1SFDA

Oxidized form of amicyanin mutant p94f
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTFHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Amicyanin
publication title Structural Studies of Two Mutants of Amicyanin from Paracoccus denitrificans That Stabilize the Reduced State of the Copper.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 25
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1sfdA00
2P80A 1AZNA 4HHWA 5E9NA 1PLBA 6PAZA 1J5DA 3FQ2A 2BW4A 3ERXA 1GS7A 1A4CA 2YXWA 2OCCB 1BXUA 2PP8A 1GW0A 3T6VA 2CCWA 5I26A 3T9WA 5IY5B 2YAFA 4G7RB 1ZPUA 5B3SB 3L45A 1F56A 4YSUA 3FU7A 1KDJA 1JZIA 3FQ1A 3OMAB 3AG3B 2PLTA 2I85A 5AKRA 4DP6X 8PAZA 3TU6A 2XXFA 4NAJA 2VMJA 1ILSA 1OV8A 7PAZA 3NT0A 2HRHA 3JTBA 3V9EA 1NIEA 3QQXA 4KO6A 1JZGA 4FA7B 1PMYA 2R7EB 2FWLB 2XV2A 1J9QA 2HZHA 2ZWNA 3ZBMA 3ABLB 1PNCA 2YQBA 2B3IA 5I6PA 2X87A 4KNTA 2PCFA 2YAPA 1GS8A 3IEAA 2VN3A 2IDUA 2YAMA 3H56A 1IBYA 5I28A 3C75A 2JKWA 3AW5A 4A2EA 1HFUA 1MDAA 1TU2A 2AVFA 3OD3A 3NSFA 3NJIA 2EIKB 1N70A 3EHBB 2R7EA 1NICA 3UABA 1OE1A 1PLCA 6PCYA 4M4RB 1M9WA 2HRGA 1SNRA 3NP3A 4GY4A 1AZBA 1QNIA 1RKRA 1BXAA 5F7BA 4YSPA 3GYRA 2IDTA 4E9WA 1OE2A 1NIDA 2DYSB 2QDVA 1KDIA 4GP4B 3EH4B 2UX7A 1BQRA 1MZZA 1SDDB 1I53A 3MX0B 4A2DA 2PPEA 3SBRA 4DP7X 4DP2X 4X4KA 3OMNB 1AG6A 4YSSA 4E9XA 2BP8B 3EF4A 1OE3A 3RYMA 1E5ZA 5I6LA 5B1AB 4YSQA 2XX1A 4E9SA 3NJMA 2PPDA 2XXGA 1JXFA 2ZONA 1IC0A 1ZDQA 3X1FA 4HIPA 5I6MA 1RZQA 1SDDA 1NIBA 4YSTA 1ILUA 5F7AA 4M3HA 3SBPA 1SHWA 2FQEA 1JXGA 1SFHA 1ZIBA 1E5YA 2BP8A 2H47C 2QDWA 3S3CB 3UAEA 1ASOA 1J9RA 2MRYA 2ZXWB 3CG8A 3ZDWA 2J56A 1L9TA 4DPBX 1L9PA 2BP0B 2AANA 3FU9A 2IDQA 3FS9A 4BXSV 2GBAA 3QJRB 2YAEA 4WKXA 3FPYA 3IE9A 1E30A 3EH5B 3S8GB 3V9CA 4UF7C 5B7EA 2YAOA 3AG1B 2CAKA 2FJSA 1FA4A 4AI7A 1HAWA 4BWWA 4A66A 1DYZA 2UX6A 3X1BA 4AKPA 4CSPA 2FT7A 5I5JA 5I6OA 1TKWA 2YAHA 3CVCA 5D4HA 1JZEA 2BP0A 1AANA 3FQYA 2PP9A 2VSMB 3FT0A 3IBOA 3PXLA 4CSZA 4F7KA 2AZUA 4DP1X 1IBZA 2FQDA 1A65A 2PPCA 2TSBA 9PCYA 1NDTA 2IAAC 4FAAB 3D12B 1AS6A 3NJNA 1NZRA 4KNSA 3DKHA 3FSWA 1AOZA 1FWXA 4KO7A 3X1GA 2QT6A 3JT2A 2I7SA 4GP8B 1X9UA 2GC7C 1B3IA 2XV0A 2VSKB 1NIFA 4E9YA 3ZIYA 4AKOA 1SHXA 2FNWA 4QKTA 3CDZB 3T6XA 2NRDA 2HX8A 3OMIB 4MFHA 2YARA 1AS7A 1GY1A 1NTDA 1BAWA 4UANA 1JOIA 1UATA 1TEGA 2XV3A 5B1JA 3SQRA 3ABKB 4W9ZA 2H5UA 3FSVA 2IWFA 4K9JA 2LLNA 1ET7A 3NSDA 3FYEB 5AZUA 3NSCA 3PAVA 1BQKA 3TBCA 1IKOP 1GS6X 3CDZA 4YSRA 1NIAA 2ZOOA 4DP9X 4Q89A 2CJ3A 2EIMB 4HAKA 1JVLA 3X1EA 4E9TA 3FSZA 2J57A 4YSAA 2FQGA 4DP5X 1SF5A 3BVDB 4KOCA 4TXVB 1ZV2A 4BK5C 1XB8A 5D4JA 1ET8A 2QPDB 1PAZA 4YSDA 4ZK8A 1CYWA 4HCFA 2CALA 2J5WA 1L9SA 2HX9A 3U25A 4YSCA 2XWZA 1M56B 1AIZA 4KO9A 3AY2A 3DIVA 3GDCA 2OJ1A 3ZX1A 4N4YB 4DP8X 1WS7A 2CBPA 4HHGA 1PF3A 3S8FB 1A3ZA 1SFDA 2RACA 3FSAA 1NWPA 3NJLA 3NJHA 5PCYA 5I5MA 4ENZA 1V54B 3NSYA 1R1CA 1PCSA 2Q9OA 1ID2A 7PCYA 1YLBB 1WA1X 1M57B 3OM3B 2FT8A 3PLYA 4E9RA 5B1JC 1QLEB 2AZAA 2P80D 2XX0A 2FQFA 1PLAA 1ZDSA 2YAQA 3QJUB 4DP0X 2XYBA 2VW6A 1CYXA 4A2FA 4F2EA 2BWIA 3DTUB 4BWUA 1URIA 4G7QB 5PAZA 1A4AA 1VLXA 3CVDA 4YVNA 2DY2A 2I7OA 2IDSA 1MG2C 1ADWA 3UACA 4W1TA 3CVBA 1JERA 4G72B 2DV6A 1CUOA 3PAUA 3N2JA 2GSMB 3N55A 3TA4D 2GC4C 3PPSA 2DWTA 2Q5BA 4F2FA 4KOBA 3QJVB 3AG4B 4P5RA 2EINB 4AKQA 2UXVA 5TK4A 4A67A 1OOWA 1WA2X 2XVBA 3S3DB 1GSKA 4JHUA 3IN2A 4YSEA 2VM4A 3FYIB 2DWSA 4YL4A 4EF3A 2J55A 3ABMB 3ASNB 1JZJA 2HX7A 1BQ5A 2UXTA 5A7EA 2BZ7A 3BQVA 2JXMA 2MTAA 1BEXA 2Y69B 1E65A 1W8EA 1N68A 1WAEA 2PPFA 3QPKA 3PAZA 1X9RA 1EZLA 4GP5B 3EH3B 4BDVB 2E86A 2W8CA 2QPEB 4KNUA 1ASQA 1RZPA 4YSOA 1GY2A 2IWEA 1OF0A 1AG0A 3T6ZA 1EHKB 2UXFA 2TSAA 3NJJA 4DP4X 3NYKA 4GYBA 1JZFA 1MZYA 1ET5A 3QJTB 2XLLA 2CUAA 1AACA 2PCYA 3NJFA 1OCOB 2VW4A 4BDVA 2GI0A 3GXUB 3WKPA 4JKNA 4JHVA 4RH4A 2YXVA 4GXFA 2IH8A 1CC3A 3T6WA 3FU8A 1GYCA 1KYAA 1MG3C 5I6NA 4YVUA 4A2GA 1W6WA 4DPAX 1W6LA 4HALA 5TK2A 1AS8A 2WO2B 3WNIA 1A4BA 4AZUA 5B7MA 1L9OA 2X88A 2IH9A 3FPXA 1V10A 2HLEB 5B1KA 4UAHA 3HB3B 4BWTA 2IDFA 2WSDA 1KBWA 2GB2A 1E67A 4QLWA 1J9TA 3NP4A 4PCYA 2FTAA 1SF3A 4Q8BA 2HXAA 1ETJA 5D4IA 3UGEA 1ZIAA 3OQRA 1KBVA 1PZCA 2BHFA 4HCGA 1AZUA 1AZCA 1SJMA 2AFNA 2VW7A 1PNDA 2OV0A 3T71A 2IWKA 3PCYA 4E9QA 1CURA 4AX3A 2H3XC 5LDUA 5B1BB 1KCWA 3WG7B 5AFAA 2BW5A 3WI9A 1RCYA 2PP7A 4P5SA 1AAJA 1TEFA 4DPCX 1BYPA 3AZUA 1HAUA 4HZ1A 4A68A 1KV7A 2VM3A 2GIMA 1ASPA 5FC9A 2XUWA 3S3BB 3X2QB 1KGYE 1NPJA 1BXVA 1PZAA 3HEIB 1JXDA 1V55B 1L9RA 3UADA 2W88A 4E9VA 3TBBA 1J5CA 4PAZA 5B7FA 3G5WA 1AQ8A 1QHQA 1DZ0A 1IUZA 3ASOB 1XB6A 2A3TA 2EIJB 1NINA 3NJGA 4N8UA 1PY0A 1XMEB 1NPNA 4NB7A 1XB3A 2BZCA 3QJQB 4NERA 3TASA 4L0PB 4BXVA 5I5IA 3AG2B 3KW8A 1FFTB 1WA0X 1KCBA 3NJKA 2BWDA 5ANHA 3X1NA 1BYOA 1GR7A 2EILB 3H4HA 1AZRA 4WTQA 5I6KA 2XU9A 1WS8A 2DYRB 1AR1B 1OCRB 4HCIA 3SBQA 1PZBA 2FT6A 2WO3B 3IN0A 4G70B 2PPAA 4A2HA 1A8ZA 1T5KA 3H4FA 3CZUB 2B08A 3WIAA 3KW7A 3WNJA 3WKQA 1L9QA 1JVOA 3MBWB 3ABGA 4G71B 3QJSB 2BO0A 2Y1AA 1JZHA 1J9SA 5EHFA 3UAAA 2JFCA 2GHZA 2N0MA 3FU7B 1OCZB 1OCCB 1NWOA 4KO5A 2UXGA 4G7SB
chains in the Genus database with same CATH superfamily
