1SFDA

Oxidized form of amicyanin mutant p94f
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTFHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title Structural Studies of Two Mutants of Amicyanin from Paracoccus denitrificans That Stabilize the Reduced State of the Copper.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 25
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1sfdA00
4MFHA 1NINA 2CBPA 1BYOA 1ZPUA 3IE9A 1GS6X 2GC7C 4YSSA 5I6PA 4P5RA 3QQXA 1ASOA 1OF0A 1ETJA 1L9TA 2EIJB 3KW7A 1PZCA 3CDZB 1AOZA 4YSPA 1PLBA 4BWWA 1PZBA 2XXFA 4BK5C 2XV0A 4DP8X 5LDUA 4DP6X 1A3ZA 1JZJA 1UATA 3FSZA 4HAKA 2ZXWB 1JZHA 3X1NA 1L9RA 5D4HA 1MZYA 1IUZA 2MRYA 1W6LA 1X9RA 3ASOB 2XV2A 2BW4A 2BHFA 1NICA 3DTUB 1ILUA 2PP9A 5FC9A 1AIZA 1OCZB 3GYRA 2BP0B 3X1FA 4GP8B 5B1BB 2MTAA 2YARA 2HZHA 3KW8A 4GY4A 2YAPA 1GYCA 1BXUA 4M3HA 3TU6A 3FS9A 4HHWA 1WA2X 3H4FA 1GS8A 6PCYA 4FAAB 2JFCA 3OM3B 3DIVA 2JKWA 2XUWA 3NP4A 2DV6A 3TBCA 2VW4A 1A4CA 4E9XA 2YAHA 3IN0A 4BDVA 3WG7B 1PZAA 2W8CA 2WO3B 3UAEA 1AG0A 2GIMA 2AZAA 3PAZA 3SBQA 2TSBA 3RYMA 1MG3C 3NJFA 1GY1A 2VM3A 1SDDB 1ASPA 3NJNA 1NIEA 1L9QA 4HIPA 2H5UA 1NIDA 1KBWA 4DP2X 1URIA 3NJJA 3HEIB 1JVOA 1JXGA 1PCSA 2BZ7A 2BW5A 2CAKA 1PAZA 3GDCA 3NJHA 2JXMA 5E9NA 1NIAA 4EF3A 2P80A 1KDIA 2LLNA 4DPCX 5B7MA 2XU9A 3IBOA 1KV7A 3S8GB 2RACA 4YSAA 2FT7A 4KNSA 2PCYA 2IH9A 1AZRA 1SJMA 4DP9X 1V10A 3X1GA 7PAZA 1MDAA 5I6MA 2IAAC 3FSWA 4KO7A 1SF5A 5D4JA 2FQGA 2BZCA 1FFTB 1M56B 4YL4A 5I6KA 3FQ1A 3NJKA 1AS7A 1TU2A 1IC0A 2DYSB 2QPDB 4KNTA 1E67A 3QJUB 3S3CB 2WO2B 3ASNB 3FU7B 1WA0X 2R7EA 4RH4A 1L9PA 3UAAA 2XV3A 1FA4A 2DWSA 1EZLA 1M9WA 2PLTA 3X2QB 3CVCA 1AAJA 4N4YB 1KBVA 1L9OA 4E9RA 2GC4C 3IN2A 2HX7A 1RCYA 5I5MA 1OCRB 4GP4B 3FT0A 1HAWA 2Y1AA 3FQYA 5B1AB 3FYEB 1OCCB 4G7SB 2AVFA 4CSZA 5B1JC 1F56A 2FTAA 1E30A 2VW6A 1ET7A 3T6WA 2EILB 3OQRA 3T6XA 2OV0A 2UXTA 4WTQA 4DP4X 1JZIA 2J5WA 2IWFA 1ZIAA 2FWLB 2PPAA 1BQRA 3D12B 2PP8A 1KYAA 2XWZA 5I6NA 3CG8A 3NJLA 5F7AA 1BXAA 1SFHA 2EIKB 2FQEA 2GHZA 3JT2A 1NPNA 4KNUA 1J9QA 1E5ZA 3WNIA 3ERXA 4QLWA 1N70A 3WNJA 4ENZA 1TKWA 2WSDA 2BP8B 1X9UA 2FT8A 2YQBA 3NSCA 2QPEB 2P80D 3OMAB 4K9JA 1NTDA 3JTBA 3N2JA 2AZUA 2HX8A 3DKHA 4KO5A 3OMIB 1JVLA 3NSYA 1AR1B 1J5DA 4YSTA 4QKTA 1PNCA 2PPFA 3NSDA 2Y69B 2BO0A 4UAHA 1NDTA 6PAZA 1EHKB 2J57A 3H56A 2IDUA 5D4IA 1GY2A 3NJMA 3U25A 1V55B 5F7BA 4YSDA 1E5YA 1E65A 2PPEA 4BWUA 1AQ8A 1ASQA 4NB7A 1ET8A 3FU9A 4E9VA 3FPXA 2BWDA 2FQFA 5PAZA 1XMEB 1TEGA 3EH5B 3NJIA 1KGYE 2VM4A 1CC3A 1OE1A 1SNRA 2YAOA 1ET5A 4GYBA 1OV8A 2X88A 4JHVA 3TASA 3QJRB 3FSAA 4JKNA 3NSFA 1ADWA 3ABKB 4F2EA 1BYPA 1N68A 2UX7A 5TK2A 1AZUA 2XX0A 3AY2A 4G72B 2HLEB 3BVDB 3EH4B 3FPYA 2AFNA 3FSVA 5I26A 3OMNB 2OCCB 2YAFA 4AZUA 2CALA 5ANHA 4M4RB 3BQVA 2W88A 1XB6A 2HRGA 4UF7C 1DYZA 1I53A 3UADA 3WIAA 1JOIA 2J56A 4HALA 1GS7A 4Q8BA 1RZPA 2YXWA 2Q5BA 3CDZA 1GSKA 1ZIBA 2UXGA 4P5SA 3ZBMA 2IWEA 3V9CA 4DP5X 1SFDA 2QT6A 1VLXA 1XB8A 2ZOOA 2FT6A 3AG2B 2J55A 1HFUA 3L45A 4A2FA 3AG1B 4DPAX 1A8ZA 1RZQA 1QHQA 2I7OA 1A65A 1JXFA 4E9YA 1BQ5A 4PCYA 2CCWA 3UACA 4A68A 3WI9A 4E9TA 2AANA 2BP0A 5I5IA 2GI0A 1PLAA 3AW5A 4YSOA 1BXVA 1NIBA 1J5CA 3SQRA 2PP7A 2B3IA 1CURA 2VSMB 1JZGA 1KDJA 3PLYA 3UGEA 2DWTA 4W9ZA 1WS7A 7PCYA 1AZNA 2ZWNA 4AKQA 2VMJA 1R1CA 2UXVA 1DZ0A 5A7EA 4BDVB 5I6OA 2I7SA 1NPJA 2B08A 2EINB 1SDDA 3TA4D 3WKPA 5I6LA 3SBPA 4G70B 1J9SA 3FQ2A 1RKRA 4G7RB 4BXVA 1MZZA 3PPSA 5PCYA 1ID2A 5AZUA 4E9WA 1OE2A 1SHXA 1M57B 1MG2C 4HCFA 1B3IA 2XXGA 3CZUB 3N55A 4NAJA 4G7QB 1ILSA 1CUOA 5EHFA 1NWOA 1XB3A 3FU8A 4FA7B 4E9SA 4BWTA 4DP1X 1GW0A 1WA1X 4E9QA 3H4HA 1PF3A 3S3DB 1WAEA 4YVNA 3QJVB 3CVBA 1SF3A 1AG6A 3AG4B 4N8UA 4GP5B 2X87A 2ZONA 3PAUA 3MBWB 4NERA 2CJ3A 3ZDWA 4AX3A 4GXFA 3FYIB 3T6VA 3TBBA 3CVDA 1AS6A 2GSMB 3IEAA 3T6ZA 3QJSB 2VSKB 4YSCA 1CYXA 3FU7A 4A2GA 1QLEB 4KO9A 2Q9OA 2R7EB 1W6WA 3ABMB 1IKOP 2E86A 1WS8A 1OE3A 2GB2A 4KOCA 1JERA 2QDVA 4A2EA 4YSUA 3UABA 2DY2A 2YAEA 1IBYA 5AFAA 1FWXA 4KO6A 5B7EA 3NYKA 3EH3B 3AZUA 2HRHA 3QJTB 1SHWA 4HZ1A 4AKOA 2OJ1A 2HXAA 4F2FA 1T5KA 3MX0B 3WKQA 1AS8A 1BAWA 1A4BA 1GR7A 2IWKA 1A4AA 2XLLA 2IDQA 4W1TA 3ZIYA 1OCOB 4AI7A 2QDWA 1JZEA 2XX1A 1W8EA 3ABLB 2HX9A 1IBZA 5B1JA 4YSQA 4JHUA 1AZBA 9PCYA 1J9RA 3OD3A 5I28A 1KCWA 4F7KA 5IY5B 2YXVA 1HAUA 3AG3B 3ZX1A 8PAZA 3T9WA 1KCBA 2H3XC 4A2DA 1ZDSA 1NZRA 4AKPA 3S8FB 4DP0X 1ZDQA 2IDFA 3V9EA 2BP8A 1L9SA 5B3SB 3PXLA 1J9TA 4HCGA 4UANA 3S3BB 4BXSV 4A2HA 3PCYA 4HCIA 4TXVB 4DPBX 1QNIA 3HB3B 1JXDA 4A67A 3NT0A 2H47C 2VW7A 2NRDA 3G5WA 4YVUA 1TEFA 3NP3A 4G71B 2IDSA 2PCFA 1PLCA 1ZV2A 5I5JA 3QJQB 1PMYA 4L0PB 3SBRA 2DYRB 5TK4A 2I85A 2XVBA 1BQKA 4WKXA 1AANA 4YSRA 2TSAA 1AZCA 3PAVA 4ZK8A 4Q89A 2PPDA 5AKRA 3C75A 2YAMA 1CYWA 3QPKA 2PPCA 1NWPA 1OOWA 2EIMB 4HHGA 2FNWA 4CSPA 3EF4A 3NJGA 1BEXA 4A66A 2UXFA 3EHBB 3ABGA 3X1EA 2N0MA 4KOBA 2UX6A 4PAZA 2GBAA 2FQDA 2VN3A 5B1KA 5B7FA 2IH8A 1NIFA 1PNDA 4X4KA 4DP7X 3X1BA 4YSEA 1YLBB 2BWIA 2XYBA 2IDTA 3T71A 3GXUB 1JZFA 1V54B 1PY0A 2A3TA 2YAQA 2CUAA 1AACA 2FJSA
chains in the Genus database with same CATH superfamily
