1SFDA

Oxidized form of amicyanin mutant p94f
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTFHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of Two Mutants of Amicyanin from Paracoccus denitrificans That Stabilize the Reduced State of the Copper.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords Amicyanin
total genus 25
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1sfdA00
2B3IA 1AS8A 1PZCA 2UXTA 1EHKB 2HX7A 5AZUA 4DPCX 4E9RA 1E65A 4A2HA 1NIFA 3AG3B 9PCYA 4G7SB 3IBOA 3T6WA 2OV0A 4YVUA 2XLLA 1SHWA 1AACA 3X1BA 4AZUA 1M9WA 1L9OA 1AS7A 2IDUA 1GS7A 1NICA 2IWEA 3FQ1A 1BAWA 3KW8A 5TK4A 2CCWA 1L9TA 1PZBA 1AG6A 2XVBA 5I5MA 5B7EA 2W8CA 1AS6A 3QJSB 3FU7A 2EILB 1SF5A 3NJFA 1WA2X 4BDVA 1A4CA 3OD3A 2PCFA 2XWZA 3T6VA 3WIAA 4N8UA 2Y69B 5A7EA 1ET7A 7PAZA 1M57B 1TEFA 1IKOP 1AZBA 3WNIA 2QT6A 1AZUA 1ZDSA 2UXFA 1A65A 1XB3A 3AG4B 4BK5C 2LLNA 1GYCA 4YSCA 1ZPUA 3FSWA 3SBRA 1J9TA 4AI7A 3ZBMA 2JXMA 3QJUB 3QJQB 2I7OA 4YSQA 3PAUA 1ET8A 1JZGA 1TKWA 2X88A 4KO7A 1NPJA 2JKWA 3CZUB 4JKNA 3TASA 4UF7C 4HCGA 3S8FB 3EH5B 1W8EA 2J56A 2BP0B 3IN0A 3ZX1A 2XV0A 4EF3A 5I6NA 2J55A 3OM3B 2NRDA 5B7FA 1HFUA 2UXGA 2WSDA 2BHFA 2VSMB 1ZDQA 1L9SA 2VM3A 1ETJA 3QJVB 4Q8BA 3PAZA 5AFAA 2MTAA 4AX3A 3NSYA 3N55A 5B7MA 4KOCA 1OOWA 2EIKB 1EZLA 3UACA 2XV3A 1KDJA 2DWTA 2YXVA 2GI0A 4YSRA 3L45A 2VM4A 2N0MA 5I6MA 4AKOA 2QDVA 2BO0A 4E9WA 1NWPA 1PLCA 3X1GA 2HRHA 2X87A 3BQVA 4YSTA 1SJMA 4DP9X 4BWUA 1WAEA 3ZIYA 4HHWA 5B1BB 2HZHA 1ASQA 4A2FA 3ZDWA 4NERA 1PNDA 3SQRA 4KO9A 2YARA 2CUAA 1AR1B 4DP0X 4GYBA 2UXVA 4E9SA 4YSUA 3TA4D 4GY4A 4YSPA 5D4IA 2XXGA 4Q89A 2FT6A 5B1JA 1L9PA 2VSKB 3WKPA 3ASOB 4BXSV 1J9QA 1NIBA 4G72B 2BP8A 1KYAA 1ZIAA 5TK2A 3S3BB 1JZHA 1M56B 2WO3B 4UANA 5PAZA 5F7BA 3S8GB 1MZYA 2XXFA 1E5YA 4GP5B 1QLEB 4E9XA 2VMJA 1NINA 4CSPA 3T6XA 1GY2A 3N2JA 3NT0A 2FWLB 2TSBA 3GDCA 4F2FA 1BXAA 3FSVA 3GXUB 4ZK8A 2J57A 2TSAA 3OQRA 4G7QB 3TBCA 1BYOA 2HX8A 1NZRA 2FQEA 2YAPA 3FU9A 2QDWA 3OMAB 4P5RA 2CAKA 4JHVA 1X9RA 2IDQA 2R7EB 4CSZA 1JOIA 2YAOA 2I85A 1AG0A 1ASOA 1GS8A 5ANHA 1MDAA 1NIDA 2XV2A 3UAEA 4BDVB 1SDDB 3S3CB 2RACA 4KO6A 4DP6X 2FT8A 1SDDA 1PZAA 2DWSA 2BZ7A 3NJNA 5D4HA 3HEIB 4F2EA 1V55B 3NJHA 3WKQA 3NP4A 1KBWA 1ASPA 2AZAA 3TU6A 3UGEA 1J5DA 1IBZA 1PCSA 2J5WA 1OV8A 2VW4A 3FS9A 1PAZA 2FQDA 1OE3A 1OCOB 2UX7A 2VN3A 3CDZB 3T6ZA 2B08A 3H4HA 2AVFA 4DP5X 3CVDA 3HB3B 4KO5A 2YAMA 1IC0A 1MZZA 4FAAB 2OCCB 1SHXA 1KGYE 2DYSB 4K9JA 1IUZA 3AW5A 4DP2X 8PAZA 2QPDB 4DP8X 5B1KA 3CVCA 3G5WA 1E30A 3DTUB 3KW7A 1JZJA 1ET5A 1OE1A 3QPKA 2GC4C 1PLBA 1X9UA 3NSCA 2H3XC 1DYZA 1NPNA 4JHUA 4HCFA 2CJ3A 1CYXA 6PAZA 1QNIA 1W6WA 1WS8A 1NWOA 2Q9OA 4BXVA 2BWIA 4ENZA 5IY5B 3DIVA 1A3ZA 2P80A 4HZ1A 3SBPA 1ZIBA 2GIMA 5EHFA 2IAAC 2PPCA 4WKXA 3T71A 1BEXA 1BQ5A 2XUWA 1RCYA 1TU2A 2HLEB 2PLTA 3FU7B 3X1NA 1TEGA 1DZ0A 1XB8A 3AG1B 1JZEA 3NJIA 4E9YA 1KCBA 2AANA 3FYIB 4NAJA 4QKTA 1AAJA 2GBAA 2BP8B 2IWKA 2UX6A 4M3HA 4X4KA 4YSDA 1BQKA 3ABMB 1ILUA 6PCYA 3ABKB 5B1JC 2PCYA 2ZOOA 4A68A 1N68A 3WI9A 4DPAX 4HIPA 4HALA 3ERXA 2FJSA 4YSAA 3MX0B 4A2DA 1L9QA 1KV7A 2P80D 2FNWA 3QQXA 3C75A 2H47C 5B1AB 3BVDB 4DPBX 1UATA 1CC3A 2EIMB 4L0PB 4UAHA 1T5KA 1J9RA 2GC7C 1J5CA 1VLXA 2JFCA 1FWXA 3SBQA 3V9EA 2BP0A 2BW4A 3MBWB 1PMYA 1OCZB 2BZCA 2DYRB 5I6KA 3IN2A 3PAVA 1JXFA 2I7SA 4E9TA 1JZFA 2HX9A 1KDIA 1GSKA 2YXWA 3ABLB 4GP4B 4PAZA 3EHBB 3PCYA 1RKRA 1JERA 2BW5A 2PP8A 4AKQA 4F7KA 1JVLA 1JZIA 4W1TA 1NIAA 3GYRA 3NJGA 3NJKA 2W88A 1NDTA 3S3DB 2R7EA 1I53A 1XB6A 5LDUA 3PLYA 3EH4B 3UABA 3NSFA 4KNUA 1GW0A 4DP1X 3X1FA 4AKPA 1KBVA 4BWTA 1E5ZA 3NJMA 3FSAA 3AG2B 3IE9A 3ASNB 2EINB 2Y1AA 1HAUA 1ID2A 1A4BA 3OMIB 3CVBA 5FC9A 2XU9A 4YL4A 4E9VA 2VW7A 1R1CA 1A4AA 4A66A 2AZUA 4PCYA 2OJ1A 2PPDA 1WS7A 4MFHA 2CALA 4KNSA 1WA1X 2IH9A 3ABGA 3PPSA 2GB2A 1FFTB 4N4YB 1SNRA 2PPFA 5F7AA 1SF3A 1PLAA 1ILSA 1AZCA 1BYPA 2XX1A 1ADWA 1L9RA 5I26A 2HRGA 3WNJA 5E9NA 2A3TA 5PCYA 4E9QA 3PXLA 4HCIA 2Q5BA 4YSEA 1AANA 2FQGA 4P5SA 2EIJB 1FA4A 4FA7B 3X2QB 2MRYA 1OE2A 2PP9A 2YAEA 1B3IA 1BXVA 3QJTB 1OCCB 3TBBA 2YQBA 4HAKA 4TXVB 1J9SA 2IWFA 1AZRA 3FSZA 4KOBA 4KNTA 1GS6X 2QPEB 4G7RB 4A2GA 1MG3C 3FPYA 2XYBA 3H56A 5I5IA 4GXFA 1SFDA 3EH3B 1CURA 3NP3A 3UADA 1KCWA 3NYKA 4GP8B 1JVOA 3FQ2A 4DP4X 1SFHA 1HAWA 1GY1A 4YVNA 2XX0A 3DKHA 2BWDA 1WA0X 3T9WA 4WTQA 3U25A 3UAAA 3NJLA 2GHZA 1E67A 2IH8A 4W9ZA 2HXAA 3H4FA 3FU8A 1OCRB 2PPEA 5B3SB 2YAQA 3CG8A 1PY0A 2ZXWB 3OMNB 1PNCA 3FQYA 3FT0A 4BWWA 3X1EA 1AZNA 1AIZA 2AFNA 1QHQA 4YSOA 4DP7X 2CBPA 1AOZA 5I6PA 4HHGA 2FTAA 3JT2A 4NB7A 4A2EA 3EF4A 3QJRB 1GR7A 2PP7A 1NTDA 5I5JA 3RYMA 1V10A 1YLBB 3V9CA 2GSMB 3FPXA 1JXDA 3NSDA 1RZQA 2IDFA 2DV6A 5D4JA 4G71B 2IDTA 3JTBA 3FYEB 2FT7A 7PCYA 1A8ZA 2FQFA 1NIEA 3D12B 1MG2C 4M4RB 3WG7B 1N70A 4YSSA 2YAFA 2PPAA 1CYWA 2WO2B 4QLWA 5I6LA 1JXGA 3NJJA 3AY2A 2ZONA 1IBYA 2VW6A 1OF0A 4G70B 1PF3A 1F56A 1URIA 1V54B 2E86A 5I28A 2H5UA 1ZV2A 3IEAA 2ZWNA 4RH4A 3CDZA 2IDSA 5I6OA 1BXUA 2DY2A 1XMEB 1AQ8A 1CUOA 1RZPA 1W6LA 5AKRA 3AZUA 4A67A 2YAHA 1BQRA
chains in the Genus database with same CATH superfamily
