2Z4QB

Crystal structure of a murine antibody fab 528
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
218
structure length
218
Chain Sequence
QVQLQQSGSEMARPGASVKLPCKASGDTFTSYWMHWVKQRHGHGPEWIGNIYPGSGGTNYAEKFKNKVTLTVDRSSRTVYMHLSRLTSEDSAVYYCTRSGGPYFFDYWGQGTSLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermodynamic consequences of mutations in vernier zone residues of a humanized anti-human epidermal growth factor receptor murine antibody, 528
pubmed doi rcsb
molecule tags Immune system
molecule keywords anti egfr antibody fab, light chain
total genus 42
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2007-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z4qB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z4qB02
1T22B 1MLBA 3ZE0F 5IV2A 3WL9B 5DVLA 3EDJA 1VESA 3TPKA 2BJML 4KJYA 4YDVA 4TSCL 2GKIA 3JZ7A 1IM9B 1FE8H 2LTQC 3V4VH 4UV7H 3QWRA 2IBZX 2HKFL 3GMNA 1OP9A 1LO3H 1OLZA 2B4CL 1OY3B 4AEHH 5C0RL 1AXTL 1BD2D 5ITFA 3Q48A 3RDTA 1EVUA 1M6OA 3BSZH 5FF6B 4APQB 4MA7H 4NNYB 1SYSA 1JWSB 1EJOH 5SWZE 2HMIC 5DJ2B 4O2FB 5JOFB 5KSUB 1MQKL 5JQ6H 4BFBD 4NDMB 4G6MH 3PDOB 4HK3J 1S7RB 2JCCF 4ENEC 3JWOL 4Y5XA 4KC3B 4H8WH 5E6IC 3FAWA 1MRDH 3U9UA 2M8XA 4OBRA 4UT6L 5DVOA 4DWHA 1GGCL 3DX8B 1HHHB 4FP8H 3HZKA 4Y4HC 1LGVA 2FEDD 4OD1L 2E6QA 1AI1H 3QEQB 2L4OA 5LGHL 3FFDB 3IVKA 2BMKB 5ALCH 5L2KE 2VZOA 2Q6WB 3NIDF 5E99H 1BF2A 4HWBH 3O6FD 3NMEA 4NFDA 5D1ZC 4TUJB 4H0HB 4YXLH 2Y36L 4DGYH 1YEHL 5JQHC 2HG5A 5ECJE 1CFQB 4YDJA 2D0HA 5IW3A 3NIFF 4LVHB 3HRZA 4HH9B 3R8BB 5F7NC 2X4RB 1KB5H 4EOWH 1U8NB 4JFYA 1RAMA 3ULSB 2HT2D 2Q6WA 3LS4L 5I1HL 3OKDA 4N0UE 1FO0A 4YR6B 2X5PA 4HIIA 2DN7A 5C09D 4PRNB 4PJAE 2F54A 1BM3H 5C0CD 3PUCA 1IAIL 1YQVH 3LRSA 4OF8A 1W72B 2ID5A 4ZFFB 3FONA 1RUAL 4JREC 3HNTL 3P0VH 5KSVB 1U3HC 2E7MA 3BYTA 4NQDB 5DYOB 1I7RA 4PIRF 3C09B 3RVXD 1CL7I 2ITCA 3LKPA 1NAMB 4JZOB 4LU5H 4O58H 1F11B 1PKOA 2Z35B 4OGAC 2AJZB 4FTVB 4RGNC 1NPUA 4ZPVA 1R0AH 5CZXC 1TJIH 4YK4C 3RZCA 4XVTH 5EC1B 3VXQB 1N59B 3TN0C 1TTUA 4P4KD 2NTFA 1YEIL 4QHLA 3SDDC 3U30B 4ZFFA 1ZTXH 1K2DA 1H3VA 2LAGB 5K93A 1Q9LB 4ELKB 4U6VL 4H5SB 3V0VA 2RJMA 3F58H 4M6OL 3QR2A 3V0WH 3VGAB 3MRCB 3J8F7 3BPLB 3G5ZA 3L5HA 4YBQC 5DVKA 4U1LA 3KPPA 3PXHA 5JR1L 4MA1B 4W4NA 5TDOB 4F7PB 3V2AR 5HDQH 3U30C 3SDDB 5IFJB 5AZ2H 2J8HA 5GRVK 1R3HA 1XIWB 1R3KB 5JDJA 1G6RA 2HTKD 4G9FB 5HI5C 1NC4A 2CSPA 2EDWA 4KAQH 1QEWA 3DYPA 1KJ2B 4L9DA 5DO2C 3H9SB 2MSPA 4QXWA 4XNMB 1KXQE 5IFHL 4BKLA 2VDNL 5J1SC 4O51B 4OD2B 3ZKQD 4Z7NE 4XVUD 1JNLL 3S5LB 5KTEL 1NBZA 2MCPH 5DFWH 4NJ9H 1U3HD 5IKCB 3VXRD 3MUGA 5C0FB 3IETA 5F89A 3PQYB 4PB0H 1IKFH 2PW1B 3ARBB 1MCNA 3U0TA 3JWNC 1C16B 2BRRL 5CJXA 3HAEG 3WFCH 2VLRE 4LDLB 1KCKA 2OTPA 4E41B 4F37F 4KQ3L 4PJHF 2AQ3A 5KVDH 3MGTB 3MRFB 1RURH 3V4UL 3LS4H 2W9EH 4NQCA 3WFCL 1REIA 1ZSDB 4GXUM 2CPCA 3GSUB 1DBBH 1A7OL 1KJMA 1AP2A 4LDOB 3SDCA 3VD7A 4IIQB 5EBMB 5ESQA 3OJVC 3P30L 3QIUC 4M7ZB 1CF8L 1P4IH 5BJTA 4XTRD 2Y9RT 4DGYL 1PEZA 3NCYS 1EEQA 2NPLX 4K3GA 3ARFC 1DUZA 1CD1B 3I75A 4YZFF 2WWKO 3P11H 1J1PH 3QXDB 4JM2A 4IS6B 1F3RB 1IAOA 4XCEA 5CEZH 3DPBA 3IFOA 4NQSB 1HSAB 2G5RA 2YR3A 4KKLC 5DC9B 4LLAA 1CI5A 1CR9H 3WFDH 4NZRL 3SBWC 1JN6B 5DD5H 1WWWX 2VQ1B 4L29B 2KKQA 2P5WD 3CC5A 3MRMA 3U7AA 1IL1A 3SGJC 3O2VL 1FNGB 3HUJE 2EDBA 4R8WH 2ZUQB 1N6UA 5F9JA 4QF1A 1AO7E 2L7UA 5IMOB 3LS5H 4WW2B 3M07A 3KWWA 3GMNB 3U48A 1BOYA 1U92B 3GNMH 4QGYA 2HVJA 1AXTH 5FUCE 4JY5L 5I16B 3E3QE 3G6DH 5D7IE 1T2JA 3RTQD 4JFOB 5F7LB 4FTVA 2AAVA 3AREB 1CVRA 4JAMA 4QKXB 3GUTB 4PJ7F 4JDTL 3PWLA 2AXJA 1TJGH 5BCAA 1R3LB 1U2CA 3WLWC 1Y6MR 3ZTNH 2FWOA 1RY7B 2P43B 3N9GH 2J7LA 5HGDB 5A2IH 2PYFA 2EO1A 2ED8A 4DKEH 1CIDA 1XGYL 4TQEL 4ZTPH 3UPAA 3C6LB 4GMSH 4HCRL 3DBXB 4A6YB 3V0VB 2WWMC 3SE8H 4P2RD 5J9PA 3RWCA 1D3CA 1KUMA 3K74B 4DTGL 2R29H 3M1BA 2CK0L 5E00B 1RZFH 4PV8B 5JXAL 4JRYE 3HHRB 2OBGA 4LHUB 1PZ5A 1OSPL 2HLFC 4H0IA 6FABL 2KDGA 1XF2A 1KIPA 5FO8B 1MRFH 1XIWD 3BWAB 1PY4A 4PJEE 5IBLD 1ODAA 4NT6A 4GXVL 3WHE1 4GQPH 1WC7B 4Z7QE 3T0DA 1CL7H 5GGUB 5A16B 4TSBL 3C8KA 3T4YB 2LFGA 4X6BA 5D72H 3QXTA 2GJZB 3G04A 2DI7A 4Y5VA 5KVGH 2DYPA 4FQ1L 1E6OH 3MRNA 4JVUA 3B5TA 1QBLH 4I0PC 1YA5A 3NA9L 5TF0A 3H9HB 4U6TA 5CJBA 3PWNA 5T5FL 3S5LA 4IMLA 1MFAL 4GBXB 5CEZL 2QADD 4XP9L 2VERN 5T1LD 4GRWH 2WK2A 3OKDB 3UYOD 4NFBA 4C83A 5SWSB 2ATPB 5IW6A 3O9WA 2Y06H 4GAGL 5I18H 3BRGC 2UYLB 4PBVC 4X6BB 2VXVH 5J11B 4N0FB 2PTVA 1CXEA 3TA3C 5H35A 1WICA 1B4JL 4M6ML 3FONB 4Q7DA 2PCPA 4WU5B 4FQQA 2HYMA 5T1KB 5AYUH 1H5BA 4G43B 3F6IA 3TFKC 2GW5A 1EX0A 3E6FB 2LAAA 3TZVB 3LH2L 4JO4H 4QEGA 4JY6B 4LOUD 3TYFA 1JZ2A 1DANU 1VGEL 3Q3GB 4R3SB 1T83A 2VLRA 3TJEL 3DXAD 1KCSH 4G8EA 1FN4A 3GMQB 4O9HH 5GGTH 1FSKB 5D70L 1JF6A 1JGUH 3WIIH 4BZ1L 5TFSH 2EDLA 4LSDA 3TBWA 3PWPE 2E7HA 1EO8L 4PD4K 5DI8A 3T3MF 3TCLA 3A6CH 1QRND 5T3XH 5IQ7H 5C0IA 5GZOC 1Z9LA 5B4MD 3PWUA 4YE4H 4Q6IA 5L9DL 2GY5A 3OAYK 5AYQA 1N7ML 3WS3A 4HV8A 1MWAL 4LPYA 4YGVB 3MROA 5DD3L 2P46B 5FOBA 1U8KA 3KPNA 5BMFH 5DS8B 5HHMB 2A6JA 3BO8A 4U1HB 2X89A 4WRLA 3IDJB 4P2OA 4HZLA 5A2JH 3GIZH 3OKMA 2AXGB 2DWDA 4GKSB 4WI4A 2XI9A 3C2AH 1MHPL 3M8OL 3RDTB 4HKZB 4PBWD 2X70A 4BQCA 