2VDPB 2DQUL 1INDL 4HU8A 1HH9B 5CBAB 4FX5A 2KKQA 1QFWH 4LHUB 3EH1A 1NEPA 3P30L 5F9WC 2YK1H 3L9EA 3H9SA 3RU8H 4TRPL 3FO9B 2DQDH 1FZMA 3CFNA 5FX3A 3WFDL 4LLWA 35C8L 3CU1A 3CZLA 3O2DH 3KNBA 5C7XH 4WUUA 3ABZA 3VFVB 1M53A 1HS6A 2WOYA 3IJHA 1DUYB 3L16A 2OR8A 5IBLD 4P3CL 4RAHA 3ZQXA 3M86A 5AZEH 3E80A 1E8XA 1TQCB 3CVHL 2XWXA 1P7BA 4H0HB 2R2EA 4NM4L 2IPTH 2IH1A 3QDHA 1D7DA 4EDXA 1Q8MA 3BEWB 4OCRH 3ATFA 4FQQA 3RWDB 4OAWB 3CFJA 1QATA 5TQ0H 1E4HA 4OF0A 2Z6FA 4X7SH 1QW8A 2WXQA 4AGNA 5JW4M 1Y0LB 4TQ8A 3N44F 4FYRA 4JO8A 1AXTL 1CDGA 4HJ0C 4HK3N 4M5TA 4XVTH 3MV8B 1G5GA 3ZDZE 1O5PA 1SBSH 1HHJB 5SWSA 1K72A 1SDAB 1KXVA 4AZ8A 4F15C 2WGNB 5T3ZH 5K9JL 3BKCH 3DVNA 2ILLA 4ZMXA 5E9AA 5FO7A 1BPLB 4P23C 3DXAE 4E9XA 3PJLA 4JBSA 4PRBB 1HXYB 4OLUL 5KOMC 2W8CA 2RH0A 5LWYL 3CUPA 3TXAA 1AGCB 1GY1A 3MACH 1NKGA 1D9KA 4TQEL 1D3CA 3BP6A 3L3KA 1ZS8B 1C8QA 4XPAH 1VADB 3LPWA 1URIA 1KWGA 3H9HA 1OT4A 1JXGA 1P2CB 1XH3A 2BHZA 2BW5A 1GGIH 4H8QA 4I4WA 1F97A 3O4LE 3VDAA 5E9NA 3QHFL 4ZFFB 3KPMA 1GOGA 1V5JA 2H6UA 2ZSVB 2LLNA 4DPCX 1MFDH 2WXJA 3DROA 3NVQA 2ZSWA 2V5RA 3S8GB 4P5TB 1TVBA 2WQVA 3DSNB 3LS4H 1EUTA 2JJSA 4JKMA 3FT4B 3QWOB 4A6YL 4JHAL 4MXVF 2ZXQA 1CF8L 1TZHB 2F7RA 3DHMA 4M5YL 5I6MA 3BXNB 4NZDA 2G2RB 4KZDL 1O6VA 1IGFH 2W95A 3ARFA 4LOFA 3L3OC 2XETA 5FAAA 1BJMA 1AC0A 4TOYH 3VDCA 3UJIL 1W16A 3F65A 2YD5A 3P2TA 1PZDA 4QOKE 4M6OL 4Y4KC 3CV5A 2YMOA 5CN1A 5DYFA 2P5PA 4UV4L 4G6KL 4HJUA 3ARDD 3O2DA 2VDML 3VXRA 5EOTA 2HFFA 4R2GD 1UXLA 2F1AA 1EO5A 4HK0A 5GIRB 1BFTA 2KYIA 3FT0A 3NIDE 1AQDA 2DBJA 3LXCA 4K71B 1IM9D 1XT5A 3SB3A 4V2CB 2VKXA 3QR1A 3UBXI 4DO5A 3LEVH 2CCLA 2H6OA 2NNAB 2IV9A 3MX0A 4HJEA 3C9NA 3QUYD 5EBWB 3PUCA 5GXBB 4GAFB 1OCWL 5AUMA 3EGDB 1N5YL 3W0WD 3I84A 2HTKD 3SODB 4OH2A 3HMWH 2CUMA 1TSHA 2B7DT 1YMHA 3QQ4B 4LCVA 2Q2EB 4IOFC 2WMPB 2PXYC 3FBQA 5M7QA 2GHZA 3FDWA 3NCYP 5A2AA 2UZXA 2OMTA 3WUZA 2AK4D 3J8F7 4YGVA 1J8HB 3WTVA 3V0VA 2VNCA 5K1NA 5CO1A 4FERA 1X4XA 4J3UA 1JG9A 5EUOB 4Y5VC 3MFGB 3G9AB 4JANB 3WS6A 4OZGE 1NFDF 2X1PA 1VFAA 2XV6B 1SLWA 3O2VL 5DJZB 2EEXA 3TEXA 2NY4C 1M71A 3KLHC 2JJTC 2R2HA 1FYTB 4FF9A 2KHAA 5C7ZA 4BH7B 1G1YA 5D1QB 4RGNE 4Z0BH 2B9BA 4JFZH 4PRPD 2VZ1A 1FHNA 4Q14A 4LSTL 4NQSB 1DDHB 2JB6B 3O0RH 4LL9A 1L0XA 5FYJD 1GY2A 4S1DD 2WXGA 4Q9QH 1I8LA 4TNWF 1JPEA 2AKRA 3FB7A 4JFXA 5AAMC 4F8NA 3LZOA 1MRDH 1NUFA 3OTTA 3M8OH 5DURD 4LGPB 3FU9A 1DANU 3TIEB 4U1NA 2QBWA 4NO0A 5C08D 4RWYL 2JTDA 4G43B 1MRCL 2XIIA 4IEFA 1N59B 4BFGA 3T8MA 3BUQA 1A6AA 2VM4A 1FNFA 5D93B 3GBNL 4UBDC 2XDHA 5F88B 5BZWB 2WYHA 4XNXH 4D3CL 3CCHB 1GYAA 2C3HA 2W91A 5L4JA 4LB8A 3ZHNA 4IBQA 4RFNC 5LN4A 1P1VA 5FDWB 3ZKXC 3CVIH 4PY8J 2DQ6A 1EFXA 4BUQA 1I9JL 1QEWA 3GS0A 3RWCB 2DIEA 15C8H 2DM2A 1KB9K 4HIJB 3EOYG 3ILPB 2Y5EA 2CM6A 4K9EC 4JO3H 2E7DA 3H9ZA 1NGZA 4R26H 3QXDA 4XNQA 4R7VA 5D7JA 4K0OA 1JZ7A 3ZTDC 1WITA 3BT0A 2NT1A 1I9IL 4GRWF 4PGDA 5E1GA 4ODUB 2WKOA 3QJXA 1IQDA 4B7LA 4XH2A 1I85C 5BNXD 3DJTA 4F7TA 4DUXA 3FB5A 4OCWH 1MVUA 4Y1SA 2B0SL 3H9SB 2OR9H 2HMIC 4WTZA 1FZMB 2OQJA 2UXGA 4LLWB 4HS6B 4K23H 5CMAA 3KNBB 1H3XA 4JEGB 4QRTA 4R4NC 2QFRA 4WUUB 4X6EA 2MNUA 4ZO8A 4WHYG 4XMTA 1CO1A 3GHEL 4PW3A 3V0IA 3IJHB 3CFUA 1SDYA 1BHGA 2Q3ZA 4ZQKB 5GGRA 5HDLA 3TWCL 4ZX6A 2R2EB 4Y4HC 2IH1B 3HG1A 1DBKL 1JF5A 4P2OD 4EDXB 1BQ5A 1A7OH 4FQQB 4GAGH 3APNA 4JRXD 4YMPA 4RDQF 3DYMA 3ARBA 4YSOA 4GRLD 4HA1A 2YSTA 2NY3C 2VXSL 4FEMA 4KTDH 3KLAA 4K3JL 4PVNA 5H35A 1F45A 4G83A 4HS3A 1RK7A 4L0YA 5T1JA 1QSEA 3CDGB 2XZAH 3D3VA 2VDKB 1WF5A 4JKLA 5SWSB 3PL6A 4TUKL 4LHUG 5T1DH 2ITCA 5FYLD 1EDQA 3DVNB 4H2CA 4QRBA 4AKQA 5IW1A 1BV8A 2AABL 4G1MA 4N2OA 2CDFA 1S6NA 2D4FA 1E4XH 3D1MC 5E7BA 1QLFA 2B08A 2R4RH 2Z35A 1KGIA 3DMMC 2WZ6A 3HUJA 3SBPA 1NCAH 3HHSA 2AQSA 4G70B 1OHQA 1HSAA 4HMCA 2EUVA 1PZ2A 2NSMA 4NN6B 1CI5A 1D9KB 2H9GA 3BP6B 3L3KB 3H9HB 4LVNC 4MB4A 4C83A 4N20A 3KDMA 1XH3B 4MMXA 3BQUD 4I4WB 5J11B 1CUOA 2ICWJ 2QADB 3PQYD 5EHFA 5EWIL 1SUHA 4LPCA 3B7SA 1X9LA 2OSXA 1CZ8H 1WAEA 2ZSWB 3QRGL 5JPMC 1TVBB 1A22B 3GS7A 3KGTA 1MI5E 5C6TL 4NWUH 2OYLA 4CRPA 3TNMB 5EIIA 2KLSA 4FTVA 3MGTA 4MZIA 5LAXA 5T1LD 1INQA 2EYSB 1HC1A 2GSMB 3ARFB 3T4AA 3S2AA 3RDTD 5IB2A 4DQOL 3F5WA 1DJSA 1W15A 1DN2A 4WQOA 4XBGA 3PAYA 2VR7A 1ZMYA 4FZEL 2LVEA 1PW3A 2J1XA 4NI3A 3LPGA 1WS8A 2PETA 3LV3A 3U0TA 1CGUA 2ZNWA 5K59E 3VXRB 4FC3E 3MLWH 2HFFB 5EOTB 3DIDA 5E5LA 1TQSA 4HK0B 2X3AA 5DD3H 4ZW7A 3W39A 1AQDB 5TE7H 3FUIA 2ODIA 1GVIA 2JCCA 4AKOA 1JIBA 1RI8A 3STLA 4YK4C 3MX0B 4R8WL 5GS0L 5IM7A 4FNTA 3C9NB 4KJQC 2BVPA 4TTDD 5IB4A 4LDEB 4LLYA 2LTQB 2MOVA 3LRHA 4JHUA 1AZBA 2GTQA 4LAJH 3QP3A 3DWTA 1KCWA 5ID1A 2YXVA 1BVLA 1YMHB 3B8SA 1YY8A 3T1FA 1TDQA 3MLXH 4YHPA 3Q48A 1JPTH 4DAGH 4XMZA 5D8JH 2E4TA 4NIYE 3B9DA 3SGKC 2UZXB 4YHMH 2OMTB 4OQ1A 3DX0A 4YGVB 1KN2L 3QAZC 4OZHE 1X4YA 3V0VB 1H8LA 4PIRF 3D9AL 3SEPA 4IKNA 5EZIL 1S2EA 2BERA 1K4CA 1PD0A 3GS4A 4NUGH 4PBVC 3ESOA 1YYCA 4Q0XH 5D71H 2Z7ZA 4HU2A 1H8NA 1VFAB 1XGPA 3HB3B 2X6BA 3JV5A 2B1AL 2HKFH 1INEH 3WO4C 4YO0A 3BRDA 1M71B 1OTSC 2R2HB 5TE4L 2J8HA 4KK9D 3GBDA 2IDSA 2PCFA 2XICA 3NSJA 4V33A 2VLKD 5I5JA 1QYGL 3ORJA 1S5HA 1I82A 2DYRB 2G9KA 4P2AA 4F2MA 1JZ4A 2D3NA 2AGJH 3NESA 3UAJD 2GIYA 