4XP9L

X-ray structure of drosophila dopamine transporter bound to psychostimulant d-amphetamine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
213
structure length
213
Chain Sequence
ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIEGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/inhibitor
molecule keywords Transporter
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 51
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp9L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp9L01
5CZVH 3HR5A 2EE6A 4R7DA 1MCHA 3QEQD 3U0TB 3GUTA 3KPRA 2OP4H 3KWWA 3MBXH 1K4DB 1C1EL 2R39A 3BRDA 1A14L 2HWZH 3VRJA 3KXFA 2X40A 1MCPH 2VITB 1RMFL 1BECA 1Q72L 4MD5A 4MS8C 3V95A 2D9QB 1RZFL 3FQWA 2D4FA 1UXWA 2PXYC 3QHFL 1J1OL 4O2EA 1V7NL 4PJ7E 1PLGH 1FL3A 1MHEA 3BDYH 4N8PA 3OKNB 3VFSA 5ISZE 5ETUB 5GRZA 1VPOL 3BH8A 3MLXH 3VXSD 2A0LC 2ZUUA 3AXLA 5JORA 3P4NA 3ZZ1A 2W9DL 1ORSB 5K9JH 4K8RL 1SJEB 3SDAB 1MHPL 4JB9L 3RUGF 1X4YA 1CR9L 4P59L 3OKMB 4R2GC 3F6LA 1QO3A 4HZLB 4NNYB 3LQZA 2I9TB 2QSCH 1HQ4A 1OAXL 3R8BB 5C0CB 1F4WH 4HK3N 3ZKMC 3GK8H 1EX0A 1UCTA 4KK9C 3WFHA 2E27L 5GSVB 1F4HA 1UADC 5EG6C 3ELAT 1WGOA 3GSNH 1X4ZA 5C0RH 5F7MC 3QUYD 4HG4J 4YX2H 4NQVA 4KPHL 4WFGE 4E0RA 1ZA3A 4OJFL 3QUXC 4G6AC 2P49B 3U7YL 4PGEB 5TF0A 1NCWH 1NUDA 4IDJL 1ZXQA 2RFXA 4POUB 3W39A 4EOWL 4GKSB 3WHXA 3RWFA 1ADQH 2P42B 3GI8H 3O2WH 1NAMB 4G6ML 3KPMA 3DX8A 3VGAB 3ARYA 3BYTA 3NABL 3UTZB 5B8CB 3MLVL 4NGHH 1JNJA 2PW1A 2BERA 3WUWG 1T7VA 4R3SB 3MLZH 2FJFB 2BVQA 3WNMA 5I15L 3GSXA 2X2YA 1GZQB 3IFLH 3O9WC 4M61B 4NNPL 2NY6D 1IAIH 1IC7L 2B0SH 1BJ1J 4HKJA 2LQRA 2WZPD 1KEML 1EJOH 3V7MA 2Q8BH 2FJGB 2E9WA 4ZFGL 5TQ2L 1MJUH 1KJVB 2I27N 5FFLA 4N0FA 4MNQD 4KZDL 4KKLC 4MJ6A 3GGWA 5A2KH 3E0GA 4ZD3L 4HWNA 1I9IH 1U8NB 2VLRA 3OL2A 3TN0A 1IC5L 3A6CL 4WENB 3VGGA 3HUJF 4PJEB 3OXRB 3ZE0E 3M8OL 4JFQA 1A3RL 2E9BA 1G7HA 4KJYB 3SKOB 2X4RB 4C56B 2WINA 4Y4HA 4QHUA 3BOVA 5F7EL 3CLFH 3ULSB 2ZUYA 3D0LB 2ARWA 3PL6D 4AYFA 5IOPA 1A1MA 1JNNL 5DMGC 3EDFA 4DN4H 4JO1L 4NO2A 5C0CE 4HIIA 2HRPH 1S7VA 4GW1A 2X4SB 2X4PB 3GMLB 2MFNA 4EN3B 2QSVA 2N56A 5FDWA 4LCCB 3ZE1F 1A7PH 3FL7A 3SKMA 4XMLH 4QHNA 3HI5H 5I73B 3L1OH 2OR9H 1F4YH 1CQYA 5IR1A 3FQRB 4X9HA 1IQWH 2IQAA 5C08E 3MBEC 1C5CL 2SEBA 3K46A 4KVCH 1A22B 4LOUC 4BKLB 4OV5A 4Z7UB 3IDIB 3ARTA 3TV3L 3AB0B 2R69H 2WBJA 4U1HA 1TVHA 3SE4C 5L8KB 5EFIB 3GHEH 2DD8H 5JNYB 4K8RD 3W9DB 5I9QB 3O2VL 1PKOA 4YUEH 4NM4L 3I6LE 4LCYB 3MJ8B 5ACZA 1RHFA 4P4KA 4GXVL 3ZKSD 4HX1B 1U8JB 1LO3H 1KOAA 2JIXD 4MX7A 1T0MA 5IM7B 1G84A 5F88B 7FABL 5MEOA 5EO9A 3VH8G 4E9LA 2IADB 3TH3T 1KTDB 4RFOH 1U92B 1D6VL 3QXAB 5D7JD 3OR7A 1T6VN 3EJJX 3H9SA 3DX6A 4ORGA 1BF8A 1JGUH 4HFWB 3U4EA 4HF5L 3C8KA 1IZJA 1KXVC 2J1KA 4M6MH 4JM2B 4WO4B 4L8BA 3SOBL 2OSLB 4PJEE 1EV2E 3BAEL 5T1DH 1G7MB 25C8H 5E24E 4KQ3L 1UH2A 5C0GB 4YK4C 1FVEB 3U30B 4I2XB 5CD3B 1IL1A 5DFVC 1UWXK 4JFXA 4XI5C 4XC1H 3WFDL 3NFSL 5J06A 4C56E 2Q3AA 5D9SB 2YHGA 2R9HC 5CZVL 3RWDB 4JFFB 4LKCB 1DQQB 2PYFA 3P4OB 5KS9A 4P2RB 2OP4L 4L1DA 3DURA 1BVZA 4QHLB 3ARGA 1QQDB 3MBXL 2H41A 2BRRH 2HWZL 5I76A 4LDOB 3BIKA 1A6ZB 1M7XA 5AEAA 5CJXC 4U1JA 2DYPB 3DRTB 4G6JH 1ZWIA 2XQYG 4L29B 3SDXB 5LWYL 4MLSA 2V5TA 5KSUA 4XC3H 4OZHA 1A1OB 5IB3A 1IAOA 2C1OA 3ES6B 4WI2A 2O61B 1YN6B 1YECH 1PLGL 3BDYL 5IKCB 2HMIC 3V6OC 4OF6A 1FO0A 4IM8A 3UPRA 3MLXL 2VXUH 3C5JB 4Z7UE 2XKSA 1ZT4A 3X11B 1LVEA 4NZRH 1B0RB 2YD9A 3KPOB 4PD4K 5ILTH 5F7KC 5K9JL 1YNTB 3UBXB 1A7NH 2UVFA 2WW8A 3SDDD 4PJIB 5AUMB 1NJ9A 4GKNA 3JV6A 4MSWB 1JVKA 4GO6B 1XF5A 4RA0C 5F9WC 2QSCL 3FQUB 4JN2B 2GSIB 4M9PA 1F4WL 3GK8L 4CADA 4QY8B 3MR9A 2A1WH 3MV8B 3MZGB 4QF1A 3GSNL 5EUKA 5IK3A 5C0RL 3RWCA 3NA9L 4HZAA 4TVPH 5ESVA 3ZSTA 1N59B 3IDJA 3GMNB 5FGBC 4N8VA 5F7WC 1RZ8B 4XAWH 2BHZA 3VI4E 4I2XE 2XXCB 4HQQH 2BOCB 1D6EA 1KB5L 2W1NA 1ADQL 4POZC 3GI8L 1AHWA 3BVNB 3O2WL 5CZXC 4F57H 2PN5A 3ARPA 4NGHL 4Y19B 2BSTA 1CFQA 4JFFE 4NCDA 4ZS6D 1XCTA 3ILQC 3MLZL 4PJBA 2X1PA 4RAVB 4WJ5B 2A6KB 1CE6A 3IFLL 2EIZA 3VXMB 2KDGA 4WFED 1DBJH 1IAIL 2X4QA 4MJ4A 2B0SL 3MPCA 3VRIA 1JBJA 5DD3H 4L8CB 5EZOH 1UWGH 1EJOL 4ONOA 2Q8BL 1M05A 5CIPH 4KROB 1MJUL 3NOIA 1EGJH 3GDBA 1A6TB 3SDXE 3T65B 1MAJA 3LMJH 3TPUB 1FNSH 4AG4H 1F3JB 2AEWA 1G9MC 1UACH 2H45A 1PSKH 2QSQA 3BP5A 3KJ6H 1I9IL 2IANB 3EO1A 1M6OA 3RVVD 5IMOA 3L5WB 3PQYD 5ANMA 1HOCB 2NY1D 1GZPB 4FFZH 2R29L 3DUUB 1KNOA 4ODXB 5E2UH 4MAYA 3ARDD 4ALAH 5J9PB 4X6CF 5CCKH 1U8LA 4PJIE 1BOGB 2P44B 4J3WA 3CLFL 4ZFZA 1ZT7B 1KJ2A 1WFUA 3KYAA 4R97B 4DN4L 1JZ6A 3DYPA 1NFDA 5A16A 1DQJB 5SX5K 3QNYA 3BXNB 2EDJA 2HRPL 2WP3O 2EYRB 2GHWB 3MV8E 1IQDA 4KI5F 3EJZD 3LCYA 1A7PL 4GRWB 2ZNXA 1YEKH 2OTWA 3KHOA 4G43B 4E42A 3REWB 3B6SB 1P1ZA 2MMXA 3HI5L 3L1OL 3PGFH 5MERA 4PJCF 2ICCA 2OR9L 3MNZA 4MD4A 1YMHB 5JZ7D 3K4DA 1IQWL 5TQ0H 3I9GL 5E08H 1G7JA 3ZDZF 3MRBA 1DCLA 1NCUA 5D72H 4FFYH 5ITBH 5BQ7A 4Y19E 1NKRA 2R69L 1UB5A 3ZE2E 1F3DH 3GHEL 4YHLH 4BSJA 2DD8L 4DVRH 3PWJB 3MLUH 1MY5A 2NXYD 1FNGB 4YUEL 4K3HA 3B8SA 4OZFA 3VXME 4NKMA 1JHTA 5BCAA 5BRZD 3VFUA 2ICES 1LO3L 3S3SA 2IPTH 1QEWB 2ZUWA 2VKXA 2LTQC 4RFOL 3IFPA 3GSOB 3JV4A 3QAZC 4XVSH 5DRWA 1CCZA 