2WKLA 5KTEH 3HS8A 3ULVD 2A74C 2Z4QA 4K7PL 4PJ8A 4U4IA 4PRNB 1DSYA 5TDOB 2X10A 5HD8D 3TA3D 1C5CH 1RURL 3PGCB 4N8VB 4X6FB 4AZ8A 1A5FH 3UO8B 3BUBA 2BY1A 4Y5VC 4PJ9B 1HI6A 2G3XA 3H2WA 4MXQC 4NAQA 3WENA 3GSQB 2A6IA 3GSWA 4YSUA 4WNQB 5ICYB 2HVKB 3NABH 1B2WL 1F4XH 3ESVF 2PLTA 5AKRA 4JFHD 2CGRH 1Q9OB 3ATFA 5HHMB 4RSVA 1S9VB 4IRZA 5TDOA 4PRNA 5FF6B 3PGCA 1JGUH 2YKKA 4N8VA 4X6FA 3BIBX 2X4PB 2GHWB 3G7TA 4DFIA 4J3WA 4PJ9A 4TNVF 1ODUA 3SO3B 4JPIB 5CJ8A 1WVZA 3IJEB 5FWQA 5KBLA 3MLSH 3GSQA 3MFGB 3MLVH 1W8NA 4WNQA 4NN7B 5TQ2H 2HVKA 4XWOD 4AJVA 5ICYA 1XF5B 4ES9A 2OR8A 2ID5A 1Q9OA 1E2ZA 3IT8D 5HGGS 1S9VA 3LMJL 4GO9A 4YNYB 3CN1A 1T0OA 5FF6A 4OGYL 3OD3A 2FECL 2X4PA 1UACL 1P4IL 2EIKB 2BIIA 3B2UC 5IJDC 2E9JA 1A9EB 1NICA 3UIYA 4JPIA 4WWOA 2IALB 1PLCA 6PCYA 1Z5HA 3IJEA 4W9GC 5TPWL 3T0DA 3UPAA 5D2NC 1QEWB 3QG7H 3QXUA 12E8H 1XF5A 3LAFA 5K59E 1HL8A 3A23A 1DO6A 2V6HA 2KZKA 4YNYA 4PJFB 4AEIL 3EO9L 3JWNC 4HSQA 2JLLA 3V4PL 5I1HH 3MOAL 5ESQB 2DM3A 1HEHC 1A9EA 2ZAGA 5FGBA 3OMNB 5DLLA 2IALA 5GIRB 3EF4A 4PS3A 1OK8A 4YX2L 3RYMA 3DK2A 1QEWA 1R46A 5I6LA 5B38G 3N42B 1R5VB 2X2UA 2W07B 4KKZA 2K8MA 1JPTH 4MX7B 2YZ1A 1HL9A 4ODUB 4BCXA 2ICEC 2WPGA 3N06B 4JMNA 2VJXA 1MIEH 4PJFA 4P5TD 3OZ9L 1N10A 3CC1A 4JQVC 4JO8A 2DM4A 2Q76B 4JREB 5ESQA 5EF1A 5EN2B 2BDNL 2DH3A 1KBGH 3SDDD 4ACPA 5GIRA 5A2IH 4R4FH 2QDWA 2W0KA 1OPGH 2ZXWB 3TT3L 3EYQD 3B8SA 5ERWB 2VGLM 1R5VA 1XO8A 2W07A 1L9TA 4MX7A 4AJ0A 4ODUA 3HMXA 4I1PA 4QRFA 4MXVE 3VJ6B 3RHWK 3B1TA 6FABL 4X6CB 1KIRB 1Z2KA 5KS9E 2Q76A 2AJXH 1N19A 5EN2A 3V9CA 1HINH 3KLSA 1U3YA 4ZO6A 2X2HA 3AS3A 4OGAD 4QF1B 4CSPA 3LOWA 2F1EA 2YAHA 3EBGA 3KPPB 4UQAA 5ERWA 4I0CC 3ZTNL 3UGEA 1GYVA 2DEYX 2IGFL 3K72B 2PP9A 3PXLA 3VJ6A 5G4NA 2B77A 1E3XA 1RIUL 3O4OB 1QSFB 4X6CA 4CSZA 1KIRA 3B2PA 4DP1X 1H3GA 4X9FA 4UQ9A 3HKZA 1WFUA 2MKLC 2WMPB 4FAAB 5ANME 3D12B 1TQCC 3TEXA 3W5NA 3H42L 1IBDA 1PTZA 1SLWA 1AYOA 2EDEA 2F53E 3T0EC 3VG9C 2Y7NA 4QF1A 5KS9F 5L4IA 1F90L 5EEUA 3KPPA 2VWEC 4X9YA 1KJVB 5F9WB 3K72A 4ZW8A 1CQKA 1SY6A 2QTEA 3KYMB 4GP8B 1UTDA 1QSFA 1C12B 4Q0XL 2GC7C 3S35H 3KR3L 2C7FA 2ZPKL 4E42B 4KITB 2V0AA 3BSHA 1CD1B 2WMPA 1OAZH 1RZJC 1WLHA 2W0FB 2FYVA 1OF2B 3DJRA 4N3UA 2LW3A 5JDSB 4J6RL 4BV1A 3HE6B 4YHKH 3N40F 3FJTA 4FNPA 1KJVA 3K2IA 2NCEA 1N6QH 1KJMB 2DLIA 1X5FA 3H8NA 3KJ6L 3KYMA 3M45A 2JJTC 5EOCJ 1C12A 2DQTL 3OF6A 3SOBL 4OIAA 5EU6E 1OP3K 1ET7A 3NSDA 4XPTL 4D8PB 4E42A 3NSCA 4YHZL 5IV2B 1CD1A 3QPXL 4NQED 1SJEB 2W0FA 4G5ZL 3JTTB 4I18B 1OF2A 2P48B 3SGJA 4IOFD 5E9DD 2FD6L 3QQ9C 5DR5L 5JDSA 4K15A 3QQ4B 3HE6A 3T4AB 2E4TA 2JWYA 2WOYA 4YSAA 1CS6A 2PWHA 4JRFA 3L5JA 4F15C 1KJMA 3I9AA 5L6YH 4HC1H 1XF1A 5MEQB 3VYNA 2PTUA 1ET8A 4D8PA 1WHPA 5IV2A 4NUPA 2CG9X 5DHVB 5EU3B 1Z1WA 1SJEA 4QPEA 3JTTA 2UYLB 4I18A 4IK6A 1L9SA 2RH0A 2B59B 5C8JB 1WD8A 3S88L 3OAUH 3QQ4A 2C3GA 3T4AA 1J8RA 1NEPA 1RULL 3LCYA 5FYKL 4DP8X 3MXVH 1KTJA 1HKLL 3H55A 1AGDB 2BSBA 4L5FL 2LTQC 5IOKA 5MEQA 1DBJL 3EH2A 4NQTA 2NNAB 4WFEE 2J72A 5HHOB 2IOIA 2F18A 5DHVA 5EU3A 4M93B 3TH4T 4WW1B 1GSMA 4NFBA 2UYLA 2WUBH 4AV4A 1NH6A 2B59A 2XQYG 3NDZE 1M57B 2JKRM 3WJJA 5C8JA 3S8WA 2GQHA 4WNSA 2XZQL 4KK8C 3VQMA 2EUWA 4EI6B 2WXJA 1CGUA 1I75A 5BJTB 1GZHC 2K7PA 3DDGA 3IDXH 4MAZA 1N64L 2XYBA 3HZMB 5SX5K 1AGDA 4JFFB 4JO3L 4BSJA 4PG2A 2L04A 3PREA 4MA7H 3KJ4C 5ISZD 1UA7A 5DJ8B 2NNAA 4G7QB 5C2BH 4TM9A 5HHOA 4WW1A 2FAUA 5SWSD 3CJJA 2BWQA 4JFXB 1U58B 2K4AA 4EI6A 5BJTA 2PKDA 2RA1A 2MPVA 4N20A 4Y4HD 4CBPA 1RZFH 2E46A 3HZMA 4AQAB 1AVAA 4JFFA 2AGJH 3TONA 1QATA 3HAEH 2ZWZA 5DJ8A 3LNGA 4P5KB 1DQKA 4XAWH 4ZMNA 1HILB 4LCUB 1MDTA 1ZLSL 2H32H 4KH9A 1IAMA 3KL0A 1CFMA 1T0NB 5D7JD 1A3QA 1EGJA 1Q1JL 1U58A 4JFXA 1LDSA 2F1BA 4HJJH 4OAWB 2AQQA 1JZJA 2BRRL 3J07A 1HXYB 2D0FA 4UV7L 3O9WC 1HE7A 2V2TB 1YEEH 3ASWA 4KC3B 4AQAA 1A64A 3MGTB 1DVTA 3TLRA 2I9TB 1GJWA 3HC2A 5HDLA 2PPFA 4L1HA 4K5PA 1IM9D 2OULB 4P5KA 4U4BA 3EJPA 1HILA 2QELA 2CWRA 3QJXA 4U1JB 5F7YC 3KYKL 4LCUA 2O1AA 4LRIA 5D1ZC 2R4RL 4LSPL 3RAJL 4PD4K 1TJGH 1T0NA 1UQSB 2W0PA 3AUWB 2ZXCA 3F85A 3QJFB 3BE1H 4L1LA 4NN5B 4P5MB 5CBEB 1CF1A 3WTXA 2DWDB 1G7JB 1I1YB 3GRWL 4OAWA 1PG7X 1HXYA 2WWMD 5F7EH 4KVCH 5INDB 2V2TA 3M07A 4QCIB 3MGTA 1L4IA 1ET5A 2Y23A 4ZMPA 4YLBA 2I9TA 3KWVA 4MCNA 4Z7VE 1P4BL 2AXGB 1IM3B 4L23A 4QHMB 2BIOA 3HN5A 1S2EA 2DWEB 2HT2C 4XCEB 3MRJB 4U1JA 3M46A 3V9FA 1NAMH 3APFA 2Y24A 4MAYC 4NWTL 3O6KH 1TPXB 1UQSA 3QJFA 4RH4A 1IBFA 5CBEA 1L9NA 2JLPA 4P5MA 1P5UC 2WXPA 2DWDA 3T6WA 1G7JA 1I1YA 4G6MH 2X12A 1KYAA 4BUQA 1FRGH 5FYJU 2IVFC 2JH2A 4A2MA 3SHSA 5LCVL 4H8UA 5INDA 2WQVA 4QCIA 4DOHE 3LDBC 3NJXA 4MA1C 4N2BA 4F7PB 2TRYA 2AXGA 5DA4A 1IM3A 4QHMA 4AGPA 3SCMB 5I71C 1C7TA 2DQCL 2DWEA 4XCEA 3MRJA 4BWTA 3JZYA 4BZ2L 2HT4D 3I6KB 1QNZH 4JS7A 4Z7VF 5MI0C 5TFSH 1DBMH 5DMIH 1GPOL 3QXDB 3NCMA 4AE0A 3WFCH 1B4JH 1EAOA 3FT2B 4OFPA 3PYCA 4LPYA 4F7PA 5SV4A 3X14B 2VDPL 2NY6B 4NN6C 4D9RD 3SCMA 1H0DB 5CEZD 1DN0B 1F58H 5AYUH 4PRPE 1HWGB 3H7LA 3I6KA 2P3YA 1YY9D 4V33A 4P5SA 4D3CL 1U8LB 4GKSB 2DM2A 3QXDA 3WIFB 4AWJC 4HZ1A 3VQ1C 1J11A 1JWMB 4QOKB 5JQ6H 4GEIA 3O4LD 1U3HB 3FT2A 4C8XA 1J5IA 1DSFH 3QWNA 2V5YA 4KY1L 3DX1A 1H0DA 1DN0A 5CCKH 