ZD 1CIUA 3WS6C 1BOYA 3D85A 3RVUD 2R2BA 1RFDL 3UZVB 3P4OA 5KVEL 4OZFH 1AGDA 4RGND 3HHRB 4MCYB 1ES0B 3SDDB 1NPUA 2MJWA 1QRNE 3UTSD 5T3XL 3GSOA 2OP4L 4JZNA 5EIQA 1WWAX 3QUZD 5HGGS 1NMAH 3DTXA 1BFOA 3O2VL 3D85B 2R2BB 2DMCA 3P4OB 3GI8L 1AGDB 5AZEL 3O3UN 1FNSL 2OL3H 1KEMH 4KWUA 5IVXE 3GSOB 4JZNB 1X7QA 5L8JB 3IU4L 3TP4A 3DTXB 2CKBL 1BFOB 1PFCA 4N1EA 4BELD 3ALXA 3MJ9H 4KMQA 3IS1X 2BNQD 1AGBA 4MXVF 3LPGA 3DX9A 2AW2A 3O8XC 3QFDA 1SEQH 2QQKH 4FQXB 5DTFA 3JWNC 4ETQA 5KS9A 1X7QB 1LNUA 5DMGD 1IGJA 3QEQE 5CEZE 1QSEA 4JFZH 1KCLA 5TQ0L 3DX9B 4NKDA 3QFDB 1KJ2B 1MY5A 1NAMB 1N2RB 3ZKMD 3GFUA 2I27N 2Q76A 5KS9B 1V05A 4PJCA 4UQ3A 3C5ZC 1IGJB 1RSFA 4P2OB 3RVUC 3UYRH 1JRHH 1CBVH 3NA9L 1YNLL 1QSEB 1BZ9A 4OM0L 3K8KA 5IT2L 4LCIL 1EZVX 2F5BH 4RGNC 4NKDB 1U3JA 2H32B 43CAA 4FG6D 1BAFL 2Q76B 2FR4A 1P4LA 4PJCB 1UH4A 3ZL4L 5EU7C 1MRDH 3U83A 4Y16D 4KZDH 4NQDA 3Q48A 4PRIE 2R8SH 2R0ZH 4ODSL 2HFGH 3QQ3A 1UADC 1BZ9B 3ULUF 3FQRB 3VH8A 5LWYH 4P2RD 3P30H 5KAQG 1FL5B 2C3WA 4OT1H 2FR4B 4CRPA 1P4LB 1EX0A 2DWDA 3D2UB 2HLAA 3WFCL 3MLVL 2C4XA 3LKSA 3NGBB 1A5FH 1ORQB 2B1AH 2XZQL 3QQ3B 4R90H 4Y2DA 3BRGC 5DXWA 3ZE0E 5ABDE 2DBLH 2AEQL 2ZZUT 1P84K 3GMLB 5DMGC 4ZOCA 4DGIL 1W0VA 2DWDB 2HLAB 4URTB 4FZEH 3LKSB 1MAJA 1JPTH 3S88L 4IBLT 1IM9A 1YEKH 1UH3A 4K94L 2VMFA 4Y2DB 3KJ4C 2LU4A 4GBXC 2O5XL 2FHBA 3ZKMC 1F3JA 2BVPA 1G84A 4EI5C 2P47B 5KTEL 5EORL 1M1SA 4XB8A 4HMCA 1W0VB 3BUYB 3T4YA 1IGCH 2BVTA 2XKNA 3B9AA 3FAXA 1IM9B 9CGTA 1EO5A 3QJHA 4G6AD 3EGSA 4UOW0 2PTVA 4FG6C 1JZ8A 1F3JB 2BVPB 4CU8A 4MXQD 3JBG7 1QFWI 4ZO6A 1KTLA 4GW1A 4Y16C 3TWCH 3V0AC 5DC0A 1GZQA 4Z7VF 3T4YB 4R97C 2XKNB 3HI1A 4PJXE 1ZANH 4HGWA 4QRTA 3QJHB 3EGSB 1HXMA 1S7TA 1WF5A 5EOQH 4XRCA 1DR9A 4MS8C 1KTDB 3G5XB 3P9MA 3MRPA 1KTLB 4PG2A 4DAGH 4YHML 4GW1B 3EYSH 2CGRH 1GZQB 1GGYA 5T3ZL 1G9MH 4M7JL 3HI1B 5JPNA 3ZDXF 4JFDD 2FJGB 4HGWB 5DFVD 4QRTB 2K7QA 4O4YH 5HVWA 1J11A 1KC5L 5E00A 3B43A 4OLEA 1S7TB 3CC5A 3KXFB 5SWSE 4PV8B 4WHYG 5C3TA 3L95B 3P9MB 3MRPB 1A0QH 3O3BA 3QDHA 4HT1L 4R4FL 3S35L 2H41A 4DGYH 5JPNB 1UQSB 2LAAA 5BW7C 1WGOA 2DL2A 4MSWA 5IK3A 4KVCH 3QDMA 5CJQL 5IROC 4IIQC 1FFOA 1JWUB 4TVPE 5FA3A 5E6ZA 1GHFL 2Y06L 4XNQA 1KCVL 3C6LD 4G6AC 3GMOB 1MFBH 5EH1A 5D72L 4EN3B 3CMOH 3L7EA 1BPVA 3UDWA 1KFAL 3QDMB 3K2UL 4MXQC 1Q1JH 3V8OA 1FFOB 5FA3B 3O3AA 3QUYD 2ZCHH 3MREA 4KROB 4XNQB 1BECA 1F8TH 4XBPA 4ZTPL 3H2WA 5I2IB 4PJ7F 2ICWI 2QLVB 4YC2C 5I75B 1CD1A 3L7EB 4YUEL 5D7JD 3RWJA 2XWJB 3OMZA 3ULVF 3SDAA 3RRQA 1YNKL 3BDXA 4X0KA 2VQ1B 4Q58C 5CZVH 2VQUA 2CD0A 3O3AB 5GS0H 5J56B 4D9LH 3MREB 2Q1EA 5F70A 4UU9A 4XBPB 1QO3A 1ZTXL 3DYPA 3MUZ1 1HILA 4OFKA 1EIBA 4PY7B 3RWJB 4LP5A 2DLFH 3SDAB 5H2BA 4WW1A 3GJEB 3L6FA 4X0KB 5D6CA 4GG8A 3O6FA 2HT2D 3HS0A 5GRWA 5DJ8A 4M3JA 2XV6B 3BZFB 1HZHL 5IFJA 1MFDL 5DQJA 2X4NA 3TNMA 4KJQC 5J6GA 1HILB 4KAQL 4Z7UA 4PJAE 3ZYZA 2HFEA 4QRRE 4DFHA 5D7IA 3KNBA 4L29A 4WW1B 4BZYA 3GHBL 3UTTE 2D7PA 5F7WC 5D6CB 5CD3A 1T22B 4GG8B 5EG6C 5BS0A 3O6FB 3KS0J 3HS0B 5KVGH 5KSUA 3SGJC 5IFJB 5DQJB 3TNMB 2WIIA 4PJGB 4CJ1A 3CSPA 1BM3H 4IRZL 1HKLH 2XOTA 4Z7UB 5IBLD 2MKLC 4LHQB 5D7IB 3KNBB 4L29B 1QRNA 4I0PA 1S8DA 2NY0D 5CD3B 3CSGA 4RQQA 1CDGA 2AABH 3OAZK 12E8L 5KSUB 5KN5B 4MB5A 3SGDI 3PWUA 2WIIB 1FGVL 2EE9A 4H5SA 5D7JC 1MI5E 1EJOL 2OK0L 1CDHA 1E6OH 1KCUL 2WNGA 4JZJA 4K23L 1MCDA 1YC7A 3SJVD 4I0PB 1S8DB 4M48L 3MRRA 