1SFDA

Oxidized form of amicyanin mutant p94f
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
b'DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTFHPFMRGKVVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title Structural Studies of Two Mutants of Amicyanin from Paracoccus denitrificans That Stabilize the Reduced State of the Copper.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 25
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1sfdA00
2HX7A 1ZV2A 3PLYA 2BW5A 3EH3B 2BP8A 1GYCA 4F2FA 4Q8BA 4YVUA 4HHWA 3QJVB 1SHWA 2JXMA 2IAAC 3AW5A 3TA4D 4YSOA 4M3HA 4DPCX 2B3IA 1QLEB 3NP4A 1JVLA 4KO9A 1E5ZA 4N4YB 1A4BA 4YSTA 4G7SB 1NTDA 4DP7X 5LDUA 2H5UA 5B1JC 2FQEA 1PLCA 3ABMB 2W8CA 2ZXWB 1XMEB 3QJRB 4AKPA 2MTAA 1PLAA 3FYIB 4W9ZA 1FWXA 3SBPA 3ZDWA 4F2EA 3NSFA 2GC7C 1MDAA 2HZHA 3JT2A 3IE9A 3NJJA 5AFAA 3UABA 4KOCA 1QNIA 3AG3B 2DY2A 1GS7A 2EIKB 3CDZB 4A66A 4E9XA 2PP7A 1T5KA 2AANA 1BXVA 1IC0A 3UAAA 2WO3B 4BDVA 3ABGA 5B7MA 4P5SA 1JVOA 1JXGA 1J9QA 1JERA 1A8ZA 6PAZA 1E67A 3NJIA 4JHVA 1XB6A 3PPSA 2GB2A 3HB3B 3WNJA 2FWLB 3T9WA 3WNIA 2YAPA 1SNRA 1EZLA 1OOWA 2YAQA 3N2JA 3X1NA 2BP8B 2HX8A 1WAEA 2BZCA 2CAKA 1ZPUA 2XXGA 3NJNA 3T6WA 1AOZA 2TSAA 1BQRA 2PPCA 3T6XA 4BXSV 1KCBA 4E9WA 3TU6A 1ETJA 1J9TA 4A2EA 7PAZA 4A2FA 1ADWA 2PLTA 1PMYA 1X9RA 2I7OA 1TU2A 4NERA 3FPYA 3IN2A 2VSKB 3OQRA 3SBRA 2QPDB 5D4IA 4CSPA 3KW8A 1DZ0A 2VW4A 1PZBA 4NB7A 1RCYA 1NDTA 2DYRB 1GY2A 1TEGA 3NT0A 3SBQA 2XXFA 2AZUA 5ANHA 3FPXA 3NJHA 5TK4A 1GY1A 4HIPA 4AKOA 1AZUA 1AANA 1SFHA 2WSDA 2ZWNA 1CC3A 2VM4A 1CYWA 3NJFA 3HEIB 1AS8A 2R7EA 4DP6X 4GP8B 2CBPA 2AVFA 3X1FA 2CUAA 1M9WA 1PY0A 1OE2A 4BWTA 1M56B 2EIMB 2Y1AA 1JXFA 2GBAA 5I5IA 3ERXA 3IBOA 4AX3A 1PZAA 2WO2B 3V9CA 4BDVB 4E9TA 4L0PB 2YXVA 3ASOB 4DP2X 3X1GA 1L9QA 4KNTA 1AG6A 1FA4A 1W6LA 1PCSA 3UGEA 5PCYA 1KBVA 4GP5B 3H4FA 2FJSA 1N70A 4BXVA 3GYRA 3PCYA 1W8EA 5B1BB 4FAAB 4E9QA 3FSZA 2XYBA 4FA7B 2CCWA 2GSMB 2IDSA 3PAUA 2FT7A 4HAKA 1R1CA 4BK5C 3N55A 2UXFA 1OCRB 2XV0A 1X9UA 1WA2X 1GW0A 4KOBA 2DWSA 3EHBB 3NYKA 1NWPA 3H4HA 1XB3A 4AZUA 5I5MA 3FYEB 3AY2A 2TSBA 3NJMA 3EH4B 1AZCA 1OCCB 4HCFA 1WS7A 2UXVA 3NJLA 3IN0A 3AZUA 1MZZA 2P80A 4G71B 5B7EA 3ZX1A 2FT6A 1JZFA 3UADA 5I6MA 1NPJA 2QPEB 2YAFA 2BW4A 4GP4B 4DP0X 2PP9A 4YSUA 1JZIA 3ZBMA 1BYPA 2I7SA 1GSKA 3FSAA 1TEFA 4E9YA 2VW6A 5I28A 4HCIA 1OV8A 2QDVA 1L9SA 2QDWA 5I6KA 2YAEA 1J9SA 3FS9A 3IEAA 1A4AA 1FFTB 1SF3A 2OCCB 2R7EB 3S3DB 5I5JA 3OMNB 4HCGA 1BQKA 4MFHA 1GS8A 1SDDA 2GHZA 2PPFA 2IWFA 1PLBA 1B3IA 1ET5A 2E86A 4WKXA 1JZHA 3AG4B 1V10A 4YSPA 1AZBA 1MG3C 3FU8A 4KNSA 3OM3B 1IKOP 5B1KA 2DYSB 2XUWA 4M4RB 5D4HA 1NIFA 2XV2A 2RACA 4BWUA 4DP5X 2FT8A 1AZNA 2VW7A 1AIZA 3PAZA 4WTQA 3WKPA 3NSYA 4KO5A 2FQFA 3QPKA 3NSDA 1JZEA 3UAEA 2XX1A 2YARA 3ASNB 1BQ5A 1IBYA 4K9JA 2VM3A 3UACA 3BQVA 4UAHA 4RH4A 1WA1X 1ET8A 1URIA 1YLBB 2BP0A 2BZ7A 3X1EA 3FQ1A 4BWWA 6PCYA 1IUZA 4KO7A 4N8UA 4ZK8A 2I85A 1KDIA 3TASA 3TBBA 4G7QB 2YAOA 5D4JA 4E9VA 1L9RA 1E5YA 1BXUA 1SFDA 1JZGA 1NIDA 2XWZA 4YSEA 2X88A 4YL4A 1E65A 1JXDA 4Q89A 1J9RA 1HAWA 9PCYA 2XV3A 3SQRA 1OE3A 1E30A 3WKQA 1RZQA 3ZIYA 2IWKA 4YSSA 5B1JA 1L9OA 2GI0A 3PAVA 1SHXA 5B7FA 2JKWA 4F7KA 5F7AA 4UF7C 5AZUA 3WG7B 2CALA 5E9NA 4GY4A 2BWDA 1SDDB 2CJ3A 5EHFA 2UXGA 2PCFA 2YQBA 2XU9A 5B3SB 1AG0A 3QJQB 2XX0A 3DTUB 2IH9A 2YAMA 1NINA 4KNUA 1UATA 2GC4C 1PNCA 1I53A 1V55B 1GR7A 4NAJA 1MG2C 2X87A 8PAZA 1WS8A 2AZAA 2UX7A 4G70B 2HRHA 3CVCA 1ZDQA 4CSZA 3H56A 4P5RA 3G5WA 1GS6X 1AQ8A 7PCYA 1MZYA 1OCOB 2HRGA 2HXAA 4JKNA 1ZDSA 4W1TA 3WIAA 1KDJA 5I6OA 1OF0A 1ASOA 1J5DA 4AKQA 3T6ZA 1HFUA 1NIBA 3AG1B 5I6NA 1QHQA 2BP0B 5F7BA 1BXAA 2PCYA 4YSQA 4EF3A 1VLXA 2QT6A 2OV0A 1V54B 2N0MA 2B08A 4UANA 3NJGA 4A2GA 1RZPA 3FSVA 3BVDB 2IDTA 1L9TA 1CURA 5AKRA 3TBCA 4JHUA 2UX6A 2XVBA 2YXWA 1SF5A 3EH5B 1NZRA 4GYBA 2FQDA 4DP1X 3CG8A 2J56A 1L9PA 2J5WA 2IH8A 2YAHA 2EINB 2PP8A 3S3CB 3EF4A 3KW7A 4YSCA 3WI9A 2Y69B 3NJKA 1NPNA 4A67A 2Q9OA 2DV6A 3DKHA 2VN3A 3OMIB 1AZRA 1J5CA 3QJTB 2H47C 1AACA 2W88A 4YSAA 1A4CA 1NIEA 2H3XC 1KBWA 3CVBA 3ABLB 2EILB 3X2QB 3NSCA 1OE1A 3FQ2A 1HAUA 2IDUA 1NICA 2FTAA 1OCZB 2ZOOA 3OD3A 2FNWA 1ID2A 3FU7A 3V9EA 1KCWA 1AS7A 2OJ1A 4AI7A 3FQYA 2GIMA 2LLNA 3ABKB 5PAZA 2Q5BA 1JOIA 3X1BA 3S8FB 5FC9A 1N68A 2MRYA 1TKWA 3T71A 1ZIAA 2JFCA 2NRDA 1ILUA 2VMJA 4YSRA 5TK2A 4QLWA 3S3BB 3GDCA 5I6PA 2DWTA 1DYZA 1NIAA 2IDFA 4DPBX 2A3TA 3L45A 1CYXA 3QJUB 4PCYA 4DP4X 1M57B 4E9SA 1WA0X 2PPDA 3FU9A 2XLLA 3FT0A 1AAJA 2ZONA 3JTBA 3PXLA 2P80D 2HLEB 4HHGA 3MBWB 4YVNA 3DIVA 1A65A 1ASPA 3D12B 2FQGA 3FSWA 2AFNA 1EHKB 3NP3A 3GXUB 1JZJA 5IY5B 2PPAA 1NWOA 4E9RA 4TXVB 1PF3A 2PPEA 1ZIBA 2HX9A 4QKTA 1W6WA 5B1AB 2J55A 4HZ1A 1PZCA 1AS6A 2EIJB 3AG2B 1BEXA 3QJSB 4A2HA 3CVDA 4A68A 3C75A 3MX0B 4G72B 4X4KA 3CZUB 2VSMB 3CDZA 2BO0A 4DP9X 1CUOA 1XB8A 5I26A 4DPAX 1KGYE 1F56A 5I6LA 1RKRA 1SJMA 2UXTA 4G7RB 4KO6A 1KV7A 2IWEA 3T6VA 4GXFA 3FU7B 3U25A 4DP8X 4ENZA 1BYOA 4HALA 3OMAB 1KYAA 1ET7A 3QQXA 1IBZA 1A3ZA 4A2DA 3RYMA 4YSDA 2J57A 1PAZA 2BWIA 2IDQA 3S8GB 1ASQA 5A7EA 2BHFA 1ILSA 1AR1B 1PNDA 1BAWA 4PAZA
chains in the Genus database with same CATH superfamily