2AV1A 3GSWA 2A4EA 4NXKA 4WKZB 2IANB 1F58L 2A6KB 4XWGL 1AXSB 2NY1B 3ARRA 4A2HA 3DRTB 2C26A 3T09A 4E9RA 3C6LD 3P73B 3ORJA 1OK0A 2ZOKA 4LP4A 2BWQA 2WJ5A 1W80A 2ITDA 1R0AH 3KXFD 4PJ8A 3VWJA 2G3ZA 4J3OD 5FM8A 1NFDE 4PR5A 5E6YA 1UA6H 4MA3B 1RUMH 3QUXB 5HDOA 4OQTA 5DK2B 6FABH 1XH0A 2IWEA 2OMYB 4WW1B 3QORA 2EEBA 2Z3FA 2KPWA 5DLML 3FFCB 2NZ9D 5EZJA 3NFSH 3QB7C 3OB0K 3FTWA 1RJLA 1THCA 3JWDC 4GUCA 4XZUB 4M7JL 3EFOA 3PWNB 2IH3A 3MYZA 2EILB 2APTA 2JLLA 3NJFA 2DQFB 5LHDA 1CF8L 3OD3A 2MNJB 5DYOA 4HDIB 2QGEA 3DYPA 1MWAA 1H3TA 2XWZA 1NMCB 2WTRA 3MRHA 2ROYA 2JQZA 1BJMA 1S7QB 4ZMVA 4N6RA 4LLQB 1QTSA 3LAFA 5D55A 3MN8A 3TFBA 3EF7A 3UZQA 5GRJL 3K74B 5IMOB 1R6VA 2FJHB 3QCUL 1MLCB 2CLVB 2FX8L 2QFRA 1JHTB 2HWZH 2ZCLH 2B20A 2JXMA 4NQVB 4WFHD 5IQ7H 4JK0D 1QBMH 5HDQH 5ICZB 1LE9A 3WXVL 4XVUD 4NWUH 4K71B 2GJ6E 4HWEH 2ENPA 3DVNA 1DQVA 4J3TA 3ZVVA 1ZD6A 4LHUB 2X88A 1W72H 2ARWA 2O1AA 4YBLC 1PX3A 2BOBB 4WO4D 3CSPA 3P30H 1U91B 1SUJA 5JHDD 4JRYD 4POUB 4B6ZA 5TF1L 4LOEA 1AD0A 2MCG1 4XCEA 3ZL1A 3DVGA 4OF7A 2C9PA 4WW2A 4NBXB 2YD4A 1YEIH 1RU9L 4RMSA 1ZWIA 1YG9A 1MI5E 1WBYB 4HZAA 1YVLA 3H9HA 4QHLA 5D7JB 3U4BL 2HRPH 2Q76A 1ZTXL 3U0PB 1KXTB 1TOXA 5GS1B 5EEUA 3Q05A 1AR2A 3HG5A 5JHBA 4LGSB 4UDUB 1CTOA 3UAFA 4F7CB 2BXYA 1P5UB 4Q6YA 3RA7L 3RI5F 43CAB 3SKJL 3H3BC 1NGQH 2CBOA 1LMKA 1YNLH 6FABL 4KROB 5KSBF 1NAMB 2F7OA 3QE5A 4I89A 4HFUH 5JHLH 2W95A 3RBSA 4AIZB 4K23H 3CPLA 3GSWB 4PJHB 4YSTA 2IANA 4NZ8A 5DXWA 1K4CB 4OCMC 4Y9CA 4ELKA 1T03H 1KYDA 5I30L 5TTRA 1QLRA 1MCOH 5T3ZH 4HIQA 4XC1L 3DX0A 3DMMA 1F1GA 2ARJB 4F5CA 1TYJA 1F58H 1TQTA 1W91A 3RNQB 4YBLB 3NFNA 5D1XD 4JGNA 3VFMB 3NIFE 1LYQA 4OT1H 4KHXH 4FXGA 4Q9QL 2C9SA 1TCMA 2NTFB 3ARGB 2XXGA 4JDTL 2VAJA 4LBAA 4AGPA 4U1MB 3GJFA 1OTUD 4WWKA 2X4PB 5F7FA 1WTGT 4AEHL 3FCUB 3PWPB 4LBEA 5GRXG 2R56L 4WVRA 1FJ1B 3TA3D 3ZHLA 3EG9A 2L3BA 5CNHA 3KL0A 5BRPA 4JY4B 2DM4A 4LPYA 4J1UA 5C3IA 4Y16D 2CKNA 3TT1L 2L7UA 1R5IB 4NIKB 2QGCA 4KQ4H 5E6UB 3T3MB 4HDIA 3V6BR 2VERN 3QQ3A 1N8ZA 1MW2A 1DL7H 5DGRA 4AQ8A 4Y5YB 5IROC 3ULVD 2QPFA 3FONB 3VD3A 3I6KA 1FYTB 2GAZB 3ZSTA 2EVGA 2CAKA 4XR8C 1BBJA 4M6OH 3V9FA 3RZWA 3VGEA 4CSZA 2YGNA 1SJVA 3LXCA 3KPSA 4B50A 5CIPB 3NCCB 4G59C 3VGGA 4KRPD 4NC1E 1E2WA 4P9MH 1QQDB 4XCYB 2PWHA 1YCSA 4IMLB 4HPOH 1YMME 1CDUA 4PRPD 1XCWA 4DGYL 5IB5B 1R33A 1WDAA 2PNDA 2JSFA 3TU6A 3UGEA 3BW9A 1N3NA 4O4YH 4HUKB 4R0LC 4DWHA 1HNYA 3EYSH 4B9FA 1H0DA 4EIZC 4PMFA 1TPXC 4K55A 1PGRB 4YWGH 3CFKB 1HI6A 2AVFA 2I9LA 1TYEB 4F33A 5D2NE 5KOMC 1AKPA 2E8ZA 4K3EL 3LVEA 4OUUB 4A37A 1BIIA 2W1NA 2E75C 3H9HB 3QXTA 3QS2A 3N85H 4WEBH 5D7JA 3BUBA 5CGBA 2DYSB 3EO1B 4K9JA 2X3BA 3SJVB 4D9RD 1ZV9A 3BH9B 4XAKD 2M8XA 4Z7UE 2FLBT 3HNVH 4Z76B 4I1PA 4NQDE 1ADQH 2GC4C 4JN2A 3ARYA 1NAMA 4PI2A 4QDGA 3GS0A 4NN7C 2B59B 4LP5A 1LQBC 4UNUA 3OJMB 5TGBB 5AVUB 3MOAL 4NRXA 3THMH 4Z8FL 3IJ9A 1OTSD 4YK4B 3C08L 4R4ND 1ZIBA 4KDVA 3S7GA 3GHPA 2OXGB 5AVSB 5JLZB 1YN6A 3AS2A 4BSJA 5FKAA 5DMYA 3ZL4H 1OL0A 1CU4H 2HKFH 3CSYA 3FU7B 2XZQH 2X2JA 4ZX4A 1QRNB 4XWOC 2V2TB 2JVUA 5L2KB 1N9PA 2C4XA 1W15A 4E5XG 1GGUA 4P04A 1REIA 4JREB 1G7MA 4XP6H 1RK1A 2QVIA 4IRSC 3SDCC 5DJZA 1HJBC 2FIKB 4F2ME 4E41B 4XPAL 5IG7A 2BVQB 3NJIA 3Q6GL 2MNUA 2CLRB 4ZOAA 2KERA 4DZBA 1AQHA 1HOCA 1M9SA 2ZX5A 3F58H 5KSUA 4UQ2A 3Q44A 4XMKH 3OX8A 4OCNC 5MERB 1T83A 1BQKA 1EFXD 3O4OB 2MSPA 1GHFH 1JTTA 4FQPA 4MCZB 3WE6A 1G9MH 3LB6C 3DX9A 2R0LL 2ZOOA 4AYGA 2OZ4A 4L1BA 1UOVA 3IDXH 3CHXA 1G7IB 1YEJH 5BNXD 4PD4K 3UYOD 5DWUL 1F6AA 3GXPA 4I2XA 4KV5E 2CA4A 3MJWA 1LVEA 3PV6B 5ESAA 3DSNA 3FQXB 1DQKA 1YQVH 2CDFA 3BPNC 3IKCA 3L9EA 1J9RA 3DVIA 3ZDXF 4PJHF 5CJQL 5DR5L 2IOMA 2DQUL 4KAQL 1JV5A 1K2DB 4WNQA 2VQTA 3W39A 3PRZA 4KRNA 3TNNA 4HXAH 1TTBA 1F02I 1U8OB 3N0PB 4L3CB 1E28A 3EYVA 5C07B 3NIDB 2F2HA 3FRUB 1IL1A 2Z1KA 1KIUA 1EGJH 3W5MA 3VFUA 4HUWA 4EXKA 4DVRH 4BBWA 4KKRA 3GBDA 1JERA 4N0YH 2NY2D 3JYCA 3KYKL 4F7KA 3CFJB 3S35X 4U1HA 3VI3A 2AV7A 5ID0B 2EDWA 5JXEC 5MENB 3DTXA 4LP8A 4QMEA 1XSKA 1NBYB 3BISA 3NQIA 1RZIA 1H3WM 3THML 5C0EB 2J1WA 5IFHL 1Q9LA 4WCYH 3X1FA 4X4YB 1UJTA 4MXVF 2CRIA 2YD5A 3BPCB 5DVLA 4PGZA 2ZUSA 3AROA 4OJCA 1GZHA 5K9QI 4X7DC 3RB5A 2Y06L 1JI2A 4F8LA 4NIYE 2Y25A 3EDJA 2R0WL 1EHAA 4GRLD 4IS6A 5FEBA 4PCYA 2HVJA 3M17A 2E47A 2JJTA 3CHPA 3D4ZA 4WW2F 3MQIA 4I77H 1IGML 4P2AA 5D7IB 4NM8L 3ZQXA 3PPSA 1CE6B 3T77A 1HEZA 3H42L 1RZ7L 2ZXEB 3DNKA 2PPFA 3AQDA 1O7DE 2BIMA 2EXYC 1UOLA 3PL6A 2UZXB 4KDTA 3BXNB 3EHBD 4GG8A 5I0YA 4L8BB 2WO4A 3HNTH 4YHOH 2R56H 4H0IA 2EXSA 1SLXA 4BUQA 3VB9A 4H40A 4QY8A 1MFBH 4PJ7E 5GRVL 2EDKA 1XGPB 1IM9B 4YSEA 2QMJA 3FB8B 1G7MB 1IV8A 3J7HA 3VXSA 4BSVA 4AV4A 1T20B 5GGTH 4FXTA 2MCMA 4ZFZA 3RAJH 5KJRH 3BAKA 3F7LA 5EBMA 3MGOA 5KEZA 5CZXC 2ORBH 1WD8A 1CI5A 1KLGA 1ZEAH 4F7TB 3I3BA 1C8PA 3FTGA 1GW6A 2LHAA 2W0FB 3GHEL 3CLFH 4JO8A 2P5EE 3HZ3A 3N06B 2ITEA 1NEUA 1EHLH 5I73C 1XT5A 1RIUH 4K8RC 4TQPA 4KKLC 5J89A 1UWGH 3BO8A 1NGYA 3GSNA 4KTYA 1XR8B 3K71B 3RA7H 2ATAA 4PG2C 2CK0H 5CCKH 3DBXB 3VXTA 4P59H 4OV6F 5IVOA 5AVWB 1UFUA 4H0HB 3FU8A 2WZPD 4P23D 1XH2A 1UD6A 2D7NA 5E8DH 4RRPA 5DJ6A 2YAQA 1JPFA 4DF9A 5JIMA 2ZXWB 4TUJB 3OMNB 3AU1A 4QR7A 4Z7WE 1AIZA 1T66D 3R4RA 1QHQA 