1HI6A 5DVLA 3VWKD 4EI6B 3H3PH 3VXMA 3PWUB 5C08A 2DI9A 2V17L 4H5SB 2VLKA 5EZJB 1I1AC 1A7PH 4KFZC 5GGRB 1T2QH 5E6IC 2HT2C 3VFGL 1HI6B 4ELKB 3MLZL 3QEQA 3VXMB 5C08B 2FYYB 2APFA 2VLKB 4UTAL 3HB3D 1UACL 1J1PL 2Z31A 4J12A 1CLOL 1NCBL 3QRGH 2EC8A 4X6BA 2ZJSH 5HD8D 4K3EH 4PBVC 3S6CA 3H8NA 3SGKC 3V79C 1DVFD 1TVHA 4WUUB 4IRSA 2A77H 2Z31B 4K3JH 1OAYL 4KJWD 4M43H 2NY0C 3MJ7B 1SBBA 4X5LA 4WY7H 3RUGF 2FATH 3RX5A 3CDGB 4POUB 4PRIA 3CFBA 1TVHB 4NC1C 4GAYA 4IRSB 1Q9WA 3MBEA 3D1MC 3HMXH 4Y19D 3C08L 5CSGA 1JUFB 4AIXA 2YPKB 2KZWA 1DQQA 2GJ6E 1YECL 4ZUUA 1WAAF 4C54A 3JV5A 4PRIB 3CFBB 1T7VA 4RAHA 3MBEB 4Z7WA 3W81A 4F58H 4RA3A 1NUGA 1P6FA 1ZVHA 1BMGA 2P8PA 3LKPA 2R39A 1YC8A 1AH1A 3NA4A 4HHAA 1DQQB 2D7MA 1OARH 4ZUUB 4R96A 3ARGC 1DQDL 3HB3C 4Z7WB 4NZUH 2P8PB 4Y88A 3MCG1 4HHAB 4OGZA 5HD8C 4LL9A 4TUOA 5I1EH 1DVFC 4NKMA 4LASL 4R96B 5B21A 5C0CB 1FRGH 4ZNCD 3WD5L 4PRHE 4R4ND 5FF6B 5CEZL 2E27L 3QEGL 4KJWC 5EFIA 3MRDB 3KLHD 4QXUL 5CKGA 5C70A 1RZ8A 4TUOB 3X13A 5DR5H 1TJHH 3WNMA 3LY6A 7FABH 3B9KD 4JFFE 4PJXA 1JZ7A 3UEZA 4N0YH 4R2GB 2PW1B 1KYOK 4ZNEE 2CK0L 4LGPB 5EFIB 4IS6B 1CDIA 1T0NB 4LLUA 4XMKL 1IKFH 1WBXB 4YHZL 1QFHA 1RZ8B 2EXYC 3X13B 1H3VA 4YHYB 1XIWC 1K8IA 3K80A 4RWHA 4Q7DA 2FNBA 4M62L 3BEWA 4MB4A 1TJIL 2J8OA 2D7TL 4LLUB 3H42L 5HDQH 1N0XH 5IR1A 4C4KT 2FDBP 3IFPA 5J12C 1JZ5A 2QADD 1K8IB 2E7HA 3RGVD 1H3PH 4FHBD 4KUCD 5D1QA 1GGIL 4MQXD 5KG9A 3BEWB 1WUNT 3EYUL 4RWYL 3ARBD 4IRJD 4LCUA 2IGFH 1YQVL 3IFPB 1FJ1A 4X6DF 2E7CA 3QIUA 3P4NB 1IAKA 1XFPA 5EZIH 5D71L 1FFPA 3GRWA 3UTPE 4FQPA 4MMXC 3FB6B 5D1QB 5J0BA 1JNHA 3E3QE 5GS0D 1G9MC 5KG9B 4D9QE 4RFNC 2Z92A 4LCUB 1HYSD 1J86A 1JPGA 1N3NA 2WWKO 1IVLA 5GHWL 1CI5A 5C9KA 2R0LL 1FJ1B 1HHJB 2PCPA 3QIUB 1Y0LB 1IAKB 4NN7B 5CLTA 1B6DA 1FFPB 2APXA 3MLXH 3CX2A 5E4EB 5D5ME 2EDXA 1JNHB 4K7PL 4CUCA 3PV6A 4GG6E 1NFDF 2MTPA 4KUZL 5DFWH 2QHRH 2Z92B 2KL6A 2H1PL 4MAYB 4QNPF 1JPGB 1X4YA 1F4XH 4OSUH 3NCJH 5CINL 4GRMA 2HKFH 1MAMH 2PCPB 4XBGA 5GS2H 3ZSTA 2XFXA 5DZNA 5EOTA 5DQDH 3MRKA 1G7HA 3FQWB 5C0DA 2UV3A 4CAGA 5I9QC 4NBZB 3RAJH 1FYTD 3VXUE 3K74B 1MOEA 3RGVC 2VXQL 3THML 5DK0A 3P4MB 2HAZA 4MQXC 4R6UA 5EOTB 3MRKB 1G7HB 5C0DB 4PJAA 3W82A 2F58H 3ARBC 4QRRA 4IRJC 5IEHA 4Z0BH 4RBPK 1ZHBA 3DRQA 5F88A 3CVIH 1WWCA 3MOAH 2NY7H 1OAUL 1OGTA 2FHFA 1YN6B 3HLAA 2P42B 5DK0B 5GS0C 1A6WH 4QWWD 4NC0B 2FL5A 4EJ1C 3U0WH 5K9JH 4L1HA 4QRRB 1I9RL 2AEWA 3BZDA 4XZUB 5IEHB 1HYSC 3ARFB 4OGYL 2NY3D 1ZHBB 3WKMH 3DRQB 1NLDL 3E0GA 5F88B 5JUEH 4WO4D 1OGTB 3ZT7A 2NY6C 3HLAB 4TVPL 4RFOH 2K9UA 3V4PL 2OJZL 1U91A 2X1OA 1JGUL 1MI5A 1I9JH 4M7KH 5D9SA 3GRWL 3UJJH 5LQBL 2YHGA 2R56H 4AL8L 1ZHLA 4R26H 1L0QA 3JWDL 2B2XH 4HS3A 2AXGA 4POYA 1U91B 2EIBA 1MI5B 5D9SB 4ZS7H 1AO7A 1K3IA 3A6OA 5T33H 5IHUH 3MO1A 5IIEA 2IQ9H 1LILA 3TFKC 1ZHLB 3MLUH 1OAZL 2F53A 1DCLA 1AQKL 4HS3B 1UCBL 2AXGB 2DJSA 4ODUA 4JO3H 3MBXL 4YHOH 4TSBL 4Y1AB 4Q9RL 3EAKA 3MNZA 1AO7B 4HWBA 3LPFA 5IIEB 1N5AA 1BJMA 4PJ8D 1V7NH 4ORGA 2OXGA 5GGTH 3RL1A 5IB4B 2DQDL 4Z7OE 1RHHA 3FRPA 2F53B 3OB8A 4NHCL 3TBVA 3QXVA 1NSNH 3VFUA 5CJXC 3VW3H 2OJEA 1IL1A 2IALA 4GLRI 1M6OB 1FORL 3LEVL 1BOGA 3MNZB 1CG9A 1N5AB 5L9DL 2NY3C 1MCQA 4AEIL 1I8KA 1MPAH 4MA1C 3C2AL 4WO4C 4PJEF 5D70H 5FV2A 3STZA 4U6HA 1RHHB 1MFEH 5HHMD 3TBVB 3B3IA 3TT3L 3RIFF 1IL1B 2IALB 4NFCA 3GJFA 2D4FA 3PDGA 2X5PA 1CG9B 5T1DH 3GUTB 3AC0A 4OZGB 5H8DA 