5DR5L 2BFGA 4Z6AT 2AKRB 4JFXB 3T77A 4JFTA 4RISL 4M5SA 3VRIB 3GZKA 3S48A 4U1NB 2A9AA 1J0YA 3L7FA 4XVUC 2WBJD 4YUEH 3ZHKA 1FBIL 3VWJC 3CC5A 4IEFB 1NCWL 2Y23A 4KDTC 1UJ3B 1JRHH 3RBSA 3H2QA 3K3QA 4QYOA 1P7QA 1F8TL 4LVHB 4AEHH 1T03L 3EBAA 2DKUA 3V6OE 5HHVL 4OV5A 1Q72H 1EFXB 1PNDA 4X4KA 1QEWB 4M48L 2AF2A 2O6PA 2IDTA 1N3NA 3WIIL 2WLNA 1NGZB 5CEYA 3QXDB 4XNQB 4X6CA 1A7QH 1WFMA 4UQEA 1D2PA 5D7JB 1HXMA 2XWBA 2GUYA 5I15H 3OF6D 3OKDA 3WHE0 1DR9A 5J8OA 5FA4A 4PGDB 1IQDB 1JDAA 3AADB 5F8RC 3FHAA 4XH2B 3IU4L 2OZ4L 4JO2H 1MCKA 3B9VA 4JFUA 1MVUB 3GXIA 1D7CA 1U2HA 3KXFE 5CMAB 2XWTB 5AL0A 4F93B 2UVEA 2XYCA 5G55A 4QRTB 4X6EB 1KV3A 5E23A 4FZ8H 1AQHA 2ZTBA 1TTFA 4U1HA 3ZDYB 4XPBH 5G4NA 5CD3A 1QWHA 5I71C 1B6UA 4AYDC 5GGRB 4J6RH 1MXDA 2UV3A 5A2KH 5KS9F 1NCOA 3HG1B 5A40E 3WKNA 3FT1A 2J1WA 5BOZG 2PP9A 3LB6D 3EFFB 1EEQA 5AB1A 3H6AA 4I9WD 2M1KA 4JHWH 3ARBB 4DGUA 2W65A 3ET9F 4D7PA 3D6GA 1A1OA 4BCYA 4U05A 3SJVD 1GYCA 3KLAB 5H35B 3GUFA 1P5VA 1WBYA 1UH2A 4HS3B 1QSEB 3KBFA 5E99L 2DD8L 3H3PH 5J12C 3RB7A 3D3VB 3VYPA 4YIQA 1UD3A 1I75A 3PL6B 1DBAL 2ITCB 3MXWH 2WLLB 3ESMA 3SGDH 4DK3A 5IW1B 5GSVA 2HJKB 4G1MB 4MQXC 4N85A 2CDFB 2ZKYA 3QJFB 5JXEC 2I9TA 4GQRA 4MYPA 1GGBL 1XIWC 4PJDE 1B4RA 1QLFB 3FO1A 3VXUE 2Z35B 3TT3L 2DZEA 5HHMD 3HUJB 4MAYD 4D9LL 3QXUA 3HHSB 5CLWA 4JE0A 2H7WA 1HSAB 3QUHA 3M17B 2H9GB 3A67H 4Z7NE 1GTNA 3PWLA 2CXGA 3QYNA 4I5BA 2WP3O 2A74A 1X4ZA 4C83B 2F53B 3KDMB 5ILTL 3MJ9H 4MMXB 4AVKA 1CQYA 1RLBA 1ZLDA 3NAAH 2P80A 5IQ9A 3IDXL 4YQXL 1KDIA 2N7BA 5TFSH 5I0WA 5MENA 2FJHA 4HAFA 5LVEA 2DQGH 4YSAA 3SKOB 5MEQB 2N7AA 5FS5A 4U1GC 3ZKMC 3F62A 3LAFA 1AZRA 1YN7A 4CC4C 1CDJA 1WGVA 4K8RL 4CDGC 5EIIB 2C9XA 1M6OA 1O7DC 3MGTB 4FTVB 4GUOA 2L8AA 1LK2A 1THCA 4C56A 3ARSA 3WO3B 5LAXB 4DKEH 4YJZL 1J05A 2OMXA 5EU7C 2EDJA 5IFJA 1INQB 1M56B 3D2TA 4PG9A 1E6OH 3T4AB 1R3IH 2CKBH 4PY7B 5IB2B 2PF6A 3F5WB 2OCFD 4XBGB 5FWQA 3V0WL 1N6QH 1SBBA 2OJEA 1OTUD 1A8JH 1PLGH 5CHNA 3BDYH 1RZIA 3CVCA 2FD6H 3LV3B 5D55A 3U0TB 1DL7H 2NQCA 5GZOC 2ZOLA 3MYJA 4KRMB 4YEEA 4APQC 4HW6A 2UZIL 4I77L 5D7IE 4ZX4A 3D7PA 1DVYA 1I1AA 3W39B 4FADA 4AQZA 4EIUA 3CMGA 2RQEA 3BN3B 1TETH 1C16A 5F9DC 2FWSA 2JCCB 2BINA 2YK1L 1OZTG 5LG6A 5DRZA 3ATEA 3CXFA 3STLB 1T6BX 3O2DL 2O6DA 2E76C 4YC2B 5DMIH 4WSGA 2BVPB 4NWTH 4FFWC 3UTTE 4OJAA 1WWCA 2X53A 5KSBB 4BZ1H 4XC1L 2XJKA 1ZHNB 4XODA 5AZEL 5ID1B 5F7AA 1BVLB 2PW1A 2JJUA 1NPNA 5DD6A 3T1FB 4YHPB 4IK7A 1N70A 5HPMA 1U4EA 4OLXL 3TLRA 5AENA 1WHPA 2H2PD 4JG5A 4MB5A 4XZUA 3NFNA 5BXFA 5C0RL 2YN3A 2VXQH 2YMTA 4EKJA 4X7SL 1IZJA 5C3IA 5KBPA 1K4CB 3IFNL 2ZJSL 3UZEC 3TA3C 1AR1B 1XGPB 3VFTA 2Z9TA 2AV1A 2K3HA 4GKOA 1KJ3H 4XE0A 3P3YA 4YO0B 4KZEL 3C5SB 4F27A 3NJVA 5T3ZL 4O51A 3P0GB 4OTXH 3OWRA 3SYQA 1BX2A 4GNKB 1GL4B 1RAMA 3VMNA 1NDTA 4XNZC 5JHMA 1DVFD 1S5HB 2K70A 2UZPA 4F2MB 3L2NA 1QBAA 1E5YA 1E65A 3MJ9A 2D2CC 5FFLA 5AAWA 1CICD 3MACL 4JG1L 4GBXD 5KN5A 4PGJA 1OT1A 5DD1H 2BSRA 1PVHA 1QSFE 3JWNH 2BWDA 5DFWH 2ZF9A 4NQCA 4XPAL 1XMEB 3L7FB 3IT8D 1SYSA 2ESVE 3FAWA 3CC5B 2WW8A 1S3RA 3DX8A 1HCVA 1OLZA 3WFCH 1PS3A 4ZMAT 3DI3B 4JHVA 1HTYA 3EDFA 4IW4C 1DE4B 2R8SH 2LAAA 1JPSH 3WTUA 5BS0D 4QYOB 1MFDL 1BYPA 1MH5A 1Z5HA 2BX5A 2DF3A 4JFPA 2WQRA 1HINH 4OV5B 1WUZA 1NQBA 5SWZE 5DMGC 3WFHA 3T1WA 4FFYH 1N3NB 1T89A 2AFNA 3EH4B 1FRGH 5JDSA 5CEYB 2P4AB 4X5RA 2KZWA 1CU4H 2AV7A 4FMFA 4DCQB 1HXMB 2XWBB 3MNDA 2B1HH 2VABA 2DYPA 1Q38A 1FV1A 5AEAA 5FA4B 1I53A 3GKZA 1MCEA 1NANI 4GAJH 1L7IL 4HALA 4GKSA 4KAQH 1E9PA 3G5VA 5IEHA 3DA0A 4DK5A 4Z8FL 2YD8A 4XI5D 5D7KD 3ZQWA 2WLYA 3CQFA 3D2UD 4BZ1A 1VLXA 2HWZH 3B8YA 3U83A 1KBPA 2K4AA 4Z3HA 3L08A 4GMTL 3LEVL 4U1HB 3TO4C 1U21A 5CD3B 4B3EA 3L9BA 4FN0A 4E5XB 4CJ0A 4LE8A 1UT1A 3LN9A 3I6SA 5ITBH 3UYRH 4NIKB 3FULA 5AVVB 3IPEA 2VXQA 5BUAA 1S9XB 2WTRB 1LO4H 2RGSA 3HMWL 3NIGF 4OJDH 4PJGE 2FR4A 1ULVA 2GSIA 3T2QA 1GTFA 2PUQT 4JO4H 4MA1C 3R06A 4AVJA 2JKIS 1A1OB 3Q3GA 1DSFL 3JXAA 1U41A 2Z4QA 2VSMB 5F96H 1WBYB 5C0ND 2Y1VA 1JZ8A 4WO4A 3DK2A 4BK4A 5FA3A 6FABL 1A47A 1BFOA 4HMEA 3DO4A 1DQTA 2EP6A 3DETD 4JZOA 2UXVA 2V5SA 2H2SD 5A7EA 5GSVB 1QZNA 4WTZG 1BZQK 3B9KA 4O2CA 2YKLH 3A6CH 1TJHH 3FCUB 4OIAA 2C1PA 4G5ZL 3FO1B 1J9SA 5E6RB 2GFBA 1B4LA 5DMGD 4X8JA 4NRXA 3MUGA 4BXVA 1DFBH 4FXGA 5CUSH 5KSAB 4E9WA 1EO8L 1M57B 1QSZA 2J2ZA 5DWUH 3ZHFA 1B3IA 3IB4A 3PWLB 4I5BB 3F04A 2A74B 3ATAA 4Q9QL 4JVUA 4J3XA 2CO6B 1L0QA 2CNYA 3MUY1 3UTSA 2FLRT 2OP4L 1IT9L 2FJHB 4ZO6A 3S3DB 1BAGA 1XSOA 3IGFA 3QJVB 5AVXB 4PV9A 4TSAL 4LKCB 1UWEL 3RURA 4MAZA 3V7AG 2LAGB 5C0BD 4FFYA 1YN7B 1S78C 3QG6A 3HAEH 3X14A 5IBUB 4D8OA 2WNKA 1M6OB 1NMAH 4XNXL 3T6QC 1MQ8A 1P4IL 3T2LA 3MOBL 1LK2B 4C56B 2CDGA 1J05B 2OMXB 3U36A 2HFTA 2XY2A 3CVIL 3QJSB 5B4MD 1TMCB 2OYMA 4PG9B 5K1VA 15C8L 4MQ7A 3QUXD 4BE5A 5DCCA 4DWHA 3ABMB 2OJEB 2CO2A 5CHNB 1RZIB 2Q6WA 4TULH 4S1SH 3MA9H 1MCCA 2Z7YA 2ZOLB 3MYJB 3BUBA 1MNUH 4GS7B 3Q8AA 2YD7A 2WTPA 1DN0A 5D5MA 2HN7A 1SHWA 3P02A 4XE5B 3SDXA 2N0KA 2OJ1A 1C16B 5CR1A 3FTXA 4WENB 5ICYA 4U4IA 1DP0A 4OCWL 2HKHL 3FUHA 2OR9L 5DRZB 2XCMC 3KYMA 3PFQA 3DYPA 2Q7AA 4K23L 4Y4FC 1BWMA 3DTXA 2QV4A 1IBZA 5E8PA 5F21B 1J9RA 1LQBC 5L2JA 