2DIAA 3MGTA 4NQTA 1UC6A 4ODWB 4GQRA 5FYJL 4NNXB 3QULB 3LPGA 1AOHA 3APMA 4NB7A 2D0GA 2Z4QB 4WI9A 5E6ID 3KPQB 4GKSB 3ZE2F 4HS8H 1P7KA 4ZZKA 5GS0L 1LQSR 3CPUA 1EDYA 5I9QC 2L8AA 2YLKA 3CZGA 1T04B 2VCOA 4Y9EA 4Z9KB 1GC1C 3A4DA 4L4VE 3DX7B 1L9NA 3BWAA 1F4AA 1KB5A 3CU7A 1NGZB 3QQDA 3QRGL 5CJXC 5TQ0L 2IDFA 3HN5A 3BN9D 3LS5H 3FYEB 4HUVA 4B9IA 4JFEA 1YNKH 3D12B 4XBEL 2D31A 1FE8L 1U8KB 1ZT1A 3QHFH 4D2NA 4G9FE 3K4ZA 1A21A 3TVMA 3U4EA 3V0VA 1J8SA 4LEBA 1S2EA 4AGNA 4QLWA 4MNHB 2O6DA 2ZUTA 1U93B 4MJ6A 4KJQC 4PLJD 1EBAA 3MAWA 4LPTA 2I60H 5EOCJ 2HVJB 4U7SA 1DE4A 3I9GL 4JHBA 1P53A 3LRKA 4YQXH 3MRBB 1U42A 4E2OA 1N4XL 2OYKA 2P8MB 4N0FA 4ZUWA 3PQYE 1Z5YD 2AEWA 5ADPL 5D7IF 2IFFH 4KGLA 1LP9E 3OGOE 2WKOA 3ARVA 5TPWH 4N2GA 5EUKB 4X5PA 4QRPA 4JQXC 4YDJA 3B9KB 4GS7C 2HYMA 1N7MH 2DI7A 1NM4A 3BSZL 4AE0A 5JIHA 4DN3L 5AW4B 2HJFB 3N91A 2FD6H 2PW1B 4YHOL 3SY0A 2HLAB 5LGJB 2VERA 3N43F 3NCYS 3RL1B 4FXLA 3VGAB 5DS1A 2G2RA 4ZAKC 3EYOA 1I85A 2GCYA 4RGMB 3X1BA 3MJ8A 1L9OA 4O58H 4DO5A 1XF2A 3SPHA 1KXVC 5LCVA 4PJBB 2QR0A 1R0AL 5E6IB 4DETA 1U36A 1CFQA 3DO7B 1BAWA 9CGTA 5T3XD 2WLIB 4R84A 5F7DB 3MZTA 5C0BA 1JS4A 2YPLA 4DUWA 3MNVB 4GBXD 4LPCA 4K3GA 4X80L 3GKWL 3BP7B 3L13A 4UTCA 3W9EB 1NC4D 1HWHB 3CN4A 2J21A 4JL1A 5CR1A 4U6YB 3CX5J 5FECB 1UZ6E 2WAQA 2XIBA 1MFAH 1XGTB 1JGUL 2P1YA 4FULA 3RWGB 1KBKA 1IFRA 3MYJB 4KK9C 1QSFE 3STLA 1VFBA 4AEIL 3OLDA 4L1DA 3WIAA 4XPFH 2XWXA 1EQWA 3VSQA 2X3CA 1AZBA 2YD3A 4Y5VB 4B9YA 4FNPA 1T0MA 2WWMC 1MLBA 2XPGA 4KZDL 4BHUA 4OZGE 1KJVB 3MJ7A 4S2SB 1JHTA 3IDYB 2GITA 4WUKH 1BZOA 5E0QA 1MHPH 2IG2L 1GPOL 2IQAA 4Z3FA 4OTXH 2ZF8A 5ITFB 1UWYA 4RX4A 1TJMA 1XQ4A 2WXIA 1AYRA 1LJMA 4APXB 1CFBA 2BOBA 1NMBL 1VEOA 4J8RB 3WSQH 3TFKD 3ROLA 4XP4H 4ZO8A 4M6OL 2ZUXA 5K5YA 1BBDH 3QQDB 3EYUL 2XV0A 5CJQH 5DR5H 3LQAC 4J6IA 4CSTA 1FFPB 3Q2NA 4B41A 5GGUB 1J0JA 1TTCA 4JFEB 1OY3B 3BMVA 1B0RA 1PG7H 1QABA 2G9HA 1T83C 1YEJL 2BK8A 1SYSB 2X1QA 2FGWH 1MFEL 1LEGB 2WXOA 4FNLH 4YZWA 1G7QA 4OKDA 4RAUA 4H20H 3UACA 3KLHD 2XV3A 2DWTA 4P2RE 2BOLA 1AMXA 2OMNA 2V33A 4GRLB 5HHOE 1ESOA 3DJSA 4Y2DA 1QBLH 2BIQA 2BO0A 3SDYL 1WRFA 2X2HA 3BVUA 4DGWC 2EVIA 1CFSB 4NPJA 3IE4A 3PP3K 2JB6A 3NMEA 4C83B 2YBRB 2YO3A 3BUTA 4K15A 4O02A 4W4OA 4YN3A 5J56B 3L1OL 1SJMA 4PTUA 2WINB 1D9KA 5JIPA 2LOEA 2NY4B 4PRDB 3GF8A 2ZCHL 2Y5EA 2KI6A 3DMMB 4GIOA 4HJSA 4HT1H 1KCKA 1R3JB 5EO0A 4QT5A 3M1OA 4IBTA 1OAYH 3PGFH 2OCFD 5GHWL 2NNRA 3AWGA 1N0XH 4U1MA 4XT1C 5L2JA 2JIXA 3GI8L 4Y1AE 5FYKU 4JFSA 3KGSA 1KBPA 4DKAA 1LP9A 5GRWA 5CF3A 1KB5H 5D7LD 3BAEH 4W9GC 5JXAL 5MEQB 2B4CH 2PTVA 2J6EL 4QRTA 5C7ZA 3E6HA 5GRJH 2XVGA 4OCWH 5TK2A 3ZRSA 1AXTH 5GSRA 1M56B 4EZMA 4OZHB 5EC1A 5D7JC 2V3DA 5FYLL 3A4AA 4CDHA 5DRNB 1MZYA 3WJLA 1JDAA 1JWMB 2CKBA 3G5YB 12E8L 2LR4A 1N5AB 4Y5VA 1S8DA 1IX2A 2H7WA 4Q2ZB 4TVUA 3SKJH 5E2TH 3TEUA 5IGXH 4PSPA 4MDJA 4A6YA 3G6JB 1DBAH 2X42A 3D2UA 3FFDB 1B9KA 1NCIA 3N9GL 3HNTL 4PVNA 1HK6A 4JFHD 1XIWA 2YEQA 2OR7A 5CIPA 2YLHA 1BECA 4U0QB 1JMXA 4UWQB 4RAVA 1NANI 2VTFA 1HZHL 1P0SE 3PQYD 1DEEA 2F08A 1TG8A 3IJ8A 1RU9H 5KZCD 5DUBA 3NJHA 1OPGH 3WKQA 3A4EA 1EERB 4ABWA 5GGSY 3SPCA 3VG9B 4NRZA 3BMWA 4IMKA 4D0CA 3GMQA 1IBZA 1F0LA 5L2KD 3TCTA 4Q6IC 1OV8A 3H8NA 5DJ8B 3U0TA 3GLDA 4S1SL 2W9EL 5L4IA 2Y7QB 2O4EA 2VITA 4Y7OC 3K72B 5EZLA 1OQXA 5EF0A 1AD9A 4WRLA 1J0YA 3EGDA 4F8TA 4PVMA 5GZOA 3B9EA 3P4NB 4P05A 4WV1C 4I0PA 3B34A 4IRZA 4KQ4L 1LK2A 3SJVA 2A1WH 1F6LL 3MNZA 1HKLH 1NGWA 1NLBL 3GMRA 2H9GA 4X9YA 1WO2A 2NNFA 5BMFL 5IJVA 3W57A 3S98A 1QSFD 4HP5A 2WWMD 4UU9A 1P1ZA 1F11A 1IGIL 4AJWA 2WKGA 5FHBL 4GW1B 5EIVA 5BVJB 5LN4A 4CUCA 3QA3B 1DFXA 4PTUB 4AXWA 4PV1C 4EDWL 5BQ7B 3ALWA 4IOFC 4L05A 1NBZB 4URTB 4HU2A 1MCOL 3PAYA 4YHKH 4ZXBC 4FFVD 3PF2A 4TULH 1TEGA 2AXGA 1Y6MR 2NW3B 3TS8A 3QRFM 2FR4A 3KLLA 2R2HA 2CUIA 3SHSA 3LH9A 4R7DA 5IB1B 4PCTA 1A7NL 4GAGH 3MUY1 5K9JH 1E4WH 1P4BL 3IGFA 4NLHA 1OARL 3GO1L 4HEMA 3U6XA 3V0FA 1OHZA 3HKZA 4J3OC 1ORSB 2IFFL 3HVNA 1OAXL 4WI7A 1ZTXH 4LLYA 3QO1B 2X70B 1JPTL 3QCTH 1FYTD 1T4KB 4EE2A 5B38A 4LSQL 3EW3B 3I9GH 4WW2C 2Q86B 1DFBH 1BYNA 3V4VH 2IMMA 2GUOA 5B1CA 4M3JA 2WBJC 2CR3A 3VD7A 1ZANH 3UTQA 5L88L 1E5AA 5IMLB 2H2SD 3SYAA 4FG0A 1QEWA 1Q90A 4Q9RL 3CXHK 4K4KA 4N0RA 1DQJA 3T2NH 5EBGA 1PMYA 1OCZB 4JRXE 1IQDA 4Y16B 4X80H 4ALAL 3TNNB 3CHOA 3GM0A 3NAAL 5F1IA 2OX5A 3BKCH 3TESA 3QJFB 3ULUC 3RRQA 2F7IA 2J6EA 1GL4B 1HE7A 3MRJB 3SPGA 4AH2A 1INDH 5TDPB 5JQHC 2DJUA 4HUWB 2Z31A 3L1GA 1MCEA 4PWEA 4A7QA 2WMPB 1DSYA 3FTUA 4FNLL 1KIQB 4KX7A 2HKAA 5DUJA 3UJIH 2DW5A 3MTXA 5CM1A 2VQ1A 2WZ5A 5HYJB 3C8DA 1S5HB 3L5IA 4O2FB 4PHXA 4QHKI 3KCPA 4F8OA 3G5XB 4JFDB 2DYPD 1VJSA 3VXRE 2Y4SA 4CC1A 2QL1A 3EIFA 3EH4B 5AW7B 3RVTC 4XBGA 3KLSA 5C0FA 3Q2WA 4BZ1L 2RA1A 3DXAE 4Y5XA 1YNTF 1HINH 1UACH 2CIKB 2X6MA 4MVBC 2EDQA 5AYQA 2HJKB 4M7LT 3ISWA 1E42A 4KROD 3HI5L 4RGOL 3ULVH 3UMNA 3WV0A 1JMZA 4FN0A 1WWCA 4FXKB 5HHPA 3L48A 4ODSH 2VR5A 3F05A 3OZ9H 3T3MF 1UURA 5HHXL 2BNRD 2YFNA 1A7NH 3HZVB 4GAGL 2XYCA 1MHHA 1CLVA 4XBEH 1RULH 3WDIA 2CSPA 5EIIA 5CWSB 5CEZD 1K8DA 1RI8A 2XWJA 3L3OA 3WNJA 1PVHA 5IIEA 5FGSA 4P06A 4PGEA 3T6QC 3QHTC 3CFNA 4Y4KA 3HHSB 