2AQ2A

Crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3 mutant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
110
structure length
110
Chain Sequence
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGVGNTEKGDIPDGYEASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords T-CELL RECEPTOR BETA CHAIN V
total genus 32
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2005-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2aq2A00
5DQJA 1HCFX 1RMFL 2OS7A 3T1FA 1C5CH 3NFNB 3M8OL 4QOKE 1MJ8H 4JRXD 2NZIA 1VKXB 3LQZB 4N1EA 2PF6A 4JRYB 5E8NB 1G7MB 1FL5B 4B7LA 3T0DA 1JF6A 1WIPA 1J9CT 2XPGA 5SX5H 1YEEL 5JR1H 3PQYA 4G6ML 3RIFF 1RUAL 3DROB 3RY6A 2JCCE 3DRTA 2DF3A 1DQDH 2IQ9H 3NA4A 4UIMB 1ZT1A 3GI8L 2L7JA 2W38A 4XB7A 1TQCC 2R2EB 3I50L 2EKSB 2DQFA 4YGVA 4PJDF 5K33A 1CVSC 1G7QA 4ISVA 4YE4H 3RZCD 2EEAA 3CFCL 1QBMH 3MMEA 5HDOA 5F7NC 4OCSH 4C56D 3HE7A 3G5ZB 5JXED 5EU6E 1EEYA 3WSQH 3RVUD 4Y0GA 4DGIH 2R8SL 1U8NB 3K80A 4CN6A 3HC3L 4NKIH 4JGUA 5ACMA 2HFGL 4DKFH 1E6OH 3N06B 1ZV5A 3ARGA 3L5XH 3KLAA 4XNQA 4HIIA 3BIKA 4ZODA 4KROB 5T3ZL 1ZKAA 1BWMA 1KCSL 5BV7C 1KENH 1MQKL 3HE7B 4L9LA 5F96H 5IT2H 4GRLC 2GK0B 4DVBB 1N4XH 3D2UD 3O6LH 4K8RL 3F12B 4HLZH 5C0GA 1XGTB 5AUMB 1XF2A 4PIRF 2NY7L 1KLGA 2CXGA 1FFQA 4KVNL 4EI6A 4UUJB 3BAEH 4P23B 5I1AB 5CD3A 2DQEH 3ARUA 5C09D 2X4QA 3BAEL 1EEUA 3CLFH 3UTSB 5DF0A 1YDPA 1G9NL 3SCMD 1N0LA 3UPCA 1BVKA 1IGMH 1YQ2A 1YN7A 3FB5A 4WFED 2OR9L 4QO1A 1XIWA 2QSCL 4FN0A 5IVOA 1T5WB 2ITCA 1OGTB 4OZHA 3VFWB 4X6DA 1FNHA 5FB8B 4Z7WB 3VD3A 1CG9B 4DEPB 1TCRB 2XY2A 3QDGB 1TVHB 4Y4KB 4X83A 4X99B 5JXAH 2D0FA 1DBML 3PV7A 3WIIH 4AT6A 4HW6A 4IOFC 1CGYA 2ICWJ 1WITA 3QIWB 2VZUA 2PO6A 5FM4A 5J4MA 3IDJA 1FLRL 2X70B 3GIVB 4D8PB 2PO6C 4NQDD 1HHGB 2XT1B 2DBJA 1BM3H 4HT1L 1WEJH 3JUYA 3UTSE 3PL6C 4KK5D 2HJLB 4P3WA 5C0CB 5J6GA 2J8OA 2VSCA 2GK2A 2Q86B 5K9OB 1BZQK 1FCCA 2CO6B 1FVCB 3TPKA 1WUNT 2B4CC 1VEMA 4CDGC 1I3GH 2GJ6A 1HXMB 3E6FA 5EBWB 3F5WA 3QIBD 1O7VA 1KEGH 2H3NB 4ENED 1JP5A 1QFWL 2PXYA 1D5ZB 4HIJA 2NY1B 3X3FL 3VRJA 1FYTB 1HHGA 1W2KT 2YA0A 1DQMH 2FGWH 1CG9A 2Q8BH 2O5ZH 2BY1A 3L6FA 4BSJA 1RZKH 4M7ZB 1EXUB 1PQZA 2CQVA 5HGHB 3C8KB 4U6XB 3P73A 1VESA 3P30H 2FH6A 4LHJB 1I9RH 1ZTXL 3CLFL 5C07A 1WFTA 3MRDB 4X4ZA 3WXWL 1CFTB 3LVEA 3CSGA 3G04B 1EAPA 1JTTA 4S1QL 4XXDB 1DVFB 5FXCH 4P9HL 1NDMA 1VB9A 5E5UB 3W9DA 5BO1L 3T3PE 3AM8A 3EO9H 5J13B 5ICZB 1B0GA 4YHNB 4FQLL 2YMXL 1Z9MA 1I8MA 4FXKA 4HUWB 1TZGH 2V6HA 3AM8C 5I1EH 4KDVA 3ULSA 2P8PB 4K8RC 4MD4B 5KSBE 3MGTB 1G7HB 5FUOL 3ARFC 5C0CE 4F80A 1FGVH 3SGEI 3MLSH 2HT3C 2VAAB 4MVBC 4OQ1A 4JREB 1CIUA 3RA7H 2MPAL 4K8RD 4JFXB 5FYJH 5E00B 1K2DA 3QIWC 3VG9C 3GMMA 3RAJL 5F7DA 3HCVA 4PBWD 5DUML 2YD5A 3MQIA 1FC1A 1G1YA 4ZYKB 4LDEB 1MWAB 2ED9A 2AABH 1A1OA 3TT1H 2ORBH 1S9WA 4JPIB 4XGZA 4DZBB 5C0JB 3OKYA 5C0JA 3UTTA 5ECJE 3UBXG 1HHKA 1WBYB 2A83A 1MF2L 5KSBB 4WFFE 3DMMD 5EOCJ 1NMBH 2BSSA 1T1WB 3VFMA 5C1MB 3PHQB 4Z5RB 9CGTA 2A77L 4PP2B 4NFDA 4L9LB 2FB4H 2Z8VC 4K3JL 4MJID 5ILTL 1VFAB 2J8UB 4MNHA 2NZ9D 5BVPH 3SPVA 5E24E 2VO5A 4X9HA 5IG7B 1FAKT 4Q9QH 1BZ9A 4I0CC 2O5YL 4PRID 4IMKA 3PDDA 3NA9L 1P7QB 4O4YL 4YBQD 4ONFH 1YYMH 2X05A 1FFOA 4NN5B 5ESAA 3MA9L 1DEEB 3MFGB 4H25B 1CFQB 5SWSA 3CSYB 3L5JA 2DWEA 4OGAC 1YUHB 3A6OA 3MA9H 5D1QB 1KCKA 1IQDB 4RGMB 1MHCA 4NGHL 5I75B 2J4WL 1CGUA 4OB5H 1DJSA 2F53A 3C5SA 2H26B 2Y9RT 5IVXB 1JL8A 1KG0B 2J8UE 5CEYA 5E2VH 4UQ2A 3ISWA 4K7PX 5KVMC 3LIZH 3DX9B 3M07A 4PJ9C 2WZPD 4G6AD 25C8H 1ZVHA 4QWWC 1N2RB 2VITA 4U6HB 1LWRA 3NABL 4MZ2A 3U36B 4PJBB 4MNGB 3MUGB 1GHFH 3NGBB 1R0AH 1UB6A 4PJHB 5TDOA 4Z78A 4LAJH 4PRNB 2ZUSA 1K8IA 5FO9A 5L88L 1HK6A 5GHWH 1LEKA 5CIPA 3H7BB 2A6DB 1A4JA 5DLML 3WN5A 2H2PD 4X6FA 4KU1A 2C3VA 1GC1C 3ZHLA 4NO0A 3DX7A 3EJYC 5JOEA 4LEXL 1URLA 4OQTA 3SDYH 1AC6A 2BVTA 5CIPH 4U3CA 1NFIB 3WL9A 4WW2F 3PGCB 4Y5VC 4E5XB 3QUMH 5ESVA 4IRZH 4NSKB 4S2SA 3ROLA 5IR1B 4GKSA 4HS3A 1PW3A 1NGWB 3K8MA 4MHHI 3O4LB 5FKPB 5FYKE 3GJEB 1UM4H 5DMKA 3QIUD 4CGTA 1VDGA 4WW2A 1DUZA 1FNSL 5FGCE 4F7TB 2CGRH 1NKRA 3RWHA 1BPVA 3STZB 2WQ8A 1RHHB 4XCFH 4G8GA 5HVFB 5HI5D 2Y5TA 2OL3A 5ESVB 5M95B 5E2UL 1RD6A 3VCLB 1BJ1J 4LU5H 3GSQA 3DBXA 1RZFH 3FOLA 1EHNA 2J1KA 1NAKL 2LFGA 1A3LL 2Z31D 3OKNB 4MNQE 1QNZH 3CDCA 1NFDB 1CDUA 1NBZB 1MNUL 1OW0A 4JZOA 4M8QB 3U0TB 1XF3B 2P44B 5E8DH 2YEZB 1RJYB 4MMXC 4UBDC 4XNUH 1MAJA 5EH1A 1QEWA 3A67L 4XVJH 5KSUA 3SKOB 4GW4A 2JB6A 4JDVB 3I50H 3R06A 2W9EL 3SDDC 4LSRL 2YKLH 2ZUQC 1K4CB 1X6NA 4LQFH 4N8VA 3VG0L 5ITBH 4WWKB 2EE3A 2A73B 3LKQA 3KPLB 3KS0H 4PRHE 5HGDB 3ROOA 5T1KA 3T77B 1U8QA 1Z9SA 5KSAC 1TTGA 1NGPH 4K55A 5ESQA 4EIZC 1WWBX 1MFBH 4GRMB 4K94H 4YDKH 4BH7B 5JXEC 1C5DB 3QISA 1VFOA 4DW2H 4UDUB 4K3HA 3O4LE 2QADC 4WJ5B 1A6PA 4WGVB 2PCPA 4LFHD 3UZQA 5LWYH 4K9EC 4TPRH 2X09A 5CEZL 5EBGA 3DPBA 4PRDA 3U82B 4OZFG 5D7IE 5A1AA 3OHXB 3IFNL 2NLJB 1D6EB 1EZVY 1YMME 3DX6A 5I17A 4Y16A 2WV3A 4NQDB 1U3HA 2H2SD 3L7FA 3T2NL 3GMPB 3O2WH 5HYIA 4NHCL 3WFCH 1NLDL 4FQJL 4CRPA 1VFAA 2J8UA 4JQXC 4H26B 2UWEF 1QBBA 4KH2A 3FJTA 1CD9B 1RUKL 2DMKA 4LLYB 3B3IA 3K81A 5LGJB 4F57L 4BK4A 2EDFA 4P2OC 1ZHKB 4WI4A 