2Z4QB

Crystal structure of a murine antibody fab 528
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
218
structure length
218
Chain Sequence
QVQLQQSGSEMARPGASVKLPCKASGDTFTSYWMHWVKQRHGHGPEWIGNIYPGSGGTNYAEKFKNKVTLTVDRSSRTVYMHLSRLTSEDSAVYYCTRSGGPYFFDYWGQGTSLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords anti egfr antibody fab, light chain
publication title Thermodynamic consequences of mutations in vernier zone residues of a humanized anti-human epidermal growth factor receptor murine antibody, 528
pubmed doi rcsb
total genus 42
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2007-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z4qB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z4qB02
4WUUB 2Q20A 1BZQK 3TBSA 1Y0LA 4FFVC 3MCKB 1WEJH 4L8SB 3RJDA 3BZEB 3WMSA 5GRVL 4NCC1 1DDHB 2VLJA 4JFXB 5I30L 1BZ7B 3UAJD 2VMFA 3QXAB 5F9AC 4QRPB 1UA6L 3UJIH 4NQEE 1EEYA 4BQ9A 3RL2B 3IU4H 1QRND 2VAJA 4F2MA 4ZS6D 2NY0D 1CGVA 1YYMH 3MYJA 3WN5A 1QUNA 1V3JA 3P0VH 3UJJH 2LU4A 2ICWJ 3KXFB 4OF8A 3VDBA 3PGDA 5AAWA 1RZKL 3SE4C 2V2XA 3AY4C 3NPSC 1LEGB 2R2CA 5I66A 3QRGH 1X5YA 4XNYH 3KGRA 3SDCC 5E5MB 2HN7B 3M17A 4YBHA 5E24E 1NCTA 1P7QD 1MFDH 4NYLB 3MFFB 4CDHA 4LSTL 4LQ1A 4R90L 4OCSH 4S0SD 4FZ8H 3MODH 5I9QC 2FJGB 4OB5L 1R24B 3QDGD 3QDJA 4WJ5A 4PY8J 2NPLX 3BE1H 1RK0B 5EU6E 1IC7H 3RA7H 2GY5A 4MD4B 4Q7DA 3WFBH 3SBWC 2HJFB 3PWUA 4WI6A 4V1DD 4PV8B 2IQAA 5D2NA 1MFCH 1T7YA 4NFDA 3QWOB 5IESH 3GEWB 2FX7H 3MLTA 4QXUH 3MBXH 4JY4B 4OLUL 2VKXA 5JXEA 5FUOH 2ICWA 4LCCA 4OTXL 2Z31C 1BQHB 1Q1JH 3FRUB 3QUMH 4O9HH 4KKAC 4LMQI 2GSGA 2NLJB 4KZDH 3ZTJG 4WTZG 2HYMA 4RISH 1NL0L 3PHQA 3JV5A 4I48A 4FFVD 1CFSB 4C56D 3P9LB 3C5SA 3CCHB 5HHME 1FG2B 2P5WA 1MJ8L 4AEIH 5ETUB 5LCVL 3RUGE 3QJHA 5DQDH 1QSED 2NY6C 1N3NB 2GQHA 1TVDA 1Z0NA 3AS2A 3QEGH 4LRNL 2PTTB 1F4HA 4KKBC 4ODUB 1YEHL 4LEXH 4MS8C 4KWUA 3P4MB 1VPOH 5EDXA 3RNKA 5HHVL 2DI8A 4QEGA 2P8PB 4M1DL 3QFJB 3LS4H 4J3XA 5FA4B 4WO4C 3FONB 3VFMB 1U3HC 1CU4H 2JIXB 4N8VB 4JREB 5DVLA 4HS8H 4QCIA 2YUZA 2VZVA 1FVEA 3V6ZA 5DLML 2YMXH 4EBQL 4RFEA 3SDCD 3ARGB 3O4LB 3VH8G 3BGMA 1KOAA 4UV7L 2B1HH 4NRZA 3WFEL 5DURD 3NZHH 2C3GA 3RAJH 5DK2B 4OFDA 1MLBA 3O45B 4GQPH 3MQIA 4I77H 3BOVA 5DJZA 3MBEB 4JFEB 2AEPL 1S8DB 4OJFL 3QUMA 1RQ5A 4YFDB 2R1XA 3O3EB 3VRJA 1QYGL 3PP4H 4NJ9L 3TVMB 2DJUA 1A3RH 1FP5A 4HIHB 1C16B 5F72S 1DQQA 2ID5A 4UOW0 3TH2T 3VXUA 1NFKA 3OXRA 3I75B 5SWSB 4L8CA 1ZLVK 1G7IA 5EOQL 4DW2H 1X5IA 2Z31D 3LD8C 5EU7C 4KKAD 1A6TA 5EBLB 1L0QA 3CLEL 3GK8H 3BMWA 5AYQA 2Q8BH 3PV6A 4R0LC 1YUHA 1H0DA 1A6UH 1MCLA 3IETB 1T4KB 4C57C 4X6DB 1U8QB 1CBVL 3LRHA 3GSRA 4DVBB 4HFUL 5IVXE 2NY6D 1RUPH 4D3CL 4WHDA 4JAMB 4ORGA 5GHWH 4X6DF 5E00A 4KKBD 2C1PB 1M7XA 4MS8D 2BNRD 3MRBA 4LHUA 1Z3GH 1VFAA 4PGCA 4WO4D 4UT6H 5CJXC 1GGCH 1U3HD 2EXYC 3ZE1F 3VWKC 1PY9A 2OL3H 1F4WL 1UYWH 5JHDE 3SGKC 4X99A 4DJMA 4DVRL 4OZHB 4K3GA 1VGKA 1AXTL 4ZAKA 4MAYC 3SE9L 4XC3H 5IBUG 1PZ5B 1KUMA 1IM9D 1D5BA 1D9KB 3VFNB 4ESKA 4OZHF 4LVOC 2H45A 1YZZA 5F7KC 3AS1A 1LEKA 3MRRB 2EE6A 4W4NA 2F58L 4DFIA 4KUCF 2NXYB 2ZUQC 3NCYP 3QNYA 3TN0C 5DD6A 1C1EL 4FS0A 3SGJC 5C0JA 4XH2A 1FFRA 3O9WA 3MUGB 3O3BA 4WWKA 1MVUA 3L7FB 2R29H 3INUL 4JN1L 1IKNA 3QCTH 4OLWH 3TNNA 1QD0A 1NGYB 3T0XA 1UXWB 1NGPL 4IOIA 4O00A 4LEOB 5IB2A 3BZ4A 3VXNA 4M5ZH 1Q9WA 5L2JA 2XZAL 3BSZH 3MSPA 5D9SB 1ZKAA 2A6JB 4U2YA 4IMLB 3VCLA 1H3PL 3HC0B 1KBGH 3GHBL 4OCWL 4HCRH 2OL3A 3BVNA 1KJ2H 4JQXC 3HPLA 3HI6H 5DQ9B 2IAMB 3SJVB 3ROOA 1V05A 5HPOA 2BSRA 4QO1A 1FV1A 2W91A 5D6CB 3QDMA 1O7VA 3WS6A 2EXYD 4XP6H 3VWKD 4ZUWA 3PL6A 5GGTH 2C1OA 2GUOB 5I16A 2NY4B 4KK5C 3BN3B 4RIRB 5GIRA 3OAUL 4M5YL 2ADFH 1RZKC 3V4VL 1KPVA 2X4UA 4FQ2L 3NZ8A 2K7QA 4MAYD 1FFNA 1KCUL 4XAKE 3VFWB 3R1GL 4P49A 2CLRA 1DLFH 3TCXA 2F5AL 2D7NA 5IP4A 1KCSL 2L0DA 5F93C 2ADJB 2F53D 4CVUA 3DV6A 3K1DA 2IH1B 4UIKH 4HKXA 3DBXA 3HI1B 5FDWB 4ZUVB 4O4YH 1FNEA 4JANB 2LFGA 1FVDA 4XNQB 3TBSB 1Y0LB 3TN0D 5C0AE 1JWSA 1MIEH 3NIDE 1PDKA 4JR9H 2ZNWA 3MV8E 3C2AL 3MZTA 3HC4H 2VLJB 4PD4K 3MV7E 1X5ZA 2W59A 4NKQB 5CINH 3ZHLA 3TIEA 1EEYB 3U6RB 4OT1L 5I8KL 4HCRA 4HQQH 3MPCA 4TVSa 1KJ2A 4JEGB 3Q5OA 4OAWA 3MYJB 3MRPA 3WN5B 1XGUA 2DI7A 3QWRA 5INCA 2BVPA 1ORQA 1Q8MA 2MSPA 5DJ6A 5F71A 4ZO9A 3PGDB 5E1AA 4Q0XL 4ALAL 4IRZL 5I66B 3MJ9H 1JHLH 4JPKL 1DQDL 1S78C 3RIFK 4LLUA 1JPGA 5GGTA 4NCC2 4I18C 5AG8A 4HIEA 3M17B 3WXVL 5D7LE 4U1SB 2DM3A 3NAAH 4PJAA 2IBBA 5FA3B 3ARUA 4LCIL 3QIBC 4PREA 3WFDL 1HHJA 3QDJB 4KK5D 1ZHKA 4NO5A 2DICA 3ARFC 3UTPE 1HH9A 4OCRL 2IQAB 5TE7L 3FO9A 1FNHA 1I7TA 2AKRA 4F37F 3NGBB 3HMXH 1DR9A 2BOBB 5GS2H 2ICWB 4LCCB 5I1AB 5ICYA 2I60L 2DD8L 2R0ZH 2H41A 3AMKA 5KS9E 5MP6L 2ZG2A 1RUAH 2GSGB 3MRDA 1DQLH 4OZGE 4Z7UE 4IMKA 2ZWLT 3PE9A 3PHQB 2DQHL 2X41A 4OKDA 5AYUL 3RZCC 3UP1A 4BSVB 5DVNA 2BVUA 3C5SB 3E1F1 2P5WB 2BZDA 5DMGC 4XCFL 4IRJA 3QJHB 4YJZL 1UQSA 2DJSA 1R5WA 1IVLA 3MJ9A 5ALCH 3U0TB 1RULL 3MLXL 1CGYA 3ZDZE 1LO4L 3RNKB 4M6MH 5IVXA 1QLRA 1J9CT 1VFMA 4QOKE 3U7WL 2R1WA 4YEFA 5IROC 5FEBA 3GSVA 