4OZ4B 4GI9A 4CJ1A 4JRYB 3L9RB 5L7XL 1RK0B 2XWRA 1I9JL 4XCNB 3X13B 5ERWB 4QPEA 1ACYH 2R1YB 4XVJL 3VGHA 4XPAH 2AQQA 5I16B 1MHCA 5IEKA 5A2IH 2B1OA 3FDWA 3FQTA 3TWYA 5DMJB 3NH7L 3R1GL 3O0RL 2ALWA 1BAFL 1WWWX 3KYAA 3M8OH 5D1ZI 4E42A 1HL5A 2EEAA 2EH8H 2P28B 4Y4KC 4AEEA 4BKTC 1S4IA 4DKEH 1JF1A 1H5BB 2NYZA 1NGYB 2VSDA 2X4UB 3N1PC 3N41F 1KACB 5EU4A 1KCWA 5CU5A 4G5AA 5C0CD 5AW6B 4Y4FA 4JS7A 3U7YL 1X3DA 3LNFA 3WFEL 1E67A 1I8LA 3QFJE 3AXLA 2XWDA 3MUJA 4YPGA 3OKMB 3WJJA 4EZJA 2VRAA 3SD5A 2ZG2A 4ORZC 1W8OA 2BY3A 3CVHH 3UDWA 2OX5B 4M1GL 2XPYA 4RMWA 3G04A 3TO2B 3UO8B 5I1LA 1MW0A 1JHKL 2VKWA 2MTPA 2CMRH 5TDPA 5I18L 4DP7X 4XCCL 3FRPA 4B7IA 4WEBL 5IVXA 2BMKB 3UC2A 1DN0B 1XF4A 3GB7A 4WFFD 3KPTA 3NN8A 5DEGB 1AC0A 4JDEA 4P4KA 3QNYB 4PBXA 4A2EA 3TEXA 4MJ5B 5ILTH 4NO2A 4PSRA 3CBJB 3HC0B 1Q0YH 3KZ8A 3BSHA 1A14L 2ZOUA 1RXLA 3VXQA 2FH8A 3C8KA 1D7FA 1VAHA 2JKJA 4HA1A 2FYYB 1NGPL 4MTMA 5MENE 4MXWL 3SE4A 1INQB 1VADB 1YDPA 2JCCB 2ZOTA 3JTTA 7PCYA 1RZ7H 5K59E 1OSPL 4R3SA 5L8JB 4TNWK 4IIQC 5C2UB 1FAIL 1AGDA 2OSLA 3SIKA 2ILLA 1OD7A 1HZKA 2F1EA 3OR6B 3L3IB 2H5UA 5HHNB 3FT2A 3IPBA 1UM5H 2ENJA 2VDMB 3WN5C 2JCCF 4LLAA 1XMEB 1FO0A 5F3HA 3ZZ1A 2ZUWA 3SDDC 3RZCC 5K93A 4LOUC 2WVSA 1GTNA 2Y1VA 3SD2A 1YEGL 3S5YA 2HJLB 3LEXB 1FLRH 3LEVL 1ZLSH 4M8VA 2AK4B 2HJFA 4DKEL 4X98B 3SZKC 2XBZA 4E36A 4QHNB 4NPYA 1LDSA 4QGYA 4DHLA 3BH4A 4QRPE 3N40P 3NA4A 4FABH 5D2LB 5KVGE 3ELQA 3SKUD 2IFGA 3RGVA 3RDTA 4PP2B 4XN7A 1BSIA 1GS7A 3MODH 3MV9B 1SM3H 3FT1A 5A6LA 3ARBC 3KW8A 4QHUB 4YOKA 5JHAA 3HG3A 4APQB 5E8DL 2DH2A 3D3VB 3ZTCC 5SWSA 3WN6A 3DDFA 4IHOA 3RY6C 4AYFA 4Q0XH 1OK8A 3KPPA 4IIZA 3U1SL 5FHAH 4HXBH 4TSCL 5E5UB 3T6VA 3VTTA 5LBGA 2ZNWA 5AVXB 4TUUA 3SOBL 2OMXA 4WEUD 3WKMH 1A47A 7PAZA 3OKMA 2RCSL 1C08B 5DWPA 1JJUA 1MH5A 1IZJA 5DRXB 5FCUH 5HHXH 3MUUA 3TO4C 4DGUA 3BAWA 4V1DE 3MJ6A 2WXLA 5B3NA 2D03L 4JZOA 1U95A 3BKML 4KQ0A 2V17L 5E1IA 3W82A 3BVWA 5KTEL 4TVPD 3U83A 2I9TA 4H8UA 3FH8A 2IQAB 2I7OA 3ES6A 4UTAL 2ZOLA 3SDAA 3QCTL 3QDMA 3MBXH 2F1AA 1FH2A 4X6FB 1EUUA 4PJ6A 1TKWA 4P9HH 4XCCH 2HLFD 3B7YA 1TT6A 2I32A 3QEQE 1KGCE 3ZE0F 3H1ZA 1FHNA 3KPLB 4DZ8A 3US1A 1CK0L 2E7MA 4EPSA 3HUJB 2VXSL 4K94H 1MCSA 2APWA 4N90E 3M86A 5D1QC 5HPOA 1MFCH 1KJMB 1HFUA 5F0LB 5GGUA 3I02A 4HIXL 4RDBA 4DEWA 3HC3L 4LDCA 4MQXD 5D6DC 1T89C 1XCTB 3QJVB 1LD9A 2PYFB 3ARZA 4XTRC 3NSYA 3MV9D 3BDYL 4OD2A 4HJ0C 3MXWL 4FQJL 2JKSA 3GI9L 1Q9OB 1ZV5A 2BVPB 3VWKD 2FVNA 1A6WH 1ZT7A 3I9IA 3CC5A 2PTTB 2DQHH 2GUYA 3MROA 1QSEE 2IV9A 4PB0H 2BSDA 2NY6D 1M7DB 5F96H 5G5DB 3S2AA 3V55A 3GGWB 3IJSA 1XGUA 3KPRD 2VABB 4BSWA 1RZKC 4HJJH 1KXVA 3DPDA 4LOFA 4MAUL 4XXWA 1NM9A 4BGLA 2HRHA 4LAJH 2X87A 1LE5A 3QZWA 4L3ED 2PYEE 1U8MB 1IQWL 5LUMA 3FQNB 3CCHB 1U8NB 4GUPA 2ZXGA 1HSBB 3EJRA 5BS0D 5I66B 3QUYC 2A9MH 2GIXA 1JN6A 3SQRA 5DQDL 3V7AG 2WOYA 3WMSA 1AJ7L 4U1LB 4UOZA 1QPPA 4LQFH 2EIDA 2JE8A 4NQEA 4OM0L 3L95A 1Q1PA 1X7QB 3MCLH 3MRMB 3Q9PA 1DQDH 1E40A 1J8HA 4KKCD 1MI5A 1Q94B 1EJ8A 2CUMA 4J3OH 1WAPA 3D4YA 3ZU8A 4YHLH 5JQIB 3RVXD 1BREA 4G72B 4M1DH 4TN9A 1V3LA 1KYAA 2BS9A 2P8LB 3L7EA 5E6IC 4YHKL 5IHWA 2ERJB 5DK0B 4K94C 5PAZA 2HMIC 3V4PH 1O75A 3ARQA 4DUXA 2EICA 3ILDA 4DGVH 1QFWM 1RLBA 5I1CH 3QG6A 1S9XB 1J0HA 1E6OL 4JQVC 2FYVA 1Q8MA 2QQQA 5T5NG 3KPMA 2D9QB 3GDCA 2IGFH 5E9DE 1RJZA 5CJXA 4U7MA 2VLRB 1CGWA 4E5XB 5E4EB 1NOFA 5TF1H 2WZAA 1ZA3A 4JHVA 2M83A 3ARFB 4HK0B 2AXFA 3VI3E 5E1AA 2R0ZL 3KM2A 5LKNA 4IEFB 2N59A 2XWBB 1RUPL 5GJTH 3FULA 3VB8A 5JR1L 4Y19E 4M9OA 3DVNB 3DVFA 1JVKA 1Y0LA 3OHXA 1OM9A 4TPRL 4WU7A 2ADGA 4M4RA 2I07B 5D4HA 3WXVH 3NP4A 3SKOB 1SYVA 4FFYA 1ASPA 3ZSSA 1S46A 2XACC 4YXHL 2ZKMX 4X5XB 2W94A 5IK3B 1OE3A 3RILA 4QD2E 4LHJB 1QFHA 1KCSL 2IJ0C 2UX7A 4HG4K 3H4HA 2X38A 2VR9A 2XWCA 3QIUA 4V1DB 5KSBB 3N3EA 3N43B 4UT9H 2YQGA 3FB5B 3CFBB 4PS4L 5IESL 4AW4A 5BOPA 4L4TB 3S3JA 1VHPA 1XEUA 1I3RB 5EPMA 1N6VA 1KTJA 4P48A 3KW7A 3SQOH 2FL5A 1ECYA 3CVHL 3TO4D 3SBWA 2AJZA 4PY8I 5LXVA 4XMVA 1UVQA 2VAAB 3C5SB 1QNIA 3CN3A 2J8OA 3P4OB 3P40A 1UENA 5AZEH 3MV11 3NZSA 1DO5A 1FG9C 2ZUUA 3PDGA 2IAAC 5IEHA 3CDGB 3D0AA 4KU1A 3BLBA 3X14A 4TOYH 3PABA 4WGWB 2WLYA 1O6SA 3CN1A 4GEJA 3KS0J 1EFXB 1VDGA 1IC4H 4PJ9C 3L4XA 1OAKH 2P5WA 3LY6A 2I26N 3GSXB 1EHXA 2K7QA 4JG0H 1I1AC 3SGDH 4BGDA 4LCUB 3PWPA 4P2OD 3VFWA 2DQGH 2AANA 4R5TA 1VGKB 4E41D 3SCMD 5IQ7L 2UZPA 4J4PD 4P3CL 2H3KA 4FCAA 3G7TA 2EKSB 4MBRA 4JY4A 4MQXC 3AMLA 4DW2H 2FDBP 6PCYA 3KYOB 3NCJH 2IAMA 3VFVA 4L8SC 3AGWA 4P2OC 4BIKA 4G7YL 1I7TA 4HALA 3L6FB 4OZIA 5HYJD 4I9XA 1BLNB 3GMOA 2FJSA 5EORH 4R96A 2W9LA 2MQ3A 1UG9A 4LSQH 2XTSA 1U8CA 4IK6A 5FYKD 1OAUH 5ESQB 3RX5A 3HZMB 2XKUA 2H2PD 5DZNA 1IVTA 3UERA 5E2WH 3ABZA 1ZXKA 1OSZB 3SPVB 2XHNA 4TV3A 1FC2D 3S96B 1OIOA 2H32H 2F0CA 4E9TA 4NZRH 4N8VB 2KLTA 4NO3A 3ZK0A 1T80A 1GSKA 1ZJBA 4QEGA 2Z0BA 2F53A 1F1DA 1UOKA 4CMMB 5D7HA 5G4OA 1O5DT 4NP9A 4GMTH 5J6HA 2GABA 5JIKA 2E7DA 5JIDA 5JTWA 3NJKA 4P49A 2FX9L 1NCAL 1FQ9C 2ZQKA 3IMBA 1G4RA 2HH0L 3MV7E 3V0WH 2AMGA 4P57A 3HPLB 4IRZH 3TLRA 2ZYRA 1EAPB 2EDFA 4DP1X 1EEQA 2V9QA 3OGCA 1P9MC 3QUXC 4Z7VE 2WV3A 5ISZA 5DSCA 5FWQA 3MREB 3RIAK 2K70A 3EO1A 4GRWB 