4AM0A 5EIIG 1NBVL 4WV1A 1TTCA 3JT0A 1F90L 1C1EL 3HI5L 5F70A 3D5OF 3L5XH 1RJCA 2PW1B 1BMWA 5JHDD 3FT3A 3FFCE 3BZ5A 4PJEE 3VWKD 1C9SA 5DD0H 1CDCA 5HPMB 4YXKL 3A3YB 1I9RH 2OSLA 5EO9A 5M94B 4P5TC 4XZUB 3PXLA 4GAGL 2B15A 3NFNB 2MCAA 5BXFB 4ISVA 1NDGA 2A0LC 4RGMB 2WXPA 5ISZA 1SN5A 1BZOA 2EYTB 4DPBX 2OW7A 4WTWA 2A1WH 3B2UC 4JCWA 1OHZA 1CMOA 3VFTB 2NRDA 2AV1B 2XZAL 3QNYA 3X3GH 3ZIMA 2ZXBA 5B22A 2CJTA 3S34L 5G2NA 4O51B 2P5ED 2ZOUA 4MSWA 4OGAD 1G9HA 1ANUA 1BX2B 2ZUYA 3AT9A 4DTGH 1C5CH 4L2LA 1W0WA 5EN3A 4ONOA 2CH8A 4O2FA 4LLUA 3MLUH 1EH9A 2VLRE 3EHBC 2R4RL 1RZJL 5HHQB 2VSDA 2FHCA 5KN5B 3HJEA 3S3PA 5GS2D 4ABVA 2BSRB 3QPKA 1LWRA 5HJBA 4NQCB 4K71C 2BOBA 1MJ7H 3QI9D 3KYAA 4CSPA 3HAEA 1SYSB 3L9YA 3FQXA 4M7ZB 2A9NH 3DX8B 4L3EE 1RH8A 4R0LA 3SD2A 2ZYRA 1KTJA 2ITFA 2PTVA 3VYOA 2YSSA 4LCIH 4WSJA 4Z95H 3GMLA 1ZTXE 4MZRA 1QLEL 1MH5B 2YOCA 2CKBB 4JFPB 4P2QD 2UYLA 4Z3FA 1CGWA 3AGWA 3SPJA 1S7XA 5IFAH 1EEYB 3GJFH 4XNYH 1N12A 4Z7OE 3H2PA 3WFHB 5K9OB 1DVSA 4EN3D 3VI4E 3HE6D 5JDSB 1P84J 1JZ2A 1JPGA 4JFFD 4QHKI 3N50A 4XO5A 2AV7B 2KL6A 3NJXA 1JP5A 4QUOA 4AENA 1N10A 1F4XL 5HGGS 2VABB 4NSKA 2DYPB 2NR6A 1ZJBA 1FV1B 4YSSA 3TVMD 1FGNL 1GS6X 3BLKA 4EN2A 2BCKA 3FT9A 3O8XC 3ULVD 4I0PC 4GKSB 4HHAA 3BGMA 4MNQA 1E9PB 3LS5L 5I24A 3RHWK 1WFIA 1JUFA 2QPFA 1KSRA 1U93A 1COBA 2NY5H 3ZL1A 1D5ZA 1W80A 2ORBH 4XAWH 3UBFA 4XCNA 5K9QI 3QA3A 2FWUA 5D1XD 2KQNA 2HT2D 3K71B 5IB5A 1X9RA 2AJYH 4PJXA 2KLTA 1FJ1B 2BW4A 1IKNC 5HGHA 1IILE 1PD6A 3QPXH 4L5FH 4C47A 1J9CT 3GYRA 2EO7A 5I9QC 2F54E 2VN7A 2FR4B 2GSIB 5D93C 4GW1B 3D85A 4P5KA 2MTAA 4DVBA 1P7HL 5AL8A 3Q3GB 4YX2H 3SDCC 5FIEA 2Z4QB 4Z3EA 4YHML 1TQWA 1WA2X 1WT5C 4KGJA 3EUUA 1IAMA 4U6VH 1KB3A 3L4CA 3TTYA 3BRFA 4WO4B 3K6SB 5FA3B 5HVFB 2NX5B 1O9ZA 1BFOB 3QB7C 3DIVA 2XUWA 5HJGA 4UZGA 3QAQA 4NUGL 3D07A 1GC1L 3LZQA 3G5YA 1VEOA 4JZOB 4HULB 3UROR 4CU6A 1IARB 4ATTA 3B9KB 1INEL 3NJFA 4O2CB 3UL4A 3ARGD 1TZOA 2C1PB 3V8CA 1FORH 2LHAA 3GLZA 3MRQB 1TQTA 2GFBB 3E3QE 3QFJB 5EDXA 3O9WB 4X8JB 1T66C 3MUGB 4NRXB 1D5XA 4RGOH 4FXGB 3AJ7A 3L1EA 4OIIH 2VQ1B 3HEIB 3LNHA 5EF2A 1JVOA 2QR0A 2X4UA 5TDPB 1FSKC 3LH2H 4U0QB 4JG9A 3GDCA 4EF3A 2VWEC 3QJZA 4G8GD 4G8IA 3GMOA 3IXAA 2HB0A 2OM5A 3UTSB 1X5MA 1K3ZA 4OUOA 1Q1PA 1QBML 4YUEL 4PV9B 3GJFA 4WI5A 4AY0A 1JRHL 1ZXQA 3OAUH 1T1YA 3QG6B 3QXAB 3T0AA 3X14B 3O3EB 1HHIA 1LHZA 2F7IA 4IJ3C 3SCMC 3GI8H 4AEHL 4FCAA 4IGBC 4R97C 2CDGB 5F3FA 2ROXA 3GIZL 3U36B 3TZVA 1WZAA 2FYVA 3INOA 5I1KH 3S3CB 1KGCD 3BH8A 4PV8A 2NXYD 5JHLH 3BLBA 3VUAA 5L7XH 4AVHA 2E9JA 4XMUA 1BSIA 4MQ7B 2DWSA 1EZLA 5AYTA 3P4OA 3MUZ1 4ESKA 4PJ9C 1IGJA 4G6AD 4NQDA 2Q6WB 4HOWA 5JQHC 5I15L 2FLMA 2KZKA 4KH2A 3B2VH 3W0WE 2Z64C 5DVMA 1QAWA 2LV4A 3OLDA 3TFKC 3OSVA 3KM1A 5F6HJ 1OCCB 2UWEE 3IPFA 5D5MB 4CSZA 3MRKA 2ZKWA 3RPBA 3SDXB 1ZTMA 1QASA 5ICYB 1EJOL 1MOEA 3UDWC 4MJ6A 4WUKL 4LASL 5BZDA 5IMMA 2AK4E 3KYMB 3AREA 1ZIAA 4HJGA 3DTXB 4RDBA 5F3BA 3LNIA 3JQOB 5E8PB 3C8DA 5L2JB 5IBUG 4ONFH 4AM0B 4X4XB 2EADA 3T0ED 2X4PB 3AQYA 4JM2A 4WV1B 3KG5A 5DD5L 1YDPA 4M6AA 4X42A 1M42A 2QADC 2X4NB 3WNJA 1U8IA 3FT3B 3KLSA 5EORH 1A66A 4IRSB 3TEWA 4PJCA 1TPXB 2OSLB 2R0LL 4X7TA 2R0WH 5EO9B 3ZDXB 1H6EA 4A38A 4PRPE 3N2JA 3JZYA 1P6AB 1KC5H 4ISVB 2HX8A 5FYJE 1NDGB 1K8DA 2G60L 4D7BA 4KKLD 3FB8A 2EDRA 1RJYA 3FUJA 4LSPH 2Q8AH 3MTXA 3WJJC 1E28A 4QKTA 3HCVB 1F6FB 4MJID 4KK5D 2OSWA 4B9KC 3PDDA 2XN0A 2V17H 4Q9RL 2MCMA 3B7TA 4OLWH 4MSWB 4ZW3A 5CJ5A 4G3YL 3U2IA 3PJSA 4AXWA 1RK0A 1W0WB 5EU5A 2C3VA 1RZKC 1F1GA 1QR1A 3E1F1 1YSOA 1ET8A 4E9VA 4HUCA 1BM7A 3IJYA 4D94A 1I8KA 2FQFA 4FKEA 5PAZA 1C5BL 5AYUL 2APWA 2AI0L 3C6SA 4OVVA 2BOBB 2WLKA 3WV0A 3HAEB 3PGDA 3FQXB 3SZ6A 4KVCH 5JO5A 2ICEA 1YJDH 3MJ9L 1EZVX 2CMRH 2WCSA 3QJRB 4R0LB 3TASA 4EKXA 3NAAL 3U7YH 4X5WA 2YSSB 4DGWC 1SVZA 3GMLB 1F1DA 1OB1A 2X44D 5JHLA 4FG2A 4Q6KA 5IQ7H 3PU7A 2UYLB 1JMXA 2XX0A 1K3IA 1S7XB 3SDDC 3P9WB 4J8QA 3KGSA 4LEXL 1LO5B 4Y2DA 4DKEL 3GXDA 3VI3F 1BD2D 5T5FL 2WQWA 1A25A 3ULAB 1JPGB 1VERA 1WAAF 3DX9A 4XCCH 5IT2L 1E6OL 2DMKA 4AENB 4NSKB 4LEEA 3KJ4B 2IOIA 1N6QL 1LO0H 5CINH 3WJMB 3WS6C 4B5ZA 2BCKB 3BDYL 1WD9A 2PWHA 4HHAB 3BGMB 2FD6L 4MNQB 1DL7L 3VTTA 1KYUA 2H45A 4FD0A 2BIIA 2EDWA 1JUFB 4WNSA 3N41B 1U93B 2UZYA 2FT6A 4JRXE 2FE0A 5C09A 1D5ZB 1TETL 3E1ZA 4M3KB 1LWJA 2G30A 4OI7A 4XCNB 1A8ZA 3QA3B 1NBZA 1F6LL 4V1DA 4W9KC 3H1ZA 1SVBA 5IB5B 1V3KA 5DMIL 1T5XA 4PCYA 1HIML 3DPDA 3K5RA 4PJXB 4WFHE 3US9A 4BHUI 2NZIA 2I27N 5HGHB 2GVYA 4I18C 2GI0A 2NY0C 2W0PA 4Z7WA 5KBLA 2XN2A 5F7NC 1UJ3C 4BQCA 4P59H 2PP7A 4DVBB 3D85B 3CWGA 1J0JA 1TTBA 4FXLA 4UT9L 3PE9A 4KHXH 3UGEA 1U30A 3CSBA 1JHKL 3BH9A 1YEIL 1CE6A 1BDYA 4AMKL 5T3XD 5SX5K 1FDLH 1JWSA 1OW0A 2NZ9D 2O1AA 1YC8A 3TL5A 2YR3A 2FATH 3G5YB 3REVA 3GTTA 3PQYE 5I6LA 5D7JC 2CDEA 1KEGL 2VKWA 3HPJA 4TNGA 5I18H 2BNRE 4LSVL 1WLHA 2FH8A 3V5HB 3T3ME 4ZOCA 1D5XB 1VCAA 1Y1DA 5CGYD 5KSBF 1NLDL 1RIHH 1ORSA 2X4UB 4HISA 3QEUA 2VXUH 3FXIC 4XTRD 5AB9A 5LXGH 4KK8D 5KJRH 4G8IB 2AQNA 3UBHA 3GMOB 3MODH 2O30A 3UXFA 5CCJA 1RZFH 5LAPA 4N0UA 4LXFA 4XPGH 4B0MM 2I25N 2B20A 3MLRH 2O5YL 5KVDE 1KCRL 1PJWA 2H1PH 3GJFB 4H5SA 4NI6A 4LSSH 2OLDA 