2F15A 2XN9A 2B20A 2BSTB 1Q0YH 1KBGH 5JIKA 2IFFL 1FZMB 2E27H 5GGRB 1UJ3A 3UX9B 5ADPH 5JOPD 2E6JA 3HMXA 4G6JL 3HUJA 2YPLA 1FL6A 4NOFA 3KPOB 2ZCKH 1UG9A 2IH1B 3TLRA 1XGUB 4M7JH 5FYJL 3SDCC 4N5EC 2A83B 3UDWC 5KS9F 4K3EL 5F8QC 5TH2B 3CLFL 1F58L 1MPAH 4H20L 3QFDA 2FB4L 3ZDZE 2FX7L 1LEKA 3SKMB 1Q0XL 2NW3A 1P84J 4L4JA 2VB5A 4GUPB 2GK0A 4I5BA 4Q9RH 2VAAB 3MXWL 2AJUH 5D7JB 5CSZB 3GSQB 4EEEA 4ODWB 1B0GA 4ETQB 3DURA 5B3JF 5IB5B 1JHTB 1GC1H 3Q5OA 3I6GA 4TUKL 1G0XA 3OGOE 1T3FA 2Z91B 3BIAX 2WUBH 4DCQB 1IGMH 1V3JA 1RUAH 4UINH 3SKMA 3ZSSA 2J8UE 5DFTA 4FA8A 3MV7E 3UTPE 1WCQA 1HHIB 4HJGA 3LPGA 4L4TA 5F93C 5FHBH 2JELL 1OTTD 5FKPB 2WSKA 5FM4A 3L3DA 2AQ1A 2CKBB 1LE5A 1C7TA 5EWIL 2ARJB 1UB5A 3VFUB 1MCOL 1QO3A 4FQCH 3DX8A 3VI3E 3UTTD 2CUIA 3D2UA 4ERSL 4JG0H 4Z8FL 3W39B 4NQEE 5T1MA 3MLPA 4Y5VC 2Y36H 3OB0H 1LEIA 1FL3B 1KFAL 5IW6B 1PVHA 5E6IA 3QXWA 3RX7A 3SDXB 5C6PB 3ULUD 2VXUH 4RMRA 3CFCH 5DRWB 2EO9A 1SEQL 3N85L 3O4LB 1UB5B 4K94L 4UTAL 3QH3B 2R9HD 5FUZH 1HQRB 4PP2A 3KHQA 4I77H 4NCDA 1CGYA 5CWSB 1OL0A 4YPGA 2BSRA 1P7KA 4O2CB 4UB0L 3AVEA 2CRZA 4NIKB 5C9JA 1RIVL 4PRPA 1DEEA 4NZJA 4PY7B 1C12B 5CUSL 4E0RB 1NMCC 5EZIH 5DMYA 1MLCA 1YY8A 2DKUA 2PYFB 2GUOB 1R3HB 1BJ8A 1FRGH 3D39A 4OI7A 1HCVA 3LSOB 1HQ4A 3FT4A 4OUOA 5GJTH 3HRPA 1QFUH 1EJOL 3IFNH 4NOBA 1RJLB 1VPOH 4KJWC 4LLYA 1OTTC 1G7HA 3VD9A 4F7CB 1MHHA 5JXED 3C5SA 2OTWB 2RFXB 1G9MH 1A5FL 2VSCA 3H3PL 3SKOB 4KQ4L 1QOKA 1JPFB 1T6WA 4N90E 4ZS6C 2QHRH 4GRWE 1NGXB 1JNNH 2ERJB 2R2EA 3QDJA 4WDIA 3RX8A 3FQUB 1CU4H 3RDTD 5CZKA 5DURD 3R8QA 3ARVA 3GSOA 3IF1A 3TNMA 5I30H 1NH6A 5FV1L 3VI3F 3NZHL 5B39A 3BZ4B 2NTFB 2ZSWA 2VXTH 1CXFA 3ZKMC 3V7AE 2W0FB 1RJZB 3WLWD 4X7FC 3DRTA 1VA9A 4JKKA 1R5VB 1W0VB 4RISL 3EDEA 4HX1A 1U8NA 2R9HC 3BKJH 1YMHB 1IC5L 2VDMH 1IM3B 5FFLA 2YPKB 4FOMA 4DW2L 5SX4H 2VABB 3AU1B 3VWKA 1NCDL 5CJ8A 1XR8A 1Q9WA 2EIEA 3ARTA 1RZFL 2A74B 3UMTA 2R0KL 4ZYKA 4NRZB 4FQXB 2NZ9D 3K8LA 3MRBA 4HWUA 4U3HA 3E6HB 5DLML 2GJ6A 5IBUB 4X0KA 4PLOB 2V9QA 4PS4H 2VN7A 3BQUA 4TOYL 4Z76A 3TGXA 4D9QD 1EH9A 4NM8H 4X5XA 3RL2A 1AKJD 1YNTB 3EOAB 3GMRB 1ZE3C 4LQ1A 4DZ8B 5JORA 1DDHA 4JDZA 1CXLA 4OM0H 1JWMA 2ADJA 4IS6A 4FG6D 3RX5A 3PP4H 1GGBL 3CXDL 1S5IL 4QHKI 4S1QL 4PGDB 2BX5A 1CFBA 3UTSB 5DI8B 2OI9B 1LK2B 2GCYB 2EYRB 3RWEA 2FEEL 2HT3D 3VXOA 5DJXA 1NDMA 2PYED 2AK1H 1K5NB 5T3XD 3MOBL 2BVUA 3O9WD 5KG9A 5GZNC 4DK6A 2Z8VC 4YAQA 3V79C 1RFDL 1UCBH 4M1DL 3QO0A 4LPXA 1CFTA 5EBLA 3MRFA 3D9AH 3FO9A 2XRAL 4XHJD 3ARDC 2GSIA 1TJHL 4GAYB 4ZFOB 2VL5A 1I3RB 2GIYA 3S3PA 3DJ9A 1ERNA 5CJOH 3QAZC 3ZLQC 3IU3B 5AZEH 4JFFD 4BFIA 4G3YL 5ESQB 1CIUA 1T1WA 4PV9A 5ALBL 5HHQB 3G6AB 3G5XA 4K07A 1JPSH 2P49B 4NPYB 2FBJH 1GL4B 5F8RC 3FOMA 4M7LH 5DVMA 1JHKL 2DTML 1IGJB 4OM0L 1KGCE 1MLBB 2DLGA 1KXVC 1J8KA 4KDTA 4HIHB 4LFHD 2UZIL 3ZDZF 2DQEH 5DLMH 1XGUA 1Q38A 1HYSD 2OL3L 1QLFB 3BPOB 4IRZH 5MEQB 2VDPH 1D9KB 3MJ9H 1VFBB 4EVNA 4R2GB 4JN1L 1QQDA 4FFWD 5E8PB 4LASH 1RZJH 2YSSB 3BWAA 3KR3L 3BH8A 1LO2H 4Y5YA 4PRAB 1MY7A 1MSPA 5L6YL 5DO2D 5AUMB 3DX9A 5K9OB 1R3IH 2G75A 1KPRA 3LAFA 5GIRA 1P5VA 5I8KL 4M9OA 4EIZC 1NEZB 1II4E 1T04B 3D25B 4MNQA 3LH2H 2YWYA 3T0WA 4A2MA 35C8H 4XI5C 4JM4H 3MOBH 1E0OB 3F7RA 4PP1C 5I30L 4U1NB 3QQ9C 4LGRB 1OSZA 3UJIL 4LIQL 3DX9B 4S11A 43CAA 3HZVB 4P9HC 4CVZA 4PJ7B 4DN3L 1UACL 3U46B 3NN8A 4LSTL 3QP3A 3MJGX 5H35B 1MIMH 5CBAA 4EI5A 3L3IB 2MMXA 3LQZB 4EI5C 5L8LB 1FNFA 1KEML 1QPXA 2VIRA 5C92A 3FCTB 3DBXA 4A6YA 1L0QA 3PNWB 1RUPL 1GC1C 1OAQL 3MRHA 4XZUB 3AC0A 1KJ2H 1X44A 1ZLUK 1KCUL 1MCHA 3DMMC 1RMFH 4NWTL 4XHQA 3BN3B 1YNKL 4WHDA 5CP7A 2BZDA 2HFFA 1AIFA 1OPGH 2WINA 1SMOA 3SOBH 4BM7A 3LCYA 5F7HA 3I2CL 1B6UA 1G7PB 2HLAB 4R2GC 4P2YA 3TBVB 1WK0A 1RULH 4IMKA 1AKJB 1XF3B 2PW1A 3ARBA 4HFUH 1ZGLA 2PXYB 1F3DJ 5ACZA 3MPCA 2YC1B 4ELKA 1JP5A 4R90H 1ZT7B 1QKZL 4TSAH 3O3EA 4WFHE 3BN9D 2OTUA 3L7EA 3WN5B 2GEEA 1F97A 1KB5A 1BP3B 3L95B 3SJVD 1S9WA 5IESL 1LE9B 4C58B 2H3NB 5ELIA 3ULVD 2P24A 5E08L 3VFOA 3TBYB 2DM4A 4KKLD 1OB1B 4HK0A 2EIDA 5I8CB 3U4AA 4PLKC 2X4QA 4LLQA 3HNTH 3ZE0E 4M5ZL 2B1AH 3QUKA 5E8EB 5C0JA 3I6KB 1A6TA 5EOCL 3N1MC 1K2DB 1U3HB 4PREA 3WHXB 3VXRB 1SY6A 1KXTB 3ULUC 2FJGB 2ZZUT 4J3UA 3WHE0 4LCCB 4HJ0C 3C60B 4DEPC 1I1YB 3REWB 1OQXA 3FQUA 3MLVL 2NY4B 1NANI 5A2FA 5K59F 4P23C 4UTBL 4DAGH 3OKNB 1SEBA 3QBTB 3ZTJH 4BFIB 5CCKL 5E56A 5J0BA 3VG0L 5KN5B 1FFRA 3E2HB 2BNRD 3RIAK 4EDWH 1WFUA 1NCCL 2EC8A 1KT2A 1FL5B 2F54D 4NSKA 2WBJD 3ZDXF 4HUKB 4LLUA 1YMHA 5L7XL 2L0DA 4ZNCD 3KDMA 1WV7T 4XPFL 2ZUSA 4LCWA 2Z31C 4MAUL 1TZGH 4QHUB 1D9KD 3FL7A 3KNBA 2E8ZA 4GS7C 4UT7L 1XIWC 4GO6B 1KJVB 1QNZH 5E4EC 1QSEE 4EQ3A 1JGDB 4NHCH 4Z7VE 2IQAA 2RR3A 4DVBA 3WCYA 3HG1A 1CGUA 3O3DA 5DD1H 3LEXA 4JG0L 3T0BA 5BW7A 4JM2C 3BP7B 4OZHB 2CLVB 4X99A 2Q7YA 2BVPB 1JWMB 2ADJB 2V2WB 4KMTH 4QXGH 3UROR 1NCAH 4JZJC 2IPUK 2BY2A 3RNQB 5EBWB 2CKBA 3IFOB 1LK3L 1LE5B 1AGDA 3QQNA 2V9TA 3BW9A 4RX4A 1H3TA 2UWEE 4MJ4A 3HC4H 4JKPH 2EZ0D 4PRBA 1TTFA 3DMMB 3VWKD 4YK4B 4I4WA 5E5RB 1KNOA 4QXUL 3LZFL 4NNYA 5I66A 5FO9B 3C6LC 4HKXA 3ZYJA 3IKCA 4M8QB 3VE0A 2DI9A 3STLB 2AI0L 3CX5J 2MKWA 5CBAB 3PWVA 4N9GB 4AEFA 5GGUA 3BEWA 3QHFH 4X7TA 5IB5A 3L3KA 3IFLL 4HIIB 3I50H 4LEXL 