3L3GB 3UTQA 1U8KA 3VXTB 3MR9A 3QUXD 4E41A 3UMTA 5IMKA 1A8JH 2B0SH 2ARJA 2GEEA 2B1HL 3GMNA 5HSFA 4O2CB 1C7TA 4RWYH 5D1XA 3FT4B 5CLWA 4WJ5A 4ZUTA 2N7BA 4JGJA 5TH2A 4HK3N 3MOQA 3LEYL 4QGTA 3IDMA 3GMRA 4YDJA 4ODWA 4NWTH 3NPZB 2UVFA 2P5ED 2W0LA 3F7PC 2Y7QA 1NCNA 5ADOL 3IAQA 4HMCA 4YEFA 1MY5A 5HHVL 3ARRA 4PLJC 2BDNH 4NM8L 5CAYB 4RGMC 4MD4A 2FHBA 2IAMB 1P7KB 5EA0L 1WZLA 1TZIA 3HNVL 1R3KB 5LAXB 4QTHA 3UTOA 1CXFA 5E99L 1JE6A 2VQTA 2J2ZA 2VN7A 4FQCL 3OKNA 1KJ2L 3D18B 2AJUL 2X89A 3LHPL 1S8DA 3EW3B 3VJ6B 3QXAA 4HC1A 1OTTD 3D3VA 2FECL 5JORB 4KQ4L 5C7XH 5FYKD 2J5LB 2X9WA 5D7KE 3TZVB 2NY5H 4G5ZL 1KTLA 3KPSD 3OJDB 2H6PB 4OSUL 2WBJC 1WTLA 4PTTB 5T1MB 2M26A 5TE7L 3VXSE 4XRCA 1P9MC 1RZ8A 2A0LD 4K9EL 3RBSA 1AKJA 5L8JB 1AKJB 1Z0MA 1FNGA 5KS9A 3BRFA 2YWYA 3STLA 2BOCA 2CRMA 3KXFA 4JO2H 5TPWH 4JE4B 5GGQL 3BPCB 1JRHH 3SHSA 4LAQL 1U58A 1H5BC 3N1QC 1MRDH 1KSRA 1RZGB 5DHXB 1F6FB 2DL2A 3CLEL 4FQQA 3D85A 4Z77A 3SE3C 3MRPB 3SDCC 4BH8B 2QEJA 4KUCD 5I15H 2Q20A 1U8MB 4R97B 2FIRT 3ARDC 1BAFL 2EDYA 4QCIA 5DR5H 3Q6GL 1F8TH 4RGNE 3UJIH 1QBLH 4YFLI 4UT6H 5T1DH 3OPZH 3N1FC 5DRWB 3LPFA 4J7RA 4I9WE 2PYEB 3TO4D 3MRMA 5GRJH 2G5BA 1JWUA 5F3HB 2G9HA 3SOBL 3U30B 3LQAH 1MWAH 5JTWA 4CVZB 3ULUE 1IGCH 1CXKA 1M05A 4MCYA 3VGHA 5MEOB 1CGWA 3VFNA 1JHLH 2JIXB 2GY5A 1FO0B 3O3BA 5DEGB 2ZSVB 1YY9D 3GKWH 2VB5A 5FKPA 1X4XA 3KNBA 2BSTB 4M61B 1YJDH 3TT1L 4PTUA 4XGZB 4DZBA 1GXEA 5JOFA 1ADQL 1CK0H 3K74B 1U8PB 2V2WB 4JFZH 4AG4L 2G60H 3MJ8A 2BK8A 2VXQL 2X41A 2FYYA 4Y2DC 4EUPG 1R24A 4YFEA 2A1WH 4F9PC 2VE6A 1UQSA 1MRFH 2EKJA 4YIQB 2FO4B 1XH3B 1DANT 1SMOA 4ZS7H 2AK4A 4PRAA 3T0WA 1XGPB 3VFTB 1NL0H 3AXLA 2QADB 3L1OL 4OLXL 4Z7OE 3WIFA 1HINH 3DUUB 4WCYL 5KW9H 2OK0H 2PYFB 1QFHA 5DUPL 2D7TL 3C5JB 3S8WA 3HFML 2QQNH 4R2GB 4IRJA 4RBPH 4PJCF 1U3HB 3SQOL 3HB3D 5C6PB 2EYRB 1EHLL 2E6JA 1Q9WA 5CBEB 2RAMA 4MA1C 4EVNA 3S34H 4HGWB 4GBXD 4B41A 5HYSB 1UH4A 5ICXA 4O2EB 3QO0A 4HLZG 4F7EB 1K5NB 3ARXA 2D31B 3P30L 4HS8H 4MJIE 1LEGB 1OW0C 3RGVA 4EUPB 4NQEB 5E94B 3ARED 5MERB 5GZNC 1BQLH 1S9YB 1ULVA 2C7UB 1OTUD 5GS2H 1F6AB 3LS4H 4S0SD 4UTAL 3E3QC 4UTBH 3T2PA 5L7XL 5LGKA 4N9GA 4N9OB 1TETL 5IHUL 5D6DC 2EC9T 1KT2A 3QEQD 4D0DB 1WZMA 1FFOB 4PJEF 4PGEB 2M2DA 5I2IA 1IM9D 1YEIH 1EBAA 2WP3O 1UM6H 3UC0H 4YHPA 1PG7W 1A6UL 5IB2B 4LSQH 1XGPA 1XGQB 3T09A 2Y06L 2Q76A 1EEZA 3M17A 4QY8B 4QYOB 4X6CB 5IMLB 4N8VB 1MFDH 3DYMA 4YDIH 2JELH 4L5FH 1SM3H 3HE7C 5I18L 1A9BB 4DN3L 4K71C 3CC5A 4FQJH 3ZDZF 3KJ6L 4WO4D 3O9WB 5ID0B 3V6OC 5C0NC 2VR5A 1T7WA 4O2FA 4URTB 2NTFA 4Y4HC 3ARFB 5LCVH 1EEQA 2WWKO 2N4IA 4KUZH 1GZQB 2ERJB 4JM2C 5A2LH 1UC6A 2WNGA 4JKLA 3QHZL 4P5TD 4A2LA 5C8JA 1HOCB 4JM2A 2DLFH 2K7QA 4JFHD 4NP4L 1OVZA 1PVHA 4RGNC 2VERN 3KPRE 1GIGH 4EBQH 2EIZA 4YHZL 1A1MA 1A1MB 3TPUA 5TDPB 2WK2A 4YWGL 1YMMA 1Q8MA 1X4YA 4NQEE 2VQUA 3NTCH 4LVHC 3ULUC 3L3JA 4Z7UA 5DS8A 5ALCL 4BKLB 2DDQL 4X98A 1LO0L 4P5KA 1KXQE 4MXQD 1AP2B 4G6JL 1CZ8L 3QIBC 4N90D 4AY0A 3DSNA 3KPOB 4PRPE 5CD3B 4HFUL 4PJ7E 4RMVA 5JHLH 3T3PF 4HEPG 4Z9KB 4FQQB 4HZLB 2PNDA 4LCIH 5C2UB 5C71A 1EIBA 1LP9A 4U6YB 1KTDA 2FBJH 3N0PB 3RY4A 2GJ6D 4G8IA 4LHUB 1PG7H 4RMQA 3QQ3B 2I5YH 4GAYA 2Y25A 3BPNC 4DVRH 5IVXE 4G7VL 4HKBB 4JPVH 2ADFH 5I8KL 4LQFL 3VG0H 4X9FA 3O11A 3IJHB 5KBNC 4CJ0A 5K9JH 2N7AA 5CGYD 3TNNB 4HX1B 4N1CA 3EOBB 5I1JH 4Z7WA 4F8TA 2NY3B 3MA7A 1SJHB 5GZOC 2PN5A 3IU3A 3DVFA 1FL6A 1J1PH 1KTLB 3MREB 1IRAY 3C5ZA 4Z7QE 1CTNA 5GRUH 4K71B 4LSSH 3HR6A 1KCUH 3HKFA 3QUZD 4Y5YC 5AG8A 3IXAB 1RIHL 1XCQA 1J5OH 3U9UB 4JPKH 2XTJE 1T1YA 2EIEA 2QHLA 3FRUB 4E42A 5A2IH 1AD9B 5DZOA 5M7QA 4KKNA 1JGDA 1G7PB 1YZZA 3L3DB 4RNRB 3GKZA 4CVXA 1C5BL 3N9GL 2CKNA 3BXNB 4MXVF 4WEBL 5C7XL 2NY6D 1OSZA 4S10A 4CADB 3QFDA 1GGTA 3E3QE 2J7LA 4BA8A 1OF2B 3N1GC 1L4IA 3MV9A 5HGAB 4K3DL 3ARDB 3EO9L 1LE5B 3WFEL 2DQIL 1SBSL 2X9XA 2GSIB 4S1SL 4Z7VA 2B5IC 3QNXB 5GSVB 2IG2L 3RUGF 4X7TA 3ORJA 4Q0XH 5I1IH 4DQOL 5H37H 4HWBH 4CADA 3K0WA 1YYLL 2VR4A 4A6YH 4Z7UE 4MA1B 4Q0XL 5DD1H 2XOTA 5IF0B 1OM3L 2P7TB 3SE8H 5I66B 5D2LA 1RZJH 4POZD 1BQHB 4XBPB 5FIEA 2HH0L 5E08L 3HI6L 3ZYIA 4ZAKC 5JOFB 1U8JB 4CL7A 2VDQH 2KPNA 2HAZA 3MZGB 1HKLH 4JN2A 1A47A 3MRHB 4KMLB 4N0YL 1SJHA 4JHBA 3VFOB 5D7IA 1EJOL 2BFVH 4PP1C 1WZ1L 2VLJD 1BBJB 1I85C 3PE9A 1NCWL 1HHIA 4UIKH 4QXUH 4Y1AA 3MJ9L 4UNTA 2AJZB 1ORQB 2PR4L 2YBRB 4LK4A 4G80B 5GGRB 2BVOB 4E0RB 4PRIA 3H42L 2C3GA 4U2ZA 4AENB 3AXLB 3BYYA 2R4RH 3FB7A 3HI5H 4HPOH 5GRUL 1VCAA 1W0WA 3OKLA 5IQ9B 2YPKA 4JG0H 3O6FC 3P4LA 5E8OA 1H0DB 3MNVA 4J3XA 4NC2B 5JDJA 3ECBA 3GHBH 1FN4A 3KWWA 5AG9A 1A64A 5C0CD 4EJ1C 2WSKA 4OUOA 4GG8B 5I16A 5ICYB 3WIIL 1ACYH 3VGGA 1KPVB 2XIDA 4XI5D 3LD8C 4C54A 5FYKL 1I8IB 2BJMH 4JFZL 4JKPL 4AG4H 2VLME 3KYKL 5DSCA 4LLWB 2OI9B 5HY9A 3BIAX 5JIIA 4O4YH 4CVUA 3I2CH 1NUGA 3KJ4C 5JUEH 3B9VA 1E4KA 4XI5C 1T2XA 3BKCH 4Y4KD 4IOFD 1ZK9A 4HS8L 1MFEH 1YMMB 3LEXB 2OL3L 5HI5C 2D9CA 3QIWD 5AEAA 4QF1B 5INDB 1XR9A 5MENE 1KCVL 2DLGA 5I19L 2M1KA 3PQYD 2K7PA 4X7SH 3TBTB 4LMQI 5DSCB 4P2QA 1AXTH 5IVXF 3VXQB 3PWUA 4NC1E 1TETH 3L95A 1KTDB 5IHUH 4ZO6A 4P2YA 5CJ8A 1QUNA 1FZOA 2P5WD 2D7TH 4WHTA 3HE6B 5F71A 5JIPA 3FOMB 5DJ2A 