3K4ZA 2IJ0C 3FAXA 3GI9H 3SQBA 5DO2C 3W5NA 2GTWA 4QCIB 4NKIH 1AFVH 3H7BB 4A2MA 1S78D 1FO0H 5F7EH 1FVEB 3V6ZB 5E56A 4Q74A 2O5ZH 3BMVA 4ZTOL 3BGMB 1CF8L 3SGDI 4A6YB 4OLXH 4NRZB 1FZOA 3I9GL 2VTFA 1OAYH 2WINA 1JGLL 5IMKA 1T03H 1N7ML 3MLZL 4ONFH 3IDIB 3O3UN 1MLBB 4QRTA 3DMMC 3QIBD 4M6NL 3UDWA 2BMKA 4YHKH 3RP1A 2L7UA 3LH2H 2VC2H 5HVWA 5BZDA 3ARFD 5L0QB 4PJ8A 1XR8A 2Q86A 3TJEH 1CXHA 1TVBA 3VRJB 3VD3A 2R8SH 2LABA 5DEZA 3VXUB 5LGHL 1DQQB 4NN5C 4QRUA 4QLRA 3OXRB 1T21A 3WUWB 5FGBC 4L8CB 2Z92B 1G7IB 2QQQA 1U8HA 3U4BL 4ZS7L 2XTJC 5D4QA 5ISZD 2CK0L 2J6EH 3OKDA 1A6TB 4AIOA 1INDH 4NRYA 2ZUVA 3OX8A 4JZJB 4JKKA 3LKQA 3RZCD 3QH3A 3PV6B 4KMQA 4GW1A 1HNFA 1YUHB 2EH8L 4KU1A 1H0DB 1QFWI 1JYNA 1ED3A 5DMGD 2FBOJ 1OD9A 3QXVA 3UTZA 1TPXB 5JOPE 3X3FL 1BBDL 4ORGB 1XGTB 1FO0A 5E00B 4GXVL 4G8IA 4OCMC 1IT9H 2W60A 4X6EA 1CZ8H 5I1KH 4ELKA 4PIRF 3B9KA 5J89A 1VFAB 2COQA 4U7MA 4HWEL 2W9DH 2D2OA 5DO2D 1PJ9A 3MREB 3E8UH 2HLAA 2NXZC 3BH9A 3ARDC 4R4BA 4CU6A 4EVNA 2KKQA 1KG0A 3RGHA 4Y5VA 1VGKB 4ZAKB 3CMGA 5HYJB 1NC2D 3V8OA 2X4SA 3DMMD 5I2IA 4XB7A 3WJJA 1D5BB 4JFQA 4KZEH 2OTWA 1CGUA 3LDBC 2FHBA 4JO4H 5GGSA 3JWOL 5GISL 5C2BH 4OM1L 1LEKB 2P5EB 3KJ4B 3KPRA 3WLBA 1IQWL 3VXRB 2J6EA 4KVCH 3IFLH 4PGZA 4JFFE 2Y5EA 4KI5F 12E8H 3KYKL 5FKAA 1JI1A 5T1KD 4P59L 3PWPD 4NWTH 3EYOA 3GB7A 1P1ZB 1OTTC 4P5TC 5FHBL 5J6GA 1PG7W 4XH2B 5FYKE 5D7IB 3T2OA 2O5XL 2ICCA 5C0AA 1A7NH 2XTJD 3O9WB 4WWKB 4WY7H 3RBSA 3S6CA 2DRUA 2EDRA 3MV8A 1MVUB 3TO4B 4HUMB 2DLEA 3H3PL 3MV7A 2LVCA 1CYGA 5D7IF 4O51A 3I02A 4Y2DC 2ICES 3LPFA 5B22A 1I1RA 4PRNA 3TNNB 1OHQA 2OJEA 3KYOA 3ZL4L 1TLKA 5IB2B 4IOIB 1G9MH 2X44D 3BZ4B 3VXNB 2G60L 1BOGA 1Q9WB 5L2JB 1CE6A 4KC3B 3GSQA 4KPHH 5FHAL 5JZ7C 3VCLB 4MDJB 2BY1A 4PJIE 5C09E 5CLWA 1RIHL 4XVTL 5E9DD 5BS0E 2QQLH 4H25A 2OL3B 4TSBH 5F6IC 2HFGH 2IPTL 2V9RA 3HPLB 1MSPA 3ROOB 2BSRB 1FV1B 2UUDK 3PP3H 4ZODA 3JWDC 4QTIL 2UZYB 4QHMA 1F13A 5DJ0A 4ZFGL 3QDMB 3I50L 5BRZB 4KK8C 2NXZD 1K9TA 5ID1B 4ZUWB 3PL6B 5I16B 4M93C 1QFWM 3ARDD 5FV2A 3H3KA 5GIRB 1HEZB 4YDKH 4PLOB 2PYEE 1KPVB 1ZHNA 2X4UB 5DT1L 3NZ8B 5J56B 3VRIA 1FFNB 1CDHA 2CLRB 4QXTA 2C4FU 4N1EA 1OTSC 4Q58C 4G9FD 2XACC 4JDTH 2NW2A 2QSTA 1EERB 3DV6B 2DDQH 3Q1SH 3DBXB 4HIXH 2UWEA 1REIA 4W4OA 4OM0L 3NA9H 1B6UA 1CLZL 3HNVH 3S35L 4EXPX 1JWSB 4PYHA 4OZGA 1OTTD 4P5TD 2A9MH 5DMIL 3OQ3B 3ZDYF 3CFEA 2AXFA 3QCVL 3BYTA 4IS6A 3G6JE 3CXDL 1S5IH 3KDMA 4KVNH 2ARJQ 3O2DL 4I3RH 1MF2L 5C7XL 4Y2DD 3BI9X 3ZT6A 4OAWB 1Q9KA 3LRSA 3MRPB 1XGUB 5INCB 2BVPB 1ORQB 2P4AB 3S4SA 1N0XH 2XN9D 1JF1A 5JZ7D 1I4FA 3WLWC 1O5DT 4J4PA 3BKMH 4N0YL 4LLUB 3TT3L 1T1YA 4N8PA 2E7BA 1MCOL 2DIJA 3CX5K 2EO9A 4JZNB 1E4WH 4FQXC 3L7EA 4HIEB 4RFNC 3NIFF 3UBXI 3HUJE 2IG2L 1NDGA 1UM5H 1P4BL 4ETQA 2Z93B 4PJAB 4KK8D 1EJ6A 4PREB 2VO5A 4ZUSB 2F9BT 3RWGB 1HHJB 5HDBF 5TE6H 4NO5B 3JWNC 4YPJA 4PJAF 3KR3L 5IFAL 2M26A 3BIAX 4QGYA 4YHMH 4AEHH 3WKMH 3FO9B 4R26H 2EH7L 4JVPA 2AKRB 2CQVA 5BVPL 4M9OA 4IHOA 1EFQA 3QWQB 4PJDE 4R7NB 5F7DA 3B3IA 4LHQB 3D0VA 5ICYB 1OTSD 3PQYA 2ED9A 1AJ7H 4RMTA 3ZYIA 3HPJA 1NGZA 5CSBA 1NBYA 3O11A 3RTQA 3C09B 2HVKA 3FMGL 3O6KH 1A7PH 3TT1L 2DL2A 3D69A 5JUEH 2P47B 4KKCC 3EO1A 2YBRA 2GJZB 4PJXA 5D70H 1A6WH 1KCRL 1CL7L 4EI6B 1UQSB 3RVUC 5I19L 4KQ4H 1FJ1A 5FYKH 3R8BB 1I9RL 4B0MM 3QUYC 2F8VA 1QLRB 1IFHH 4GAGL 5CZKA 2R1WB 2I27N 2QHLA 1G9EA 4X6FA 2K3TA 4K7FB 3U9PH 5CGMA 3GSVB 3P30H 3ZSSA 4HGMA 2C7UA 4J23A 5IVXF 2GTWB 1X3DA 4M00A 4PRAA 3WLWD 4Z95L 3GHEL 4L5FL 1Q0YH 5EZIH 3K2MC 1BJ1H 4J3WA 4FQXD 2VDRH 3OHXA 4K94H 1TQBB 3N1FC 4PJ5D 3J8F7 1QFOA 1FZOB 3CK0L 4XNZC 4NGHL 1KLGB 2D7PA 4QWWC 5IMKB 1JNLH 4M02A 3P77A 3QP3A 4QRTB 4U6XA 3I6GA 4M8VA 5J06A 4GG6E 5C9KA 2A6IA 3O8XC 1DBBL 3DGCR 4PJ8B 3ISWA 4HBCH 5T1LA 2Q86B 4P9ML 4YDLC 3TWCH 3ZKMC 1D7FA 5ESAA 4NBYB 3QHFL 1RJCA 1WITA 2BSTA 4QRUB 1BFTA 2AV7A 5E2UL 1T21B 3A6BH 2H32H 2YXFA 3UZQA 1I1FA 3IDXH 1U8HB 4JG0L 4S1SH 1GOFA 3ZZ1A 5I18L 3DX8A 3OKDB 4X7EC 1V7NH 5KVGL 4K07A 4NRYB 3BISA 3I3EA 3UC0L 1PEZA 2DYPA 3LKQB 3QH3B 3EHBC 2DLFL 4GW1B 4L4VD 1UJTA 4U1MB 3EZ8A 1A4KA 3JWOC 4HT1L 1ED3B 4KKCD 2WWMD 3BKCL 3AS3A 1P7HL 3RVUD 3WD5H 3T0VA 4CNIA 1NSNL 4MA7H 1Q9OA 1SQ2N 4KGJA 4ODHH 3U7YL 3QUYD 4JQIL 5I71C 2W60B 4X6EB 1SBBA 3MRNA 4ELKB 4PJIA 2WIIA 3B9KB 4LPTA 5BS0A 4HKJA 3OKNA 1OGAE 3LMJH 5EIQA 2EYSA 4XT1C 4X9FA 4MDIA 4HWZA 3BH9B 25C8H 1AQKH 4YAQB 4R4BB 2F19H 1BECA 3V9FA 1E6OH 4U31A 4XRCA 4EVNB 2I9TB 1KG0B 3V5HB 4Y5VB 1AGBA 4HJ0C 4QWWD 1KENH 4U1NA 2DQEL 2X4SB 4P2RA 4G6MH 4Z18A 1XEDA 2H32A 5I2IB 3LHPL 4PJCE 2OTWB 3O8XD 1DANU 2RR3A 3DVGA 1NEZG 5CEYA 3ZKMD 3CIQA 3KPRB 4KAQH 3WLBB 1FQ9C 4AZ8A 1Z9SA 5FKAB 1YNLL 4U0RB 4MX7B 3GB7B 4NC2B 4WW2C 3C6LB 1CK0L 3OZ9L 5EH1A 4OFIA 4YDVA 3NVQA 4LNRA 4ZTPL 3NFPA 1YEDA 2ATPA 4LL9A 2P8LB 3MV7B 1ITBB 4F15B 4GRLA 1CCZA 1TMCB 4O51B 3EHBD 2Z8WC 4PRNB 1NCAL 3G6JA 2OJEB 1MFNA 3KYOB 1INQA 1YN7A 3D85D 5E99H 3LKNB 2QADC 3A67H 3EDKA 4PG2C 3GSQB 3HZKA 4J6RL 2HT3C 2LU3A 4H25B 4Z76A 3H42H 4YHLL 3DO7B 2F74B 1HIMH 4KHTL 4K8RC 1VFUA 2NY7L 2DWDA 