1IE5A 3VGAB 4F20A 1I1AB 2Q2EB 3H9SB 2W92A 4OJDH 3L54A 1JJUA 4KXZI 2CGZA 3WHE0 4RAUB 4ZODA 1U8LA 3ASOB 4GKSA 1XB6A 7CGTA 4OZHF 3WIFA 1KJ2B 3WIIL 4QOKA 1JWMA 4NI3A 5EEVA 2J20A 2P5PA 1U3HA 5D1ZI 1P6AB 3BPNB 3VXTB 3ULVH 4CC1A 1PIFA 2VXUL 1TVBB 1JF5A 4P4KB 3QUZD 1K6QH 4WK2B 1N6UA 2B4CH 5ANHA 1I1AA 2P46B 3C08H 3H9SA 2EILB 4OQ1A 3EOTH 2VR9A 1L0XA 4OD3L 4LCWB 1EUTA 4RAUA 4FD0A 1HHGB 1KJ2A 2P52A 3KPLB 5K1JA 3ZT7A 1OALA 2VB5A 4Z1PA 4AMXA 5A2FA 3VXTA 3G6DL 1DQDL 4Q14A 1MI5D 4PJ7E 1CF8L 3DUHA 4HPYH 4B5EA 1TVBA 3MBWB 4P4KA 1M7IB 3EO1B 4EDWH 3N42F 1MCHA 3FCTB 3P1VA 1O75A 1E3ZA 4OKVB 4XMTA 1PSKL 4H8QA 5C3TA 4M4PA 3BH8B 4JO5A 4LCWA 3I9IA 2HVJB 3I9GL 3NJVA 2QQNL 1HHGA 3KPLA 5T33L 2BJML 1JYWA 2XJLA 5AW7B 2QADB 1OCWH 4P2AA 3ES6B 4YBLB 1BEYL 5M95B 3EGXB 2Z0UA 5F0MB 1QSFE 2P7TB 3KXFB 3MBWA 3O3BB 3CBKB 5C08D 3ZGHA 1M7IA 3EO1A 3PNWB 4JHAH 5HVWA 5LLIC 4HS8L 4MJJA 1NCWH 2YC1B 3FCTA 2Y6SC 3KPSB 1JNJA 1UASA 4JFDE 4QGYA 5B3SB 4OKVA 3N1PC 1F56A 2O4EA 2V5SA 4PJ7F 1ED3B 3BH8A 2HVJA 4HF5L 4DP6X 2VJ8A 1RHHB 1RSFA 3ES6A 3SODB 1ECZA 3BP6B 3U9WA 3EGXA 3HMWH 3L2LA 3NT0A 4G6JH 5TQ0L 1HYSC 4J7RA 5DJZB 3ETSA 1ZLUH 3JWOH 2P7TA 3KXFA 3O3BA 2YLKA 2YMXH 3PNWA 1V7MH 3D5OF 5IVOA 2YC1A 3KPSA 4YDJB 1YEDB 1TZHB 4ODVL 2VMCA 1DQJB 2ZSVB 3E0GA 1FDLH 5IFAH 1MQ8A 3HN8A 1ED3A 4NZFA 4CA4A 3QDGB 4R26H 4MA8L 4GFXA 1KPRB 1GS8A 1RHHA 1HWHB 3QRGL 3SPCA 2VLMD 3X14A 3BP6A 5EOCH 5E94B 5B39B 2WP3O 5DJZA 3SPGA 2XIIA 4Y4FD 4CKQA 1X5AA 1WT5C 2EQDA 2R0LL 2A4CA 3EHBB 5AB2A 3CSYB 2HH0H 3LNHA 2HTLC 1OE1A 4YDJA 1ZK9A 1YEDA 1TZHA 2J6EL 1DQJA 2ZSVA 1E8ZA 2BPBA 4ODHH 3QDGA 4OSUL 1KPRA 3NH7L 4X5PA 1OE2A 1WE5A 1JAEA 5E94A 3VXUD 2R69A 4HG4J 2GI7A 2LLLA 5B39A 5TF0A 3EOYG 4BZ1A 2AVGA 2CRMA 4DP2X 3TURA 3CSYA 1DLHB 3QWOB 4CN4A 5IMOB 1P4LB 1XAUA 4H88H 1UFUA 4IRZH 4TF4A 4RMSA 3ZR6A 2B8OT 3OLGA 1F4WH 1RVFL 2YBGA 5EEZA 1NC2B 4ODSH 4LVNC 2ADFL 1ZEAH 4P9HH 4DVRL 4QJ3B 3KM1A 1DLHA 2ZAHA 1T66C 3QWOA 5A2BA 4X8CA 5IMOA 1P4LA 1ZLVK 2H47C 1KXQA 1PLGL 3ZYJA 4OUUB 2NNRA 5F96L 3CG8A 5E2WL 2J56A 4MQTB 3ARSA 4RFOH 3DOHA 3SOTA 4LPCA 1NC2A 5BZWB 1E30A 4N85A 1YEGH 4JFFE 4H0IA 1ZJAA 2O6FA 4U7KA 2O5NA 3PDGA 3AROA 1S3RA 2IJ0C 4ELMB 2CZNA 4LP8A 2VXVL 3GBDA 4OUUA 3RTQB 5I6OA 2PETA 4FQXC 5C0BD 4J23A 4EO5A 5DD1H 3CQPA 3SZKC 3U2JA 1XL4A 5DUPL 4HJTA 4F8LA 1VA9A 1V3MA 3HR5B 3ARTA 4M1DH 3QCUL 5BZWA 1ZLWK 4JCMA 4Y2DC 4DK5A 1WWBX 3FQXB 4AK1A 4OZIB 1F4AA 3DOSB 4NPKA 3ZKMC 4H26B 4ELMA 2AAVA 4TQ8A 5ADOH 1XF2B 1Z7JA 4QRQB 2P5WE 5GS2D 3RTQA 3FSWA 1O7SA 1AOZA 3TVMC 3VNZA 4WTWA 4JM2F 4HD5A 1HL4A 5F72S 2X28A 3HR5A 5C86A 4KMTL 1NC4B 3WBDA 4UDTB 3FQXA 3ET9F 4OZIA 1HZKA 1SHXA 3DOSA 1MCPH 1CDUA 2DWXA 2OSYA 4H26A 1HXKA 3UBXB 1XF2A 2J1KA 4QRQA 4F91B 3GNMH 4KI5C 2OZ4L 3VH8B 1WISA 4X4ME 1TYEB 1JPEA 1AE6L 4NIKB 4PLNC 4OV6F 1OTTC 3Q2LA 5AOIA 1A3RH 1NC4A 1CFVL 2F0CA 4Y4KC 4QLRA 4UDTA 4ATWA 4UQBA 5D7LB 3ZHLA 3L1FA 2ESVE 5AW3B 1LQBC 4X83A 3UBXA 1I8AA 4PTTB 2AP2A 4H25B 3RWFB 5DWUH 4KDVA 3VH8A 2HVBA 1U4FA 2AK1H 1QLRB 4FADA 1EHNA 3S37H 3T8VA 3QA3B 4BK5C 3US0A 1EBPA 5D7SH 3RNKB 1UUSA 5D7LA 3HUJF 2Q3XA 2P1YA 2YGNA 3GS4A 5DO2C 5AVZB 3F7RA 4PB0H 2J5WA 1RMFL 4LOFA 5EO9B 1CLYL 2FHBA 4PTTA 4H25A 3RWFA 4DUWA 1SY6H 3L2NA 3IDIB 1IB5A 4IRJD 4FN0A 1FO0H 3ZX1A 3CTTA 1QLRA 4OLWH 1MFBH 4X0KB 3OKLB 1A6VL 3QA3A 1QTYT 2NW2B 3RNKA 4A7QA 1BM3H 1V54B 1Z0MA 4M6OL 1ZTXE 1T80A 4EPSA 4L8CB 4OQTL 1RIHL 2XQBL 2VXTL 3AJ7A 5EO9A 1TQBB 3FT3B 4K55A 2QL1A 1GC1L 3IDIA 3BVTA 3T04D 3RX5A 4Z95H 4B27A 1BVZA 3MBED 4QOKE 4X0KA 3OKLA 3EDFA 3G08B 4K07A 1ACZA 1JPSL 4OGXH 2NW2A 3QFJD 4GRLD 1EXHA 2X4TB 4OLXH 4YVNA 1IT9L 1NUDA 3S5LB 2NY1C 4WEMB 1YG9A 5D70L 1DJIA 3ZRCC 4L8CA 3P0VH 3E8UL 4BKSC 1NLDL 4RLDA 3FT3A 3H9SE 1PZUB 4JG1H 5IWLA 1OAJA 1BQUA 3ARDD 3CSTA 5JZ7C 4UNVA 3OGOE 5H37A 3UBHA 3G08A 3SDAD 3JWDL 2XI9A 2I27N 3MLWH 4NUJB 3VWKC 2X4TA 3PV6B 4XCCH 5L9DL 3B3BA 3S5LA 3AITA 2IEPA 3EXJA 3HE7B 3UTOA 1O7DE 3IDNB 4JZJB 1EFXD 2R0KL 4XPHH 3U9PH 2HKHH 4LCWE 4PV8B 1CB4A 2NQ3A 2UXTA 1KB5B 4XVOA 3WKNA 3UX9B 1OL0A 4JGJA 2QSVA 5DHVH 4AXWB 1N68A 5T3ZD 4PS4H 1PIGA 2BVUA 2IBZX 5FGCB 3MUJA 4OI7A 5J1TC 4NUJA 3PV6A 3VXRE 1LO0H 3HE7A 3TYGH 4P07A 2BNRE 1QI4A 3IDNA 5AAWA 2BVTA 4JZJA 4FRWA 2XQYK 1U36A 3CFEB 2Y5TB 4Y16D 1S7VB 1F3RB 4PWIA 3QHZH 4PV8A 1KB5A 3FB8B 5F71A 3NJJA 5AW1B 1UCTA 2ADGB 4AXWA 1E27B 2WIIB 2ZUSA 3KEDA 4BGDA 2MNJB 3KXFE 3LB6D 4QNPF 1R0AH 5DJDB 5L8KB 3RVTD 3KPSE 4KDTC 1WGVA 2YXVA 3CFEA 1A6PA 2Y5TA 4APQB 3EF7A 1S7VA 3T0WA 5CGYD 3FB8A 2XZZA 4LP4A 5FR3A 4W9FC 5LHDA 4N0FB 5FYJD 2ADGA 1ZSHA 4YDKH 1E27A 2WIIA 3X11B 4CNIB 1Q0XH 4J3OH 4ALAH 3FPXA 1V10A 1DFBL 2HLEB 3X17A 3ZYIA 5JMOC 3HB3B 5DJDA 1FHGA 2XN1A 4LHUG 4X5LA 2G3MA 4PCYA 1SF3A 4OBRA 2VDQH 3I74A 4WAFA 5F3FA 5LGHL 1G94A 4APQA 1VZGA 4PVLA 5C2UB 3OPZH 5I1AB 2EDMA 3QDGE 1YMMB 3O45B 4N0FA 3TCXA 4ZOAA 2A74B 3X11A 4CNIA 2JKJA 4M03A 4XTRC 4LAQH 3SDCC 2H3XC 2CO4A 3EKCA 5B1BB 2BLFA 4M61B 4Y5VB 2Y5EA 4LSQL 5AVRB 4NZRL 5AVQB 3CFBB 1AAJA 4XN5A 4M43H 4BHUI 4RAHA 1CTOA 1XCQB 3AZUA 4DGIH 5I1AA 1ODAA 1YMMA 3O45A 2EDNA 2VAAB 1TLMA 2YUWA 2A74A 3ZL2A 4ODWB 5CLTA 4EN3B 3WN6A 