2XWEA 5DEFA 3BFQG 2Y7QA 2IPTL 2FEEI 4NO0D 1D2OA 3BH9B 2ZCLL 3VI4E 1EX0A 1KIPA 3UTQA 1UWEL 4JO8A 4WI4A 4F2FA 2G9HA 1WBZA 3LJ3A 2OMYA 2BVEA 2QKSA 3O6FD 1DBAH 1EZVX 4O5LL 5JA9A 2HMIC 1UWFA 4PJHE 1BP3B 3STZA 1RZGA 2AAVA 3NP4A 4HIXL 3FKUS 4OV5B 3BT2L 2G5BA 3PGCA 4GKSA 4PS3A 5LGHH 5J1SC 1MOEA 3UJTH 5H37H 3KPRB 4JDVB 5LBSH 3UTSE 3VXRA 4HT1H 3X3GH 5KAQG 4TQIA 4C4UA 4KZDH 1OSPL 3MGOB 1NGWA 3QPXL 5JXED 4K71B 4M5SA 3UP1A 5FPIA 4NNPH 3CPLA 3E8UL 3H54A 1D6EA 1UEMA 5F7FA 3MRQA 3HZYB 2AJUH 2Z6FA 4YBLB 3PGDA 5GS1C 3BN3B 4ECNA 1DE4A 3HC4H 3EGSB 4HPOH 4MQTB 3AS1A 2YD7A 2DJUA 5GZOC 2AKRA 5T1DH 1KN2H 3NJXA 2CGYA 2A6JA 2DIEA 1RIUH 2HTKD 4PJGE 4UBDD 2FD6L 2UUDK 4K3DH 3TT1L 3ABGA 5EFIB 4V1DB 4K5PA 3FHEA 3MV11 3BGMA 1BEYL 1T80A 3AY4A 3CHPA 1B2WH 2IG2H 3UCRA 4PJFF 3AAZA 5EOCL 4OZ4B 4R97B 3ARDA 2F5AL 4XNMB 2E27H 5JIKA 2OYPA 1ZTXH 3ZKXC 3WDHA 4TUKH 5B39G 1KEGH 3FCGA 5HHQA 5FW6A 2ZWZA 4KX8A 4PGEA 5MI0B 3WNIA 1S6NA 1UG9A 4NYLA 4QXUL 4XO5A 4WK0B 5FOBA 2ADFL 2HX8A 1HYSC 1RMFH 4QOKA 5AG9A 3ZDYB 2GTZB 4BE6A 1WAEA 2DBJA 3HI5L 5J5EA 1NFDE 3QQ4A 4YQXH 2CBMA 1R3LB 2Y2TA 4XN8A 1EEYA 1QFPA 1JP5A 2QR0B 2O1AA 3GSNB 1DL7H 1GGIL 1PMYA 3I6SA 1XXDC 5D6CA 3CDGA 1KULA 2DN7A 3U0WH 3VGAC 2ERJB 2X3BA 2NX5A 2CCLA 3FPYA 3FQXB 4HWZB 4MJ4A 3S7GA 4R96A 5EIIB 1F90L 5EZJB 1G0XA 2ODIA 1PZBA 1W72L 1QTSA 2Y07L 3L9RA 1LMKA 5I17A 2X9WA 4HXAL 1NMBL 3ZU8A 1AC0A 1OAYH 3VGFA 2PABA 3MLUH 5HYJD 5E0QA 4OCRH 1B88A 5DJDB 4Z95H 5D7IF 3CHSA 5EUOE 1CG9A 4LIQE 4EDXA 3DTDA 5HJBA 3O3UN 1U92B 1G0DA 1NLBH 1FSKC 3QR1A 3BKYH 5CIPH 4MAYD 3EJZD 3FB8A 4PU2A 1BD2B 4H5SA 1UM5H 4G8FB 2YKLH 4J3WA 1PJWA 4FQIH 3N04A 4JRYA 4QHNA 1A22B 3BIAX 3F7PC 3SIKA 3PWPB 4HKZA 1I1AA 1CGSH 5DVOA 1BLIA 1SEQH 1IZJA 5GSVA 2Z93A 1IJNA 3L3IA 1OWRM 5FHBH 4Q9CA 4BE5A 1IT9L 2ZCHL 4KFMA 5JA8B 1ZCRA 4X6CF 1T6WA 2A38A 1ZLSL 3RUGE 2NY5L 4MQXD 4R7NB 4XGZA 2CCWA 4FA7B 1Q1PA 4HGWB 4S1RH 2ZYIA 2NQ3A 2P1YA 5FEBA 1NCWH 1GW0A 3C5ZA 1A5FH 1BCIA 3SE9L 1PAMA 3W5NA 5IQ7H 4HJJH 3WE1A 2VJXA 1NWPA 3GPSA 3CFUA 3GS0A 2XACC 2YD3A 3FU6A 1S3RA 4Z7OE 1NGYB 5K33A 1WS7A 3T2NL 4EIBA 1CXIA 1RULL 2IBGA 3QRGL 3D25A 3VI3A 2JELL 2WSKA 2EEAA 1CGTA 2V17H 3IS0X 4FADA 4C56D 3HUJA 3MBWA 4PWGA 5DUBB 4HS6A 4YZWA 1WC7A 2NQCA 3LKSA 1XQ4A 5DD3L 3QJHA 1JGDA 4QRPE 2B0SH 3II3A 5LAXB 1OV8A 5CZKA 4GNKB 2A7BA 3QULA 5K59E 1VACB 1EHLL 5F9WB 2DM4A 4OT1L 2VZ1A 4FNLH 4QRSA 1KBBA 3QDJB 1PVHA 2CIIB 3FOLB 5DMIH 3GTNA 1B90A 4UNUA 1IGYA 1FFNA 1PD1A 5AKSA 1XO8A 1D5BB 4GRLA 4NNXA 1NKOA 2EDNA 2PPFA 3VVWA 3DVGB 3ULUC 3GS7A 5I8CB 2E86A 1JZHA 3AG4B 3ULVE 1JPFA 3EDDA 32C2A 4N2LA 5DJZB 1AY1H 2BDNH 4IRSC 3MKKA 4HS3B 4G9FE 2BNRE 4M4RB 1UZ6F 1OT1A 4K5OA 3CC5B 4HKJB 2HH0H 2YLKA 3V0JA 2DIBA 1ADQH 4YMPA 4BQ9A 1NJ9B 4YBHA 4KO5A 4ZXBD 3ROLA 4MGXA 4ZFOB 4KPHH 3FAXA 5CEZL 5DHDA 2DLGA 5GGUB 3N91A 1EXUB 4KTYA 3QFJB 1NGPH 1KEML 3HNSL 4OZFH 3N41F 4F33B 4L3FA 3IXAB 1MFAL 5KYUB 3UACA 3ZDXE 1G7QB 4Y88A 2E56A 1FLTX 4PJFB 1MJ7H 1FRGL 3AS2A 2QKIC 3REWA 3G5XB 1WFUA 2JJSC 1F6AA 4XWOC 3TA3A 4S2SB 1Y0LA 4L3ED 4XP4L 3DC0A 2P26A 4E68A 1JPGA 5DK2B 2GJPA 4NC1C 1G7HA 4QD2E 2Y5TA 4KRLB 1W0VA 4LQ1A 3NABL 1QO3B 1PG7W 2P5EB 1ZANH 3MYZA 2J6WA 3U0PA 3G6JE 3VFUA 3SY6A 4IOFC 1OE3A 2AXGA 1UM6L 3UCQA 1BOGA 4JR9H 5HGBB 3SCMB 3GUFA 1T0OA 2XN2A 3SOBL 4JM2B 4WUUB 4P2QB 2X38A 3KL5A 4PB0L 2H6PB 5KSAB 2XA8L 3DUUB 2NPLX 4J6RL 3WEBA 5FECA 4K2UL 2C9PA 3DVFA 1WGOA 1MJ8H 4HFUH 3W2DH 5KOVC 4D7PA 4E5XG 3QYMA 1MCOH 4AGPA 5EU5A 1A02N 4KMQA 3LZOA 3QDGA 5I8EB 2VC2B 5D7IB 1HOCB 3GSNL 5BZZA 2ZKHH 4XRCB 3T65A 5GGQH 1A9VA 1O75A 5HY9B 1TOXA 2X87A 2ZT9C 1WS8A 1R3HB 4OBSA 1S9YA 4F15C 3FW6A 4HX1B 4G70B 4XAWH 2QADC 1SM3H 4KGLA 5K9OA 3FXIC 4CSSA 4APQB 5BRQA 4IOIA 3KJ4B 5C6TL 3LKQB 1OP3H 1OF0A 1J5DA 2F53B 4IRJC 1LO5A 4L1BA 5CZXD 3ATEA 5AOMA 3TIEA 3VB8A 1W80A 2N56A 4MMZB 4WY7H 5E08H 1AJ7H 4WDIB 3C6LD 1TJHL 4PREA 1ACXA 4ELKA 4FQJL 5CJOL 1RLWA 4PJDA 1O7SA 2BVOA 1FJ1A 2VO8A 2XV6B 4MX7B 3CXDL 1ESOA 3QEUA 2O5YH 4G8GA 5T3XL 4LCIH 3T3PF 5AW9B 1UB6A 4K3GA 3KVPA 4ZFFA 4RLDA 3QYNA 1JNNH 2IH8A 4IBZA 1QD0A 2JIXD 4NHCL 1CBVH 4K23H 1NUNB 4K5LA 6CGTA 2EC9T 4I3SL 2WMPB 1TZHA 2QZ5A 1JGUL 4PJ8C 4XX5A 3DKHA 2VMCA 4ANKA 5DHEA 1UB5B 5E99H 3S3JA 1IFRA 3KM2A 3MX0A 3KBPA 3PJNA 4NPYA 3MLYH 3NAAL 2WOBA 2APTA 4B9JA 4ODXB 2X9YA 3QIWA 1N2RB 4GEJA 3U7WH 4CSTA 4BSWA 2Q8BL 1QSFD 4UT7H 5E8PB 1P4LB 2N7AA 4HLJA 3SE8H 1KTCA 4KJPC 4HUUA 5SX4I 2AABL 1E43A 4EBQL 4MJ6A 1DANU 1JZ5A 2FAUA 4FD0A 3RL2B 4LVNC 2ZUQC 5E8OB 5CCJA 4AUYA 1G1OA 4Y1AA 4HUWB 3PIQB 4NZUL 1XF2A 2MRYA 4ZOAA 1KNOA 3MJ9H 3U4AA 3O2VL 3O4LE 3EDKA 2W0PA 2GCYA 1JTTA 2WVVA 5D1ZC 3ZTCC 1IGIH 1L9NA 1RUQH 4XB8A 1GJUA 5MEND 2SODB 3QAZC 3GDCA 4PBDA 4DH2A 2ZF9A 1NIAA 2CWRA 2J25A 5EOTB 2XRAH 4KTEL 2H8PB 4Z5RB 4MJIE 4PI0A 3KCPB 4Z9KB 5CZVH 3IJEB 4CU7A 4YBQC 5EIIG 1FAKT 1RSYA 4XP1L 1INQB 5LNDA 3MHZA 3RL1A 4XAKD 1EFQA 1MIML 3VFMB 3V52L 2D7TH 3WY4A 2FR4A 3MDJA 1I75A 1LE9A 1SJXA 4GAFB 4AZ8A 3SGJC 4AIZB 3GKZA 2PW1B 5CD3B 1BFTA 4L3CB 4U1SA 5AVWB 5F7MC 2XWTB 2PPEA 2UZIH 3T0EA 4FLRA 3GMLA 2WXPA 3SO3C 5KWYC 4BQ6A 3NIGF 3VRIA 2J55A 3L5XH 3B5GA 