1QTYT 1T1YB 3T0XA 2R8SL 1HHIB 4AW7A 3ZN6A 1AS6A 4IRJD 1XBDA 3BVVA 1Z9SA 4OY9A 3MJ6A 5TF1H 3TZVB 1CYXA 1Q4NX 3MLVL 4A2GA 2JTYA 3BH8B 5E8OA 5E5UB 5I2IA 4LEOA 1M05A 5LHDA 5KSVA 4ELMB 4UZSA 3P4OB 4CMHC 2QDVA 3EXLA 1IGJB 3B1TA 1S3KL 3LDBB 2R0KL 2XTLA 3JWNG 1CU4L 2EKSA 4NQDB 4XP5H 9CGTA 2B5IB 1IBYA 3INUH 4HG4K 4XP6L 1GZHC 4JO5A 4KV5E 4TUJA 4FQ1L 1VRSA 5DVPA 1J10A 3IFLL 4ANVA 4GAJL 3S3JA 5T33L 4XHJC 3R8BB 4N2IA 4Z7QE 1G84A 3MNZA 3MRKB 4M93C 4YL9A 1F58H 1XL4A 5E5MA 4MJ6B 5TPWH 5IMMB 4BFFA 3AREB 1KIPA 3P0YL 3TN0C 3AC0A 2HWZL 3EYVA 4I89A 4G9FA 5F3BB 3VDBA 1R75A 1DQLH 4JRYD 4F7KA 3W9DA 1EX0A 1QNZH 3AG3B 5D2NA 1CDYA 4X99A 3PDGA 2ALWA 3L3DB 1OKEA 3OVUB 4JM2B 2VZUA 2AC0A 3F84A 1QR4A 1YDPB 3TYGH 3CXDH 1U8IB 4UMSA 5AW5B 2YEQA 3BWSA 4PJCB 2Y06H 1LO4L 1CXFA 2VLKE 4UANA 4X7TB 1SJVA 4HCIA 3RVTC 3ECBA 2Y6TE 1GOFA 4N6RA 4CVXA 1K8DB 4ZODA 3FB8B 3RI5F 5CM1A 1RJYB 2X89A 4KJPD 1E28B 2BIPA 1BF2A 5BZZA 1JCKA 3C87A 3KLKA 3STBA 4N0CD 2WPGA 1PLCA 3MBXH 5JXAL 3BN9D 4Q9CA 3PJSB 1RK0B 3A6CL 5EU5B 2A5UA 2C3VB 2JIXA 5DS2A 3QZWA 1QR1B 1OD7A 2E4FA 2DH3A 2YAMA 1HWHB 3GLEA 1F4YH 3HTLX 3IJYB 1DFBL 1NWPA 2E8ZA 2P5WA 1I8KB 5F1SA 4HKBB 3FO2A 3C6SB 3ME0B 2YRPA 4G6MH 3PGDB 5JO5B 1G7HA 2ICEB 5CP7A 4L9LA 1HILA 1RIUH 1OB1B 2IH8A 1CDBA 5J5EA 1W9XA 3NMEA 3N43B 1GGCH 3TYFA 4HJJH 3T71A 4JHBA 5J13C 1HDMA 2GJZA 3OKEA 3BDXA 1YPZA 4KPHL 4Y2DB 1R24A 4MHHI 3GMMB 3I3EA 1WWAX 3DX9B 4LOUC 5FPIA 2H41A 4JRFA 1P1ZA 5DLMH 5I30H 5L4MA 4JFSA 3II2A 5BV7H 2IDCA 2K7PA 4DZBB 1AR1C 5CSBA 4HDIA 4PD4J 4FFVD 4EI5D 1YNLH 3MA9L 3DDFA 3W2DH 2DM4A 4OQTA 3RAJL 1J1XH 2XTJD 4ANUA 1NAKL 1H15A 2UZYB 1MIEH 1UATA 1WTGT 3HAEG 4I9WE 3FSZA 4WEBL 5C09B 2R2BA 1BG9A 1UA6L 2CGRL 3FTGB 2HUHA 1L9RA 5LB1A 3SJVE 1SYVA 1NBZB 4V1DB 4L8DA 3L3IA 3QWQB 4HXAL 1WGOA 2YRBA 1I7ZB 1T5XB 3BAXA 3R4DA 2BRQA 3QZOA 1YUKB 1MCPH 3U30B 4Z7WB 1X5AA 2COQA 5HVWA 43CAA 2YARA 3MLZL 2IQAA 3L5XL 1USZA 3ZE1B 2CLVA 2YOAA 2IAMD 5D70H 5DD0L 5HHME 3V52H 4FMKA 1I9RL 4Z1PA 3JYCA 3BH9B 6PCYA 4KITB 2NYYC 4GI9A 5HGBA 1CE6B 3RKDC 3NP4A 5FM4A 5FHBL 2ADJA 1LO2H 1JWSB 3WG7B 5JW3L 4PUBH 1MFMA 2W81C 1B0WA 2DH2A 2YZ1A 3WHXA 3QDMD 1IM3D 1AIFA 3REVB 2WYIA 4U1KB 2CDEB 5FWRA 2Q3XA 3HPJB 3HE7A 3X12B 1W91A 2EEBA 2LU5A 2Z8RA 1FVCA 1PTZA 3FRUA 3V5DB 4FQLL 4F80A 3MLUL 1ORSB 5EN2A 3AGVA 3WAKA 1T4WA 3OHMB 4XVJH 3QEUB 4WGKA 2G9HA 4U3CA 1KV7A 4R7DA 4P2CG 3O3DB 2BNQD 2EE2A 4K15A 3L5IA 2AJSL 4N0UB 4Z7VA 1MJ7L 5KVEH 4I2XA 3OR6A 5DJYA 5I19H 1RZ7L 2F8XC 4H5SB 2A9NL 3ESVF 2DS4A 2FQGA 1CLYL 5E6ZA 1IO4C 5MEOA 1TU2A 2OS7A 4KNTA 4DKTA 5HY9A 1QUNA 1Z9SB 2MWCA 3HNVL 2K78A 3FU6A 4O9HL 1FL5A 4L2YA 5E8OB 4RH4A 4JREC 3D05A 3C6LD 4EOWH 5TQ2H 3VW3H 5I2IB 1BZEA 1DCEA 1I8AA 1M05B 4LEOB 4XGZA 5L9DH 2X4RA 5KSVB 3EF7A 2NT0A 1UEYA 4N4YB 2HFGL 1YN6A 3BHBA 2A6KB 3A0OA 2WXIA 2EKSB 4KKNA 3RUGE 3W1ZA 3BIKA 4JUTA 5KZCD 2VMDA 2Y7OA 1YA5A 3ZU8A 1ZAGA 1NJ9A 4QHUA 3MNZB 2ADFH 5E4OA 1W72L 5IK3A 4QXVA 1R33A 1MLBA 2OMWA 3GHBH 5E5MB 3O6ML 3P3RA 5DHYA 1HEHC 4TLTA 2V4LA 3SE8H 2V3DA 1KIPB 3BAYA 1L3NA 5KSAC 3EYVB 1CCZA 4G9FB 5IB3A 5JPNA 3C60B 5D2NB 4X99B 4JY6A 4BSJA 2CM5A 3WNIA 1T4KA 5E7FA 2AJYL 4UV7H 5GRVK 1S7TA 4K7PL 2BSED 4MASA 3SPIA 1TKWA 2WSDA 2YFOA 3QRLA 4L5FL 4PLNC 2J71A 4TVPD 3ZUNC 3JTBA 4L8BA 1AGDA 2Q3AA 1J8RA 3CC1A 3OMIB 1SOSA 4UUJA 3T2NH 4EQ3A 2MJWA 3ECBB 4N6RB 4CVXB 5FKPA 4LPXA 4DERA 1R3KA 1NL0L 2GT9A 2AXWA 2WSKA 4FHBD 4MCZB 2VDLB 4ZAKA 3ULUF 3IDGA 1KFAH 2OMBA 1OAUH 1YY9D 3IDMB 5KYWB 2J57A 3ZO9A 1OSPH 3DX1A 3AT8A 3QCTH 3J27A 5BS0E 1LE5A 2JIXB 1DQKA 5E8DL 3TJEH 3U1SL 3U6RA 3DX4A 3DO7A 2P7TA 2P5WB 4YLBA 1S9WB 1QRNA 4OIIL 5JYLA 4FHJA 4DGIL 4KXAA 5IFHH 2R39A 3FO2B 4PCSA 3LH2L 3ZKND 2R59A 3TBSA 1J0HA 4OCSL 1BQUA 3LQAH 4L8SA 1G7HB 1Z32X 5CP7B 4L9LB 4L8CB 2W9EH 4BK8A 1A7PH 2PO6B 7FABH 1MCJA 3HW7A 3HLKA 5EIQA 2AJUL 5E00A 2ZX9A 1IC4H 3DV6B 4NFDA 1UD4A 3TYFB 5I66A 4JN2A 1HDMB 3TCLA 4PJ5D 1F3JA 2GJZB 1AI1H 4QRRD 3GI8L 3OKEB 1YPZB 3BI9X 3SE6A 2ZOKA 2VTFA 1OO2A 3BQVA 1JNJA 1OGAD 1XB6A 5JHLL 4UF7C 3CZGA 4OM0H 5L7XL 3EYQC 4X5QA 1IAII 1A3QA 1P1ZB 1GS7A 4WJ5A 3SDAD 4HWNA 3IRPX 2Q5BA 4H8WL 4IU3A 3EBGA 2VQTA 3QXTA 3S3SA 1HE7A 2ZCHH 5DZPA 5CU5A 4JDZB 4J39A 3O6FD 1CLZH 3B2VL 1KJ2A 3KH4A 4ATWA 3Q2WA 2NTSP 1CBVH 1HU8A 2J55A 3FN3A 4BEIA 2Y1YA 4RIRA 1DJIA 3RVVD 3V6FA 1AKJD 1UCBH 2R2BB 1NM9A 3IWVA 3QZPA 1A65A 4NHCH 5HBBA 1SYVB 2J8UE 4L8DB 2WWMD 3L3IB 1MI5A 3UJTH 1U9KA 1RUKH 1Q0YL 5IIEA 4A2LA 1PJ9A 1AHKA 3DTDA 1IC1A 2GAZA 4M7ZC 3FTVA 5C0AE 2X70A 43CAB 2VJXA 4AG4L 2IQAB 4QAWA 5I1DA 1P4LA 2CLVB 3N5AA 4QAMB 4LIQH 2FZ3A 2YXMA 2DWTA 1OARH 1A6UH 5EORL 2YPLA 2AEPH 2E7CA 3QT2A 3FCTA 3VXSA 2AEOA 4KROC 4TNWK 5HGBB 5GRYA 1KC5L 3I9AA 2ZWLT 4PJBE 4MJJA 2ADJB 1FE8H 2EYRA 2FJFB 4LSPL 2Q8BH 3K6NA 3WKPA 5FYJL 4FULA 3WHXB 5E6IA 5EU6A 3SDXF 2ZAIA 4YNYA 2KBGA 5I17B 4W4OA 3HE7B 5EEXA 2E9GA 1UH4A 2MFNA 3KL0A 3ETTA 5LQBH 1SY6H 1FVCB 2XBTA 2XXGA 5EN2B 3ZXAC 4KXBA 3DX7A 3G6AA 3P73A 5DHDA 2EC9T 4GQ9H 5DO2C 4YEFA 2NY7H 4QTHA 2Q7NA 3ULUC 3CFCH 4E9QA 4ANKA 4R7DB 3FL7A 3QG7L 4Q7DA 1CTMA 1VJSA 4AV0A 4JJOA 4J4PA 1SF3A 4Z7VB 5DC0A 1R3HA 3HNSL 3KS0H 