1I75A 2D7QA 3ASNB 1KLFB 2IOOA 4L4TA 4GAJH 3T0BA 3V4VA 3GNML 1ZHBB 4V11A 3CHRA 2XU9A 4LLUA 3V6FB 4XE5B 1U8QA 4F93B 4WNJA 2OJ1A 1E5UI 3UO1H 2EVJA 5C6TH 1DSFL 1ZHKA 2WB1A 4JFFB 5KVEH 4BFOA 2ZE0A 4M8RA 4XP9L 4BFRA 2A6JB 2F5AH 2R4SH 3TWCH 1BYPA 3NFPA 4Q74A 1BZ7A 1DP0A 3HC4L 3OHMB 2E56A 3QQ4A 5I26A 4N3UA 3TO4A 3W9DA 3CU1A 2VUOA 2VR3A 5I23A 5IT2H 1NCWH 1FL5B 2BVOA 3OR7B 3W37A 4JRYE 1PKQA 2NLJA 4P5SA 3FCTA 4F37K 1G84A 3UEZA 1X5LA 3HG1E 2PP9A 1A9EA 3T8MA 5INDA 1B3IA 1I1FA 3QJTB 2HP4A 4JPQA 4N22A 4HAKA 1OAKL 4Q7DA 3EJCA 1G87A 1G5AA 2BXZA 3L4CA 3ARGD 4KOBA 4N2KA 4UM9A 4ELMB 3KCWA 5EBLB 3CQQA 3T0XA 1G1YA 5J4MA 4J28A 1JF1B 4PTTB 5AUMA 1RL1A 1AHKA 1D5IL 4MZIA 5CCJA 3RNQA 3UADA 2DQTL 2DMBA 2RIKA 5LGHL 2UYLA 1WFOA 3GIZL 2PABA 4MWFB 1CGXA 1XZWA 2EDXA 1J11A 2KDGA 2F53E 2N7SA 5E7BA 2FEDC 1JGLL 1FORL 2ADFL 3VMPA 4LBEB 4S1DC 1FN4A 1P4LA 4C47A 1YEFH 3OB8A 2VDRL 4F9PA 4C59B 3SDDA 5AW8B 1K4DB 5SV3A 4AMKL 2BSTA 4FQCH 2A7BA 3T04D 1N10A 4ZNCD 1BQUA 1TZHB 3BWUC 4HHGA 4JG5A 2XBTA 3MCLL 1ED3A 5H37G 1Z6JT 2BVUA 3WS6C 1G9NC 3VG9C 4X5WA 1A1NB 2VJXA 2H6PA 2EYRA 4HHAB 4A7GA 4KK5D 1FYTA 5F21B 5J12B 5FLVA 3TN0A 3DA0A 2H2SC 3PDOA 5JQ6L 5MENA 1MWAL 2AKRB 4PRHE 4KK8D 1NJ9A 1XFPA 5F6HJ 3VW3L 1MCLA 3QEGL 3N40F 1KB3A 4PJIA 4ZZFA 1YDPB 2JCCA 2Q3ZA 1IGTA 3JTBA 4P07A 4TQEL 5HYIA 3WD5H 5FOBA 4WFEE 5D7LB 1UKQA 4L4TD 4EI5B 1C9SA 5FPIA 4XNXL 1ZHLA 5L0QB 3POHA 5MEPA 1DDHB 5A2AA 5CP7B 5AL0A 15C8L 3FBKA 1HHJA 5ID1B 4XMWA 3ZHDA 2NY0B 2VLKA 1BMZA 3DURA 1V54B 3FT2B 3OG4B 5FV2A 3BFWA 1AIFA 3DX6B 3IEAA 4UMSA 5AVRB 5EA0L 2R9HD 2EO7A 2EDBA 1A02N 1QATA 1VZGA 4OLXL 4GLRI 4L3EA 1EAOA 3H6JA 3NFPB 3D85A 4XB8A 3UDWC 2J7LA 2VR4A 1JAEA 2UWEF 1J1PL 4PWGA 5I2IA 3CQFA 3N42F 2AK4A 4E9LA 2P5PA 2C1PA 1RZFH 1RIUL 2CK2A 3SQBB 4QHMB 5F7WC 1LO2L 1E9OA 1KPRB 4L3FA 4XN9A 2ZWKA 5EEZA 4MD4B 1MDTA 4N0YL 3QQ3B 4KGJA 1H3UA 4LSVL 4Z77B 1M9WA 3RFZC 1BM3H 1LEIA 1MIMH 3EOBB 5GGSB 3OAWA 3WFBH 1VIWA 2X1WL 4N2LA 4XVJH 1H9DA 2BLFA 2WBKA 4IBYA 1EZVY 4HPYL 1BD2A 3V8CA 4ELMA 4UM9B 3AT9A 1WAAF 1TMQA 3N42B 4HXAL 3I6KB 2QQNH 3VTAA 4UQDA 1FO0H 4ELMF 5FKAB 4NZDA 1M7IB 4KJYB 1XH1A 2F54B 1JG9A 2PO6B 4DGIL 5ENWA 1RHHB 1NC2A 4OLYH 3WFDH 4FOMA 5C0RL 2O61B 3SCMA 4N8UA 3RZCA 5EF3A 5T1JA 3GPSA 5CKAA 3IETB 4KUCD 1KLUB 1YJDH 1P5UC 1WC7A 5AW0B 3AGVA 3QDMD 1BX2A 1IFHL 1WV7T 1H8OA 1M3IA 2VLJE 3BW9B 3LZPA 5KSUB 2X0VA 3IVKB 1TETH 3AG4B 3H9SA 1KJ2H 5I15L 1ZKAA 2Q8BH 2QSCL 5JMOC 1SXSA 3G6JF 1FYTE 3MLZL 3LXAA 2WVVA 1EPFA 4FS0A 2I9LB 1IEAA 3LTVA 5BS0B 1I4FA 1OP3K 1TKWB 4NSKB 4RCAA 2R8SL 2CO1A 3C09C 2VT0A 3VD2A 1NPJA 1NFAA 4EUPG 3C5XA 2Y07L 4AYSA 3VQLA 4IGBD 3MBWA 3DX7A 4N2OA 2FBRA 2PCPA 2PR4H 1HXMB 3FMGL 3P9LA 4ZSOA 3ARBB 1BAFH 4N5ED 3C2SA 4XXDB 2ED8A 2YPVA 2D31B 1ZDQA 3PHOA 3FUNA 2UY6A 2ENQA 1IAIH 1KB9K 4EN3B 3T0EB 3EJYC 3H85A 4CVXB 4NDMA 4ZX3A 3VRJA 1E7VA 5JDJA 2CLZA 4ZOCA 4AQ1C 1MFNA 4WI0A 3K6SB 3DX6A 1E9QB 1JD9A 2DLTA 2VM4A 3GXFA 3PE9A 4X9HA 4F5CE 3L54A 1G7LB 1Z9PA 5T3ZE 2Q2LA 4XXCA 5IQ9A 1XGRB 4AV0A 5EN2A 3MKKA 3BFQG 1CDIA 5C3TA 3SDXF 2IC2A 4NGHL 4EMZA 3S0PA 1UWGL 4B3EA 4DP9X 1DJGA 1TZIA 4GFTB 1ASQA 1ITCA 2OMVB 1H3PH 1JGUH 3IAPA 5AW1B 2AJ3B 2J8UE 3B56A 3BUPA 3MXVH 2M1KA 4LSSL 4R4FH 4Z77A 1RUAL 4FXGB 1UXLA 2YKLH 5GRUL 3WNPA 2QHLA 4NUMA 1HEZB 1JYXA 4IRJD 4KK8C 4OZGF 4DERA 1BM3L 4NKDB 2BY0A 3I6LD 2OZ4H 5TFSH 2P8LA 4GO6B 2NY5H 2VXTL 4M1GH 2FJUB 1CXLA 4ONHA 4I3RL 1MAMH 3EJQA 4OCSH 4XNMA 5DHMC 4UINL 1SXAA 3GMLB 2O5XH 3CTTA 4RAHA 1I82A 1AGCB 1KNOB 2F1BA 3B43A 3TZVC 5FECA 1BF5A 3BDYH 2XFXB 3Q9QA 3BT2L 3MYJA 2YEVB 3C08H 4ZMXA 2B39A 3F84A 1SDYA 4P2RB 3QEQA 3VFTA 2NNXA 5EBMB 4GT7A 1IGCL 1KLUA 5I5RA 4ZK8A 1VFOA 3PU7A 2GAZA 1IFGA 2B7DT 3NSXA 3NZ8A 4JM4L 3ZHFA 3P3UA 1PZ5A 2AP2A 3NCEB 1JGEB 2DN7A 5BPPA 1JWUA 3VYNA 2I85A 1AG0A 1DVYA 1NKOA 1NBYA 2F7PA 1RQ5A 4GIPD 5DJ2B 5BS0A 2IBGA 4BDVB 3L7FB 4NRYA 1CDJA 1LL1A 4WU7B 1OHQA 5D1ZB 2AK4D 4F58L 2V7NA 4IMLA 1GJUA 3TXAA 1M6OA 3VXTB 5CP3A 3BSGA 1QVOA 1HIMH 2CU9A 4FQXB 1QG3A 4OU3A 2V8LA 4OCYH 3VXMD 4APQC 2J5WA 3PJSB 4N2BA 3IGAB 5B4MD 3HE6B 1G1CA 2Q87A 4XB3A 2P5ED 3FU3A 1YQVL 4F33B 2QQNL 3A4FA 3KYNB 3O8XC 3FCGA 5JPMB 3ILPA 4ZUVB 1R24A 1J7VR 2WNKA 5I1KL 3O3BA 1V7NL 1JCVA 1LEGA 3BP6A 4S1RL 3I75A 3QEUA 1ZLEA 1OAJA 1HHGA 4UUJA 3W5NA 1IUZA 1WQVT 1DANU 3IFPB 3MRDB 2QPDB 5HVHB 4OQTH 5EOQL 4IU2A 3KWTA 2EDJA 3UBXA 1ZRUA 35C8H 1YHPA 1YY9D 3G6DL 3QWQB 3VI4B 1BEYL 4PR5B 2H3XC 1NGQL 2WBJA 4QRPD 4JHUA 4MJIE 4HUVB 2CJ3A 4HWUA 5ITBL 4GG6A 1AMYA 5J6GB 1FZKB 4UZGA 3DECA 1DQLH 1EO8H 1N8OE 3MI6A 3GTNA 4QHLB 5K39A 4OSUL 4PVLA 4YHIA 4ZPTA 2XUWA 1ZA6B 5CBAB 4F7CA 2YUWA 4XBPA 2PLTA 2ESVB 3RBGA 3U2IA 2EADA 1UB5A 4YS4A 5DURB 3AG1B 4OZIF 4N0UA 1UD3A 3WJLC 4NQCA 3EAKA 3O8XA 4O5LH 3P2BA 4AQAB 4BK5A 1LK3L 3FRPG 4MNGB 1TQCB 1FVCB 2WCSA 3NACL 4OZFA 2UX6A 2ZUYA 4LLQA 4OVUA 4D0BB 5MEQA 3FU5A 4HS3B 2G2NA 2L7JA 3NIGE 4G9DB 1UH3A 5C0CB 2NXYD 3UZEC 4UOW1 1QPKA 1CD1A 3UTPE 4HKBB 1I7TB 2CDGB 5DEFA 4P46B 4R2GD 5KANG 3UXFA 3VXOB 4DPAX 2VLME 2FHBA 4YE0A 4HK3N 1YEKH 3EDEA 2ZJSL 3ERXA 5IJDC 3D39E 2QVMA 4R96B 3U2JA 2P80D 2BINA 2EE0A 4L0PB 4IIQB 