3KHQA 4EDWL 4ELME 3B5GA 3QNZA 4HXAL 3HZYA 3C08H 3O0RH 5IB4A 2G75A 3GFUA 5A43C 1F4XH 2B4CL 5E8PA 5D5MA 3NMEA 4TUOB 3HE7D 2ADGA 3HG1A 3L95B 1UEYA 3M1BB 2VDPH 2VZTA 4L29B 4M5ZH 1K85A 3X17A 3LKPA 4U6VL 3S5LB 3PWPE 2ATKA 4DCQA 1C5BH 3N9GH 5D6DA 2NZ9C 5TDPA 1PZUB 1CXIA 3R0NA 2GSGB 4HZAA 3LZFH 4IRSA 3ARGD 1F4YL 5CCKL 2AQ2A 3QG6A 5FECB 5JW4R 4MYWB 2NY3C 4HIXH 4P59H 4QOKD 4OGXL 1UB5A 4TTDD 3D2UA 3QNYA 5DFVC 5JMOC 3BO8B 4HXBL 4NN7B 2YMXH 4OCNC 3HZMA 1OP5K 3HS0A 5ISZA 2VNCA 3H9HB 2P8MA 2E7LA 5CZXD 5HHMD 3RZCC 3U4EB 4OV5A 5DJXB 3RVXC 2ZNXA 1YN7B 2Z31A 3TM6A 2Z91B 3WL9B 5C2BL 4LCUA 4QGYA 1U8OB 4OD2B 3RWGA 4GG6F 5IW6A 4HPOL 3EGSA 1F11B 2D7MA 2DIJA 4JGMA 1NUDA 5AYQA 1K3IA 3V5DB 1N5AB 2AJYH 4FG6D 5GGVL 1BVLB 3ZKXC 4KVCL 1RVFH 4ZDHA 1V7NL 3C6LB 4YNYA 3WE6A 2XZCL 4N8PA 1X5ZA 2RQ8A 4Z8FL 1HILA 1N8ZA 4WWKC 3O3EA 1J1XL 3O2VH 3P4OB 5FAAA 2DLIA 2VXSH 5C08D 2HFFB 2I07B 3B9KA 3UZVB 3EJZC 1EJ6A 2VABB 2FEDC 3PIQB 4GKOA 1FNEA 4F2MA 5C0BD 3B2VL 3CXDL 3FQXA 5IBLC 2H45A 1IAII 4F7CA 1MOEA 5D1ZA 4JPVL 2WWKT 4ODXB 3QUMA 3U9PH 5DFWH 2X5PA 1U91A 5D2LB 3RFZC 2FL5A 3L3HB 4ZTOL 5IBLD 1MCIA 2HVJA 3BDYL 1T4KB 2YUVA 4HKXB 4Y4HB 1X5LA 3MXWH 5MI0C 3BUTA 2R23A 3N50A 1ZLUH 3TH3T 4OFPA 2DI7A 1WSST 3TJEL 2HMID 5F1IA 2R0KL 1RAMA 4M1CC 2AV1A 3OR7B 5BZWB 4YXLL 3CFKB 3ZTNL 2AK4B 3MRRB 3QHFH 3O6LL 2D0HA 4EQ2A 4OCXL 2V2TB 2Z8RA 3RDTA 4NYLB 4GQ9H 3SO5A 1DDHA 1S9VB 4LBEA 4NO2B 5GSRA 2NTSP 2X1OA 1P4LB 1JZ8A 3U48A 2VDOL 3G6DL 3QO1A 2IBGA 3FN9A 4TRPL 2BX5A 5I9QC 3MBXH 4H8WH 1IGCL 1XEDA 5BOZG 4KRPC 5CKGA 1I9EA 3DBXB 4RGND 4Y4FC 4L4VA 3K2UH 2HLAA 3DECA 1CDHA 3PWPD 2HT2C 1II4E 4ZUUB 3WKMH 3NFSH 2P48B 4LL9A 5HBBA 4WI9A 1F8TL 1QR4A 3GBNH 2EO1A 1I1AA 4Q9BA 1R3LB 1S7WA 1YNKL 5E00A 5HPMA 4MGXA 5JQ6H 3TBSB 1AQDB 4KAQL 1HXYA 3QEGH 1FV1A 1CN4A 3VRLE 5C9JA 1J11A 2LQRA 1RUQH 4LLVB 3C2SA 3MRNB 5C92A 2Z35A 1G7IA 4RFNB 3U46B 4DFIA 1YY8B 1MLCB 3VWKB 4G8FA 1HQRA 2DN7A 2P8PA 1NCWH 3SKOA 3ARFA 4OGXH 5HYJD 1T6VN 2YS4A 4L4TA 2VXVH 3QDJE 2APTA 1ZHBA 4ODVH 4WHTB 5TFSH 5B38B 2YSSB 1TFHA 4OI7A 1A6ZA 4WCYH 1EV2E 4LNRA 5SV3A 2W0KA 3QDME 4O02L 5TFSL 1B4RA 2NX5B 1Y0LA 3U0PA 1S8DB 4OZHE 1ERNA 4PJCB 4U31A 4KZDH 1S7RA 5E08H 3ZYZA 4HG4K 5T3XE 1WGOA 2VKXA 5C9JB 2UV3A 1OPGL 5GISH 1BEYL 1MRFL 1I3RB 5T3XL 2NYYD 1NMCB 3U4BH 1QLFA 3ZDZE 4BQCA 1XCTB 3IDXL 4XRCB 3TT3L 1ZLVH 4ODWB 3U4BL 4IS6A 4P3CH 3G08B 3FO9B 5KW9L 3JTTB 1KJ3L 3GUTA 4XX1G 5E94A 3HPLA 4I1NB 4R8WL 5LG1A 2DYPD 2D31A 5DK3A 2JJSC 3ZDYF 5F7LB 1JUFA 5JPMB 5BRZB 1EK3A 1LK3L 1V3JA 1E4WH 3D18A 3MLTA 4LLMA 4XMPH 1AXSA 1RJZB 1H5BB 1IGFH 3E6HB 3O3AB 4NDMA 5FK9B 3RWFA 1MHCB 5FFLA 1VADB 1J8HA 3M8OH 3WIHL 3WSQL 4O2CA 4DUWA 3NACL 4LLYA 2W91A 1NANH 3HI1B 1G6RL 3EO0A 1JGLH 3DX7B 1QRKA 1DBJL 4JJ5B 3D39B 4LASH 4XVSL 5EZLB 3MR9B 1JGVL 5EORL 4KDTA 4LVNC 3O41A 4HIXL 1EO8H 4P59L 4AK1A 1OAYL 2V17H 2XTJB 5GS1C 1R3IH 1U8IA 2JCCA 5DJ8A 2OR8A 3C6LD 3ZE1F 4J4PA 4I0KA 4PJ9A 1BQHG 3ME0A 1FE8H 3S4SA 3MLXL 4OQTL 1UACH 1IEBA 1ZHLB 3VWKC 2ZUYA 3VFSA 4EXPX 4NJ9L 3DX9A 5HYEA 1AD9A 5I18H 3I3BA 2D03H 1H8OA 4YHZH 3H9HA 3UYPA 4PGDA 3I84A 3WXVH 2O93L 4ZUWB 2H26A 1YDPB 4M93C 2XKSA 3C6LC 2Q87A 3O2DL 3MJ7B 5EBMA 4JFFE 1M6OB 4CNIB 5C0GB 4PJ7B 4NQXB 1IC5H 4OF6A 3H2WA 1N6VA 2B20A 4F57H 1OSPL 3MA7B 1JGEB 2HRPH 3VXRB 5KSVB 3VFGL 1I1FB 5KVGL 2I25N 5INCB 4LSDA 3RX5A 5JLZB 3LN9A 4YHKH 4R3SA 5GPRA 4YBLB 2IPUG 1BOGB 2BNQB 5DK2B 1DSFH 3NIGE 5DVLA 2MCPH 2ATPB 1YEJL 3CXHJ 4K3JH 4UNUA 5FOJA 5D7LE 4OCRL 1FO0H 4K94L 5TF1H 4ZQKA 1U58B 1B0RB 4EKXA 4G9FA 1UXSB 3KNBB 5TQ2L 2VLRA 3LAFA 4KKBC 4OIIH 4MDIB 25C8L 3EO1A 1RFDH 1N6QL 1FO0A 1I9JH 3EFFB 3S88H 2I60H 5CP3H 5DK0B 1GGIL 1TJIL 3QDHA 3MOBL 4JZNB 3TYGH 3TBSA 1SHMA 4HKZA 1BBDH 3RTQA 1J5OL 1IM9A 4JB9L 2GQHA 3KPMA 3GI9H 5FGSA 2P43B 5ENWA 2JK5B 1WFUA 4K3EH 4R90L 1RJYA 4NUJA 3C9NA 3VE0A 5E9DD 3RWCA 1J88A 3EYVB 4WDIB 1QVOB 2EDWA 5HHOA 1M7DB 1NPUA 1WQVT 5FM5M 5DJ2B 4X0KB 1MSPA 3FOLB 4FXLA 4RMWA 1JHLL 4ETQA 1P4LA 2VLJE 2VZVA 4EDWH 1T04B 1XGYL 4I2XA 3VH8A 1Y6KR 3F58H 3B2UD 5T3ZD 4LBEB 1FORL 2OMNA 3O8XA 1R5IA 1YEHL 1P7QD 2GT9B 3HA0A 4HWBL 4PRIB 3BEVB 4WTZG 3MJGX 1YEHH 1QFOA 4NNPH 3HG1E 2OJEB 5ACLA 2H32H 1JN6A 4FFWC 5DMKB 1V3LA 1T83A 3L5WA 3QCTH 5C8JB 5IFHL 3Q2CA 3S36X 2VQ1A 4WU5B 1KG0A 1IC7L 1OL0A 3RPKA 3NCBB 1CLYH 4ODVL 4OCMC 3UPRB 4XT1C 3MRIB 1CE6B 4U1IB 5J06A 4GKNB 1NAKH 4ZPTA 3T0EE 1P6FA 4NQEA 3X3GH 2V9TA 5L2JB 4XCNB 1NMBL 2EDOA 2VXSL 3H42H 1LO5A 3BQUD 3IDYC 2DQCL 3ES6A 5IV2B 2I60L 1IGJA 2CK0L 2FD6H 4HK3J 5DVNA 5F6HI 1DN2A 5LGJA 4IRJB 5FA3A 2YWZA 4CN1A 1I1FA 3TO4C 4E0RA 1T1XA 2A6IA 4KK9D 1MCKA 4UV4L 2G5RA 3SPVB 4YEEA 3WKML 5CZKA 4HK0A 3VDBA 2X4OB 1SBBA 4F3FA 4I48B 3MRLB 4BZ2H 5FUCE 4HC1L 4LRNL 3SE9H 4X7EC 5IM7B 5IVNA 4JY5H 4L8SC 1L7IH 3I2CL 1U6AL 1T0NA 3IS0X 4KKBD 4R96A 2E8ZA 5EUOF 3MOBH 1BQUA 4MD0B 4PRDB 1PDKA 1B2WH 2YHGA 4OCYL 4EVNB 4Z5RA 5HHOE 1KGCE 3DV4B 2EZ0C 1A1OB 4Y4FA 2ZUXA 5DEZA 3HN3A 3RVTC 2CIIA 2AERT 1T3FB 1PFCA 4H25A 2BCKB 2EDTA 2VZOA 4UUJA 2DJ4A 4YHYB 2FR4A 5J12C 2DM7A 2NY3D 4XBGB 4O00A 5MENB 1LGVA 1VENA 3PGFH 5JW4Q 3ZE2E 4DUVA 5MEND 4U1SA 3ARGB 3Q5OA 5I8EB 