4OLXL 1I8KB 1UEYA 3STZB 2GJ6A 4HIIB 4K3GA 4HQQL 3VMPA 3B3IB 4GMSL 2CLRA 1U8OA 4G8FA 4EKXA 1YMME 3GJFB 1I85A 4QHNA 3BKJL 4Y0GA 3CXDH 2VXSH 1F4YH 3FOMB 5FO7A 3QWRD 1P7HL 1W0WA 3IU3A 3QPXH 2V2TA 3WHE0 4P99A 4HIXL 2V5TA 5IHBA 3QDAA 1U8OB 4FXKA 3MNWA 4YXKH 1YEFH 5BV7B 4PJ8C 2V2WB 2B0SH 3IF1A 5D6DC 5I1GL 1A64A 35C8L 1KCSL 5FO7B 3PGFL 1W0WB 3IU3B 4WCYH 1LO2H 4L8SA 5ICZB 2V2TB 2AV1A 4GQPH 1GZPA 2ZSWB 2E7LC 3MNWB 5DA4A 4G8EA 4PRHA 4ZDHB 3L3HA 2PXYA 3UYPA 1OD9A 1XGYH 3IF1B 5DVOA 3SDCC 1GOHA 4LDOB 4HWBL 4NQEE 4NM8L 4UOJA 2AV1B 2EE3A 4HPOH 5IVNA 3O2VH 1DZBA 3D69A 1MUJA 4X9GA 4EEEA 3VG0H 3L3HB 2PXYB 4DEPB 4W6YB 1I9IH 3PGDA 4JM4L 5D2NA 3NAAH 1IC5L 4Q0XH 3HTLX 1UWXK 4KKAD 1JPSH 3QFJD 2YC1A 2KBGA 5F1IA 3G6JF 4HPYH 3D69B 2HP4A 1PD6A 3NIDF 4JN1L 3L3OA 5FUOL 2WQ8A 1A6PA 3CFCH 2XIDA 3PGDB 5ESQB 5DD5L 5C92A 4KC3B 1P5UA 5D2NB 3CVHA 2HVJB 2F8VA 4KVNL 1VKXB 4UUJA 2P7TA 5F1IB 3PQYD 4Y4FA 2R9HD 4WI5A 5T1LA 4FQ2H 5TQ0H 1FNLA 3L3OB 3FFCD 5BV7L 3TN0A 5DJDA 3WIFB 3UTQA 3TZVD 3V6FB 3CVHB 5F21B 5K59E 2HRPL 1CT8B 2W9DL 5ID0A 4UUJB 1MJ7L 2DD8L 2A9ML 2P7TB 3MGOA 5HY9A 4DTGL 3F58L 4Y4FB 5T1LB 4QKXB 4RRPA 4BQBA 3I75B 3KR3H 3QG6A 5E8PB 5FYKL 5A43C 4U6VH 3M1BA 1QBLL 3TN0B 4AQ1B 5CGTA 2ERJC 3UTQB 5A2IH 5MHSD 4I3RL 2SEBA 2XN9D 2IFFH 5ID0B 4ZOAA 4KU1A 5HY9B 4M9OA 1MJUL 3R1GL 5D5MA 4WI8A 5FM5M 4AY0A 4S1QL 3QG6B 5I19L 5KSVA 5BMFL 3M1BB 2Z8RA 4X7CC 4QXWA 2SEBB 4OF5A 3TBSB 2KZ1B 2DQUL 2MQ0A 1ND0A 2MSPA 4MNQE 1PVHA 1MNUL 4P5TB 2PYED 1TITA 1KG0A 3E1F1 1F6AB 5D5MB 3SE8L 4NYLB 1JYVA 1E4WH 2DDQH 3IAPA 3S96A 2J8UE 4MJID 2AEQH 1QFUL 3VXUA 3RQ3A 1KELL 3RIAF 5F3HB 3UPRB 1KPUA 1V8HA 1ND0B 2XICA 3DUUA 2AJSL 2IF7A 4MA7L 2R9HC 1F00I 2YD4A 5JW3L 1KG0B 3V7AE 1CXFA 3V5HA 3S96B 1FVCA 4XH2A 5I1KL 5I1CL 5JXED 4TNVF 4B7LA 3TZVC 3C2SA 3TJHC 3VCLA 3IRPX 1MCRA 1WITA 5EORH 3B2VL 1KJ2H 4QOKE 2A9NH 1P4IH 4XC3L 1NAMH 3QISA 3WUWA 3QG7L 1LO5A 3RTQB 1U6AH 3WUZA 3CVHL 5DJ2A 4XVSL 1A8JH 4XPFH 5ICYA 1J9CT 3PWPD 1FVCB 4XH2B 5JMOC 1G7MA 2DQHL 1KJVA 3QNYA 1J0JA 3VCLB 2EIDA 4APQA 2NX5D 2H32H 3WUWB 1LO5B 2HJLA 3OX8A 4FNLL 2P5EA 3A0OA 3QI9D 3NPSC 4KK8D 3BN3B 3CFEA 3S3SA 3DRTA 1G7MB 5DRNA 2Y07L 1ZLWH 5B8CA 4APQB 5ANMB 4O2EA 4XCFL 1T21A 2HJLB 3G5YB 3OX8B 2P5EB 4NJ9H 1XGQB 5EA0L 4ZG1A 5DA0B 1VGEH 2A6KB 5I1IH 5EPMA 3JXAA 3CFEB 1EFXD 1DANU 3HA0A 3O4LA 5DRNB 3A67L 3RIFK 5DD1H 1DSFL 3LH2L 1RHFA 4YK4C 1RULL 4HT1H 4C83A 1T21B 1OW0A 4S1SH 3CSYA 4U0RB 4N9GA 5DURD 2BNRD 5EPMB 1QSFB 3PWNB 1U3HB 3O4LB 3PP4H 2AS5M 5AG8A 2BCKA 4XB7A 4MJ5A 2R69L 1AJ7L 4WIQA 2LFGA 4D3CL 1GHFH 2Y06H 1SJHA 2YKLL 3E8UL 3CSYB 4G6JH 4I0CC 2BSSA 5E8EA 2RCSH 3BQUD 3AMLA 3BSZL 4FFZL 1UZ6E 1XGRA 2J6EA 2I60L 1LEKA 2BCKB 4MJ5B 3H3KA 3O0RL 2XZCH 5GISL 4ODWB 3QI9C 4KK8C 3LN9A 4XT1C 1YEGH 2PO6D 4KZEL 4ZTPH 2CJUL 4B7IA 1R5VB 5DC4B 2BSSB 5CUSL 4YUEH 5IBUG 5KJRH 5GSVB 1YNKH 3OKLA 3L3IB 1LEKB 1P9MA 2CLVA 1WV7T 4EOWL 3W11D 1DBAH 3GNML 5IHZA 2EDQA 5JQ6H 4U1GB 3U30B 4KTDL 3QIBD 3OKLB 2W07A 3I6LE 2I9LA 1F58L 2F54A 3AUVA 5AAMA 3OKDA 3DX6B 1DFBH 1OQXA 5EU6D 4YAQA 1DL7H 2Y7QA 5ETUA 5T3XD 3DECA 3FMGL 43C9A 1LK3H 2I9LB 4XCEA 2F54B 2CDGA 3C9NA 3OKDB 3BO8A 4DOHB 3RKDD 4JGMA 1XR9A 4YAQB 2Y7QB 2NXZB 25C8L 2JJWA 3S3PA 1UH2A 3RWGA 3BQUC 5LJYH 2DTSA 2EIZB 4PRDA 4XPAL 1JBJA 3S35X 43C9B 1JHLH 2IQAA 4OZHA 5M95B 4NQEA 4CVXB 1C7TA 2F74A 4J3WA 4XCEB 