2WBKA 2WXOA 4BCXA 4ZFOL 4LMQI 3K8KA 1D9KB 1TVBA 2JCCE 2EDLA 5TDOA 4ALAC 1A7QH 4XCNB 1YEEH 3W9DA 5HYFA 2PWHA 1KGYE 5J11B 1S46A 4ZPTB 2R83A 1G7LB 4Z76A 2UXTA 2HJFA 4PRIE 2AQNA 5GRUL 1I8UA 1OAUL 3MRRB 3OQ3B 1S7VB 3TEXA 3FU7B 4ZFQA 5HHPA 4KVPA 3RDJA 5IJCC 1JWMA 2VLME 1IBZA 2FGWL 5CU5A 3TPUA 4MD0A 3WFDH 2DQGH 1MRCH 3VWKD 2DYPD 4WWKB 5IVZB 1X3DA 2YA2A 1JPTL 3K6SB 1AHWB 4PJ5A 3RILA 4QXTA 5LDSA 4P2RD 2HX7A 5AWNL 2WZPA 3PLYA 2ADIA 3LPOA 1GYCA 5IFAH 1MCIA 3S2CA 1P7KB 2ESVB 5BZDA 1BIIB 4FFWD 4FQ1L 3TLRA 4W9DC 3ZKSD 1I3UA 5KVEH 2CGRH 3IWVA 4LDEB 5HVWA 4PRNA 1UXSA 2NY1B 3DOSB 5IWLA 3ARFD 3H9HB 5AVZB 3T77B 2ZOUA 3BX7C 1RH8A 1K85A 2WJ5A 1PDKB 4QTFA 2W91A 4R26L 4ZAKD 4RZCB 3NEEA 1MCDA 1VKXA 1PY9A 5DJ2A 2YK1H 3JZYA 1JHLL 1HQRB 2VKWA 3RWGA 1NC4B 5LO7A 4Q56A 5SWSA 3MLRL 3OWRA 1FYTD 5JZ7C 3NSFA 4OIIH 3D6GA 2W38A 1FZMA 4G6FD 5AFAA 1H9DA 3UEQA 4OAWB 1IKFH 1HNGA 3GMQB 3T3PB 5HDQH 1OSYA 2G60H 1MJUH 5J6HB 1SOXA 5D2NA 3X3FH 3MRHB 4FI7A 4Y4KD 4AITA 3FT4B 3WO4C 2H2SD 5DJYA 3FT9A 4NRYA 3BWUC 1UA7A 1KXTA 3D2TA 2WWKO 4BDVA 1RZ8A 4Y2LA 4BQBA 3L3JA 5KYXB 4M8QA 1M4KA 4JFUA 4JFZH 4GAYB 1MWAL 2BIOA 4MS8C 4Y19E 1A9EB 4JFFE 2C26A 3KPLA 2J1ZA 4R5VA 1GYUA 4GINA 5E8NB 2EXYC 1PEWA 4HWUA 3V4PB 4CJ0A 5F6HJ 5EBGA 4AQEA 3VH8B 2XA3A 4UQ3B 2VDLH 4UOZA 3B9KC 4Y16C 2XZCH 2BZCA 4YHZL 4I1NB 1J10A 4FQCL 1A1MA 3N85H 2W0LA 1JNHA 2X4OB 1P5VA 3HVDA 3O8XC 5DVLA 5KOMC 4KJYA 3ZK0A 1MXDA 1BFVH 1QPXA 5EZOH 4CVZA 3R4DA 4UCFA 5GS0H 2A73B 4NN6B 1EAJA 2I7OA 1N0XL 2H2PC 1XVSA 3I6LD 1TU2A 4FQXC 3U36B 3WV0A 3DRQB 4ZS7L 4V2BA 3IFOB 1NCJA 2OTUA 3CSYA 3HRZC 1DZ0A 1EO5A 1KB5L 3SYAA 5CD5C 1N26A 4ICXA 2NNCA 3MV7A 3QUYC 3PQYB 5H35B 4XPAH 3G5VA 1F3DJ 4ETYA 2AQSA 1FL3A 3DO3A 1MLBB 3S34H 5G4MA 2YUZA 2MPAH 2HLAA 4XZUA 5AW3B 4ZW6A 4DPRA 1TVDA 1CC3A 2H9GB 2A0LD 5H94B 2NNRA 1A2YB 1NAMH 2WXNA 1S7TB 5DZ9A 1SXBA 2ZF8A 5D7JC 1SMDA 3LXBA 3V7AG 2Y6SC 1Z9MA 3SBWC 1KN4L 1SZNA 1WZ1H 3D07A 3BESR 1HEHC 2WTOA 3ZKQD 4QXGL 3P4OA 1KBVA 1MCNA 1U21A 1TKWB 3O2DH 4PLKD 5BZWA 1OGAE 2OR9H 4HIHA 4PJXE 2F61A 3C2SA 4C54A 5CNHA 1BQHB 2A74B 4PJAA 3GYRA 1BVKB 2CO2A 1KJMB 4K3HA 1N64L 5DYOA 4X6DA 3JTSB 3ARGA 3O3DA 3NFNA 1TTRA 2QHLA 1N67A 25C8L 3PAUA 2BJML 1HQ4A 3LIZL 3EYVA 4MXVF 4N2AA 5HJ3A 1X9UA 4GO8A 4DGIH 1A14L 3LEXA 4GKZA 5JYMA 2XI9A 1R24A 2OXGB 4P0DA 2VLJB 1MW1A 4XVUD 4EN3B 5DD5H 1EUTA 4XC1L 3D69B 1I1YA 2A6KB 2TSBA 4BFGA 5L2KE 2FECL 1WO2A 2EJ1A 3CDCA 1T0NA 1A6VH 1K8DA 4FGMA 4HC1L 3EOBA 4AENA 5HHMD 5IUSA 4W68A 2V8MA 1OPGL 3WS3B 1F4XL 4UT9L 3MODH 2IBBA 4OD1H 2ICEC 5KTEH 2GY5A 3KS0H 2OLDA 1GHFH 4ZYKB 1CLCA 1BM3H 3ZR6A 2NR6A 3UJIL 3PWNB 4NC1E 2J21A 5CJ8A 4BKLB 2ZP8A 2BVQA 1P1ZB 1GRWA 5AL8A 2CLVB 3Q9QA 4DKEH 3TTSA 3ULVH 5C08A 4PJ9A 2WUBL 4K9EH 4BFJA 3ML9A 2E4TA 1DSYA 3K5SA 4JG0L 4K94L 4NZDA 1A4AA 4TN9A 4KITB 4UT6H 2Q7AA 2R7EB 4U1JB 5F7DA 4AEHL 1YEGL 3UJJL 3OKOB 2Y7LA 1W0YT 1RVFH 3FB5B 4G80A 5BVJB 1SDDA 1YMHB 3HOGA 3D50A 1LQSR 4YXHL 5MP6L 4JZJB 5GJTL 4JO2L 3GLEA 3MLXH 1TO4A 4KNSA 1H3GA 1U8MA 3DSFL 4P46B 1S5IH 5T5FL 2Z34A 3QNZA 1J87A 2C9SA 3RZCA 1B0IA 4YHIA 5TQ0L 1E6JH 1M1XB 1QLRA 3WKPA 1NL0L 3VI3F 3RB7A 4CGUB 1X7QA 1KIPB 4TTDD 3HUJF 5JUEH 4WEMB 3GT6A 4W9CC 1BQ5A 2RMNA 2HPOA 1QMUA 2GBTA 2WXJA 2YD0A 3EYQC 1N7ML 4YPGA 3STZB 1ET8A 1URIA 1IC5L 4RMUA 2WNWA 4GKSB 1VFBA 5C0FA 4X9BA 2CK2A 2LU5A 3Q3GA 4R5TA 3FHQA 2X89A 3VXRB 4W4NA 4XBEL 1L9RA 4JBSA 3H8NA 3NIDF 4OLVL 1HL5A 3N43F 1FFQA 4WO4D 5T1LA 2PTUA 3FH7A 1UH3A 5IHLB 3QH3A 1TNMA 1SOKA 5EU6E 4ZSOA 4YSEA 5CAYB 2NW3A 1AGEA 4X8JA 1JXDA 1OP5H 1RJYA 4BFNA 1HIMH 4Q89A 4WTXA 3QC5X 3MXWL 4HMDA 3IGAA 4MNQD 3LKRA 2VXQL 1DE4B 3ILPA 4EUPH 2QSCL 4N24A 5DFVD 4BA8A 4RZKA 2Z31C 5DWPA 1M7IA 2O5ZH 4KQ4L 2LLLA 3V4PL 2A6JB 5I1EH 2CSPA 2XN9D 4JFEA 1X5HA 3LRMA 1RURH 4YGVA 3WFBL 1I8LA 2RCSL 3BGMB 1B4JL 2ZCKH 3DTUB 2YAMA 3NTCH 2HN7A 2EEXA 4FN0A 4B9GA 3KNBB 4P3DA 4UIMA 4XBPA 4AL8L 2IH3B 3AAZB 3IKCB 4NGHL 5IQLA 1QW8A 2VL5B 1X5GA 3O3BA 3QG7L 3Q01A 2NNXA 4WV1B 4PGEB 4YHOL 1MG2C 2OAAA 1F11A 3VG0L 4OFQA 1NA8A 3FAWA 2Q7NA 4DZ8A 1M3JA 4KWUA 3ARTA 4E42B 4OW6A 1WGVA 1WAAE 3TBVB 2VITA 4JQVA 1P4BL 1TJGL 4W9KC 4JFOB 2WW8A 4UINH 1T03H 4W1TA 3A6CL 4E41D 1KJ2H 3QHZH 1DJYA 3JWOC 4GG6E 1E50A 4YH6A 1HFUA 3AG1B 3BYYA 3IMSA 4GLRI 4GUPB 1QHQA 2X6MA 1VHPA 2FGZA 1C5DA 4JZNB 1JF1A 3OAZH 4M3KB 1AVAA 2Q7YA 1UKTA 1YPZE 2ZYRA 4XI5C 3VD7A 2VDPH 3MCKB 4OFYA 4R96B 3G9AB 2P5WB 2CJSA 3QZOA 2MEJB 3AFLA 4LASL 1FG9C 1HKLL 1KCUH 5I1IH 1J1OL 2R2HB 1NCAH 2XVBA 3C60B 3GDBA 1SF5A 5F3HA 2D0HA 5J1TC 2J56A 3OKKA 3RIAK 3KPOA 2PP8A 1VJSA 4YSCA 6FABH 1PZ3A 3QUHA 4LU5H 3HAEA 4EDXB 3DJZA 1H3PL 1P4IL 5IKCA 3U9UA 1HSBA 4OCXH 1XH3A 1AACA 1OL0A 4FMKA 3V4VA 4YSAA 1BZDA 3HZMA 5D5ME 5A2AA 4AM0B 1NKRA 2FYYA 4RNRB 4Z7AA 1A3QA 3FNKA 4H5SB 3WLBA 1VERA 4NN5B 4G7YL 3FQ2A 4FJ6A 4EOWL 4KRNA 3IE4A 1HC1A 4AQ8A 3MZTA 5GSVB 1CFQA 2XWBB 4A6YH 1J5OH 3SDAC 4PJIB 4GFXA 3LHAA 2CO3A 3L9BA 3MMEB 3ZE2F 3DK2A 4J27A 3N44F 1N8ZB 1WJ3A 3MV8A 3P77A 4ODSL 2Q10A 5L0QB 3TFKD 4PJDF 3UZQA 4GXVL 5F6IC 3W82A 1QLEH 5E2VL 2C7FA 3D0VA 3NJVA 3PP4L 2DKMA 3QUXA 1LMIA 2F74A 3D39E 1MWAA 1LJMA 2NCEA 1AQDA 