2DQUH 3BN9C 4XPBL 3P4NA 1JGVH 2YD9A 2B1HH 4N0UB 3VXNB 2YC1B 2R8SH 4AMKH 1F4YH 5CCKH 3DV6A 4D0BA 1PEWA 5F97E 1U8OA 5F6IC 1JPSH 1K9TA 4LLQA 4AIZA 1X5JA 1WBXB 5CHNA 3VFSB 4PBVC 3HE6C 2XZAH 3EYFB 3FB6A 4K3GA 1TVBA 4PV8A 3QI9C 4M7LL 2APXA 4MJ5B 4ZO9A 3RX8A 3LB6C 4R96B 2VLJA 2Y06H 5KS9B 1CDJA 2HJKA 2P45B 4QWWD 1Z9LA 5ANME 4BZ2L 3O45B 3EJZD 1DUZB 4FQXA 1MCQA 1X5HA 2XQYG 2B2XL 3HNVH 4X9BA 1FVEB 5DD3H 4O9HL 1FGVL 4GO6B 1C16B 4E9LA 4PJBF 2BHZA 4WI7A 5F7FA 3QXDB 3VMNA 3GJFK 2H2PC 1QEWB 3B4NA 1H9VA 2UZXB 4NSKA 4X6BB 3SJVD 3H7LA 5J6GB 1CE1L 4O5LH 1AJ7L 3ECBB 1JTOA 5IP4A 4B0MM 4PJ5D 4F7MB 3WFHB 2D7NA 1HHHA 3O6MH 1U8HB 3EYVA 4WDIA 1A9EA 3P9MA 4KROD 2VDNL 2VMFA 3TBYA 3OXRB 4CUCA 3QZWG 1GOGA 3GHEH 1IGIH 1CICA 2P8LB 5I8OL 4N0UE 1EXUA 1PQZB 5I1GL 4JO3H 4Y4KA 1CR9L 1MCCA 1YMHA 2QHRH 4PTTA 2Q7YB 1MJUH 1ZVYA 1CF8H 1KACB 3FQUB 3INUH 2IAND 2ITCB 3QIWA 1PLGL 4OZHB 3T65A 3VFWA 3WLWD 1YEKH 2J6EL 3QEQB 1J0HA 1NAMA 1ND0B 5B8CB 1RFDL 3P9MB 4GS7C 2FATH 3BKJH 5GGQH 4EN3C 2OJEA 2ICEB 2NPLX 1L7TH 3LN4B 1KB9J 3TJEH 32C2B 5A40E 2CRZA 2F58H 2P5WA 3U6RA 4R4FL 1Y0LB 1L7TL 1OQXA 3BP6B 2NY4D 3JV0A 2EC9U 2AXGA 5ANMB 3RNKA 2GFBB 4OGYH 1NC4D 2OZ4A 4N5EC 1DLFL 4M48H 1XF2B 4PLOB 4C83B 3HMWL 1LK3H 1I8KB 2CLRB 4LSUH 2H32A 4Y1AE 1F3DJ 1OAUL 2X4QB 2WINA 5A2FA 1RUMH 4NPYA 3WIFB 2VUYA 5FUOH 1KN2L 1ZHKA 3EUUA 3IKKA 3QB7C 5T5NF 2XKNB 2YPKB 3ZKMD 3C9NB 3MRNA 3QCTL 3O3UN 3RY5A 3Q3GB 1PSKH 3DUSB 5HGAA 1QYGH 3MCKA 3RTQC 4I18B 1U92A 1WCQA 2LU4A 3GSRA 4IRZL 3OV6A 3PNWB 1RIHH 2MSPA 3KYNA 4ZPVA 1HQ4A 3O0RL 3RI5K 12E8L 1T1ZB 1IAIM 3QDMD 1F3JB 1QP1A 1T0MB 1S9YA 2W1NA 4ISVB 4LLDB 3FRUA 1V5JA 4UT6L 5HDLA 1NBVH 2FJFA 5FM8A 2OYPA 2J6EA 3FQWB 3NCYP 1Q0XL 3MACH 3JTSB 4Q58C 5ICXB 5DLMH 1KPUA 3QQ9D 4HJ0D 4ZO7A 4OZFA 1M71B 1U8JA 4MSWA 5HHNB 3WNNA 1JYXA 1D6VH 1ETZB 1OGAD 4JJHA 4KK6D 2ZP0T 2OMBA 3DVNB 3THMH 5JW5A 3QDJB 5F7DB 4MD0A 4ZNCD 4WW1A 4TSCH 5IB1A 3BHBA 3TBWA 1J05B 3N1PC 4G43A 4XMLH 1CFVL 4XNZB 1E4XL 3X12A 2IPTH 2A9NH 4LSPH 4WU7B 4M4RA 3L1OH 1NGQH 4RGOL 3N1MC 1U8QB 5JXAL 4TTGA 4XVTH 5GGSY 1U8LB 5GRYA 3SJVE 4LCIL 4JFEA 2FJHA 4K7PH 1BF8A 1QPPA 1DE4B 3MYZA 3QUZC 4DKEH 1KIPA 1FLTX 2A38A 3UBXA 5I1DA 4P2QE 4U7KA 1X5YA 1OAUH 1YEJH 3BP4B 1UH2A 1ZWIB 4OCRH 3KAAA 3UTTB 4U2YA 1D3CA 2YPVH 3QUYB 4OV6F 2YUZA 3MBEC 1YPZA 2ZKHL 2APBA 4ZPTB 1F3JA 2ZCLL 3JV4B 3MV7D 4JG1L 2Y5TB 1ZLWH 4PJ9B 3KXFE 3TNMA 1T83C 4IS6B 5DJYA 3W0WA 1LO2L 1NCBL 5JA8B 3CMGA 3JV5A 3HC0B 5GJTL 3FFCD 1RMFH 1X5FA 3DVGA 3B2UC 4NOBA 3JXAA 2QHRL 5KSAD 5D5MB 2BNRA 4OF0A 4POYA 1CGXA 2B39A 1QLRB 3TN0A 3NIFE 4LCCA 4FFZL 3UTTE 2E9WA 1JFQH 2IFGA 4G3YL 3GSWA 3OGOE 4XP5H 4XPTH 3ROLB 1J1OH 5IR1A 1QG3A 1U6AH 1VADA 3EYUH 5JNYB 1JZ2A 4XP5L 1NUNB 4XPTL 1T2QL 2XN9E 1E4WL 1UWXH 4HJJH 3L7EB 5I6XC 1S5IL 2OL3B 1A6UH 2R2BA 4QHLB 2D7OA 3KYMA 4OCXH 1LP9F 3KXFB 4Y2DB 3FB8A 4MD5A 3BP5A 5EZIL 1FNGB 1RUML 3C5ZC 3NCCB 4EBQL 3SGJA 5F7EL 1MCLA 1HNGA 4PUBL 5ENWB 1EO8L 1FZJA 3BT2L 4MNGA 5A2KH 2CK0H 3O4LA 1W8NA 5J1AB 1Z5LA 1OAZH 4RIRB 2NY0D 3BUYA 5A3IC 3W82A 1IAKB 4MVBD 1OQOA 5DUBA 3FO2A 2ENSA 5IT2L 1IVLA 2UY6A 5H94A 4G6JH 2OLDA 3SDAC 1N3NB 1NFDF 4JQVC 3TA3C 1JIBA 3V4UL 5IGXL 4ZSOA 5LXGH 1C08B 1OHQA 3TVMD 2ZCLH 5DJAB 3WN5B 4NM8H 2VLKD 1Q0XH 3MACL 5JA9A 1IQWH 4TULH 4UDTA 3VXRE 1JCKA 5GSRB 1SJXA 5DI8A 2IPKA 5HI3D 2HJLA 1BX2A 2R1XB 3QUXB 2XNAB 2BRQA 3GO1L 5E99H 1QSFD 1MEXH 5D72L 2O61B 2V7NA 2NXYC 5DHVA 4X9IA 4CW1B 1MCWM 1U8LA 2WWMC 2EZ0D 1KNOA 2LU3A 2X2YA 4U1MB 1TNMA 5GGSB 1IGYB 3MRHA 2XQBH 1TZHA 2Z4QA 2EE2A 2M8XA 5JQHC 1AD0A 1B0RA 4ELKA 3BP4A 2EDQA 4LCWE 4LARL 2UWEB 8CGTA 1UADC 4MSWB 4JKWA 1FC2D 4RBPK 5LGHH 5SWQB 1KPUB 5KOMC 3GK8H 4BSWB 1T20B 4IBLT 4IOIA 3ULVF 1IGYA 3FT3A 3U4AA 4MMZC 3H9SE 4NHCH 4N8VG 3I6LD 3T2NH 3OKMB 1A02N 2EYRA 1AXTL 4S1QH 1YC7A 3MRLA 1I9IH 4D9QD 4ONHA 3EDKA 5F7UA 1MQ8A 3QFDB 1DBAH 4KJQD 4JFXA 2JJSA 3BPOB 4JG1H 4KGLA 2O61A 4X6DE 1AY1H 3O8XC 5MEPA 3DXAB 4WWKD 5EBLA 4YHOH 3G5YA 3U7AA 3HR5A 3WHE1 3HNSL 2XTJC 1BBJA 1DQML 2CMRH 2NNAA 3O41B 5EFIB 4P2QD 5C0EB 3CX5J 3TCLB 2QSQA 5IV2A 1D5XA 2G60L 4HSQA 3G9VA 4YZFF 4HUWA 4JHZA 5GS0C 4YDKL 2AW2A 2BXZA 1S7UB 4I0PC 4ZFZA 1FFNA 4D3CH 4HUUA 1ES0B 3CFBB 3CNKA 4W81A 1VGKA 1ZHLA 3GNMH 4NT6A 4L9DA 1MCPH 3ULVD 3FQWA 3HG1D 4QRPB 3WS6C 2NY0C 1FVDA 1BD2B 3LPGA 4Y5VA 3KPSE 3KPPA 1X3DA 1EH9A 3L3IA 5E6IC 1D9KA 4PYGA 1YYLH 1J0JA 4IRSD 2VN4A 4X5WB 4CJ1A 1I1YA 2XFXB 2ITDA 4KI5E 2MJWA 1D9KC 3NTCL 2NW3A 4RISL 3QIUB 3WLWC 2FSEA 3SKJL 2H6PA 3O3DA 1AIFA 1RVFL 2EDBA 3TWCH 4N8CL 2J8UF 4CVXB 4OLZH 2SEBA 2L7UA 4TUOA 1MJUL 2UVEA 3VXSB 3G5XB 1MCSA 2QBWA 3ULUH 3ZZ1A 5FA4B 1C08A 1AP2A 4M1GH 3BH9B 4M93B 4U3XA 4AJ0A 4NKOA 3V0VA 1JNHA 1KEMH 1ZA3A 3MUJA 3EHBD 3MCG1 4OSUH 2J88H 2VLRD 1SYVA 4U0QB 1ODAA 1IGTA 4V1DD 5EUOB 5F89B 3RWDA 4QTHB 4RIRA 4JRXE 3AAZA 2VLMD 4MNQB 4RDQF 4OFDA 4OZIA 1ZT4B 1C16A 4HDIB 1G7IB 3U46A 5I73C 1R3HB 4L3EA 5DEFB 1HH9A 1QOKA 3MRBB 4PY7B 5D70L 2AVGA 1KXVC 4KRLB 3FAWA 2VXTH 4UQ2B 3LIZL 1CDIA 1MELA 5EO9B 1RZ8B 2V2XB 4OI9A 4UILL 5CJQH 2JJUA 3HC4L 4DKFL 5C0BA 5L0QB 1MRDL 2YUWA 4HS3B 4KTEL 5C0AD 4OZ4B 4OZIF 1G9EA 5HHOD 