5MEOB 4NC2B 3C9NB 2PO6C 3BO8B 1B0GA 4S1RL 2FECI 1XR9B 1FGVH 5BRZA 4M6ML 2EH8H 5ADPL 2B4CH 3ZSSA 4NM4H 3HAEH 3VD4A 1ZA3A 4FQIL 2IQAB 4OZHB 1QHOA 4KMLB 3W11C 2J6EL 4OD2A 4BK5A 1INEH 2EKSA 2FEDC 5EC2B 1B0GB 3S7GA 5C0FA 5BRZB 1U8QA 1XR8B 2ESVE 2ZG3A 4GRWF 3QIBC 5C6PB 4G43A 4OM1H 3QHFL 4XPGH 1U36A 2I5YL 5DMIL 1PDKA 4LLMA 3TCLA 5I1HL 4OD2B 4ETYA 4MXWL 1MHCA 2VZUA 3BJ91 1U8QB 4UTAH 2XNAA 3SDDD 1WCBA 4ZD3L 4G43B 4HKZA 2R0KH 4KTYA 4LLMB 2DRUA 3K81A 3RKDC 2J88L 3D85D 4ZAKA 4C56A 1MHCB 2X42A 3MFFA 1FSKC 4I0KA 4F57H 2XNAB 5JR1L 3RIAK 1X4XA 1WCBB 5ITBH 1CK0L 3RU8L 3LS4H 4DVRH 1UM4L 4ELME 3H7LA 2WK2A 2GW5A 3VMOA 3O9WA 2VR4A 4C56B 3MFFB 1ZT1A 3O3EA 4ENED 4YDLB 1J5OL 5DUPL 3TC9A 2OTWB 3HE7C 2DQJL 3GB7B 4OFPA 1DBMH 4R0LB 5HDLA 5L0QB 4LPWA 1PSKL 4RGOL 4P3DA 4NP4L 3FCTA 1L7TL 4MNQA 1AY1H 5MI0C 1T3FA 1WQVT 3K4DA 4JQIL 1LO0H 1ZT1B 3MA7A 3O3EB 5SWZA 4HC1H 4TULL 1UYWH 1SJXA 4WFFD 4BQ8A 1IGFL 2AGJL 2J8UA 4PJBF 2CDEA 4HUXA 2NTFA 4P3DB 3FCTB 1DANT 2EH7L 4PUBH 1QSED 4DN3H 4MNQB 4M61B 1T3FB 2M2DA 2WBJA 1MFCL 2CQVA 5SWZB 3SDDC 2ZCKL 2J8UB 2CDEB 5CAYB 1CWVA 2NTFB 1A6AA 4JG0L 1AXSB 1RAMA 1EEZA 1S5HA 1LE5A 3CH1B 3OV6A 5ACZA 3QEGH 3DUHA 5T3ZD 4GRLA 3QXTA 1KLGB 3L9RA 4DUWA 3W2DL 4NQDD 2XQBH 4XNYL 4X98A 1EEZB 4LCWB 2OYPA 1ACYL 1S5HB 1LE5B 1IC7H 1C8PA 4FQXC 5IW6A 5AD0A 1JHTA 2DTMH 1J88A 1OAXL 3BD5A 5ACZB 5K9OA 4GRLB 4KKBD 3L9RB 2J4WL 5KW9L 5JHLL 1H0DA 1DEDA 4CMMA 5HJ3A 1AP2A 2AK4B 4PTTA 4X98B 5FCUH 1S5IL 1JI2A 3BT2H 1C5DA 4QRPA 4O02H 4Y2DD 5HSFA 4KRLB 1IAIH 5IW6B 1KENL 4JGUA 5AD0B 5K9OB 1C12A 4RMTA 4BK4A 4LLVA 1TJIH 3OJVC 4P2OC 3B8YA 4JDVA 1B4JH 1H0DB 2XTJE 3LEXB 4CMMB 5HJ3B 1AP2B 3PL6A 1IM9D 1AGCA 2DMBA 3GBNH 4QRPB 1C5DB 4WJ5A 4U49A 3I3EA 1KEGL 1KJ3L 1J1OL 3MRJA 2D31A 4PJ5B 4N0CD 2D9CA 3F6LA 4LIQL 1OD7A 4JDTL 1N4XL 4RWYH 2O61A 1ZS8A 2X9XA 4I3SH 1Y6NR 1KF9B 3FT3A 4OGXL 2VUOA 1YYML 4FQ1H 4KGLA 1A6TA 4WJ5B 5D71H 1YYLL 4OCWL 4K7FB 5C2BH 2VAAA 1RUPL 3MXVL 3MRJB 4XBEL 5ISZE 4OIIL 1S7SA 4JO2L 2GY7B 3NGBC 1ZA6A 4HEPG 4BZ2H 4O5LL 1A6TB 4XC1L 5I16A 2YD7A 4ZUWA 2VAAB 3DO7B 4QXGH 1YEJL 4KKCD 1T03L 1P1ZA 4WWKA 4MLSA 4KUZH 4KRPD 3S37H 1ZA6B 4NQCE 4PRBB 4DCQA 5CINH 2E6PA 4ZUWB 2W1NA 3I2CL 2UVEA 1U8LB 3QT2A 1I7UA 1P1ZB 2YD5A 1QFWM 4KHTL 5C0RH 5JORA 1BEYL 1NCDL 4ALAL 3VD5A 3D0LA 2E3VA 5FO8A 2VIRA 1ZVSA 2VXQH 3CMGA 1UM5L 4I4WA 5D7LE 5FM8A 3QDMD 4N0CC 1FCCA 2GSGA 3VFSA 3RHWF 2R4SL 5CJOL 1MCFA 2D7QA 4PLKC 5JORB 1MHHB 4JG1H 4HWNA 5IFAH 1TZGH 2DQTL 3D0LB 2DQGL 4H20H 5FO8B 4RAUB 2JK5A 2GJJA 4CVZA 1IEBA 2GSGB 3VFSB 3HRPA 1S9KC 3IKKA 4YX2L 3VDCA 3HUJE 5I66A 2K1MA 1X44A 5C8JA 4F2MB 4LDLB 2Z0BA 4EDWH 2JK5B 2UWEB 3VA2C 4HF5L 4HK3J 4KKCC 5IV2A 3AREA 1IEBB 2EDRA 2ZUUA 3SDAD 5ACLA 1JGUH 1QPPA 3WBDA 2VL5A 3QWOA 4PG2C 1D9KA 1DQMH 4Z77B 5E08L 5B39B 5I66B 5DLMH 4LKXB 3EKCA 3QSKB 1I1FA 3JWDH 1KB9K 3VFNA 4CVUA 1Q0YL 3AREB 2Z93B 4Y4HA 2VL5B 3QWOB 1A3RL 1D9KB 3O6FD 5HYQA 4L3CA 2FX7L 4JAMA 4K7PX 4EN3C 1I1FB 5JDSA 4N8CL 5I8KH 2NLJA 1DP0A 3VFNB 4HUNB 3U82B 4HBCH 4ONHA 4XAWL 4U0QB 4KROC 5FK9A 1HDMA 5BS0D 4NBXB 3O41A 1NMBH 1GGUA 3IDXL 5HYQB 2ARJB 4LRIC 2B4CC 1A7OL 1HK6A 4OIBA 4BYHA 5I75C 2XPGA 5JDSB 4YBQD 3UDWC 2COQA 4JPWH 1MIEL 5IB5A 3UTSE 1NCCH 1UJTA 5FYKU 4ONHB 1QRND 4I0PD 1T5WA 5I8EA 5FK9B 5EU7E 3O41B 3QIWA 4AJ0A 4ELMA 5EBLB 4XHQA 2PYFA 5HHQA 5CP3A 3HFMH 2XPGB 2A83B 2AEPL 