1BJ1H 1TVDA 4YHNB 4RA0C 4LOUC 3ULVE 4L8DA 2A6DA 4JFEB 4RA3A 1MI5A 3S97C 1C16A 5GZOD 4L8BA 2X4TB 2BMKA 2Y07H 4XAWH 4KROB 3V6FA 3IU4H 3GEWB 4WFHD 1D6VL 4WWID 5DVNA 4EIGB 4M7KL 3VFGH 3WEXA 2J8OA 3QUZD 2PXYD 3C9NB 4OQTA 1YEEH 5BRZD 1FDLL 3CDFA 5FKAB 3FZUC 2D03H 1YEDB 4TUJA 4TNWF 3IU4L 4YFEA 2ZUVA 4NZTH 4XVUC 4ZOAA 2D4FA 4QHLB 5E70A 4MAYB 4G6AD 2IBZY 3ES6B 5IJKC 1DFBL 2VLMD 2HN7B 3QNZB 1DQTA 4AM0A 3F62A 2H8PB 4PJXA 4APQA 3CNKA 1M7IA 3D87B 5IR1A 4OCSL 5KSUA 5K9OA 2DKMA 2NY3C 2NXZB 1V8HA 3KPRE 3U9PL 5I0ZA 3U0WH 2DOCA 3QFJB 5IB1A 4JFDA 5MP6H 4U1KB 4GRWF 1Y6KR 4FQ1H 1OAYH 5DJ6A 1U93A 2NR6C 3AXLB 2VLRD 3BP4A 4JQXA 3GHBL 3L5XL 1F13A 4OGYL 2AERT 5JHDE 3FT2B 3TO4A 4LSUH 3RUGB 1ORQA 3DRTB 3BP5A 1JNJA 4ODBD 3C8DA 2GK2A 4F15B 4JZOA 1XGQA 5IUSA 1T0MA 1H3UA 2RCSH 2V2XA 4O2EB 3R0MA 3TCXA 3DV6B 5T1KD 5EPMA 1KTLB 4YZFE 5D7LE 5HI4C 5DJ6B 4WY7H 4M00A 1INDL 3MC0A 4F9PC 1RZJC 1FGVL 2B1AL 3EW3B 1FIGH 3FQNB 3TBTB 4LPCA 4JO4L 4HJJH 4X7DC 1ITBB 4G43A 4IM8A 4PUBH 4S1RH 4RX4D 3MO1A 4OBSA 3I3DA 4F7CA 2MNUA 5DFVD 1YEHH 1NBYA 5MENA 4BA8A 3IYLW 4G8GA 1Z9MA 1UQSA 1TJGL 5F7WC 1DBJL 2Y7QA 5FK9A 5D7LD 1NMBL 2QSCH 4MMXC 3WJJC 1CGSH 4U7MA 3TNNB 5C0DA 5EIIA 1QFOA 1GGUA 4XP9H 1J5OL 3JUZA 1MFAH 4IOFD 5KVEL 3TWCL 5TH2A 1KN4L 4M43H 3BMWA 5HDLA 4JQVC 4OI9A 4PJEB 4OLWH 1SQ2N 4MZ2A 5BJTB 2FH8A 3RNQA 5BVJA 4TSBH 5GZND 1NGQL 3RKDD 5LGKA 3SKJL 4GXVH 3VWKB 4FNLL 3ARQA 5F70A 2ATKB 4Q6YA 3ELAT 3V5KB 5GXBB 2BHYA 4S2SA 5DF0A 2K1MA 3ETBF 3HR5B 4KDWA 3JVGC 1FVCB 1KLUB 4N8PA 3TCLB 4Z0XB 5E6ID 3I50L 3HE6D 5I17B 1JK8B 4HD9A 4IOIB 3HI1A 3P11L 3O4OC 1JGVH 1NLBH 1LO0H 1SJVA 2ZP0T 4L1HA 1NAKL 5I1EH 4KJYB 3B6SA 1ZOXA 4FQIH 4JB9H 1DBAH 5DTFB 2X4NB 1QRKA 2AI0H 3ZHDA 2DQTL 4YXHH 5LXGL 2EDFA 1IRAY 2HLFD 2XNAB 2A6KB 1FG2A 1JJUA 2VDLH 2DLFH 1PYWB 5BV7H 3SGJA 5EOTA 4PUBL 4S1RL 3VFTB 5JTWA 4LVOC 1T1ZA 1CXIA 2N1KA 5CGYD 4UDUB 3GSWB 5IMLB 2CGRL 4JKPL 3BGMB 5BRZB 2KQMA 3QJHB 1C5CL 1CCZA 3DI3B 2RCSL 4CVXB 2FATH 2VABA 3O3UN 4XBEL 3LQAL 2KPNA 3GHEH 3SDAA 2D31A 4PB9H 1XEDA 2XKSA 4CADB 5GRJH 4CGTA 4NZUH 3OKEA 1I8IB 1PEWA 4P57B 4QRQA 2YPLB 5SWZB 5E2UH 1IKFL 1P5UA 3CX5K 1QHOA 5IWLC 2ICWA 4U1NA 5DD1L 4PG2A 5J11C 5FM5M 4GXUN 4M02A 2X44D 3PGDA 1CLYL 4NUGL 2YOCA 3UZVB 1TVBA 3NFPB 5F9JB 1MCPL 1WUNT 3OR6A 1J1PL 2ARJQ 2AJXL 4ONGH 1XH3A 2VJXA 5H2BA 4KTEL 3L3JA 2ENSA 4J7RA 4E41E 3MV7A 4FZEH 5TE4H 2XRAH 4IIQA 5DT1H 4GAFB 4CKVX 4HKXB 3PHOB 1BD2A 1RZGB 1GHFH 1KTLA 3DGGA 4DGIH 3V0WL 3MYZA 5B3NA 3ZMRA 2FATL 4B7IA 1T03L 2CRIA 4N1HB 1WBYA 2YA1A 5FKPA 4NO3A 5FHAL 5JW3L 2ZJSL 4RBPH 1MAKA 3WUWG 5D6DC 3X14A 2JE8A 1U8HB 4N0UB 5JZ7C 4GT7A 5E1HB 1OGTB 5EIIB 3JTTA 4M5YL 2H32H 1XF2B 2Q86A 4LU5L 3O45A 1N3NA 1TMCB 5I1EL 4V2BA 3BP6B 1MJ8L 4XB7A 3AREC 4H88H 1JHTA 2YD1A 3QZWA 4PRDB 4AH2A 5IFHH 4JFPA 4M1CC 5F21B 4MD5A 1RPQA 4Z7OF 1NMCB 3MRPB 5IHUL 3C5ZC 3V52H 5E94B 4YNYB 3HG1D 3O6KL 1GGIL 4WDIB 5DK2A 4F15C 3WXVL 2R2BA 3BKCH 2ATPA 4JFDB 4KXZH 3HAEH 3HMWH 1HXMB 2DQDH 4FS0A 5TJWK 2AXGA 2AK4E 4YEFA 3I84A 1X5GA 2VLLA 2H2SC 4PGBB 3C6LA 3EJZC 4LK4A 4H8WC 4JHWL 2X70B 3EBAA 2VWEC 1IQWL 1MNUL 3IAQA 1I1AA 1MIML 4XAKD 1U58A 2BSTA 5I71B 3AB0C 4R4FH 2GI7A 5DMIH 5HGHA 1U8PB 3AGVA 2EE6A 3UJJL 1VKXA 2I07A 1NFIB 2NYYC 4LQFH 1IT9H 2DYPD 3BIBX 1KJVA 4HULB 4WV1B 3CFBA 4NN6B 1ETZA 4N0CC 4UUJB 4QLRA 5HHOD 2DKSA 3GMOB 3R1GH 1GGCH 3SKNA 5I15H 1FH5L 3IETB 3OR7B 4TOYH 4Y4FD 4N8VG 4R9HA 5BZWB 1X7QA 3AM8C 3PWUB 4I8DA 1NCBL 4P23A 5J57B 4CVXA 3I6KA 4GW4B 4R7DA 4MS8D 3IGAA 5HJ3B 4J12A 4PREB 3MA9L 2VLKE 4G7VH 1T2QH 2ZOLA 2B8OT 4I2XA 4DN4H 1QRNA 3KPSD 3QFJE 3KR3H 3EYSH 3N1PC 1MRCH 1RUQL 3QRGL 3KS0J 4JQVA 4EI6B 1HZHH 3EO0A 4EOWL 4NNPL 3G6JE 1AHWB 3IAPA 1KJMB 3GKWH 5FOJA 5I66B 4R7NB 2XTJC 3CFCL 5IHZB 2VXUL 1FZOA 4CN4A 3GGWB 2BERA 4LLDA 5HI4D 3RA7H 1JGEA 4HJGB 5E99L 4HF5H 4JFFB 4NBYB 2CUMA 4HUWB 2X7LA 4U1IA 1AD0B 2DTMH 2VO5A 3MRQB 3QPQD 4L3ED 4TSAL 4X80L 1JZ4A 4F80A 3GKWL 3B9KA 4GBXC 3JV5A 3QXAB 3RVTD 1RZGA 2HFGH 3LEXB 2IH3B 4P2OD 3T08A 4PJ8A 3LKOA 5HYFA 3W5NA 5ICZB 5CSGA 4R2GD 5DK0A 4HWEL 1I9JH 4LCIL 1E4XL 4JG1L 2AK4D 5C0EA 2A74A 2OR9H 2EDQA 4NRYA 1IGFH 3EJYC 3QXAA 5H8DA 5B38G 4KZDL 3WDIA 2R1YA 4UT9H 5EUOA 3PHQB 3QUMA 1UEMA 1I9RH 3CSGA 2K9UA 1A6AB 4Y1AB 1MEXH 4OLUL 1DLFH 3H9ZA 2AS5M 1K6QH 5MERA 1IGTB 4M03A 3BQUB 5K9QI 5ICZA 1MFBL 4ODUA 2BOBA 4PJCB 4NBXB 5KANI 1MFNA 4QHUA 1WVZA 2FWOB 9CGTA 1WBXA 4U2ZA 5ESVA 4K7PX 1BPVA 2QADC 3A67H 3UPRB 4NO0D 4L3CB 4Y4KD 1AGCB 1KFAH 2XFXA 4K3EH 2R1YB 5CIPB 3TBSB 4YH6A 2YC1A 12E8H 4R97B 1BQHG 3UYRL 4CW1A 3WDHA 2D7TL 2HWZL 2DLHA 5I8KH 4AZ8A 3HC4L 3BKCL 4PGCA 2XOTA 1QA9B 1S7QA 4K3JH 4YHKH 4AEIH 2Z8WC 1BFOB 5B21A 4DUWA 2PW2B 1PY9A 2BVPA 2V17H 2VLJE 3TVMD 4LEOB 1JPFA 5FGRA 3EYOA 1T21B 1F2QA 2VKXA 2PN5A 5EB9A 3VW3H 4JFYB 3REVA 4YFLI 5DJYA 1ZS8B 3QDMA 1AGCA 2XFXB 4HUUA 4OCWL 4RISH 4WW1B 3L3OB 3MXVL 2BVQB 4PRBB 2K3TA 3GMPA 4Z77A 4PJAF 1CGWA 1A0QL 4GAJL 4Z7WB 5I1IH 3VXNA 4XCCH 4NWUL 3BDBA 4X6DE 4R4ND 1Q94A 4PJIA 1FNAA 1YECH 4LMQE 4ODVL 4MJ5B 3CFBB 5CLWA 3SQOH 5DD3H 3F6LA 3HZVA 4OGXH 3SKNB 2EXWC 3HPLB 3NIFE 3VD4A 1OARH 1A5FH 3H3PH 5BZWA 5I71C 5DQ9A 3U46A 4AQ1B 4NN7B 3RIFK 1C08A 