1EGJH 1BD2E 3QUYD 5TF0A 1M4KA 1OLLA 3A0OA 5EIIB 4JFQA 1RURH 4JM4L 5JUEL 3GEWB 4FQCH 5L88H 2RCSH 3MLRL 1ZANH 1KIPB 4PJIF 2HT3D 4U0RB 4LCCB 3HLAA 1B3JA 1R5VA 5C0FB 3FT2B 3NVQA 4XPBH 3LKSA 1P7QA 2CUIA 3F8UB 3QRGH 4P2OD 3MV11 1FVEA 4W4NA 4XTRC 1KJ2B 1YNLH 5E56A 1UCBH 3O45A 3L3OA 3PABA 4NHUB 1DQQB 3GBML 4XCFL 1NGZB 2CDEB 1IAOB 3RRQA 2OTWB 4GLRH 3FQRA 3NFPA 3REWB 4U1HA 3JV4A 4YC2C 3KR3L 3ULUL 3BQUC 2O5ZL 3P2TA 1F4XL 4K7PY 4LVNB 5FDYA 5FEBA 4ORZC 3GJFB 1EFXD 4N0FA 1INDH 1Q1JL 4PG2A 2X40A 1OGAB 5HYFA 3KHOA 3T3MF 4TVPD 4JO4H 1F2XK 1BQHA 5B3NA 4NO3A 3U7WH 3UJJL 3QEUA 4ZXBC 1JHTB 2W65A 2DWEB 1KB5H 2Z4QB 5H2BA 5I1HL 3PWPA 5KTEH 4F7CB 3G6JB 3KLAB 4XNQB 4GRMA 5F72S 2CUMA 3M17B 4ONGL 1AJ7H 1AR1D 1MCRA 1QA9B 1T2JA 2IH1A 3B83A 2VXTL 5BV7B 3WNLA 2XKNA 2VAJA 1X5AA 4R7DB 5DQ9A 1UM4L 1N64L 3WO4C 4PJGB 1HILB 1EVTC 4MLSA 3TN0C 2NXYB 4L3EE 1P2CB 2FLRT 2LAGB 3Q0HA 1HZHH 5IJKA 4MB5A 5HHPB 2R2HA 3C60A 3R4DA 4XNXL 2L4OA 5GISL 5DUMH 4EUPA 4JFDE 1T03L 5IJKC 2VDLH 4N0FB 4QHKJ 4RDQG 2NY4B 3V7AE 3S96B 3WJJC 1A22B 4M6OL 1FNAA 5I66A 1IFHH 1UKQA 6FABL 1G0DA 2AK1H 4HBCL 3QXVA 3FQUA 4HJGB 2X1QA 4QHNB 3HZMB 4NWUL 5EU6A 1K2DB 4NNYA 1CVRA 2DM3A 4LSQL 1T1XB 2IMMA 4NQSA 4HJJL 5DT1H 5AZ2L 3VFPA 4MAUH 4DTGL 43CAA 1OP3K 3GMLB 1CFSB 1SMAA 1KCRL 5FHBH 4GW5A 3PWJB 4F7MA 2A6IB 3IDIB 4HUKB 2HH0H 1M1SA 3FKUS 4GRWH 3MLVH 3O3AA 2BC4B 2BSRA 2OQJB 2DQTL 4YHMH 2P5EE 4YAQA 4I13B 1DLHB 4Y8AA 5HVWA 1GOHA 4AEHL 4F33B 3PJSB 3J8F7 3P3YA 3QULB 2VRAA 3MJ9H 3PDOB 2DI9A 3GK8L 3QIUC 4FQ2L 3G08A 5DEFA 5DJ6B 3TBTA 3QHTC 3ZKQD 1JMXA 1ZT4A 3IRZA 3U7YL 2AEQH 2YPLB 3TIEB 1MHPL 4QRRA 1MAML 3ULVC 4MXVE 3BGAA 1IGTB 3NIFF 4TVPE 2WBKA 2RFXB 3T0ED 3TEUA 1KIQA 1H3XA 2WANA 1SY6A 1GPOH 5CP3A 1MVUA 5E2TL 1K6QH 5CEXB 4BH8A 3IXTA 1DQJA 2BMKB 2NX5A 1GGUA 2FHCA 1FYTE 4ZFOB 1B88A 1FLRH 3VXSA 4EI6B 4KK8D 4B50A 4HLJA 3RUGE 5I16B 3P4NB 4E5XA 3MV9E 5L2KB 2EH7H 5D1QA 3ZL4L 4TOYH 4OLYH 2I9TA 1KLUB 3EOAA 4HFWB 3CVIL 4P2QB 1VERA 5IFHH 3FMGL 3TA3A 5L8LB 2C3VB 3UX9B 5CILH 4BKLA 4XX1E 5GGRY 1CI5A 1H3UA 1S7XB 2FB4L 4D9LL 2ADJB 4PP1D 4U1JB 5IG7A 3H7BA 1ONQB 2QR0B 2Z0BA 1TVHA 2MOVA 1TPXB 5DZLA 4JM2F 4QXWA 1KT2B 2EE9A 3V52L 5D96C 3BWUC 4HCRH 3STBA 2F54A 2CIIB 5FGBC 2WUBH 3JWDH 3K1DA 1TVBB 1NFDE 3QEUB 4X6EB 3WCYA 1S9KC 4MNQD 1F58L 3OB0K 5EBMB 3WUWB 2YD1A 3VFOA 4RMRA 1IZKA 1GGBL 3FFDB 2R0ZH 3SGDH 1MHEB 3F6LA 4FA8A 3SKNA 3NIDF 3L3GA 4JQVA 1XGTA 5AUMA 2QKIB 3EJJX 1ZTXH 3ZKMC 1G7MA 4TUJA 2CDGB 2FX9H 2H9GB 1LO3H 2DQDH 2GITA 2QQKH 3RDTB 4XCEA 1HIMH 5DTFB 5E9DB 1T7YA 1MWAL 2AGJL 3SBWA 3S4SG 4DKAA 3X14B 3WDHA 4JDTL 5D7LB 3VXRA 1J12A 3DIFA 1SY6L 4LSSL 4HWZB 5CEZD 4GW5B 5I1EL 5C70A 5BXFA 3QDGD 4AEIL 5BXFB 4U4BA 1WFNA 1IZJA 4H1LA 1PKQB 1BAFH 5CSGA 4MAUL 4PRBB 5E9DA 3WIHH 3F7RA 5DMYA 4GMSH 4RFEB 4L9LC 3VA6A 3HC4H 3K8LA 4FQPA 5EORH 4NNXB 4Y5YA 2D7PA 3SCMA 1NJ9A 1YECH 1F00I 5DD6A 4UAOC 4KJYB 1KC5H 5D6CA 1DVFD 2ESVA 1AGCA 1S7VB 3DXAD 1WIUA 2GI7A 2ZUVA 3ROOB 1CYGA 4BFIA 1E4KC 3IFNH 3U30C 4BQ9A 1PKOA 5AWNL 1YY9C 2DBLH 2DTML 1FCGA 1Q9OA 4OD1L 1FAIH 2IH3A 2VC2H 4L1DA 1IBGL 2CSPA 5KSUB 1LO4L 1CICB 2P8LA 2R29H 1DQLH 3PL6D 2H3NA 4QRPE 5F1KC 3O2DH 4X80L 2CDGA 4RRPA 4JG0L 2AEIT 3U79A 4I2XB 3VH8B 1SYSA 1QFPA 3S97C 1GAFH 1RIVH 3QG7L 1UA6H 3G6JA 3TBVA 5IVZA 2VDML 1CLOL 4DQOH 2WUCH 1B0GB 2HRPL 3KYKH 4YHNA 5HDQH 5IKCA 2AJVL 3D69A 1RUPL 1A3LH 1RJCA 5HGBB 4QOKB 4Z95H 5F7KC 4TNVF 1F58H 1F90L 3D6GA 1LEIA 3G04A 4FQ1H 2ZCHH 3STZA 4EEEA 4NQTA 1UB5B 3GUTB 1I85A 3MROA 1JN6B 3W0WD 5DA4A 3P73B 3MNZB 4HF5H 2WIIB 4NM4L 1H3TA 2FBOJ 1FVDB 3MRBA 3PP3K 3IFOA 1BQLL 2GCYB 4D9LH 1R3LA 1S7WB 3QPXH 3PG2A 2AV7A 1S7RB 4KXZI 5JPNB 4WUUB 1JZ4A 4M7KL 1WAAA 4GW4B 4JPWH 5C07D 2I9TB 2ZUWA 1OLZA 2YEZA 1S7UA 3TH2T 1MUJA 5LQBL 5J0BA 3SQOH 4F33A 1T21B 4MA7H 7CGTA 2EXWC 4UT9H 2NNAB 2VDKL 5EFIA 4ZS6D 4DN4L 5F9JA 4U6VH 4FFVD 4FZ8L 4I77L 2XWBA 2FZ3A 2BNQD 1X7QB 2FX7H 3NIDE 5JPNA 1P7KA 5C6TL 2EIZB 5EO9A 4LSVL 4RX4A 4JR9L 5HD8D 2ITDB 3ABZA 3O4LD 5DDHB 1UWGH 4DGVL 1EAJA 3MUHL 3LRGA 1QFWI 4Q9CA 1EEYB 2KZ1B 5DR5L 3KPSB 5C09E 3CCHA 4MDIA 2CUHA 4YDVB 4WFGE 2VUOA 4QHMA 3TZVD 1IKFH 3MLWL 5EUOA 5F89A 1JNLH 4Y2DD 4I5BA 5IESH 4ZD3L 3FAXA 1F5WA 5F7EH 3VWJD 4M4PA 3RZCB 1CFQA 4NJAL 2XRAL 4RCAA 5KSAB 4MQ7B 4JFEB 4WFHD 2JJTA 1XGQA 3P0VH 1F4HA 3V0WH 4RZCB 4JY6B 4FNLL 4Z7VB 3V6FB 1RIUH 5DHYA 2DLFL 3Q6GH 2VXVL 4HAGA 1TJGH 2V7NB 3ZKXB 5KS9F 3OAYH 1XF5B 4GT7A 3WS6A 4HULB 5HHVH 3WE6B 2Z92B 1SVCP 4JRXB 5K9KA 4DOHB 4MQXC 4X4ME 4EDXA 4ZDHB 2BSSB 2P49B 1WISA 1DCLA 1EZVX 5ILTH 5KVDL 3QUMB 2YOCA 1WAAE 3SKNB 1RIVL 3V2AR 5H2BB 5BJTB 2V5YA 3HZKA 4DN4H 3BISA 4HS6B 4YLQT 5GS0H 1RZIA 4MWFB 3MOAL 3IAGC 3WBDA 3U83A 4PJ5A 4I5BB 4ODXA 2DYPB 1G7JB 4ELKB 1FL6B 4YFLF 3JVGC 1V7ML 5DD5H 4PGJA 2EH7L 5ESAB 3TF7C 4F2MB 5GSVA 2H8PB 3G5VA 3CPLA 4DOHE 4GG6A 3LEVL 4MZ3A 3TYFB 5AZEH 4AEHH 1LE5A 2G2RB 5MHSD 5DRZB 5AYUH 3V5DA 2DMBA 4WWKA 4R0LA 3EBAA 1QBML 5TQ0H 4I8DA 4J8RB 2G5BB 5AYUL 1Q94B 4NKDB 4DJMA 3BDYH 2EDRA 3FHQA 1X6LA 1BIIB 4ZMAT 2EDKA 4RZCA 4KQ3L 4WO4C 5J7CC 2HRLA 1QZ1A 1JPGA 1AR2A 1J0KA 1Q0YL 1F97A 4WFHE 1B6UA 2XZZA 5C0FA 1A3RH 