5E00A 2AJXH 4WFHE 4UDUB 2DLEA 5DVKA 1LK2A 5I74B 4LLWA 2PO6A 4BFIA 1JGUL 2ENYA 2VE6B 5HGDA 2IANE 4M6ML 4X7DC 3PWPB 3SCMD 4UNUA 1U9KA 1OP3H 5DMYA 5KG9A 5T1DL 4OFPA 25C8L 1YY9D 1G7LA 2X9WA 3EDEA 3V6ZA 3VWKD 2F9BT 4OI7A 1GOGA 1FRGH 5TPWH 1P4BH 3H9HB 2CJUL 3WO4C 4HK0B 4ODUA 2BNQB 5KSBA 2EXWC 1IM3B 4XC1L 1Q9LA 5D71L 1QSFB 3GEWB 1YEFH 2ZSWB 3ALXA 3BPNC 4KV5E 3V0VB 4ZPVA 5E6IA 4LU5L 3ISWA 2C3XA 4P3CL 3L3GA 1JRHL 1U3HB 5MENA 3QHTC 1OGAD 3QDGA 2R0WH 2NY6C 4P48A 3R0NA 2D4DA 5DVMA 4CMMB 5JPMB 3ILPB 2BRRL 3IKCB 3MJ7B 4GAFB 3I02A 3RDTA 3SBWC 2P5ED 3HC3H 3BZ4B 1YDPA 3AY4C 2C3HA 4UUJA 4GRWE 4JFEA 4PRNB 2NY0B 4UTBH 3UTTD 4KC3B 2P45B 2ZG2A 4G6JL 3AMLA 3TZVB 5B3JE 4XNYH 2X1WL 4JPIA 2EE2A 3VFWA 4RZCA 1GYAA 3LKSA 4OF8A 1YECL 1MREH 2QTEA 4I0PC 1W0YT 5F7DA 5CGTA 3OKOA 2DQFB 3RTQB 2EYSA 1AO7D 2VXUL 1K4CB 4RGND 2ZSVB 3N9GH 4JDTH 4NZRL 3ARQA 5KVDH 3RFZC 5ILTL 1TENA 1H3GA 4Z7WB 1B4RA 3LV3A 2XWTA 1NBYB 3ARUA 3UTOA 5IUSA 3PL6C 1I7RA 3BP4A 3V5HB 4A6YH 3MRRA 2Z8WC 1UQSB 3EW3B 5EBLB 1KIRB 2YK1H 1UB6A 3EFDH 3G5ZB 1KELH 3DX7A 2PUQT 4YFEA 4GS7C 1TFHA 3D3VA 1H3WM 4XB7A 5CJOL 2A6DA 2A1WL 2ESVA 1FCGA 5B38A 4PJHF 4XP5H 1PYWB 4TVPL 3PWPE 4NO0B 3SKNA 1AD9B 1H0DB 3T1WA 1UVQA 1CDIA 1BMGA 4XAWL 4CNIB 5IFJA 4LBEA 1GGTA 4HQQL 4N5UA 4YEFA 2K7QA 2ZWLT 3OKEA 4RMVA 1QSFE 1FNEB 3D85B 4I48B 1VB9A 4F57L 5FM4A 4LPCA 3GJFH 5DD5H 4X6FB 2PXYA 4TNWF 3D48R 4M7JH 4DKDC 3CXHK 1Z9OA 4X5XA 5MEQA 1CGSH 4NQXA 4LQFH 5FF6B 2VZVA 1T5XB 2BNUB 1AGCB 4NC2B 3L3DA 3HG1B 1DVFD 1KLGB 1G6RB 2P4AB 4P57A 4LRIA 1X5IA 4NRZB 1B9ZA 5EU6D 1ZT1A 1DBJL 2XTLA 1V7MH 5DD3L 1AXIB 2FBOJ 5DF0A 3QUMA 1P84J 1UWGL 5I1IH 3GMPB 5D7JC 1EGJL 3RWJA 5C09A 4XPHH 3MNVA 3G08A 4U1NA 2UZIH 3KPSB 5B39G 3PXHA 3LMJL 1FNSL 2DLFH 4AG4L 1UACL 4JZOB 4UOW1 1PSKL 5EZLB 4UNTA 2F74A 5CEYA 3SGKA 5I2IB 3KJ6L 3FKUS 2EXYD 3OXSB 2V7NB 2AV7B 1LMKA 2W0KA 3FZUD 4R7DB 3GUTB 2DDQL 2XI9A 5EOCH 5E2UL 5IQ9A 1OLZA 1B0GA 5JIHA 1FFRA 2DQEH 4WI6A 4Z7WE 4ALAL 4UQ3A 3WJLA 2FX9H 3QUXA 3KXFB 1N0XH 3IAGC 1TQBB 1VADA 5CCKL 5D96B 2R56H 4MD5B 4RISH 4RMRA 4LLYA 1EFXD 2I5YH 1GGYA 3IFNH 1UXWB 1A4JB 4O2EB 4Z0XA 4EUPA 1NLDH 4NO3A 3EUUA 1MHEB 2GQHA 4N0YH 4NWTL 1A64A 3BH8B 1YEKL 3C6SB 3O9WA 3IYLW 3FRUB 3WHE0 2F53A 3AXLB 3QXVA 1RZ7H 3BD4A 3D25A 3P4NB 1KN2H 2WQRA 3QCUH 1YYLL 5HDLA 3UCRA 4Q6IC 5IHLB 2NW3A 5D5MF 1MH5A 4IBLT 5TQ0L 5E08L 2XY2A 3PDOA 3W82A 3VFGL 4HCRH 4TSAL 1I9RL 3LQZB 5HVFB 1OP9A 5D72L 3MRLA 4FFYL 5ITBL 1HQ4B 4PLOB 5F96H 3SDDC 4YHLL 1A7RL 4BUHA 3X17A 3WFHB 1WITA 5EU4A 2YSSA 3MLUL 4DVRL 5F9JB 4XHQA 3HG1E 4PY7A 3WS3A 1KF9B 4L8DA 5IW3A 4C83B 2DQJH 4FFVD 3C60C 4OT1H 3HRPA 2ZUXA 4E0RB 4GT7A 5HHOA 4ZFOL 2VRAA 1ZA3B 4LNRB 4YHYC 2IPTL 1FGVH 4UQ2A 1MCBA 3WSQH 2K9UA 4Z78A 5T3XH 4XVSL 3KPSE 4LPWA 4ZUVA 5GS1C 4NQEB 3TIEA 2XZZA 5SV4A 3W39B 3GFUA 1FVDB 1Z5LA 4HUWB 3RWFB 3KPMB 3DX8B 1ZA6A 2B39A 2ZOKA 5F3BA 3O0RL 3OAZK 2PW1B 1H3TA 2BVQB 3KPRE 3GSXB 5TPWL 1P4BL 5CBAA 4U6VH 1C7TA 1VENA 4R4BB 4UT7H 5E8NA 3V5KA 3VDBA 4YFDB 3B43A 5HYJD 1J0ZA 1YEFL 4L3ED 1P7HL 4PRHD 4JPKH 3PWUA 3KXFE 4HKJB 4P9MH 4ZS6C 4IJ3B 1N5AA 4NJ9H 3SDCA 2B4CC 1WTLA 2IC2A 1FC2D 1S9XA 2R0WL 1I4FB 5CP7A 4N0FB 4RFNB 1EH9A 4JR9H 3CVIH 3QZWA 4LLVA 3V8CA 4LRNH 3J7HA 4HKBA 5EB9A 4FQXA 2VLRB 3TN0B 3HC3L 3WDIA 3ULUF 5C0IA 1XGQA 4UTBL 4M5ZL 2OI9C 2G5RA 4XNYL 4OZGB 5LBSH 5EO1B 1AD0B 1D9KD 5DQDH 2E6QA 5CP3A 4MZ2A 3RVVC 1CGWA 2DJSA 2XZAH 5EIIA 4Z77A 1MREL 3B2UD 2NY1C 4OCXH 5FB8B 4I4WA 4HLZH 3WBDA 3ARDC 3WS6A 1BZ9A 2OZ4H 5IOPB 3W2DH 1A1MB 5FECA 5DUBA 1IAIM 3EO0A 4NO2B 3UEZA 4NRYA 2O5YH 3N9GL 1I9JH 4JDTL 4HIIB 4QXUH 5KVDL 1S7VB 3WNLA 2DAVA 2EC9T 3V4UH 1KB9K 1U6AH 2FWOB 2WUBH 4A6YL 2GCYA 4NFDA 1I8MB 3SKMB 1IGTB 3PE9A 2YK1L 1NCTA 3O81A 3EFDL 1KELL 3HC4H 5CS7A 3EJZC 5EC1B 3D6GA 5EBMB 3DPBA 3RU8H 1IAMA 4NQEE 2IQAB 1NGWA 5HHXH 5DVOA 4XP5L 4NZUH 3QI9D 4Z7QF 1U93A 4G8IA 2KH2B 4OV5B 1JYXA 5IGXH 1TCRB 3CSBA 2R0ZL 5JZ7C 2WBJB 4U1HB 2CIIB 1TVHB 4QEGA 5GS0H 5L0QB 2W60A 1UWXH 4PS4H 1AQKH 3BUYB 1NMCB 3C09C 4TNVF 4P4KB 3JSSA 1RUQH 5DD5L 1T0MB 5BW7C 4LMQE 5MEOB 1MCKA 1A5FH 1BQHB 4M7JL 3X12A 2NXYC 1QBLH 3QNZA 1CGSL 2P8LA 4LQFL 2BVPA 4NN6C 1SYVA 5E9DD 3T0DA 3WO3B 3TVMD 5F7FA 3ZDYE 3RX8A 5DJAB 1UA6H 4MYWB 1MCSA 3HI1A 5DEZA 1V7ML 2VLRE 5D2NC 4GKZA 4WY7H 1Z0MA 1V5JA 2Y07L 5I1IL 1ACZA 4HV8B 3L3JB 4URTB 2A6JB 4XPHL 4YWGH 4OZGE 2UZIL 1PG7W 3VXPA 1ZK9A 2DLFL 3CXDH 4Y5XC 4JFXB 4JREC 3SCMC 3BGFC 4H1LH 4HIEA 1BVKA 3S98A 2KBGA 2X7LA 3GMMB 1CXKA 3O6LH 5CJQL 3TBSA 2OM5A 5EO0A 1YY9C 4WFFE 3W5MA 3TA3D 2FSEA 5GZND 1NH6A 4HWBA 3E2HC 5HVWA 4LARH 5JXEC 3CIQA 4PJ5B 1SJHA 4KJPD 2PYFB 5KS9B 3ARSA 5D1QA 5EOCL 3DURB 5MHSD 3ARGB 5J12B 5C0BB 1TNMA 1H5BC 3T3PF 1N0XL 4XTRD 3S36X 5I75C 4H26A 1LE9A 2R56L 4U1JB 3MJ9A 2OL3A 5EBGA 4KRPB 4X8JA 2CR6A 1ZWIB 4CN6A 5GXBB 4ZFFA 4XXDA 3IFNL 1AJ7L 5KSUB 4OZHB 5IB3B 1IAOB 1A02N 4HS6A 2QADD 4O9HH 4F7MB 1K6QH 4G3YH 1FO0B 5TE4H 5F21B 2O26U 5TGBB 1KBGH 2YD7A 3UPRB 3W0WD 1RZ7L 2R1YA 1KN2L 5KOVC 3ET9F 1YMMD 3QDAA 4TTDD 1HSAB 4ZXBD 1U8QA 1OT2A 1J8KA 1MCFA 3WEXA 2FRGP 3QQ9D 4Y16C 1F11A 5C0ND 4RGNC 1INEH 4GKNB 3JV6B 4HCRL 5E2TH 5JW5A 