1RUMH 3SDAC 1FGNH 1XAUA 3W9DA 4H88L 3GBML 5IB5B 3QXWA 4M02A 5I0ZA 3DUSA 4LSPL 1T5WB 2VNCA 3FFDA 3E6FA 3QIWB 3Q3GA 4XCCL 4NO0A 3VXMD 2PYFB 5HHQB 4NWUH 2BNQE 5C08D 2HYMA 3UJIH 4HKJA 2VLKD 2LV4A 5D2LF 3T8XA 3W9DB 2BMKA 1GOGA 1QPXA 2C4FU 1H5BB 3BKJH 4LBEA 3O6FC 5DK2B 2F9BT 4OLZH 3BFOA 3FFDB 3DI3B 1CN4A 2XTLA 3HNVL 4IHOA 5CEZD 4HKJB 3BGFB 4H1LH 3ZDZF 5GS1C 1OT2A 2X4UA 2LAGB 3RDTB 2VDPL 1EV2E 5D93B 4UV7H 3T8XB 3VFVA 2BMKB 2Z31D 2E7BA 1VFAB 35C8H 4P4KC 4XVTH 3VFWA 4F7CA 1KCSH 3O2WH 4B50A 4IHOB 1RZIA 4IRSD 4YBQC 5F7EH 4CBPA 3VFVB 4HSQA 4I0PC 3H9ZA 2VLJA 1U95A 4JFQA 1PG7X 4QGYA 5C86A 3OKKB 4F7CB 3U7YH 4P48A 4PRID 4TYUA 3OJMB 2Z9TA 1RZIB 3MBED 2IBZY 2IANB 2DLTA 5DRXA 3LAFA 2AXFA 1RU9L 4ODTH 4E0RA 2VLJB 1U95B 3KWWA 4Y7MA 4WV1B 3EIFA 4JFQB 1WICA 3OBAA 3EDDA 1EEUA 2LVEA 1X9QA 2J5LB 3WJLA 2F15A 1IC5H 4GH7B 5JXAH 2FIRT 5DRXB 2Y1VA 2VWEE 4E0RB 3KWWB 1U8HB 1G9NH 4G6KL 5EOCH 5FUOH 3GJFH 5DSCA 4QHLA 1T89A 3EFFA 3MC0A 3TJEL 4JKKA 5FUZH 2UUDK 1U92A 2Z31C 5DK3A 4OKDA 2HLFD 2XKUA 1CFVH 2P49B 5DC9B 1HHKA 1T20A 3AS1A 5DSCB 1T1ZA 1V3LA 4IRSC 5DHXB 3V6OA 3RA7L 5KSBA 5IVOA 5L8KB 2BK8A 1QZ1A 2Z35A 1CGSL 4RA0C 3NZHL 1U92B 4PJIE 5DVMA 4A6YB 5KVMC 5ISZA 3V95A 2P44B 1T20B 1FIEA 4CU6A 4OLUL 3VRIA 2VDRL 3VXNA 3MBEC 1HCFX 2DM3A 4JO4L 4OJFL 5KSBB 2Z35B 4UOW1 1FN4B 1NFIB 5L2KA 5FYLL 3BPOB 4X7DC 4M3KB 3V0VB 2A1WL 1FVDB 2FD6L 5CBAB 3SGEH 5F72S 3VRIB 3VXNB 4TSCL 4NQCA 1NL0H 5KZCB 4Z0XA 2AEIT 5L2KB 1MNUH 2FGWH 3K46A 4U1HB 3DVFA 4ZUTA 3KAAA 1CFSA 3BWAA 2ZUTA 1C1EH 4U3XA 3UBXI 4NQCB 3VRJA 2D03L 5D1QD 1O0VA 2QQLL 3Q0HA 1X5YA 2HLFC 3LHPL 4WI4A 5DZOA 3PNWB 4Q9CA 4HDIA 4ZUTB 3PE9A 5EN2B 5I1KH 4OF7A 4NIKB 1CFSB 2FX9H 4TVPD 5E2VL 3QEUA 3LRSB 4GO6B 3QIUD 3HAEG 3EDFA 3KPRA 4R2GC 4N90E 3OAUL 3VRJB 3WS6A 2CRIA 3QG7H 3OXRA 3CIQA 3CVHH 4HXBL 4NJAL 3TVMC 3KYNA 2IPUK 4HDIB 3B8SA 4OV5A 4D94A 2BDNL 3MCLL 4JJ5B 5T1KA 3QEUB 1KIRA 3HUJA 1ZSDA 3KPRB 1M05A 4LQFL 3VGHA 1KLUB 3SDYH 3OXRB 1SVZA 1VPOH 1OQOA 1ZMYA 1A3LH 1BJ1H 2D4DA 3HG1B 1MRFH 4OV5B 3MV01 4NO2A 3QUKA 5FHAL 5T1KB 2NZIA 1KIRB 4GFTB 1ZSDB 1M05B 2V2XA 2FLBT 3JWOL 4NOFA 4XCFH 2WBKA 1Z9OA 5E95B 1SBSH 4LAQL 5I18L 1JZ2A 1K3ZA 4GT7A 4NO2B 3QUKB 5FO9A 1M7DA 4FFYH 5D1QC 4JHZA 2C4FT 3VFMB 1GC1H 5GJTH 3N85H 3FQXA 4UDTA 3GMRA 5SX4H 3EFDL 3BAEL 4QRRD 4CNIA 1VFBA 2A2QT 5FO9B 3QIUC 4LSRL 1M7DB 4NN7C 4FABH 1K85A 1HKFA 2R69H 5E4EC 5AZ2H 1EJ6A 3FQXB 4UDTB 2GIYA 1LO4L 3GMRB 4YDKL 5INDA 1OWRM 1T1YB 3JWDC 4MAYC 3U79A 5HXMA 3JZ7A 4YZFF 3SOBH 4CNIB 1VFBB 2R0WL 1IQDA 4ZQKB 1I8LC 3NIFF 3RFZC 4NC1E 4M1CD 1OP5H 5DVNA 1U42A 3CFDA 2NY2D 1MI5D 3ZDYF 2CIKA 4KH2A 3U9PL 4KZEH 5INDB 3DXAE 2CJUH 3JVGA 3PGCA 3ROLA 4MA8H 1IQDB 2YD3A 2VAJA 3RWHA 2Q6WB 3JTSA 3OSKA 2IFGA 4YR6A 5E2TH 4F7MA 2ZUVA 3NVQA 1NGZA 3IKCB 1AO7D 1D5IH 3P9LA 3DVNA 3RJDA 3T65A 3PGCB 1NAKH 1NGWA 3QQ9D 3OKNA 1IKNC 2F53D 3RWHB 3JTSB 4YR6B 4IDJL 4F7MB 5KANG 2RR3A 4DQOH 1NGZB 4X6CF 3N1QC 4GBXA 2X1XR 3ARFC 3P9LB 2ZOKA 3DVNB 1F2XK 3T65B 4EI5A 2VZ3A 3ILPA 1A7RL 1NGWB 2YXFA 3OKNB 1KN4H 1B2WH 3S98A 4NDMA 1X5GA 3BD3A 3SO5A 4M93B 4X7SL 4PRNA 1HH6A 5ADOL 3MOBL 1DUYA 3TA3A 5CEXA 25C8H 1CR9L 4BJLA 4TPRL 3I50L 2NY4D 4PJFE 1TMCB 1RUQL 1XCTA 2GI7A 3KPTA 3D39A 1ITCA 4HIHB 4ONFL 4KHXH 4M1CC 3WFDL 4NDMB 1FV1B 1WFOA 4PRNB 1KOAA 5GS3A 4Y19E 3IFLL 1HH6B 1CFQA 1I3GH 2ZSVA 1DUYB 3AY4A 3TA3B 