3WN5C 5BRZB 2XFXB 5G2NA 4LSDA 5IMMA 4NWUH 1WA0X 2UZYB 5E1AA 3FT0A 4JQIH 5F1IB 1RZJC 4IDJL 4DQOL 1DBKH 3HUJB 4OFPA 4CADB 2D9QB 3LEVH 4Y2DB 3MBWB 4YL9A 4YVNA 1WC7B 3DX9A 2V4LA 5DMGD 3ROOB 3LKSB 3HJEA 1JGDB 4F1ZA 3VXSA 3IDIB 1MI5B 3ZT6A 2F7PA 3NK3A 4M8VA 1NCDL 2F1EA 3Q5TA 4EPSA 5AAWC 2D9CA 2MMXA 2ZXDA 3CVHA 3OGOE 2KQNA 1UYWL 3SYCA 1LWRA 1W2KT 4F2MA 1AS6A 4I48A 4WHYH 4J4PD 1IGYB 1FFNB 4CKQA 3NIDB 3N43B 2P4AB 4H20L 1DBBH 1KB5A 5L7XH 2X70A 3OBAA 5EO0B 2WINA 1TMCB 3K72A 1ED3A 2KLRA 2V2WA 4OZHB 2NW2A 1NGXA 3N50A 1YN6B 2AQPA 32C2B 3R18A 4NO2B 1HVXA 1IFHL 1UH4A 3JWDC 5EBMA 3CLEH 4AYSA 4G7RB 3Q1SL 4HWEH 1CFVL 1KV7A 1BQHG 2ENJA 3EG9A 3T6VA 3B3IA 3HC0A 3CMGA 1E9QB 4OD3L 4Q6IC 3UZEC 4HOZA 1XBRA 2YD8A 4LT7A 5KYYA 1I4FB 5ISZE 3LZFL 4CUCA 3EUUA 1UASA 4OQTL 1S9XA 1DVQA 2JKRM 1EO7A 1ASQA 1U8OA 4OGAD 3DOIA 5TPWH 1YY8A 4OFDA 4LSTH 1W15A 4AYFB 3FB6A 3IMUA 5K9JH 4ZMZA 1TETH 1XCQB 1YEJL 3O2WH 4DTGL 1RU9L 2IGLA 1CLYL 4PJCE 1TQCB 3EJRA 5EH1A 2ZOWA 2IAAC 1CICB 4ZUSA 1DBMH 2AXFA 4GKOA 4UUJA 3P02A 4JM0A 4X4YB 4QXVA 1SDAB 3QW9A 3HFMH 4JKWA 4O00A 4UMSA 1CD1A 5CHNA 2K4AA 5FYLD 3S5YA 3VMPA 2VDQH 2Y5TB 4LOUD 1W0VB 5D1QA 4KX9A 1FFRA 2YMTA 3VXTB 4MBRA 4NXKA 4MNGB 4UDUA 4N2BA 3S2AA 3K0YA 1KLUB 1KPVB 3H9SD 3VFUB 2R69L 2W8CA 5D1XB 1C7SA 2AXGB 5K9KB 3GZOA 2AXHA 3S6CA 3VNZA 5IR1A 3C9NB 3EJQA 3JVGA 1R46A 2GC7C 3OPZH 1KACB 2NNAB 5F9JA 5I74B 4Z3TA 1KZQA 3BJLA 3NPSB 3SE4A 3SDYL 5F7WC 1BZEA 3MR9A 1G7IB 3U48A 3LN4A 3WY3A 1KCRL 3CDZB 2J73A 3NZHH 2SEBB 3EDJA 1IC0A 2DKUA 3OR6A 4JKMA 4LPUA 2QVMA 4HD5A 3DHPA 1U8QB 1DLHB 3UYRL 3KHQA 2D03H 4P5SA 2EE6A 4HMCA 9CGTA 3VO0A 4L8CB 5ICZA 1S9YB 2ZOLA 1BGXH 5TDNA 1ZOXA 3PG2A 4UTAL 1UWXK 1E67A 2ZSVB 2GB2A 1IRAY 3G3LA 2CD0A 1ZGLB 3T9WA 2QPUA 3VQMA 4JFQB 4N5EC 1U3HD 1EBAA 2ZKWA 3DV6B 4JPVH 3QEQE 4P4RA 5L6YH 1AE6L 2EIEA 2EYTA 3HMXH 4L2YA 3MUGB 2O26U 3P3RA 4NFBA 3VAEA 3KCWA 3TJHD 1IAOB 1QA9A 4XPHL 3TIEB 3FBKA 4P23C 2EDEA 1JN6B 1HCVA 2E46A 2VAAB 4H13C 3ARRA 4G1EA 4GSUA 5GJSL 4IU2A 2BVOB 1I9JL 1QOKA 1WFMA 3FO0L 4PS8A 1HJBC 2R4SL 3GIZL 5CO1A 5E8DH 3LX9A 1UB6B 3MRFB 2WGXA 4KROD 1NFIA 2VMEA 4ZS6D 3UG3A 1AGDB 1CLZL 1HILB 3OQRA 2OMNA 1F41A 1KXVA 2VLLA 4HETA 5KANG 4YEEA 3THML 4QWWD 5KYNA 3D4YA 2F0CA 1TZHB 2I26N 3N1FC 5DQJB 2DYRB 5GHWH 2H4EA 2WKOA 1MVUA 3L17A 5FYJE 4BZ2L 1KC5H 5ANHA 1BVNP 4WHDA 3AVEA 5IG7A 3A4AA 4RISL 4NPYB 4AWJC 4EKJA 3TH3T 1MCPL 3HEIB 2Y2YA 2AQTA 1OTTC 3ULUH 4WFHD 4U6VH 4FLOA 2CDGB 5E03A 2YFNA 3R0MA 1IAKA 4BSWB 4G5ZL 2JE8A 4ZMLA 1H3TA 5DHYA 1II4E 4TNEA 2VXQA 2OXHB 5DR5L 4AGQA 4HUKB 1YC8A 3TVMC 4ONGH 4FMVA 5I1KH 4QRUA 2C1PA 1SRDA 5FAAA 2MPVA 3SZKC 3VFWB 2BHUA 1I8IB 3BPLB 4G7VH 4UV4H 3P1VA 4WSGA 2WVVB 4LLQA 3WEXB 4BA0A 4KKZA 5IEKB 4NJAH 4AVIA 4I7ZC 2H32A 1KCLA 1J8HA 4PJ7A 1K5NB 2EDRA 4C8XA 1J1PH 4EI5B 1HHIB 4FG6D 2VXSH 4FNSA 2IXQB 3N55A 4I0PD 1WA2X 3HZVB 4HIJA 4XE0A 2X1WL 1E4XI 2G75B 1DBAL 5JNYA 1NDMB 4DERA 1HEZA 4EJ1C 3IPEA 3FYEB 2IFFH 1UOLA 3GI8H 2OX5A 4JGMA 3ARSA 4YIQA 1D7CA 4GBXD 5DC9B 5LGHL 2FR4B 5J6SA 2GUOB 3P4NB 1NPJA 1OWWA 3UJTL 2QPEB 1SVZA 4HZLA 3RKDC 3FMGH 3IJYB 5HDBE 4EN2A 5CBAB 5LBSL 1MELA 2OL3H 4HT1L 5C09A 3TZVA 3X3GL 1OAZH 4KZDL 3ZBMA 3V6FA 5J9PB 3GMLB 4HDIB 2JCWA 3ARWA 2P8MB 1U58A 3W11D 4NNPL 1KTKE 2RQEA 3EGXB 4LLDB 3BP5A 4LB8A 2K1MA 4JFHD 4ZMAT 2AJUL 1L6ZA 1TVBB 2VMFA 3HC4L 2F54A 1OSZA 4HPOL 1VAHA 4PJAF 5AZEL 4H8HA 5I15H 2OMXA 3GKWH 4X6DF 3GEWB 1Q9WA 1J7VR 5D4QA 5T1DL 1KN2L 2V7HB 4Z76B 3ARBA 1RIUL 4NKQB 1HXKA 4PG2C 3F7QA 5DQ9B 1B0RB 1T1XA 2AJ3B 4K3DL 4TNWK 5IROA 5TGBA 1G9EA 5F96H 3GJEB 4F7MA 3RY6C 3MLSH 1QQDA 3CNKA 1JWMB 5AYUH 4CU8A 4URKA 3TPUB 2CPCA 3GSOB 1B2WL 3RVTC 1PZDA 5DF0A 2IG2L 5I76A 1P2CB 3WEAA 4JDTH 4W9FC 2LGNA 4MXWH 5EA0H 3CN4A 2VCOA 1KEGL 4TUKL 1NM4A 1FORH 2XZQH 3EJPA 4U1IA 4F1SA 1SVCP 5DJ0A 1DJGA 3IMVA 4X5XB 1RMFL 5F0LB 2V8LA 2MOGA 4YQXL 3IAGC 3FH8A 4F7CA 4BWWA 5DJ8A 3FONA 4KO7A 4N8UA 1AXTH 3B7SA 2WSPA 1DL7L 4I0CC 3HE7C 4RGNC 4FA8A 2ZZUT 1NOAA 3GMOA 3U0WL 1VKXB 2PR9A 2E7LA 5DJ2B 4S10A 5FO9A 3ESMA 5MEPB 2O5NA 2IBZY 5CEXA 3QUKB 1EH9A 4CN1A 4AGLA 4QF1A 2PWEA 4P2OD 4PN6A 3EXJA 5I30H 1F4WH 4JN1H 4YE4H 3T3ME 1VRSA 1W16A 1OAYL 1CBJA 3W0WB 4F5CE 3MLUL 1FUNA 1RZQA 4OCRL 3L2NA 3TNMA 3IDJA 1QBAA 4K8RH 4Z95L 5FO7A 2CJTA 3L4YA 4ZUWB 5IVXB 4GEIA 5KS9B 4HKXA 5B7FA 2ZG2A 3P4MA 5JHLA 2ARWA 5F7AA 1KXTB 4FS0A 4AMKH 4DQAA 1CDHA 1NLBL 2NZ9C 3BKYL 4KHXH 2CO6B 4FFVD 2UXGA 5HYEA 3KWTA 3FBQA 1UM5L 2YKLL 4FQIL 3ES6A 4KXZI 2WZAA 2ZX6A 3KPLB 3ML8A 3RHWF 3HBQA 1CGSL 1XX9C 5E9DB 4KK5D 4RAVA 1SEQL 1XGRA 2ALAA 4ZTEA 1INEL 3BDBA 5BOJA 2P8LB 5AW7B 4KRPB 5FHBL 3BSZA 1L4IA 2WAHA 3MFFA 4JRWA 4G6MH 4X0KA 3TXAA 4PIRF 2OW6A 2OP4H 4HF5H 2HRHA 1V3MA 1N5AA 5EU4B 2H3KA 2OZ4A 4MJID 5L2JA 4S1RL 3ZRCC 4FXKB 3QXDA 1NCWL 4ZXBA 5FUZH 3ZTJH 1A5FL 2A9NH 2ZPKH 3WIAA 1U8NA 3PF2A 4YPJA 5ADOH 5SWZA 4HJJL 5IQ7L 4LVOB 3IDMA 3MUUA 3H42H 4OQTA 2VDRH 3DUSA 3RWEA 3WKMH 4HD9A 2IQ9H 1P7QB 4PHZA 5E00A 1TCRB 2NY0C 2TRHA 3LMJH 5FW7A 1CZ8H 1E4KA 2DIAA 3CSYB 1UCBL 1RZPA 3RIAF 2LAAA 2V17L 2DBLH 3B7TA 4X4ZA 1ZS8B 1YEIH 2WXFA 4DZBA 2F7QA 1NBYA 1QFWM 3G5VB 4L3EA 3HE6D 2H6UA 