4X6DF 1XF5B 4NP4H 1U2HA 3FB5A 5F96L 4CADB 3BHBB 1BD2D 3MR9B 4WTZA 5CEXB 4QF1B 4IIQC 1IGYA 1YEEH 3OWEA 4W6XB 2DQJL 5E2JA 1B0WA 5EUKB 5C08D 2Y5EA 5IT2H 1FHGA 3NFPA 3QQ3A 3IDJB 3D1MC 4FZEL 1FGVL 3L5XH 3Q2CA 1CXFA 1EO5A 5T3XL 3QEHB 5C6TL 3QEQA 3DXAD 4DZBA 5M94B 4RIRA 3BJLA 4PY8J 4ETYA 3ZT6A 1AHWB 4LHUG 1NEZG 3BPLB 1QLFA 4R90H 2BSTB 1CFQB 2EEDA 1XCTB 5KS9E 4PJBB 1SJVA 4U6VL 4OFYD 3KYNA 2EIZB 4YDLC 3VWJD 4UT7L 4FFWD 5C0BE 2X4QB 3QG7H 4NQDB 1U8MA 4LSDA 4P9ML 4HD9A 4NJ9L 3LKPB 1M05B 4LCUB 4JDVB 4Z95H 1DVFC 4OCRH 5LKNA 5CHNA 2X4NA 3BZDA 3MRCA 5I17A 3ARBB 1DBBH 2I07B 1XF4A 4HEPG 5ICYA 4OZHE 5F8RC 4JR9L 3CVIL 2X10A 2AP2A 1HI6B 3DSNA 2DM4A 3MV01 4HS3A 4M4RA 1DUZB 1X5AA 1M6OB 3HAEG 3OAUH 3WUZA 1F58H 4UIMB 3VI3F 1HXYA 5IMOB 1ZLSH 5ANMB 1ETZB 4NHCL 5DQJA 2IMNA 2AJZA 3ULUH 5LBSL 3CSGA 4QTHB 4ELMB 3VD5A 4MAYB 1ZANH 2Z91A 4Y4FC 5IBUG 2EXYC 3GBMH 4I13B 2JE8A 5KSVA 2XZAL 4KJQD 2QV2A 3OV6A 2NZ9C 3FZUC 1U8LB 4OCXL 4OUUA 4OZIA 2CLVA 5HD8D 4HJ0D 1SVCP 1S7TA 4ZFZB 3QUYA 4C58B 1B2WH 1DFBH 3W2DL 1BP3B 1P4IH 2XKNA 3HI6H 3ARXA 5GJSH 3QNYB 1I9JL 2NLJB 4J1UB 4A2LA 1J86A 4X4YA 3HRZA 4YLQT 5K59F 3V4UL 1ND0A 1IQDB 3OKLA 5E8PA 1U6AL 2WUBL 1WIOA 2CDFB 3ORJA 3GKWH 4IS6A 1ZVSA 3IU3A 5HDQH 2BY1A 2VLJA 2OTWB 2D7NA 1GGCH 1VDGA 1T1WA 4PPTA 4X9GA 4JFDB 3KYOB 5MERB 1KTKE 3MA7B 3MNZB 2BSSA 1NLBL 4MD4B 2YRLA 2GJZA 3RU8L 4ZAKA 1CYGA 2Z9TA 2GK0B 4NZUL 3F58H 1ZHBA 5GGUA 5DWUH 3WV0A 5E6ZA 4EI6A 4JG1H 4UV4L 5IGXL 3ZTNH 1KCSH 1FLTX 1YUHA 2EICA 2W07A 4KH2A 4N0UA 4OTXH 5T1LB 4PJBE 4P5TD 3AY4A 1AQKL 4PS4L 3NAAH 3BI9X 4Y5YA 3LQAL 4NN5B 4NKMB 1F3RB 2WQ8A 2D03H 2GYSA 3CVHH 4NQDE 5KN5A 2F8XC 4I3SH 1RUQL 1TZHA 4H8WC 4AEFA 4PJDF 5DJ8A 1A5FL 4EEEA 1QBLL 4HJJL 1JF1B 3IFPB 2QQLH 4FFVC 1UM5L 4NQUA 5DRWB 1XIWA 5HY9A 4BM7A 4Q7DA 5HYQB 2HFFB 1UA6L 4NQCD 1BZQK 2WSKA 2PO6B 3U36A 4LDLB 1M4KA 4WY7L 1MHCA 4PV9B 1S7UA 1BM3H 3DUHA 4PJ7F 4PLJD 5KG9B 1PZUB 2OMNA 5ANME 1KXQE 4DAGH 4YWGL 3H9YA 3V6ZB 4ELME 4JFFD 1K8IA 1VGEH 3CXDL 1A2YA 4ODUB 4HLZG 5EC2B 5FYLE 4DKFH 3DYMA 2X44D 1R3KB 5C07B 4U7KA 3HC0A 5E6IB 5E8DL 4Y89A 1OP5H 3BUTA 4RNRA 4NO5B 5TJWK 4LARL 1QD0A 5MENB 3AGVA 1NC4D 3PIQB 4UTAH 3B9EA 5EZJA 1RAMA 3NCYP 1RY7B 3I02B 4EXPX 4YPGB 1Q8MA 5DS8B 5C0EB 4UDTB 1MCLA 2DI7A 4UUJB 4JFEB 5D7LB 5DHVH 5DJ6B 1FORH 2LV4A 3HZYA 1PW3A 3GMRA 4U6YB 3BPOB 4WDIB 4UBDD 2CUHA 1H3PH 3C2SA 4JFDE 3VFWB 1KYOJ 4RZCB 3LKSB 5LJYH 3BP6A 1CD0A 4O9HL 3SKJH 4MA1B 1K6QL 3QIWC 4UAOB 3S37X 4G3YL 3OKOB 5TE4L 1D9KC 1KBGL 3UMTA 3O6KL 1W0WA 1VKXA 4AJ0A 4FXGB 4P4RA 5DUMH 3B2UC 5FGRA 3QIBA 4WEBH 3RZCD 5CGMA 2IALA 1H3VA 5IG7A 2HJKA 1UJ3C 4E5XB 3QXWA 1AGDA 3OX8A 1I7RB 3BP4B 3CFEB 4JEGB 4AEIL 3MRRB 1INEL 5E2TL 4PRIB 3ARZA 1P5UA 2DQGH 4NP4L 5I1GL 4W4OC 3VG9C 3DX7B 2X89D 3QIUD 2A6DB 2ESVB 2WK2A 2AK4A 2ADGB 3ZYJA 3SKNB 5IT2L 3IDUA 3MRJA 4S10A 1UVQB 2BFVH 4HHAA 4H1LG 3L5XL 4XP4L 1FNLA 2D0HA 2V6HA 4LBEB 4IEFB 4Y2DC 4JRXA 4G8GD 3HMXH 4ZUUA 3G04A 2UY7A 5LGJB 4PTUB 5C07E 3L3KB 3HZMA 2PXYB 1MQ8A 3T3ME 5A2JH 4X4XA 4CVXA 5A1AA 1J87A 4R90L 4X5XB 3X13A 5MENE 4NQXB 4D9QD 4DGIH 2LAGB 3L3DB 5FM8A 3EDDA 3OAYK 3UDWC 4AZ8A 1W0VA 3LSOA 3VH8A 1MJ8H 1ZT1B 4P46A 3QG7L 3U0PA 3QUMB 3U46B 4JFEE 2IAND 3CDCA 3MX0A 4OCRL 1CK0H 5C09B 1RU9H 3MNVB 1TZGH 4U1LB 3QH3A 4WIQA 4F7EB 1DBBL 3MYJB 4LDEB 4R2GB 4KI1A 1OF2A 1MNUH 3MRPA 5CEYB 1DQLH 3JWDC 5I66A 3OAUL 1F58L 1QFPA 3SDDA 4M1GH 5FGCB 4H8WH 1ERNA 4NIKB 1ZLSL 1FL5A 4HXBL 1ITCA 3ULUL 2FO1A 3M17B 5IQ9B 1B0GB 2WIMA 3BFOA 3TA3C 5GZNC 5GRYA 4UQ3B 3E6HA 1HSBB 3QUXB 2VDPH 4XGZA 1AXTH 1VADB 4KJPC 5CEZE 3RVWD 3RL1A 4LLYB 4PRIE 3UTQA 5GS1A 1B2WL 1DFBL 1P4IL 1I8IB 3TJEH 3HI6L 1VFBA 4R0LA 1B6UA 1BFOA 4XTRC 5GJSL 5FYJD 4WHYH 3D3VE 4DWHA 2Y9RT 2ESVE 4RDQF 4FXLA 4QXTA 3GKWL 5HDQL 3O9WB 4P23A 1GGCL 2QADC 4UV7H 3D25B 3IFOB 3MRGB 4PJFA 4YH6A 1WEJH 1KCUH 1A7OH 4F37K 3JUZA 4RMTA 1DJSA 3N1MC 4JHZA 1SY6H 5K9QI 4N9OB 4WNQA 1MH5B 3CU1A 1FAIH 3PHQB 3F58L 1G7QA 1P2CA 3CNKA 3CCHB 1OTSC 5DWUL 1LO2H 1W72B 3OAZH 5EPMA 3PF2A 4TTDC 2VR9A 4ZPTA 4ZXBC 4JG1L 1CLOH 3ZTNL 4OGXH 3S96B 2VDNH 3EZJB 2AQ1A 3QQ9C 1EEUA 1DSFH 5C0NC 5EU4B 4AL8H 2XG4A 4PY7B 3WS3B 1OTUD 4L8DB 5CUSL 4JKMA 4LSQH 3LN5B 2D03L 3CVHL 3FRPG 1O7VA 3MRKB 4I3SL 3KPPB 5TE6H 1JMZA 4UQ2B 3MREA 3F7QA 4ESKA 4V1DA 3OKYA 1S9YA 5C09E 4Z78B 3PQYA 3MRQA 2QQLL 1E4KC 1MCEA 1UZ8A 2EH7H 3VXRD 3ARDA 3OSKA 2VH5H 4R8WH 3LVEA 5BV7H 4JFYA 1AGBB 3W5NA 1ZA6B 5F3BB 1UC6A 1BM3L 1EHAA 5CJBA 5FGCE 1BLNA 4ISVB 1N7ML 4PREB 5BMFH 1X5XA 1VGEL 4PJXA 3WFCH 5E8NB 3T0EA 3V5KB 3UBXI 4DKFL 5I18H 4N9GA 4XZUA 1PG7X 4YEEA 1N5AB 1FFPA 3RNKB 5HHPA 3VWJC 4MJ5A 1S9XB 1RK1B 5CP7B 4JG0H 3MBEB 4UTAL 3TESA 1XF1A 3F7VB 2DBLH 4IRSD 3B5GA 3QZWB 4LLVB 4MQ7A 3WIIH 4WU7B 2EKSA 3SQOL 5GGRB 5E8OB 4HKBB 4BH8A 1AKJD 5AZEH 5AG8A 3BJ91 3LKNA 1F6LL 2IMMA 1FORL 5GHWH 3D2UD 4JFZH 4MJID 1UM4L 5B4MD 1H3PL 3NBNA 5I16A 4KDWA 3K8LA 5EIIB 4Z77B 3OR6B 4U1MB 1KG0A 2V9QA 4I4WB 3QEUA 5BRZA 1BZ9B 5FECB 1R5VA 1CDGA 5DUBB 4PJAF 3EO0B 4KJQC 2Y5TA 4NRYB 2NY4D 4WEBL 3CJJA 4XVJH 5D2NA 1U91A 3FB7A 5MP6H 5HD8C 4HJ0C 4LFHD 1NFIB 4LCCC 2B20A 3NZ8A 2GCYB 1TMCB 2WLYA 3BZFA 3QUKB 