4QHMB 5DJ0B 4P46A 1XF2A 2Q1EA 3P73B 4K7PH 4FP8L 1TENA 1LO0L 4Z7WE 1HKLL 3HUJA 2DMKA 5JMOC 4LP4A 1CGWA 4XPGL 5FGCE 1N26A 3V5DA 5FO8A 1Q94A 3FCTA 2IAND 5AZEL 4OCYL 1ZHNB 3O0RH 1D5XA 3Q2CA 3VRIB 4ZD3L 1VHPA 4FXGB 4HJ0D 5FCUL 1MCPH 3PF2A 3REWA 2R2HA 5T5NF 3T4YA 1HHKA 3EFDH 2XWTA 3KPSD 4R3SA 4ACPA 1T1XA 5LVEA 3CH1B 1NBZB 2A38A 1RZFL 2NW2B 4PJDA 4XMLL 2UWEB 5EPMA 3ULVE 5T5FH 1S3KL 3NACH 2WUBL 4UZGA 3TPKA 3VGEA 3QEHA 4KTDH 3ZKQD 5TPWH 1IC4H 4X7TA 3T0DA 2UWEF 5FYJH 5IVOA 4LLVB 2MCG1 5BW7A 1FSKB 4O58L 43CAA 2AXFB 3G08A 4IS6B 5FUZL 1NLDH 3MLVL 3DWTA 5DS8A 3BKJH 1PKOA 2CLVA 3IAQA 4QXGL 2BY0A 5SWQA 1EHXA 4TPRH 3AROA 3GBML 2V9TA 4N0RA 1Q9KB 2NMSA 3LRSB 3WJLC 5DC9B 3NCCB 4XBGA 5IMOA 5E8PA 5JW4N 4LQFL 3DX7A 2QADD 3S4SB 1HXYA 5EOCH 1ZVHA 1JF1B 5GS0H 3V52H 1WAAE 1I4FB 2HT3D 4JRXD 3V6OA 1T1YB 4LOUC 2VZOA 4NQDD 4GKSA 4RX4D 4Z8FH 2X1OA 3L7EB 4PPTA 4P3DA 4K8RD 4MD0B 1NDGB 5FO9A 4UIMA 3VJ6B 1KCVH 3DVFA 3WS3A 1KJVA 1U8OA 4ETQB 4I8DA 1AE6H 4NZTL 3G6DH 5C0NC 3LVEA 5EOCJ 4IBLT 2AP2A 2KH2B 3FL7A 3QZWG 1R0AH 5IW6A 4NJAL 2DQIH 3UPRA 5I75C 5FYLD 1OLZA 5C08D 1ZLUK 4PRID 3NCBB 4ERSH 35C8H 3VXOB 3M8OL 1JZ2A 2Z9TA 3PXJA 3T0EB 2PW1A 2R4SH 1DLHA 5I1IL 4IHOB 3OJMB 1A47A 5F7DB 3B3IB 4D0BB 3FB6A 2GJ6A 1OB1A 3PQYB 2NY5H 1UKQA 2GY7B 2XI9A 2A9NL 2Z35A 2AERT 3ARBB 3OR6A 2YA0A 3HPJB 1NGZB 1NBYB 5DJCA 3RVVC 3O11B 3RTQB 1JF6A 1UXSA 3JVGC 2BNQD 5DGQA 1RUML 3NABH 4U49A 3GSNB 3D69B 3C2SA 3EO1B 4ZUUA 2YBRB 4FG6C 4PJXB 5DRZA 3B9VA 4FOMA 1BVKA 2AJVL 5IFJA 1FJ1B 4LBEA 4PJXF 1Y18B 2VKWA 5KVDH 4L9LC 4G7YL 2BVQB 1HSAA 4X6FB 4JM2A 1QEWA 1ZVSA 2C7UB 1U2HA 3HMWH 5CBAB 1ZT4A 3LN4A 5C6WH 3N9GH 3K74B 2ATKA 3OKKA 5D1XB 1HHHA 4LOUD 4QHLB 1OGAA 3C5ZA 3BH8A 4WHYG 1ZK9A 1OAUH 3RRQA 1AD9A 3OHXB 2PXYA 4DKDC 1UVQA 5SX4H 2HWZL 3RY6C 1QR1A 3FN0H 3P77B 4JFOB 4U6XB 2LTQB 5C0ND 3H9SE 3X13A 1CLYH 4P9HH 1IC5L 2A6IB 4YR6A 3EYFB 3LEVL 1XF3A 5T1LB 2GK2A 4U6VL 4KK6C 1CGSH 1I1AC 1UG9A 4NT6B 3ARWA 4AL8L 2BSTB 5I8EA 2AV7B 4N5EC 3BJ91 2AXJA 1F8TL 1FAKT 1HHIA 5J11C 1S7QB 3UROR 5DF0A 2YKLH 3DX8B 4IDLA 3OB0K 3ZE0E 3RVVD 3GMLA 3TYGL 4NO0B 1PLGL 2DYPB 5DWUH 2Z8SA 4ZPTA 5CKAA 4RGNE 3HR5A 1A8JH 4XXCA 2ZOKA 2Y07L 3WXWL 1SVCP 4FXKA 4FG6D 4JFZH 4EI5C 1QLEL 3SCMA 1NGQH 1MLCA 5J7CC 1TJHL 2L7JA 4YHOL 4MA8H 1BEYH 1YEEH 1KEMH 1JPSL 2HKFH 2IGFL 3FTGA 1MHHA 3C6SB 4Z9KB 2UZIH 3MRNB 5DFTA 2WIIB 3ME0A 4JO3H 3HLAA 4HKJB 3FFCE 2RFXA 1E6JL 4JLRA 4MDIB 1KULA 1RVFL 1AGEA 1OP9A 2C3XA 4XRCB 3KYMA 4JKPH 4Y4HB 5MHSE 5DMJB 1KLFA 5D7JA 1ULVA 5DJDA 3N1PC 1BFVH 1AGBB 3BKYH 2H8PB 4P2RB 2BHYA 4U7SA 2H32B 1PSKH 4XWGH 5EUOE 4FZEH 2G5RA 4KK6D 1I1AD 5CEYB 1EO8L 4B50A 1MY5A 1RURH 4RAVA 2D4DA 4MJIE 5E6IC 4N5ED 2ADIA 5FM5M 4TUOA 4QRQA 2Q7NA 5EU5A 3OKEA 1MQ8A 4YDVB 1FC1A 4L8SC 2ITDA 1RZ7L 1X9QA 5JMRA 4OGAC 3KVQA 4LNRB 2R0LH 3NFPB 1YEDB 1I85A 2ATPB 1CQKA 3VXSA 2OBGA 5IHUL 2R0WH 5ACZA 3OKYA 4NUJA 3UYOD 1X6LA 2MTPA 5J9PA 4LGSB 5CSGA 4TSCL 3TFKC 4BZ1L 1YN7B 3ZT5A 1CGTA 1LK3L 4EI5D 3HZKB 5C0CE 3MRIA 4YXHH 3G6JF 1BFOA 3QXDA 3GBNL 4LAQH 3TH4T 2JJVA 2A6DA 1ONQA 3U9UA 1H9VA 4EOWL 3BYYA 1MREL 2BVOB 2IFFL 3F58L 3J7HA 3PGCA 1WQVT 1U8IA 3WKNA 1NAMH 1XF2B 4P46B 1E28A 5DUPL 3OF6D 3I2CH 3HUJB 1BWWA 2HA1A 3EYSH 1PVHA 1AHWA 4ONHA 3L5XL 3DXAD 3OKLB 1MQKH 4NHCH 3JTSB 1Q94B 2I5YH 3FCTB 3GJFH 3V5DB 1IBGH 5ALBL 5FO8B 3HUJF 3MLWL 1TETH 1VKXA 1NFIA 3GGWA 1D5XB 3BHBA 3REWB 2R2HB 3T4YB 2XZQL 2XWTB 4R3SB 1JHKL 2XPGA 1W72H 2X4QB 3E3QE 4Y1AD 4WUKH 4PUBH 4PJFA 2F5BL 4LU5H 4JDZA 1DSFL 2NR6C 4KMTH 3O2VL 3IDMA 3E2HB 4PJHA 1X5FA 5E6ID 3UJTL 5CEZE 3TIDB 3ZTNH 4LSTH 4WUUD 2DKSA 5D6DC 4PJDF 4MJ6B 2B1AH 2EDLA 3IT8D 2NX5E 5T33L 5EWIH 4OGAD 1J8HE 1U8KB 1P9MA 43CAB 3MFGB 3G08B 4LLDA 1U8MA 4JO1H 1D6EA 5DS8B 1CL7I 1RUKH 1ZT1A 2CLVB 3CH8A 3S3PA 3T2NL 2GT9A 1VGEH 5C9JB 1R3HA 4JHBA 3MNWA 5MEPB 5I1JH 2XKNA 3TFKD 1EHLH 5IMOB 4XBGB 4XBEH 5E8PB 1NAMA 1A7RL 1EDQA 5CD3A 1UH4A 3TBWA 1NANI 3H8NA 4JREC 2J4WH 5KTEL 4GKSB 1SJEA 5IOPB 1M7DA 3GJFA 3EOBA 4YH6A 3RWJA 1XMWA 1WEJL 3GNMH 4UIMB 3WS3B 5FO9B 2O93L 1BD2E 1KJVB 1U8OB 3ARGC 4LIQH 4V2BA 2APBA 1NBQA 5INDA 3CVHH 5EOTA 2QQKL 1BQHG 5B8CA 3DGGA 3MLUH 5IW6B 2F54E 5K59E 3UPRB 1NKOA 1W72A 3UJIL 1TCRA 1NCCH 3MBEC 4WV1A 3IU4L 4M7LT 4PJ7E 2B39A 1S9YB 4KV5E 1X4XA 1YYML 1DLHB 4CMHB 3CU7A 5EO1A 3TVMC 3P0VL 3UJJL 2P46B 4OZFH 3FB6B 2GJ6B 1OB1B 2NW3A 4YDJA 2GAZA 2Z35B 3QRGL 1E4XH 4XNYL 5J12B 1LO2H 4Z7QE 2NR6D 5DJCB 2C3HA 3L3IA 4N0UE 4YC2C 3IJHB 4F9PC 1XGPA 3S37H 1UXSB 1MFDL 3QJFB 1YMMA 4OCSL 3D39E 4FZ8L 3MODL 1P84K 5DRZB 1BIIA 4HS6B 3IYLW 1EZVY 3S36H 1CR9H 1BVKB 1TVHA 2AEPH 3BE1L 2OCFD 5IFJB 1CD8A 1IC7L 3RA7L 4LBEB 2GK0A 3DOSA 3WFBL 4NIKB 4KKNA 4HHAA 2AK4A 2JK5B 1MFCL 3KNBA 1MOEA 3C8KA 1HSAB 4GRWH 5CMAA 2MHAB 5E95B 4WDIB 2FX7L 4JM2B 5IESL 4QXUL 2NY3B 1IGJA 3MBXL 1C8PA 2OR9H 5FUOL 3LN4B 4OQ1A 3CVHA 1FNAA 4KH2A 5C8JA 3QFJD 2J2ZA 1MCWM 1Q1JL 3AREA 3QUML 4O9HL 4APQB 3ILQC 4JM2F 4QRSA 3FFCA 1FN4A 1OGAB 3C5ZB 3BH8B 2JIXD 3L9RA 4KZDL 2F8OA 3OG6B 4WFGD 1AD9B 1JRHH 2PXYB 1XR9B 