3O41A 1NZRA 2VLKB 4BH7A 2XOTA 1FO0H 2HG0A 2UWEE 1JCKA 2PCXA 3N0AA 3QIBA 3S3CB 1LO2H 1KYDA 2DLIA 4WEBH 1X44A 1AH1A 2YGVA 2B9AA 4PJBA 2G5RA 1IM3B 1XR9A 2BVTA 4NKMA 4YK4B 3WFCL 4IGBA 4FNLL 4P5TD 1B9ZA 1E28A 5DMIL 5C0BA 1U8PB 3VA6A 2A2QT 5AB2A 2VDOB 1WFIA 4YHYB 1RZKC 1XIWD 4PRPB 4J7RA 5JPMA 1DN0A 1WEJH 3UPRB 3DYMA 4PTTB 4I87A 1I1RA 3KYMA 2YEZA 1DUZA 4ELME 3ISWA 5KBMA 1S7QB 4NUJB 3NVQA 1J0HA 3CHXA 2DH3A 3V9EA 1AY1L 2BDNL 3ZZQA 3QORD 4XNYH 2HH0L 4X6DB 3ARGB 4PR5A 1ADQL 2BMKB 1KLFB 4TL5A 3TNNB 4WJKB 2YGOA 3FO2A 3X1BA 1VSCA 5FC9A 2XICA 4KPHL 3EYVB 3ATDA 3B2UD 1GZPA 3AROA 4PD4K 3LEXB 4GKZB 2ZXCA 2OMWA 1IBFA 3UZVA 4NI3A 3K6DA 4V11A 1I1YB 2IANE 1MJ7L 5DTFB 2J2ZB 3OC8A 4LCWB 5A6IA 1R34A 4R8WH 1URLA 4MNHB 5DA4A 1EV2E 4C83A 4NQDE 1AAJA 4AENB 1O7DC 2A83A 2P80D 1DJHA 4HHGA 1QLFA 2NY5C 1XV8A 5DMKB 1EUUA 2RALA 5KN5A 2DW5A 2AFNA 1V5JA 4U3HA 1JK9A 2BSEA 2GK0A 4XMPH 4ZZFA 3NRQA 4V33A 1ZANL 3RTQD 5JW5A 3E38A 5C08B 1HHJA 1QVOB 2VE6A 3GSXA 2WXGA 2Z9TA 3PS6A 2UVEA 4Z7NF 1XGTB 2H7WA 4JR9L 3JV6B 3ZDZF 3ECBA 1EEZB 3B8SA 4ODTH 3UAJA 5IV2A 2K70A 3L81A 3F12A 3X11A 3QJSB 1FNAA 4X4KA 5AOJA 5EEUA 2H45A 4I18B 4DP9X 1ZGLM 2FJFB 2MKLC 5EO9A 2W5PA 3B7UX 2WLJA 1FIGH 4BZ2A 4JFFD 3K71B 4HFUL 1MJ8L 3QYCA 4FQQA 2ISDA 3W2DL 3BQUC 4WNQA 4FKKA 3QEHA 1MCOL 4M7ZC 5TF0A 3W9EA 5LN8A 2ZNWA 4QAWA 4PP1C 5D1ZI 4GXFA 4DP8X 4YHIB 3OMAB 4H0GA 1KYAA 5FF6B 2ZKHL 1QSFA 2ZKXA 2FX7H 3QWQB 2GJ6A 3QQXA 5D9SB 5FK9A 2WQRA 4JRYE 5EDXA 2BWIA 2OK0L 4XAWL 3GSQA 3S96A 2Z92B 4NKOA 3T6QC 2W0FB 4ATWA 5EF1A 1DSFH 1HZHH 5IQOA 5CSGA 5CLZA 3B2MA 2VLRE 3FN9A 1OCWL 3Q05A 1BBJA 3ZOAA 1PKQB 2UZXA 5KJRL 2A9CA 3PUUA 2R39A 5CLYA 2JKNA 4FP8H 1KWGA 3MRPB 4Q8BA 3IVKB 5E08L 4WY7L 5T5NF 1PZ5A 1XCWA 1C16A 1AJ7L 3Q3GB 4AC4A 3ETBF 1XCTA 1FL5A 4L4JA 2WWMC 3LXUX 5E6UB 1JVLA 4LRIC 5T1LB 1HSAA 2WQUA 1X5XA 1MAMH 1XZ0B 1GMEA 3HG3A 3BO8A 4LCIL 1MREH 1RJYB 5BCAA 4K71C 3APFA 3SGEH 3JV5A 3GLDA 1JNNL 1XGPB 2VDLB 2ZYHA 3IGAB 1CBVL 4K23L 2E5EA 4AKPA 1PS3A 1ZLVH 3PWUA 4YBLC 1ZTMA 4FNUA 4LL4A 4D8PA 2P49B 3L2LA 3DPDA 3L08A 4FYSA 1BMGA 3WE6A 5E99L 5LCVH 3QAQA 5KG9B 3FO1A 4JFEB 5HGAB 5LBSA 4LCYB 5T3ZH 1Z3GL 1WSST 3FUKA 4QIRA 4ONHA 4X6EB 3MLYL 1N8OE 5E2TH 3V0WH 1R9FA 2ZUWA 1LD9A 2PP7A 3BAYA 1OAJA 2FBJH 3U7WL 4UT7L 1E27A 4JANA 4E0RB 3KZ8A 5B8CA 4Z7WE 3SE8L 3J07A 3OX8B 4JY4A 2WXHA 2H3NB 1F11B 4R97C 4MCNA 4R6UA 1JMXA 4B6ZA 4DZ8B 3EXLA 3K2UH 5MI0C 3OLDA 1R5IB 5CINH 1FG2A 3MJ9L 2Q86A 2FK9A 3SGKA 1G6RB 2Y7SA 3SKMB 1T1ZB 4Y9EA 2RA1A 1IGIL 1RUQL 1LL1A 4CW1B 1I85A 4H44C 2V2XB 5IMOA 3VYOA 3HKZA 5FGCB 3P3TA 3KYKH 4N5UA 5DLLA 3GZPA 2XRAL 2ZOKA 3MA9H 2DJ4A 5CZVL 4KJWC 1HNYA 4IIQA 2ERJC 3GSVA 3NH7H 4HKBB 4Y4FD 1QW9A 5C3IA 2ED8A 3P9WB 3LVEA 1PQZA 5F3HB 2D7TL 3BP7B 5EC2A 4Y5XA 3KPOB 2VISB 5CSBA 1KGXA 3SBRA 3W38A 5FM4A 1T21B 2XIBA 4MAUL 2UY6A 1D7DA 1NDTA 4ZAKA 3HAEB 2XXFA 2UZIL 1QWHA 2BFVH 4LSSH 5C86A 2COVD 3V6ZB 3O3EA 3L5XL 3OKNA 4L4TA 3V4VB 3DXAD 4ETQA 3HZMB 4UM8A 4QTHA 4LLUA 5DRZA 1RK0B 3WKNA 1FYTA 4A2LA 2Q2EB 4HSCX 4K7FA 4ZQKA 4U3XA 1E9PB 3ZL2A 5AVXB 2HUHA 1A7QL 4MSWB 1YN7A 1U6AH 1YEEL 1UWYA 2BRQA 1ZK5A 2GBAA 4AX3A 1NSNH 2EUWA 4JQXC 4KTGA 2I60L 4GQZA 4OD2B 1F3JA 3ME0B 1XAKA 3FN0H 4Z7NB 3O6LH 1SMOA 2VDMH 2YXVA 4L29A 3MV8B 2LU3A 5DD6A 2AC0A 1QEWB 2BSCA 4WKZB 1JGIA 4JMNA 2DQGL 4QHKJ 4TRPH 1MRCL 2WB1A 4U6XA 1SQ2N 2X7LA 5T8IA 2PXYB 5CIPA 4U1HB 4DKDC 4E9QA 2MNJB 2D0FA 3GMRB 3OB8A 2F8XC 3FH5A 5IFAL 4HAKA 5EC1B 2XETA 2L7QA 5IMMB 4RWYH 3APCA 2UXFA 4R90L 4RA0C 4NM8H 1AO7D 2WKOF 4FI8A 4UIKH 4XPBH 3EHBB 2WLLA 3ZSTA 5MEQB 5I1AB 5KVEL 2CGRL 3F85A 3VXQA 3VD9A 1ES0B 3PXJA 2EKSB 3GHBH 2XPZA 3QUZA 4AIOA 3DX9B 1WUZA 2YPVA 3Q8EA 4BZ1A 4WSJA 1P6FA 5BS0B 1CL7L 2I27N 4U7SA 5LXVA 1KT2A 1DEEB 4YSUA 1O9ZA 2BY1A 2X53A 3FQRB 2YK1L 5GGRB 1MKFA 3TV3H 4E9YA 1VGEH 1S8DA 4F2MB 4GSRA 5F9WC 1AP2B 5D7KE 4JFDD 3ORJA 3CX2A 3PV7A 2DM7A 5ES4B 4OIIL 5HHNA 3IDYB 2VXUH 2V3EA 3ZW3A 3HG1A 1NCUA 1IKFL 2V2WB 1RZ7H 3U79A 5C9KA 5HDQL 2HTLC 1MJUL 4TNWF 3X3FL 1X5LA 4PJ7F 1J05A 2IAMA 2JI2A 3P0VH 1EXHA 4N20A 1TO5A 2GHZA 2H1LM 1OTSD 2XWXA 3D34A 2FH8A 3B3IB 4OKVA 2F08A 1RI8A 4P57B 3S5LA 4LSPH 1TIUA 4JFZL 5ITFA 3WDIA 2EXSA 1DUYB 3DMMA 1ZE3C 5LGYA 4EUPB 1IKOP 1IGTB 1P53A 2GY7B 3KPPB 5C0AA 1YY8B 4DP5X 1QASA 3AITA 4ZW3A 1EFXA 2HT4C 3JWOH 1HH6A 4KAQH 1LP9B 3MNWA 5D1ZD 5HHXH 2MFNA 3AREB 3B37A 4KK9C 2ICWI 1SDYA 2VDLL 2C9RA 2FHBA 2X4PB 1UH2A 3M1BB 5JO5B 4MWFB 3KDMA 3ASNB 4QHPA 2XZCL 4I1RA 4ZUSB 4K9JA 5G5DA 2KT6A 2X3AA 5DVNA 3Q8BA 1BM7A 3D05A 3N85L 4WI0B 2EH8H 5EZIH 3V5DA 2EDFA 3O9WB 1BFVL 3B5TA 5EZOL 4CN6A 2AK4E 1NBVH 5ABZA 4J39A 1OTUC 1OW0C 2Q8AH 5GS0L 1RPQA 2N7SA 2YAOA 1X5AA 1ROCA 3QIUA 4TNGA 5IZ7A 4OZFA 3BZEA 4UAOB 3AXIA 3EYOA 4HWBH 2I25N 1YEHL 5AEAA 1L3WA 1CI3M 4L0YA 2BHZA 3ZYIA 4L4VE 4XPAL 5HGDA 4WTZG 2EVFA 4AJ0A 1KJ2B 5F9JB 1J8RA 3RA7H 3SCMC 1AIFB 4MDIA 1N12A 2IMNA 3BEVA 2MPAL 4JM2C 3WKQA 2HCZX 2KKQA 3MR9B 1LDSA 4JCLA 4AYMC 5KSAC 4YSSA 4XX1E 1KPUA 5I1GH 2Z8SA 5DHVB 1WT5A 2VDPB 4QRAA 1EGJH 3KPMA 1NAML 5E6ID 2O61A 1GZHA 5DZOA 2V9TA 2JKJA 4LOFA 2PWDA 4NS0A 4ADGA 1G5GA 1QI4A 3GIVB 4HH9B 2XU9A 1WZ1L 