1C12B 1CL7H 5FF6B 3O4OC 5CSZA 1BBDL 2AJ3B 3RHWF 2W60B 4KHXL 5T3ZH 3QEQE 2XWJB 3W11D 1Q1JH 4OZHF 1WF5A 5JXEA 1P5VA 3T65B 3W39B 4ALAH 4ELMB 1PYWA 2HKFL 5DUBB 1KF9B 1N5YL 4PB0H 3WJJA 3MLWH 3KPMB 5E5MB 4KVNH 3WFDH 1RHHA 4PJFF 2RHEA 4WV1A 4WHCA 1LO3L 2DQDL 4APQD 1HDMB 1HNFA 1ADQA 1RY7B 2FJGB 4ODHH 3CSPA 2E9BA 4M43H 4LVOB 2P4AB 3MNZA 3PP3H 3HUJA 5T1KB 3ZT7A 3ARTA 5ITFA 4ZAKD 3BE1H 4QCIB 1P4BH 3WLBA 1KJVA 2PW2A 2HT4D 3S3PA 2MQ3A 4OLVH 5AWNH 1L6XA 4OKVA 3KYMB 5TE6H 4L8SB 1OAKL 5DJAA 3OAZK 5CZVL 1RZJL 5IVZB 5GJSH 5CUSL 1YNTA 4NKDA 3UYRL 1IL1B 3R1GH 5EOTA 1F13A 2BOCB 5DHVH 4PJ5E 4QYOA 3UJTH 5IMLA 2ZSWA 1I7RA 3LKNA 3C8DA 4KI1A 4OI8A 3S35X 4GXVL 5DRXB 3BUYB 5DWUH 1NGYA 3MGOB 4FS0A 3TJHD 3BHBB 3TBWB 5CINL 4NZRL 4AM0A 4H5SA 4U7MA 3OF6D 2WIIA 4OLXH 1WBXA 5CHNB 3WHXA 3ZLQC 5C0AA 3S37L 4HXAH 3S6CA 3PHOA 2J88L 4YDJB 5LBSH 3LCYA 3CXDH 2XG5A 3EDJA 3PQYE 3QPQC 5HYSA 4OGZA 3KDMA 4PJ5B 2E5EA 5I1LA 3CX5K 4LIQE 1MFBL 5IROA 1FHGA 4X7SL 4P9ML 2F5AL 3SJVB 5CLTA 4P2RD 4W4OC 2WUCL 2IQAB 3REVA 5KVFL 5EN2B 2Z92A 2F5AH 1J1OL 2CDFB 3MV7A 5LJYH 3IFPA 3EDEA 3OKLB 5D2LE 5DD5L 4JY4B 4U1NB 4XBGA 4TPRL 8FABB 4BUHA 1T66D 4HWZA 4ONOA 3WMSA 1UB6B 4HUMB 4PJHA 5TDOB 1XF5A 3FFCA 3CMOL 3MSPA 1RURL 4JM4H 3IRPX 4HUXA 4AEFA 4MJ6B 5EN2A 3U2SA 2BNRD 4G9DA 1TZGL 1HHIB 1DVFC 4PP2A 2XXCB 5BZDA 3MNWA 2X4UA 4KI5D 5EO1A 2XA8H 3ZT5A 5I17B 4PS4H 2WW8A 3FT4A 2BVEA 1MHPH 4OV5B 1FPTH 5CEYB 4PS4L 1IT9L 1HHKB 1WBYA 2A83B 4F58L 5JPMA 3GMNB 1YNLL 4XAWH 4LPXA 4X8JB 1ZWIA 3EHBC 3H6JA 2AI0H 3ARZA 1MRCH 3C2AH 4PRHD 3D2UB 3QNYB 1MCJA 1NAMB 1ND0A 5B8CA 3TZVC 1BJMA 4CU7A 3P4OA 4TTDC 5EBLB 3RUGB 1YA5A 4GJTB 1D5IL 4HUXB 1OAKH 2E6QA 5GIRA 6CGTA 3GIZH 1DSFL 3OKEB 4MJIB 2XACC 3VGFA 4PJEB 2OTUA 3KS0J 5K59F 1LO4H 3DJ9A 3V0WL 3GNML 2IFFH 4OCWL 3FTGB 1IILE 2A77H 4HAFA 3S9DB 1AGBA 1QLEL 3MRCA 1TLKA 3SGJC 1ZGLP 4WGWB 3BN3B 4TUJB 5TE4H 2JCCF 5L2KA 4PV9A 5GGTA 2FYYB 3B5HA 2W0FB 1T1WA 3D5OF 2AEPL 5IMOB 2BY0A 1WFOA 3D3VD 1S3KL 1JTPA 3MUY1 1NFDA 4PG9A 3CD4A 5IESL 3SE4A 2C9AA 2P5WB 4LPTA 3VCLA 1NSNH 4Q9RH 5CUSH 3ULVL 5L8KB 2V5RA 4ZOBA 3OQ3B 2GUOA 4LPCA 1G9MH 1U2CA 3BD4A 3IETB 1HH9B 1JF5A 2VDKH 5B21A 5ACZB 3LRSB 4H88L 5TF1L 1FZJB 1I9RL 3L3OB 3VA2C 1QKZH 4WWID 3FZUD 1I75A 2GKIA 4I18C 1FP5A 3OXRA 1HOCA 4JM2B 1DR9A 4JDTH 1ZA3B 1A7RL 3I3DA 5J6HA 3K7UA 4P57A 1G1CA 3WUZA 5CJ5A 3N85L 3S37H 5I0DA 4G8IB 4LHUA 4ZSOB 5IHLB 3OMZA 4MAYD 2BVPA 3HNSH 2HMIC 4PREA 4S2SB 4NUJB 3CZFB 4JZJA 5KANI 1G0XA 1MFDL 4YDIL 2UYLB 1CDYA 1YN6A 4JHWH 1Q94A 2ZJSL 4M43L 4YHLL 3BDBA 5JR1L 3TO4A 3K1KC 1OAQH 1O7SA 1KULA 3V6OE 4FZEH 4C4KO 1PKQE 4MA8L 4F7TA 1N59A 3WJLA 2Z8SA 3NCFB 1AI1H 1Q9LA 1QSVA 3L6FB 5EUKB 3CLEH 1P7HL 1OTSD 4X99A 4KJYA 3UZEA 5D2LF 4EI5B 5EU6B 1ZHNB 4PJ8D 3QI9A 5CWSA 1T4KA 1BFVH 2J8HA 3TH4T 1WBZA 3OAZH 3W2DH 3FN0L 2VL5A 4GKSB 1I7UB 1C1EL 5EU7C 2L0DA 1XGUA 2P7TA 3QJHA 4U33A 2PUQT 5GS1B 5D7IF 2JKXA 5EU3A 3X13B 3VXSD 3V6BR 2R29L 1UCBL 4KFZC 1H0DA 3MNVB 5ALCH 2FHFA 4NKMB 5GQBA 3DXAE 5ID0A 2OSLB 5E7BA 1SYSB 1NLBL 4JFDD 4H1LB 2SEBB 2VOTA 4PJIB 2EIBA 3LKRB 3B9DA 5F96L 3F58L 4P3DB 2ILLA 5I1KH 5I8EA 1PEZA 5GS0L 5JHLL 1ORQA 4IM8A 4ONHB 2CD0A 5GGTL 3L7FB 1BQSA 4K2UL 3BEWA 1V7MH 1IM3A 3GIZL 4Y5XB 1NQBA 2PW1A 3ZT6A 5HHME 4FTVB 3ZKSD 2PTTA 4IRJD 4LP5A 4Z7WE 3WFBL 5DD6B 4XNYL 4YUEL 3WS3A 4O2EA 1OB1B 1HI6A 3I6KA 3IDUA 3P0GB 4P46B 4A2MA 4MJ5A 4NQDE 2JF1A 4WHDA 1C8PA 5L9DH 3U4EA 1I7UA 2BNQE 3HZKB 1OTUC 3S96A 4ZFZB 3QO0B 4F7EA 4JPWL 3O9WD 3Q6FA 3VXOB 1BFTA 1Z3GH 3ZE1E 3VD9A 1U8KB 2RBLA 5IW1B 3V52H 4R7DA 3CDGA 5ESQB 4UINH 3MRQB 4MA7L 3BDXA 3EYQC 5K9KB 1FZKB 4MS8C 3F7YA 1KENL 4JRYA 4L3ED 3VXRD 1WCBB 3VMPA 4GAYB 3BESR 5E4IA 3SQBA 2GTWA 4XWGH 5IBTH 3EYOA 2W0PA 1G9ML 3LKPB 5DTFA 4C4KT 3DYOA 3VI3E 1KLUA 2R4SL 1S7XA 3JWNC 3MLPA 4G3YH 4NDMB 3T4AB 4ZXBD 2BVPB 5DMGD 3RKDC 1CXLA 2C3HA 5F9AC 5SX5K 4HFWA 3EOAB 1LD9A 1YEGL 2F5BL 3MGAA 4KMTL 3LD8B 1KB9K 4ESKA 2VR9A 3OAUH 1DL7H 1MVUB 2PYEE 5B38G 5DEGA 3RVWC 4QXTB 4EZMA 4WRLA 1YEDB 2LVEA 4DK3A 5JHDA 4JANB 2DQJH 1MQKH 1K8DB 4W4OA 2W9DL 4FTVE 3OB0H 3WS3B 4Y16D 4YDLC 3RVWD 1FJ1A 1U3HD 3DROA 1INDL 5EU4B 4K94C 4LAQH 4U1HB 4ZNEE 1ED3B 3I6LE 3HC3H 4NKIL 5FV1L 3IVKB 4CN4A 3PL6A 1NCDL 1QTYT 3QQ3A 3LB6D 4Z0XB 1QFWM 5CILL 1G84A 3SKUD 3HLAB 3HB3C 2R1XA 3QUXA 4OLEA 1IEAA 4PFEA 2IG2H 4QEGA 4E41D 4TSBL 2APFA 1FBIH 3DURB 3QULA 4Z0BH 4LPYA 2VKWA 5EU7E 3VWJB 2AK4E 4OZGA 4JO1L 3GSWB 3DYPA 2F8OA 2OR7A 1TENA 1B0WA 2PXYC 4HWUA 1JI2A 4XNXH 4L3AA 1NBYA 4ZS6C 4JVWA 4ERSH 2CLVB 4NC0B 4PY7A 4V1DE 1A14L 1Z5LB 5H37G 4HD9A 5C08E 4OZGF 2X70A 3NAAL 3P0YL 5I1KL 1B6DA 4ZFOL 4JQIL 1MJJB 3ZDXE 4AZ8A 2UUDK 1Q9LB 3I6GB 1S7TA 2VISA 4M1DH 4BM7A 5EBWA 4AYFA 3QDJD 1IFHL 4N5UA 1RUPH 1INEL 2PYED 2Z93B 3TO4B 4OLYL 4CBPA 2QTEA 2UY7A 2BOBA 4JY5L 4Q6IA 5DJDA 3VJ6A 2CRYA 3HMWH 1OGTA 1V3KA 1TQBB 2K9UA 3Q5TA 5JZ7D 1MAKA 4PJAA 4MA3A 5K9JL 1YJDC 2ENYA 4BQ8A 2EECA 2R39A 1HWGB 5T3XD 1DDHB 4BZ1L 5J89A 2CRIA 2DIAA 3NPSB 3TBVB 3BRGC 1WT5A 2I24N 4IDJH 1Q0YH 3ARGC 5C08B 3BN9D 5DRZA 5HHOB 4W68A 5A2JH 1BOGA 2BNQA 5I76A 3C60C 2V9QA 1CFNA 1OCWH 1AXIB 1PY4A 2FECI 4H1LH 4KXZH 