3X11B 3SJVB 3LHPH 5DEZA 5I6XC 1OW0A 3LPFA 5B38B 3UEZA 2OTWA 2RFXA 2YPVL 3QIBB 5IHBA 2R2HB 4LSSL 4WNQB 1DJSA 4OJFH 5D71L 4DJMA 1NLDL 1QRNB 3ARGA 3QXVA 3CFJA 1UA6L 4XNQB 1UCBL 5AUMA 2OMNA 1NGZA 2FEDC 2PO6A 4PRNA 2XKUA 1BVLA 3ZKXC 3U36A 2ESVB 3NPSB 4XP4H 3WKML 4MD5B 4LCUB 4QRUB 2ADFL 3GJFH 4YHOH 1W0WA 5HHPA 5I18L 1GXEA 2Y06L 4GAGH 3IDNB 4LDEB 1F90L 1HYSC 1I8LC 1AE6L 2BNRE 5JW4N 3RGVB 1D5BA 3O3EB 2GJJA 1KJ2A 3W9EB 2WUCH 2R8SH 2OTUB 3L7EB 4OZFA 1CFTB 4ODTH 2PO6B 2QKIA 2C3XA 5C0DB 3BWUC 1UWXK 4KV5E 4HQQL 2NY7H 1PD6A 1I85A 2F53B 5CD3A 1FC2D 1L7IH 3OXRB 4LLQB 4LHUG 5KZCB 4EUPA 4TVSa 3LKOB 1DVFB 1OTUC 2IALA 1SJXA 1G7HB 5T3XL 5IQ7L 5HVWA 1YJDL 4XZUA 1KN2L 1V7NL 4JZNA 3FQWA 2CIIA 2JB5L 1OPGL 3CDCA 4I13B 2OP4L 4OLZH 1U9KA 2OXHA 2R23B 3BE1L 5L0QB 1MUJB 2ICWJ 3AS1A 1Z5LB 2BVOB 3O0RH 3BQUD 3FB5B 1OLLA 3ZE1E 3V6OE 5AYUL 2IPTH 1KEMH 3K3QA 1QEWB 1RVFL 3RTQC 2BOBB 4OF0A 3R1GL 1CDCA 3E8UL 5GGRY 2HMID 1LEKB 4U6HB 3ARWA 4HHAA 3UZEA 3VJ6B 1FL5A 2YMXH 3X3GH 5C0CB 3BH8B 4Y5YB 5C7XL 2WV3A 4P4KC 3MXWH 1N4XL 1EEUA 1TPXC 5EIQA 4LL9A 1FFQA 3WKMH 2A1WL 2FR4B 5F6IC 4Z7UF 3VXRE 5E9DE 1O0VA 3HC0A 4IBLT 3TT3H 2WWMD 5D96B 4Y4HD 2X1WL 5F44A 1Z6JT 2AJVL 4ZUVA 4Y2DC 3V4PL 4QCIA 2MCG1 1RHHA 1UH3A 3E2HC 4L3EA 2EKJA 5FGBC 1ND0A 3R0NA 5FYLL 1JUFB 3P9MB 4IRJB 5INDA 1WJ3A 3S4SA 3L3KB 3QEGL 4UAOC 2J8UB 3HS0A 1AC0A 1Q0YL 4KROD 3OKEB 4R97C 4EBQL 3RWDB 4QNPE 4XGZA 1JPGA 5B8CA 3P4LA 3BUYB 4K2UL 1U92A 5ABDE 4K94H 5IGXL 3QULA 4GRLC 1KELH 3W39A 1QUNA 2YZ1A 4E42A 4FQ2H 1ZT1A 4HT1L 2B4CC 5FB8A 5EZJB 3DROA 5CILL 2R1XB 4M1GH 3MGOB 1QSEA 3PL6A 3BQUC 3B6SB 3RI5K 4IOFC 4NYLA 4XCCL 5JOPE 1U8LB 5JA9A 1JPST 4OCRH 4NQEB 4MX7A 4PRDA 3CFKB 3QIBD 4AH2B 2FBJL 1JNHB 3B2VL 3QQ3B 4CU8A 3WJLC 1G7PA 3QDGA 1CLOL 3LB6D 1MCOH 3G6JB 4G3YH 2VL5B 3BOVA 5J1AB 2W0KA 5E94A 4XCNA 2W65A 3AS0A 4WY7L 3BPLC 5IROC 3C5ZD 1EO8H 1M6OB 3VXPA 3FB6A 1G7MA 3ZL4H 3MGOA 5KVDL 4H1LH 4HEME 4KQ3H 3S34H 3ZKMD 4DGVH 4UIKH 1XCQA 3ARBD 4JPWH 4C4KO 1XR9B 1HEZB 5E5MA 3KS0H 2D7TH 1PKQE 4WO4C 4KVCH 4KFZC 4IOSD 2GUOA 4JFXB 1KACB 3RAJH 4I18B 5D71H 4HSQA 5K9JL 3ULUH 4C56E 3IDNA 2X42A 3PABA 4JDVB 3RGVD 5ENWB 5MI0C 3MV8D 2WWKT 3VFRB 3KYKL 4ZUSA 5DURB 1QLEL 1G7MB 3PL6C 1U8PA 3DO7A 4RMVA 1WIPA 4ODHL 1H8OA 3HMXL 3IJYB 4PTUA 4ISVB 5C70A 1Q0XH 4LF3A 2R2EB 4KK8C 4Z7WF 3HLAA 4U1JA 2QQKL 3MBEA 5D4QA 5T5FH 1PSKL 1YECL 4YHYC 3QCTH 3SCMA 4P23B 5DUBA 4N0RA 3QIWB 3L3HB 4YXKL 4Y4KA 3VMOA 4C54A 1JHLL 4FZ8H 3BAEL 2IEPA 4ZS7H 3VD3A 4G6JH 1TQBC 4JGJA 5C08A 5DZOA 5C0GA 1I1FA 2PYEA 4TUOA 1X5HA 4JQIL 3OKOB 4Y7MA 1GSMA 4WJ5A 3V6ZB 3DETD 4BQ9A 6FABH 3O4LE 2VQTA 4MNHB 1TQCB 3ZSTA 5EO1A 4CAGA 1CBVH 3TBWB 2NY1B 1KTDA 3QUMH 4KTYA 1T5WB 3S35H 4A6YL 7CGTA 4ORGB 1A6UH 2V9RA 3MRGA 2BXZA 4MJ6B 5C07E 3UYRH 4HHAB 1GIGH 3F7VB 2R15A 1P69B 5JW5B 5I9QC 3QJHA 3ARRA 2JJTC 1U3YA 2P8PB 4WGVB 3OPZH 4PLNC 3QPXL 4WJ5B 3AMLA 1HI6B 5JHDB 5KTEH 4K3DL 1DN0A 4Y4HB 5SV3A 1J0ZA 4JEGB 5DS8A 1JGVL 3O9WB 5CS7A 3U4BL 3ULVL 4QGTA 4EQ2A 5F7MC 1FAIL 4NKMB 1QSED 3PL6D 5TPWL 4U1KA 4Z0BL 2V5SA 4F33B 1T0NA 2BSSA 1E6JL 3GJFA 4EZMA 4MJ6A 3H42L 4K8RC 2EE9A 1UB6B 4UT9L 3EYSL 4FABH 1X3DA 3GNML 3HI1B 3E6FA 4G42B 4HAGA 2IC2A 4BK4A 2YD8A 3TYFB 4LNVA 2XY2A 3GSNH 4O9HL 1HN1A 1HWHB 1XGQB 4NGHL 4OZGA 5GJSH 1LILA 4KRMB 4LPWA 4OLEA 3N0PB 1OAXH 3FKUS 2DQUH 3MODL 3VRLE 5L8JB 1RIVH 4D8PB 4JO3H 4OLWL 1UFUA 2D7MA 2NY3D 1EHLL 4IDJH 3BEVA 2V5RA 4KTEH 1EERB 1Y18A 1IFHL 4JN2A 2R1XA 1G7QB 4ONGL 3F7YB 3QDMD 3R06A 3FB8A 1GZPB 5KZCD 1QBML 2Q3ZA 4U1HA 5AD0B 4PRHD 5I1JL 4NUGH 4ZAKC 2OM5A 4PJHE 4RGOH 5CEYB 3STZB 4JFZL 2NW2A 4XPHH 4IDJL 4XCYB 3G08B 3TIEB 3HZMB 2HJFB 3N1FC 4M6NH 3ALXA 5F89B 3UBXA 3NFNA 1EMTL 4G8IB 3GSNB 5MI0B 3VGHA 4MDJB 7FABL 3PGDB 2Q8AH 4J3WA 4NZUL 1A14L 1IARB 3B2UD 5FO9A 2Z93B 1UKSA 5FGBA 1INDH 5KSBB 5HY9B 1IILE 1KF9B 1ZLWK 1IZJA 3W82A 4NJAH 2ZOLB 1R3JB 3ECBB 3NABH 4LHQB 4ELME 5IM7A 3MLWL 5JXAH 3KLDA 1XMWA 4Y19D 3SGDH 3ULUE 3H42H 5DQJA 1N64H 2ILLA 1CZ8L 1OTUD 3DXAB 7FABH 3PGCA 1YNLL 4U4BA 4WI7A 1CG9B 3HE7D 4UV7L 3DO7B 4Z18A 1QPPA 3T0EB 5I1LB 3BXNB 3BGFC 4HS8L 2VXQH 2NW3B 1Y6NR 3KAAA 2O61A 2VAAA 1NAKH 4OZHA 5JNYB 1ZWIA 5GGTA 2I60L 5IBLC 4PJBF 4PJ8D 2X9YA 2YD9A 3H7BA 3QIWA 1CBVL 1W72A 2MTPA 3T1FA 5HYSB 4GRLB 4DKFH 4D9LL 3MRNB 4Q9QH 5FGSA 4WTXA 5A2LH 1J1OL 3VXUA 1FFPA 1X5ZA 1AI1L 4OLXH 4YHIB 3MRRA 4JQIH 3OL2A 4WI8A 3Q1SL 4L4VD 4YBLC 1P1ZB 4FP8L 1DQJB 4FNLH 1DL7H 1F4WH 1AHWC 1GHFL 4H1LA 1FDLH 2Z35A 3O45B 3VMNA 4R8WL 1X4YA 5SWSA 4HWBA 5C08E 3IDYC 4IRJC 2HFFB 2H1PL 4EDXA 2C1PA 2F5BH 2XZZA 3NACH 4WEUD 1ADQA 4RMWA 3V52L 2XZAL 4HFWB 4NO3B 2PXYA 2QHLA 5ACZB 3LN9A 5KVEH 1UZ6E 4LCYB 1U6AL 2ZKHH 4PR5B 3FRPA 4DN3H 4J1UB 3ULVH 4F58H 1WAAA 5E2WH 2A38A 1CVSC 1N2RB 2CXKA 1EXUA 5D1ZA 1G9NL 1NJ9A 1FE8L 3V4VL 5DEFA 5H94B 4JRXA 2BNUB 1AXIB 3OXSB 5HVGB 1VEPA 3D0VB 4JFEE 2YXFA 3B5GA 5DUPL 5AAMA 3LPWA 1OD7A 1X5FA 2X4QB 4K55A 5CEXA 1MJUH 1U8OA 3BISA 4HC1H 3LQAH 5HHOB 4PFEA 1JRHI 3GGWA 1TDQA 4WNQA 2DLEA 4HBCL 3GO1L 5D7KD 4MD0B 4KK6C 5CFHA 3MTRA 3EUUA 4QXGL 4Z9KB 2CGRH 3IRZA 4P4RB 3DX7A 1DBKH 3CK0L 2DQGH 3H0TB 4G5ZH 3AU1A 1WEJL 3QG6B 2FYYA 1FJ1A 3B9KB 3Q6FB 5GSVB 