3BUDA 5DDHB 1CT8B 2ZOLB 3FSOA 2PYFB 4LLYB 5HHVH 5TDNB 2ZX5A 5J4MA 2ILLA 4YC2B 1XXFC 3RPKA 4C4KT 5LWYH 3RWIA 1A3LH 1UOWA 3O2DL 4DJMA 1JYNA 3OKDA 3EOTH 3AQZA 1PNCA 3F05A 5DS8B 5AW5B 1I53A 1I8KB 2GSGB 4NAJA 2Y6TE 2XXCB 1BQLL 1K4DA 2UX7A 1ZHBA 4APQC 2EO7A 4WUKH 1FHGA 4XCEB 3O0RH 2FSEB 1DQQA 4KXBA 3QO0B 3ZUNC 4JKNA 2ATKB 3EJSA 4NO0B 1RZJH 4WWID 3I6KA 1CXHA 4MMZC 4HG4J 3BWZA 4HAFA 1ASOA 3TO4D 4P4KD 4Y5YA 3N1MC 5DD5L 5I6NA 2BP0B 3O6FB 5F7BA 5J8OA 3VFSA 4N0FA 3MA7B 3NCXA 4D0BB 4NUGH 2H1PL 1Z5LA 1LTXA 5EN2A 1XGUB 1DVFD 3OMZA 4EDWH 1N6VA 3MODL 1TNNA 4OD1L 1LO4H 1XD1A 1KGUA 4GYBA 2ZWYA 2FQDA 1DVTA 1XGZA 3CXHK 1A6ZB 1GHFL 3GMNA 3P9MB 1BM3L 2G2PA 5JW4R 4MD5B 4PGBB 3LNFA 4HUMB 2YPLA 4HQQH 1MFDH 3WI9A 4Q0XH 3NJKA 3I74A 4TVPH 4F92B 5ALBH 4DKEL 4K9EL 3UFIA 3PV6B 4F57H 4NSKB 3I3BA 4UT6L 5C2BH 1XGQA 4KXAA 1N59B 1QSEE 4J3OF 1EDHA 4MA7H 3AM8C 4U4BA 3Q5OA 2B59A 5AD0A 4N2NA 3WXVH 4ZUVB 5FXCH 4Y9BA 1NICA 5DUJA 2XN9A 5TF1H 4LARH 5ISZD 2L4OA 2Z8RA 3WXWH 3NCJH 3MLXL 1ZLWH 2CM6A 1FPTH 1GGUA 1S5IL 4WI3A 1QRNE 4LLQB 2LLNA 3VM7A 5JYLA 4APXA 3MJ7A 2F6AA 4TKWA 3EUDA 1E6JL 3CQFA 5FYLH 3MQIA 3MI6A 2F8VA 3M17B 1C8PA 3WTYA 5GGTH 3G6AA 5JUEL 3ECQA 2CA4A 2P7TB 1FLRH 1TLMA 3LRSB 2IALB 2Y3AA 1DP0A 3B9KD 2KPWA 4HJGA 1I7TB 2QVFB 2Q6WA 1HEZB 2BX5A 1DYZA 1WWBX 1YAZA 3L6FA 2X05A 4AM0Q 1KXQA 2W07A 2PETA 2OZNA 4HLZG 3DX6A 5EN3A 4MYPA 3RNKA 5CFAA 4HZLB 1OLLA 2WTRB 2PTTB 5LN4A 2H2PD 5KSUA 4U7MA 3KPSA 5T1KD 1JSYA 2AHIA 3U2IA 2G3XA 5FDYA 2QQLH 4BZYA 3HAEG 1L0XA 1IQDB 1A0QH 2GW5A 3ECWA 1UURA 4LCVA 4PGCB 3KPRE 5GGSB 2Z4QA 5CEZE 1S9VB 3QUYD 1P9MC 2IV9A 1HIML 3DTXB 4ZUTA 2Z35A 4OCMC 3RQ3A 1PLGH 3DX3A 1Z3RA 1Z9OA 4MASA 3QJOA 3TJEH 1UFUA 1YMMA 3L4VA 4UQIM 5I1LA 5IHBA 5HYJB 1D5XB 2WBWB 4UU9A 4WK2B 5D96B 4XTRC 5HI3C 2O5ZL 3VFGH 5AVTB 2ITCB 5I1EL 3MGTB 3VRLE 3KLKA 1SBBA 5J11C 4XBGA 4TLTA 4UMGA 3H3PH 4JFWA 2KYIA 1UENA 4F7MB 1QQDB 4NQXA 4QGYA 5IBUB 2HUEA 1G7PB 5C0CE 2ZCKL 2DQIH 3TF7C 2FE0A 3NTCL 4MAYB 2O93L 4B5ZA 3DETD 2PO6D 3ELQA 3NCWA 1S3KH 2OI9B 3IKKA 2FX8H 2R29H 4ZNCD 1AXSB 4WWKC 5GPRA 3ZGIA 1HINH 2JLPA 2Y06H 3G5YB 2JTYA 2UYLB 3BHBB 1ND0A 3KLAA 3ETBJ 4ZPVA 2EZ0C 4LVEA 4QRRD 1GIGH 1VFAA 3MBED 3QA3B 5FDWB 2IQAA 1NOFA 5AAMA 2ZICA 3A24A 4EVNB 3VI4A 1M6OA 4UINL 1GKOA 4N8CH 1KJ2L 2PYED 3QHZL 4NNYB 1U8HA 2BWQA 2FZ3B 2NY1C 4HEME 4ZT1A 3ZKMD 1MCFA 4IU3A 5BUPA 2YS4A 3ETSA 4LDCA 4HHWA 4PJHA 3QJVB 3QWOA 5D6DC 3U4KA 5LNGA 5J7CC 3I9GH 2VDPL 5FO9B 1MY5A 4MHHG 1ETZB 5DRXA 4J28A 1NGZA 1T3FB 3L95A 1KCUL 1I3VA 1OPOA 5AVYB 5T5NG 1SUJA 2ID5A 4OUOA 5DEGA 3UTSA 1NCAL 3CN3A 4IBWA 1RJLB 4XB7A 4C56B 4JUSA 2A6IB 2CHDA 4NBXB 5F7KC 5GQBA 3HR6A 1TTCA 4NT6A 1M05A 4G59C 2HLFC 4WLCA 3IDJB 5CBEB 6FABL 4Y1SA 5FO7B 3VXUA 3MNVA 4LU5L 3Q5YA 4HKXB 3IETA 5BO0D 5F88A 4N9GA 2J4WH 4OCXL 2CXKA 2H26B 3QNFA 2ADGA 3ETTA 2E9WA 2WP3T 1M2OA 4J4PA 4PJGA 2BSTB 2FWOB 3ES6B 1Q1JH 3CZFB 4HW6A 4YX2H 4IYKA 5T3XE 4PV9B 4RAVB 1BXVA 3RVVC 4NBZB 3UAAA 1U9KA 1J5OL 4A6YL 1BD2E 3B4NA 2GJJA 1B4TA 3WEOA 3WAJA 5GISH 2DZEA 1N5AB 3CXFA 3T4AA 1XB6A 3KYOA 3CN1A 1ACCA 2GUYA 3GJFH 1QLEL 3VWJD 3VSVA 3MOAH 1H6TA 3BDXA 2X44D 3VX1A 1Q9KB 4MJJA 1RK1A 2LAGB 1T5WA 4JHWH 1Z0MA 2YAQA 4GRWF 4UV7H 3S4SA 3TCXA 3N2JA 3OZKA 1NDGA 4AL8C 4ZQTA 4PS4H 4LLWB 1NFDA 1NLDH 1TLKA 1ZVSB 3NZ8A 4NWUL 4PRHD 5E00B 1AOZA 2VIRA 2G9KA 1BA9A 3AMLA 4NN6C 2Q1EA 3TBWB 4Z3JA 3BDYH 4PRDA 4JQIL 1DBKL 1ZRUA 1GGBH 1CU4L 4HJ0D 3PDDA 2Z7ZA 3LEVL 4L3EB 5ESVA 4PGDB 5IVNA 4KKLD 4H0HB 2FSDA 2Y22A 3RWFA 4CBPA 3OJVC 5IB3A 5KJ4A 4W9HC 3VFVB 4NO3A 3ZLQC 4LNVA 3ET9F 1ZLDA 3GHEH 5FFOA 3WBDA 2WLNA 1ZVYA 4NKMB 2Z4TA 3SPGA 3UG4A 5KVDH 1OSEA 2AZUA 1M42A 3LAFA 1TCMA 2JF1A 1L5GB 5TK4A 1QI5A 2R1WA 3PU7A 4AKOA 3P0GB 3QBTB 3FUHA 5EUOA 2EYRA 2Z31D 3T1FA 5J6GA 1DBBL 3EFFA 3H2PA 5L7XL 1MLCB 4Z77B 2MTPA 1T89C 1L0PA 3KYMB 4M29A 3JZ7A 1S7RB 2OL3B 1I3GH 2EDQA 3HPLB 4F9LC 4AGOA 1PZAA 3CLEL 1A7BA 4ORGA 4G42A 4DO4A 1Q90A 4HWEL 2E7DA 3QPQD 5E4OA 2XKUA 1E42A 3VVVA 1S5HA 2A74C 1O6SA 1NAMA 3FUJA 2BIMA 1MUJA 1YA5A 1NBZB 2BM3A 3PJSB 3UO8B 3EGDB 1BFOA 3MNZB 5MEOB 2AQRA 1GZPB 1N70A 2XWCA 3NSJA 5FB8B 5TPWL 2WYTA 4Z7QF 3RUGA 3EFOB 4LSTL 4OCYH 5C0ND 3UZVB 1TJIH 5K9JL 1TETL 5FA3B 3O2WL 3US1A 2OMVA 2NXZD 3UH8A 3QFJE 3EFDH 5CEYA 3MLTA 5FO8B 1IM9D 2XJLA 5JW4Q 3B2DC 1DBML 2QQNH 3QZWA 4XI5D 4XWGH 5FIEA 3RGHA 3HFML 4KI5F 3C6LB 3EH4B 3V0VA 2VDQL 5IOPB 1OT2A 2VR7A 2WLIA 5B7EA 5KN5B 3V5HB 2L7UA 1H15B 2YAFA 2IPUG 1JK9B 4JGNA 4WI8A 1X5JA 1ZXQA 4XE5B 3IPFA 2ED7A 4NP9A 3BT2H 3MTRA 2VE6B 3TT3H 4B9PA 5EZPA 1GSKA 4QRPA 5FKPA 2JIXB 5GIRB 4GB9A 1QFOA 2P5EE 4HLEA 3I6GB 3OPZL 2BNQD 1P84J 4DGWC 2H41A 1UA6L 4OGZA 3IEAA 1SF3A 2OCCB 5EO9B 3FTSA 4WUUE 3E8UH 3CLFH 1MHHB 3D4GA 4JZJC 1OO2A 3I9AA 3NZHL 1BQKA 3U4EA 3BOVA 4P3WA 1WZMA 3O11B 4YXLH 5JOPE 1S7SA 3AU1B 4P46C 1XF5A 5IQ9A 4UYPA 1QSFB 2D03L 5EU3A 3T09A 1J0IA 1BGXL 4G9FA 2BNRA 2X9XA 3D0LA 4D9QE 2FD6H 2O6DA 4RRPM 2DYSB 1KIQB 3BISA 1FV1B 4LEXH 1AZNA 4PLJD 4R0LA 2JB6A 4X8CA 3SDDD 5TFSH 3RPBA 3FFOA 3NSYA 3K2IA 5L6YL 3E6FB 3Q13A 4ZO7A 3HMXL 3QPKA 4GRMA 3VCLA 4NDMA 1HCFX 1SLVA 1VZHA 2CO7A 5A2LH 4BH8A 2DTSA 5MENB 