1N12A 4M61A 4Y5VA 2ZUTA 2YD3A 1X3DA 2W9EH 3L8QA 3CFBA 3C5ZB 1I3UA 4B9CA 1KXQE 2GJJA 1XCQA 1GAFL 2ZNWA 3P54A 4NKDB 5AVTB 1NBYB 3R8QA 4YHOL 2QSTA 4TVPD 2VAAA 3H3BC 2XJKA 1H9VA 1AKJD 4ODWA 4MKTA 4L0PB 4EN3A 3TF4A 4HS3B 4QKXB 4B7IA 2XPZA 4MS8C 4NNYB 3C5ZA 5IEKB 4NZJA 5D2NB 5LO7A 3N9GH 1URLA 1PZBA 3Q48A 4NKDA 1NBYA 3LKOB 1T5KA 2C9XA 3KW7A 5C0JB 5MHSD 3GTNA 5DFWH 5J6GB 3WDIA 3D4GA 3UO1L 5DMYA 3NCFB 3SGDI 4DK6A 1QBMH 1PZ2A 3CPUA 4HS3A 1GGCL 4PLOB 2R29A 1KT2B 4KQ0A 4NNYA 2X44D 4ELME 5IEKA 1OCCB 3OKYA 5I73C 5D2NA 2PYFB 5D8JL 4K5OA 4AQZA 4DW2H 3LKOA 3O8XD 2RBLA 4G9FD 4NUGH 5CM1A 2ICEB 4R5VA 5C0JA 1I8UA 5J6GA 3RGVD 1GS7A 2H2SD 1WICA 4EQ2A 1A7OH 1F6AB 3V6OE 1GJUA 3KM2A 1NAKH 1NKRA 4OZIE 4D9RE 4F92B 1KT2A 2XTJE 4OKDA 3DHPA 3QR2A 1KYUA 1CLVA 1JZIA 1LE9B 1I4FB 1U30A 3NCCB 3QYCA 2PYFA 3BIAX 3VG0H 2XYCA 5TE4H 2UY7B 3RZCB 1ILSA 5L7XH 5INCB 2ICEA 1ZY9A 4ELMF 2F54E 3BMWA 3HW7A 3IRPX 1IBGH 2JELL 4KWUA 4JQVA 5I8EB 1VB9A 1F6AA 3VD9A 3CZJA 3CVHB 4FNLH 4WFFD 4ZW5A 2GJ6B 2XV2A 4Y2OB 3ABLB 3E3QE 4GSDL 1RJLB 4WWKC 5CNHA 1EJ8A 1LE9A 5TE6H 2WYHA 1I4FA 4WFGE 3HC0B 4JB9H 4Z8FH 2UY7A 5GXBB 3RZCA 2O6CA 5E4IA 3VXSB 3F7QA 1IBYA 3QB7C 4G2AA 5INCA 1DJHA 1GGYA 4CGTA 4RMUA 1QFHA 3S36H 4MXQD 4DGVH 5I8EA 3CFIC 1P4UA 3LIZH 3CVHA 5IQ7L 2NUPB 2GJ6A 1MY7A 4P48A 3IS1X 1I3RB 4JY5H 3L08A 4Y2OA 5D7LE 3HPLB 3AVEA 1RJLA 2PNDA 1MCLA 4H40A 4M4RB 5GGVY 3O3AB 4ZXBC 3DTXB 5IBTL 3CN2A 2I25N 3HC0A 4WI9A 5A2KH 1XHHA 3U1QA 1DQLH 3D2TA 1AD0B 1IAKB 1VIWA 3MLRL 5DHYB 3GSRB 3VXSA 2YUZA 1BQRA 1MZZA 4NAMA 4A2DA 2VJ0A 2UUDH 2XTSA 3IDUA 2VZ3A 4O58L 2NUPA 4XWGH 2O6DA 4JRXB 3VSVA 1I3RA 2QLYA 3HPLA 5JLZB 3PP3H 3BPLC 4M4RA 2B20A 3CFDB 3O3AA 5DHEA 4YOKA 3DTXA 4WJG3 4LZKA 1IGIH 2BFVH 2V3EA 1AD0A 1IAKA 3GTVA 5DHYA 2PPDA 1JXFA 5HYJE 3GSRA 1MW3A 2EXYC 1YNTB 1NIBA 2YD7A 3EJSA 5KTEL 4M3HA 4HJ0D 4DNLA 4OIBA 3TBTB 4JRXA 1IFHH 2FQEA 5JLZA 2PW1B 3NK3A 4EUPB 3CFDA 1T2XA 2J5LB 5CU9A 1UH3A 4QTHB 4PCKA 5LBSA 3DVGB 4KY2A 5HI3C 1KWGA 4WWID 4X50A 3NABL 1L6ZA 4BXSV 1F4XL 2YAEA 2EDBA 1FYTE 2JJTA 1YNTA 4AG4L 2CGRL 2X1WL 4HULB 3UC0H 5EWIH 4WK4B 1AC0A 4UF7C 5B7EA 3AG1B 3TBTA 2CAKA 3GSOB 4GAFB 2PW1A 1JGUL 4QRRE 4EUPA 1VJSA 1DYZA 4YHNB 3TWYA 2FT7A 1W2KT 2DQDH 1T6WA 4P3CH 4QTHA 4LSRH 2R69H 3DVGA 3MLSL 1AANA 3IPBA 1JGVH 2VDNB 1RXLA 3GS0A 4OM1H 4Q9BA 5E8EB 5DD5H 5TQ2L 2NXZD 1N18A 4PTUB 1G6VK 1QAWA 1CVSC 3LRKA 2CM6A 2LTQB 4ZOCA 3WO3B 5BRZB 2ATKB 4J28A 1XCTB 3GBNH 4FFZH 5DUJA 3QIUC 5ABAA 5D72H 2VKXA 3GSOA 1G7HB 1JCKA 1QRNB 1Z5LB 4FP8L 5TTRA 1ZHLB 5D1XE 4N5EC 4YHNA 3T3PB 3MJ9A 2OTWB 3VFTB 3MJWA 3W5MA 2F8XC 4OGQC 3AS0A 1OGAD 1VEOA 2NTFB 5I0WA 2C8NA 4HISA 4FTVE 5E8EA 2WCSA 3SO5A 3QG7L 3WE1A 1X9UA 5F9OL 4PTUA 1CCZA 12E8L 4JG9A 3EGDB 5BRZA 2ATKA 3KJ4B 1OWWA 1XCTA 2YBRB 4IOSA 4AKOA 1IMHC 1J7VR 2ZF9A 4CUCA 5BZDB 1G7HA 1QRNA 1Z5LA 5I1HL 1TFHA 1ZHLA 5F7FA 3UTTB 1VAHA 1T7XA 1NCAH 2OTWA 3VFTA 4C4KO 2N0KA 5I0DA 1V3LA 2NTFA 2ZCKL 2BOBB 1GZHA 3UTSE 2GY7B 1T1ZB 1DQVA 3TJHD 1VESA 4XO8A 2IWFA 4AITA 1JPTL 3EGDA 3T0ED 3FYEB 1NCTA 1XX9C 4LASL 2JI2A 2YBRA 3Q6FB 4PJEF 4N1HB 4FG6D 4PP1D 2ZOOA 4NGHH 1NOFA 5BZDA 5ADPH 2IQ9H 4Y19E 1EK3A 1DANT 4HAKA 5EUKB 3UTTA 4B41A 2QGEA 1RPUA 4HIEB 5BZXA 4AUYA 3BOVA 4MA3B 3CXDH 2WLJA 1NCBL 4G6FD 4R4FL 3HAEG 2BOBA 2ZUUA 3U83A 2OZNA 1OPGL 1T1ZA 3B56A 4PUBH 3O9WB 1KLFB 3D0VB 2EABA 2G30A 2APXA 1ZVYA 1HVXA 4OB5H 3W0WD 3Q6FA 1RI8A 1JYVA 3G5ZB 2EC9U 5E2TH 3AXLB 5D1ZB 1WP6A 2XWZA 5EUKA 3HG4A 1BJ8A 4HIEA 1HINL 3DIVA 1JRHI 5DXWA 4MA3A 4NUMA 5KSUB 4XN7A 1UXWB 5TJWK 1BAGA 4MWFB 3Q8AA 1DVQA 3MUGB 2AEPH 4X7EC 3WMQA 1MCOH 1YMME 1X5MA 3WEOA 1CDIA 3O9WA 1KLFA 3D0VA 5JIQA 4UQEA 1PF3A 2AW2A 1SOQA 3AREB 3ZRFC 1C9SA 1RZ7H 3EJCA 3ZW3A 1NPUA 4GRWB 1NCIA 5K5YA 1FG2B 1H8LA 3G5ZA 2EDRA 4ZMXA 7PCYA 3WTVA 3AXLA 5D1ZA 4B9ZA 2CCLA 4YLCA 3CFQA 2BCKB 3NEEA 4LK4A 5KSUA 3BO8B 1P5UB 2XFGB 1UXWA 3PF2A 4Z3FA 4QJ4B 4MWFA 2J4WH 3MUGA 1U8JB 2DMGA 1TXKA 3MV7B 4F80A 3CZKA 4Y1TA 3CMGA 4GIAA 3MXWH 5AW9B 4MA1B 5T3ZH 3AREA 5I71B 1FG2A 3QFDB 1PZ5B 3S35L 1XV8A 4BFRA 3HG0A 4HFUH 1OAZL 5MI0B 2BCKA 4ZTOH 3SDYL 1XTLA 3BO8A 4GUCA 1P5UA 4NRYB 3LNFA 3LRMA 4X8JB 5IB2B 1YYLH 3FH8A 5E9AA 2CR6A 1U8JA 2IFFH 3CLFL 4YHKL 4ZBJA 3MV7A 4DQOH 2EZ0D 3KDMB 4AGMA 2ZKYA 3F83A 1N6QL 5EU6D 3J2PA 4KK8D 3GXFA 3QFDA 4NWUH 1PZ5A 5I8OH 2VTFA 4NFCA 4AC4A 2R2EB 1RUAH 2ODHA 2GSGB 1VHPA 1TTRA 1NMBH 4YL4A 2AQNA 4NIYE 4NRYA 5D2NE 4X8JA 5DEFB 5IB2A 5A7EA 4ZYKB 1UYWH 4ODTL 1WH0A 3TF7C 1FIGH 5GPRA 4EXKA 1LJMA 3MNZB 2VDOB 3KDMA 4K9EH 3QPKA 4NKOB 3H0TB 5CKGA 1VF5C 2CDGB 5FYJH 3ARUA 4B3EA 3HLKA 3DV6B 3JWNE 3CX2A 4HC1L 1SM3H 3QXTA 4X7FC 2Q6WB 2MNUA 1BA9A 2R2EA 4U0RC 4ZX6A 2GSGA 2A9AA 3MUUA 2NY5H 4N0UE 3WLBB 1FPTH 2PWGA 4FYQA 1ZXQA 4K23H 5J4MA 5DEFA 1K4CB 2UXFA 2ZKMX 4ZYKA 3OAUL 5JW4R 4JNXA 4RRPM 3KH4A 5DJYB 2WVVB 2BXZA 3MNZA 3TEWA 3K4ZA 4NKOA 3H0TA 3MXVL 2CDGA 1AD9B 5HBBA 1U91B 3DV6A 4R7XA 5F1IB 2EVFA 2EECA 2PCYA 4WFED 1XZ0B 2Q6WA 5D2LB 4JPKH 3RX9A 2GY5A 2F8OA 1SXCA 4WHTB 2QGBA 3SYCA 5H37H 3L5HA 3WLBA 2XIDA 2WUBL 4C47A 1GYCA 2EO1A 1K4CA 1MG3C 2VOTA 1CDYA 1S7TB 2XRAH 3AU0A 5DJYA 2WVVA 1L9OA 