2G30A 3RDTD 3IKKA 5J0BA 3QEQD 3U48A 2YEZB 3QDGB 3KLAA 4HPYH 4MLIA 4BJLA 4Z7OE 2EDYA 2BW4A 2AGJH 4XMLL 3NBNA 4NCDA 3W39B 1JPGA 3IN2A 3R7QA 3QIWB 3GBEA 5EBWB 4W9HC 5DMGD 1XBRA 1LEKB 2RFXB 3RWGA 1HCYA 1IL1B 1KDIA 1YECH 3L9YA 3ALPA 4ZUUB 3QFJA 2PF6A 4P3WA 3RWFA 5GZOC 2WNWA 3AMKA 4PJ7F 3CFUA 4M7JH 5DVPA 2NXYC 3B5GA 1IAIL 3OXRA 4H25B 4ZYKA 1BHGA 3U0PA 2ICWJ 4JHWL 1OANA 1TO5A 3H0TB 2BNRB 2N1TE 4XMZA 2FZ3B 1JI1A 1EAPA 3J2PA 4QRUA 1RIVH 2NNCA 3V7MA 3L5WA 1GW0A 1LMIA 4WI3A 1KG0B 3O3BB 4I3RH 1OZUA 4AKPA 4BKLB 3ESPA 2GSIB 4BWTA 1E5ZA 1KFAH 3QI9C 4ODUB 2LVEA 4FLSA 1IBHA 3AG2B 2XTJE 3T0EC 3WOVA 3B9KA 4FYRA 4KNQA 4R6UA 1ZXQA 4E9VA 4YAQB 3H2QA 5KYWA 1QRND 5T1LB 3FOLA 2DYPB 3V95A 1HI6B 4LZKA 4K7FA 5BW7C 4X4ME 4KNSA 4DFIA 2NTFA 3CFEA 1MJ7H 1QA9B 4M5TA 3RWJB 4PWFA 3JV4A 4S0HA 5KVEL 3BDXA 2Y5TA 4PGJA 5IFAH 4LKXB 2CJUL 1IKFL 1IGYA 1LO5A 1MPAH 1SBBA 3HUJF 3O9WC 3OAUL 3L4UA 4GW5A 5I75B 4J1UB 1W8NA 4GRLA 1PTZA 2Q5BA 4JO3L 4O4YL 4ANWA 4BH8B 4XNUL 3EYQD 4QRBA 3GRBA 1XGTA 3M7FB 2R2HB 1A25A 3SJVD 2B1HH 3HS8A 2JB6B 3V0GA 2X44D 4AIOA 4JFXB 4JFWA 1OCCB 1FVCA 4M8QB 5E4OA 5T3XL 2AQ2A 1PG7L 5GZOD 3ZMEA 5AALA 4N2EA 1ZSDB 1MLBB 2BIIA 3J07A 4X50A 2HTKC 3BGMB 2ERJC 1HNGA 4TLSA 2AQTA 3WIIL 1S5IH 5K9KB 3ZUCA 1FNGA 2XY1A 4X6DF 3QUGA 1D9KC 2PUQT 1X7TA 2QBWA 1R3IL 4W4OC 3EOTH 2XG4A 3L4VA 4JFQB 3MV8B 1J88A 4APXA 2CRYA 3QPQD 4OGQC 3FFOA 3NCYP 3FCBA 4GI6A 3BYYA 1VKXA 5DJAB 1AQDA 3LS4L 2C9QA 1M1SA 4GAAA 3W0WA 4F3FA 5H94B 1T3FB 3AM8C 2O5NA 3CFKA 1MAKA 1JNNH 4MD0A 2ZSWA 5BRQA 3MC0A 5HDWA 4LF3B 4N2NA 3TM6A 4UT9L 1O9WA 5DMGC 1XGYH 3TGXA 4Y16C 1AZVA 4HEPG 2J5LB 5IW6A 3IMUA 3LZFL 1NTDA 3A6CH 3TN0B 3QIBB 1H8LA 2H2PC 4YDZA 4Q6IB 3V9CA 5ICYB 2FZ3A 1CL7I 1F42A 4PJIB 3GRWA 4JN2B 2X40A 4CN4A 1N5YH 1A0QL 3UBGA 3QIUC 2GJPA 3ARWA 1TVHB 1A3RH 1E28B 1V3KA 1OP5K 1IKNA 7TAAA 3QDGE 2FQFA 4UQCA 3MLUL 1DDHA 2X89D 3VFUB 1FVDB 1G7HB 2YAFA 4QHPA 1CYWA 1D9KB 1USQA 2C9VA 4PRIB 5CBEB 2DB8A 1PLGH 4XPGH 3F7PC 5DJDB 2CRZA 1Z5HA 4YAQA 3EJZC 3BVNA 4UT6L 4XNZC 3TEWA 3O6LL 5DVOA 5I28A 3QJXA 2VLMD 1Z0MA 1ZV2A 4DEUA 3HBZA 3CJJA 4GKNA 4KJWD 2G0KA 2OMZA 3AREB 1T5WB 3BZFB 4DOHB 1D9KD 4FXKC 4LIQL 3MUHL 4OFYA 5LVEA 4K5LA 3V5KB 3WENA 4CGUB 1GMEA 4JM2A 3GEWB 4RDQG 5KZCB 4LU5H 1A2YB 1S5IL 3IF1B 1XWVA 3BCDA 5E6ZA 2ZKYA 4D8PB 4G7SB 5CEZH 1HDMA 3MLXH 4KKNA 1KTBA 2HAZA 1KC5L 1A1OB 2NXZB 3FT3A 1UWXH 1WHOA 3O2DL 3PWLB 3HAEA 4M1CD 3EZJB 4HETA 5DD6B 5EZOL 3TN0D 1LEIB 4FJ6A 3SYCA 2ITCA 2ATKA 3D05A 3FQXA 3TT3H 4W6XB 2OBGA 2V2XA 3BWZA 1DBBL 2XVBA 4BFIA 4NWTL 5D7SH 5JYMA 1FL3A 5E6SB 1U0QA 5MP6H 2JI3A 3QJSB 2DDQH 1KTCA 2VDKL 4U6TA 3JWNG 5T1KA 1BJ1J 1WA2X 5FA4B 3WY1A 4Z7UB 5C07A 3IU4H 4FQIH 2VUKA 4ZFZB 5MEOA 2HVKB 4PRPA 1RZGA 4Y4HB 2B9AA 4X6DB 1WC7B 3A6CL 2V5TA 5FDYA 1M57B 1HH6B 1UH2A 1TQUA 3AAZA 2Y36L 4XP9H 5FUCE 2J8HA 1TQBB 3AU0A 2W07B 3CXDL 4MLSA 1NCDL 1SQ2N 2VLLA 4FLRA 1KBGL 3PL6C 3D30A 4KDTC 4LAQL 1JBJA 2CCVA 2X70A 4K7PL 2YGQA 3ZBMA 3UJJL 3QJQB 5AEAA 4HVBA 5FGBA 1JZGA 2E76C 3QO0A 5I8OH 4IU3A 5J6SA 5LWYH 5HYFA 1HHHA 4J8RA 3F7YB 4UF7C 1G7PB 2H6OA 4QWWD 2OYPA 4ORGA 4ERSH 4FI8A 4ELDA 2H9GB 4M48H 2PW2A 1OGPA 4LHQB 3MBED 3U9PL 4J3VA 3FTYA 1SBSL 4OJYA 2WSDA 4NAQA 2UUDK 2NQ3A 4M1CC 5C0BD 3UGXA 4YHMH 4Q52A 3STZB 5CD3B 1TVBA 2B14A 2VM3A 2JELH 5JOEA 2E7LC 5M94B 1TQVA 3IGUA 4PRAB 4RAUB 1S7WB 4JDVA 2EDDA 1T2JA 4KOCA 4NDMB 5GGVH 2ALAA 3TVMC 3ESUF 4GW4B 1SOXA 1SZNA 2HT2D 2X28A 3QR0A 2X6CA 2AGJL 2YRPA 4FNTA 3FN0L 2VH5H 3VG0H 4UAOB 4XZ4A 5HI4C 5CD5D 4BFBD 4PJFF 4PB9H 3MGOB 4LESA 2APXA 2W0PA 4OLWL 2BJMH 1WE5A 3BESR 3V0AC 1GA2A 1A9BB 4FZEL 1NCUA 5ISZD 3V4PA 3UTTA 1MFAL 3WUWB 4M29A 3VXPA 2WWNA 3D39A 3HI1A 1QI3A 2H32B 4NT6B 4FXKA 2R29A 5TE4H 3TBVA 3NIFB 2Z93A 3OAYK 5C9JA 4M5YH 5C70A 3QXDB 2BDNL 3ZW3A 3LZFH 3ULSB 1OO2A 4XOCA 4OCRL 5EOCH 4WWOA 2AF2A 4HGKC 3TA4D 4ZO6A 3WNNA 2C8NA 3OHXC 1TJIL 5C7XH 5D96B 3EO9L 3C5ZD 2OTUB 3RTLA 5FA3A 2XN9E 1P2CA 3L3GA 3MOBL 1ZY9A 1QEWB 3VTMA 2WLKA 2XKNA 2WYHA 4HWBH 1U92A 4RMBA 5B8CC 3QIWD 2E27L 4OGYH 1UD2A 3K4AA 4ZBJA 2O5YL 1UD5A 3BE1H 5JHDA 4ODWA 5KJ7E 3HG1D 2XXFA 2BVEA 1ORQB 1CGTA 1NEZB 4ZFFA 1CXEA 4MAYC 2K0RA 4BE6A 2Z8RA 4GBXB 1AI1H 2JK5A 1CDCA 1T7XA 5EO9A 2TSBA 5CFHA 2BVYA 3DK2A 3BWSA 1N4XH 1T6WA 2TSAA 4AQEB 1ZVYA 2WLIA 2KZKA 2HX8A 4OI9A 3P11L 1I7RA 4P5RA 5C71A 5IKCA 2IDQA 1CIDA 1OSPH 4PUBL 4ZTPH 1KB5B 3ZT5A 3KR3L 4LNVA 4A7SA 1OKEA 1NMAL 2WXQA 2PWDA 4JAMB 1FAIH 3UAEA 2ZOLB 4KO6A 2BIHA 3PY9A 1QHPA 3B9KD 5HGHA 5HJBA 2D9CA 2DD8H 4TVPH 5FM5O 3KVQA 1YEWA 4P2OA 1VRSA 3JSSA 1MELA 2XWTA 1UA3A 3K2UL 4JZNA 1FFNA 1KBWA 2WK2A 3EJPA 3GIVA 5GS2D 4ZMTA 4JB9L 4KK6D 4YHPA 4ANUA 1H6TA 2BHYA 3HI6L 1MRDH 5IB4B 1PCSA 1I3GL 4ILDA 4JRXD 3MRRA 4CDGC 4WNSA 1MFMA 4MAUH 2MNWA 1OCOB 1QLEH 1P4IL 1OTTD 2GJZA 4HJJL 1KCSH 3UTZB 3QNXA 4Y9GA 2IGTA 4TLUA 3SE4C 3STZA 1MOEA 4TTDD 4HD5A 2X0WA 4NNPL 4OCSL 4XVTL 4M62H 4LPWA 2E3VA 1M6UA 3T2LA 4L5FL 4U6XA 3CH8A 3UPRA 3LHPH 1FPTH 1ZVNA 4I8DA 1L4IA 1XGYL 2JJSA 2W81C 3D33A 4N3TA 3QFJD 4N8VG 4FABL 4TNVF 4LKCB 3WLBA 1AE6L 5CZRA 2WOBA 4DP8X 4DO6A 3ILEA 3SPJA 4MSWB 4AYEC 1D7DA 2G5BB 3QZPA 4AVKA 