3DIFB 4XMKL 5A16A 2Y36L 3MUGA 4JPKL 1T80A 1V8HA 2PTUA 3LDBB 1D5BA 3LN5A 1AKJD 1IGIL 3TLRA 5I8OH 3BZFB 1KCUL 3VFRB 4ODBD 3C6SB 4GKZA 3RTQB 4MJ4A 4JHWL 4NT6B 2XXMB 5TDNB 3SKMB 3RQ3A 2ESVB 5CD5D 5EU5B 1PG7X 1YPZB 3EOTL 4LCYA 3FT3B 5HHNA 4V1DB 3BSZH 1T3FA 3QCUH 4WY7L 1KJ3H 2E7BA 4YQXL 35C8H 4WVRA 1ZLUK 2XZQH 5I1CH 1JVKA 4LLDA 1GPOL 1UFUA 4GFTB 4C57C 1SVZA 2D3VA 5BO1H 2P47B 3AY4A 3KYNB 1OB1A 4ONGH 4P46A 4CVZA 4LSTL 1S5IH 3U1SH 3UTQB 4XBEL 3VXTA 3ZYJA 5BRZE 1VHPA 2D0GA 2ZJSH 4NQUA 3L5HA 5CBAB 3NIGF 3TIDB 4JO1H 3DUSA 1RK1B 1QA9A 2IH1B 1WZKA 3P4MA 5D4QA 4HV8B 2DLHA 2H2SC 4UV7L 3IFLH 2F8XC 4JO4L 1GL4B 4OF5A 3GSUB 4NCDA 3T0EA 4PJCA 4N90E 4OD3H 4HUNB 3G5ZA 1Q72L 3CIQA 1I3VA 3HI1A 3MRKB 3UP1A 3S3JA 3PHQA 3S35L 2NX5D 4KJPD 4OT1L 4HCRA 3OHXA 2OCFD 1U95B 3HS0B 5SX4H 4KKLC 4BSWA 32C2A 4YDVA 4RSVA 1GIGL 3STLB 3BPOC 5C07B 2VDNH 3CVHB 3QH3A 1GGIH 1TJIH 1XGUB 3PQYB 5TDNA 3SKMA 3BW9B 2Y23A 2RFXA 3TA3D 2JE8A 3UPAA 5E70A 5C0BB 2OR9H 3DARA 3CFJA 4I48A 3TWCL 1YPZE 3IU4L 4ORGB 4HDIA 3LV3B 5GHWL 1QD0A 2FZ3B 2X4NB 4I0PB 4UV4H 1RZKC 4TSAL 1T7XA 1VFBA 4IOSD 1CD1B 2HFEB 2O5YH 1QKZL 3D0LB 3AAZB 4MNQA 4M6OH 4MS8D 4JJ5A 1KEGL 5C0IB 4YAQB 1BX2B 3TO2B 2IQAA 4HKJB 1RK0B 1SYVB 3REVB 4OGAD 3MLRH 1MCPL 4Q2ZB 4GBXA 4XNYH 5EIIA 3DURA 4G8EB 3RWFB 4G7VH 1QHPA 2R56H 3BPCA 3RGVD 2A6JA 4HH9A 1MI5A 3BVNB 2XYCA 4DGIL 3FL7A 1KYOK 1QRNA 2AQ1A 1UZ8A 4LHQB 4X7CC 4IDJL 3NOIA 3D0VB 5F3BA 3QEQA 3KYOA 2VH5H 1XAUA 4PRNA 5FO9B 2NY4C 2EE6A 3MLVL 3RVUC 4Y19E 4ORGA 4KK6C 4B7IA 2NX5E 3I85A 2AJXL 4JHAH 1X5IA 4ZAKA 1GVIA 1G7JA 4FNLH 5IB3B 2I9LA 3GZKA 3F6IA 5ID1B 1QPXA 4J2XA 4LEOA 1BFOB 3VXUD 3HUJE 1JPFA 1TQBC 3ZKNC 3DGGA 3OZ9L 3VI4E 3F65A 2P24A 3HMXA 4P4KC 4XPFH 4J6RH 5SWZB 1O0VA 1NEUA 1QLRA 3PIQA 4MQTB 1MAMH 4K3DH 4PJDB 1NFIA 1DQTA 1YEGH 4Q2ZA 5HI4C 4JAMA 3RDTC 5KANG 1E4XI 3DXAA 2X42A 1VACB 5AD0B 4JM2D 3ALXA 3I02A 1BZ7B 4FQHB 1ZLWK 1FFRA 3F7QA 1MLBB 3MYJB 1W0VA 4L8CA 1U2HA 1D5IH 2DKMA 1RZFL 3CFKA 2DKSA 4BFIB 1K8IB 2DQCH 4HCRL 1YMMD 3RGHA 3OKDB 3OF6A 3MLSL 5HPMB 4FRWA 4JFYA 3W0WB 1FJ1B 2ZPKL 4FP8L 1CTOA 4U0RC 1N2RA 4U6HA 3G6AA 3L9RB 2XRAH 4PV8B 1JHTA 1F6LL 3GO1H 3SGDI 3ARPA 3LS5H 4F9LA 4XWGL 1UCTA 4BSVB 2A9MH 3HAEH 5HHMB 4OT1H 4WENB 1NGPL 3KYAA 2YC1A 5DK2A 3ZE2F 5EU5A 4IIQB 4HV8A 2DJSA 1I9IL 1MF2H 1JK8B 3H3PL 1FNFA 2VABA 1Y18B 3KPLA 7FABH 3O6KL 5HDBF 1OF2A 1H15B 3E2HC 4PD4K 4YHOL 5HGGS 1VKXA 3ARBB 4Z6AT 5DHVB 4R26L 4XVJL 4HEME 3B6SA 4FG6C 3QUYC 4KZEL 1IC1A 1JNNH 5A16B 2HN7A 4LKXA 2XNAA 1KJ2H 2FO1A 4FZ8H 4I77H 3RKDD 3V79C 4WTWA 1N5YH 4JAMB 3WD5H 4UZGA 4CNIA 5C9KA 1AO7E 5HHXL 4CMHB 5T5FL 3AC0A 2QQKL 5D9SB 2R23B 2FX9L 4D3CL 2DMCA 3ILQD 3D25B 2R1YB 4NO5B 3GSQB 4M7LT 3NABH 1I3UA 2VIRA 3QUZA 2UWEA 5LCVL 2IC2A 1NDMB 3BE1L 1ETZA 4FFWD 4KMTH 1CE6A 4U1IA 1LHZA 5I8CA 5CWSB 3JV6B 3KR3H 3VDAA 3GSVA 1KIRA 4WI8A 2GCYA 5FM5O 5CFHA 4NP4H 3SGKA 1CGTA 1AGFA 5HXMA 4FTVA 5CGTA 1G0YR 1I1AD 4NZUH 4S1DC 1PD6A 4RX4D 4HWBA 1OM3H 5ISZE 2IBZX 3VI3F 3BP7B 1MIMH 3NFNA 2FX8L 2X7LA 2O5XL 4NBXB 1FYTA 1HZHL 1IC5L 2JB6B 4JDVA 2CK2A 1CQYA 2O5XH 2LU7A 1KCSH 1A7PL 4GG8A 4RFOL 1G7HA 1J8HB 3TZVA 4ZUSA 3LKNB 4Y19A 1E4XH 3ARFD 5HYJA 2OSLA 4JLRB 4RWHA 1JWSB 3MLTB 3OSKA 1PX3A 2IALA 3QXWA 3K4AA 4R97C 3TV3H 3VWJA 3SE9L 3WFDL 3BZ4B 2AS5M 2BDNL 2BHYA 4H0IA 1KIQB 2RIKA 1D6VL 3EZJB 5CIPB 5E2WH 2JK5A 4YUEH 1S7SB 5C0IA 4KPHH 4QRRB 3SN6N 1UT9A 5ISZB 2QV2A 1AO7B 2OI9C 5D70H 2H41A 2YBRA 5DJYB 2EYTB 1FO0L 3WLBB 4XPAH 3QBTB 4ZTOH 2YD7A 4EN3A 3LEXA 4M1GL 2FATL 3BKJL 5D1ZC 4U3HA 5DDHA 2GUOB 1LDPL 2BVQB 4KKAC 1NGQL 4RGOH 1QRNB 5IUSA 3O6FB 1I7TA 2GJZA 5IVXA 4DGYL 4NRYA 1EHLH 4P2OB 3LMJH 3RWDB 4DCQB 1RZJC 2CO7B 5JHDB 4PG2C 4JZJC 1FVCA 2ZCKH 3CZJA 4EUPH 1C5CL 2R0WH 1A5FH 5LGHL 4LHUD 5ICYA 5F7HA 4P2RE 1RK0A 4LARH 3MV8A 1NCTA 3UTSA 4K9EH 4FFYH 3VXPA 3QQ4A 43C9B 3UTZA 2GAZB 2XZCH 3V4PH 4MXQC 4WEMB 3QFJB 4AL8L 3O2WL 5TQ0L 4NZRH 3BZEA 2EEDA 1G7LA 1JPGB 2DAVA 2XN9D 4FQXB 2UZYB 1QBAA 1B9ZA 3BKYL 4PJBA 2VXUL 1XR9B 4GW1A 1GOFA 4GRLD 4WUKH 2WQRA 1CFBA 5HVHC 4PJ7A 3SDCD 5DFTA 2AXFB 4PJ8A 3QI9D 2EICA 4P2RB 4GMSL 1JNLL 5IB5A 2VLRB 4RA0C 1E6OL 3RIFK 4OTXL 1N0XL 1OAYH 3QFJE 2F9BT 4GMTL 4P23A 1YEDA 1QFUH 1I1AC 4X4YA 3GSNL 3PP4H 1P4BL 1T22B 4X5XB 1MEXL 4PJ7F 1RPQA 2F54B 4IIQC 3P0VL 3ZDXF 2ATPA 5SWSB 4OZIE 2DQTH 4P4KB 4AIOA 3FN0H 3CFCH 3ZSTA 3D48R 4RFNC 2DI8A 4WFFD 2WBJB 4I4WB 4IJ3C 2ARJQ 4HBQA 3HR5B 3V5KA 3V4UH 1L9NA 4QTIL 4GAGL 3WV0A 3OGCA 4APQA 3RJDA 1BLNB 3MO1B 1W0VB 4YFDB 5I76B 2Z31C 2FWOB 5IEHA 1GGYA 5I74B 3IS1X 5B39B 1QO3A 3AS2A 1YC8A 2VE6B 1EPFA 2W65B 3NN8A 1HHJA 3MRGB 4X5XA 2UUDH 1M6OA 3O9WC 2XICA 1UYWL 1U8PA 4U1GC 2BZDA 12E8H 2X1PA 1EJOH 5IW6B 3JTSA 2NY7H 5IB5B 4Z7QF 5EU3B 3MBED 3X13A 4WFGD 3HPLB 1CE1H 1UXWA 3OB8A 3T1WA 2HJFB 3V0AC 2DB8A 5LBSL 5B3JF 3NCJL 4QRUA 3X11A 4M02A 4M3KB 4GLRI 4QHMB 3T0BA 1VEPA 1KB5L 4PLKC 3T3ME 4HK0B 2ZZUT 2ICWI 4AQOA 4Y89A 1FGNL 4L4VE 1CD0A 3L5WB 1S7TB 2PXYB 3IJHA 5J57B 5D72H 4XMLL 5DRXA 3F5WB 2QADD 5HHXH 1WT5C 3NGBC 4CW1A 4ZFGL 4XWOD 2CJUH 5C08A 3AS0A 5HDQL 1DP0A 4J3OC 2WINB 4N5ED 2ID5A 1IL1A 5EOTB 4YHIA 1YN6B 3NH7L 