5KZCB 1LD9A 4Z7VE 1NDMA 1X44A 2E7MA 3ARGD 3O4LD 1VCAA 5K33A 1QR1B 1ZTXH 3MA9H 4AEIL 5C0FA 2DLTA 4HFUH 3X13B 2DOCA 3QO0B 5DQDL 4OZFA 4YR6B 3QEGL 4KHXH 1XF3B 5F70A 5CKGA 1F97A 2QL1A 3UBXA 1D9KC 3L6FB 3MBED 4LEXL 1C08A 1NFDA 4JFED 3SDXE 1VPOL 1MJUH 2M8XA 3B8SA 5EUOA 5L88H 5I8EB 4K7PX 1S7VA 4MXWH 3TVMD 3LS4L 1GCFA 1AR1C 1T7XA 2VABA 4MJIA 2D03H 1HHIB 3BD3A 1CU4L 5SWSD 3O6FA 4HS8L 1WISA 1JGEA 1F3DH 2W0KA 2YMXL 2ZSVA 4F57H 2IBZX 2BERA 3P9WB 2GJJA 4H8WH 2BXYA 4ZFZA 2B1HL 4ZPTB 4NP4H 1JJUA 3NZHL 3HR5B 1JZ4A 1KYOJ 2ZOKB 3RAJL 3WCYA 4FXKB 5JW4Q 5CJ8A 4I77L 4GXUN 3SCMB 3BP6A 3PNWB 3FQXA 4HDIB 3SKUD 1RZIA 5C0CA 1G1YA 3PP4L 1A3RL 1T2QH 3FTGB 1MHHB 3P3YA 4E9LA 1KIRA 4ZOAA 3HLAB 2X1WL 2JJWA 2IAMC 1JV5A 2RFXB 5KG9A 1T83C 4JLRB 2AJXH 1AXSA 1HINH 3ILQD 4BSJA 1AGEB 3R0MA 4HUUB 5CILH 5DXWA 3QI9A 4HIJB 3GK8L 3KYMB 2NY4C 5TGBA 1CT8A 2Q8BL 1GPOH 5D7JB 1N5AA 1SYVA 2RIKA 1A6UL 1A7OH 4WI8A 5F1OB 4BA8A 1HDMB 3QNXA 4MCYB 1RUPL 4JRYB 3V0AC 4KUCD 5I6XB 4OCWH 5GHWL 5HHQA 5HVHB 1D9KD 3MR9A 4KRPB 1EAPA 1MIMH 3IDUA 4RAVB 2V7HB 1SVZA 4AIXA 2YPLE 2ADIB 1Z3GL 2VLKE 4GBXA 4QRQB 4TUOB 5EU5B 4JFDE 3QQNA 1AR1D 2PO6B 4UT6L 1GGCL 5CIPH 4RSVA 2OMNA 5E8OA 5ID0A 1FDLH 2OL3L 4JY5H 3VXSB 4MJ5A 4Q6YA 1UYWL 1H3GA 1BGXH 2NX5A 2X4OB 3DI2B 3CZJA 5SX5K 2EICA 4G6AC 1J8HA 5ACZB 4NUJB 3IFPA 3V4VH 1A14H 4HMEA 2A74A 1QNZH 2DQCH 2EIEA 2XOTA 4XC3L 3C08H 4DKEH 5D7SH 1OSPH 3MRIB 4IRSA 3QXDB 2EO1A 2A6DB 1T2JA 1ONQB 3U9UB 4RA3A 2EDXA 3QEUA 5DJXA 1JUFA 5IFHH 3D2UA 1HCFX 3PGCB 1U8IB 4H1LB 2IAMD 3SJVD 4G8GE 4ELME 4JFHE 1BP3B 2VZUA 1AHWB 4ONHB 4D0DB 1XZ0A 4MA1B 2NY4D 4YXLH 1VKXB 1IEHA 5F7WC 2A73A 2UZXB 3QCTL 4OLWL 1NFIB 1I75A 2F54A 3BHBB 5DC0A 3DSFH 4TVPE 2NCMA 1MNUH 4G43A 3WHXB 4M5ZL 4PJ7A 5IGXH 3T08A 3BSZL 1GVIA 3NGBC 2XPGB 5F8QC 4PJFB 5JXEC 4LCCC 1KBGL 1IRAY 2BSSB 4HCRL 4JDZB 3P2TA 3TBYB 4UU9A 2EDJA 1KJ2L 2X89D 3IDMB 2DM7A 1JTOA 4PJHB 3HI6L 4U6TA 5M7QA 5D7KD 4GW4B 4PJFF 4C4KO 2EIZB 4MA3A 4PRPE 3EOYG 3K2UH 4HXAH 4N0UA 4FTVA 1CDGA 4PJHF 1EUTA 4MGXA 2FNBA 4XMPH 1ZHLA 3CDCA 4XP6L 3FOMA 5GGTL 4PRDA 5JOFA 1U8MB 2CDFA 5HYEA 5E4IA 3HG1B 5FF6A 1D6EB 2B2XH 4OLYH 1ZT1B 5EZLB 2ADFL 4G6AD 1F02I 1R3HB 4ENED 3MNWB 1VACA 3NTCH 5JW3H 2VDQH 4DOHE 2LE9A 1PBYA 1DLFL 5A2KH 1KFAH 1YEFL 1U91A 5HGAA 2V7NB 4PTTA 5CD3B 5I8OH 2HRLA 3IAGC 1OW0A 5GRYA 1CN4A 3TBWB 1XGRA 3QYCA 2VLMD 4UIKL 1YY8A 4O4YL 3V79C 4Q9QH 4J7RA 1U95A 3CZFA 5IUSA 3EOBB 4ZO7A 3RWJB 4L4JA 1MIEL 5D5ME 3G9VA 4JR9L 4F3FA 3EBAA 3LKSA 5INDB 5EOTB 3HC4L 4X4YA 5TFSH 3VW3H 2BVYA 5CINL 4D2NA 3EOTL 3DGGB 4D9RE 2O61A 3TV3H 1ACZA 1V7MH 3OGOE 1TCRB 5JIIA 2YRLA 3QDJD 4WV1B 5K9JH 3RX5A 5L0QC 4HQQL 2CO7B 5GJSH 2FX9L 2CDGB 3OAYK 5ACMA 4WNQB 4Z0XA 5EO1B 3PGFH 3SDXA 4KRLB 3F12A 4GRMA 4P2QA 2HKHH 3MJ9L 1JHLL 5F9JB 3ES6A 2NW3B 4YDJB 2GAZB 3Q5YA 5JXED 2FWOB 2WLYA 4JCMA 4ZTOH 3ALWA 5CEXA 1XGPB 3NFNB 1VFBA 3U7AA 4Y8DC 3BW9A 3ZKSD 3CAFA 2VLLB 1A7QL 2N7BA 2WBWB 4JZJC 1YMMB 5MENA 3NAAL 4W81A 4I3GA 3VFVA 3D0LA 1BIIB 4RGNB 2P5WD 2X9XA 3VFOB 4E42A 2VRAA 1F90H 1TVHB 2X05A 1MPAH 5E6YA 1TPXC 4U1IA 3N85L 1NLBH 4ZFFA 1Z9LA 2G5BB 3QHZH 4HHAB 4A2LA 2AK4B 1MY7A 3KNBB 3FB7A 5GRUH 5CMAB 3TGXA 3X11A 3HMXL 5KN5A 5IB1B 1IGJB 3U4BH 5ILTH 5C8JB 4Y5XB 4I0PA 3U83A 2R0ZL 3AREB 1P4LA 3FFCB 1FN4B 2C4FT 1RUAL 1DQLL 1C5CH 3L9RB 4LP5A 5E7FA 1M4KA 3BRFA 4NNYA 1NDMB 1I8KA 3VI4F 3WUWG 1DQJA 1BREA 3TJHC 1QRNE 4AQOA 5C0FB 4ZAKC 2DTMH 4LFHG 3IJSA 5DJ2A 1S9VB 5KAQF 4U6YB 2ZCHH 5ALCL 3UBXB 1DBKH 2YD6A 1C08B 1NFDB 2ENSA 4KI5C 4M6ML 1QFUH 5DR5H 5FUCE 3KJ4C 1YJDH 1NFDF 3GI9L 3VXUD 1U8LA 3GKZA 2WSKA 3O6FB 1K3IA 1AFVL 4TVPH 4QT5B 1FO0L 5F7EL 2FZ3A 4JFDA 4RFOL 3VMPA 4LFHD 1LE9B 3H9HA 3O9WC 4WWKC 3QDGE 2CO6B 4OLXL 3TO4C 1WBXA 3MROA 1OAYL 1IKNC 4MZ2A 5TE4H 1T03L 4GRWB 4ONFL 2BRRH 5JHLH 4V1DE 4KY1H 4YHKL 2HTLC 2HFFA 4HG4J 4HAFA 4LDEB 3LH2L 2VC2L 1KTKE 3BP6B 4OM1H 1FAIH 3FQXB 6FABH 4GRWF 3TJEL 1WVZA 4DK3A 1RZIB 2R8SL 5C0CB 1FNSH 1X4ZA 4CADB 3TESA 1W8OA 1K8DA 3RDTB 1KIRB 1XFPA 1JV5B 4YIQB 5AWNH 1RHFA 3FQWB 2VISA 2XA8H 8CGTA 4C56E 1AXSB 5I1LA 3TBTA 1ZOXA 4AYFA 4OCLC 2J6EL 3U48A 3GSWA 1UEMA 1INDL 1NPUA 3QI9B 3PL6C 5DI8A 1CT8B 3K46A 1QSEE 1XCQA 2HRPH 5FFLA 1H3TA 1N5AB 1SYVB 2ED8A 3T3MF 2H9GA 3IDNA 3TJHD 1OVZA 4PTUA 4NM8H 4ZAKD 5HYJD 4MNHA 4JE4B 5HHQB 3MR9B 5T3XD 4KI5D 1EAPB 3PDDA 1OAKH 5HDQH 1RU9L 4UTBH 3VGGA 1CZ8L 2P5ED 3EJZC 3VXRD 4GBXB 2W9DL 1YA5A 3EJYC 4ETYA 3E8UL 3B9EA 3MRGA 3CJJA 2IPUK 4GMTH 4PRPA 1R3JA 3OR7A 5E8OB 4MJ5B 1NCUA 1A4JB 1UC6A 4HZAA 2NX5B 3O9WD 2YD3A 4WWKD 5EFIA 5GGUA 3DETC 1J8HB 4DGIH 1II4E 3TO4D 2A74B 1MWAH 3TA3B 3RFZC 4O02H 4S1DC 3LPWA 1M1SA 3ARTA 3QAZC 3L3KA 2DMBA 2HTLD 4KZEL 5BJTA 4HMDA 4JO4L 1VB9A 4U1LA 4DEPB 3HE7A 5C2BL 4B41A 4AT6A 5IJVA 4KVCL 2B4CH 3IFLL 3QEUB 4P2YA 5DJXB 12E8L 1JUFB 2EYTA 1SYSB 1YPZB 1X5KA 2MOVA 2VYRE 3Q5TA 4R9HA 2F8XC 3WYRA 3S36X 1E27B 1P2CA 2KDGA 1A7NL 1CDIA 2J8OA 1YPZF 3QDMD 1TJIH 4WY7L 2Y36H 5D5MA 4YE4H 5I0DA 1CLOH 5BRZD 2G2RA 1ZWIA 6CGTA 3FQRA 3PL6D 4EUPG 4UNVA 4OCNC 