2YKLH 3GSNA 5D6DA 4U6XA 4YK4B 5K9KA 1OHQA 2DQGL 3SE3C 1ORQA 5DD6A 2PW2A 5C2BL 4H0GA 3OB8A 3VWKA 4DUWA 2M2DA 2VXTH 1NGWB 1J8HD 3SDXF 1KB5A 3EFFA 1YZZA 4YGVA 1U93B 3DTXA 4G8IB 1ADQA 4XPTH 3V0AC 3V5DA 2VZ1A 1H5BA 3L3IA 1OGAA 2W60B 1HHIA 1JK8B 1HDMA 2Q8AH 1AR1D 3LEXA 1M71B 4X7FC 3HMXL 1BJ1H 2EDRA 4QRRA 1ES0A 2BY2A 4L8SA 3LRSA 3D39B 1LEKA 2IAMA 1HILB 2P5EA 4X98A 5E5RB 1F4XH 4P5TC 1L9NA 3X12B 3OGCA 5J4MA 1ONQA 2LU4A 3QNZB 3KPLA 5GGVL 2P8LB 4G8EB 3UTTA 4U2ZA 1MFAH 4DGIL 3Q6FA 4PJIF 2ED9A 4IHOA 4KKCD 3HI1B 3BX7C 4OD2A 1MJ8L 2DQHL 3UJJH 3EOTL 4XBEH 2HLFD 4JM2C 3BW9A 3LQMA 1S7SA 4GKZB 1HCVA 5DK2A 1SQ2N 4LPUA 4N68A 5GJTH 1CK0L 3FN3A 3U30C 3V6FB 1RU9L 1TZGL 2EDWA 1HE7A 3LB6D 3TBYA 3VXPB 3C6LA 2KQNA 3JWOC 3OKDA 3KPRD 4HIEB 1BVKB 1MNUL 2X7LB 1ZGLB 1FG9C 1K3ZA 2MQCA 4PLJC 4OCWL 3TBSB 5F9WB 3QG6B 5EBWA 5EO0B 3STZB 2FSEB 3P4MA 3OB0K 3KXFD 2VDLH 2AKRA 1EERB 1T89A 4YNYB 3LAFA 1SJHB 2D7MA 4IIQA 5E4EB 1N5YH 1HWHB 2JELH 3FO0H 3U7WL 3QWOA 4WW1B 4G9DA 1NAMH 2VDPL 3QRFM 1AXTL 3ZE2F 3T09A 4UU9B 1S3KH 2V2XA 4C54A 4KUCD 4Y8DC 3C9NA 5DTFA 4E41B 4HUVB 4W81A 2X05A 4ZFFB 2JJVA 3V4VH 4XXDB 1I3RA 4EKXA 3SJVA 4J7RA 3SDYH 3FHQA 4HS6B 2JB5H 1T4KA 5F44A 4XVTH 4ACPA 1MI5B 1JPFA 2Z8VC 4UBDC 1JNHA 4JO3H 1IMHC 3S8WA 2PF6A 3PABA 4UIKH 4UV7L 2DQIL 2XZCH 1KCUL 1U8QB 1IFHL 5FKAA 3CSPA 3WEXB 4CVZA 5DJ2B 5F6HJ 5BS0D 5MEPB 5AYQA 4ZSOB 1NGXB 5D7IB 3RZCC 1T7YA 3D39E 1LO2L 4XNXH 1AY1H 1OSPH 1CLOL 4OGXL 3TT1H 1HHJA 3FB5B 1JPGB 2J8HA 5C0JA 2VDNL 4ODWA 1A0QH 4K23H 5SX4I 5T3ZL 4YXLH 1DSFL 1SM3H 3PWVB 4OCLC 3QEGH 4UI2A 5L6YH 1MLCA 1IGYB 4FXKA 2DM3A 4LSQL 5C8JB 4NNXB 3UTSD 1S78D 3KG5A 3I3BA 3NFPB 3QIUC 5TE6L 2J6EH 2F19H 3BWUC 3QDJA 5HGBA 1CF8H 3OTTA 4F33A 1MEXH 3QEQB 3VXTA 4GRWF 3V0WH 4DZBB 1TJHH 1GC1C 4RIRB 1WBXA 5GGQH 2EH7L 2Q7YA 4R8WL 5EU3A 3DGGA 4O5LH 5B3JF 5BV7L 1XF3A 3MROA 1F13A 4YBHA 1KLUB 1FV1B 3MV11 4FQPA 1EO7A 1QLFB 1MCOH 1XR8B 4M6NH 2AI0H 5I1JH 5BMFL 3KYNB 5F89A 3WFCL 2ADFH 3UPCA 5D1XA 2X4TB 5JDSB 1BIIA 5I18L 3L95A 2E9IA 4MA8H 1U36A 1U8MB 2ARJA 3MFFA 2ITDA 4KROC 5DYOB 2FO4A 4WHYG 3QP3A 1R3HB 5CHNB 4E41E 2X4NB 3VXSB 3MRCB 1IM9D 4JG0L 1XF4B 3U7AA 3EYUH 2DBLL 4XT1C 5F1KC 2DMKA 1J05A 4DN3H 3PG2A 3WIIL 2R4SH 3B9VA 1RULL 4HS3B 5I1KH 2NNAA 2VISA 5B39A 5AZEL 1MI5E 1QACA 4Y4HD 5DEGA 1KIPA 1T20A 5DQJB 5GHWL 1ZHNA 2AJZB 2W9EH 4M7KH 4H88H 1HEZA 4JFZL 4MDIA 1PDKA 3ARFA 3FOLA 2CD0A 4DTGH 2XNAA 2LTQB 1FLRH 4OUUB 1I8LC 2HVKB 1F2XK 4OZIB 3QAZB 2CQVA 4ZSOE 5AZ2L 5IFAH 1S7TB 4HIXH 4OM0L 3QUYB 5DLMH 3RUGA 2C3GA 2FX7H 4HIJB 3JVGC 1IT9H 1V3MA 3ZSSA 1DEEB 5JMRA 3TT3H 4HPYH 4X4YB 3HRZB 3RVWC 5E8PB 2OYPA 2R4RH 3QYCA 4PGCA 2AJUL 4IS6B 1FVCA 3IU3B 3MO1B 2DQDH 2GAZB 3KLAA 4QOKA 4BK5A 3ESUF 3F12A 3O3BA 4H25A 3FB8B 3CDYA 3QJFA 3WO4B 5D6CB 1T1WB 2LU7A 4X7TA 3MZTA 5A3ID 2YZ8A 2BSSB 3QEQE 2GJZB 2YXMA 4ZAKB 3VFVA 5DFTA 4LLQA 5DK3A 4K71C 2VXTL 4NYLA 4L5FL 1NCDH 3K2UH 5H2BA 3PWNB 2NY6B 1ZHBB 2UV3A 4XP1L 5GGUB 5HYJA 5ID1B 2JCCA 5HYSB 3AAZB 4XPTL 3HFMH 4UOW0 4FQIH 4X6BB 3VJ6B 4GQ9L 5C0AD 2Q8AL 2DKSA 2R2HA 4Y5YB 4MNQB 2K1MA 5ENWA 3PV6A 2C26A 4PRAA 4JY6B 3KPTA 4YBLC 2ZG3A 5EN2A 1SBSH 1TZHB 3H9SD 4FABH 1F4XL 4ODVH 3EYVB 1MJ7H 4GW5A 3TNMA 1OTUC 1DN0A 3VXSE 1MFAL 2GK2A 1EGJA 2MOVA 5T3ZD 4IOFD 5HY9B 3KS0J 4R96B 1S9WA 5CBEA 5DT1L 4NRXB 1YYMH 4ZO6A 4XX1E 3UJJL 4FTVD 5JOFA 3U36B 2P48B 1X6NA 5I19H 1MHCB 1S7UB 1HK6A 2WV3A 3RY5A 1URLA 1YQVH 5GJTL 2BNRA 1RZKH 4WW2C 1K8IB 3HUJA 5HHQA 1VFAA 2H2SD 4O2CA 5BZDA 4U1IA 3HC0B 2A73B 4N1EA 2E7LA 1T1ZA 4W4OA 4OZIE 2YD6A 2VDLL 2EDYA 1WBYB 1I1FB 1MPAH 1N5YL 2JELL 3FO0L 3G6DH 1JZ7A 1QSED 5EZJB 5L2JA 3BQUD 1CXHA 1EXUA 2V7HA 3QISA 1VEOA 1S3KL 2VLJE 5F70A 3EJYD 4MWFB 3QI9A 2WMPA 4IRSC 4GFTB 1VFMA 4XWOD 5E7BA 2FD6H 3KPQA 1D5BB 4RQQB 5FCSH 5J6HB 1CN4A 3SDYL 4RAUA 2XTJB 2JB5L 3SPVA 3WLBA 3TWCL 4XVTL 1JV5A 1B3JA 1V05A 2AJYH 5EUOA 5B4MC 1WIPA 4F9LA 4IRJD 2XQYK 1W0WB 2JIXB 1VKXB 2NYYD 4L1HA 4UIKL 4YQXH 5DA4A 2HTKD 1PFCA 2XZCL 2IALB 1PGRB 2IFFH 4HXAH 4WUUA 1QHOA 1KENL 5E9DA 3QXTA 3TVMA 5B3NA 2CO7B 5IROC 4MNQE 3OX8B 4G6KH 4JGJA 5D7JB 5ESQB 4WTWA 3BD5A 4JGMA 4XNXL 1AY1L 4PGBA 1F2QA 2CMRH 2NY7H 4MVBC 5SWQA 3W9EA 2VQTA 3TT1L 4TUOA 3KLHD 1RIVH 1A0QL 3ULVD 4YXLL 1SM3L 4HDIA 3QEGL 1KCLA 3IXAB 5MI0B 4B7LA 5I8OH 5L6YL 1HKLH 4QYOB 2QQKH 4UT6L 3GKZA 3I6KA 1KEGH 1AP2A 3TBWB 3VD4A 3FTGA 4F8QA 3LIZL 3MRJB 2J6EL 2F19L 1I3VA 4NT6A 1CF8L 3HMWH 1T1YA 3QCVH 2AVGA 3V0WL 4OLUH 4I18A 5GGQL 4F7TB 5F9AC 4O5LL 4GRWH 2VL4A 5BOZG 4JY4A 5I30L 1AR1C 4F8TA 4MCYB 4DUVA 1MCOL 3UXFA 1IC4H 1ZTXL 4M6NL 4GAJH 5I1JL 1WWAX 2NX5A 2VAJA 5I1LB 3OGOE 5TDNA 3Q5TA 2ADFL 3TBTB 1W0VB 4K9EC 1X5JA 1OAYH 1IGCH 4MA8L 4LP4A 3U0PB 1NUGA 3FFCA 5DRXA 4BZYA 2VDKH 1RURH 5IJVB 1QVOB 4KKCC 4Q6IB 3UTPD 3W0WA 2AXFB 5L2KA 3QH3B 1NC2D 2C1PB 1HZHH 3EYUL 1T21A 2D7TH 1YA5A 2AS5M 4U0RC 1OF2B 1YMMA 1E4JA 2XTJE 3MRPB 4RDQG 4DN3L 3S35X 4LASL 5I1KL 1D5ZA 2B5IC 2OS7A 3SDDB 3LB6C 2ZG1A 5J11B 1MAMH 1FL6A 3PHOA 2W9EL 3LDBC 4H88L 4YE4H 2X09A 4YHPB 4L4TA 3STLA 2EEBA 3LKRB 5DD1H 3HE6D 1TQBC 3E6HB 1HYSD 2NW2B 4XGZB 3NIGF 4EIGB 3DROB 1WWCA 3RL1B 4A6YA 3PWLA 5IFAL 3CX5J 