3TYGH 1RZ7L 3T4YA 4OCRL 4YLQT 4YXKH 1OAYL 4P46B 3GDBA 2J88L 4WGWB 2O5ZL 5FA4B 3I6LE 4FQIL 2APXA 4JB9L 1U8IB 2C7UA 3KPRB 1HSBB 1FP5A 1EFXD 5E2WL 5D9SB 4KUCF 5LG1A 2PO6C 3RKPA 1MREL 4XPAH 4XPFH 2QQNL 5BV7B 3QEUA 2AXHA 4AIXA 1EHNA 3LMJL 1DFBH 3DV4A 1LD9B 1CLYH 1V7MH 1ETZB 5FM5O 1MFCH 4ACPA 3SBWA 1FZJA 5IHZA 3P77A 5AZ2L 1NCWL 1A6WH 5EO0B 4LAQL 4HGWB 1G6RB 5C6WH 5KS9B 1CICC 3D3VE 4L3EB 4LP5A 1A9EB 2Y5TA 1X5LA 1IEHA 3MNZA 1JUFA 4G80B 5DC0A 4JVWA 4GW4A 5K9QG 3BPNC 4WU7B 5IK3B 3DVGB 4ODXB 3QO0B 3TT1L 3PDOA 4ALAH 1A1MA 2I5YL 2X1XR 5HGAA 2HT2C 1EO7A 3BH9B 4HMCA 1X5AA 1ZTXL 4WV1C 2VQ1A 1Z5LA 2BVOA 4WHYG 3LV3B 3NOIA 3B5HA 5J12C 2B5IC 4KK6D 3LQMA 3P4MA 2I60H 3MNZB 4ZSOE 2AKRB 1MFDL 2VZUA 5EOQH 4ZD3L 5I1CH 3IDUA 4PJBE 2IPKA 1OTSC 5DHXB 3T8XA 4O58L 3FOMB 3L6FA 1WZLA 2PUQT 1FV1B 4XPBL 1TLKA 1VDGA 1ZLVH 1J87A 3VFMA 1CZ8H 2HVJB 4FQ2L 4P3DA 2EDRA 4YFDB 3QUMB 4Z77B 1NDMB 4G9DA 5DDHB 2A6IB 4O00A 1UADC 5T3ZD 3KPLB 2A6DB 4PRIE 3WFHB 4P4KA 4D94A 3GK8L 1E4JA 3ARDB 3EJZD 5BS0A 3MZTA 4KRPC 2YSSA 3MBXH 4RGMB 3WBDA 1ITCA 5DEGB 3QHTC 2GJ6D 1R5IA 5DMGC 4ZFOA 5JUEL 3FO0L 1NCWH 4H25B 2ENYA 2A0LD 2FJFA 5DD5L 3AROA 4NZRH 1B90A 3NFNB 4PR5A 4Q97A 4B7LA 5F88A 2UZYB 3QEQA 1D5IL 4NHUA 4XT1C 4MXWL 5DWUH 2EIBA 3BUTA 4J23A 4MDIB 5CJXC 1KPVA 2JB6A 2V7NB 5DA4A 2UY7A 1YEGL 4OD1H 5GGSA 1UT9A 3C8KB 4XRCA 3VFNB 3GSUA 3O4OB 3C5SB 2BP3A 4YDJB 5SWZA 4Y19B 1WCBA 5HHNB 1UXSB 3DVIA 4NKQB 1CFNA 4P3CL 3ZDYF 4D0DA 3H9HA 1E27B 1FIGL 4I0PD 3UTTA 1EGJA 3MLVH 2CQVA 5EZIL 3P4NB 1HNFA 2VLKB 1G9EA 4MXQD 4LSSH 3TM6A 5JNYA 2BC4B 3B9VA 4N0YL 3RDTC 2GTZA 3CVHA 3I85A 3LIZH 4I0KA 5I1DB 5F1IB 5EO1B 4FABL 5INCA 3KYMA 5IVZA 3RKDC 4RMTA 4Z0BH 3EFDL 4B5EA 8CGTA 3N1GC 1XIWA 1KEGL 3EFFA 3VXUB 5LQBL 5SX5H 1QO3B 2RGSA 5ADOL 4Y16B 3M17A 1RHFA 3WS6A 3NGBC 1MH5A 3L3JB 2FO4B 3T09A 1FG9C 4UMGA 4HQQH 1Q94B 4PJIB 2BOCA 2H9GA 2GTZB 1UM6L 4F7TB 3SDXA 3KYMB 4PJFB 2V2TA 1UH2A 1PW3A 3VFOB 3WIFB 4F57L 3T2QA 1DE4A 4KRLB 3W0WB 1HH6A 4HUMB 4ZO7A 4HC1A 4U6YA 4J2XA 3VWJA 4KXZI 2MHAB 3V9FA 4J3VA 4AEIL 1QFWL 1H3PL 1AQDB 4XP6H 5TDNB 1U8HA 1N2RA 4JO1L 4N0UA 5JR1H 1NFDF 1XZ0B 1OD9A 5DJZB 4XMLL 4JFFA 4M7KH 3VFGL 4IRSB 1ZA6A 4U7SA 3QDAA 5DJAA 1N3NB 3D39B 4HLZH 4M6OH 3RWEB 4LKXB 4P5TA 5HYJE 4X6DA 3F8UB 3DYMA 3IJHB 5FGCB 3A67L 4DUVA 1D5ZB 3GIVB 2E6PA 1JI1A 4AIZB 5FECA 3GMLB 1W8OA 4LSTH 4JPVL 2FSEA 1JK8A 4IOIA 4JZNB 3C6LD 3HMXH 3LKSB 3T0EC 1I9IL 5F7DB 4OCXL 2HKHL 4ISVA 4I2XB 3FN0H 4YDVB 3LB6C 3DX7B 4L8SA 3TIEA 2LU7A 4LHUD 5EO9B 1IGFL 1UM4L 4F8QA 5T1DH 1YMME 3WSQL 4MA8H 2K7PA 2P5EB 1I3GL 3BHBA 4OB5H 3CVHL 1QHPA 5EU6B 4DAGL 5GHWL 2CDEA 2VMFA 1CDHA 1AGBB 2Z8RA 2GFBA 4HKJB 4R0LA 2FLRT 5D7SL 4DGVL 1ZLSL 1CWVA 2FX8L 4WFEE 2CLZA 2X4SB 3P0GB 4ODWA 4P46D 3RHWF 4NFCA 1I8KB 1HHJA 1CE6B 1KJ3H 4GMTH 3KPRD 1I7UB 1Q9WB 3FJTA 3CCHB 3MRJB 4WHTB 3IDMA 5ETUB 4QRQB 3DXAA 5KVFH 5T1LB 2E8YA 5E8DL 4ZUVB 3WE6B 4RWYL 2XG5A 4FFWC 1RHHB 3OGCB 4JFOA 1RIUL 4WI3A 4AT6A 1ZLUH 4L4TB 4JGUA 1N6QL 3IGAB 5HJ3A 4WU7A 1A7PH 1FBIL 1RUKL 5BRZE 5HYSA 2R2CA 1MFBH 1H3XA 3TZVD 5T33L 1M05B 4KZEH 2V7HA 4N9GA 3L3OA 5T1LA 3NPSC 1VEOA 1OSZB 3TH3T 2HJFA 2O5XL 2R4RH 1CFSA 3BESR 4HMDA 1BF8A 2X9WA 1Q1JL 2W38A 4MQXC 3QDHA 4HJ0D 4N0YH 4Q6IB 2EDYA 3SGDI 2BNQD 3U6RA 5E8OA 1SYSB 3MA9H 3MLYL 4NGHH 4NQCE 3D69A 4M1DH 1VGEH 1BVKA 2A6JB 4PYGA 2JJUA 1ND0B 4X9GA 5JQ6L 2LQRA 3TJHD 4U49A 3V6OA 1NC2D 4L3CA 1P2CA 3O3BB 2GYSA 4YPGB 3BZDA 2MOVA 1A3LL 3FAXA 1DEEB 4PY8I 4AEHL 3VXPB 4CVUA 5C9JB 1YY9D 4KK9D 1C12A 4PGCB 1NFDB 4KV5F 3DI2B 1BFOA 3R06B 5GGRA 3MYJA 2XIDA 3TN0B 4WTZG 5E4EB 3UTQA 2VZSA 4P2RE 1DQQA 1D5IH 4JHWH 2B2XH 3QDGE 5IR1B 2IQ9H 3MLZL 2CKNA 3EOBB 4L4VE 2WBJB 2NY0C 1ED3B 4I9WE 4KY1H 5IB1B 2Z9TA 5HHXL 1DQLL 4Z8FH 1G6RL 4ERSH 4ZO9A 3QUML 3IDGA 4KI1A 1B0WA 5FGCE 5J1AA 5GS0D 5DJZA 5FCSH 3IJYA 4OLYL 4PTUB 2X4RA 3EYFA 1RZJL 1J0IA 1CLZL 4LLWB 2LE9A 1AR2A 3MLXH 2YKLH 3IDXL 1IC5H 2VDML 1KIRA 3M45A 2JELH 3FB7B 3I02B 3DTXA 3SKUD 2WBJA 1A4KA 1ZXQA 5B39B 1YEDA 4OQTH 4YR6A 2V6HA 3SCMB 1R5WB 4Y1AE 1G6RH 3MMEB 3GJFB 5GISL 5KSAB 1T3FB 2B39A 5D7JD 2DYPB 4J4PC 3GSVA 3QYCA 4RIRA 5D2LB 2VLJD 3SN6N 5FB8B 2IMMA 4DOHE 1UACH 3C87A 3DTXB 1DLHA 1U8MA 1IC7L 3WO4C 1J0YA 3PDGA 2D7NA 1WZ1H 2FHCA 4UQ3A 4X0KB 5C6TH 2WP3O 1VFUA 4MA1C 4LCUA 4QRUA 3QJFA 2ZUTA 4XPGH 1CT8A 3S3SA 5MHSD 3LS5L 3FFCD 4JANA 4XCFH 4B0MM 2X89D 4OZFG 4X4YB 2SEBA 2CDGB 3WV0A 1MHHB 4LCWB 4M4PA 2BOCB 2AP2A 3MLYH 4XC3L 4J3SA 4JPWL 1B6DA 3IJSA 2EIZB 2J6EL 2AK1L 3JWDH 2WIIA 1A6VH 3ZL4L 5J6HB 4ZG1A 3VXME 5TDOA 2CR3A 4HIEB 4O02H 3S37H 3JV0A 1IQDA 1T7VA 2EEDA 4O5LL 2XWTB 1HXYA 3QUZB 1C08B 1LO5A 2FGWH 3HR5A 1GGBH 3CXDH 3VA6A 1EIBA 4K8RL 2MHAA 1YJDC 1TETH 1B2WH 3DVNB 3F7VA 5HDOA 4FTVE 1P7HL 2QR0B 1M05A 4Z6AT 4R4BA 4U3XA 1YY8B 5DHVH 4P2OB 1TETL 1TIUA 5EZLA 3QNYB 4HK0B 1T1WB 4YHZH 5IB4B 5LQBH 2Z0BA 3GBMH 2PTTB 3A6OA 3OAUH 5D2LE 3HI6L 2ED9A 3STLA 4GKZA 1W0WB 3QUYA 1NC2B 5I19H 1NCUA 2FO1A 1MCSA 3CD4A 1JGUL 4YHKL 5D7SH 4MD0A 2R1WA 5JORB 4F37K 4KRPD 2BXYA 2X6MA 1XGRB 4UV4L 2P45B 5LCVH 5EC2A 3GRWA 2GSGB 5D1ZD 5EO9A 2FHBA 3MNVB 3PGFH 4UINL 4D9RE 1K8DA 2FIRT 5IMOA 1G7IB 1SBSH 3V8CA 3E1F1 5DUPH 3QDGB 