4HFWA 3M07A 1W0VA 2A73B 2LAGB 1P69B 3JV0A 5IMLA 4LKXA 2D0GA 4UDTA 3FB5A 5J8OA 3K8MA 1G9ML 4AG4H 4G43B 3QNZB 2C4XA 5HVGB 4PJ7B 4YGVB 5BQ7A 2BNRE 2DKMA 3REVA 4KPHL 1WBYA 1MCQA 5B3JE 4N0YH 4NQCA 2ESVB 2QQLL 3D87B 4UU9B 4PJ7F 2HFGL 3RIAF 3KPPA 3LZFH 3EJZD 2DLGA 5HHNB 3TP4A 5AAMA 5JXAH 2W0LA 4PG9A 3C09C 4MA3B 1MWAA 1PQZB 4N0UB 3EJYD 4FTVB 2YD5A 4LVEA 2OLDA 3NN8B 1ZHLB 3S98A 3FOMB 4UUJA 5JOFB 2FH6A 2E9IA 3IDJA 5FF6B 4YDKL 3DETD 1I1YA 1E4JA 5ENWA 1GGTA 2BSED 1B0RB 4HS3A 3T3PE 4S1DD 2XZCH 2VUYA 2X4RB 3VFGH 1B4RA 4YBLB 1MCDA 4L8BA 4DAGH 1U91B 3JSSA 4PTTB 3CFIC 4JDTL 2XWJA 1XGRB 4HIXL 3Q1SL 4N0FA 2DDQL 1YY8B 3LB6C 5DD1H 3NA9L 1U95B 3CZFB 1OT1A 3C60B 3HNVL 2X4TA 5EU7E 3QSKB 1OAXH 1TQBC 4F3FB 1FORH 3LKSB 5I15H 2EXWC 2A9ML 1I7ZA 4M8QA 5FV1L 1D3CA 4DFHA 1IAKB 2O61B 3RZWA 1S5IL 4KVNL 2JB6A 5GQBA 1QRNA 4I3RL 1RY7B 4X5LA 1JYWA 3BIKB 4PJ8C 4EIZC 1LDPH 3GM8A 1JIBA 4Z0XB 4M4RA 3SDXB 3F12B 3RGVA 1N0XL 1VDGA 1MCNA 4P2QB 5HHPA 4WFHE 3ES6B 3BKML 3P0GB 4W70A 4XBPA 4J2XA 2DQFA 2R1YA 5ABDE 1IGYA 3SDXF 3ZTJH 1E4WL 3L3OA 1VFBB 1KJMA 1UM5L 2AEIT 3BW9B 5D93B 5GZOC 5MENB 1EEQA 2EEDA 4HWBL 4OD1H 3VFVB 2YD2A 1OQXA 4BZYA 4UAOB 4MNGB 4E42B 2YSSA 5TE6L 5I17A 5HI5C 1TXKA 4U1IB 3K81A 3DUHA 4V1DA 3IU3A 4ZFFB 3MRJB 4YHML 5E94A 4AEHL 3WKML 4R26L 1I8IA 3BGFB 3FB7B 1G7QA 2F53E 3IFNH 5C86A 4X9HA 4GFTB 4NNXB 5TDNB 3MUZ1 3B9KC 3BDBA 4LRIA 4DGYL 4I0PB 4RQQA 1AJ7L 1P4LB 2FGZA 4K3DH 3SN6N 2IH3A 4OD3H 3LB6D 1N59A 4DN4H 1CWVA 5H8DA 3O6KL 1A7PL 4NNYB 1I8KB 3LIZH 3UPCA 3NA4A 1F58H 3MX0A 5JUEL 1DQJB 2ZCLH 1GZQA 2HT4C 4CVWA 5D70L 1A6WL 4Y5VC 1QSEA 3EFFB 5GZNC 1CFBA 5EU3B 4KQ4L 4HGWA 4PS4L 2P45B 5FYKL 3MCLH 5HHOE 3WJJC 5GS2D 1TTGA 1PKQE 4WCYH 4PJ8D 4WTZA 1IFHL 3AM8C 1X5AA 2OQJA 2BY2A 3U9PL 1DEEA 3P30L 5IHBA 5JO5A 2AQ1A 3AY4A 1U8LB 5HTSA 1KPRA 4U0RC 3L95A 2YEZB 3C6LC 2FZ3B 2DM2A 4JFDB 1Q0YL 5EZIL 2E7LA 1BBJB 2VDRL 4K94L 1N64H 2IPUG 3RY5A 1WBXB 3MROB 1S7WA 4F15C 5GZOD 1JNLL 3RQ3A 4YZFE 4NCDA 3KLSA 2HFFB 2XFXA 3UTQB 4GG8A 5HI5D 3KLDA 4H20H 3SBWA 4HBCL 1K4DB 3TWCL 1UJ3C 4XP1H 3ABZA 4FN0A 4FRWA 3VH8A 4Z77A 1K8DB 1AO7D 4NWUH 4RAHA 3A6BL 1YEGH 2Z31A 3IDXL 3WFHA 2VISB 3B9KD 4S1SL 2ADGB 5I1LB 3G5YA 3TBTB 1ZLWH 3GSWB 1V7NL 2AJYH 2XWBB 1K4CA 5DI8B 1J10A 1FGVH 3FQUA 1XCQB 3T1FA 3IJYA 4EJ1C 1EEUA 3W39B 4BFBD 3IDNB 2P8MB 2HT4D 4PTUB 4DN3H 2Z91A 2OM5A 4PJ9B 5GZND 1KB9J 5DJ8B 4DK6A 4MNHB 1GGIL 3WD5L 1WF5A 4MA7L 1F4YH 3FT3A 4NZJA 1EHNA 1RZ8A 5JQ6L 4M1GH 3HTLX 3V4UH 3SOBH 3KPRD 1OP3K 4XVUC 4M1CC 4W4OC 3FQNA 4GKNA 4WO4A 5CGTA 3UO1H 3LMJL 2A83B 4PY7A 2JJSA 3MZGB 4HC1H 1ITCA 1J87A 3MRGB 3C6LD 3DX9A 1BVZA 4Y16B 5B38B 25C8L 3OR7B 1AQKL 2F19L 5ADOH 1FSKC 1E6OL 4QHUA 1UZ6F 3OKMA 4RGOH 5AZEH 5EFIB 3GSOB 1J0IA 5DEFA 4M43H 1QRKA 3MV7D 4NQSA 3A0OA 4ZSOE 4UTAH 1KENL 1BM3L 4J1UA 4W6YB 3L3KB 5GRJH 4G6ML 4MD5A 1URLA 4U1LB 1CE1H 1UFUA 4AT6B 1CDCA 4KAQL 4MQTB 5IJVB 2WUBH 4HEME 4PRHA 1MI5A 1KC5H 4NN7B 5TH2A 1ZLSH 2VXTH 1R5IA 1I9JH 5F7NC 1BVLA 2FBJH 5JPMA 1QHPA 2HJKB 1H15B 1P2CB 2FECL 3QIWA 4ZYKA 5D5MB 2X09A 1ZWIB 3JZ7A 3FQRB 1ETZA 3I6KA 3I3BA 4HFWB 2D4FA 3O3AA 5IMLB 4LKXB 2I25N 3CNKA 4UDTB 5D5MF 5FIEA 43C9A 4ISVA 4RCAA 2Q6WA 4OFYA 4LLWA 3T0EC 3GMRA 5E99L 5BQ7B 4U05A 3A67L 4HC1A 4NKOA 4WI4A 3REVB 1WBYB 3BUTA 4NQCB 2E27H 1SMAA 5AD0A 3H42L 1HIML 3KPPB 1SBSH 3ARBC 2APVA 4XVUD 3UXFA 1RZJC 4M1CD 3RTQC 3MUHL 1MWAB 4K7PL 5FKPB 4XCYB 3B5HA 2DBLH 5E2WH 3V0VA 4UUJB 1NGXA 2VZ1A 1GGUA 5TF1H 1I1YB 4I2XB 5ENWB 1CFVH 4GAJH 3O0RL 4HS3B 2QTEA 4EDXB 1KGCD 1MCPL 4NQXB 1KNOA 3EFDL 1CVSC 1HSBB 3MJ8A 5FCSH 4K3JH 1G9NL 1QSFB 4L8BB 2Y5TB 1A9EB 1BJ8A 1T3FA 4JQVC 2FATH 3WDHA 5DEGA 5D1XC 3B4NA 5T5FL 4WFFD 3ARZA 1N6UA 5TF0A 2QKIA 3NACL 1F6AB 2XTJE 4KTDL 3BXNB 1ADQH 5TPWL 3U2SB 1IC4L 2E8YA 2CSPA 4RA0C 3ZT7A 1I7RA 5IR1A 2PYFA 1I7ZB 4M8QB 4NC0B 4HLJA 2D9CA 1A0QH 2IF7A 1NLDL 1I7UA 2LTQC 3BKJL 2JB6B 4ZPVA 4CU7A 2QEJA 4PGDB 3MYZA 5HDLA 4TPRL 1Z5LA 3DVIA 5LXGH 5HHOA 1L7TH 1FIGH 5E9DE 5J1SC 5I1GH 3T0ED 3AAZA 3RGVB 5EOCL 5HSFA 5GS0L 1MCRA 4FQCH 3V52L 4BFIB 5HHPB 1F2XK 3KLHC 5IB5B 3RBGA 2DQFB 1ZLVH 2R1YB 1IC1A 1PD6A 1CGXA 4JQXA 5D71H 3PQYD 1SY6H 4Z8FL 3ARBD 3TZVB 2Q76A 4G9DA 1KCVL 3MLSH 2GSIA 3RTQD 5BCAA 2P43B 2H2PC 1AE6L 4R8WL 1LO5A 1TDQA 3G6DL 4PR5A 1C5BH 1HILA 3FKUS 2YSSB 5A2JH 1R0AL 4RRPG 5I17B 2DQIL 3EDEA 3F6IA 3NH7H 1R3KA 2Q7YB 1MRFL 4V1DB 3IU3B 3TPUA 3KPLA 35C8L 1QVOA 1QPXA 2R4SL 4G9FE 4GMSH 1I8IB 1FZMA 3AUVA 3MRLA 1G7QB 4M7LH 4ODSH 1QA9A 2EC9T 3GKWH 1ADQA 1W0WA 3RI5F 4BK4A 3B8YA 4PJGA 1YNTB 2NY5L 3WNKA 4RQQB 2NTSP 5T3ZH 3OKOA 2W9EH 1JNJA 1WGOA 2IH3B 5D1XD 1N59B 3TYGH 4NN6B 1CXLA 3NABL 4N9OB 4MAUH 5GGSY 3BPLB 3C87A 4K23H 3JUZA 3HCVB 4HJJH 4Y4HC 4X83A 1GC1C 2H2SC 3DX6A 1GZQB 4JPIB 5E0QA 5GJTH 1QSEB 4G8EA 1JWMA 4POYA 4OUOA 3QEQE 2VERN 4HGWB 2C3VA 1NQBA 4PP2A 4LASH 2KZWA 2XN9E 5KVDL 5A3IC 5T1LD 3FO0H 3MOBH 1SY6A 1I8LA 3IAPA 4HW6A 3FQTB 5DA0B 2OQJB 2P44B 1LHZA 4X6CA 4FQIL 5DMYA 1DEEB 5D2LE 3WIFA 3HMWL 4MXVF 5JO5B 4PGBA 4OGYL 1EXUA 3L95B 5F3HB 4L4TB 