3OR6B 4I2XB 2QSTA 3DBSA 2ZONA 3OGCA 4L4TA 5DJYB 4KVCL 2W80C 5FUCC 1A4KB 4F3FA 3NFPA 5AW2B 5MERA 3N40F 1QABA 3FYIB 3VGBA 3EOAB 5BRZD 3SO3C 5MEOB 1TU2B 3MQIA 4YSCA 3WFBH 5HY9B 1AO7D 3KPPA 1QUNB 4B7IA 2FJUB 4L4JA 5FGCB 4EBQH 5IESH 1FL5B 5BV7B 5AZ2H 2IH3B 4A63A 3QEGL 1IKOP 1P69B 1YNKL 3I85A 3E8UH 4XGZB 2X4RB 2XWDA 3RFRA 4ETQA 3CFKA 5BVPL 1IE4A 2N7SA 3IAQA 2KI6A 4PSPA 1E2ZA 1YN6B 3BHBB 1MPAL 2VL5A 2BXYA 2H4EA 1G6RH 5D6DA 4KVNL 3BIKB 3PYCA 1N7ML 1LO0L 1SM3H 2X6MA 4PJIF 3BT2L 2HXAA 4F2FA 1NJ9B 3DHUA 4QHUB 3U2SA 4GT7A 4P4KC 1BAWA 3JWOL 4ZUWA 5JHDE 5IK3B 1A4AA 4GRMA 5HTSA 2OMWB 4TM9A 4R4BA 5E51A 2V3FA 5DHYB 1NBQA 5MEPB 5LGYA 1PU0A 3O9WC 1TQBB 4OSUH 2XQBL 3UBXB 4EZKA 5C1MB 3TP4A 5IB3B 1ADQA 5JPNB 4Y16D 4ERSH 1LGVA 5C0JB 1UM6L 4BKTC 4JY6B 1MWOA 3ZGHA 1ZDSA 1A6ZB 4JFED 4WFFD 2J4WL 4QRUA 3V9EA 1S7TB 4OD2A 1TKWB 1QRKA 2AJVL 5HHXL 2P5EE 4AJ0A 3VM7A 1IZKA 1W2KT 2D7TH 4NT6A 3QORD 4L8BB 1AGDB 2C3GA 5FCUL 3SE3C 1UWYA 4TNFA 3MJ7A 4MCYA 4KHXL 3NT0A 4YHZH 5FKPB 1F4HA 3VFOA 3W5NA 3QARA 4X5LA 5JOFA 1R3KB 1FIGL 2EE6A 2GT9B 4YDLB 2WLHA 1JWUB 4ZNCD 3QIWD 5FV2A 3C8HA 4ZAKB 2IF7A 2VMCA 3N41F 3IDGB 2FGWH 4J3BA 5FECA 1SY6A 5TK4A 4O58L 3LKOA 1ZVNA 2X4OA 3FQNA 1D5IH 4Y0GA 3SE4A 3ILQD 4PJHA 2EVGA 2NY2D 2YPVH 3MVSA 1G9MC 4YE4L 5I18L 5DZVA 1LE9A 1LE5B 2EDOA 3BEVA 2ZWZA 2ETWA 4C8XA 4P2QE 3U6RB 1E3XA 3QZMA 1C7TA 3OZKA 1HNFA 3F8UB 3DO7B 2P7TB 4DEPB 2ODHA 3GJEA 2NCEA 3JVGC 1QRNB 2OCJA 4R83A 4AYBA 1TLMA 4FQXD 4MMZC 3A6OA 2UX6A 3FQWA 4OZIE 4L1LA 5LXGL 3TBSB 4X5XB 4JFFE 4L8SB 5KJRL 4HCRL 1OAQL 3A5VA 3MODL 6TAAA 3CBKB 4IMKA 4ORGB 5CEZH 4DP7X 3MLRL 2YGPA 4JN1L 3ULVE 2H1PL 3OQ3B 3D08A 5E00B 1J7VR 4LSSL 4PRHE 3NTCH 5IF0B 3D4GA 3SOBH 4M7KH 2DL9A 3P4MA 4JN2B 4PJAA 4ZT1A 5KVDL 4LHUD 3TCLB 4BSVA 5I66B 1F3JB 4AQOA 1PY0A 2CK0H 4FQJH 1H8SA 3H42L 4XVSH 3HBZA 2VYRE 4IRSC 4MS6A 5F93C 3RP1A 1TPXC 5TF1L 2VAAA 2ZOKB 4WU7A 2XFXA 3UGUA 1ID5I 2FH6A 2DICA 3GSNB 3I9PA 4MAUL 4BD4A 3AB0C 4GG6A 3ES6B 4WJ5B 2ZE0A 4RWHA 4HH9B 4JAMA 3QZWG 4CVZB 1QMUA 5F7FA 4IU3B 4XP5L 1T7WA 3ALXA 1MCOH 2B4CC 3INUL 5FHAL 2JQMA 4U3HA 4Y5YA 1EK3A 3KZ8A 3IWUA 5I1LA 3X1NA 2IOMA 2GTWA 4DKFH 4RIRB 2NY6B 1YECL 3QBTB 4ETYA 1FGVH 5CXPA 2VRAA 2XV2A 4FJ6A 2ZQKA 2IFFH 3VVVA 3WD5L 1FO0B 1MI5B 5ANMA 4FG4A 4OQTL 1AD0A 1T6VN 4TF4A 5FV1L 4WZ9A 3R8QA 1PYWA 3QO0A 2GAZB 3KW8A 2DWXA 5B8CA 1MSPA 3LN5A 2X70B 3CXHJ 3B2XA 4LHQB 5I1DB 5KANG 4ELMF 5A2JH 1P4LB 2P44B 5DTFA 3W9EA 4CILA 2FZ3B 1OAJA 4AQ8A 1XGRA 4CN6A 1FYHB 4WKZB 3FCTB 4J3OF 2JKWA 4LQ1A 5ESVA 2DV6A 3AM8A 3VXSB 3QFDA 3C09B 1MREH 3KPOA 4P4RA 3IMSA 1WBZA 5AVTB 2WO3B 2PW2A 1FLRL 2HYMA 2EYRB 3DDGA 3PY9A 1PG7H 5AVUB 5B39B 2DLGA 2YPVA 2Z34A 4KTEH 4G8GE 1OWRM 5E6IB 5EU6B 1IEBA 4XHQA 4YN3A 3QEQE 4YNYB 3QWRD 3QIUD 1YYMH 1VFMA 2BY0A 2NR6C 3QIBA 3KJ4C 4PEEA 5C07E 3O4OB 3WN5C 3BKJH 4DOHB 3AS2A 2ZWSA 3Q5TA 3Q0HA 4NQXA 3ZHLA 2HLAB 4KGLA 3DX7B 1JNNL 4PJ7E 4UTAL 1RJZA 4PN6A 2E7MA 1FH5L 2XBZA 2ZX6A 3GSVA 4QTHB 5GJSH 1EZVY 2R27A 1KGCE 4EIBA 3OPZH 1JNLH 2FT7A 3WXWL 5KW9H 4HS8H 3Q8CA 4LCWA 1R3HB 1XGUA 3OGCB 1MDAA 1N6UA 2YGOA 4HEME 2IAAC 2Z65C 3OHXA 2M83A 4YZFE 4F3FB 3NFPB 4DUVA 3ZE0F 1QQDA 5MERB 4X6DF 4LCUA 3FQ1A 3NJKA 1AS7A 1BJ1J 1E67A 1N18A 3QJUB 5LKNA 5GS0D 3KPPB 4P46C 4BRJA 2XV3A 1FA4A 1HZHH 1A14H 1GGCL 4HFUH 3QGVA 5E4EC 5JUEH 4QMEA 3N0AA 3FUMA 4CVWA 4NP4H 4ETQB 4E9RA 1L9OA 3CFKB 2G2NA 2BOCA 1OGPA 2MIZA 2DQEL 3WXVH 2VL5B 2XA3A 1UA3A 5T1MA 1AGBA 5I30L 2ICCA 2D7NA 3T0EE 3RGVC 3VXNA 4AYID 3D34A 4RVBA 1E90A 3LTVA 1EIBA 4HD9A 2J6WA 1SUJA 3R4RA 1QW9A 3M6DA 4WTQA 3U79A 4GRMB 4LPUA 3FU0A 4C4BA 1ZT4B 1FL6A 4N9GA 5HI3D 4R4BB 1CLOH 2BSDA 5CCKH 4DN4H 1U8NA 1MIEL 1NANH 2MSPA 4LVOB 4YDIH 3L6FA 4LOVA 4QHPA 2IIJA 3PWPE 1KYOK 3NIFB 1V7NH 4XXWC 2K45A 3DVGA 3D52A 1UD8A 2ATPA 1DUZA 2FX9H 4HIIB 5J6HA 1PKOA 4JL2A 4MJIE 4QRUB 3S9DB 5KYYA 3LRMA 4OD2B 2YQBA 4X0KA 4N0YH 4PGZA 5GGQH 3ML8A 3OMAB 3VU1A 4FG6D 4F5CA 4DQAA 2BMKA 3GRWH 4KO5A 2O72A 3U6XA 4NT6B 2WLZA 5D1QD 4FQIL 2FYYA 2EVFA 3ZSTA 1JVLA 4LLAA 3MJ7B 2EDHA 3LPFA 5D70L 4M5ZH 5TD4A 4N2BA 3VFOB 2RIKA 1BZDA 3O81A 3I2CL 3QFGA 3MKKA 5IMKA 4UAHA 1T80A 4ZD3H 4NZ8A 5FECB 3CFIC 3O2WH 4LRIA 4PJ8C 5F7BA 5JMRA 2PPEA 3LKOB 1WZ1L 2X4OB 2DPKA 3KXFB 3FQNB 2D7MA 3LDBC 4JPIA 4AL8H 4D9QD 2A6DA 3RVXD 4PJHB 1XBRA 4J3OC 2B5IC 3N85H 4K2UH 3BKYH 4GSUA 1LE9B 1R5WB 5D1ZC 2GCYB 3OAZH 4FLSA 2F5BH 3NPSB 3TCTA 4ELKA 1H6FA 2IG2H 2YN5A 2K6WA 1A6VH 3FQWB 3GQFA 1BD2E 3ILDA 5I6XC 3AREC 2EVJA 3WLWD 4Z7UE 4ALAL 4XBEH 5GS1C 2OXGA 5K33A 3VXTA 5JTWA 3WTSA 4NQED 4PLKD 2HLEB 4JM0A 1GGYA 1N64H 4KFMA 4L3AA 5GGTH 3RZCA 1N4XH 2ZP0T 1NGPH 2XVKA 3P4MB 4PJAB 1JXKA 4BSVB 4LCCC 2B8OT 1AR2A 2ZWYA 1G6RB 3NN8A 1CN4A 1RP9A 4AJYV 2VAAB 4G8AC 4M1DL 2XFXB 4KKQA 4WU7B 2DI7A 2IPUK 3OSKA 2DLEA 2XG4B 5TH2B 3VW3L 1GOHA 3AU1A 1FAIL 4OJCA 4WUUD 4GG6B 3T0VA 5F1OB 3DOHA 4JAMB 4ZMLA 3C5JA 2CHZA 4G9DB 3V9CA 4DP5X 1EJFA 2DN7A 3GI9H 1XB8A 4HUWA 4JZNA 5D2LF 5CWSA 4Y5YB 2IANA 5BO1L 5I1LB 1KCUH 4DPAX 4QIRA 3O45A 1RZQA 2GTWB 4HUVA 2ADFL 1E7UA 3R18A 2I7OA 4ZO7A 4L48A 2B3RA 3PFUA 4ZYKA 3BESR 4OT1H 5BUPA 3WNOA 1SN2A 2X0UA 3SE8L 1FNLA 