3MRNA 4HIXL 5DLML 4W4NA 3UTQB 3VXNA 5GS1B 2FX7L 1IT9L 1I1AD 4RMUA 3MUZ1 1BFOB 2A9NH 4D0DB 3TT3L 3UAJD 4Y1AD 4TVSa 3DNKA 4QRUA 3RP1A 4P9HH 4PGDA 1Q9OA 1U8PA 3EYFA 2FEEI 35C8L 2V2WA 2DQDL 3DV4A 4G9FA 3FT3A 2G75A 5EIQA 1CVSC 2Y23A 3M1BB 5EA0H 1Q0XH 1EMTH 4J3TA 4U1GC 4JRXE 4OFYA 3K2UL 4WNQB 5IB2A 4OZGF 4X0KB 4QTIH 4K3EH 4HH8A 2W9LA 5EPMB 4D2NA 3UROR 4ZPTB 2VXVH 2HJFA 3GJFA 4JHAH 2Z93B 3FOMB 3B5HA 4FQIL 1NL0H 3RJQB 4JVPA 2EYTA 1YPZB 4TYUA 4PB0H 3QDMD 4GLRH 4OZ4B 3T2QA 3L9RA 3PGCA 1UYWH 4QGTA 4QXWA 2OI9B 4CJ1A 1SBSL 3V9FA 3AC0A 4FABL 4ODVL 1RZJC 2V5RA 1P7KA 3B5TA 5IW1B 3MREB 5ERWA 1S9YB 5CILH 3PQYB 3MRQB 3NCJH 2NY1B 1ITBB 4OF3A 4Q0XL 1S78C 5ICZA 2XV6B 3ARDB 1YYML 4N0RA 4JFYB 5KAQF 1GXEA 1CDUA 2Z8SA 1IAKA 5I19L 5HJ3A 2GKIA 5BXFA 1YQVL 3S37H 3MGTA 2VR4A 1BLNB 2D31A 1DQTA 1RZKL 3EAKA 1NEZA 2M8XA 3QDGD 2HFTA 1K5NA 4XZUB 2Q6WA 3L7FA 3TYGH 1FFPB 2VIRA 2EDDA 3RDTD 5K9QG 2FDBP 3WFEH 4L3CB 4U33A 1MPAL 4X6CA 4M03A 1RVFH 3QULA 1AC0A 4JFED 4RFNC 4NKOA 1T66D 3G6DL 1J12A 1GPOH 9CGTA 1VERA 4OKVB 32C2A 1N2RA 2EKSB 4WEMB 5E5MA 5JUEH 1C5DA 5C0DA 1LE5A 1R5WA 2AW2A 2WWKO 2J5LC 2GT9A 5JW4M 3LKNB 5HI3D 1L6XA 1UZ6E 3QUZA 4DK6A 2GJ6A 2FD6L 1ZLWH 2MSPA 3QQ4A 5ADPH 1V3JA 3C09B 1KSRA 5I16B 3HAEA 5FIEA 4HFUL 5DQ9A 5DUPH 4Y4HC 1VEPA 1T83A 4AEHH 2NXYB 3F65A 4PJCA 2AJYL 4NN6B 5F7LB 1WBZA 3QEUB 5BRZB 1KTLA 4HCRA 1R5VB 5JOPD 3IXTA 2Y5TB 4YQXL 1P5VA 1FJ1A 1RJYB 1YPZE 1FAKT 2IFFL 5D2NB 4HXAL 3FB7B 4KMTH 4X9FA 3Q48A 1FZOA 5IVXF 4G6KL 4Z7VB 3D3VD 5IJKA 1YJDC 2H3NB 2HTLD 3GSNB 2P24A 4QKXB 3ZT5A 4NKDA 5K9KB 4WGWB 3UBXG 4F3FB 1BEYH 4GXUM 2NY7L 4Y5XB 2QQNH 5J1TC 3BGFB 1NGQH 1ORQB 2BY3A 1U8HA 4XMKH 1AI1H 1RIVL 4LVNC 3RVUD 1MWAH 4G42A 3PQYE 3QHZH 3NFNB 3VWKB 5CWSA 5I8OL 4Q2ZA 3E2HB 1HKLL 4UINH 2QQKL 2ZKHL 2YD1A 5HYEA 1KEGL 1KB5B 2WUCL 1T2QH 5E1AA 5A3IC 3JWNC 2CH8A 3MCKA 2XYCA 1JWSA 2W65A 4ZS7L 4UT9H 4R7NA 1H5BB 2Q86B 3HMWL 1OGAB 1HHIB 3BEWB 5I75B 1G9NH 3QCVL 1PBYA 2I9LA 2XQBL 1UH3A 5GSRB 1G9EA 3OPZH 4GMSH 4MNGA 1ES0B 3OB0H 1LEKB 2P5EB 5E03A 4X98B 4S0SD 1R3LA 3OGCB 2W0FB 4X7CC 4XCNA 1ONQB 2AJVH 4JCMA 4KKAD 2DWEB 3UTTB 1F5WA 1IC4L 1SMOA 5JW4N 3D0VB 4OM1L 4JRYA 3S34L 4D9LH 1Q94B 5B22A 5T1KD 3RVTD 4OD2B 5I0ZA 1OAYL 1IGCL 3BW9B 1DEDA 4IOFC 3RWEB 5DK2B 2VDKL 3TEUA 1RURL 3ECBB 3LRGA 4DKEH 3VXUA 1AO7B 5JQHC 2C4FT 1HZHL 2HN7A 4RGNB 1NBVL 3OKDB 5D7SL 4I3RH 2DF3A 4P5KA 2RQ8A 1V3LA 5EBWB 2AAVA 3P4MB 3VRLE 3U4BH 3G6AA 1CFVH 1X6LA 1CG9A 2XT1B 5FYKD 4ZNEA 1MAML 5BRZE 2H2SC 2YD2A 4IIQB 4OD1H 2Z35A 1GH7A 3ARGC 4YE4L 2PNDA 3QWOB 3JTTA 4D8PA 1IKFH 2A77H 5D2NE 5DD1L 4ZYKA 3HPJA 3QIUA 2YA2A 3H3BC 2Q3ZA 4FQHA 2IBBA 2EDTA 1CXEA 4Z7VE 5GGVY 3TCLA 2V2XB 3RVXD 4PJBF 3C9NB 4AMKH 1GRWA 1KT2B 5FHAH 3S9DB 3S4SG 1BVLA 3SJVB 4YXKH 4S11A 4TUJB 2A9NL 4N0CC 2F53D 2CXKA 3ZO0A 4Q74A 3A6BH 1F4AA 4ONHA 3EJYC 3TJHD 1IGJA 4P9HL 2GUOA 4X4ME 4DGVH 4XNUH 4G8GA 4XWOC 1WF5A 1JPFB 1MQKL 5E1HB 1JNHB 2E7HA 1P4LA 1Z9MA 3PABB 2HJLB 4YDLB 1RJLA 4U4BA 4LPVA 1N8ZA 1OGAE 3FQXA 1E4XH 5FKAB 5EA0L 1Q0XL 1EMTL 4CVZB 1DVFB 4U1SA 2NYYC 5EU6B 2VSCA 3GSWA 2ZJSH 2HTKC 4QTIL 5FUOH 5D4QA 4ELMF 4K3EL 2CDGA 2P5EE 1RUAH 2VXVL 5J3HD 4JHAL 1UGNA 1HHJB 2F8VA 5HHOD 2CPCA 5C0JB 4P99A 3UTTE 5L88H 2Y1VA 2X6MA 1MLCB 5HGAA 4FXKB 2ICEB 3RPIA 1UYWL 4K7PH 3KLHC 2PYEA 5C71A 4LEOA 4ETQA 3BRFA 4FNLL 1DQMH 3ULVC 2EO1A 2YWZA 5HDBE 1ZVHA 5HGBB 2DKMA 5CILL 4F33B 3D18A 1OY3B 3NCJL 1AO7E 5JOEA 3CZFB 1I8LA 3TNNB 3VXTB 4RGNE 5F9OH 1E6JH 1AHWC 3IAPA 5EU3B 4H1LA 4WU5A 3MROB 2QL1A 3S37L 1EFXB 5SWZD 3SDCD 1A6WL 4G5ZH 1L0YA 5CMAB 4XPFH 5F89B 5C9JA 5D1XB 4Z6AT 1BIIB 3TYFA 4YHML 1AGFB 2ARJB 3FONA 4QHKI 4FQXD 1JF6A 3WFEL 3GJEB 3MNWA 1T0PB 1RVFL 3SJVE 4QRTA 3O6FA 3I75A 1GPOL 1BAFH 5AAMA 1J05B 4ZTOH 1EBPA 3H7BA 1OVZA 1AC6A 2PTTB 5JUEL 2VISB 5B39B 1GOHA 2EZ0D 5DEGB 4OGAD 1KIPB 1T20B 2HT3D 4FQ1H 2AV1A 5IMLA 5EH1A 4MAYC 5ADPL 4MDIB 3FOLB 4P49A 3HNVH 3QWRD 3DUSA 2XNAB 5DUPL 1CVRA 3FHAA 4LLMA 5AD0A 3CUPA 2FIKA 1JWUA 4GUPB 3RJDA 2FHBA 3RUGB 3HE6C 1X7QA 5D5MA 1HYSC 2KL6A 2BVOA 4KMTL 2UZYB 3LEYH 4LGSB 5J1AB 1T5WA 4FMKA 3I84A 4O2FB 1KCVH 2CK0H 2R8SH 1PEWA 3VXRA 3L3HA 1FH5H 3KLAB 4TOYH 4RBPK 4WW2A 5LVEA 3F12B 3O3BB 4H25B 2D7OA 1BEYL 2QQNL 4PRPA 4OLVH 4MB3A 1QPPA 1NGQL 4X7TB 4XMKL 4YDJB 4MQSB 1MWAL 1KIQA 2RHEA 5DJ0A 1T3FA 3QHZL 1HXMA 3RY6A 2Q7NA 2YPVL 4PFEA 4UINL 4R4FL 5DZNA 1A9BA 3PHSA 5HYJB 4L3EB 4NQSA 4ENED 2JCCB 1C7SA 5FO9A 2R2BB 4L9DA 1T80A 1G9NL 5IF0A 4HKZA 2H8PA 4LVOC 4NJAH 1RZIB 1FE8L 1FO0H 1M7DA 3OPZL 3QO1B 4GMSL 1FNHA 5ENWB 5KJRL 3E8UH 2MHAB 3V7AG 5DVNA 5EN2B 2ORBH 3WIHL 3ARED 3KVQA 1AKJA 2GFBA 5GRJL 2AJVL 4GW5B 3TNMB 2Q76A 4WEUD 4LAJH 2UVEA 5D93C 3D2UA 2AEPH 1JMXA 3FRPA 4MJIA 4D9LL 1D9KB 2DRUA 4FZ8H 2XN9D 1OSZA 3VD7A 4PTTB 5JOFB 4J2XA 1SYSA 1QYGH 3R8QA 2WANA 1AXSB 3CFCH 2YXFA 1XZ0B 2AEQL 4CDHA 1UG9A 3RBGA 2BNRB 4F9PC 4DKEL 4ONGH 3M07A 1N6QH 1A8JH 1EDQA 5FV2A 2CIKA 5HHQB 1H8NA 5C3TA 5D1QD 1VFAB 2OMBA 4I3RL 2V9TA 4OAWA 5E6IC 5BZDB 4JKWA 1KPUA 4K94C 1NDMA 1QRND 4J3OC 2P5WD 3MLPA 4KU1A 3U4BL 1CFVL 2X4OA 3QXDA 5IHZA 3RUGE 4I3GA 4LSSH 5JDJA 1KFAH 5L2JB 3WIFA 2FJHA 1IKFL 1L0XA 