4ZQKA 1ZHBA 3RWGA 1B4JH 2YRPA 5IB3A 5LXGH 2F53A 5CD3B 2CDEB 4LCWE 1T89A 4AMKL 2I9LA 1JIBA 3NCBB 4GUPA 1LO0L 1IMHC 2HVKA 4OAWA 3FQXB 4DZBB 5HPMB 4HXBL 3AB0B 4GSDL 3I75B 4PJCA 4KPHH 2PXYC 4YAQB 1MFEH 5JMOC 1JMZA 4FMFA 3O6LH 1H15A 3GZKA 3NA9H 5JA8B 4JQXC 3K4AA 5HYSG 2R4SH 1CFNB 1BHGA 1K3IA 2C4XA 1FZKB 2ZCLL 3BIKA 3BE1H 5EU7E 4W4OA 4NP4L 3LY6A 3BPNB 4HDIA 4OKDA 4UIMA 4OZGE 5GRVL 3CC5B 3MRMB 4DZBA 5HPMA 3MUJA 4W6XB 5KOVC 1XGPA 3SCMD 3MBXL 1YEFL 4MXQC 1T5XB 4YEEA 4P2QD 4U1GB 3CDGA 5DGQA 2E27L 4J4PA 4DQOL 3EHBD 4OV5B 3QI9C 5KW9L 3F58L 4OZGB 4EI5B 3DVFA 1CGXA 4JFHD 1JNHA 1GOGA 1R5IB 5FO7B 4FQHB 4WEMB 4I77L 3BYYA 4P5KA 3SO3C 2VLJB 2B0SH 1RJLA 1MF2L 2F19H 5TF1H 3PWPD 3EIFA 1MH5B 3KJ6H 5ANMA 4DK3A 1H0DB 1HOCA 2NZ9C 3T0AA 2AKRA 4JAMB 1SYVA 4L8SC 3FQTB 4DUXA 2ZWLT 3WFEL 5KAQG 1LWRA 5E8PA 1U8JA 4X9FA 2YD6A 4IHOB 4F7EA 2FLBT 5GS0H 1UZ8B 3H9SD 5IG7A 2AXFA 1AGEA 4JRYB 5H2BB 3DUUB 3V7AG 4NNPH 2BSRB 1A64A 2HFEA 2VN4A 3I3EA 1A3LH 1ZV5A 1GGYA 1KCRH 3MRGB 5JOEA 1WCBB 1QYGH 4G9FE 4XC1L 2UZXB 1Q9KA 4PV8A 3VG9B 2FZ3A 2PNDA 1ES0A 1AR1C 4Z7WE 4JFQB 1M7DB 1CLCA 2LABA 3I3BA 4H1LB 2B1HL 3KYAA 2AJZA 1UC6A 3PDDA 3CVHB 1H9VA 4ZFZA 3MUHL 5I8EB 5IHLB 2QSQA 1P7QA 5JDSA 4LRIC 5D2NA 4Z7UE 1Q1JH 3U36B 3CPLA 5FCUL 1GC1L 4PJXE 3WHXA 1Z0NA 4PGBA 1RZKH 2HJKB 3MRIA 1FNLA 5SWZD 4H5SA 4MB3A 1MCEA 1BQUA 1BFVL 2F58H 5L2JA 5TE7H 1DDHB 4JDZB 2H9GB 1IKNC 3QAZB 4MQ7B 4G6KL 2FYYB 3CLFH 1RUMH 2D7QA 3UTSA 4X6FB 5FCUH 2W0LA 4WEBL 1INQA 3MODH 4ZUUB 3PV6A 5FA4A 3MRPA 3L5JA 5TQ2L 3X3FH 2ADGA 3B43A 4JN2B 1YEKL 4U6YB 1CL7L 4UU9A 5KSAD 1N0XH 3EYUL 1LDSA 5D2LA 1IM9A 1F02I 1N5AA 5KG9B 1RI8A 2E7LA 1KBGL 5I73B 5CZVH 3KNBB 2V17L 1FN4B 3GMQA 4QTIH 1FV1A 2A0LC 1NBVL 4NRZA 3VFMB 4KMLB 1S7WA 2HAZA 4NRXB 5IP4A 4X6DB 4H26A 5C0FA 5DDHA 2JCCB 2EYTB 1WAAE 5DUML 2XZCL 5ESAA 3U82B 4WI6A 1QSFA 5FYKL 1Q72H 3B3IA 3VFWA 4Y16C 4TVPE 2V2WA 4K23H 1S7RA 2JCCE 3DSFL 3FN0L 3BMVA 4KKBC 4QOKB 1I75A 3FFCB 4I0PA 3L9RB 4PGDA 3T3PE 1GIGL 2P5WE 4LCCA 4PJCE 3T4AB 4Y8AA 3NTCL 1CGTA 3DMMA 1IZKA 2KL6A 4RDQF 4IRJD 3BEVB 4GG8B 5I8OH 2ITDB 4ONFH 3DNKA 4BZ1H 5EUOF 3JV4B 3VWKC 1OT2A 1F4YH 1LNUB 3EYUH 4UZGA 2IAMD 4CN6A 3H3BC 1AQDA 5TDNA 1SY6H 4PRPE 3KJ4B 4KGJA 1NC4D 3WFZA 2JIXA 3WUWA 1OB1A 4PJ9B 1J0KA 2A6IA 4ONFL 1JGDA 4D9LH 3M8OH 43C9B 4NQED 4AQOA 4BJLA 1P6AB 4L3AA 3RPIA 1U8JB 1FVEA 3P9LB 4N8CH 1M71A 4LLDB 5FUCC 3V95A 2AJ3B 3PIQA 4RMUA 5I76A 1LEIB 1IGTA 4CVZB 1HH9A 5ICXA 1QBLL 4HIHA 5EU3B 2JJVA 4PJIF 2HTLC 5ESVB 2XZCH 3BZFA 4KRPB 3K7UA 4EVNB 2UV3A 1XGTA 1FHGA 5I1LA 3T0EA 4RMQA 3RPIB 2NY6B 1I9EA 3P77B 4CW1B 2NQCA 2NX5D 4LGSB 4NO5B 3DX6A 3QDGD 4PJXB 1T0PB 3K8KA 1QLRA 5FUOH 1VHPA 1U8QB 4XXDB 5CZVL 1K85A 3OAUL 1B0RB 2IG2H 2BNUA 3NPZB 3P73B 5C0BA 3QNXA 5T3ZH 5FDWA 3CCHA 1A9BB 4W70A 3D5OF 5E9DB 2ZCHH 3BEWB 4X7TB 2IAMC 3QEQE 5CMAB 2XQYG 1FH5H 2MFNA 5ENWA 2OMBA 5I15L 1ZHNA 4Z7UA 3CFDB 5EFIB 3TFKD 3ULSA 1BIIB 2DQTH 3GMMA 5E6ZA 4YXHL 4BQ6A 4G8IA 2X2YA 5MERB 1JNLH 3FRUB 2XPGA 3QCUL 4PJHB 1JFQL 4ZFOL 1XGPB 1OCWH 3IT8D 1J1XH 3SE9L 4Z5RB 4HBQA 4NHUB 1QBMH 2VITA 4TULH 1S7SB 5I9QB 3WXWH 3X12B 5I1AA 1TVBB 3NFPA 3WUZA 5FDWB 3LKNA 3UTQB 4K2UH 3QQ4A 2P48B 3RVTC 4Q9BA 2WMPA 1KB9J 3IJHA 5TQ0H 2VIRB 3MV11 4P3DB 3BZEA 5FYKD 1BIIA 1OP3H 1N5AB 3SJVA 1YEFH 4G8GB 3NZ8A 3VG0H 1AGFA 5FA3A 2JJTA 5EIVA 4KJPD 4UBDC 4R96B 3MQIA 4HPYL 5JPNA 3H9SE 4D2NA 2LVEA 1UXWB 2RHEA 2CR6A 1ZWIB 1KV3A 1TCRB 1WBYB 3OR7A 4BELD 2P7TB 3QUZA 4FXGB 2YK1H 1XAUA 4H25A 5D7KE 3SGKA 3E0GA 3MRBB 3S7GA 1WSST 3DRQB 3RUGA 4YHPB 4H88L 1JFQH 2QR0A 1QSFE 1KG0A 4K94C 1E4WH 5EBGA 1B4RA 2X1QA 1GH7A 3PJSB 3QPXH 4OI8A 4JFED 4X7SL 3FT3A 4P2QE 3AS2A 5C8JB 1MFDH 4ZFZB 3IDIB 5J3HC 4HJJL 2DM2A 2XWJA 5DHYB 4TTGA 1JF5A 2XY1A 4KGLA 4Z0XA 5J8OA 3GBNL 4L5FH 4AIZA 5FECB 4R90L 2HP4A 3BT2H 4EN3A 1CT8B 1A2YA 1OVZA 3GJEB 2JB5H 2HN7A 4MXVF 2E7LC 3ARPA 5DXWA 4M8VA 1MHCA 4ALAL 2YKLL 4PJGA 2IPKB 3EO1B 4P9MH 3RWFB 4DGIL 3QEQD 5FK9B 4X4ZA 2P44B 3NCJL 1YNKH 4FFVD 5CJQL 1TZIB 1L6XA 4F3FA 1SVCP 5IWLA 4M61A 4JRXB 5F1IA 1PDKA 1WZMA 3GHBH 3OZ9L 3VG9C 1A6WL 2W59A 1F4AA 2NX5A 3LOWA 4S1SH 4WHYH 2NXZD 1JYWA 5HYJD 3GJEA 2G5BA 3PP3H 3H3KA 3DIFA 4QOKE 4Y16A 2Y4SA 3ZZ1A 3G5XB 4OZFB 2HJLA 4LPVA 4M7LT 4TULL 1YPZA 1ADQH 2F5AL 3PWVB 4XMPH 1MWAA 5IW1B 1RZKC 3N50A 1YMMA 2BDNL 3F12A 5AZEL 2XICA 3QUXB 4JZJA 5CKAA 4AMKH 2APBA 4HUXB 4L8SB 5IVOA 2PR4L 1W72H 1AO7B 1L0YA 1CF8H 4PG9B 2DQUL 2LU4A 3TPUA 1H3GA 2DQCL 2P42B 3GSNA 3T2NL 1QFPA 4Y4FA 4ODSL 2EDJA 5I17A 3GHEL 4UV4H 2IANB 2CIIB 4O51A 3HE7B 4WFFE 3PHSA 4YQXH 4ZNEE 3G5VA 1UWGH 1AGDB 4NQDD 1YYML 3C5JA 5EU7C 3CFEA 4QHMA 4U1GC 2LV4A 2BNQB 2KBGA 4YHLH 4L9LB 4FTVD 3D0LA 3CFDA 5C0BE 5HD8D 1CFSB 4QRRE 1MY5A 2XWTA 4KKAC 4Q74A 5EN2A 3QHFL 3AFLA 1TPXB 3U6RB 1QFWI 1S5IH 4Y19A 4QTHB 1R24B 4P4KB 3PHOA 1T7XA 2EE3A 4GH7B 4HWZA 3GMLA 3MLRH 3VU2A 4LLWA 4K3HA 2A77H 1N6QH 5D1QC 1D5XB 1DUYB 5E2VL 2QQLL 3KYOB 3MGTA 1P7QD 5BQ7A 3CFEB 3CXHJ 5F7DA 2A73A 5EU6E 4HUWA 5EUKA 2NXZC 1CDGA 5JW4R 2JJSA 2NLJB 3NN8B 4BFEA 3HC0B 3D3VB 4MVBC 1T89C 4JHZA 4NC0B 1CTNA 5CINL 1AQKL 4ZXBB 3DSNA 5HGAB 3FQRB 1R3LA 43C9A 3OSKA 1T1XA 3VI4E 3SJVE 1GCFA 2Y1VA 2VDOL 