5CEXB 4RZCA 1J05B 2GJ6D 2OQJA 1XCTB 5AUMA 3D39B 4BH8A 4X5XA 3KJ6L 5FA4B 4XNZB 2YSSB 3EOAA 2MQ3A 2ZSVB 3GKWH 4FS0A 1A1OA 1CD9B 5JW4R 3QQ9C 4RZCB 2OXHA 4Z7VB 2OQJB 5AUMB 4BH8B 4X5XB 1CXHA 3BZ4B 2E9IA 5BW7A 5I1HH 5FYKD 1FNGA 3DVGA 3T2PA 1UWGH 4KJPC 1XF4A 2MPAH 1PW3A 1FBIL 4MD4A 3V4VH 2FBOJ 5DWUL 4LSUL 4ZD3H 5F7YC 3QZWA 5CLWA 2HKHH 1EGJH 5HGDA 1FNGB 1KPRA 3DVGB 4PJIA 4PRHD 3UO1L 1XF4B 4MD4B 2PXYD 3REWA 3D3VA 5FOBA 5JR1H 2L4OA 3DURA 1F4AA 2OX5A 1T1XA 4O58L 1G9NC 1WC7A 2KUTA 1UM4H 4ZPVB 3Q5TA 4DKDC 5HGDB 1KPRB 4PJHE 3ROOA 2NYYD 4PJIB 1NUFA 2GUOA 4FN0A 3REWB 3OAYK 3D3VB 1I3UA 4JHAH 2JIXA 5DUPH 1ZLSL 5FOBB 5A3ID 3DURB 5FKAB 2X4OA 3WEXB 2HH0L 2BSRB 1WC7B 2AJ3A 5BV7C 4NP4H 2Y25A 5IMKA 4F15B 3NZ8A 5H94B 2G2RA 3NCYS 1FNAA 2GUOB 3RVXD 4Y4KA 4U1KA 2JIXB 4TULH 2OZ4A 1NEUA 2IWGA 2X4OB 4NNPL 4NUJB 2X1WL 2AJ3B 4AYFA 2JCCE 3NZ8B 4JKMA 4Y4FD 2WAHA 2UY7A 5ALCL 1YPZE 4XPBH 5T1LD 3DV4B 4M1DL 3IJYA 3WO4B 3QDGE 2D7NA 2DM2A 4FXGA 4Y4KB 3TN0D 4U1KB 5HPMA 4HFUL 2R1YA 3CZFA 1MCOL 2G75A 5C0AB 4IDLA 4HS6A 3SGJA 1HSAB 4E42A 4JRXE 4ZFZB 1U2CA 3UTPD 1MF2H 4JG0H 2PXYC 4DEPC 2X9YA 3IJYB 2ADJA 4JO1L 3MGTB 5K93A 4P23A 1T7WA 4D9QD 5HPMB 3FO0H 3CZFB 4XVJL 2G75B 4HS6B 3V7MA 4ZPTB 4P46A 4PP2A 4KI5C 2VC2H 5FGRA 4K8RL 1U58A 3QXAA 2ADJB 1BIIA 4WI3A 4P23B 4G8GE 5D2NC 5A3IC 2AV7A 1YNTA 4TUKH 1B3JA 3WLWD 1IAOA 2J4WH 3C09B 4P46B 2JJSC 5GRJH 2IPKA 1LEGA 3FKUS 3V5KA 4LNRA 1GAFH 1S5IH 1I1AA 1NLBH 1U58B 2J1KA 3RVXC 3WFBH 3QXAB 3PJSA 5E6IA 3VXUD 2AV7B 4XGZA 1NBZA 2ATPA 1IAOB 4QXTB 2ATKA 1ZGLA 4QHKJ 2IPKB 1LEGB 3HPLA 4Y4FC 1W0YT 4LNRB 3Q2CA 3TN0C 1R5IA 3PJSB 4R8WH 3RNKA 4H26A 1TTFA 5EUOF 1CGYA 1NBZB 3ESVF 2ATPB 1N4XH 2OZ4L 4ZMAT 1ZGLB 4JKPH 2OL3A 4DGVL 3HPLB 1EEYA 1U0QA 2FJFA 3E3QC 4OGXH 3GIZH 4V1DE 2DQCH 2Q7NA 4PLJD 1DDHA 1BF8A 4BFIA 1R5IB 1XGUA 3OR7A 4H26B 2Z91A 3MXVH 3N9GL 4OIIH 2BERA 2QSVA 2I25N 4NT6A 4APQD 3D48R 3QH3A 3T0BA 5HYJB 5SX5K 3CFKA 2YZ1A 4H0IA 4P5TC 3VGDA 2P5ED 3MRLB 5IUSA 1FDLL 1EEYB 2FJFB 5E9DE 4O5LH 1DDHB 1QLFB 1V7MH 2B1HL 4BFIB 4H1LG 3DXAA 1GC1C 3OR7B 2Z91B 5TE7H 2OTPA 5CGYD 3WLWC 1FIGH 3QH3B 1OAKL 3F7YA 1G6VK 2ZOLB 3IDYB 3G6AB 5F1OB 1NANH 4OQ1A 4HJJL 4JHWH 5D1ZB 4L4TE 4G7VH 5FGCE 3O4LD 4KY1L 2AK1H 5GJSH 1OP9A 3RTQC 3F7YB 3I6GB 1A14L 2H8PA 4QHKI 1WAAA 5EBWA 1F3DH 3ARGA 1KIUA 2X1PA 5IEKB 2DI7A 1TJGL 1BGXH 4LVNB 5HI5D 1LMKA 5GGQH 2UZXB 2ADIA 2PW2A 4P3CH 2H8PB 5EBWB 4GMTH 3MUHL 4PLJC 5JO5A 1DLHA 2C1OB 1YZZA 3EO0A 4APQC 1S9VA 3GSWB 4I18B 4D9RD 4HV8B 1UC6A 4YX2H 4U2YA 1HWGB 1XMWA 5HPOA 5JO5B 5ESAA 2OL3L 4HK3N 5C3LD 3UJTH 1OCWH 5CGYC 3EO0B 1S9VB 2H3NA 3RZWA 5CILH 3EDJA 1XIWA 2X4TB 5DFTA 1QOKA 1SEQL 2NW2A 2QQKL 2W38A 3IGAA 1U3HC 1QBMH 3WL9A 2NMSA 1EBAA 3WYRA 3K8MA 4NPYA 4ZUSA 4J3XA 1OW0C 4JFZL 2F54D 1VDGA 2NY1B 4H0GA 2JELH 2GKIA 3AGVA 3HZMA 4HKXA 4JE4B 4K3DH 2VZOA 3WL9B 5HI5C 1NC2A 3X14A 4LLYA 2GK0A 3UYRL 3BIAX 1JRHL 4NPYB 1CBVL 3WHE1 2BRQA 4RIRA 5J12B 1SVCP 2EDTA 1H3XA 2C3VA 2F5BL 2E8ZA 5IQ9A 3MRHA 5DYOA 1HNGA 4LSDA 4HKXB 1HHIA 5I71B 1MRDL 3RI5K 1V3JA 4LLYB 4KZDL 4TOYH 2FZ3A 4NQED 4X6DA 2NPLX 2YWYA 4RIRB 5F6IB 1YY8A 5IQ9B 2C3VB 4YPJA 3MRHB 5DYOB 4NN5B 3TF7C 5LWYL 3QP3A 3U4AA 3P30L 2W60A 5IB3A 4OT1L 5BRZD 1D3CA 4PJHA 1W8OA 3U30C 1P9MC 5EIIA 3HZVA 1A5FL 4LSPH 4X6DB 5GGVY 4N5UA 3T3MF 1YY8B 3I9GH 2DBLL 2EIEA 1ZAGA 4X9IA 4PJDF 5IB3B 2DLHA 1I7TA 