2A77L 3RDTC 1TETH 4JFOA 2BK8A 5F1NB 1S7XA 3L5HA 5KW9H 4LK4A 4MA3A 1T66C 3CH1B 1IKNA 3O11B 4QOKE 2QLVB 3QI9B 3BPOC 4CKVX 4KTEH 4KWUA 2IGFH 4ODBD 5FHAL 1QR1A 4YXKL 4RAUB 4PJ8D 3A6BL 3SPVB 2YR3A 3WLBB 4HGWA 1JV5B 4DGVL 2ICWB 4XNUL 4BH7A 1S7QA 5EUOB 3DVIA 5HYJE 4NZDA 1MCWW 2A9MH 4L3EE 5EOTA 4PUBH 1MHHB 1QBBA 2JCCE 4XMPH 3VGDA 4HMDA 4QRPA 3HE7A 5M7QA 1NUNB 3O6MH 1O0VA 2BCKA 2D0GA 2MKLC 4ZQKA 1OWWA 1QFWH 2A83A 1E4XL 2OBGA 5E9DB 1DLFH 2AXGB 3CC5A 3TVMB 3DVGA 4U2YA 4OIIL 3IF1A 4JJHA 4WI7A 1GJIA 2ZJSL 5FUOL 4U1KB 4PGBB 5T5FH 3CVHA 5SWQB 3DX9B 3BPCA 4TUOB 3BESR 2CKNA 2RAMA 5L88L 5FYLH 5CSZA 3GJFK 1X5YA 4CDGC 3BSZL 4JKPH 43C9A 1AP2B 4K7PL 4MDJA 4BSVA 1ZOXA 3GMOA 3RVUC 4LVHC 5BO1L 1OW0A 1DQML 3TA3B 3Q3GB 5A40E 4YHZH 2WIIB 3NN8A 4NT6B 2BNRE 1TQCC 2VUOA 3T4YB 1T1YB 2P7TA 2YPLA 4I18B 3MV9A 5ALBH 3LH2H 5JHDA 1HHHA 4PRBB 1U8IA 4WV1A 3U48A 1VA9A 4J8RA 2WP3T 2BOBB 3DRQA 2G9HB 3GRWH 3EOAA 4O58H 1LDPH 4LRIC 5TDNB 4XPFL 2X42A 2IG2H 4O51B 4I0CC 3WL9A 3MLTA 5DJXA 3GB7A 4FHBD 4KK5C 4KKAC 2QADB 2ICWJ 1VGKA 3CSYA 2F58H 4Y8AA 4XHJD 5FAAA 3ZTJH 2C3VA 3AS3A 4CVWA 4EQ2A 3RVTC 3W0WB 5L2KB 3SY0A 4NN7C 5AAWA 4FQ2H 1V8HA 3JBG7 4KDTA 1YMMB 3SGKC 4ZTOL 1ZEAL 4ZXBB 5BJTA 5F7YC 4GW4B 2BSED 3FO2B 3NMEA 4S1RH 5EUOE 5BS0A 3PHOB 4FQ1L 2DI8A 3QCTH 4L4TB 3HNVL 3P77B 4OB5H 1R5IB 3WJLC 3NCFB 3C2AH 4YR6A 5C6PB 1U58A 5E9DE 2FEEL 3GSQA 4X9IA 1BD2B 4ORZC 1OAUH 1WUNT 1SBBA 4GRLA 3MRNB 4QCIA 1RQ5A 3BP7A 3UTSA 5C08B 3VXNB 3WD5H 3RKPA 2VLJD 1JF5A 1FFNA 4G80A 1OCWH 3QT2A 1LGVA 4X6DA 1G7PB 3RVXC 3GM0A 3LEYL 2IBGA 2YPKA 4BFBD 4PGDB 1LD9A 3DXAB 3SHSA 1U8PB 1KCVL 4P2CG 5E99L 3U9UA 2R8SL 3EYFB 2IFGA 4ZAKD 2V2WB 1FH5L 3DV4B 4TOYL 2BVEA 5FUZH 1S7WB 4OLVL 1KPVB 4YBQD 4LSRH 3TJHC 2F8OA 3MJ6A 1GAFH 1X3DA 4K3JL 5KAQG 2ED7A 5MHSE 3VWJB 4YJZL 3HMXA 3MRFA 3B3IB 2VUYA 2HJFB 4MNHA 4DJMA 2XFXA 3ZKQD 2EYTB 2JJTC 2A6IB 1HNGA 4XP6H 1IM9A 2IPKA 3BN3B 3PNWB 3L9RB 2NY2D 1E6OH 1XIWD 4NJAL 3PGCB 5M95B 5J3HC 3MLSH 4F7PA 1NANI 2OK0H 3IDYC 1WFNA 3FFCE 3HS0B 3RL2B 1P7KB 2CLZA 5ERWB 3OZ9H 2VXSH 4CN1A 3W0WE 5L2KE 5EU5B 1CD9B 4ZOBA 2EDNA 2EIBA 4M1CD 2AEPL 4WWKA 1BQHG 5ICZB 1YMME 4FZ8L 5CEZH 4OLZH 1ZHLA 3MOQA 3ABZA 1IAKB 1QYGL 1S7RB 3CFCL 4JFPB 5HJ3B 4PJ9D 2FR4A 5BXFB 3IJSB 1NDGA 4NUJA 4LHJB 2IH3B 4ONGL 4PG2C 2WWMD 1N6QL 1IBGH 4L4TE 3OBAA 8FABA 2ZUVA 1XGRA 4AIOA 1PQZA 1K5NB 2NY5C 3EOBA 4F15B 2HKFH 3L7FB 1BD2E 3SDCC 2YD5A 5ID0A 3FO1A 2AERT 1ROWA 1KTRL 4NSKA 4LSSL 3VFNA 1J0YA 3P0YH 3HNSH 3RWHB 3T4AA 5I1DB 4X7SL 3H0TB 5FO8A 4FQXC 5K9OA 1N2RB 4MZ3A 5E5MB 1A4KB 1C5DB 2YC1A 3DXAE 1R5WB 2XTJD 4AQ1B 5C0DB 5KW9L 4EXKA 2GT9B 2R0KH 4L9LC 3CDFA 3UPAA 2GJ6B 5F71A 2IGFL 1TVBB 3QQ4B 4JCLA 1LWRA 2CDEA 3HAEB 2VAAA 3R0MA 2EZ0C 3QIBD 5C0AA 1XGTA 5FEBA 4OGAC 4P5TB 2HT3C 3N1GC 5IFHH 4KAQH 3QFJD 3QUMH 4PJCB 5KVEH 3WS6C 4HUMB 4PUBL 1KTLB 4XMPL 3BKJH 1H3UA 3O6ML 4JHWH 5ABDE 1FJ1B 1TZIA 1T22A 1MFBH 2DICA 1T04A 2F54A 1FZOB 1ZSDA 3EZ8A 3QPXH 1CGVA 3KYKH 1RI8A 4NQCB 4X7EC 5J6GB 2P24B 3DV6A 4NKDB 2F5AH 4FTVA 5T5FL 4PP1D 4UNVA 2AK4D 1CFSA 2P43B 5DJDA 1BGXH 3LPWA 4K7FA 2YEZB 3TH4T 2Z4QB 1EEQA 5FYLL 3BWAB 4PJDA 3AS0A 5CWSB 1XR9A 4Q2ZB 1DBKH 4JKPL 1NSNH 4TNWK 4JRXD 4EDWH 3FN9A 4KHTH 1MLBA 5E1AB 4BELD 3VFOB 1CU4H 3S35H 1GL4B 2W65B 3IDNB 4YHZL 5T33H 1MCPL 3IJYA 3GSUA 2C7UB 3REVA 4M3KB 3G6JA 4C57C 2J8UA 1NC4B 4ENEC 5ALBL 1G7IB 2I9LB 1A6PA 1QSEA 3LH2L 1XGPA 3BQUA 4D9RD 4MNGB 5INDA 1LO5A 1WFOA 5ISZA 2XPGB 3P11H 4XRCA 5GS2H 4P46D 3BISA 1Q9KB 2OX5A 4X6CE 1L7IH 3GRWL 5D1ZA 4O58L 5HPOA 1LDPL 2H32A 1HH9A 2AQ2A 5D7IF 2IG2L 5F97E 3HZKA 3AREC 5IVZA 1ZS8A 1PY9A 1JN6B 2Z31A 4LKXA 1CFNB 2HKHH 1W72H 4J23A 3AROA 3AS2A 2G60H 4I5BB 2UWEA 2VQ1A 3GBNH 3QJHA 3NZHH 3FT4B 4IRJA 2GJ6E 1A6VH 4CN4A 1ZV5A 4EVNA 1MCRA 4FQ2L 3T08A 2BSRA 3RZCB 1T03H 1J1XH 1BWMA 1R24B 4QHMA 4P5KB 4F2MB 1KULA 4ELKA 3DVFA 3QFDB 4S1RL 4PJCE 3G6AB 1MRCH 1CG9B 5E4EC 1CBVH 1A6AA 5D1QC 5INCB 5JTWA 2Z35B 2CLRB 2NZIA 4TPRH 5T1MB 3S5LA 3ZYOA 4YX2L 1FIGH 3CDGA 3QCTL 2XWJA 4OB5L 3F7PC 4ZYKB 3LKQA 4D8PB 3C2AL 3HPJB 2VDMH 5GGSB 3QIUB 4OQTA 1NCWL 1QP1A 1MJJA 4FQHB 5FA4B 1BBDH 3MRHA 1OAUL 4NQCE 1RIUH 3A67H 2EE3A 3SGEI 4GMTH 5DJYA 1BVLB 4P23D 3EHBC 4ZODA 1MUJA 1OCWL 3EOYG 1IEBA 5D7KD 1IGJB 2GUOB 2NY5H 3DBXB 4G8GB 3NPSB 1PVHA 5FUZL 3CK0H 1P4LB 3WFZA 5IW6B 4PJ8C 1RJLB 4LSRL 3TGXA 4DFIA 1JZ4A 1N8ZB 4YO0A 1GAFL 4RMQA 4CL7A 3N06B 2Y6SD 4HH9B 2DQUH 2X41A 4MNGE 3GSWB 3L6FB 5ETUA 2HP4A 2J12B 5IIEB 4S1DC 2CDGB 1NCCH 5DK0B 1JIBA 4BYHA 1R3JB 1AE6H 4HWEH 4V1DD 4XP6L 4JRYE 4OZIF 1NC2A 2RCSH 4YDIH 5HGAB 3FT2B 3SDAA 1E6OL 2CK2A 4GG8A 1VACB 3MLSL 4TTGA 2KQMA 3F62A 4ETQB 4Q9QH 4HZLA 2HG5B 5DHYA 4OV6F 3MCLH 3AM8A 3OZ9L 2VXSL 1JPSH 3VXUE 3D18B 3IU4H 2OLDA 4YHNB 4XXCA 4NFBA 2QSTA 5D2LA 1I75A 2DTMH 4H1LB 3HE6A 3T0ED 1WK0A 2EH8H 1EVTC 1INQA 4ZNEE 3O8XD 3WJJA 3V6BR 4PGEA 1CICD 4YHIA 3H7LA 1I1AA 1KGCD 4JZNA 4K3GA 4XMLL 5C9JB 1HINH 2XACC 1X44A 4Y1AA 2HKFL 5J1SC 1CL7H 1F4YL 3FONB 5B8CA 2A74B 3RIAK 5A43C 1QFHA 1PEZA 4BUGA 2APXA 3MNWB 3TM6A 4K71B 3P0YL 4KVCL 2APBA 4QRTB 3O45A 1RZGA 4XHJC 4BQ9A 3HZVA 5I1EH 4NC0B 3EIFA 4G8GE 4RBPH 5DDHA 