3LNDA 4I3SL 5KOVC 1HYSC 1ET5A 3QPKA 4KI5D 1X9UA 5I0VA 4PGBB 3M1BB 5CUSH 5ERWA 2ZIDA 4JVWA 4UILH 4NZTH 1XX9C 3QZWB 2XQ0A 1DJYA 3C09B 1SEQH 5DC2A 4RX4D 3APCA 3V0JA 5IHBA 5F7DA 3HS0A 5FUZL 3UYPB 1WZ1H 2H32A 3DJRA 1CWVA 3WIHH 1ZA6A 2MCPL 2ROXA 43C9A 4MZ3A 1TUPA 4AYDC 4YFEA 1UADC 2CXKA 5LNEA 1USZA 1O9ZA 4M4PA 4YUEL 4WFGD 3MRPA 3STLB 1G0YR 1EJFA 4QRRA 1FO0B 4X5QA 4ZUSB 3E38A 3OV6A 1FGNH 4TLKA 5B39B 5C0IA 2H3NA 1CLCA 5IJBC 4D0BA 3O3EB 2FSEB 4M3HA 1X5ZA 3FHEA 3VFNB 2VMEA 3WLWC 3LEXA 2BCMA 4EDXB 4JFOA 4PW3A 1B2WL 4ZD3L 3LIZL 3S48A 4AQ1B 2HT4C 3NCBB 3TO2A 3VU1A 3V52L 2XN0A 4IJ3C 3IDXL 3DOSA 3REVA 4NUQA 5EU5A 1YO4A 2YD7A 4WGKA 1B6UA 5E95B 2O5YH 4A2DA 4MQ7A 1RV6X 2NY6C 3VVVA 3BGFB 4WW1A 2ZJSH 4NI3A 3VCLB 3Q2CA 3WHE0 2YA1A 2JV6A 1A7BA 2PYEB 3HC0A 1A3QA 3O6FB 4HK0A 4DPRA 1E4XI 3RL2A 1XCQB 4NZFA 3ZPDA 5ALBH 2KS0A 4ZNEA 4ANVA 1BVNT 5E00A 3BP5A 1IM9D 3LCYA 4Z7NE 1BZ9B 3WN5B 1TJGH 4NKOA 4PH8A 3QFJB 5JORA 4RLDA 1FCCA 4OIAA 4CSSA 5EIQA 1MCQA 3EGXB 4H2AA 4FG4A 4YC2B 4U6VL 3EHBB 3PCYA 1MI5D 5IB4A 1I7ZA 3EFFB 2NR6D 3VQ1C 1U8IB 3GS7A 2GJZB 4XNYH 1WTLA 2NNAB 4R0LA 1XV8A 3MR9B 3OKDA 5CUSL 5CGTA 2O26U 1NUNB 2ED9A 4FFZL 4FHJA 3B9VA 2O5XL 5KSBA 3UZEA 3ES6B 4AENB 3P9WB 1P69B 4RQQA 2BY2A 1CBVH 2VMCA 3C9NA 3FSAA 5D2NC 1INDL 3IE9A 3GXNA 1UQSB 4B9PA 2EINB 1A6ZA 1W0YT 4KHXL 4LB8A 1CLOL 1OGSA 1PX8A 1FZMA 4OZIE 1KJMA 2DTSA 1MCFA 3JUZA 4HSCX 1KYUA 1M71B 1VCBC 4HWBA 1K85A 1U8JA 2YPVL 3C60C 2V17H 3DBSA 2CO7A 5BZWB 3HR6A 4DKFH 5BVPL 1MHHB 2QVFB 1R5VB 5FKPA 1ND0A 3TFKC 4YDVB 2NY2B 2CJSA 4RRPG 5DQJA 1RFDL 2ZYHA 3HZYB 2L04A 3UTSD 3KWVA 2ZP8A 4OGXL 1EEUA 5ETUB 2AEQH 3HHSA 1QFWI 3TYFB 5C07D 1WUZA 2J8UA 4P2QD 3QDJA 3ARBD 4FNQA 4WFHE 3ULUF 4IHOB 1KELL 1UEYA 2ODIA 2AMUA 3Q5OA 1CXFA 4FA7B 2J1KA 1F11B 4ENED 4ZUSA 3SDXB 2ORBL 1WBZB 4QNPF 4XOAA 1CTNA 1LK3H 5DRXA 3UC0L 3EH2A 4KNTA 4JY6A 2ZOWA 3MV9E 5FUOL 1II4E 4ZTOL 2P45B 5D5MB 2X2IA 1T4WA 4LARL 3RIFK 1SFDA 4FQJH 4MDIA 4MNQD 1EEYB 4WUUE 1OF2B 4OIFA 3RX9A 1MJ8H 4N20A 4AZ8A 1DEEB 5DS8A 1PCXA 2VYRE 3FO9A 1VESA 4YVNA 2EUZA 1X7QA 1WA0X 1YYMH 1J8HB 2ICEC 2OPCA 4LHUA 2C7FA 1YAIA 3OPZL 4QF1B 3PHQB 3ZT6A 1FHGA 5DJ0B 5T1MA 2MCAA 4EQ3A 1B9ZA 3RVVD 5B3SB 3FK3A 4ICWA 5DJ8A 2UV3A 3BRFA 4HV8B 1T7VA 1GVIA 1CIUA 3PIQB 5F3BA 3DJZA 4PJEE 3VXNB 1SGKA 3I02B 3KJ4C 5SWZE 5JW4M 5EU7E 1VZIA 3EXJA 1DN0A 1XF4B 4G6MH 4ESKA 2VLKE 3D0VB 3FH5A 3INOA 5IQOA 5E99L 4Y5YA 2DKUA 1LGVA 1I7ZB 4NENB 3EJTA 3ISRA 4LVHC 3E6FB 5EUOB 3TIDA 4YDLB 4K7PX 3RWIB 1BBJB 4UQAA 2MPAH 1P6AB 3Q8FA 4KKZA 4PYHA 3OKNA 3MLVH 3IJSB 4G8AC 4ODTH 3Q7JA 3GZOA 4NN5B 3QXAA 2YK1L 4HGWA 3KEDA 2Z91B 1Z7JA 1A8ZA 4FYTA 1RPKA 3N9GH 4LSRL 2XG5A 1Z3GH 3QHZL 4AXWB 3T1WA 1KTLB 1K4CA 4ELKB 3GMMB 1IC4L 4AOFA 3D07A 1QLFB 3QYMA 1UKSA 1FZMB 3I3EA 3QCVH 1NCBL 1URIA 2GK0A 1HH9B 2NY0D 1JDDA 2IDSA 4YXLH 3MRMA 1YYLH 4MMZA 4WQOA 1WHPA 1CFNA 3I9AA 3DRQA 3AZUA 4PG9B 3ZDYB 1S7SA 1H3GA 3MRKA 2QLYA 3K81A 2FO1A 4J2XA 2F5AL 2DQTH 1TZAA 1DLHB 3K0WA 9PCYA 4NWUL 3ZKSD 1MJ8L 1SY6H 4U33A 3DX8A 5FO7A 35C8L 5JW5A 3VG0L 4AITA 5DD6A 1N8ZB 2PWEA 32C2B 1NQBA 5HI5D 5D5ME 2B59A 2D7TH 2YC1A 1U21A 4S1DD 3NK4A 3BKYL 3FQ1A 5L6YH 1JCKA 2DWYA 5D2NA 3FU6A 5BO1L 3VD4A 1Y07A 4PTTA 5AUMB 5B7EA 2ZX8A 3Q8EA 2F8VA 2VXVH 2ZCHH 2J1YA 3L9RA 3ZY7A 4OD3L 1N18A 4DGIH 2DQFA 2EUWA 1Y0LB 4QF1A 3HMXL 2OMXB 4YUEH 4L8DA 2I07A 3LOWA 3BC9A 1C08A 5GGRY 4DVBB 5I16A 2HFGH 4TRPH 4XAKE 5E8EB 2EC9T 2W07A 4N6RB 4Y4FD 4JE0A 3LN4A 1P5VA 1U3JA 2XZCL 3OF6D 4XAWL 2FO4A 5IMOA 4C56E 2IAMD 2UWEE 3P3YA 5D1XB 4FHKA 4NUJA 1OARH 4XBGB 4YEEA 5C0FB 4OZIB 3CFDA 4ONFH 4S10A 3QO0B 4Y4FB 3UBXG 3BH8A 4NUGL 5T5FH 3O2VL 2X6BA 3L3KB 2OL3L 2Q3XA 2BRQA 2WXGA 3O3AA 4IDLA 1WGVA 4KO7A 2CDEA 3LRGA 4OIIH 2EYRB 2C3VB 2K4AA 4HHAA 4JKNA 3TASA 1KY7A 5IOKA 1S7TB 1GGIH 4KVNH 4Y19B 2R69A 1OSZA 2ICWB 4Y2DD 3EYUH 3RPIA 3CWGA 1OD9A 3S37X 1JZ7A 4NO0B 4JFDE 4UQ3A 4YE4H 1MCDA 3FRPB 2GTQA 2VZTA 4PP1C 1QACA 3L2NA 5C8JA 5D7JD 2BX5A 3GC3A 3QARA 3WU1A 4JN1H 2L0DA 1A3LH 5B7MA 1FC1A 5I1IL 1WBYA 5C6WH 4GKZA 4HKXA 4P3DB 3D18A 5FW8A 3DIFB 1DVUA 4X99B 3WIFA 3LKSB 1ZVHA 4MNQE 4XNUH 3INUH 4GXUM 4LGPB 1EV2E 2GK0B 3OPZH 4QXTA 4XN2A 3V79C 1LWHA 1JYVA 4AY0A 2IV8A 4L2YA 5LAXA 2VO8A 4FYQA 4MMZB 3D0LB 4XVSH 5HGAA 2N1KA 1ZVSA 4WO4B 5I30H 2WPGA 3IU3A 5BO1H 3O6KH 3HS0C 4BELD 3T3PF 1DLHA 5J11C 4GRMA 4JFVA 3TBVB 4AGMA 4GJTB 2ZTBA 1INEL 2ESVE 3II2A 4LLWB 4NQXB 5LB1A 4K3JH 4AL8L 1AR1B 4N2MA 3UJTH 1PIGA 3QG7H 3ILQC 3NFNB 4UYPA 4XHJD 3NK3A 2OP4L 3Q2VA 3S3PA 1BD2B 1MXGA 2B0SH 2FT6A 4QJ3B 4X5RA 1BW8A 1EA9C 3PWJB 3O4LA 3OZ9L 4YPGB 1NIBA 1G0XA 4ZD3H 3LKOB 5EN3A 4NHCL 4NQDB 1RHHA 4K7PY 3SGJC 1PKQB 3PGCB 4LCYB 4NN6C 2BP3A 3ESNA 4WI6A 2WXFA 1ETA1 4KKBD 2FHCA 5DTFB 5E8NB 1BZQK 4CSPA 12E8H 2KLRA 4WJKB 4AMXA 4DN4L 3HA0A 3A21A 2Y07H 3ULUE 3RUGA 3ARDD 3H9SB 2NY1C 2QPUA 1QNZL 2TRHA 4MX7A 4Z7NF 2B5IB 4N9GA 5D70H 4J5VA 4KAQH 1NAMH 1SEBA 1T22B 1YEEL 1A3RL 3KXFB 4J6RH 2VDQB 2OI9C 3U4BH 4W81A 3GSNB 2R0ZH 1MY5A 1QFWL 2ED6A 2XVKA 3BH8B 4UOJA 1HXYB 4CNIA 2IAND 3MLWL 1UT1A 4G42B 4HMEA 2BNQA 4F8PA 1KF9B 1T21B 4UBDC 3ATEA 3ARGC 3MRNB 4NQED 1FN4B 1JTPA 