1JGLH 4M7ZB 5E0QA 2X3AA 4ZMQA 1AD9A 1U91A 5F1IA 1F42A 4HAFA 4BINA 1XZ0A 4P3WA 4I8DA 1J10A 5D2LA 4MA7L 2GJ6E 4Z78B 1T2QH 5CD5C 3E9TA 4GXUN 5C2BL 4WHTA 4L3EB 4OLVH 3GXNA 3M7FB 4Z3GA 1WIOA 4OCMC 1PZCA 4XCNB 2Q8AL 3WOVA 1S7TA 3UZEC 1AZCA 1PKQE 1QUNB 4HGKC 1AQHA 5IBLD 4MAYD 4L29B 2ITEA 5EU7C 1RZGB 1QX1A 3RY4A 4OCXH 1E4KC 2AGJL 5CGTA 4IKNA 3T3MB 4Z78A 4RMQA 2C34A 4XAWL 1KB5H 5FM4A 1M7DB 4L3EA 3M88A 1NGPH 5FLUA 1MCIA 1KN4L 1HAUA 4LEOB 4XCNA 5BMFH 4WTZA 4GBXC 1A14L 1NFKA 1BIIB 5F7HA 1QUNA 4AQ8C 4NQXB 2DMHA 2IPKB 2XPGB 1Q9KB 4L29A 3CN0A 3HEIB 1RZGA 4I0KA 1YEEL 1E2VA 1L9RA 4R6UA 2WLIB 3QZNA 4UU9B 3ZHDA 4PWKA 4F37F 4FLRA 1M7DA 35C8L 2A0LC 3IK2A 4QHKI 1CLOH 4LEOA 4MZ2A 4U1SB 3GSXB 1CGYA 1P84J 1T1WB 1BIIA 4FFYA 3SE3C 1B4LA 3MKKA 1V05A 4NQXA 2IPKA 2XA8H 2X3BA 2XPGA 3QJQB 3QARA 1Q9KA 2AXFB 4M8QB 1AJ7H 1ULVA 4NERA 5F7EL 4KVCL 1GH7A 2VXSH 4MQSB 1FSKB 4JRLA 3HZKB 3OKNB 2WLIA 3MRCB 4UU9A 1HESA 3TZVC 1S9WB 2X6UA 2WWKT 4P8QA 4F9PC 3E38A 5IFHH 4UNTA 3PL6B 2H0JA 1CGWA 5D6DA 3FF8A 3O6KL 4U1SA 5LAXB 3GSXA 3H4FA 1T1WA 3BGMB 3T0BA 2WBKA 1L9QA 1JV5B 5J11C 2AXFA 4M8QA 4UT9H 3DECA 4RGNC 3D3VB 4X7DC 5FO9B 1B0RB 3HZKA 3OKNA 1RUPL 4PRHD 5DT1L 4RVBA 3MRCA 5EHFA 5D1QC 1S9WA 2H4EA 3TT1H 3CZNA 4KO5A 3L3OC 2CJUH 3PL6A 4RWHA 5LAXA 1NUNB 2NNCA 4PN6A 3BGMA 5F7DB 5TFSL 1VCAA 5IHLB 1DBML 2ZYSA 2ADIB 3MRBB 5DMIL 1JV5A 2BOLA 3ERXA 4PJCE 1V8HA 3WFCL 1B4JL 2NZIA 5GGVH 3D3VA 2WNXA 3QIWB 5FO9A 1B0RA 2V5RA 2X0UA 3N91A 4PVMA 1Q0YL 4G7RB 4PRPD 1M3JA 2X4UB 3DETC 1FGNH 4Y88A 2XA3A 5KVFE 5CILH 2DIJA 1F58L 5AYUL 3PHSA 2X6MA 4OT1H 2I85A 3T3PE 3IGAB 3WV0A 5HYQB 2H2PD 2XN9B 4XC3H 3GO1H 3PJSB 5F7DA 4LXFA 3VB8A 3MRBA 2ADIA 3B6SB 4KTYA 5I17B 1VADB 3D85D 3VXMB 2CHNA 5JQ6L 1CFQB 3OG4B 2E56A 5I74C 2AF2A 3N44F 3QIWA 4KHTH 3LNEA 3KE0A 1DSFL 1PU0A 4NP9A 4FABH 4A7SA 2X4UA 1DR9A 3JWDC 4PJCF 1JZ2A 4O2EB 4ORZC 1KB3A 5CCKL 1XVSA 2IAMD 5DLMH 2BK8A 2N7SA 3D52A 3IGAA 3DYPA 1BVKB 4FQXB 4MLIA 5HYQA 2XN9A 3MJ7B 3PJSA 5E7FA 3TPUB 2GW5A 5I17A 1WYJA 3B6SA 1VADA 2JKWA 1TJIH 1B0GB 4A2EA 1B90A 2R29H 3VXMA 1MPAH 1CFQA 1QZNA 1N70A 2YRBA 3ULVL 3C2AH 3ULUE 3UGUA 1AR1C 5M7QA 3D08A 4O2EA 5AYQA 1K6QL 3VACA 5KVEH 2FSEB 4YSPA 3WY2A 2J88L 1E4JA 3K6NA 4FQXA 3C08L 1BVKA 1RD6A 3EUUA 3EOTL 3MJ7A 1NIDA 3TPUA 3ZZSA 2W1NA 4L1SA 4XVTH 3VW3H 1B0GA 1MHCB 3B7RL 3UEZA 1OB0A 1U0QA 2X40A 3FAWA 4MNQB 4AJYV 3L16A 1JI2A 2IC2A 1AG6A 3B9DA 5JYLA 4HKXB 2FSEA 2V4LA 5KUMA 1E4XL 5SWQB 1AP2B 3UTPE 1ZVSB 3T8XB 1ZDQA 4GLRI 3ULUF 4C55A 4ECNA 5CJXC 5EEXA 1J5HA 2WXFA 2Y1YA 1MHCA 1GIGH 4MNQA 1HIMH 1OCWL 2Z8VC 5EZIH 3SBPA 4Y4KB 3QUMB 4IRSD 1ADQA 1AGEB 1WF5A 4HKXA 3AY4C 4JFDD 1EERB 2LAAA 3PPEA 5SWQA 1FNSH 1AP2A 1ZVSA 1UA6H 3T8XA 3QI9C 2YFOA 4HZAA 3HZYB 3UAJD 4DUVA 2Z7YA 3FS9A 4K0OA 1S5IH 3IE9A 5E24E 2XV6B 3GI8H 4QXGH 5HJ3B 1TO5A 3IFLH 3DHJA 1MCSA 5T5NF 1PDKB 4C57C 3S8GB 4Y4KA 3HMWL 3S3PA 4BIKA 4LLDB 3QUMA 2XKNB 2CBOA 1AGEA 3JWOL 3B7UX 1MH5B 1JP5A 4AKPA 2Y7LA 1C7SA 4JGMA 3T0AA 1V7ML 1D6VL 3MLUH 3QWRD 5T1LD 4P2QB 3VWJB 1E50A 2JV6A 1BFOB 5LBVA 1FDLL 5EH1A 3HZYA 3HOGA 1ZE3C 3D09A 5AVWB 1V7NH 4R26L 4EAEA 1YEIH 2CKNA 4PMFA 5CSBA 4F7KA 1T66D 1U8CB 5HJ3A 4BK5A 2VL4A 1PDKA 3FKUS 5EOCL 1TQUA 1CXEA 4LLDA 4KKLC 2YHGA 2XKNA 1NZRA 3LN5B 4F5CA 4F7TB 4FZEH 1MH5A 3DIDA 4KNSA 2AJ3B 3WLWD 3P40A 2HH0L 3UZQB 4P2QA 3VWJA 2NSMA 5FUCC 1BFOA 4JO4L 4HWNA 4RWYH 3X1GA 2QT6A 3WKMH 5DHDA 4YXHH 4WV1C 2KPNA 3SDXB 2YA2A 4NBYB 1KGUA 4FZ8H 1IAOB 1RZJH 1U8CA 4TLUA 4HLEA 4S10A 3SYQA 3MRHB 3N5AA 2JQAA 3LN5A 2HX8A 3ETBF 4F7TA 4WFHD 5LBSH 1VENA 5DS2A 2XWCA 1JOIA 2AJ3A 4OJAA 3UZQA 3W2DH 3GSUB 3QZBA 2C9VA 4S1RL 2B16A 4Y2DD 3NIDB 2HLFC 3QH3B 5I30L 3WGVB 3SDXA 3A22A 4HJ1A 4FG2A 4IRZL 5LQBH 3P4NB 1IAOA 1O9VA 2LLNA 2EDLA 2YQ2A 4EUPH 4XMWA 3MRHA 3ZKNC 2FUTA 2JIXD 2P49B 4ODSL 4ES8A 2CJ3A 1Z3GH 1ZEAL 2YA1A 3HG1B 1GGIL 3JZ7A 4P9HL 1JVLA 5D2LE 5IB3B 1HTYA 5CLYA 3IPEA 3GSUA 1MLCB 4DEPC 5DMGD 2AK4D 2W60B 3VRJB 3PDDA 2VLKE 3QH3A 2F58L 1IJNA 5KVDE 4LHQB 1GZQB 5GJTH 3P4NA 4RFOL 1PQZB 1WUZA 5D4JA 1DP0A 1QYGL 3QDAA 4CU8A 2NX5D 3BSGA 1IAII 4HCFA 2IANE 4X5RA 5K69A 1YEGL 4A63A 5E1AA 4JM2D 3HG1A 5IB3A 3IMUA 1K8DB 3SD5A 2VDNH 2APBA 2Z8RA 1F3DJ 1OTTD 1QSEB 1MLCA 1NA8A 4N4YB 3BVUA 3VRJA 2W60A 1S7WB 1WITA 2MQ0A 4TUKH 2NZ1A 3B4NA 1RK7A 1E5UI 4HHGA 4MZIA 1GZQA 5DD1L 3FDWA 1PQZA 1AXTH 1OP4A 5C71A 3VD7A 2FHFA 3NSYA 5DVLA 1TNNA 5IB4B 1FFQA 4M1DL 3ARYA 4OF8A 3NQKA 3AABA 1AHWB 5FV2A 1MLBB 1YLBB 4WO4C 4Z0XB 3GRBA 3INUH 5KBPA 3RHWF 3AQYA 4EVNB 3FULA 4K8RD 4XMKH 3T3ME 1K8DA 4BGLA 1AY1H 2ZAIA 4Y5YC 2P5WD 1I8LA 2D7TL 1QSEA 2DEXX 1NCOA 2P80D 3R19A 4LCIH 3RWIB 3U7YH 2FQFA 2V9UA 3QJUB 1F13A 2YA0A 1S7WA 3PP4H 5ADOL 2X2YA 3VRIB 4CMHC 1LO5B 2R9HD 2RAMA 1UEYA 5DO2D 3EOBB 5A2LH 4J3XA 4Z3IA 2ENSA 4IGBB 5E8NB 1ZTMA 3CN4A 2BHUA 2WVSA 5IB4A 3MFFB 1AHWA 4Z0XA 1MLBA 1FNEB 1OGPA 4EVNA 3BCFA 4KDTA 3B9EA 4YIQB 2Z31B 1MCPL 3BAWA 1HNYA 1NGXB 3RWIA 1SMAA 4PRID 4TSBH 5F88B 4J3OG 3VB9A 3VRIA 3GNML 2WINB 1LO5A 3DUSB 4CDGC 3FO0H 3EOBA 5KSAD 4L9LC 2E6QA 5IVXE 4L0ZA 1VFAB 4IGBA 5E8NA 4G7VH 1UT2A 3SDCB 4MQXD 3MFFA 2P5ED 1FNEA 2ESVD 4TLSA 1TF4A 