2R0KL 3PP4H 4UMGA 3U83A 3U79A 2FB4H 2FJGA 4OGYH 2AV1B 1NKOA 2ITCA 3BKCH 1CD8A 4M43H 1TJIH 1N6VA 4YBLB 4D9QE 1PKQA 2ZNWA 1JZ5A 1FGNH 4YPJA 2VB5A 1DANU 4LLMB 5AD0B 3QDMA 5JW4Q 3CUPB 5JXAH 2FIKB 3DGCR 5IFHL 1JWUB 1U8NA 4KAQL 4DKAA 3P9MA 5KVEL 3QUYC 3HHRB 3W81A 4XP9H 1YQ2A 1X7QB 5GQBA 4WCYH 3OJVC 4IMLB 3QR2A 1MFBL 4HPOH 1T5WB 3B8YA 3SKOA 2XA3A 3QPXL 2X4RA 4P2OA 3KYKL 3VXRB 4ZDHA 4F9PA 1QKZH 2PYEE 4WW2B 1CFTB 2F5AL 3INUH 1AGEA 3BKMH 4XVUD 4DEPB 7CGTA 2J6EA 3UYRH 1BGXL 1EZVX 1KIQB 1T3FB 2W0PA 4ZAKC 2X4SA 1NANH 4XCEA 4TNVK 1EEYB 1X5GA 1NMAH 4D0CA 4YBQC 1F42A 1NSNL 3MJ9H 4EDWL 4KHTL 4NQSB 1CU4L 3S35L 4QRRD 4CRPA 5FO9B 5TE7H 1FP5A 4OF0A 1MCJA 5T33L 2IAMD 2ZCHH 4Y5YC 1CDHA 1QLRA 5IF0B 4HKZB 3GBLA 3NPZB 2H8PB 3G5YA 4IRSB 1M7DB 2AXJA 5FYJE 3MV7D 4RX4A 4XC3L 5GRUH 1JI1A 4GQPH 4CAGA 3FO9B 3P11L 1CGUA 4FQLH 1AKJB 4BKLA 5LQBH 2Q76B 3IS1X 2GEEA 2NY2C 1XIWC 3L3OA 1L7IL 5EFIA 3U2SA 3D2UB 4YFLI 4MJIB 3IRZA 1OP5K 5T5NF 2BXZA 4B50A 4LCYA 3TBVB 2AJSH 3C6LD 4TSCH 1OSZB 3PV7A 1FSKC 2HKHL 4EI5D 4HX1A 1W72L 3PUCA 1ZAGA 3DETD 3T0WA 1G9MH 1A7NL 3BEVA 4M1CC 3WNKA 5C0FA 3GBNL 3NZHL 1KTDA 1A6VL 2FX8H 2EIEA 4M7LH 4Z18A 2CIKB 2NY4B 1T03L 2NPLX 3QXAA 5HHNB 1J1XL 4PJ9C 1CTOA 1KPUB 3UYPA 2Q1EA 1NDMB 4WHTA 1OM3H 2WWMC 3T8XB 3MLYH 2E7MA 1MRCL 3H2WA 4LLUB 3LS4H 1WISA 2X4OB 1CBVL 5IHZB 1BPVA 1G7MA 4TPRL 1FIGL 1X4XA 3WIFB 3SJVD 2VDML 4PJAA 1S7XB 4J3VA 4MA3B 1BBDL 4OCSH 2JK5B 3VXRE 1J8HB 5IBLD 1RIUL 3A67L 4QLRA 2AJ3B 4F80A 4GMTL 3MGOA 4LKCA 1DQQA 4PRPE 4GG6B 2MCPH 4P2RA 2XTJC 4Y5VA 4QHLA 1I7TA 2GSGA 4K8RC 5DJZA 5KZCB 2X9YA 3VA2C 4NQTA 4M9OA 5DC0A 2YD4A 1S7QB 3LHPH 1A6ZA 2DYPA 4Z7NF 1V3KA 5EOTB 4HWZB 3QIBC 1NUFA 3MACH 4L29A 1OAZH 1GCFA 5ACMA 2HH0H 1Q1JH 1J7VR 43CAB 1HWGB 4LF3B 5EZOL 1A1OA 4OCMC 3BZEB 3CC5B 1YN6A 3DVGB 4QNPF 4MXWH 2DQUL 3IF1B 5T1KA 5GGTH 4KDVA 3KNBA 5FGSA 2DOCA 3P9LB 4V2BA 1NCCL 2NY3D 4U0RB 3BPCB 4JLRB 5GIRA 3X11A 2NTFA 3KS0H 4ODHH 3QDJD 5MI0C 1AE6L 5CSZB 4HWEL 4YHKH 5DHXB 2B5IB 3RI5K 5JIKA 4MJIE 3HR5B 3O4OC 2QHLA 3UBXA 2RCSL 4YDIL 4PP1C 4FFZL 1C8PA 3KPRB 4MQXD 3ZKMD 3KWWB 2RBLA 3HB3D 4MDJB 4PJIA 3LDBB 4YFLF 5AUMA 4Q9QL 3KR3H 3C8DA 3VRJB 2J8OA 2LVCA 3NN8B 5E0QA 1TDQA 1WZLA 1JPSL 1CGTA 4BJLA 4AEEA 2MQ3A 2B1AH 3ULUE 4QO1A 2P7TB 3FQWB 3ZKXC 4ODSH 4QY8A 1HHKA 1UZ6F 3MV8A 5JHDB 2DTML 5ITFA 3I85A 4FQCH 5JA8B 5F1SA 5D1XD 1C16A 2EH8L 1QFWM 1U8IB 2IH1A 1N59A 1FL3B 4J8RB 2L0DA 3GSVA 3DRQB 5E5UB 3VFSB 1T2JA 3EOAB 1U2CA 1RZ8A 3LEVH 4KUZH 3BH9A 5EU7C 1Z6JT 2BOCA 1HINL 4P46C 3MLTB 5JORB 3GB7B 1VGKB 3PGFL 3BVNA 1A1NA 1KPRA 4KGLA 1YPZF 1J8HE 4NPYA 1ZLVH 2J4WH 4FRWA 3T77A 4Y19A 4U1GB 4GG6E 1QO3B 1LQSR 4RAVA 4K7PY 4WJ5A 2VZ3A 3VXMA 1B6DA 3DI2B 3ARFD 3DOSA 3JV5A 5I1EL 3SGEH 3O2DH 2JJTA 5J11C 3PP4L 2JB6A 2FB4L 5BS0B 4QRPE 1VFOA 1YEDA 1J0KA 3T2NH 1A6TA 1YN7A 3BKCL 4N90D 4M43L 4Z7QE 4NQVB 1TJIL 1WC7A 4YR6B 1FGNL 5CGYD 3FQTA 3LRHA 3T1FA 4J12A 2RFXB 1R0AH 4XP9L 3BP7B 2AJXL 3UTSB 4S1SH 4R0LC 4QOKD 3WHXB 3DARA 4WCYL 3DUUA 1WT5C 4TVPD 3MRMA 4ODXA 2BVTA 4XCYA 4X6DB 5DMGD 2YPKB 1YEIH 1LD9B 1FRGL 3S4SA 4PG2A 1QKZL 5J13C 4P23C 4W6WB 3INUL 3BKML 1IGMH 4MA7H 5L7XH 4DQOH 4LQ1A 2ZUSA 3MTRA 3WMSA 3UYRL 4BK4A 5SWZA 3BXNA 5FYJU 2EYRA 3FMGH 2YPLE 4OBRA 2CKBA 4H5SA 5JHDE 3BIBX 1INDH 5EIVA 3ZHLA 4JANA 1LO0H 1BBJA 4MJ6B 3GGWB 3EDKA 4MNHB 4G43A 5TE7L 3J8F7 3GMQA 4WRLA 2ZCHL 2Y6SC 3B9KD 2W9DH 2J5LB 1IM9B 3VRLF 4L9LA 1YMHA 1MHPH 4I1NB 3RIAF 4JFQB 3SO5A 2X4UA 3RRQA 5GRUL 1KLFA 1G7HB 4FQQA 4FQLL 2RR3A 5LQBL 2WINB 1RD6A 3OF6D 4Y4HB 15C8H 3T3PE 4QHUB 4RFEA 3CU7A 4Z7VF 2BNRD 4ZUTA 5CD5D 3PWJA 1GGBH 1FNGA 2ENSA 4TSCL 5D70H 3QWRA 1ZHLB 4GW1B 4KHXH 4KPHH 1Y6NR 1G9ML 5BS0E 1SHMA 1NDGB 4NUJB 3CXHJ 4XCFH 5FDWB 3GSOA 2FX8L 5FDYA 4I8DA 2V5YA 4M7LL 3T0EC 3P40A 4QHNB 8FABB 4UDUA 3VDCA 3EOBB 1I9EA 5H37H 5ID0B 4ZOAA 2WBWB 1OM3L 4LVNB 3DHMA 3PWPA 5IR1B 3MLYL 3FO1B 3LS4L 4NSKB 3UTSE 3F7RA 2SEBB 4D3CH 2QKIA 3T4AB 1DP0A 1WZMA 2XXMB 2R2EA 2BNQA 4X6DE 4I0KA 5K9OB 1IM3A 4NNPH 4NOBA 3DO3A 2HRLA 1QSFA 2YC1B 4TSBH 4OCNC 2FGWH 2QEJA 1QRKA 4IMKC 3V2AR 1T7XA 3WDHA 4ZFGH 5ACZB 3ETBF 1U3HA 3ESVF 2XKUA 2MCPL 4HG4K 2ZPKH 2CDEB 5FA3A 3TO4A 4MX7B 4J3UA 5EO9B 2I24N 5C0AB 1XGTB 3MOAH 3ILPA 4LGRB 4CGTA 4WUUD 1BFSA 3AMKA 3ZMRA 2CRMA 3LHPL 4OI8A 3RX7A 1BHGA 3OR7B 4XBGA 5ALCH 3H9SB 3DX6B 4ORGB 4L4VD 4ZUWA 3AREA 3MACL 3TZVA 3U4EB 2ED8A 3C8KB 2HH0L 4LSPH 4L8BB 1TZIB 1OARH 1T04B 3RA7H 1ZSDB 2LABA 3CMGA 4MXWL 5D6DC 2RGSA 5GGTL 2XN9A 3DV6B 1IL1B 2DLHA 3LKOA 4FTVB 2DQFA 3RTQA 2D7PA 5I1CH 1CFSB 2DLIA 5DJDB 1K4CA 3VWKC 2ZSVA 4ODHL 3VD9A 4PJDB 4LCWD 4YHKL 1G1YA 1XR9B 4Z5RA 1PD6A 4NC1C 4XVUC 1NBYA 3MRDA 4WHDA 5LG1A 1UQSA 2DQEL 5EBLA 1KIRA 1QRNA 4HLJA 1EPFA 5I76B 2P5WA 2FX9L 3BIKB 3IJYB 3REVB 3VGFA 2XG5A 4RISL 3G6JB 2B1AL 3WLWD 2I5YL 2J8UB 3VI3E 4ODSL 1F97A 6FABH 1QSEB 2NX5D 1XGPB 4L8SC 3BQUB 1VESA 4FQCL 5INDB 1LO5B 2GITA 1C5CH 3WN5C 2IAMC 3EYOA 2L7JA 1PYWA 2C1OB 3AS1A 2Z8RA 4XRCB 5SWSD 1WV7T 1NLDL 4NO0A 4GOSA 3FFCD 2APVA 4N0YL 3LEVL 2W38A 2H32B 4KUZL 4LIQE 1HH9B 2B4CH 5L2KD 3BDXA 4PBXA 5IVZB 1ZS8B 1ZT4B 4NHUA 4PJ8A 1LEGA 3D85A 4I48A 3K80A 3QCUL 