4GB9A 4LLDA 3UZQB 5I75C 3UTZA 3H9ZA 4I13B 2NUPA 2JKTM 3QNXB 4XVSL 4OB5L 1T6VN 4HLZG 2WXMA 2W9EH 3CZLA 1H0DB 3I6GA 5ACMA 2JXMB 5CILH 4WSGA 2FE0A 3FO1A 4MCYA 3RVTD 4FQ2L 4PJBE 3S88L 3HFML 5KBMA 3GDBA 3P3SA 5F3FA 2J43A 3FO0H 4YGAB 3B9AA 3MCYA 1NFDA 3EFDH 3LRSA 5DD5H 3T3ME 3LD8B 2LU4A 4QXTB 1E6OH 1IC5L 1KEMH 1Q1JH 1MHEB 2GIYA 5J3HC 1FZJA 3ZE2E 1SQMA 4BQ9A 4ZMWA 1NCGA 3HHRB 3FTZA 2P43B 1D6VH 1PLBA 1AHWC 4KUZH 3VWKA 2B0SL 2ZSVB 1DYZA 1NPNA 1IJNA 4P59L 4GXVL 4H26B 1T1WB 3IMVA 2A9AA 3UJJH 5KYYA 5CXPA 3UTSB 4F2MA 2E6PA 1RP9A 2BWIA 4YFLF 1NCHA 4EDWH 3WEAA 4FFTA 1UZ6F 5I8OL 5EHFA 2K6YA 4Z0XA 2YD9A 1DL7L 3CXHJ 4QOKB 1BVZA 1U93A 4MJ6B 3T08A 4NNYB 1BQ5A 1S9VB 1RCYA 1TF4A 3PABB 3X1NA 5FV1L 4ZDHA 2JJWA 1OT4A 3JWNC 2ZF9A 1X4YA 5DLLA 4QCIA 5HTSA 3MRBA 4JJOA 4K3JL 4AL8H 4BRVA 1XDTT 1MF2H 3GINA 2P8MA 4ZUWB 1S3RA 4RDQF 5DD1H 1T7WA 3V4UL 1BM7A 4WFED 4JO4H 4JM4H 3FYIB 3WO4B 1AAJA 3B3BA 4PJ5E 4ZMOA 1QOKA 4M5SA 4MAYD 5EUKA 3TN0C 3B37A 4K8RH 1DHKA 4IOIA 3U9WA 5LXGH 4NCC2 2PCYA 5E08L 3ARFD 5I1IH 2X9XA 4RFEB 2Q3AA 3LHAA 3VFTB 1R3HA 5CR8A 1G5GA 4YSAA 3MDJA 2A38A 4HLEA 5GGSA 4M43L 1KV7A 1F6AB 1MI5B 1Q94A 3QQXA 4H2CA 2R27A 3QORD 5EU7C 4F9PC 5J06A 3TT3L 4L1TA 2C9AA 1FJ1A 1U91A 4CMHB 4C56B 1JV2B 3KNBB 3SE9L 5HGBA 1YA5A 2EE9A 2XN1A 1M7IA 1YEHH 4KJYA 1QHOA 4O51A 3BKJH 2RMNA 2KPNA 4NP4H 1QSEA 1A1MA 2A0LD 3C6LA 4B9KC 1IGTB 1JZFA 1DJWA 4AQOA 4OLZH 5GGVL 4N26A 3NJVA 3IETA 1J5OL 4UZSA 5EWIH 5DQ9A 5BV7C 2QV4A 4EZKA 1ZOXA 4KZCA 1WP6A 1XVSA 2AERT 1JVLA 1XF3B 5BS0E 4BHUI 1GZHC 2ZX6A 3KPSE 3GYRA 1KV3A 1MVFA 1KJVA 1XGQB 3WEMA 2NUPB 2WBXA 1UXSB 3CIAA 4IDJH 4RGNB 4IEFA 4QXUL 1ZLDA 1OGTA 2DMHA 1WPCA 2FX9H 2EVHA 3NSFA 3CFQA 2DOCA 3FO1B 1I8AA 4FX5A 4L37B 1P6FA 4MCYB 3FQWA 5A2LH 1E3FA 4FQXD 4YR6B 3KHQA 4H44C 1ZLWH 3U7WL 3VFOA 4L3EB 2AW2A 3NJMA 1B6DA 4URKA 1H5BC 5CSZB 4X6EB 1CDBA 2Z0UA 2E4FA 2IGLA 3IDJA 5CLZA 1ID2A 3N6YA 5D1ZD 5GRUH 4GAYB 5GS1C 5KW9L 5I66A 5AB9A 5CJBA 4PRHD 1FZJB 2NY6B 1Q0EA 2WYIA 2FEJA 4KHTL 3IAQA 2VDOH 4UOQA 3QDJE 1GGBL 2L7EA 1QKZL 5D93C 3CGTA 5TDOB 4R4BA 3MRFA 1JYNA 4V1DA 2VXQL 5DA0B 4JM2C 1AZCA 4ZX6A 4KITB 5JW4R 3RZCD 2NY4C 1D6EB 4P2RD 2KT6A 4PRPE 1HHKA 5GS2H 3I6SA 1WICA 4ISVB 3IDGB 1QX1A 1FBIL 1NC2D 3NCMA 5IBTL 2AJXH 4WI0B 1JP5A 5F8RC 4KV5F 3CSGA 4MCMA 5GS0H 1FA4A 1HT6A 3O8XB 1T1YB 2P47B 4AUYA 3CZEA 5JPMC 3K8MA 1S9XA 4Y7MA 5EN2B 4HZLA 4DIXA 5DLMH 1TR7A 2J2ZB 1FVEB 3ZKNC 2XN2A 1DVZA 3QORB 3DX1A 4F7TA 1WH0A 3ZOAA 2PCXA 4HIHB 1X5JA 1GZQA 4LGRB 1CD1B 3VAEA 5EZJB 3EH3B 2HUHA 3ULVF 1WF5A 4G8GB 2IH3B 4IRJC 1ZLUH 4L1SA 1JVOA 2BS8A 2R1XB 2MKLC 5FO8B 3UP6A 2VDPH 5EOQH 1EHNA 2K8QA 3MO1A 2DBLH 3QXVA 3KWWA 3MLRL 2BCKA 1YN7B 1CG9A 2EXWC 2QV2A 3X3GL 4PWIA 4H7VA 4X5XA 2CE6A 2ZCLL 4ZMAT 3A5VA 1L3WA 1HXMA 3P9LB 3R0MA 4MCZA 5KSAD 3SDDB 2CQVA 5E2VL 4RWYL 4PIRF 4K2UL 1ETZB 3CN2A 4ODVH 5DO2C 4BWWA 3ZE0B 2XXMB 5IUCA 3MXVL 5CGYD 5D2LF 4OTXL 2IH1A 3T0ED 3LXUX 4DKDC 3DXAD 4PV9A 4JE4B 4NNXA 1CR9L 4H25A 1UCBH 1KCUL 3ETBJ 1NH6A 1UD8A 3QUKA 1YMHA 1HL8A 5ILTL 4CN6A 5F88B 4PJCF 3RWIA 2A74A 3SOBH 4PJ9D 3U79A 1G0DA 5EWIL 1OB0A 3MRIB 1EO7A 4UM8B 1KCRL 3J8F7 5G55A 3CMGA 4G80A 4KJPD 3FPXA 4QRUB 4KVPA 3NSDA 4GINA 1NGZA 2JJTC 4PJAF 4Y4KD 3EBGA 2VLJA 1WEJL 2DV6A 3T8VA 1XO8A 1JZ4A 5K33A 2N4IA 4MA1C 4G43B 1U3YA 1R5WB 1RIVL 1T7YA 4BQBA 1NOAA 3FUEA 3VNZA 5I0ZA 3GMMA 4FI7A 3ZKND 3WTXA 2YIHA 3MVSA 5JZ7D 4POZD 2G5UA 1KFAL 2OXGA 2VW6A 1EEZA 5B8CB 1IAIM 1DQTA 1PF3A 1IVLA 2ZWZA 3PJSA 1I9EA 1U6AH 3CSYB 3HG4A 2X4TA 5TDNB 4Z3IA 5HY9B 5JHLA 2ATPA 2ZWLT 2F7QA 4DSYA 3CDZA 3MRFB 4NN7B 1CFNB 1MCKA 1CTMA 1T89A 1SXNA 3C2AH 3EGDB 3LMJH 4P5TB 3D85B 3EO0B 3GXDA 4D9LH 5ISZB 1YEDB 1T1ZB 1BQRA 3QNZA 2YSSA 5AB1A 3UC0H 4UQ2B 1S7RA 2KMWA 4NC1C 4QRQA 3L5JA 4U6VH 4YBQD 5MERA 1NIFA 1T5XB 5LDSA 3BZEA 1QTPA 2B1AL 4YDMA 2F54D 4L1LA 1NDGA 3DETC 3ELAT 3A0OA 3RWCA 3WGVB 4YVUA 3M6DA 3FO2B 3RX7A 2LGNA 1HKFA 2VL4A 5IR1B 1LO4H 4PLOB 1IGFL 4R83A 2DAVA 1W0WB 4M8QA 5K9QG 2Y2TA 4UM9D 4V2CB 5D2NB 3X3GH 3F5WA 3MRCB 5TK4A 1Z9MA 3CLEH 1PZBA 4X9GA 4JFFE 4L8BA 1MVUB 5JDSB 2YJQA 4M6AA 2C34A 3I3DA 2VN5A 2VMDA 1C7SA 5FGRA 3S96A 2RH0A 5T3ZL 3UJTL 5DVNA 5J1AA 4XPHH 4Q0XL 1M05A 4J27A 5GS0C 1U3NA 4JFUA 4RA3A 3UPAA 4PRNB 1NBCA 4L0YA 1K72A 5C6PB 4NKIH 1IAKA 3IVKA 1UB6A 3RP1A 1P5VB 1RZJC 5DJAA 3DSFL 3W0WB 3CFJA 4LCWE 1NBQA 2HFGL 4XX5A 2CIIA 2WLNA 5LQBL 4OLEA 1MJUH 5JW4Q 3D5OF 2MKWA 4KKQA 5F1SA 2ADJB 4XPTL 3QJUB 2C3HA 3O9WD 2NSQA 1FBIH 1QQDA 3BGAA 3SB3A 4I85A 1WFTA 1YMHB 2QGBA 5DHVB 4EI5D 5IHLB 4FERA 4YFLI 3IMWA 3NDYE 4Y4HD 5DZOA 1NEZG 4DKTA 2G75B 1OVZA 5EOTB 3TCXA 4B5ZA 1GC1H 1EFQA 2QKSA 4K9EL 4JDZA 4IS6B 4YX2H 4Y0GA 2X4QA 3QZLA 3WO3B 2JF1A 1QSZA 2JLPA 3QJFA 1AKJA 2BNRE 3IGLA 4GG6B 4L18A 2PMZA 3FBQA 2V3EA 4KTEL 5J9PA 4EZLA 1FVDA 1G7HA 3V6ZB 1JSYA 4UIMB 3ZKXC 2OK0H 1YSOA 2ZAGA 1RZ8A 1TZOA 3NZHL 4HYTB 1HXKA 3CN0A 5BQ7A 3QQ4B 4Q6KA 3RTQA 4GEIA 2A4CA 3EOAA 3RDTC 3HHMA 3O6ML 3WFBL 1QSFA 1T04A 3V0IA 3RJDA 5I1HL 5C07E 3L45A 5DHDA 3BWAB 4OZHE 1IMHC 5JYLA 5HGAB 2DLFH 3ATDA 3UTTE 5INDB 1UXMA 5IB1A 1CFSA 4K23L 1IM3D 4NWTH 5HDRA 1E6JL 4YJZL 4CADA 2LTQC