2W60B 1RVFH 1F4HA 1NQBA 1NFDA 1QSZA 4WHTA 3K7UA 4FZEL 1JNNH 5EIIB 1R3HB 3HZVB 4KI1A 1IZKA 4GS7B 1FVEA 1XH3B 1QA9B 2NXZC 4OLVL 1CICA 1YPZA 4YHLH 1AXIB 1NFDB 3QDGA 3WJJA 1QLRA 3CNKA 4WHTB 1XT5A 1RK1A 1WK0A 1UB6A 1FVEB 3BVNA 4JRXA 4ZAKD 1HH9A 3RWIA 4AMKH 4C56D 1ONQA 2QQQA 5E2JA 1VACB 1DQLL 5C6TH 1I1CA 1CICB 2VDNH 3OPZH 1YPZB 1INQA 1ZHNA 2BZDA 2BVEA 3TWCL 4F9LA 2V7HB 1QLRB 4C59B 1AHWC 3GK8H 4MHHI 3AS0A 2FO1A 1AGFA 2FWOA 2VB5A 3S5LG 4W81A 1T66D 4Z5RA 3RVTC 3O9WD 3RWIB 1QHPA 1OT1A 1ONQB 5LGJA 4NCDA 4G7YH 4GAJH 1INQB 1F90H 4UDUA 1ZHNB 4BKLA 5FKPB 2CGRL 3EYSL 4L4VA 4G8GA 1G9ML 2VXUL 3ZMRA 1S7WA 2FWOB 4O4YL 4Z5RB 3MRIA 4MNQD 2PYEE 3PABA 5A2KH 4FMKA 1WWWX 3MODH 3VXSE 5SWZD 3RL2B 4MJIE 1A0QL 4UDUB 3SHSA 4JQVA 1XF5A 3U2SB 4L4VB 4DGYL 5J9PA 1GH7A 1JE6A 5JW4N 2AJXH 4G9DB 5C0BE 2ADGB 3MRIB 1BVLA 4KVCL 4P5KA 4YEEA 4MDJA 3ILQD 5GGSY 5J11B 2WBJD 4O2CA 4X4XA 4Z8FH 1XF5B 3RX7A 4FA8A 1T04A 4CADB 5J9PB 1MFBL 2WUBH 2YN3A 1EHXA 4P5KB 1BVLB 1QYGH 4MDJB 4YDLC 4HIJA 1CGWA 3RJQB 4HWZA 4J3TA 4V1DA 4M6AA 4O2CB 3TV3H 2ZCHL 3ZE2E 4GRLD 4R0LC 5L0QC 1F8TL 2NX5E 4Y5XA 2GCYA 2X41A 1CL7H 1T66C 2VSCA 2JE8A 5HHPA 1I8MA 1FE8H 3EOTH 3TBTB 4PD4J 4HIJB 5E9DA 4OJFH 4HWZB 1D5BA 5KS9F 1EXUB 3GM0A 3ARDB 1LP9E 3HC4H 4Y5XB 2GCYB 4TSAH 4PJEA 4X8XA 5HHPB 1I8MB 3C87A 4ZS6D 4QRPD 2ICCA 2DLFL 5E9DB 5SV3A 2GAZA 4L4TA 1D5BB 3KPOA 4PJCF 1WIOA 2WP3T 4OQTA 4OFVA 1QEWA 1D5ZB 2FH8A 3I84A 4PJEB 3PL6D 5H37H 4QO1A 1H15B 1V3MA 1CFBA 2BNRE 3TH3T 2GAZB 4L4TB 3KPOB 4LP4A 5D6DA 1G0DA 2EZ0C 5KVGL 1ZT4A 3IAQA 3HMXA 4LCCB 5JIIA 2LU7A 1HKLL 4WGVB 5HYSA 2E7LA 4YJZL 1JCKA 2Y5TA 5CCKH 15C8H 4GRLC 4HXBH 2AABL 4PTUB 4ONOA 1IQWH 2BSTA 4KKLD 3SDCA 1ZT4B 5J1TC 4A6YH 5IOPA 5HHXL 3D0VA 1E6OL 1KCRH 4GQ9H 2C1PA 2P43B 4EUPH 3W9EA 4LQFH 2Y5TB 3LCYA 4RMUA 2BX5A 3MLTA 4R4BB 2W0FA 4PGBA 2BSTB 3SDCB 4TNWK 4WWKD 1I8IA 3H3PL 2DKSA 5IOPB 3U0PA 5BQ7A 1A7PL 3EZ8A 3LQAH 1T2QL 3W9EB 1MCPL 1IC4H 3CH8A 5IKCA 3MLTB 4XI5D 3VXOA 4PGBB 3VGBA 5IQ7L 1HN1A 3MJGX 5IBUB 3RKPA 2CMRL 3I6LD 4S2SA 3U0PB 4ZYKA 5JOEA 4UT7H 5TE4L 2VDQH 5EU6E 5I8CA 5JZ7D 4HS8H 4ISVA 3CDYA 3QXDB 4KKNA 4U2ZA 5IKCB 3PDDA 2AXHA 5B3JF 3QRGL 4U7SA 5L7XL 1E28A 1SEBA 4K3EL 2P5WE 1XEDA 5INCB 4DWHA 2A77L 4OQTL 2VDOL 4S2SB 3G6DH 1N7MH 3DX8A 1ETZA 1EDQA 1MCHA 3G6JB 4K3JL 4ISVB 4M43L 5DS8B 3EO1A 4KKLC 4WY7L 2FATL 1E28B 1SEBB 4OF0A 4YDKH 4OZIE 1QR1A 3KHOA 4KK6D 2MWCA 3KDMA 3HMXL 1ETZB 2O5ZL 1A9BA 3U0TB 4Z7QF 5DRZB 3NACH 1TCRA 4Q6YA 3ARED 3FO2B 1R6VA 1UEMA 1D9KD 4HMEA 1BQHG 4FRWA 2ZP0T 5DUMH 5JLZA 3TBYA 4JY4A 1AD0B 4M5YH 2D0GA 3KDMB 4JPKH 4JKLA 4F58L 2F8XC 1A9BB 4KJYA 1TCMA 5C2UB 4XI5C 2FH6A 4LSVH 1TCRB 1G1YA 4Y4HD 1JNJA 1OARL 4AIZA 1VFUA 4DKAA 3CU1A 3LZFH 1AFVH 3H3BC 1KJMA 2QSTA 5EOCJ 1TLKA 2CPCA 3SQOL 2AJUH 3NCMA 1NUDA 3MMEA 4KJYB 2BXYA 4TVSa 3R4DA 4M7ZB 5JNYB 3N1GC 1PEZA 2RB8A 3U4BH 4AIZB 5I1EL 1NGPH 1FRGL 4K9EH 1N64H 3OQ3B 1KJMB 3B5HA 1VHPA 3EYOB 3MMEB 4I2XB 3CLFL 2WUCH 3Q5YA 5DJ6A 4LGRB 1RV6X 2OR7A 1TJHL 7FABL 2ZWLT 4KK6C 5E70A 5DO2D 3QIWD 4C4KO 4N0YL 1F4WL 2W0LA 2WIMA 4NKOA 3T3PF 2H45A 4Q6IA 2XQYK 3F62A 4ONFH 5GZND 1TENA 2IPTH 3AREC 3QDJE 5DJ6B 1IKFL 1D9KC 3IFLH 3D25B 3GMNA 2VSDA 4OLWL 2IMMA 3QUXC 3OAZH 3CU7A 3S4SG 3AAZB 3J8F7 4DKFH 1NDGA 4NO0D 4NKOB 3L3KB 4QHUA 4Q6IB 4Z7UF 3C6SA 3VXSA 5HDQL 1N0XL 3QRFM 1CVSC 3IDMA 4MQTB 3X12A 1H3PL 