2FJHB 3G04B 1FIEA 1FL5B 1QKZH 1C5BH 1FFPB 2F53E 1WBXB 2XKNB 1HSAB 4I0PA 2YN5A 4ZK8A 3JV4A 2HAZA 4ODWB 5E8DL 2OMZB 1JGEB 5SV4A 4GRWB 4KUZH 3X14A 5KBPA 3JWNG 4I1PA 4MCYA 4F27A 4HBQA 1EHXA 3P73A 4HK0A 3VNYA 2E8ZA 4UQDA 5E5MB 4MRCA 1E65A 5GHWL 4KTDH 1BBDH 1KC5L 4DUVA 2N4IA 5GRYA 3TTYA 5AUMB 4WQOA 1GSMA 2VDRB 1A6TA 4YO0A 1RP8A 1RZKH 3VXSE 3VU1A 5JTWA 4KKRA 3GQFA 1J5IA 3QHFH 3ULUL 4N1EA 2ADJB 4U6VL 1FN4A 2MOVA 4M5TA 5DC2A 2E0PA 1E4WH 4U1GB 4PJEB 5DJAA 3MN8A 3EIFA 5B3SB 2CDFB 2XBTA 3QJQB 5EOQH 3ZTDC 4ONGL 1FO0B 5I1KL 2AEOA 2E7MA 1PD6A 4CVXB 4WV1C 1KOAA 5IEHA 5IF0A 2GC4C 5C0GA 4JVWA 4G7VL 4YWGH 2HFFA 2YSSB 5DJCA 1IL1B 2BC4A 4UV4L 4PUBL 1GR7A 2GIYA 4M1CD 5HTSA 3ARDD 4NJAL 3VWKB 2DYPB 4CNIA 2XTJD 2IAND 2YUVA 4MDJA 5GRZA 4CSZA 4HU8A 1J1PL 3IDGA 5ESQA 1D6VH 1ZPLA 2VXSL 3KAAA 4P2RB 5JHMA 1D5ZB 1Q0XH 2NUTA 3HW7A 4QOKD 5JHDA 1JFHA 1ZLSH 4AY0A 3IXTB 15C8H 3ZT7A 4QUOA 5ICUA 2F18A 4WNSA 4X6BA 2IFFL 1H5BB 3GI8L 4Z7QB 3T8XB 3ARFB 2OW7A 1RPUA 1JE6A 4UANA 4Y5XB 5J12B 3C60C 3FZUD 2BS8A 2QLYA 2NX5D 2OL3L 1CURA 1BXXA 4ZAKB 1OAZL 4AVHA 4KKBD 3GXPA 4DP1X 3TEYA 1QR1B 3LKOB 1RULH 2YJQA 4Y5VB 1I82A 1RHHB 2XIIA 4QTHB 2NYYC 3L4WA 4OCWH 3SYPA 5IJVA 5AB9A 1CFNA 4RMRA 4Q58C 3QJTB 1KYOJ 4G6FB 3GKWL 5IMKA 4RX4D 4PD4J 3FT2A 3BAJA 1W8OA 2AGJH 1F3JB 4QRBA 2B3RA 4Y4KB 4WJ5A 1G1CA 4IBYA 1DQTA 1IGMH 1AGCB 2AQ2A 5F96L 5AYUL 4J3OG 4JRYD 4FHBD 5L0QC 3U30B 2OMUA 2WCSA 1I1AD 2OJ1A 4Z0XB 3WS6C 4RAUB 4B53A 4JDTL 3NIFB 5FV2A 4JY6A 4MXWL 4UILH 5EA0L 2FIKA 2OBGA 3CH1B 3L3OB 5D7LA 1FORL 3O4LA 2XZQL 3BZ4A 4Z3IA 1T4WA 4BUQA 2WHVA 3WL9A 3QO1B 4A6YA 5BW7A 2Y24A 3AWGA 2WLLB 2XKSA 4JPQA 1FH5H 2MNWA 4P23D 4UOQA 5CEZH 4R4ND 3C5ZD 2ESVE 2LVCA 3L45A 2XWDA 2KDYA 5F7NC 1B0GA 2XLLA 1R5WA 4OF5A 4Y2DC 1F86A 4X50A 3NCEB 3RPIB 3B43A 3BVUA 3L13A 4XNQB 3BFOA 3O3AA 5AYQA 4YFLI 4X7SH 1ECZA 3AC0A 3HR5A 5SWQA 1A65A 3B34A 4NKDB 3N40F 1EHKB 5I30L 1F4WL 2AQQA 4H26A 3PWJA 1GCFA 4JFXB 3V8OA 1PF3A 4DVRH 4L1DA 1R75A 5B1AB 4K8RL 3BUYB 3EO1A 1NCOA 1XF1A 5K1VA 3ZRFC 1T66C 2YBRB 5CSZB 5GS1A 3CZUB 2VSMB 4WI7A 4AT6A 4AMKL 3PYCA 1BZOA 2PR4H 4OKVB 2QL1A 4KHXL 4P5TA 4Z3EA 3B6SA 3BP4A 4GRLD 4B9ZA 2IEPA 2OKMA 3MV01 3VXMA 3SY0A 4PB0H 4PRIA 2EYSB 3RI5K 5GZOA 1F56A 2XA8H 1CXLA 4F37F 2J1WA 1BYOA 3I85A 4HU2A 1IFGA 4OZGA 4G6ML 3MNWB 4TOYH 2R0LH 3VD3A 1DANT 4J8QA 3F7YA 4KKNA 2OP4L 4HF5L 3U1PA 2OSLA 3MOQA 3QORA 1R3JA 1BW8A 1KJVB 2CBTA 1HZLA 2N1KA 3ECVA 4U0QB 4D9RE 5FUZL 3WIFB 4FYQA 2ZPKL 4MQ7A 5CLTA 1CICC 5D8JH 5ABAA 3HS0B 5ALCH 2V3FA 3CFDA 3H42L 3OB0K 4HJTA 2VDRL 1J8HE 4XCYB 3WKML 3UXFA 3W37A 2IQ9L 4LHJB 4YZFF 1Z5HA 4PBVC 4DPCX 1NUGA 4QRTA 3LMJL 3UBXA 3MRMB 3TWCH 1CZ8L 1KFGA 1BG9A 3V5KA 5EWIH 1M2VB 3GSWA 2DBLL 4TLSA 5D1XC 4B97A 3BWSA 5HHMB 4CJ1A 4ENEC 1DDHA 1B6UA 2W0KA 2E4FA 1VPOH 3D08A 4MDIB 1FO0L 2HWZH 5C8JA 2FCBA 3CXDH 5I74C 1LO2L 1Q9OB 3PQYE 4J2QA 2C1OA 1KPUB 4WEBL 3NPSC 4JS7A 4LHUA 3E3QC 2ZOTA 2FJGA 4AYID 5MERB 2R2BA 3ZYZA 2R56H 2BNUA 3A23A 4EI0A 3CUPA 3M07A 4M7LT 1QNIA 5C0DB 3B56A 4XC3H 1WEJL 3BE1H 1OKEA 1S7UB 2F58H 3VI4F 1U3JA 4ZMNA 4YDVB 2AVGA 3OKDB 3CFJB 4WI9A 1CMOA 3MJ6A 4PJHF 5J1AA 4Y19A 3QDGD 3AT8A 3GLAA 1CCZA 2BVPA 2L8AA 4HWNA 4JFFA 1WCBB 3NCYS 4KK6C 4XNYL 5AENA 5I73B 2R0WH 1DQQB 4NP4H 4JFYA 5DRNB 3T08A 5F9DC 1ZHKA 3ZMEA 2WJ7A 3I6KB 2HJLA 4AXWA 2ALWA 4Y5YB 3ESPA 4OTXH 3X1NA 2BP8B 4RSVA 3VFSB 2OTWA 2VDMB 4QAMB 2L3BA 4R8WL 2VLJE 2JXMB 4BXSV 1S7WB 5DO8A 1NCGA 3UGUA 2EO9A 4A2EA 4TNVK 1VA9A 4AQZA 3SJVE 2ZUXA 3WFHA 2RH0A 1OQXA 3KPTA 3GMNB 3V55A 3H9YA 3OHMB 4G8GD 4PJGF 5D4IA 2XG4A 4WO4B 1M53A 2ZQKA 3RGVB 5GRJH 3WJLC 4XMPL 2WLMA 4XP1H 2B77A 1GY2A 1TEGA 2F15A 2VUKA 1GYAA 1CLOL 4IMKC 1H0DA 1JWUA 1WUNT 1GY1A 4MNQB 3LSOB 4ODTL 4FXLA 1XGQB 5C0IB 3C87A 4IHOA 4Q97A 5FV1L 3EADA 1LQBC 2K7QA 3NJFA 5DMJB 4PCTA 2B59B 1K3ZA 3Q43A 3PWLB 4J8RB 3NCYP 2NZ9D 1PY0A 2XN9B 4M93B 2AF2A 2WQAA 1FIGL 2Y1AA 5I5IA 3QIWD 3D09A 1EDQA 5BV7B 1NFDF 2DJSA 1XF4A 3BPLC 4JN2A 3RAJH 3X1GA 2W60B 4KXDA 4DP2X 1SXNA 2X0VA 3HCVB 4YGAB 1QYGH 3KPQA 2GJZB 1MFEH 2R15A 3BZDA 1FNEA 1OGAA 3HS8A 4PJXA 3T2OA 3UBFA 4BCYA 2MHAB 5CR8A 3MRKB 1P5UA 1KLGA 4IRSA 4Y1AD 4EI5C 3RIKA 4U6HA 4EIZC 1AR1D 2IADB 4QR7A 3PY9A 1DSFL 1HZHL 2GSMB 3WAKA 2JVUA 3L6FB 3RWJA 5IT2H 2AK4D 2YUWA 2W07B 2BOBB 2R8SH 1JPTH 3KL0A 4FP8L 3DX6B 3ZKNC 4E41B 5EMYA 3D18B 3AMKA 5EF0A 4W70A 2DQFA 3ZQXA 3F5WA 3IGUA 4J3VA 5I5MA 3V10A 5EUOF 1T1WA 4XNUL 5L2KA 2IFGA 2RTTA 4X7TB 4UTBA 2RQ8A 2QKIA 1S4IA 3CCHB 4HCRH 4L4VD 2JJSA 1IEAA 1SJVA 1MAML 2NY6D 3DROA 1K3IA 2VDKH 2DLFH 1MREL 1UZGA 2CKBB 4HHAA 3NDZE 3RVXC 4JRFA 1XSOA 1M7DB 1KMGA 3WNLA 4POZD 3FQTA 1I7RA 3FSAA 4R26H 1BQUA 4C55A 3KWWB 4J3SA 1SXZA 4UU9B 1IIKA 4XMWA 1E5BA 3T0ED 3ZZ1A 1LYQA 2ZXGA 1JTOA 5LCVL 5T3ZL 4FE9A 3FS9A 4LLVA 1FFTB 2VC2H 3MLRH 3FCTA 3RUGF 3S3DB 4RGOH 5E2TL 3V0WL 1FZJB 4PJBE 2FBJL 4PCSA 5E94B 1F3DH 3GBLA 4IMLB 5BMFH 4O51A 1YAIA 5TH2B 1KG0A 2NZIA 4R7XA 1OD7A 4RFEA 1U0QA 4Z7OF 4Y2OA 5H8DA 3AABA 5I9QB 3K2UL 4LCCB 3WIHA 3A47A 5CINL 3HI6L 2VW7A 4HJ1A 2OYLA 4DN3H 5E5UB 2OMTA 3OR7A 4M6MH 1VEOA 3SDXB 4QHMA 1G7JB 1ZGLP 2M1KA 4YLBA 2WZPD 3D33A 4WFGE 