3KLHD 3N9GL 4FFWC 4Q6IA 1H8OA 2R9HC 3JV6B 4X9BA 4I18A 4AM0A 2VIRB 3AGVA 4H0HB 1OAUL 2D7TH 3W81A 2GCYA 4NO0D 2H2PD 2DYPD 5I9QB 2GW5A 5DFWH 3FN0L 1R5VA 3T4AB 4WHCA 3UTSA 4LARH 1CLYL 4P9HL 2XFXB 4ZSOA 3RL1A 3OTTA 1CGSL 2NQCA 3QFDA 1NMBH 1SJXA 3OG4B 1AI1H 5I1DA 3VH8B 4Z77B 2FH8A 4TULH 3D25A 3EO9H 5F1NA 4YHIA 2AI0H 2KQNA 3HR6A 4XPFH 3G5YB 1QQDA 2HLFC 3ULUH 2YKLL 4XPBH 1U8JA 2EDKA 3HZMA 4Y0GA 2DTSA 2HFEA 3EDJA 3RWEA 3FQUB 5DWUL 5IVZA 5B39G 1WT5A 1ZSDA 2ORBH 2VDMH 3IJYB 3RPIB 1CTNA 4Y4HD 4UV4H 2H2SD 1L9NA 5ANMA 1F3JA 4M7ZB 5A2FA 5IIEA 1OL0A 2BFVH 1ZGLA 1JWUA 2Z91B 1HE7A 2JCCB 3SDAA 4JFZL 3KYNB 1UZ8A 4P2RD 1NGQL 4QYOA 1RJYA 4I9WD 4FNLH 3ARPA 4MA8L 1XF5A 3W2DH 4AH2A 4NZUH 2BOCA 1BEYL 1KCKA 1YEEL 2JCCF 4LGPB 4UNTA 1KEML 2IFFH 5A3ID 2I07A 2HKFL 2QQNH 5IROA 5F1IA 1DCLA 5DUBA 4LHJB 5ERWA 32C2A 5IQ7H 3E2HC 4JO3L 3FQNB 4JB9H 4D8PA 4QHKI 4PY7B 4XHQA 4PJ5E 2EKSB 2YN3A 4XVJH 5B3JF 4FFWD 3DX9B 4PBXA 3MJ6A 2R9HD 3VXMD 4BSWA 4HKBA 4QY8B 3FT4B 5BW7C 3U0PA 4NNPH 1C7SA 4QHUB 4JKPL 3BD5A 5J0BA 2MWCA 4W68A 1H8SA 3MGOA 2CRYA 1BFVL 4NQSB 4J1UB 2Y25A 3DROB 3SQOH 1G7MB 4U1KA 1YY9C 1CDUA 1PSKL 2OSLA 4QNPE 1AGCA 4MD5B 5DK0A 1IILE 5CJBA 4XWGL 3EKCA 4FZEL 3VFTA 2CKBL 5CS7A 2J5LB 3HA0A 4OZ4A 3DRTB 4PB0H 4KJPC 1RURL 3V6OC 1GRWA 2D0FA 5C0DA 3RHWK 4PRHB 1MI5B 4HIIA 3RWFA 5LBSH 5TH2B 2KUTA 1T6VN 1R5IB 3DYOA 3WE6A 4IOFC 1BVLB 2CMRH 5IBUB 4L4VE 3QIWB 2R0LL 4ZYKB 5KSBE 2HLFD 4LSUH 2APWA 2GFBA 4DCQA 2R0WL 1ETZB 2EE2A 2ARJA 3I6KB 2B5IB 4X8JA 3O3AB 1A1OB 2Y72A 4UQ2A 43C9B 4ISVB 2Q6WB 3RVTC 1Q72H 4LLWB 2FX8H 2V6HA 1GIGH 3GMRB 5GPRA 4F7MB 3LPGA 4YXHL 4NKOB 5L9DH 4MWFA 2NY2B 4LAQL 5E9DA 4Z7NE 4Z7OE 5AD0B 2FHCA 3O2WH 5J12C 5L7XL 1NAML 1CXIA 2QQKH 2DAVA 1PYWA 3F7PC 2R0KL 2YWZA 5JR1H 3C9NA 3I2CL 3D3VB 3EYSL 1M7IB 1NGXB 5ADPH 2BX5A 4J8RB 5HHXH 1MQKL 4NHCL 4H0GA 2I5YL 3JWDH 4TNVK 1IBGL 1TETL 5KVEH 4MNQA 5IMMB 4Q97A 3W0WD 1TITA 4EDWH 4UILH 4BYHA 2D7MA 3BZFA 2NZIA 2F15A 1YY9D 1WIOA 3MJ8B 4JM2C 1BF8A 1W72L 1IGIH 3VFPB 3LV3A 2NY3C 3HE6A 3H6JA 1F45A 4PUBL 4WUKL 1NAKH 4YXKH 1T3FB 4NSKA 4YO0A 5C0EA 4LU5L 3LOWA 2IFGA 2W65B 4XAWH 4KJPD 4KMTL 3B6SA 4XX1E 4APQC 2QKIB 4UT9H 4G8FA 3C5ZC 3ET9F 4LCWA 3ZTNL 3B5TA 4P5TA 5DGRA 4OF6A 2PXYC 1EVTC 1I7RB 4IOFD 1A7BA 2B1AL 1RIVL 5EWIL 1GJIA 2P24A 5DJAA 3VRLE 1MRDH 4MB3A 4Y19A 5D1QA 4F7TA 5BV7H 4JO1L 5LWYH 4ZPVB 1RUKL 4Y2DA 1N5YH 3OMZA 2OJZH 2EDWA 1VGEL 1JI2A 1KPUA 1Z5LB 2NY5C 2EYRA 3QEQA 1ZANH 1MHEB 5HHOB 3RVTD 5F96H 5I1JL 1EHLL 4G3YH 4XBEL 1A64A 2HT2C 2XN9A 1TQCC 3AAZB 2YRPA 3CSPA 4HUKB 2H6PA 3ELAT 4P99A 2D3VA 2NYYC 3U36A 5FYJD 2FCBA 2GJ6D 1S7UA 2GKIA 2J4WL 5E03A 3T09A 4YEEA 3VI3F 5F9OH 4M4PA 4H5SA 2PR4H 4B7IA 3GNML 4G9DB 5SWZB 2GSIB 2XQBH 4Y4KA 4LIQL 4Y89A 3R0NA 3ULSA 1LO5B 2BHUA 3CVHL 4Y7MA 2IANE 1QR4A 4LPYA 4P23A 2XTLA 4JJ5B 4PR5B 4XXCC 3MLUL 3ZDXF 1OAQH 3BAEH 1UM4H 1B6DA 4OF0A 1R3KB 4TUJA 1NCCL 3VD4A 3TPUB 2CKNA 3KPSE 3GMPA 3SCMC 3SKJH 1OARH 3MRLB 1MFBH 3X14B 5GRWA 4OBSA 4M6AA 1QA9B 5F1KC 3UCRA 1KF9B 4AIZA 4JM2D 4PJGB 2NY3D 5DC4B 1E4XL 1LO2L 4APQD 5I0ZA 5I76A 4LLYA 4PJGF 3S37L 1L7IH 1OGAD 3C5ZD 4P9HC 2PXYD 4RAUA 2YZ8A 5KZCD 1JPTH 1JN6A 1LP9E 5D7JC 3MRKB 3B9DA 1LILA 3S36L 1CR9L 1JTTA 3B2UC 1MFEL 2C3VB 4PP2B 3CC5A 4GLRH 9CGTA 1X6NA 4L3EA 5I6XC 5BZWB 4JRXE 5HVHC 1KN2L 4KRPC 1H3UA 4X6CB 5EIVA 2V2WA 2JE8A 4NQDE 2HT2D 3WIFB 1OP5K 3SO5A 3K0WA 4N9GA 2OR9L 5EUKA 5GGVH 1EXUB 2HVJA 3RKPA 4X4ZA 2NYYD 1LEIB 4X6CF 4Q6IB 2PO6C 4N68A 1T22A 2DQDH 4PJ5A 3V7AE 3BPOB 1KXVC 1JRHL 2GCYB 1I85C 4JJHA 2WP3T 2X7LB 2QBWA 4FQJH 3ZLQC 4D9QD 1DQTA 5FYLE 2XNAA 5C08E 1U2CA 1ZTXL 4PRIE 3MA9L 1R5VB 2VDOH 4G6JH 4NRXB 3UTSB 3FAWA 3GO1H 2ZPKH 4OI9A 4U1GB 3RL1B 3ZHDA 4JG1H 2DL9A 4KHXL 5I1CH 4EIGB 3HAEB 2E3VA 3SCMD 3QFDB 1MJUL 4ODBD 5I1DB 5L88L 4HLZG 1MVFA 3D25B 4MXWL 5F1NB 5F7FA 5DUML 4XPHH 2D03L 4NQTA 4RMWA 1WWWX 2UUDH 4G42A 2BNQE 2R69H 3IVKA 3S3SA 4GAFB 4CVZB 1FVCA 1QQDB 2J12B 3TH3T 1MCKA 1U8JB 4F57L 3HZMB 2XKSA 4TTGA 2FECI 4L4VA 2HFEB 3E6FB 4H8WL 3TNMA 3RWEB 1B4JH 5IVZB 4NP4L 5KSBA 4MA1C 1YQVH 1ZSDB 2VAAA 4E5XB 4EQ3A 4DGVH 5ANMB 1F3JB 5IIEB 5D7JD 1ZGLB 1JWUB 3IRPX 4U3CA 3SDAB 1S7TA 4M6OH 1UZ8B 1FYTB 3OGCB 3B2UD 4QYOB 1RJYB 1S9XA 1MHCB 4AH2B 2CGRH 3OJDB 4JRYD 4I13B 4L8DB 2I07B 3B2VH 1T2QL 4KRPD 4KTEH 5DUBB 5ERWB 3K4DA 32C2B 3L5WA 2ERJB 4D8PB 5F7YC 3MRMA 1U58A 3NIGF 3SGEI 2D0HA 2AJXL 3F8UB 1R6VA 2CD0A 1HINL 2PO6D 4BSWB 5CILL 3LAFA 5CCKH 5IHZA 1DVFA 4Y88A 4K7PY 4FFYH 3VXSD 2P7TA 1GPOL 3MGOB 3P4LA 4NZRL 4NQEA 3R4DA 4H1LG 1A7OL 3T65A 2YD8A 2OSLB 1AGCB 1UENA 5DK0B 2Z0BA 1BQLH 1KEGL 5E6ZA 5IB4A 4BQ8A 2IBZY 1KTLB 5JNYA 3EJJX 4OZ4B 1MIML 1N2RA 3EO0A 4KJWC 4CDGC 5C0DB 3LEXB 4NN5B 4HIIB 3RWFB 4AMKH 3ULUF 3WE6B 4PRBB 3I85A 3UYRH 2WW8A 5FECB 5LKNA 2BJMH 1QBLH 4L9DA 5CJOH 3PWVA 4XP5H 1ZHBA 1FDLL 3SY0A 4JY5L 2PW2A 2V5SA 2VH5H 4DCQB 1BGXL 4C59B 1NEZA 1WFUA 4X8JB 1A14L 5I73B 1FLTX 5EU6A 4UQ2B 1GZPA 1QNZL 2DQCL 4S10A 4WV1C 1AR2A 3C08L 2GHWB 2PTVA 3CX5J 4DKEL 5ESQA 1YEFH 3SE8H 5D7SL 1OSPL 