1NDGB 2CK2A 5M7QA 1I7RA 1QSEE 5C0BA 4GKZA 5GGUA 4DZBA 3JTTA 4YWGH 4C57C 3C6SB 1D5MB 1NMCC 4P5MA 3Q5OA 2IGFL 5F7DA 4YHKH 3UC0H 3IDMB 3X12B 3BGAA 1N8ZA 4OTXH 5EZIL 1WIUA 4MX7B 3ULUH 3NN8A 1C5CH 4YK4B 1I7RB 4GAGL 4YDVA 5FYLD 5GGUB 3RP1A 4DZBB 1GIGH 1I3RA 3JTTB 4Z78B 4JLRB 3RZCB 4QT5B 1R3LA 3I02B 4XHJD 5IVXF 5F7DB 2VLJD 3UO1H 3ARPA 2EKJA 5DO2C 3QIWC 1N8ZB 3L5XH 5E4IA 3G9AB 3MLXL 3NN8B 1JGLH 2J2ZA 2QKIA 1VESA 3G5VB 4YDVB 2FEEL 3VH8G 4X8JA 3GSNH 1I3RB 2QHRL 3ZLQC 1H5BC 5BJTA 3NCJL 1LP9A 1MAML 2HKFL 1BJ1J 2AQ3A 3GHEH 5DQDL 2QKIB 3BGFC 5GGTA 4OCYL 3RDTC 1PEWA 3SQBA 2HH0H 4X8JB 5D93C 4NFDA 1YMHA 3RAJL 5E8DH 4MAUH 2DWEA 4QRSA 2ARWA 5K33A 1VGKA 5BJTB 4GUPA 2ENYA 1Y6KR 1LP9B 5FXCH 2Y6SD 1F11B 1FFRA 2VISA 3RWFB 4EVNA 1KSRA 4G9FA 1RK0B 2OSLA 2F58L 1X5HA 5DEFA 4Z0BL 4U1SA 1J8HA 4QRSB 4XP6H 5FV1L 2A38A 1VGKB 3CVIL 4M1DH 4W4OA 1KPVB 3MOAL 2NY7L 4GUPB 1RIHH 5F1SA 2VISB 1GVIA 1UB5A 3P73A 4EVNB 5IG7A 1JPFA 1A6WL 4G9FB 1VSCA 2OSLB 3U0WL 2YPLA 5K9JL 4Z7NE 3OR6A 3N1FC 5DEFB 3IVKA 4U1SB 1J8HB 1JK8A 4WV1C 3WKML 5ISZD 5JUEL 1T5XA 3HRZA 4JO1H 4A2MA 1DN0A 1NC4A 2J5LC 1UB5B 4RFOL 5D1XC 2R2CA 3ARXA 1JYNA 1JPFB 4OUUA 4NNXA 5E1HB 4M7KL 3ZE0F 1I9JL 3UJJL 3ZYJA 5EC1B 2A6DA 5KZCD 2YPLB 2R56L 3LN4B 3OR6B 4YHNA 5L2KD 2LABA 3KXFE 3IVKB 2MCPH 3W5NA 2KPNA 2XWTA 1JK8B 2B20A 1T5XB 2V7NA 4JFXA 3HRZB 2B2XL 1LEIA 3EJYD 1NC4B 3VD3A 5F97E 4OUUB 4NNXB 4NQCD 2UVFA 4ZS7L 5T33L 2A6DB 2EO9A 2A0LD 5C09A 2IQ9L 3RGHA 1OB1A 3MLUL 4B5EA 4HX1B 4UMGA 2DAVA 2PKDA 3IETA 3OZ9H 2Y6SC 2V7NB 1CU4H 1LEIB 2DLGA 4JO3L 4YHOL 3H9SA 1CLZL 5GZOD 3ESUF 5C09B 3BRDA 1V7NL 4RMQA 5GGTL 3QCVH 5HHOA 1OB1B 1IGIH 5BVJA 5A16B 5SX4I 1PYWA 4LLWA 3IETB 2A6JA 4YFLF 3MV9B 1NSNL 2P5WA 4PJXF 3VW3L 3V6OC 3T08A 1RIUH 3ULVH 3H9SB 1B88A 3KPRD 2GJZA 3BPOC 3G9VA 4U3CA 4L8CA 3DSFH 5HHOB 5BVJB 1T1WA 5D70L 4GRWB 3KG5A 1PYWB 5ESVA 2JJUA 5F93C 1MFEL 2A6JB 2QTEA 5T1KD 3NABH 4OZIA 5FGBC 3X17A 4WTWA 3O81A 1ZKAA 1MVFA 3VXRA 1FDLH 4L8CB 5EO9B 4GXUM 4M6OH 5E5RB 5ESVB 5BO1H 3F5WA 5IB1A 3DHJA 3HE7A 4ONGH 5ILTH 4NO3A 2XRAH 2QJDA 4LSTH 2A0LC 3VXRB 3O3DB 4NGHH 3CXDL 2VXSL 1LO3H 1F4YL 3QAZB 3QPXL 5E8NA 1HQRB 2Q8AH 2EE6A 1H3UA 4QF1A 3LKRA 5F7LB 4JANA 5TF1H 3F5WB 4YXKL 4ZXBA 1ZVYA 4ZSOA 1YEFL 4NO3B 1RUKH 4PJGE 4G6FB 4F3FA 2IADA 2B0SL 1FL3A 5D7IE 2W59A 5MERA 4OCMC 4WCYL 1LO2L 5E8NB 3DYOA 5C1MB 3AS2A 2BHZA 4JANB 4ZXBB 4ZSOB 1X6LA 3F8UB 3CX5J 1HEZB 5F7HA 4F3FB 2IADB 3DV6A 3T04D 1XGYL 4UIMA 1FL3B 5FGSA 4MWFB 5MERB 4RBPH 2ZG1A 3HI6H 5I17A 4WNQA 5T5NF 3OB0K 4PJBB 4YQXL 1ZOXA 2WINA 4HPOL 5DEGB 4M6NL 1N5YH 3DV6B 4MQ7A 3WFEH 3NFNA 5CIPH 3VG0L 4HZLA 4M8VA 4UIMB 1I9IL 1F02I 3QDJA 4FQXA 1B0RA 5I17B 3QUZB 3NAAL 4Q0XL 4WNQB 1JPSL 2WINB 3OJ2C 5AG9A 3VXME 4HPYL 5C08E 1MRCH 2VLKE 2VDLH 4MQ7B 5LBSH 4FZ8L 3NFNB 4PJAF 3TCXA 4HZLB 1U2HA 3CFCL 3ZE1E 1KJ2A 3V52H 3QDJB 1NAMA 3BE1H 1N2RA 1B0RB 2WWMD 1CDBA 3BOVA 1CD0A 3KPPA 4P2OA 1JFQH 2O5YH 2EDNA 4WUUE 5HDBE 5I1JH 5IWLA 4FQ2L 2ZUQB 2H32A 3NCCB 4GBXD 1FCGA 3VFPB 4EI5D 3KPPB 3SN6N 4JB9H 4XP9H 3SBWC 1WZ1H 1HIML 2NXYB 3MV8E 2EYRB 4K3HA 1YDPA 1PLGH 3INUH 5AYUL 1IE5A 1CZ8H 3KR3L 4U6VL 2GSIA 3FQRA 1KCKA 3TA3D 1FL5A 2IFFL 3D2UA 3UZQA 4JDZA 1A7QH 5FIEA 3D39D 1ORQA 1YDPB 1G9EA 1VCAA 3MLPA 1W72A 2L7UA 3LDBB 3BKMH 2GSIB 5H37G 3JVGC 5DJZA 4U1JA 3GMLA 4MS8D 5HHVH 1NCTA 5GRVL 1FNEA 5HGBB 4JDZB 4LVEA