3KBEA 4XRCA 1N8ZA 5ANMB 1KJ2L 5T3XE 1AD0B 3GRWA 1I3RA 1J18A 5CU9A 1WPCA 3RPIA 3V0AC 3E2HC 1ZS2A 1G0YR 3QO0B 4OGXL 1CDUA 1R4XA 1OXYA 4PJFE 4ZUTA 5B8CB 3LN5B 1ZTXH 1M4KA 1DVUA 4UV7L 4YBLB 3IF1B 1MJ8H 2E46A 3IJ8A 4N68A 4K94C 3V0DA 5DTFB 7PCYA 3W9EB 2BM3A 3IAPA 5LXVA 1QFOA 1X6LA 1XGRB 1J1PL 3ATDA 5ECGA 4P57A 5ESVB 5AVRB 3B2MA 3QFDB 3KPOB 4P4RB 5C0CA 3ZMEA 3GPEA 1T3FA 3F01A 4MXQC 1D9KD 2PW2B 1KIUA 4LL4A 2X6UA 3FCGA 4B9JA 5D7IB 4KY1L 3CLEH 4K8RD 4P23A 1HNGA 4W9EC 1IEBB 2FCBA 2NCMA 5DT1L 5AWNH 4EDWH 1EXHA 4QWWD 2NOYA 3AS1A 3QIBB 5HHNA 1OAUL 4UIKH 12E8H 1OSPL 2V9RA 3A6BL 1OAXL 4HCFA 1FFOA 2X2HA 4L05A 4NQXB 1H3GA 2DMCA 1M7XA 2XZCH 4Z5RA 4TTGA 2EICA 3L5WA 3TJEL 1RJZB 2JELH 5SX4I 3OB0K 4OJYA 4YVNA 4UTBH 2MQ0A 1ED3A 3VRLE 4B5EA 2YQGA 4AIXA 3GKWH 1RUMH 1Z0NA 3ARFD 5IFHL 4LCWB 2CA4A 3SZKC 1XGUB 4HWEH 3HC0A 3OKLA 4RSVA 2Y6SC 3HA0A 1QQDB 2W9EL 3ECQA 1A7PL 5DRNA 3N3EA 2CIIA 2WCPA 1GKOA 3VXRD 1XF1A 3HPLA 3FO0H 2XWRA 1U58A 2E86A 2O4EA 1RERA 4IKIA 1KEML 3G5ZA 4CDHA 5IROC 1I7UB 4A2EA 1AI1L 4H20H 3UABA 3WLWC 2BOCB 2DQHL 4Y4KA 5EO1B 4GKNA 4A37A 4G8EA 1J1OH 4K9EH 1YEHH 5CFAA 4JRYE 1GAFH 2CBOA 3EH3B 1AGBB 5INDA 4F91B 5IHWA 1MDTA 3IXTA 4OFPA 2EDFA 1OM3H 1U3HC 5BOJA 3VXNB 1NOLA 2AQPA 1JGLH 2VERN 5IVOA 2ZCHL 3H2WA 4AI7A 1ZA6A 2VDNL 1MAMH 1CLZL 1FL6B 2ESVB 2VUKA 3P4NA 4JKPH 5BQ7B 1QD0A 2KPWA 3M88A 3WU1A 1A7RH 3OD3A 4KKBD 1F11A 1T7ZA 2C9SA 1U8NB 2I60H 2AW2A 3K72A 1AJ7L 5HI5D 4NUJA 5T3ZD 2GJ6A 5ALBH 4MXWL 2J44A 3DVGB 1HQ4A 1BLNA 4JDEA 1DUZB 3ZDZF 5J6HB 5DJ0A 2IDFA 1X5FA 3UJTL 4XCYA 5SWZB 2X41A 3DHJA 4KI5D 5B3SB 5KYYB 2CKNA 25C8L 3HB3D 2PXYA 4X0KB 4J7RA 5JIKA 2ZKMX 2D0HA 4FI8A 2FWOB 4U1MA 3D39A 4H0IA 3PCYA 1B0GA 2BMKB 2WBXA 4TXVB 1ADQL 3BPOC 3JWDL 2FYYB 3GIVA 1KT2A 3QW9A 1KXTA 3HC4H 1URZA 3CE1A 1KPRA 4POZD 2DWDA 1A6UL 4Y5VA 4HF5L 2AEPL 4UDTA 1OAZL 1HKFA 4IK6A 4JR9H 5IMKB 2Z93A 2JJTA 1UD2A 3MRCA 4X8XA 2JI1A 2W5PA 4NO0D 4WW1A 3SQOH 2NQDA 1NEZB 4JPIB 2A6DB 3LD8C 1CE1H 4UTBA 4E68A 3EKCA 5AAMA 1KTDB 3AMLA 3RJQB 5LQBL 4U0RC 3S37L 1EFXD 1ES0A 5GJTH 1LK3H 3WN6A 3MCLL 4XNBA 2FEEL 4M1CC 4MA8H 3CFCL 4LDCA 3JTTA 4PI0A 4RZCA 2A9MH 1HXKA 4K55A 3Q5YA 4PJGB 2D03H 1T0OA 4YSEA 4X9YA 2OXGB 3RX5A 3C60C 1A9EB 3VXTB 1A6WH 4GAAA 3RZCB 2F68X 2VDRL 2CUAA 2XTJE 2WM0A 4JFYB 4ZFGH 2JVUA 3D0LA 3NIDF 4W93A 1UFGA 2BFVH 3NN8B 4RA0C 3SY0B 3WIHA 4EBQL 2OAAA 2F1BA 2ZZUT 1ETJA 4ZTOH 2Y7MA 2EIJB 5CJ8A 5HI4C 1P5UB 3JBG7 4YSPA 2WUBH 4BK5C 4H1LH 4LLVA 3B5HA 4WDIA 2AQ2A 1I85A 4DP6X 2CPUA 4HUWB 1FZJA 5F9WB 3HG1D 3MJGX 4JZNB 4P9HL 4NN7C 4ZXBD 1SM3L 2IANB 4G5AA 3O45B 3RKPA 4HUVB 1N26A 5CLZA 1IE5A 3ASOB 1VFUA 1RIVH 3ARBD 4YXLL 3FOMA 1F3DJ 1JGVH 3CHOA 4ZYKB 3V7MA 3BUDA 3EOTH 1IBHA 4N1EA 1N8ZB 4XRCB 1MWAH 4OSUL 1RZGA 4Y4HA 4FA6A 4PTTA 1I3RB 2IXQA 3RPIB 4KC3B 4OZGF 3H9YA 5E94A 3W81A 3BE1L 2BJML 3D3VD 2AQ1A 4GRWH 3PL6D 1BXUA 4AW4A 2QSVA 3QDME 4FKKA 5IHZB 1IM9A 3RGBA 4AK2A 4J3WA 2PO6C 3H6JA 3S37X 2O5XL 3V5KA 1KXQE 5BCAA 4WI6A 2Z92B 5DUBA 2CRMA 4P57B 4NZUH 5C0CB 4ODSL 1CXKA 2CIKA 1EEZA 3QO1B 3NJNA 3O41A 4X9BA 3E9UA 2BNQE 3TJHC 2WXOA 4HOZA 32C2A 3RILA 4WO0A 1EBPA 3GMRA 4HKZA 3NJJA 3DSFL 4WFGD 4MB3A 5HHNB 4GG8B 4LNRA 3DMMA 4XX1G 1JD7A 1FFOB 1NIAA 3DUHA 4Z3JA 2R4SL 1NFDA 2WZ5A 2YPVL 4Z5RB 3L5JA 3L5WB 2VN4A 4YHIA 5HDQL 4FTVD 1TJIL 2X6AA 4WWKB 3AXHA 5I1AA 1JS4A 4FJYA 3BJ91 4F33A 4PMEA 2BK8A 2WHVA 3A22A 5FM8A 1SF5A 4KJWD 5JPMA 3N06B 4GXUN 4YFLI 4XNUL 2O6CA 3HC0B 1WVZA 3OKLB 1WFOA 5FYLH 5KVFH 2DYSB 3IGAB 4KTGA 4NO5A 1ZXKA 4TVUA 5DRNB 1TZGL 2CO7A 4NGHH 1WA0X 5CEZL 1OT2A 1RLWA 3HPLB 2WANA 1NKOA 2Y4SA 3KYOA 1DSWA 1U58B 3NTCL 1ZHKB 3SOBL 3FQRA 5C08A 3G5ZB 3IDJA 1CR9H 1RFDL 4H1LA 3S5ZA 2YLHA 1R0AL 4XVSL 4YDKL 3NEOA 1FCCA 2CHWA 4Y4KB 4GKNB 4G8EB 4P2YA 2J8OA 4D0BA 1ERNA 3G04A 3IXTB 2VDQB 2DLFL 1R47A 5IOKA 1QPKA 3SGEI 1L0YA 4FLHA 2HG5A 3DRTB 4RFOH 5JMOC 1KELH 1LO3L 4FQCH 1T7XA 1K8IA 1MWAA 3P4NB 4TVPE 4UQ3A 4XO8A 4QXWA 1KYAA 5I6NA 3NJLA 4GKLA 4YBQD 1F11B 4DKFL 4NUJB 3T3PE 3VXQB 5A6IA 4NP9A 3RVWC 3BISA 1X5XA 4N0RA 2IFFL 1HQ4B 1BLNB 3GK8H 4JDEB 4HKJA 5DJ0B 4E42A 4M8VA 4OCMC 4XCYB 3KVPA 2FK9A 1AGEA 4RESB 1QHOA 1G5AA 1GIGH 2CRZA 1MFAH 4N87A 3VI4B 4U1MB 5HDBB 3D39B 3SGKA 1B0GB 3UP1A 1PBYA 1UQSA 4OM1H 3VYNA 1CI3M 1KT2B 1KXTB 4KUZH 5C0GA 1AQMA 1LP9E 1KPRB 2OYKA 1WSST 4PQXA 4TQHA 4GJTB 2DWDB 3RIFF 2BO0A 4G82A 3E8VA 4I0CC 4I13B 1C5DA 5JR1H 2FX8H 4UDTB 4UM9D 2ATAA 3A4DA 2NY4B 3WFZA 3VG0L 5B21A 2Z93B 3MRCB 3UJJH 4MCNA 1PG7L 1Z5YD 4K7FA 3COOA 4RGNC 1ASQA 4WW1B 3OAYK 4I1RA 4K3DH 3NCWA 5IVXE 4NPYA 3N44B 4RMRA 5FEBA 3ZT7A 1R5VA 2DQJL 4PWIA 4FXTA 4G7YH 4NQQA 2K9UA 3C2SA 1P7QD 4KKCD 4ODBD 1TOXA 3KYNA 3ROLB 4L1HA 1S5IH 4GQPH 3TT1H 2X88A 5IEKA 4PJ5E 4XXCA 1KY7A 1ES0B 2ENSA 2DIBA 4PBXA 4F2EA 2OULB 4RZCB 4ELKB 2ERJC 3VWJA 3T0DA 3JTTB 3P54A 1MCFA 4KDTA 1OGAE 1TQBC 1JNLL 1T0PB 1YQVH 4UILL 2E27H 1DVXA 4HS8L 4L3CA 3WNNA 4AV4A 4FFTA 2HVJA 4WI8A 1KBKA 1NFIA 3FSVA 4LL1A 1BA9A 5K59F 1PX8A 3X11A 1F0LA 2QGCA 2HLFC 2YRLA 4B0MB 4U1IA 2IGFL 3RX7A 3Q2NA 3D0LB 4G8FA 1IFHL 4HFUL 5KVGH 5JUEL 4WGWB 3QPQC 4OFVA 3GGWA 1MFEL 1W0VA 2VXVL 3OB8A 3QUZD 