5CBEA 4MWFB 3O81A 3EAKA 3DPBA 3FHAA 5TDOA 3T1WA 4JZOA 4EEEA 2J8HA 2EKJA 4MCZA 3V6FA 2OR8A 5IFHL 1A6VH 2ZUUA 4U2ZA 1CDJA 5E5UB 1FGNH 1PYWB 1DL7H 2MPAH 1C7TA 3KLAA 4YWGH 3C9NB 3EOTH 1SJVA 2JF1A 2V5YA 4XNUH 1J1XL 1EFXA 5DDHA 2IANA 4RGNC 3RUGA 2O5YH 4YXLL 4F2MB 4MNQB 3HG1D 2FX9H 4NO2A 1L0YA 5MERA 1IKFH 2YOCA 3LQAH 5AZ2H 3DSFL 2VDLH 1TIUA 3BZFB 1UM6H 1MNUL 3IXAA 2V2XB 5EBWA 5FYLH 5IGXL 3L3JA 5H94A 1RUQH 3CGTA 3LV3B 3HE6B 1M71A 4NSKB 4YO0B 5C0EB 4Y5XC 4TN9A 2YA2A 3B6SB 4KJWD 3AREC 5IVNA 2X6MA 4G8FB 1MEXH 2FGWL 4LCWB 3M45A 1A7QH 1FNFA 4R2GC 2MKLC 3K2UL 4HXAL 2XY2A 3QUXA 3F5WA 3GIVA 4XMPL 2P24B 1JP5A 1T5WA 4Y19B 4WJ5B 5D1QB 4F7TB 1BPVA 5ICZA 3WNOA 1DN2A 1UGNA 2B2XL 3N85H 1V3LA 1LP9A 4OLYL 3PWUB 1HQRA 5EO9A 3ZKXB 4POZC 5D2NB 1KPUB 1MCFA 3QEQB 3NTCL 5JW3L 2ED7A 3ZE2E 3LQZA 2VDQL 3MLTB 5C71A 5C0IA 4NZDA 3ECBA 2XN9B 4JHWH 4G5ZH 4PG2A 2H6PB 1KFAL 4JRXA 4PLKC 2BCKA 1YEJH 2RCSH 3U36B 5I8OL 3GMMA 3O6FC 4KROB 1X5XA 4IOSD 4Q9QL 4I48B 4H5SB 3STLA 4PJEE 4Y4KB 5DMKA 3DXAE 1SEQH 3ULSB 5SX4I 2W0PA 5TFSL 3VXQA 4HULB 3VW3L 4P23B 5KSAA 1YMMD 3DV4A 1UB5A 3TV3L 1V7ML 4RGND 4TUJB 5DQJA 2YWYA 3GMPB 1FL5A 5K9JL 4F80A 1KLUA 4RBPK 2GITA 5GJSL 4Y1AE 5E7BA 2H3NA 1RK1A 3U0WH 4P2OC 2AK4D 5C6TH 3PGFL 3RDTC 2HKHL 1IGTA 4ODVH 4WUUE 4RFOH 4XCNA 4RFEB 3ALXA 3QZWA 5DJYA 5BV7B 2J88H 2PN5A 1IAOA 3ARED 4WHYH 3P0YH 3UMTA 5I76B 4LLYB 5K9OA 1DTUA 4JVUA 5L8LB 3WEXA 4R2GD 3QI9C 4G7VH 5JHDA 3H0TA 1FL3A 1JN6B 3X3GH 3HMXA 5F88A 1G0DA 4PGEA 4JY6A 5DJZB 5BVJA 5J13B 1F90L 2D7OA 4X80H 3Q48A 1MPAL 4E0RA 3QUMB 2FIKA 2R1XB 5B4MC 1J0ZA 1NLBL 1RZGA 1UWGH 3CC5B 3QHZL 4POZD 4CJ0A 4HEPG 4L3EB 5EO0A 1M6OA 4M3JA 5GRUL 2V2WB 5DRWA 4R96A 4N9GB 4NFCA 5ILTL 2HVJB 2OXGA 4MMXC 4PLKD 2UYLA 3ZO0A 1T22B 1C5CL 4JM4H 3O6FD 4PJ5B 1INEL 3VMOA 3ARYA 3V2AR 4PB9H 1NC4D 3ILPA 2XNAB 3VG0H 5HPMA 3DARA 5MEOA 3AFLA 4B5EA 3GSRB 3TA3C 2BHZA 2W92A 2DTML 5J4MA 5FDYA 2ZCHL 2D31A 1DBKL 4LVNB 4NPYA 2J7LA 1RU9H 4X5XA 3MRBB 4DEPC 1QFUL 1CXEA 4LHUB 5DR5L 4NM4H 1YJDL 4P2OD 4PGCB 4QNPF 1KELH 2P42B 2FLBT 3RDTD 1UT9A 3LCYA 4M7KH 4G42B 3IVKB 1TJGH 4YHPA 4NKDA 3UEZA 2CH8A 4TVPL 1FVCB 1VA9A 1JF5A 5C0BE 4WEBH 3JVGA 4X99B 4TNWF 15C8H 5KSBB 3QI9D 3DYPA 5TE4L 3STZA 1J5OH 3LN5A 1CDBA 2BRRL 5JHLL 4KY1L 2R2EA 5KSBF 4WTXA 5HDOA 3QR2A 1V3KA 2Y7QA 1FAIL 2VZSA 2OYPA 4JN2A 6FABL 5GS1A 5B4MD 3QNYB 2YS4A 2JELH 1FNSL 3QFJE 2VR4A 5DD6B 3OV6A 2Y9RT 2VB5A 4U7KA 1L6XA 3LEYH 5TJWK 5C0JB 1RAMA 3QO1A 3MRMB 1NKRA 3IFOA 5AWNL 2XA8L 1SMOA 4Z7NF 3O3BB 4ORZC 3O4LE 4WFEE 3CFJA 1DVFB 2UVFA 4BZ2H 2P7TB 2HRPL 3RY6A 2NX5D 1XGYH 4NQEB 4ZDHA 3JTTA 5D96B 4OGZA 4NM8L 3TA3D 4LPCA 5IB4B 4JPVH 4EN3A 2DLHA 1WTGT 4YBLC 5JNYB 4S2SA 3BVNB 1YNKH 5HYFA 3GI8H 1N2RB 1Z9OA 3EO0B 1OAKL 3RWHA 5HDQL 5SWSE 1A6PA 1BMGA 4UTBL 1JMXA 4NBXB 1H5BA 4HG4K 4HK3N 2XRAH 3QQ4A 3C60C 4Q9RH 4OLVH 3BGAA 5D7LA 2C1OB 1F00I 4GMTL 3PWVB 4GQ9H 1ZHBB 3SY0B 1A9BA 1E4KA 4AEFA 2RB8A 5EC1A 1NEZB 4R4FH 1XF4A 4DGIL 2FL5A 5ELIA 5L8JB 4X6DE 5EU6B 3KS0H 1MWAL 1GZPB 4QHKJ 4HV8A 5HXMA 5J1AA 4O02L 3QBTB 1ZLUH 1JHTA 3VRLF 4QGTA 2I26N 3HHRB 5ESQB 4F7PA 3I6LD 3FRPG 5L2KE 4JO2H 1TZIA 4K55A 4DZ8A 5TDOB 3H9YA 5HY9A 4HKXB 3ZE1E 1FNEB 4JZOB 1FVDB 2B4CL 4MCZB 5KS9A 3V6FB 2ESVD 5CZVH 4JDVA 1A3LH 2BNUA 4UMGA 4Z7UA 5EORH 5A1AA 3OF6A 5A2IH 3KLAB 5D93C 5L6YH 4PJEA 1LE5A 3TIEB 4FTVD 1TJIL 2X9YA 2Y36L 5HHMB 4YE4L 1CLOL 1EFXB 2WWKT 5DDHB 1FLRH 4UAOC 4OZHE 3RUGB 2GI7A 3VE0A 5IG7A 3W82A 5FOBA 1ZV5A 3KPMA 1KJ2B 3HZYA 2YZ1A 4NO2B 5MERB 4X7SH 2AQ3A 3JBG7 3RUGF 5DJ6B 4AG4L 1KT2A 3IXAB 4HUXA 4ODWA 4QOKA 3BGFC 1D6VH 3GMQA 5E1AB 5EBWB 1JZ6A 3L3JB 5H94B 1C5DA 5JW4R 5C07E 1JPGB 4URTB 1M71B 4FQLL 3D6GA 1AY1H 3CDFA 1WZ1H 1E4XI 3LZFL 1M05A 3U30B 3ARQA 5JXAL 5F1SA 5JIKA 3C60D 4HWBH 1HXMA 3QUXB 3N50A 4BQCA 1ZHKB 4NC1E 5ICZB 2WLZA 3CVIH 1ZT7A 3VFSA 3SHSA 3QXAA 4OF3A 3RVWC 5DVMA 2V5MA 1HH9B 1HQRB 5EO9B 2FB4H 2R56H 1HWHB 1N0LA 1I7TB 1UWXK 3LQZB 3VGAB 5C0IB 3ECBB 2XZCL 3VFGL 5E2TH 1XGQA 4F7CA 4DAGL 3W9EA 4DGYH 2BCKB 2EIDA 1ZA6A 2AVGA 3GMMB 3MRDB 3H2WA 4J3SA 3SJVE 4P2QD 2CUHA 4OIIH 5DD1L 5DD3H 1ACYH 2QSQA 5E5MA 5JW5A 4JGUA 2HN7A 3OB0H 1OAXL 1JRHI 5DMKB 1FORL 5I15L 3VXQB 4IRJB 5KSAB 5TQ0H 3H9ZA 4O2FA 5GRZA 5MEND 4ZFOA 2ILLA 3DV4B 5J57B 4PS4H 1R5WB 4XTRC 1R24A 4H0IA 5HI3C 3CFCH 2CLZA 3U4AA 3MJGX 2X40A 5IVXB 2GITB 1LDPL 4S1QH 4RMQA 2VDNH 3CFBA 2H3NB 1RK1B 3QDAA 1ZMYA 4CUCA 3S8WA 3L3GA 1QZ1A 1EGJH 2JB5H 4HWBA 5D7KE 4JY4A 4XCNB 5DJYB 1BQHA 3QZWB 4E41E 2AJZA 4J12A 3CMOL 4AK1A 5M95B 1Q38A 5K9OB 4KJQC 3TF7C 3WEXB 1EBAA 2WINB 5JHDB 3DVNA 4XPAH 1CFSA 5C0BA 3P9LA 5EC2A 1FL3B 2VXVH 4M48H 5F88B 1JNNH 3CCHA 2BMKB 4OD1L 4PGEB 4JY6B 1IGCH 5E4EB 5BVJB 5BZDB 5CUSH 5ETUA 1HYRC 4JVWA 1XR8B 5F89A 2FIKB 4PJ9C 3RVWD 1TVBB 3B9AA 1QO3A 1BJ1J 2WZPD 2UV3A 1M6OB 4BFEA 3MV9D 2W38A 3IFNL 1RIUH 2VLME 5DRWB 4BH8A 4R96B 4F58H 2DJ4A 2P8PA 1JL8A 3A6CH 4JFFA 2AJSH 3QFJA 3D5OF 3ZYOA 2AEWA 5CSZA 3RI5K 5GRXG 1LNUA 3VFMA 2JIXA 4K3DL 1G6RH 5F9WB 4OD3L 3OX8B 4Y16C 4DN4L 2R2BA 4JFDD 5HYSG 