4YIQA 2BSSB 5T8IA 4B95C 2N7BA 2Z31A 3Q01A 1UVQB 1NGXA 1BDYA 1Y7VA 2VT0A 1OARH 5KZCB 4KXZH 5F88A 3ISWA 2WINA 4FMVA 5DWUL 2Y69B 1W8EA 3DUSA 4WGWB 2NY1D 3FUIA 2AK1L 3JXAA 1VFAA 1WFMA 1OT1A 3D3VE 3S37L 3SDCA 1Q1PA 3QC5X 4EE2A 2YXMA 5D7SL 3CFTA 5D9SB 5JZ7D 1U8NB 2BSSA 5IVXF 2KERA 5DD3H 3RB5A 1BZQK 5CEXB 1QUPA 1UVQA 1XMWA 4PB0L 3TN0D 4IDJH 3VMOA 1EAJA 4DF9A 3VWKD 3NYKA 3FK3A 1YC7A 1SY6L 4U1LB 4H20H 4GRWH 1FO0L 4I1NB 1HH9B 3DARA 4X2UA 3UTQB 4P2OD 4WDIB 1MHHB 5CU5A 2Q8BH 4P57B 4HEPA 5D9SA 3CX5J 3CBRA 3QPQD 1U8NA 3Q8FA 4KMLB 1CGSH 1AGBB 5CEXA 4ERSL 4G6AC 4UILL 5AZ2H 4YVUA 1YDPB 2XN9E 3BFQG 2WO2B 3IWVA 3ATEA 1G5GA 4NZDA 4QOKD 4U1LA 4AV5A 1MCWM 1HH9A 1KELL 3QUYC 4Z95L 3UTQA 1BZ8A 4WDIA 1MHHA 3AS2A 43CAB 2CA3A 4OGXL 4P57A 4EI5B 1MJ7H 4B9FA 4DAGH 4OLXL 1MCCA 3B9AA 3GM8A 5I73B 1AGBA 3FZUC 3IFNH 2M83A 2BHFA 3P0VL 4XC1H 5CN1A 4EBQH 5KVMC 5CZXD 4JG1L 2VW7A 1YDPA 3G6AB 3B7TA 1E8YA 4NO0B 2PF6A 3FRPB 1KG0B 4PYGA 3S0PA 4AY0A 3F3HA 43CAA 5AOKA 1UJTA 3ZDXE 5I24A 2F7OA 2KPWA 2ZXDA 2E8YA 4EI5A 3MLWL 4JFSA 4XCCL 2GT9B 4YDNA 4DGUA 1I1CA 1XCWA 4X8XA 3S4SB 3RVXC 1FZKB 2VDOH 1QOKA 3ZDYE 2DI8A 2YN5A 2X89A 3EDKA 3G6AA 3U9PL 3T77B 3ZSTA 4NO0A 2HKHL 5IFJB 5FM8A 3FRPA 1KG0A 2BNQB 3PHAA 5DK3A 2HB0A 1BHGA 1MRFL 1V55B 4MNQE 1HJCA 4XOEA 3VXRD 4PS4L 1CDJA 3CFCH 3T2OA 4AC2A 2GT9A 2BNRD 1IUZA 1S9XB 3S4SA 3UP6A 1FZKA 4P06A 3ZDXF 2WYZA 4XTRD 5DURD 1P9MC 3QO0B 4WUUB 2XWBB 2JI3A 3AWGA 4LKCB 3T77A 4CU7A 5I66B 5IFJA 2BNQA 1E5BA 4ZUUB 1KLUB 1PD6A 2VN4A 1TQVA 3ZDYF 3T1WA 1P2CB 4GEJA 1BYOA 4XP5H 4GI8A 4HCIA 1HZLA 1S9XA 1CI3M 2DQHH 4WENB 2DBLL 4MCZB 2CNZA 1EJ6A 4RMWA 3QO0A 3TX4A 3VFGH 4WUUA 2VLJE 2XWBA 4LKCA 5I66A 2JTYA 4JKPH 3P3TA 4ZUUA 1KLUA 4G71B 4ICXA 4JFQB 5F7LB 3VUAA 4YDKL 4KI1A 1P2CA 3LH2H 5D7KE 4ALAL 5IMMB 2BNUB 2X6VA 3NPSC 3BPLB 1UH4A 1UWGH 4GI6A 5HGDB 2QPUA 2UXGA 1SXZA 3LVTA 3D06A 1BF8A 4LLVB 2QQLH 4MCZA 4P2QE 4Z7OE 5HDRA 2MJWA 4QT5B 2VDQL 4PB9H 2VABB 1BBDL 3A5VA 3VXPB 1J5DA 2VN7A 4G83A 3I2CH 4I0PC 4MS8D 3CHSA 2GJPA 1GW0A 4JFQA 3MREB 3GRWA 3JTSB 3L4XA 4K5MA 3U30C 5F0JB 3T9WA 3X3GH 5HSFA 3AQXA 2CLZB 4KRPC 1F97A 3L45A 1T03H 3EHBD 3QT2A 4H0HB 4LAQL 2BNUA 5DJ0B 5C0CB 4ANVA 5IMMA 5L88H 5HGDA 3QSKB 4YHMH 3WEBA 3BP5B 2GTWB 3BAXA 2Z93B 4LLVA 4GT0A 1OV8A 4QT5A 2VABA 3FAXA 1U8KB 3VXPA 1ZLUK 3QQXA 4Y5XB 4DGIL 4U2ZA 3KCWA 2W91A 4Z7OF 3MRQB 3MREA 2EO7A 3JTSA 4KK9C 3VE0B 2CLZA 2O5XH 4OFIA 1E42A 2VDRH 5LCVA 3I50L 5DJ0A 4FQCH 4HUCA 5C0CA 3Q9QA 1YEHL 1MNNA 3BP5A 2GTWA 1DVXA 2VDPB 1WIUA 2W9EL 2Z93A 3F7YB 1N2RB 3H56A 5LVEA 3QNXB 4KRLB 4BZ2A 1U8KA 4IK7A 1UWFA 4Y5XA 1ZGLB 5F70A 1T7WA 3DHUA 1D9KC 1O6VA 1OSEA 3MRQA 3VE0A 2ZD0A 3LZNA 2JQMA 2X09A 1IX2A 1KCKA 1AZZC 2ZUXA 4M1GH 5C6TH 4F3FB 4J2XA 4MMXC 1GJIA 5GJSH 5HP5A 2VITB 4GNKB 5F7BA 4CSSA 3HG1E 4WW2B 3ARBC 5GS1C 3F7YA 1N2RA 1U92B 1PY9A 2DYSB 3QNXA 2P47B 3QDJB 3MV8B 2Q10A 4L8SC 3EH4B 3N9GL 2ED7A 5TGBB 1IGMH 1ZGLA 1FI8C 4L4TD 4WWKD 5C9KA 4KMQA 2MCG1 4MJIB 4L1TA 3HFFA 2HJKB 3BYYA 3CLWA 4R5TA 4F3FA 4OTXH 5C70A 3TCTA 3MA7B 4NCC2 1QBML 2VITA 3HRZC 1DFXA 1MEXH 1F3DH 3PGDB 4KROC 3CSFA 4MTMA 4WW2A 2Z7UA 4H5SB 4E9SA 5C9JB 5CO1A 1WAAA 5IBUG 1U92A 3LV3B 3QDJA 4HIPA 3BN9D 2VZVA 3MV8A 4ZS7H 3J27A 4PBDA 4DW2L 5TGBA 3WS6C 4B60A 4ZXBD 2GUYA 4OCYH 2VRQA 2YK1H 4NUGL 5EOQH 1DBKH 2GIXA 4MJIA 4PJBF 3AACA 2HJKA 2KLTA 1A7OL 3UAEA 4QY8B 2AJVH 2XTJD 1ASOA 3G6JB 3MA7A 4IU2B 4QXWA 3T5WA 5ID0B 3PGDA 1NAKL 1JV2B 1QTSA 4DPBX 3ECBB 2HUHA 4H5SA 5C9JA 3WNNA 4KVNH 3LV3A 2KDGA 3VG0L 1MVYA 2F54D 3FUMA 5TE4L 5L7XL 3KBPA 1KYFA 4CVWA 4AYEC 3R0NA 4FDWA 4ABWA 3ARFC 1IBGL 1XGRB 4FJYA 4NC0B 4WEEA 1JK8B 4QY8A 3G6JA 4IU2A 4KH2A 4RFNC 1GOFA 1JV2A 5KBNC 4WU5B 2EXYD 3ECBA 1TSRA 3IJYB 2A9DA 4W4OC 5TE6L 2JKXA 2QKIC 5FOBB 4JB9L 1PEZA 4FNUA 4Z8FL 2J44A 2PPCA 2VNCA 4P2RD 5EO1B 2R39A 3Q43A 3RDJA 1XGRA 1JK8A 3DRQB 3W82A 1LP9B 3T2QA 3LIZL 3F7PC 3ARPA 4KO7A 4MJ2A 4WU5A 4B7LA 4Z7NB 5BUPA 3JSSA 3IJYA 4NQCE 3KEHA 4ZOBA 3B5HA 5K39B 4H13C 3HS0B 4AW4A 2WHVA 5FOBA 2YGVA 1ADQH 1R5WB 1DQLL 4K5NA 4OUOA 2J2ZB 1USQA 3K0WA 5EO1A 1BXXA 4AQ1C 3WTUA 2APWA 3OMIB 3LQAC 2BVPB 3KPRD 3DRQA 1BAWA 1LP9A 2QMKA 3U4EB 4XWGL 4ZJ9A 4AT6B 1KCUH 3ULSB 3RE0A 3BWUC 3UDWA 5JXEC 4TVSa 5JIHA 4Q58C 2J1ZA 2XOTA 5K39A 3HS0A 3RG1C 1IGIL 3QIUD 2BFVL 5HYJD 3TWCH 1TJXA 1R5WA 5T3XD 3VH8G 1DLFH 2J2ZA 3FQUB 4ONFH 3BKYH 2P9RA 4GPVA 4GUQA 2BVPA 2W38A 3M1CA 1XH0A 3U4EA 3X1EA 1KSRA 4K8RH 4AT6A 1IFHL 1VGEH 3HZ3A 3ULSA 5F1NB 2XWDA 2VLRB 1SXSA 3TO4C 1MWAL 4FYSA 3U0TB 2OYLA 5B3NA 4XNXH 2J6EA 4Z7QE 1XB8A 1LWJA 3N40P 2QPDB 3FUDA 5KUKA 1FYTD 3FQUA 5HYSB 4NENB 1F11B 2GTQA 1VPOH 4J3SA 2WKOA 3NSJA 4TNGA 1PX8A 5FDWB 5J6SA 1RURH 2WLMA 1M6OB 1J9CT 5FYKE 1PS3A 4N2HA 4QRRD 5EWIL 3KNBB 4LFHD 2DD8L 4FS0A 4PJIF 5F1NA 5BO1H 2VLRA 1CL7L 3U0TA 4FGMA 1W15A 2DQDL 2Y5QA 4DN4H 4P3CL 1IJ9A 4LSRL 4LF3B 3QORD 4F2ME 4AGQA 5B1CA 1JGVL 5I5MA 3VI4E 4OM1L 5HYSA 4QMEA 5DD5L 2HN7B 4KKCC 4NENA 2OSLB 1BYNA 1F11A 3IBEA 5FDWA 4A1RA 1M6OA 3F84A 1WBXB 4QHPA 1U3ZA 4Z7QF 4FFZL 2ZX7A 5D1XD 1KFGA 5D72L 5DJ2B 2YEVB 3KNBA 5IG7B 2ILLA 3SSGA 1IFRA 4I1RA 1ZDSA 3C5XA 1TITA 4KKBC 