4Z76A 1I3GH 4LLVB 5E9DA 4WDIB 1TZAA 3IFPA 2VIRB 5DJXB 4BKSC 2OK0H 1FZJB 3FN9A 1EV2E 5DJ8A 4O02L 5AALA 3RIAK 3ZE2E 4GXUM 4OKVA 1CT8A 4XO3A 5FFOA 3TEUA 4AE0A 3HKZA 3IMVA 4HPOL 3SN6N 3RY6C 3V4VL 4A68A 4OZHF 5INCB 3FOMB 1E7VA 1PG7X 2RFXA 1AZZC 2J1KA 2BP0A 2KPNA 2W0FA 4LHJB 3WEMA 1PKQE 4DEPC 1N5AA 4X98A 4IHOA 1RZGB 4PTTB 1IBGL 2IXQB 4N8VA 5E94B 4OB5H 1V7NL 4ZFQA 4PJ6A 3MTRA 1KDJA 4BHUA 5J1SC 3TV3H 5BJTA 2K7QA 4OD3L 1IM9B 1DVQA 3S2CA 3OX8A 1CGVA 4YAQA 1XMWA 3OG4B 2FGZA 1QG3A 3ZUCA 5CF3A 4MLIA 3V5KB 1AHMA 3U1QA 1KBBA 2NY3B 2VR9A 5DUBB 4DEUA 1R1CA 1DZ0A 5CZXD 4PGBA 1EGJH 1T1ZA 4MMYA 3S98A 4JPWL 2CIKB 1EEZB 2Y7LA 4K3EL 1BBDH 4M5ZL 4QXUL 3X13A 4G7RB 3O41B 1NAMA 5IQOA 1PSKH 3MV9A 2UWEB 3EGSA 3PPSA 5PCYA 1IGYA 5BMFH 32C2B 1ID2A 2YWZA 1RZJC 5GGVH 2RHEA 2O93L 1EBAA 2HTLC 3DOIA 4HKZB 4X7FC 2PWDA 4Y1AA 5ACLA 5MEND 5EA0L 3DMMB 1CWVA 2GUOA 2IJ0C 4NAJA 4LU5H 3HS9A 4G7QB 4FA7B 4BWTA 1WA1X 2BXZA 3N85L 1BM3H 3WKYA 5BRZE 2FUQA 4YHIB 1DZBA 1AO7E 4DUWA 1XQ4A 5I1AB 4ICWA 4ZMPA 1AXSA 4C56D 2HUEA 3AG4B 4Q74A 4F33B 5IW6A 3PAUA 2VUYA 5A2IH 2J43A 3TPUB 3LKPA 1E9OA 2EXWC 2ENPA 3VFGH 5JPMB 3IEAA 2WD0A 4PRPB 5MP6L 2QQNH 1UKQA 4XBEL 4CC4A 4G42A 1BIIA 2CO7B 4U33A 1CJYA 1XCQA 1IBFA 1X5JA 4ZDHA 3DYOA 3KYOB 4MDJB 5IJVA 3MROA 2D7QA 1ZLWK 5FUZL 1G1OA 1T5WA 3FQRB 1I1AD 4H1LB 3IDJB 4MJ5A 5C08B 2YAEA 4AEIL 3P11H 3UGXA 4JB9H 3O3BA 2KS0A 3QQNA 5EFIA 2VH5H 3CFEB 1YEGL 3G04B 3LJ3A 4DZBA 4APQA 4CC0A 5TTRA 1YYLL 3GSUA 4JFEE 4WFFE 5E2UL 1OCOB 4L1BA 5I1JL 3BWAA 3CFBA 1U2YA 3ELQA 2UY6A 1RPQA 3LXAA 2IO5A 1MWAB 1U3ZA 3L4VA 1UEMA 4YK4B 4TSBH 1OP3H 1O7SA 2YD1A 4GRWB 2H3XC 2APSA 1V3JA 4ODHH 5IR1A 1XH1A 1ACCA 5F1KC 1XAUA 4RZKA 1AHWB 1OL0A 4HKJB 4E42B 3ZR6A 4MNHB 4PJAF 3HLAB 5GGUA 1TYEB 3U9UA 2BVQA 4NO2A 2C3WA 2DTMH 4I85A 2L0DA 4ZSOE 4PS4H 3S88L 4JPQA 1EGJA 4AM0Q 1GYUA 1Z9PA 3JUZA 3OLEA 1GKEA 4PJDF 3MHZA 3QAZB 2B77A 1UQSB 3Q6GH 1MJ8L 5BO0D 5C0GB 4ZNEA 5HYSA 2X3CA 2MOQA 1XFPA 4M43L 5KS9A 1KN4H 2ZUWA 3UZEA 1C5DB 5DHVH 4C57C 1MUJA 3KCWA 1KB5H 1ZPLA 4U6HA 4XC3L 3LN4A 4PRAA 3TA3A 4Z7NF 1D5MA 2CU9A 2OR7A 4QXGL 3SPGA 3WO4B 3DRQA 3NABH 4NQCD 4QEGA 4NCC2 4K7FB 3JV4B 5D1ZI 2BHYA 4LFHG 4EDWL 2ZUUA 4GRLB 4N3TA 2KMWA 4NPYB 2EIMB 1UCTA 5F3HA 1R5VB 3RTQC 4KFZC 1NM4A 3B5GA 3KYNB 5TE6H 2G3ZA 4UI2A 5IEKB 1ZT1A 2I07A 4N6QA 2DQTH 3MZTA 3DGCR 3SE9L 5F7YC 2VDPH 2NNRA 3KGRA 4ZRGA 2WXNA 3K6OA 3VNYA 1JVKA 3VWJB 2LW3A 4NNXA 4UTBL 1PX3A 1S7SA 3O6LH 1BQLL 1RUML 3ZRFC 1JI2A 4L3CB 1AY1H 2DYPD 2QQLL 2HVJB 3ETSA 4WRLA 3CZJA 1NFIB 3V6OC 3X11B 3FQTA 5L6YL 3GO1H 3BZFA 5D7IF 5DWPA 5EZJA 4O5LH 5JW5A 3TJPA 3TURA 3W11C 4U1IB 3PIQA 5E2TL 4ZW8A 2Z0BA 1Q1JH 5CBEA 4G8FB 2H3NB 4HSAC 3FO0L 2J88H 4KDWA 3X17A 2CPCA 2ENYA 4OCXL 3U4AA 3HC2A 1L9TA 3KW7A 4WNJA 1TYRA 3QQ9C 2I32A 3WFEH 3GGWB 2ARJA 5CEXA 4Z76B 3HZKA 5E9DB 1MEXL 1WC7B 3KVDD 3NH7H 1J1OL 1FZKA 3IFPB 3PABA 4K9EL 4IBLT 4KX8A 3VFSA 2ZXWB 3BVWA 3WIHL 4BFIB 1MF2H 5DJ8B 5T1LB 1OM3L 4UQDA 4OKVB 1ZANL 1CT8B 4AC4A 3BLPX 3VGFA 3BC9A 3Q43A 4UU9A 4L3FA 3CGTA 1CIUA 3BYYA 2XNAA 4JKPL 5CZVL 1AIZA 2YGNA 3S36L 2W59A 3OB0H 3OJDA 2X6CA 2BP0B 2W0FB 2I60L 5I71B 3L1FA 4BFOA 3EO0A 3FKUS 3QNZA 3X1FA 1N5AB 4X98B 4IHOB 4APXA 1Q0EA 4N8VB 4WO4D 5LNEA 1JZ3A 3MDJA 4X83A 1IGIH 5IVZA 3WBDA 5BJTB 1ACYH 1GS8A 2DMBA 5DHVA 3OX8B 2V2WB 4YAQB 1G9EA 3IS0X 1KB5A 3B9KD 4A7QA 3WTTA 3FNKA 3FJTA 4W9CC 4U1LA 3EJRA 4HSQA 3C5ZC 4OW6A 4E9LA 2H8PA 2TSBA 3EFOB 5I16A 5J12B 1T1ZB 4MMYB 3IDNA 4H26A 4HXBH 4JMXA 3X13B 2R9HC 3FH7A 5KJ4A 3F85A 2IEPA 4UT7H 1E5UI 1S7QA 2APFA 3EGSB 3MV9B 2QKSA 1IGYB 3C8KA 4POUB 1FCGA 1P0SE 2E6JA 1AXIB 3QDJA 1KTBA 3IBEA 5DF0A 4PS3A 3UTSD 2HAZA 4Y1AB 4HZAA 3AVEA 1HSBA 3F6JA 3MRPA 2GUOB 4NHUB 3SQOL 3U4BH 4YPGA 1XAKA 1HH9A 1U2CA 5HHOA 4I88A 5K9QG 3U0WL 1UB5A 1NBCA 3FUDA 4GOSA 1IQWL 2RCSH 4CKQA 2WXLA 2KT6A 3LMJH 2W38A 5IQLA 3SPVB 3UPCA 1EXUA 5D4JA 3LKPB 1DUYA 2E7LC 1TMQA 2R51A 4MA8L 2A9ML 2NY1D 2D03L 5CGMA 4AJVA 3CPLA 1TZIA 2CBMA 4G42B 1BIIB 1XCQB 3V0HA 3VB9A 3BEWA 3S36X 3K81A 3THMH 3RWJA 2PR4H 5DUJA 2GC4C 5IJVB 3Q2LA 1T5WB 4YHKH 1OK0A 4MJ5B 1Z2KA 5GZNC 4J23A 3FMGL 1NSNH 3O3BB 5CIPH 2WOBA 2VC2B 3FYEB 5ALCH 4UT6H 3LH8A 3IETA 1NGQH 3MV8A 3V4PH 2B2XL 4ZTOL 3T6WA 4C54A 2NNXA 4APQB 2F5AH 3T6XA 5EUOE 1UH3A 4O00A 2UXTA 2OW6A 3GSUB 1G4RA 4JQIH 1BVZA 2IWFA 4F37K 2PPAA 3HI6L 3CHXA 4PS8A 3BWAB 3CFBB 4PRBA 2UY6B 5A16A 3CG8A 3QHZL 1FYTE 4PJGF 2FB4H 2XKUA 4JPSA 3EDDA 1AGCA 4KKAD 5DUPL 5D1QE 2OX5A 1L6PA 4Y4FA 3TX4A 1XF2A 4AC2A 4XXDB 2K6YA 4KK6D 3ZGIA 4EUPH 4HBCL 4ABWA 5IR1B 3CN4A 4OV6F 2GPZA 3EOTL 5ISZD 4NZTH 5GGUB 3U9UB 4AV5A 4WF7A 2BVQB 1UWFA 4NO2B 3LQMA 2ZSVA 1HT6A 4H1LG 1R3JA 3FTSA 1ONQA 3HS0C 3MR9A 4XN1A 4D9QE 4P5TA 3CK0H 4NS0A 3D18A 4P9MH 4EXKA 3F05A 5HYSB 1Q94B 1EJ8A 1TO5A 1AGFA 3WL9A 1YC7A 1Y07A 1HHHA 1TZHA 1T2QL 3Q8EA 3HNTL 1PAMA 1MUJB 4U6HB 3TA3B 4UOQA 3LN4B 4PRAB 4DW2L 4BWUA 4WI0A 1IVTA 3TBTB 5FYKH 5CLXA 3UTOA 2LT9A 1DBML 3GBMH 4JL1A 4M7LL 4YHOL 4EXPX 3JUYA 3HG3A 3FCSA 1TEGA 5F3HB 4I3SL 4AYFB 4TV3A 5JW4Q 4OD1L 4IBVA 5CKGA 5L88H 3V0GA 2YD6A 3KPQA 1ZT1B 2I07B 2OJZH 3GHPA 3Q9PA 1J48A 1CFVL 4TNEA<