1DEDA 3BDXA 1TITA 1BBJA 2J6EH 3C9NA 2V2XB 4O2EA 4LAJH 2YD7A 3C6SA 5HHXH 1I8KA 5J9PB 2Q7NA 3LVEA 2V2TB 1RZIA 1WIUA 4LLMA 3RI5F 4CRPA 3PWJA 1VFAA 1G9MC 2EDTA 1DE4B 2VC2H 3OX8B 2CRYA 3Q3GA 1HILB 1RK1A 5BRZA 1IEAA 1CGSL 4RAHA 1KENL 1RZKL 3KXFE 3BI9X 4OGAD 4RGND 5J6HA 2XWJB 5DHYA 1X9QA 4IHOA 4F7EB 5IG7B 1VPOL 1Q72L 4P2QA 5BZDB 3D85D 5FYKH 4P46C 1RJCA 3CZJA 2V7HB 4MLSA 1A2YB 3RRQA 2R39A 1I1AB 3EOBA 4X7CC 3CUPB 3SY0A 1MHCB 1FGVH 5I16A 4P48A 2ZOKB 3K81A 3GUTA 4YGAB 3B9KD 3WIHA 2F74B 2R0KH 1A1OB 3MCKA 4QTIL 2OCFD 4I18C 4QXTA 4TVPH 4U31A 3G9AB 3IS0X 2HTLD 4CL7A 1JL8A 2WINB 2W92A 5C0RH 4PJAB 2OJZL 3H0TA 3VFPB 3O81A 1A14H 5IMKA 5HVHB 2XN9B 2EYTA 4V1DB 2RB8A 5IEKB 4OGYH 5D2NB 3ROOA 4X80H 2R0WH 4LSVL 1DVFA 3WNOA 4RFNC 3VRIB 3W11C 2EXYD 5ACLA 3TO4C 4U0QB 4V1DE 1NKOA 4QOKA 4G6KH 4MAYC 2WUCL 3L95A 2IH1A 1F3JB 4GS7B 2GSGA 2EDKA 5A16A 4QRSA 3QFDB 5IF0A 1FFNA 2VR5A 1KEGH 3QI9D 5ETUA 2HFEB 1KJ3L 1NSNH 2AEPH 5ERWA 2BNQE 3W2DH 2DD8L 4ZAKA 3CAFA 2ZG2A 1FZOB 1MRCL 1RUQH 4OZ4B 4R7NA 1LNUA 3X14B 3QEGH 2D03L 2AEQH 3GRWL 4FFZH 2I9LB 4ONHB 4DN4L 2R2HA 2G2RA 3LKSA 2X7LB 5F3HB 2A9ML 4G6ML 4NN5C 3D2UD 3BKYL 4MCZA 1I1YA 2C5DC 5DD0H 5KANG 4P3CH 2Z91A 1KYOK 3O3AA 4TTDD 1FNEB 1AXSB 2ZG3A 3FB7A 1FGNL 3I02A 1PBYA 3IDIA 4DCQA 1QYGL 4MA7L 3WLBA 1CE1L 2DL2A 3CPLB 1MCIA 4TUKH 2NY5C 3K4ZA 4KJPC 1F4XL 4OKVB 5HHPB 3LV3A 1X7QB 3WIHH 4G7YL 5I76B 4ZPTB 3VXSE 1SEQH 1UM5H 5F6IB 2DLIA 4PJEF 3KDMB 2FECL 3NGBB 3SQOL 3LKQA 1NGWB 5I1KH 2WQ8A 2FJHB 3C5ZA 3OR6B 3Q5YA 3OPZL 3H8NA 3UXFA 1J8HD 3SDYH 4JKMA 1B9ZA 3HTLX 5HDBF 4QRTB 4WO4B 3NVQA 5GQBA 3BUYA 3PGFL 1BLNB 3EOTL 4YDLB 1J7VR 5DJAB 1MIEL 5ILTH 4UDUA 1QVOB 2ZCKL 1BOGB 3UO1H 2Z31A 3L1OH 4JRXD 5E2JA 4JFDD 2XA3A 5D2NC 2R0ZL 3QXUA 1YMMD 1LO2L 2IFFH 4RQQA 1KN2H 5DRZA 1NCAL 2Z93A 3F7QA 1ZHLB 1VKXB 5HYJB 3KWWB 2D31B 4JN1H 4BH7A 2D9QB 5IHUH 2EIZA 2R0ZH 5CWSA 5DEGA 2AV1A 5TQ2H 2M1KA 3VI4F 3WUWB 3C2AL 3HKFA 5CIPA 5D7LA 5ILTL 1FZKA 4Q6IC 2Z31B 2CDFB 2UZIH 3N1QC 1K8DB 1EZVY 1A02N 3PE9A 4NKDB 3QCTL 3G5YA 4RGNB 4PY7A 1U36A 2J4WL 5F88B 4POZD 2ZUUA 1JRHL 1QA9A 1S7QB 3O6ML 4MAYA 1UKQA 4AG4H 4UT7H 1PSKH 4BSVB 1XCQB 1IGCL 1L7TH 4DFHA 5DQDL 3TVMC 1JE6A 5C0CA 4G8GE 4PRAA 5KSAC 3S36L 3KXFA 3OWEA 3P9WB 3SE3A 4P5KB 1JGLL 5MEOB 3RGVC 5F9DC 2NY4C 2WBWB 4AYFA 1PZ5B 5JHDD 2DICA 2I5YH 3GSVB 4YDKH 5K9KA 1MAML 1HWGB 2LVCA 5F1NB 5JPNB 1G84A 2AGJH 4OFKA 1RZ8B 2XWBB 3OHXA 4JGMA 4Y16D 1ZMYA 4JO1H 1AGEB 4FZEL 4FFZL 1FO0H 4LAQH 1KCRL 3KLHD 1W72L 1URLA 1SMAA 3H2WA 3LHPL 3HNSL 2H6PB 4F7MB 3W81A 3U1SL 5SV4A 3INUL 5D8JH 4XWOC 5CMAA 2D2OA 5F9WC 4YHZL 4IMLB 1WWAX 1ZHNB 3S6CA 3BKMH 2F8OA 4UU9B 1KPUB 4HG4J 4OIBA 5HHVL 3EJJX 3OKLA 2Y23A 4QHNB 2NY3B 3W0WD 3MJ7B 5IESH 3OTTA 2J2ZA 3FQXA 1NGZB 4PTTA 2ICEB 4EUPG 3MOAL 1A3RH 5IF0B 1CXHA 4S1SL 2IAMA 3ARFB 4KHTH 1CDJA 1B2WL 2EH7H 3FO0H 1T4KB 5JUEH 1MWAH 1VFAB 3QDMB 4YJZL 4JRYA 4RCAA 1GPOL 1I8MA 4PRHB 1EK3A 5GRJL 5JO5B 2BVQA 2YD3A 3MV9B 4PB9L 3CK0H 5D1QD 3O6FB 1DQJA 4Z7WA 3BIKB 3A6CL 1CD9B 1KC5L 4QWWC 1H8SA 2VDRH 2DQJH 4OLYH 4AY0A 1CS6A 1I1AC 1PFCA 4LHJB 3RU8L 4PRHE 5TFSL 1CD8A 3WIIL 1JCKA 3GJFK 3WN5A 5ID1B 4U1LB 5CD5D 4FG6C 1FPTL 4Y1AD 3V8OA 4F7PA 2VH5H 3TJEH 3HE7C 4HC1L 2DLTA 1OAUH 5A40E 2W0FA 5ANME 3IS1X 1S7XB 1T20A 2GAZB 3NZHH 1G7JB 2YN3A 1K5NA 4GMSL 2Q8BH 1JWSA 3IB4A 4U6XA 1PG7W 3Q6FA 5C0AA 2APWA 3KPNB 5I1KL 4N9OB 1E4WL 3D85B 2VXVL 4NO0B 5D7IA 1PJ9A 3CMGA 5C0BD 3TH4T 4JO2H 2WNGA 2P5ED 1X5KA 4X98A 3ZDXE 4JPKH 4OD2A 2EDNA 3QUXA 2APFA 2G60L 1AD9A 3REVB 3GI9L 2YK1L 4XBGB 5HGBA 1XT5A 5EC2B 3O2WH 1SEBB 4Z76B 4PV9B 5HHQA 1RK0A 1EVTC 1G7IA 1LD9A 4KWUA 1KCVL 3RL2B 2H32B 3BJ91 4N68A 3BFOA 3P40A 3ORJA 1P9MA 1J0HA 3EDKA 1P84K 5IFAL 2OP4H 1D7FA 2C3GA 4HGWA 4J3TA 4KDVA 1IC4L 1P4LB 2HVKB 4OAWB 5DRXA 5F7YC 1A9EA 3PWPA 5CEYA 4XWGH 1P53A 1F3JA 1A47A 2E7BA 3WFDL 2HFGL 1D9KA 5EBMA 3HE6C 4OFIA 3QO1B 1WZKA 4QYOA 3BH9A 4LLVA 4C59B 2QQNH 3TJHC 5CD5C 2JCCA 5GRZA 4UI2A 5D9SA 4XPTL 5IM7B 3P2TA 3TV3L 3CFJB 2DMBA 2J88H 4G9FD 4DFIA 3UTSE 3LEYL 5EUKB 3ILQC 4GRMA 3I6GB 1YDPB 4HS8H 5CBEA 3MRQA 3CDGB 4M3JA 4Y4HA 3FT3B 3ZKNC 3BKML 5FDYA 1FG2B 3W11D 1YNLH 2XN9E 3O8XB 1CG9A 3VFTA 4G5ZL 2XXMB 3INUH 3CSYB 2XKNA 4GMTL 1WITA 4OT1H 4NCC1 2RIKA 2EYSB 2VDKH 3BJLA 4U33A 1LP9A 2YPLE 1FVDA 5LJYH 3C8HA 2FIKA 3VDAA 4XC3H 4Z95L 1MVUB 1RFDH 4OCMC 4A2LA 3LQZA 3CFKA 1H8NA 2DIJA 4F3FB 4QHMB 1U3ZA 2AXFB 1QSFD 1UM4H 1LK2A 2GCYA 1XGTB 2CH8A 5EZOH 4MHHI 3I6LD 3OX8A 3MRKA 1NDGA 2HG5B 3LN4B 2M26A 2PO6D 1RK1B 3NZ8B 2G5BB 3HPJA 1UGNA 3HZYB 1A6PA 4PGEB 2AJUL 3UP1A 4Q9RL 1NCTA 4BQBA 1S7VB 1U8QA 4OGXL 1KB9K 1T04A 2RAMA 1MREH 5E8NB 5F7FA 4JFQA 4GFTB 1YPZB 5A1AA 2EKSB 4TPRL 1PQZB 1YMMB 4P9HL 5D7LB 2W1NA 1MUJA 5ISZE 4M7JL 4FXKA 5FYJH 1EEYB 3X11A 5E8DH 5BW7C 1W8NA 2MQ3A 4X4MA 2F9BT 2NY2C 1JPGB 2FX9L 4XP5L 3MXVH 5AG8A 1KG0B 4E0RA 2KH2B 4U6HA 5F9OL 1BX2A 1NAMA 1CLZH 4TNVK 2E7CA 3K2MC 4U6VH 3MBEB 1WIOA 1FC1A 2FX8H 3C6SB 2QV2A 3LSOA 2ZG1A 5DMKA 1YEIH 1E4XI 5EC1A 5EUOE 1IBGH 4D9RD 1R5WA 1N5YH 3NTCH 5CGTA 2YHGA 5DUBB 2DJSA 5LAXB 4PJ9A 12E8L 3ISWA 1CQKA 2IQ9L 5E24E 4NO2A 4PB0L 4NZDA 5E7BA 1F4HA 1P4BH 3A0OA 4JJ5B 1UVQB 4MNQD 1I1FB 