4P3DA 1BP3B 1NBYB 5MHSE 2ZPKH 4FP8H 1U8HA 1I9JL 2IQ9L 3BZ4A 2E9JA 4R2GC 4XXDA 3QPQD 4OLWH 3MRDA 5EZIH 3O8XD 5GS1A 2C1OB 2XA8L 1YY8A 4LHUG 5D2NB 5DYOB 5GGVY 3HMXL 4M03A 2UZIH 3PWUB 3MXVL 3E8UL 2FX8H 3VFUB 1BVZA 3UO1H 2XZQL 1BJ1H 2VQ1B 4UTBL 4WU5A 5L7XH 3DSFL 1A7RH 4AIXA 4NWUH 2HTLC 5JW3L 4TSCL 4MJ2A 4M7LH 2Z8WC 3GGWA 5MERA 4A6YL 1GC1H 3BWAA 2P1YA 3GSVB 4YBHA 2HKFH 2PETA 4OZFH 4BFEA 4D0BB 2A6JB 3IJSA 4NQED 4Y19B 1ORSA 1YPZF 5D2NE 4FFZH 4JRWA 5JNYA 2BHUA 3BQUA 3CH1A 4F37K 4WHYH 3BQUB 1OAZL 1YEFH 3QWOA 4HKJA 1AIFB 3ARWA 4YR6B 1FN4B 4M00A 5JIKA 1IAIL 3FTGA 1DE4A 1N7MH 3PGDB 1Z2KA 3CUPA 1S78C 2DL9A 1SEBA 2D7QA 4TNWK 3D1MC 3P77A 1MFAH 1I1YB 4ODTL 3P4MB 1RU9L 3DVGB 3GGWB 4HHAB 1UACL 2Y7QB 5M94B 4AT6B 2X4NA 5EU4A 5CJXA 4UILH 4QRSB 3UDWC 4PJDE 2YPLA 3LMJL 1MJ7L 5F21B 1RULL 3QDJA 2E7CA 2ZOKA 5DJ6A 2O26U 1IE5A 2W9EH 1GGBH 4K7PL 4XP1H 1OT2A 3DV4A 1BVKB 2BNRE 1WWCA 3QH3B 5DMGC 2LAAA 3IDXH 2V5SA 4MQXD 2DM2A 3KWWB 5B39G 2GJJA 4JQIH 1SJVA 5IMKB 4G6MH 1GGCL 1DFBH 1HIML 2QQLL 1TMCB 5D1QC 1CU4H 2A0LC 1KEML 5H35A 3CC5B 3OKEA 4OCLC 3FQRB 2VXUH 1BIIA 4BFBD 5BCAA 1DLFH 4M48L 3FFCB 1JYNA 1WCBA 4FQLH 2ZCHL 1D5MA 4KI5F 4OB5L 5D93C 5I74C 5I1GH 5MENA 2W9LA 4RQQB 4JN1L 1G7LB 3A6CH 1E27A 4LFHG 3MYJA 1A7QL 4XXCC 5BVJB 1NANI 4MCZB 3VRLF 3QRGL 2YRPA 3L5IA 4LVHB 4LF3B 4P9MH 1A0QL 1FRGH 1T22A 2DYPA 3DUHA 5J3HC 4PGCA 4Q74A 3I9GH 1AY1L 2AXHA 3HE6D 5GZOD 2OZ4H 1KTRL 3F7VA 4IJ3B 5HD8C 1MHEA 2BOBB 2BSTA 4LCYB 3NFSL 2DQUL 4X9GA 4LEOB 1MIEH 2D03L 4QXGL 5BS0A 4G42B 1MJJA 1N59B 1KN4L 2KUTA 4F8QA 2OTPA 3P11H 1U93A 3P40A 2PYFA 3BPLC 2G9HB 4PJGA 1OP3H 5E2WL 4WI2A 2BRRL 1EO7A 3GRWA 3O11B 3QCUL 3WEXA 3C6LA 4JR9H 3VFTA 4J4PD 3QG7H 5BQ7A 3LHPH 3RY6C 5TE4L 4ETQB 1CIDA 1S5HA 1P84J 2HP4A 1NH6A 1OSPH 3O8XB 4PJGF 4ACPA 3D9AL 3U1SL 4HWNA 2CIKA 4MX7B 4KV5F 4PJXB 4GSDH 5LXGL 5D2NC 4DZ8B 1TPXC 5C3TA 4M5YL 1QFUL 4G8GB 4PBXA 5JOPD 2H1PH 4JFPB 5DT1L 4EI5A 3LPWA 2E7LC 4QF1A 4ZTPL 5INDA 2OBGA 2C3XA 4OM0H 1CICD 3K8KA 2A9ML 3VWJC 2PO6B 2F8VA 4HKZB 5E1AB 2F19H 4HGMA 3KPPB 1X5GA 5DD0H 2E3VA 3QPXL 1PX4A 4X4XB 1YMHB 2Q7YA 4N0CC 3FQTA 3LV3A 1N6QH 1NUFA 3RZWA 5I0ZA 5CMAB 4CU6A 5IFAH 1S3KH 2GT9A 3IJYA 4PRHB 2VC2L 5TQ2H 1PYWB 3U0WL 1PG7L 1Q38A 1KPVA 5DRNA 1RJLA 2A6KA 2DJUA 4HUVA 3D25A 3T2QA 3SCMC 4X0KA 4L4TB 4M62H 2FEDD 1EFQA 1U95A 1OARL 2Y1VA 4JLRA 2KQNA 1CZ8H 2NY5C 4LVOC 1I4FA 1CF8L 3DHMA 3PWLB 4KTEH 1QRND 2HN7B 4LKXB 3R8BB 3B6SB 4OJFH 3TFKD 3CVHH 4WV1B 2C1PB 2OXGA 3I9GL 2EDEA 4XNZC 2EXWD 2J3SA 1TIUA 2YD4A 3BIBX 2AQ3A 5IOPB 2OM5A 5CP7B 4R4FH 3DX6B 5CJOL 3BW9A 4P4KD 2EYSA 2EXYC 4XHJC 3KJ4B 4XVUD 1AO7D 5EZOH 4PJXE 4LSTH 3FQNB 1F4WH 3CVHA 5EUOE 4M1CD 4L4TE 2FH8A 1S7QB 2HG5A 4M6NL 4PUBH 1FPTL 1NC2B 1U42A 1DBJH 4XVSH 3KLDA 4ZXBA 4XPGL 4GAJH 4PB9L 4M6MH 5FOBA 1S78D 3RAJH 5IF0A 3LY6A 1ZS8A 4P9HH 2Y4SA 1AGBB 2R69L 5LQBH 3U2SB 5ALBL 5GGSA 4HGWA 1JJUA 2X4RB 1XR8B 5E8OB 1HYSC 1OD9A 5DMIH 3MV8E 2B4CH 3SDXE 3FRPG 4Z7NF 3C6SA 4GKZB 1C1EH 4G9DB 2X4OA 4TSBH 3OG6B 1TZIB 1BZ7A 3CFDA 1LE9B 2NW3B 3DTXA 3OXSA 2AJZA 1VACA 2FWOA 4G6FD 3EO0B 5AD0A 5IEHB 4GRLB 1GSMA 3WXVL 1L0XA 2YR3A 4JQXA 1GRWA 3QFJD 4EOWL 1ZGLB 3VGBA 3L3HA 4JO3L 4UNVA 3IFPB 5TJWK 1EGJA 5EIQA 2VZ3A 4X8JA 3DRQB 3RU8L 1DBMH 5CS7A 3SDDA 3FFDA 2JJWA 4Y4FB 1P84K 4QKXB 4L8BB 1A7NL 4HQQL 4A6YB 1CLOH 1O5DT 1IKFL 5EIVA 5T33L 3PV6B 1IEBB 4R7NA 4HQQH 5BRZA 5TE7H 4Q9RL 1A21A 4NIKB 2D9QB 2FBJL 4LDOB 4PJGE 5AZ2H 1OT1A 4M6AA 1EMTH 3SDAA 1UM6L 3EDDA 5AZEL 3O2DA 4PJ8B 2J5LC 2VDRL 1N26A 1CBVL 1R5WA 4M8VA 4MB3A 5FECA 3OTTA 1HEZA 3DO7B 3QEHB 3ZE0F 2GY7B 1NL0L 1G9MC 5L9DL 2R4SH 3CK0L 4D9RE 3I02B 4R90H 2Q3ZA 2WBJD 3LS4L 4UTAH 4Z8FH 3HTLX 5DHYB 5F1SA 2PYEA 2MFNA 4PJIA 3WFCL 5E4EC 5KVEH 3QDGE 2WUBL 3ZTJG 1N5AA 2K1MA 2GW5A 5KS9E 1INQB 3H3PH 1NSNL 2P8MB 3DNKA 4R4ND 3TYGL 3CFEB 1CFTA 3IXAA 4PTUB 4UINL 1T20A 5BW7C 2DQHH 2DWDA 3BO8A 2Z91A 1NC2D 5SV4A 3D85B 2E8YA 2C4FT 4TVPH 5FV2A 5K93A 5DS8B 3UPRA 4NBYB 3BGFC 3OX8B 5EC1B 3QI9B 1SEQL 4PGBB 3AB0B 5CMAA 5IEKB 1A7BA 3QEGL 4FTVD 3AROA 5J9PA 3RWHB 1KTKE 2EYSB 3V8CA 3FO0H 3EYUL 1I7RB 5I1IL 1EUUA 2Z9TA 1T5XA 5CJBA 5KOVC 4FFVC 3K2UL 3ZO0A 3GSXB 2DQJL 1U8MA 4LLWA 2DWDB 2APWA 4PGBA 5IEKA 3F62A 3U0PB 1AGDA 1UENA 4ELMA 1NGWA 4RRPG 4KHTH 4O2FB 4L1HA 4POUB 2F54E 5IMOA 2YK1H 4KI5C 4LCCC 5B4MD 5IKCB 1FQ9C 4OTXH 1JV5B 3B9EA 4P9HC 1ORSB 5C09B 2VWEE 4M8QA 3TVMA 5JZ7C 4FQ1L 5FF6A 2XWTB 1B4JL 2VLKA 3PXJA 5T1LB 5EC2A 4UV7H 4XC1L 3GSXA 2GTZA 4PRPA 1JWSA 4YO0B 4PLJD 3BH8A 3WNOA 1A4JB 3O6FD 1QR1B 3ILPA 5DQDL 4KK8C 1AC0A 1AQDA 2I9LB 5I2IB 4PY8I 5DQDH 1DUYB 1UH3A 3MRRA 3SY0A 1J86A 1INEH 3TYFA 1N64H 4G42A 4NN7C 1GJIA 1DQLL 1E6JL 4GS7B 4L4VB 5E0QA 1IQWL 4TULL 1CR9H 1CDGA 4NN5C 4KRNA 2Q8BL 4QRPA 3E1F1 2DDQH 1ROWA 5FYLD 5I8KH 3MRJB 2NTFB 3QO1B 4NN6B 5FYKH 4MAYB 3PWVB 2WBWB 4S0TD 3MV7E 3CFBA 2VDLL 1WLHA 1JF1A 4LGPB 1PAMA 3RL2A 1IQDA 5BZDB 2R1YA 4NO5A 1QSEA 1JFQL 1A9BA 5HHQA 3VD4A 4LSVH 1R6VA 4XPHH 4EI5C 3IDIA 1EDQA 2AK1L 5DJCB 2F53E 4UB0H 3FO0L 3BJ91 4AEIH 2PW1B 3QEHA 1EVUA 3N85H 3ZTNH 2PKDA 43CAB 1OARH 4GRLA 5FDWA 2F74A 2IANA 1AGCB 1S7VA 1J0IA 3Q6FB 3VXOA