2UWEB 2VQ1B 4X6FA 4KRMB 2J4WL 3QJHB 4IRJB 3C6LC 5FF6A 2IJ0C 1NJ9B 2H1PH 4EI5C 3JXAA 2BSRB 3DETC 3HG1A 1UKSA 4Y4KD 4MXVE 5C0AE 3DSFH 4L4TD 4QHMB 3R06A 2YWYA 1G0DA 3O2DL 1UKQA 1T89C 2QBWA 1EK3A 3ARVA 3SOBH 3GMPA 4JQXA 5I8CA 3H9SE 4KQ3H 5IK3B 3T2NL 1UXSA 1TVDA 4OT1L 3S5LB 3RWCB 2CRZA 3QQNA 4L3AA 5ESVB 2XWJB 3LKQB 5IBTH 2BMKA 5T3ZE 4N5ED 5EZLA 3WSQL 4N8VB 3VGEA 4C4KT 3MRHB 4GAYA 2X9XA 2V7NA 1R0AL 4FTVE 1D6EB 4S1SL 3RI5F 5DJYB 2KKQA 4G9FD 1NPUA 5DZLA 4PJGA 3WXWH 4X6EA 1MUJB 1MWAA 5IBLC 4PJDE 1IEBB 1YEIL 2G5BA 2OTPA 2P8MA 4H0IA 1YEJH 2ZCKH 5CINH 2B2XH 1CE6B 4XPAH 1EAPA 1IGML 4MA7L 2EDQA 3H8NA 5LWYH 2C5DC 3S3PA 4JPKL 3VRIB 4DQOL 5L7XL 1M1SA 1A4JA 4YO0B 3G6JE 1L6ZA 2J8UE 3FMGL 2OJZH 1QSEE 1KB9J 3DIFA 1INDL 2DIJA 1QZ1A 4QWWD 1LO0L 4HMCA 4NDMA 4RGMB 5DMIH 4PYGA 4LRNL 3BP5B 3WIHA 3C6SA 5DRZA 1LP9A 3FRUA 4Z0BH 4Q58C 3BO8A 3EO1B 4PBVC 2DLTA 2FH6A 1NC2B 5HYSG 4M6AA 1EAJA 4GG8B 1KNOB 2NY3C 1WAAA 1QPXA 5DQDL 1A9EA 5DHYB 2UWEE 4GKOA 4QRSA 15C8L 3BD3A 4MQXC 1UJTA 3KJ4C 2XA8H 3HB3C 4Q9BA 3GIZH 5F9JA 4P5MA 1KJ2B 5DURD 2OZ4L 5D2LB 1GGBL 4C83A 4LHUD 2VLKD 3C5ZA 1NFDB 5D70L 5A16B 3HE6B 5LAXA 2O5YL 4QXUL 2B1HH 4KHXL 3V8OA 2ICWI 3NA9H 1CZ8H 3GO1H 1INQB 2P8PA 4LNRA 4OLWH 4CBPA 1BJ8A 1CWVA 4XCFL 4YHIB 3DO7A 2EO9A 1QHPA 1I1AB 4JZNB 5D1XC 4E42B 4HBQA 2NXZD 2JCCF 3CFDA 4NQEA 1P1ZB 3ULVE 1JCKA 4Y1AB 1KB5H 1FVDA 1D3CA 4HUWA 3HC4L 3HA0A 4B53A 4X83A 1MFDH 2EXWD 5FOJA 5HHXL 3DHJA 2IQ9H 2X1OA 3HTLX 1G7JB 3QUZD 4D3CL 3MRBB 2GJ6D 4KI5D 3O45B 5BQ7B 1RZGB 4R4BA 3HZVB 1L9MA 5JA9A 1UB5B 1H3XA 5GS0L 5KSAA 4TSBL 4GRMA 2FGWL 5DDHB 4MLIA 4OZFB 1HKFA 3QO0A 1JHTB 2ITCB 1RIHH 3ARFC 4LVOB 2ZPKL 1I4FA 3VFUB 5C3LD 3DECA 4AM0A 1PKQB 1EA9C 3MOAL 3SN6N 2ERJB 3QDMB 3JV4B 3ZLQC 1OWRM 3P9MB 5D93B 4RA3A 5E00B 2JKXA 4RSVA 5EDXA 5ALCL 1A21A 1LK2B 4DUXA 4LLWB 2HYMA 4I0PD 2R29H 2R15A 5CGYC 4OZGA 5HGDB 4BFIB 5EO1A 1AD0A 4LSPL 1OARL 3UTPE 3RA7L 1G7LB 4P2OB 5E7FA 1MCNA 5T3XD 2YD3A 4ZDHB 5FB8A 4JAMA 1P6FA 5KSBB 4LSUH 1AGEB 5I1CL 1Q9LB 4LLDA 3O6LL 3WUWA 4PJ9A 4ZPVB 5T5NG 4XCEB 3L3GB 1T7ZA 1II4E 3IAQA 5D2LE 3QDGB 2FWOA 4TUKH 4D0CB 1QNZH 1NFDE 1I8MA 4CU7A 5K93A 1IGTA 3RDTB 1YDPB 4M5YH 5H37G 5C86A 2MJWA 5EC1A 5EBMA 5EUOF 1QLRB 6FABL 3G5YB 4JRYD 3Q5YA 4Y1AE 5E8EA 3I9GH 1NBZA 4JPIB 3B9KC 1GHFH 1ZGLM 1TTFA 1TCRA 2VN4A 2CIIA 4M1DH 3L3OB 5EZIH 5F7DB 1N3NA 2DBJA 3U2SB 1NEUA 3NGBC 4XAKD 2EYSB 2B4CL 3VXUD 3GNMH 3BUYA 1ZE3C 4PR5A 1A6UH 4KRLB 4NOFA 1OB1A 3OJDA 2R1XA 3BEVB 3LV3B 3QFJA 5CD5C 2XWTB 5C0FB 1BQHA 3LD8C 2H1PL 3HPLA 4Z8FH 1PKQE 5DJAA 5FK9A 1UB6B 1QOKA 3DSFL 2E7LC 5HVHB 3HKFA 1CDJA 1CT8A 3QDME 4WHTB 4RRPG 3D3VB 4DCQA 1YEEL 2BJMH 4HV8A 5B38B 5DO2D 3L3JA 2A6JA 4NKIH 3V79C 2PR4H 1ED3A 3H9ZA 2N1KA 2CJUH 1DQDH 3MXWH 4XNZC 4LVHB 5IBTL 1BWWA 4PJAB 5GRVL 5DC9B 3BT2H 3GMMA 5D71H 2CUIA 1TQCB 4LU5H 5IFJB 3QI9C 3ZE0F 4P3CH 5IVXA 5KSBE 1JRHH 3OKEB 3MGOB 4OSUH 1QLEH 4O4YH 1T7WA 1HQRA 4PJ5A 2O93L 2WBKA 2EEAA 4Y5VB 4Z7OE 3WXWL 1I7TB 2GSGB 5DJZB 5MEQB 3HN3A 3DYOA 4HUUA 5C0BA 5GS0D 3QDGE 1UEMA 4F9LC 1YEJL 2ZCKL 5CINL 2B2XL 3TO2A 4P57B 1RJZA 4XPAL 5DGRA 4W6YB 5JHLH 4JM4H 2ZZUT 2GTZA 3TVMC 5E2WH 4Z95L 3RAJH 2OJZL 1I85C 3RWJB 4RMSA 4F7MA 3G08B 4U1NB 2PTUA 1B4JH 5T1KB 3STBA 3KNBB 1SEBA 4NN7B 5TGBA 2ADJA 5DMIL 1CI5A 2H2PD 2PYED 2UY6A 2VN7A 2F74B 5GIRB 4Z0BL 2HT4D 2NTFB 1ZVYA 4HC1H 1IEAA 2QHRH 1Y6KR 1HSAA 3CFBA 5L8LB 3DLQR 1MSPA 2JJSA 3RNQA 4YIQA 1ZANL 2EDLA 3GBML 1S8DA 3C60D 4NBXB 2BHYA 5JOPE 2XA8L 4I18C 3BHBA 3AU1A 3GIZL 4CU6A 2O5XH 5CJOH 1HHKB 5CEXA 3U4AA 5ITFB 2IPUK 5FCUH 2B1HL 4OF7A 4Z0XB 2ILLA 1BQLH 1C16B 1WT5A 4EUPB 1CZ8L 3GO1L 2IH1B 4NO3B 3WLWC 4OLWL 3BKYH 3GSVB 4NZJA 4K3DH 5GGRY 1LK3H 3RWIA 3QEHA 5FM5O 5I71B 3K74B 3BH9B 1UH4A 4JJ5A 2F53B 3WNNA 4PJAE 3O6FD 4FA8A 1BIHA 1TTGA 1A1NB 5HHMD 1OD9A 1KPRB 4NPYB 1MFDL 4PJEF 4DGYH 3T77B 2VJXA 2YA1A 5IMKA 2NW3B 2BVUA 2IQ9L 3PDOB 4P2RE 3MRLB 3SE9H 1KCSL 1XAUA 2Y4SA 4OTXL 3CFJA 4NQDA 1PX3A 2YSSB 3NAAL 1CGXA 2JB6B 3TLRA 3LKPA 4LCUA 4AH2A 4JDVA 1YEDB 1RIHL 4Y4KC 1YN7B 3ARBA 2I07A 5HHOB 1L4IA 1WC7B 3IDYB 1HI6A 4HULB 3GSRA 1W2KT 2MPAH 4HS8H 3FQTB 2BP3A 1DUZA 1QSVA 3OG6B 3T1FB 4ZUVB 3NACH 4UIMA 3TIEB 2YMXH 1ETZA 1Z5LB 4N5EC 2DDQH 1JP5A 2DIAA 3W11D 4ELMA 2ZOKB 3MRMB 4QTHA 4PRPD 4XCYB 2V2TA 2MTPA 1JHLH 4R9HA 4DAGL 4DOHB 3S4SB 5CBAB 3VMNA 4HK3J 4LLAA 3SGDI 3U9PH 4LSUL 4Z7UF 4OIAA 2KZ1B 4ZO8A 3PWUB 1ZLUH 5FYKE 3O8XA 1P84K 5SWZB 2NLJA 3SDCB 1CICA 3MMEA 4J1UA 1QFUH 2CKBB 4H5SB 1DDHA 4FFWC 3NIFE 1ACYH 4TUKL 1QNZL 2CDFA 4JANB 3SEPA 4NWTH 1BBJB 4K7PX 4G6FD 2FYYA 5F8QC 4KMQA 2YN3A 4ZMAT 3GMQB 4FQXB 1FZMA 3WKMH 4JFDA 4M5YL 4LNVA 3KYOA 3GRWA 1XGQB 4X5LA 3MUJA 5C0IB 4QWWC 1T1XA 3MA7A 4L9LB 4AIZA 1YYLH 4IMKA 5DI8A 2F53E 2X4UB 2GK0A 2OCFD 1F6AA 4FQQB 3VFGH 4JM2F 1GHFL 4TSAH 1IC1A 1I9RH 2AABH 3SKJL 3P0GB 4RFEB 4M1DL 4WI8A 5EZIL 4YZFE 4JPWH 3CGTA 5E6YA 2LU3A 2OXGA 1A7RH 5T1LA 3VI4F 4ZUTB 1DZBA 2CSPA 5DJCA 5IWLC 3GNML 3ULUD 1OQOA 5DUML 1A6UL 4YC2C 1IEHA 4MHHG 4S2SA 4APQD 1G0YR 3JWDH 1JF1A 1A47A 4OBSA 4WI5A 3WCYA 5HHOE 5HYQA 4Z8FL 1T2XA 3CMOH 2HFFA 4F15C 4OFIA 2C3WA 1ZLWK 4BQ6A 4POYA 5DSCA 1PAMA