2PYEB 4JY4A 4Q2ZA 25C8L 1QP1A 2E9BA 2FD6L 3TBVA 1NUNB 1AJ7L 3SGKC 5DUMH 5EU4A 4PGZA 4KRNA 4N8VA 3VXUE 1AP2B 3ZHLA 4CJ0A 1T5XA 2C3WA 3KVQA 3V5HB 1BQHB 4HGMA 2ZSWB 3S35L 3OJMB 4NRXA 4J6RH 1F6FB 4KZDH 5C2BH 4C55A 1WFNA 3PABB 1YYMH 4BZ2H 3QCVH 4LNRA 4LSPL 2N7BA 1T03H 1M1SA 2DQHH 1FRGL 2P5EE 3T0XA 3MZGB 2QL1A 2QBWA 1IM3A 1JZ8A 4GKOA 4ETYA 1NGQH 1X6LA 4G8EB 2PETA 3HA0A 1EUUA 1QFWH 3CXHK 2AEQL 3S37X 4NQEA 3ET9F 1YEJL 3E3QC 4ONOA 3VXMD 3ZO0A 4I3SL 4CVWA 4K8RD 1YUHA 4MVBD 3TWCH 4DKFL 2IBBA 1S7TA 4X5XB 3QDJE 2NYYD 1C1EH 4GRMB 5CGMA 1YPZF 5EBWA 1IAKA 3HE7A 3OJDA 4WW2F 1NMBH 3CDYA 1Q9KB 3MV9D 1CDUA 3HI5H 1LP9F 5D1QB 4F9LC 2QKIB 4PJFA 3WFBH 1NCCH 4X6CE 2I9TB 3OXSA 3QIUB 4M7ZC 1I7TA 2NY1C 4UT6H 5T3XE 3W0WA 1HH6B 1JZ6A 1BGXL 5KVFL 3P4MB 2FH6A 5IB4A 2WAHA 5ACMA 2HT3C 3NH7L 3VE0B 2B7DT 1JMXA 2OJZH 1MQ8A 2IG2L 3QUXD 4ZTOL 1IAKB 2UUDK 4IRSC 1DQMH 5BVPL 3ZT7A 3A6BL 4YX2L 1EDQA 3FB8B 3P9LA 2HJLB 1XZ0A 3HUJB 1OTSD 5BQ7B 3UC0L 2MWCA 3CLEH 2YRZA 3OKKB 1ACYL 2HFTA 2VXSL 3EYVA 1UENA 4P59H 1UWEH 2X4NA 3EO1A 3RWFA 5GHWH 3QISA 2GJ6E 3ARBC 1OHQA 5BV7C 4IJ3C 3G6AA 3RUGE 3NCMA 1D5MA 1S3KL 3OF6D 1XGYH 1S9YA 4MWFB 2Q7YB 4M4RA 5FEBA 5DK3A 4P46A 3MACH 1ZHKA 1J18A 3WEXB 4RGOL 5I1CL 4NT6B 2HKHH 4ZUTA 1NLBL 3GSRB 5GS1A 4LQFL 4RZCB 2DDQH 3MLSH 3H6JA 3KJ6L 3QUZC 4JJHA 1V05A 1EEYA 4LMQI 4R4FL 3PWJB 1FLRH 2OS7A 2Z8SA 1QSVA 2R56L 3QEHA 2YZ8A 1H5BC 5KW9H 4D3CH 4AM0B 4KI5D 2W65B 4JO3L 1MHEB 4G6FD 1DCLA 1EJ6A 1QG3A 5HYQB 1D5XA 1DUYA 5E2TL 5ESAB 1F6AA 2NY1D 3P9MA 4IRJA 2GITA 2DQIL 1SHMA 3TO4D 1UYWH 3THML 2HT4C 1CFQA 4JM2B 3O3AB 2ARJA 3VFUA 2RQ8A 2KQNA 4X4XB 3O8XA 5FYJU 5TDPB 2OQJB 1H5BB 5C0EB 3S98A 3T4AA 3CSYA 3LMJH 5FYJE 2EEBA 4M93B 3CVIH 3ROLB 1LDPH 5IJVB 1C5BH 4MJIE 4CNIA 4WTWA 1LO3L 4MDJA 4LFHG 3LDBB 5IROA 1DBJH 1A7NH 3DSFH 5KOMC 3UJIH 5C0NC 3SPVB 3FQNA 3VFPA 1RZ7H 4YC2C 5C0IB 3BW9B 3LZFH 3BD3A 4UOW1 3GM0A 4PY8J 3RHWK 1QR1B 5K9JH 3ULUL 1KYOJ 2OR8A 32C2B 4O4YH 4KVCL 2GJZA 4YHML 5BS0E 4I4WB 1HNGA 1SM3H 3EDDA 4X6EA 4K7FB 3QIBA 5L6YH 2BNRB 2COQA 3ZKND 4Y4FB 4AJ0A 4K7PH 1KC5H 1I1AD 5BS0B 3V0AC 4XNQA 5KJRH 3HE6A 3GBML 4LVOB 3WIFA 4O4YL 1Z9OA 2CO6B 1ZGLB 1OP5K 4HKZA 4HUUB 4XB8A 1FLTX 1JHLH 3BP5B 2AJSL 2EDDA 1CTOA 2JLLA 4M6MH 4WUKH 2E5EA 4BZYA 4KHTL 4ZS6D 1PGRB 4XNYL 2ZOKA 3WYRA 1FFPB 4YHIA 1A1OA 5CILH 4KUZH 2F5AH 4XMPL 4Y5YC 5K33A 2H3NA 1DN2A 3MRRB 5JW5A 4GQ9H 3OAZK 2R8SL 4C56D 2DWEB 4MD4A 3K46A 1BFVH 2F58L 4S1DC 1LDPL 1D5BB 4QHNA 2ATKA 3VFVB 3RY4A 3CFIC 3MRDB 3MO1B 3NAAH 4L4TD 4XNYH 3NCEB 1T7ZA 2UVFA 1HXMA 1CD0A 2DJ4A 5CAYB 5E9DA 5DJ8A 3JWDL 1TVHA 3QHZL 3RVXC 1HDMA 5E2UL 1D6EA 5C09B 1P4LA 3ALWA 4D0DB 5DTFA 5DA0B 1A21A 5KVMC 4HV8B 1G1CA 2XZQH 1DBKL 1DL7L 1F4WL 1OF2B 1TXKA 4MNQE 2Y07L 1M7IB 1XFPA 2GY7B 4K7PL 2FJHA 3PV7A 1DQDL 2OX5A 5C0AD 3OKNA 3NBNA 1S5HB 3S34L 5E5UB 1TZHB 1S7SA 1WGOA 2ZSVB 3OKYA 5INCB 4WV1A 3SHSA 3WNMA 3ZE2E 4HZLB 4Q0XH 3ZYOA 1TQBB 5KSAA 2NMSA 4QT5A 1CFVH 3Q6GL 5C08D 3EOYG 1IQDB 1IC7H 2X40A 5C09A 1T66C 2BHZA 1QR4A 2GT9A 3MACL 4AENB 1SBBA 4PJ5A 3W9EA 5IOPB 1K4CA 4M3KB 1G9NH 3IFPB 4M1GL 1FORL 3L9RA 2YD4A 4KMQA 4L4VB 3STZA 1VGKB 4HXAH 1FYTD 1YZZA 4G6FB 2BNQA 3VWJD 1KELL 5H37H 3HFML 1ZVYA 2B0SL 5DJXB 2VXSH 3QG6A 3RIFF 2EYRA 5IVXF 1NBVH 1IAII 4HS3B 4LPTA 5ERWB 3O6FA 2WQRA 4JM2D 1MCWM 4OFYD 4HWZB 3MV8A 5GS2D 3EKCA 3S8WA 3BKJL 2Y7QB 1U8IA 5GRWA 4GKZB 4HAFA 1EXUB 2G2RB 4TRPH 5IBTH 5H37G 4HIEA 1EMTH 5FYLE 5IEHB 3DURB 2GSIB 4JZJB 4MYWB 1MIEH 1UZ6F 1PKQA 1MCCA 1I3RA 1RUPH 1S7XA 1T20B 2BY1A 4WEBH 3UBXI 5IVXE 5GSRA 1MFCL 3VDBA 4W81A 4U0RB 3WFBL 3KPLA 3WFHA 4MNGA 2X4OA 3IXAB 1KNOB 3UYPA 3MUY1 3MSPA 4LLVB 3TIDB 2DS4A 5K9KB 1ZLVK 4JCLA 4FQXD 3WJLA 5IB3B 4MAUH 5F1NA 4GSDH 2YD2A 2WP3T 2Y5TB 3MJ6A 4Z7VA 1QR1A 1G9ML 5JPMA 2IFGA 3HG1E 1J05B 1YEJH 3S96B 5HVFB 1OM3H 5DMGD 4XH2B 2Z92A 3DHJA 3UBXB 1MRDL 1JTTA 2DB8A 3CX2A 3SKOA 3EO9L 4L8BB 4WO4A 1F8TL 1JV5B 5DR5L 1QSZA 3BKYH 1G7LA 3PHQA 1EV2E 4MSWA 1YC8A 4OLZL 3FMGH 3TN0A 3VWJC 4NO5A 1I7ZB 4LBEA 4KK5D 5DC4B 5I73C 1PG7X 1R3JA 3ECBA 4XC1H 4HBCH 4BSWA 5F3HA 1XGRA 1KPRB 3VFNA 4PP1D 4XRCB 3VGEA 3C60C 4DEPB 3OG4B 4NQVB 5D1XB 4BH7B 2BRRH 4MJIB 1BEYL 2XQBL 5KSVA 3QUXC 3PGCB 2HKFH 1BGXH 3WLBB 5FM8A 1E27A 5GS0L 1A7PL 4G6AC 1MHEA 4WFFD 4MD4B 4OCLC 4LCYA 2GQHA 5D96C 1VEMA 3WFEH 1VADA 3RY6C 1T1YB 4WWKA 3RZWA 1OGAB 1SJEB 1Z0MA 2VR4A 4PRID 4WUUA 1EHAA 4RWYH 5CZXD 3S9DB 5E8NA 1FFOB 2R0LL 1A6UL 1AE6H 3T77A 5DD6A 1A1MB 4I48A 5DJYB 4GRLA 5ALBH 2NNAB 1MCWW 1ACZA 3FT2A 3TO4B 2NR6D 3AUVA 4MLIA 3LEVL 3MRHB 3EZ8A 3T2PA 4U0RC 4UIMB 3DUSA 5HHOA 2FECI 5J56B 3MJ8B 1QACA 4W4OC 3MLTA 3JWDC 3S88L 4FZ8L 4WTZA 1EO5A 2HWZH 5E6IB 4NP4H 2FZ3B 4JFPB 2X9XA 4CN1A 1IGYA 1MAMH 4MA8L 2DQHL 1P6FA 3UDWA 3JXAA 4KI5C 1GAFL 4QRSB 4Q9QL 1ZT7A 4YNYA 2GT9B 1O5DT 4R7DB 3VCLB 4D0CB 5HI5D 5L2KA 3RJDA 4Z7NF 2HH0H 4ODHH 4FQLL 3IFPA 2BSED 1TJIL 4LIQE 4QXTB 5A3IC 4L4VA 3RGHA 1VACB 2AQ2A 4NQXB 2LTQB 1F2XK 3QIUA 4NM4L 5CLTA 2FB4H 3MR9B 4X9BA 2VZVA 5JHDA 1QFWM 5AG9A 1I1CA 3KPMA 1I1RA 2VNCA 3P0VL 5F96H 5GGVH 3GIVA 4GOSA 4NN5B 3RAJL 5I1IL 1D5ZA 5IEKA 2UWEF 5GPRA 3RVVC 5CIPH 3MCG1 4LCCC 3NCYP 4F33A 1GOHA 1T0NB 1U3HA 2GJ6B 3