2VW6A 4N25A 4FTVD 5C7XH 4PM1A 4LF3A 2X9XA 3LPGA 4BWUA 1URIA 4U1GB 1VLXA 2YPVH 1ZPLA 3LMJH 2HN7A 4PGBB 5DU7A 2OSLA 1EDHA 4ZQKB 1XF4B 1WBXA 3LZRA 2OBGA 2A6KB 3VI4F 4UOZA 5DJ2A 3RDTC 5JOPD 3ZE1F 5IG7A 5KVGH 2IOMA 3CIQA 4L8DB 4F2FA 2WANA 3V95A 4LFHG 1NCAL 1N0XH 3UTSD 5F8QC 3TA3C 3BSZH 4WUUE 1FJ1B 4BFIB 4HLJA 5KBKA 4PGBA 5SWZB 3GJFB 4ZQKA 5E5LA 1XF4A 4Y19D 2A6KA 2WXIA 2YMOA 4NGHL 5ADPL 3TTYA 4YX2H 5AW8B 4L8DA 2LHAA 4GBXB 2MQCA 1HJBC 1C08B 4FLOA 5EZOH 3CXDL 3IJ9A 3VX1A 1S46A 5IT2H 1WWAX 3PAZA 1E5AA 1FJ1A 4BFIA 2MHAB 4PW4A 3OAWA 3OZ9H 5L2KE 5SWZA 3GJFA 1E4KA 4UQIM 1J0IA 3WD5H 4OB5L 4OI8A 1JD7A 1JYXA 1USZA 5DRWB 4AGNA 3AUVA 4UNIA 1X9QA 2ZYIA 5E2TL 3V5HB 3QCTH 4GBXA 3D25B 1C08A 1MZYA 1ETZB 4AQ8A 3K2UH 4GUOA 4XO9A 4JMXA 4A38A 5FEBA 2AEPL 1E40A 1B9KA 1MCOL 2MHAA 4U2YA 5F6IC 4F33B 1AACA 6FABH 1OCOB 5FDYA 2BFGA 3KLQA 5EDXA 4JBSA 2H1PL 3SGDH 5IQMA 4JKNA 3TZVB 3ELAT 5DRWA 1RZ7L 1F86A 3HCVB 5DDHB 3U0PB 5C0CE 3D6GA 4H0LC 5I6NA 3V5HA 1N7MH 3D25A 1A4BA 1KBKA 1ETZA 2XWXA 5LGJB 1SEBB 1IC4H 5C0IB 2J4WL 1U8HB 3OKKB 4RGNB 4YGAB 4F33A 2IDFA 2GB2A 3MXWL 5T5FA 1T7YA 5T3ZL 3TZVA 2FTAA 3ZLQC 2MH4A 4F9PA 3HCVA 5DDHA 3U0PA 3KLHD 4NO3B 3UP1A 4TMPA 1W72H 3C5ZD 2D4DA 3LS5H 2DBJA 4PRDB 5A6IA 4HFUL 5E4AA 4P5TC 1S3KH 2WLLB 2X4SB 1OY3B 4YGVB 5LGJA 1SEBA 1IQWH 1YYLL 5HTSA 5C0IA 3NRQA 1U8HA 5IROC 3OKKA 2IFFL 3SDDC 4N2NA 3I02B 4DQOL 4W9EC 1NSNH 2BW5A 4Q0XH 3RI5K 3K1DA 4A7VA 2KKQA 1YEFH 2ZPKH 3EYQC 5FECB 3TYFB 5EBWB 4NO3A 4NWUL 1R17A 2J8OA 3BUQA 5I8OL 4PRDA 3HBGA 3MODH 1QZ1A 3QISA 2GK2A 2WLLA 2X4SA 1NMBL 1WAAE 4HPOH 5LXGH 1UXSB 4OQTA 1G9EA 4IQHA 4GG8B 3QDJE 4YGVA 3ESUF 1OTSD 3QNZB 1KTLB 1DL7H 3MV8E 3WFBL 1UYWL 1IARB 1JXDA 1FIGL 4WU7B 3I02A 2C4FU 3OJVC 5FYJL 4OGAC 1AYRA 4C56B 4YHZH 3BUYB 4DEUA 5FECA 3TYFA 1SM3L 5EBWA 4F9LC 5JXAL 3WU1A 4G1MB 1E4XI 4CN1A 4QYOB 4V2BA 4DSYA 2WTRB 1HEZB 2NY5L 4KQ3L 5F6HI 1FPTL 2C9AA 1UXSA 4JFZH 4GG8A 1FGVH 4HK3N 4K23L 3QNZA 1KTLA 2Y6TE 3D39B 5FIEA 1TFPA 5DS1A 1MNUH 4WW2F 4WU7A 3KW8A 4I89A 4XMLH 1WAAF 3X1NA 5LG6A 4I3RH 1GR7A 4BK4A 3EW3B 3GLAA 3SKOB 4C56A 3FL7A 1AR1B 3BUYA 3ZR5A 1UD6A 1XR9B 1FVCB 3BRFA 1AO7B 4G1MA 4JPKL 4LDCA 2VR5A 4QYOA 4S1SH 4X98B 3MCKB 5AW0B 2B08A 2WTRA 3UEQA 4X8GA 1HEZA 1COBA 4OCRH 3AXIA 1AZVA 1FC1A 4JLRB 1RULH 3U1PA 5EBGA 3D39A 3VI3B 2XRAL 5CZVH 4L5FH 5CR1A 3DBXB 5DC4B 1JGLL 4JL1A 1N0LB 1Y1UA 3NRPA 3SKOA 5F44A 1UT9A 3JWNG 1XR9A 1I3VA 2ZOWA 1FVCA 3EYSH 4JPQA 1AO7A 4KTDH 1T2QL 2G60H 4KTEH 4O02H 1SJXA 5KSBE 1M4KA 4X98A 3MCKA 4HOWA 4J4PC 4HMEA 2XZQH 4JKWA 4OLVL 3V0WH 3R06B 4YDMA 4JLRA 2LVEA 5E6ID 4NC2B 1N64H 3VI3A 3F64A 4J3VA 2VN6A 4YHPB 2CCWA 2E47A 4DGWC 3DBXA 3IB4A 1G1YA 2MWCA 3RIAK 3V0AC 1N0LA 3QBTB 2ZNXA 1KDJA 4I5BB 3OMAB 1CZ8H 1INEH 3GTTA 2Q1EA 4HH8A 4OCXL 4XB3A 5HGHB 1LP9E 4NAJA 4JFPB 4RBPH 4Z7WE 4K7PX 1KB5L 4LGSB 2K6WA 3H3PH 4YXLH 4Z7NE 4IKLA 3V9EA 1NGPL 1SVZA 3R06A 2J1WA 5EC2B 1JZGA 3W9DB 5D1QD 5BMFL 4HUUB 4OJYA 4YHPA 2D9CA 5KSBF 2HZHA 4J12A 4NQDD 4UI2A 2IBGA 4I5BA 4KNTA 4N86A 5HGHA 3ZMRA 3AY4A 4WWNA 1NGYB 3E80A 3AQZA 4K3EH 4JFPA 3C09B 5DGQA 4HUNB 4P46B 4HJEA 2QJDA 3C75A 3CSGA 3X3FH 5EC2A 1CLOL 2BRRH 3W9DA 1SMOA 3DETD 4HUUA 4N8CH 4Z7WF 4QTIH 2AEWA 2MCPH 5IM7B 4W9LC 3WGUB 1EMTH 3L95B 2WNGA 5FOJA 1NFAA 3WHXB 2B1AH 5C7ZA 4GXVH 2VXSL 3KWTA 4HOXA 2DKMA 1NGYA 3GINA 3RU8H 2C3VB 2VQUA 2JQZA 3RAJH 2ZWSA 5MENB 4CW1B 4TNWK 3MOBH 5BS0E 4P46A 2YRLA 1IIIA 2XXCB 4KXBA 5IFHL 2B7DT 4WV1B 4XNYL 2EIDA 3DJTA 3HI1B 4MS6A 5F97E 1JHTB 3MLPA 1KTBA 2EYTB 3PP3K 5IM7A 3VDCA 3L95A 4UT9L 2EACA 2D3NA 2DLTA 3WHXA 4BA8A 5IOPB 2LU5A 3VVVA 1Q4NX 2C3VA 1QMUA 2XX1A 3AM8C 4NWTH 1YPZB 4HQQH 4Y4HC 3RWDB 4XNUH 4CW1A 5MENA 3TT1L 1XFPA 4FQLL 2WKOF 1E5CA 2CJUL 4WV1A 4OI9A 3HI1A 5T1KD 2UV3A 4XP9L 2YUXA 1EA9C 4WI3A 1JHTA 2J8UE 3N1QC 2R2CA 5GGSY 2EYTA 4R90L 3D2UB 5C09E 5D7JC 5GGVL 4GSRA 2DQCH 1L9MA 4PBWD 5IOPA 1QQDB 2IXQB 1HCFX 1YPZA 3RWDA 1FGNL 1SGKA 4DEPB 1MVUB 5CILL 2IDQA 2P43B 4N9GB 4OT1L 4D9LH 1OAKL 1S7QB 3VDAA 5L2JB 4XC3L 1SN2A 2K1MA 2O30A 3GO1L 3SKJL 4FL4B 1YYMH 4D2NA 3CHQA 4HVBA 2NR6D 1INDH 2H9GB 4GMSH 3D2UA 1DO5A 4A66A 2UX6A 2G2PA 5FM5O 4KHTL 5E1AB 3Q2NA 3PWLB 4FOMA 1QQDA 2J8UF 2IXQA 3SE4A 4FABL 1MFAH 5J1SC 3MV9D 4OFYD 5A40E 1FNAA 1MVUA 5E8PB 3WHE1 4N9GA 1NEZB 5DLML 1E8XA 1S7QA 2BOCB 3LN9A 4M5TA 5L2JA 4UCFA 5T3XH 2ALAA 3VDBA 1IBHA 25C8H 2D3LA 2CHWA 3EFDH 3N04A 4EI5D 2GSIB 2H9GA 4M00A 2R29L 1MPAL 4WO4B 5GS0D 4LIQE 3QI9D 3X12B 3I85A 4U1HB 4PJ5D 3C2AL 1A6WH 2CU9A 3PWLA 3ZK0A 5JNYB 4RMTA 4Y5YB 5FYLE 1DJSA 1NEUA 5KYNA 5E8PA 4G8GE 3M6DA 1F6FB 3MBXH 3SKUD 1NEZA 3REVB 4BFEA 3WIIH 2BOCA 3WDHA 4J2QA 4Y8DC 2Z1KA 3OZLA 4XVTL 3VW3L 2HT4C 2NRDA 2GSIA 4MFHA 2EDXA 1GY1A 4XODA 4WO4A 1NCUA 3GUTB 3X12A 4HLZH 4U1HA 5JNYA 1JDDA 1SLUA 3UTZB 4Y5YA 4DKEH 4BUHA 2X1XR 2P8MB 3FT9A 4KKLD 3REVA 1VRSA 3U4BH 2PO6D 3SE8H 1TLKA 5J3HD 2VSDA 4L9LB 3JYBA 1GIGL 4D8OA 3QEQE 2GKIA 4FC3E 1HIML 3BVWA 5EZIL 3MZGB 3GUTA 2VXQH 3U79A 2OYKA 3UTZA 1XGPB 3PJLA 4OZFB 2P8MA 1FNSL 4B6ZA 1KBBA 5T33H 1UA6L 4KXCA 5D7IB 2WAHA 1CYWA 4OFVA 4L9LA 1WZKA 4LMQI 1FFOB 3KPMB 1S5IL 4XPBL 1XH1A 2HX9A 5HDBB 