3ZJAA 1MHEB 2J20A 3QWOB 3CMOH 3KYKL 5IHUL 2WAQA 2BXZA 4R3SA 3MA9L 1LGVA 2EEBA 4OLYL 5K59F 4MXQC 3FQ1A 1T7WA 5DRXB 1OLZA 4IRJA 3NH7L 4G9DA 4U6YA 4WFFE 4KKCC 3OHXB 4G7QB 3GZKA 3D06A 4P48A 2P5WE 3D5OF 4FXGB 4G8IB 4JM4H 1T6BX 1E3XA 3WMPA 5HYSA 1Z2KA 5EU6A 3HLKA 3DPBA 4LKCA 1E7VA 3LKPB 4MB1A 2EIBA 3ULVF 3ARZA 3QI9B 4KH9A 4M61A 1IAIH 3LQZB 4N0YH 2DLHA 4ZMQA 1HAWA 2BFVL 5SWSD 2XV3A 4LSSL 2HFTA 4QHUB 1E30A 1SYVA 1A25A 1SJEB 5FS5A 1R3KA 1TVHB 3KR3L 4FFTA 1TTGA 3KL3A 3ABZA 4PJ8A 4PJGB 3S5LG 1U8CA 2BSRA 4LP5A 4W9GC 1MVYA 1PIGA 3MFGB 2EDMA 3M7FB 2FEDC 2QGEA 3VFPB 1KIUB 1T7YA 2CALA 2F68X 5E9NA 4EI6A 2BWDA 3W5MA 2WBJC 2XVLA 3CFTA 3X13A 2YQBA 3ZDXF 2R9HC 2YMXH 3HLAA 3O6LL 2BINA 2VDML 4PP1D 4KRPC 4KNUA 2F7RA 5C3TA 5DRWA 3U6XS 1SY6A 3FTGB 4PJIE 3EYFA 4N8VB 1SEBA 4IEFB 4TRPL 2WANA 2PKDA 2ARJA 2Z65C 4ABWA 2W65A 4I13B 5BJTA 4HIEB 7TAAA 5EEZA 1UJ3B 4FXKC 2HFEA 5F3FA 1WAAA 2HJKB 3GMPA 4EXKA 5AW6B 1DJXA 1NFDB 3CXHJ 2BSDA 4JPKH 2GJ6E 2WUCH 2QFPA 4LVOC 1MNUL 4RWYL 3KD4A 1ZDSA 3EDFA 2LVEA 4GG6A 2Q20A 3IS1X 5D1ZA 4NM8L 3G6JF 3FFCA 4UIKL 4XPBL 3UYPB 4ODUA 5BRZE 1EPFA 3BT0A 1YPZA 3PNWA 2V7NA 4I8DA 1L7IL 1AC6A 3GHBL 3VFNA 5A43C 1EAQA 4QCIA 5B1CA 4L8SA 3FQWA 3FL7A 4X5WA 4QRFA 2WCPA 4N0UB 5FCUH 2EH7H 3B2XA 1UACL 3FU5A 4QRQA 1Q38A 4O2CB 3H9SB 3TV3L 3MV7D 1VGEL 4HC1H 3RWCA 1KXHA 1NFAA 4D0CB 3VD5A 2K6ZA 4YK4C 3R06A 5ACZA 2B4CH 1F4XH 1YJDH 1RJZA 2X10A 3SGJA 5J6GB 1YNKH 5IFHH 2VXUL 5M94B 2B9BA 3QWRD 4JJ5B 1RJCA 3MO1B 5FR3A 3HMWH 1SLXA 4GO6B 1RZ7L 2RFXB 5C0CD 4YHYC 5D5MA 3QQ3A 1WAPA 1ZWIB 5EIQA 1U2CA 1MY7A 3LS4H 3R1GH 3P0VL 5DI8B 4JG0H 4OZHE 3CFBB 3H0TA 4NKIH 4BQCA 4C57C 2JK5A 2PCFB 3P3UA 1TR7A 1O6SB 4GKNA 5DO2C 2FTAA 5ACLA 4LSPL 4WW2B 5E6RB 1MUJB 1GPOH 4AI7A 2EVHA 3OGCB 5IIEB 3IF1A 2ZX9A 4FTVE 2FUTA 3ZL1A 1GGCH 3U83A 4XH2A 3JWOL 1NEZA 5FWQA 4KAQL 1XTMA 2OMVB 3K4AA 4ES9A 3ATFA 5HHXL 4P5KA 2IPKA 3KLHD 1U3HB 3B5HA 4KJQC 2A4ZA 4MMXB 3D39A 1HE8A 4JZOA 1CXFA 4UM9A 4JO5A 3NQIA 4Z7OB 1UOVA 3ZL4H 5IB5A 1IVTA 2YRZA 2EH8L 3DHMA 5EZIL 1TDQA 1CGYA 4MZ2A 1N5YH 1NBVL 4XVJH 4PVMA 1BZ9B 3SQOH 1TQVA 3NCMA 1E6OL 1BMWA 4X9HA 5IB2A 3VRJB 1CK0H 1N3NA 1FBIH 3BVNA 4G6AD 4HWBL 4XODA 4F7PA 3GRGA 4KROB 2HT3C 4R7DB 4MNGE 1LK3L 4JEGB 1L7TH 1Q9LA 4JLRA 2VZTA 1GH7A 1I8MB 5D1XE 5I0XA 3RA7L 35C8L 1LWHA 2EEFA 1FVEB 4H1LB 3BW9A 3KLLA 5LNEA 2ORBH 1OVZA 3DHJA 4WHCA 2J6EA 1JZ2A 5I1GL 2AV1B 4ZNEE 4PJ9D 2I07A 4YNYB 2EIJB 1AGFB 1FVCA 1EGJL 4I18C 3KWUA 2ZX8A 3BD5A 3CFEB 4OQ1A 1W0WB 4MAZA 3E3QE 4KNQA 1NQBA 4G72B 2D8KA 2WYZA 3JYBA 1F4AA 4L4TE 2VM9A 1IIIA 2EC8A 3UL4A 5C97A 1T20B 4N0CC 2FO1A 2J8OA 3D0LB 5HHVL 3WLWC 5TDPB 3BXNA 5D71H 5LWYL 4J3UA 3HBZA 3VXNB 4ZFGL 5ISZA 3VSQA 1UZ8A 3A6OA 3BUBA 3EOTL 5FUCC 3S8WA 2VTFA 4PV8B 3GPEA 3QJFB 5CR1A 4URTB 3RZCD 2PF6A 4YSDA 2J57A 3VCLB 1I9RH 4NDMB 4AE0A 3S8GB 4WUKL 1OGSA 4XO3A 2QZQA 3ZDXB 3O0RL 5BQ7A 4U3SA 1IQWH 1M7UA 3MROB 2KQMA 1TFPA 1RZJL 3WTXA 2Z1PA 5I0ZA 4I0PB 3EW3B 3OG6B 2DEYX 2WNKA 3EOAB 4H25A 2OJEA 2X4UA 3OLGA 4TQ8A 1E5AA 4L5FH 4YVUA 1TQTA 1P4BH 2DL2A 1SHWA 2EICA 3B8YA 3B9KA 3QDMA 4Y16A 5E8EA 3IJ8A 3Q6GL 2R1YA 3X14B 3GTTA 3MRCB 3MYJA 4WJG3 3ZZLA 1LEIB 4GBXB 2X89D 1R47A 3TM6A 1FE8H 2HA1A 4H8UA 4YSTA 4EDWL 2YQ2A 2JQAA 2E9GA 2FECI 1LO4L 8FABA 1G94A 1AFVH 3G6JB 4FQXA 4DP7X 2EUZA 1H8NA 4LPWA 3PWVA 5ETUB 2FQEA 1JK8A 4YDJA 1XMEB 2D3LA 2DL9A 2FL5B 1F8TH 3HRZA 4HQQL 4NC0B 1HCYA 1HN1A 1MFDL 4P3CH 4Q0XL 2HB0A 4TVPL 4Y7MA 5KSBB 5ALBL 3VSTA 4YEFA 3QUYA 5ICYA 5GS0C 4A38A 4Q9QH 4F57L 3ULSA 1CTMA 2I9LB 1MPAH 2EDDA 5C2BL 1BVLB 1G7MA 4LFHD 1ECYA 3AWEA 4KOCA 2G0LA 2CLRA 2JWYA 3F65A 3WCYA 1MXGA 1UQSA 2P42B 4NAQA 3GGWB 4CAGA 3T4YA 2CNZA 3ESUF 3WXVL 4BFRA 5TF1L 3OKEB 4DVBB 4LARL 5D7JA 2CZNA 4FCHA 3WXWL 3TP4A 4BHUI 3NCJL 3PUCA 2NY2D 5DJCB 3SBWA 2IOOA 3MCYA 2VO5A 4XOBA 1DR9A 1SYSA 3KLSA 5ID1B 4MDJB 5FYLL 3AXHA 2Y0SA 4L8BB 3PPSA 4MA3B 1OGTA 4HEPG 3QEQA 4TUJA 2BCKA 5GGTL 4AQ1B 1Z9LA 1FLRL 1WYJA 2DWEB 4NQCB 1SJHA 5EB9A 2H6OA 4U1KB 1A7RH 1IEBB 2AJZA 3IYLW 2XXGA 3MBXH 2MKWA 1JGLH 5DZVA 4B9KC 3V6BR 43C9B 3F04A 4QO1A 3NA9H 4DGUA 1J8KA 4OFYD 4YFDB 3C6SB 4NHUA 1WG3A 1KTDA 1R5VA 2YXFA 2QQLL 4NERA 2ICWA 1HOEA 2HSIA 3SD5A 3F8UB 3STLA 1KTLA 1A0QL 4PY7A 3D30A 3MU3A 3QXAA 2QQQA 2VW4A 5FM5M 3Q6FA 5IB1B 3V0DA 3BGFB 1EANA 3FTWA 3A3YB 3B9VA 4P2OB 4AYDC 3NT0A 2ICEA 5CFHA 1JPST 4AH2A 1TFHA 2EVGA 2JQZA 4ZUUB 3TJEL 4GQ9H 2BOLA 1AZUA 1DZBA 5IMKB 3VFGL 3SOTA 1NCDH 3FT2B 3HC2A 1YNTA 5JOPD 3DRTA 5IHZB 5L88H 1UYWH 5E2UH 1Z5YD 2UUDH 1V7NH 1TYEB 1A4JA 2AJXH 1TF4A 5AB0A 2DQIL 2FHCA 4JRXE 1PZUB 3V9CA 4NQSA 4JY6B 1BWMA 1S3KL 1RP9A 1T0MB 5IBTL 1TQWA 2FX8L 2R29L 4ZFZB 3F7VB 3VGDA 3S88H 4QT5B 2Z7YA 1JUFA 1FA4A 3S4SG 2PXYC 1HINL 1U2YA 2Y06L 4QGTA 4QY8A 4GP5B 2YPKA 4C47A 3WL9B 4P2CG 1GIGL 4GO9A 5B1BB 1U8LA 3G5ZB 3DVIA 1HTYA 3QUXD 4MJIB 4N8CL 2F7OA 1R1CA 4U2YA 1O6VA 1B0GB 4U4IA 1R5WB 1A6UH 2VWEC 3GB7A 3ZQ9A 3APMA 3H4HA 3UC0H 4K5NA 1JI2A 5KVGL 3D2UA 4AQAB 3W39B 1E4HA 3QQ9D 3HR5B 4N25A 1JWSB 2OQJA 2C9QA 2D2CC 3H7BB 4GP4B 5DT1H 4Q9RL 1H6FA 4U2ZA 1WHPA 5HI5C 3PWJB 4P9MH 3B9AA 4GXUM 2HPTA 5AW2B 3VXSD 3HE6B 1BIHA 3RY5A 3QR0