1M53A 3IFLL 3LKNB 1M56B 3GHEH 2HLFD 2H45A 3K8MA 4FXKC 4PS8A 3MNMA 1N6VA 1XGPA 3AQDA 4IBSA 1XEDA 3OLEA 2XICA 4OZFA 3ILEA 3B37A 3MLUL 3ZKND 2FJFB 3FSAA 3LS4H 1NBVL 4Y1AB 5D7IA 5KW9H 1MAKA 1FNHA 4M7KL 1FFOA 1V7NL 3T09A 1YEIL 3KPMA 1ID2A 1CO1A 2ENJA 4ZAKB 3LKNA 3OM3B 3PLYA 3P9WB 2YD2A 3A3YB 2LR4A 5K1VA 3EYOB 3LX9A 2IPTH 4WY7H 1PLAA 4FZEL 3OX8B 4RGMC 4R97C 2X9YA 4LLUB 2R2HB 2FJFA 2Y3NA 2ZE0A 3L1OL 3QRGH 1HOEA 4RWYL 4Y1AA 3CVDA 3L4YA 4YXHL 5A6MA 3PXHA 5HGAB 1RZJL 4ZAKA 2O72A 2ERJB 3KH3A 4FA6A 1MCEA 1LDPH 5LDSA 3LD8C 2Q7NA 3LY6A 4EZJA 3EYOA 2QGDA 1R3IH 3OR7B 2J6EH 3TIDB 1LGVA 3OX8A 3O41B 3VNYA 2FJHB 3QJVB 4LLUA 5GRVL 2R2HA 5GZOD 2W65B 4I87A 2NY2D 3CFJB 5I16B 3S3DB 3D39E 2ZYRA 2E59A 1PJWA 5HGAA 5LQBL 3QJOA 2DIBA 4UZSA 3SYAA 3VGHA 5FM5M 4LVOC 3O0RH 4KRMB 1XGQB 2YKLH 3SJVD 3OR7A 4X6BB 3V6BR 3TIDA 1E3FA 1Z3GL 1AO7E 3BQVA 3O41A 4BFNA 2FJHA 1T4WA 4LBEB 1PZSA 2VLKD 3FFCB 2W65A 3L9RB 4ZMOA 3CFJA 2L0DA 5I16A 4XPAH 3FQNB 3VI3E 4MD0B 1FUNA 5GJTL 2IAND 5KANG 4MASA 1J0HA 3BKMH 4XNZC 4PJHF 1XGQA 1NKGA 3IKCB 4M3KB 4X6BA 4J1UB 5DHXB 4Y7MA 5IREA 5GRUH 4DP4X 3ZKSD 2NY4C 5ID1B 4LBEA 4Z3HA 3FFCA 4N2DA 4Y4FC 5E2WH 3L9RA 2X6CA 5D5MB 5FW6A 4JRWA 2CUAA 3FQNA 4FI7A 3MI6A 4MD0A 3GXUB 3IGLA 3BPCB 1AXTL 3KVPA 2YSSB 2HYMA 4GXFA 3CHPA 2EDWA 3DYOA 3IU4H 3IKCA 4NFDA 4EZMA 2GPZA 1J8HB 4J1UA 2I60H 1MIMH 5I2IB 3CHOA 1M42A 2DW5A 3ARGD 4XMKL 1NBZB 4GS7B 4HALA 4XMZA 3T2LA 3V5KB 2V8LA 4F7EB 5ID1A 3VGFA 2X88A 4LCIL 3U7YL 5D5MA 2XG4B 3QCUH 3IDMB 3BPCA 5E95B 4XNQB 2YSSA 2D31B 1Y6MR 4KUZH 3NPSB 1UC6A 3VFNB 1J8HA 4FI8A 3D18B 3WO4C 5I2IA 4XXCC 1NBZA 3V5KA 4EXPX 3MR9B 2ED8A 1A22B 4F7EA 3GF8A 3IAPA 2BSED 3GJFH 2WXOA 4TSBL 1FNFA 3U48A 2XG4A 3FU5A 4WTZG 2WLNA 1ZKAA 4GJTB 3U30B 3FO0L 3IDMA 3GKZA 2WAQA 3TS8A 2ZOLB 4PJAB 4XNQA 3RB7A 2B2XL 1UXMA 4XBMA 2D31A 4DPCX 5CKAA 2AV1B 1YZZA 2D4FA 3VFNA 4TOYH 1KV7A 3AFLA 3D18A 3QUYD 2DKSA 5EU5B 3MR9A 1JSYA 1IZKA 5TE7H 1PD1A 2COQA 1OQOA 3X2QB 1KGYE 3V0DA 1OARL 1ZMYA 2XWRA 2G4GA 1T04B 3CAFA 3UADA 2W88A 4NJAH 2HKAA 4Y9EA 4Z3JA 2YGOA 1EHAA 2ZOLA 4PJAA 1UADC 1UUNA 3O2VH 1QHQA 3WN5C 2G2RB 1T83C 2AV1A 1KN2H 4JDEB 4XP1H 3L3HB 5I9QC 1JPST 1YPZE 4JN2B 1YSOA 5DD3L 5EU5A 2O61B 2OPCA 4A7GF 4WGVB 4IDJL 1S8DB 4BUGA 5T5FH 1E7VA 4JR9H 4KZ0A 1T04A 2YPLB 4H20L 1J5OL 1QPKA 1HU8A 5J06A 5BW7C 2Z3FA 5AW4B 3A6BH 2G2RA 5FW8A 4JDEA 2Q8BL 2PPAA 4UQCA 3ARBB 4EI0A 2FEEI 3L3HA 4LRNH 1NCCH 4JN2A 1JNHB 3NA4A 2ICWI 2O61A 4GB9A 3LHPH 4L8SB 1S8DA 4MCYB 2XWJB 4GLRH 4LHJB 3RJOA 2YPLA 2WIMA 2Z1PA 3VD4A 4W93A 1H3PH 3ATAA 3DGCR 4I2XE 5D93B 5JTWA 2X3CA 2F68X 3PY9A 4Z7UE 4FNQA 3OGCB 3HRZB 3QUXD 1D7FA 2VXTH 3HKFA 1W0WB 2XBTA 1U3NA 3II2A 3ARBA 2XFXB 1MJ7L 4HWBA 4DAGL 4N26A 4LE8A 4HC1A 1JNHA 2Q2LA 2NY3D 2LT9A 2XHNA 3OV6A 3IFNL 4L8SA 4EBQL 4MCYA 4J5VA 1F4HA 2XWJA 3C6LC 2AJZB 2QLVB 5L8JB 3FU3A 3ARZA 4LSTL 3P9MB 4LPXA 5FO8B 1A1MB 3L4UA 2EVJA 5GISL 3ZL4H 4IBVA 2H41A 3OGCA 3HRZA 4YDIH 1W0WA 2X6AA 4ZW3A 1XL6A 3B8YA 2XFXA 7PAZA 2CBTA 3A24A 4P2YA 4XX5A 5DEGB 4Z7UF 4KO6A 1CN4A 1EXUB 2ITFA 3II1A 3LTVA 3KL3A 2VDOL 4G6KL 2KQMA 2OMYB 2PR4L 4X6DF 3RUGB 1AGCB 2AJZA 2B1HL 4OH2A 4HYTB 3P9MA 2WYTA 3ZTEA 3ARFB 5FO8A 1RERA 1A1MA 2X87A 1KUMA 4JFED 5L9DH 2VSCA 1GHFH 4IRJC 4RFNB 1PX4A 4YDVB 2EVGA 4ELDA 2H8PB 3CFCL 4I0PD 2R0KH 1MFVA 5DEGA 4JRYD 3V10A 2QKIB 3T1FB 1KZQA 1MDAA 1EXUA 1P7QD 4KRPD 2M1KA 2OMYA 2EUXA 1OW0A 3IAGC 3RUGA 1AGCA 4GO6B 2BERA 3FN0H 2H32B 1RZIB 4N6QA 2HMIC 3U9UB 2FJGB 4S0SD 4KZEH 3ARFA 1JMXA 5JQIB 3HI6H 2ATPB 3EFFB 4Y9FA 4GSQA 4YDVA 4FMFA 1UOWA 4LSDA 1QD0A 4XP5L 2H8PA 3MJGX 5DRXB 4G9DB 3DXAB 3HBQA 3I6SA 3GXDA 2QKIA 3T1FA 4EJ1C 2VLJD 1KXVA 1ZLDA 1XT5A 2DQHL 4GRLC 4KHXH 4YMPA 1KPVB 1GCFA 2Y7QB 3BZDA 3VFGL 1TZGL 5E6ZA 5D7IE 3MJ6A 4V1DB 2H32A 1RZIA 3BKCH 4GRMB 3P3YA 5EEWA 3D1MC 3U9UA 2FJGA 4AQ1B 4E9XA 1JL8A 4JKPL 4POYA 3OQ3B 3IF1B 4RQQB 3UJTH 1G5AA 5D7KD 2ATPA 2YD4A 2EE9A 2EIEA 3EFFA 2OFQA 3WTYA 2V17H 3LH2L 1RZKC 5DRXA 2ATAA 1NBQA 2GBTA 3DXAA 4G9DA 1D9KD 3SDAC 1UWGL 4WCYH 4XO5A 3IWUA 1UD2A 2O5YH 5F7AA 3CNKA 1KPVA 4OLZH 4WJ5B 2Y7QA 4PB9L 4Y1AE 3NFPB 4V1DA 4GRMA 2K6ZA 1ZV9A 4LGRB 1E5YA 4AQ1A 4APXB 1G9HA 1S5HB 3VXQB 5EF2A 3IF1A 4RQQA 3KGRA 1E28B 1IAIH 4IBLT 4FCHA 5GS0H 3X3GL 3NCEB 2O5ZH 4JY6B 5D7IF 1T03L 2PYEE 3OAYH 2MCAA 3TO4B 5L88L 4YHML 1CK0H 3L9EA 4KJYB 3EH5B 2AABH 3RVUD 4WJ5A 1U33A 4PCTA 4Q4EA 4YBHA 1RSYA 1UM6H 1IGJB 1ACYH 3NFPA 4KROD 2FJSA 2FH8A 1JHLL 1HAWA 1WWCA 4NM4H 1XTMA 4APXA 4BWWA 4PGJA 2DS4A 1S5HA 2ZUYA 3VXQA 2CO2A 2EE2A 2VRAA 4Y16C 1E28A 3NZ8B 4HSCX 5GHWL 4PR5B 4JY6A 2O5XL 3H9HB 2VDRL 1ZE3H 2FBOJ 3FQYA 4EOWH 4N28A 1I9EA 2RB8A 2NYZA 2CKBL 2VDLH 4FQCL 4PD4J 3TO4A 2CLVB 3ZZQA 4KJYA 4GKZB 3L3GB 2EH7H 5C07B 3LB6C 3ZYZA 2AV7B 1IGJA 2M26A 3RVTC 1JDAA 2HP4A 4G59C 3ZKXB 1M71B 2AEOA 3DKHA 3QNFA 3FCGA 3NZ8A 5JOFB 4FQHB 1ANUA 1VERA 5C6TL 1XBRA 2CDFB 4M1GL 4PR5A 4XZUB 3W39B 3H9HA 1BVNP 5GJSL 3A21A 2CLVA 3ZE0E 3FUKA 3IFPB 5JIDA 4IKIA 5DD0H 5LNEA 4GKZA 1DVUA 3L3GA 1DEEB 5C07A 2KUTA 2O6PA 2AV7A 2W81C 5GZNA 3CFKB 1JN6B 1M71A 1VFOA 5JOFA 1D3CA 4FQHA 2CDFA 4XZUA 4B0MB 3W39A 3RDTB 4OTXL 5DCCA 3T0