3LIZL 1WV7T 3ILPB 3DO3A 3F65A 1F58L 5IQ9A 1AGFA 5HPMB 2ZCLL 3QDJE 4XP9H 3UTZB 2FLRT 1GGIH 1EGJA 2CDEA 3O45A 2EDTA 1YQ2A 1FNGA 4XTRD 1QBMH 3MCLL 5JQ6H 1FO0B 5HI3D 4G8IB 4WCYL 1A3QA 5C09A 4O5LH 3UTOA 5CFHA 2HLAB 4NN7C 4YHPB 4NKDB 5IBTH 1GHFH 2M1KA 2XXMB 3FT2A 1V5JA 1N64L 1MCBA 5EBLA 4KJQD 4DUXA 2P5WE 4I3SH 4XX1G 3P9MA 3OJ2C 3MLRH 1BM3H 3STZB 1WBZA 2PYEA 3LN5B 3RU8H 4JFQB 1S7RA 2FDBP 4Z5RA 2R2EB 4OLZH 2DB8A 3NFSH 5GGSB 2PTUA 1CICA 4U6HA 1WC7A 5B38G 2Y7QB 4ZQKA 4H20L 4YHZL 5GS1B 4JN2B 4PJ9D 1KIUA 3TC9A 5IW3A 4XP1L 4JAMA 1G6RA 3BP5A 5L2KA 1NCWH 4NWUL 1J05A 3EYOB 1YEGL 5J6GB 3TEUA 1QKZH 3QO1B 3T2PA 3IFOB 1T7ZA 5C0AB 4K71B 3RY4A 4RNRA 3IS0X 4C55A 3MV8B 3O4OB 4P2CG 2FHFA 3GMOA 2VR9A 5HYQA 2AJYL 3CFJB 4CVXA 4Y16D 3I02B 3BQUA 4XCEA 4F8QA 1FGVL 4CN4A 3NIDF 1I9IH 2E6PA 4ZDHB 2ZUXA 3JTTB 5KANG 4DN3L 1BOGB 2B4CC 1CE6B 3U82B 3L1OH 2OR7A 2ZSWA 4EN3B 1F4YL 1CS6A 3QUZA 4M1GL 4S2SB 3VXUE 3QUKA 5EZOH 3V4UL 3RWHB 4HXBH 2O26U 3SOBL 5C07A 1U9KA 3SGEH 1H5BB 4WW1A 3UO1L 4HUWA 4HC1L 4NQUA 5D7LB 1MAJA 5ADOL 1T1ZA 4K9EH 4WHTA 1CLCA 1GXEA 4RGOL 4KUZH 2FL5B 4M43L 4BK5A 3V4PH 1NBVH 4HK0A 5J1AB 2VXSH 4IDJH 4UTAL 5HGDA 2YPKA 5GRJL 1AC0A 4QXTB 1G9NH 4DTGH 4F7PB 2G9HA 2AABH 1TZIB 1CE1L 4DZ8B 4KDTA 5D9SA 3RGVC 5HY9B 1ORSA 1SEBA 4IMLA 3RVXC 2V5TA 5FO7A 4NQCD 4FABH 5KS9B 2AK1H 1KC5L 4JDVB 2IAMA 3A6OA 4LSVH 4OZGB 2BNUB 1ZLSL 2VXTL 2EDOA 4Z7UB 1I9JL 2VR5A 3TZVC 1RHHA 4KQ3H 5KS9F 2FBJL 1GAFH 1SM3H 3CFEB 5D6CA 1OT2A 1U8PA 5E1HB 4MLSA 5TQ2H 4OZGF 3K7UA 4HMCA 4Z7UF 3KDMB 4RIRA 4OIAA 5IG7B 1B3JA 5FOBB 3OB8A 5HYJE 2RGSA 3HZYB 3V7AG 5B3NA 2VXQH 4TUKH 2R4RH 4Z6AT 5T3XE 4KI5E 4HUXB 4ODWB 4QOKB 3GMQB 2P5EE 4DKFH 1C5DB 3S34H 3VXRE 3ZDZF 3KHOA 2E27L 1QSFD 1ZEAH 2H26A 2IH1A 5FDWA 3HI1A 1SBSL 2PETA 4XNQA 4E41A 2VWEC 3BT2H 5D7IE 1T80A 3DNKA 4R8WH 5ACLA 4K2UH 4U1HA 5CP7A 1HXMB 4NN6C 1LO3H 5JDSA 2WUCH 3BPLC 2DBLL 5E2WL 4KK9C 1ZT7B 3TYFA 3VFSB 4LSPH 1MRFH 5TF1L 3OAZK 5LJYH 4GG6A 3U6RA 1CFVL 4GAJL 4I5BA 1HI6A 3S5LG 2ZKHH 3MOAH 1XGQB 2AJ3A 3D0VB 4F7CB 2CR3A 4K3JL 3W9EB 5I1EH 4YX2H 3IDYB 3RGVD 1ZA6B 2FATL 4XGZA 3HN3A 3RVXD 4RGMB 3BP4A 2HVKB 2BDNH 3QDME 2E7LC 5JW5B 4AY0A 4J3TA 1ADQL 5BRZE 2VZTA 3TZVD 1DUZA 3HS0A 4U1SA 1A6ZA 3KG5A 1BWMA 4QHNA 4O2FB 5FA3A 4ZFOB 1A0QL 2LQRA 2BRQA 3H3BC 2CLZB 2E8ZA 4EQ2A 3CLFH 4A6YH 2XKUA 5LXGL 3CFBB 4FQIH 1L7TL 1FIGL 2QJDA 1JTPA 5I1GL 1YEIH 3L3GB 4OGYH 1RPQA 4FQCL 4PRAB 2BOBA 1BIHA 5EB9A 5I1AA 2I24N 3RX8A 1QBBA 1QHOA 4XNMA 2ZJSH 2P49B 1U6AH 5D71L 2AJZB 3ZDYE 1SY6L 1LK2A 3MJ7A 5E2VH 3CUPA 3MLSL 4YHYB 3C8DA 4BSVA 5KVMC 3DVNB 5C0BB 5EC2B 4X4ME 3I6GB 1C5BL 2DQJH 4KK9D 4M7ZC 4N5UA 5F21B 3VMNA 2ZNXA 3NH7L 5F89B 2NY1B 1QO3B 5ESAB 1NGWA 4PJCA 3U0TA 2P1YA 4GMSL 1G1CA 2QV2A 3SKNA 1BLNA 3G5VA 4M7LL 3ARXA 4ODSL 4YFLF 4BH8B 3GKWL 1I1FB 3NIFE 4JFFB 5CSZB 1LNUB 1JNHA 1GGYA 2JJSC 3KPOA 5T3ZL 2W9EL 3H7BA 4L4TD 1ZS8A 1CFNA 5HDBE 3F62A 2R2BB 3O6MH 5FGSA 5IT2H 3WDJA 3VU2A 4PJAE 1A4KB 3ULVH 4MAUL 5HBBA 1TCMA 1J86A 4K23L 1BX2A 4A6YA 5DK3A 4HJJL 4MHHI 5SX5H 5IQ9B 1AGFB 1N4XL 3DHJA 4ZO8A 1T5XA 1UH3A 5GJTL 4OV6F 4FXLA 4CNIB 3IDIA 2CDEB 2VNCA 1Q9OB 1FNGB 2IALA 4EKXA 4XP4H 4LASL 2WBJA 4WI3A 3FO0L 3MOBL 2J5LC 4IJ3B 4GH7B 4PJIB 5C09B 5BS0B 3NBNA 2D9QB 3OKNB 2CUMA 4ZXBA 2EYSB 3WUWA 1KJ3H 2VSDA 4X4XA 1WIPA 2Z92A 3MNZA 4HWZB 4PJIF 4X8XA 3PDGA 3PWLA 4MVBC 1PG7H 5T3XH 2UY7A 4YC2B 3FT2B 4Z7WA 3QIWC 2D7TL 1A22B 3AS0A 4JZJA 3P9MB 2B5IC 3KJ6H 4U1NB 1WBZB 4MQ7A 2PYEB 1S7RB 4Z5RB 4LARL 1CICB 1WCQA 1WC7B 2CKBH 4U6HB 3DVGB 4ZQKB 2W9LA 4P4KA 3HZVA 4WWID 3EYUH 1EV2E 1G6RB 1XGTA 2NY2C 1NMBL 1AI1L 2N7AA 3BP5B 5K9KA 5L2KB 3PDOA 4TULL 3S88H 2FEDC 1J05B 3EO9L 2X1QA 2AI0L 4FMKA 2VDPH 2G75A 2FEEL 5E70A 2AV1A 4XPFL 3MREA 4RNRB 3ULUL 2A1WH 4XPBL 3GMOB 2X4NA 4U3HA 5HYQB 3U4EA 2R39A 4GRLB 4CVXB 3BQUB 4XCEB 3C8HA 2RJMA 3G6JB 2ORBL 2VDML 4F9LA 1INQB 1J18A 3NCMA 4UV4L 3PV7A 2BFVL 1FBIH 5HYJA 3T0WA 2ZSWB 5HGBA 3MV01 5DZLA 4FNLL 1A1MA 4Z76B 3QUZB 3W2DL 3QUKB 4NZUL 2WQRA 5DVOA 1WAAA 2P5EA 2QQNL 3VXRA 5C07B 5L7XH 2DWDB 4QRRE 5IQ7L 5LG1A 4WW1B 1YC7A 4JB9L 4HUWB 2R0KH 3T77A 2X42A 4PRHD 1MI5D 5E8EA 1P1ZA 4XVJL 1JGDA 4MVBD 5D7IA 4PYGA 5E08L 1XCTA 1T1ZB 2Q87A 2CKBA 4NNPL 4WHTB 3QIWD 4EUPH 3TO4A 1S7SA 2EC9U 4HK0B 2DBJA 1HHKB 5HGDB 1MJ7H 2YPKB 3VA2C 3HFMH 3SQOL 3THMH 3CPLA 2RAMA 4G6KH 1T1XB 4OFYD 3QPXH 2G9HB 5IEKA 3BESR 3OAYH 1AO7E 5I8CA 1JGVH 3WNLA 4PJDB 1ORSB 1KTDA 1SEBB 3EW3B 5EPMB 4PB0L 4MDJA 5E8DH 2NY2D 3ZSTA 5FO7B 2IWGA 2FR4A 2FEDD 3QEHB 2DQGH 3BX7C 3PG2A 4KTYA 5LBSL 4X7TB 2E6QA 4WFHD 1NUGA 1OWWA 1RIVH 7FABL 1RHHB 3K1KC 3MRHA 5F7MC 2CMRL 1D5ZA 4R6UA 1U8PB 4NBZB 5BRZA 5SV3A 5H37G 3STBA 4LSUL 5ID1A 4X6BA 3D3VD 2WBKA 4HD9A 3L5JA 3PXHA 5SWQB 2QSVA 4QRPD 3MV11 1HEZA 3T0AA 3KPQA 2OK0L 1Q72L 2YD4A 3DX7B 2FX8L 1HXYB 1GIGL 4XI5C 4QTHA 4OQTH 1ODAA 5L9DL 4GO6B 3KPRE 1UEYA 3KXFD 3HRZA 2VDKH 3Q6FA 3IF1A 3RWCA 4R7DA 4JKLA 4P3DB 2H26B 4EUPA 3O2WL 2E9WA 4QF1A 4YQXH 3TLRA 3F7YA 3EIFA 4E41B 3G5XA 2PCPA 4U1HB 5CP7B 1OY3B 4Q2ZA 3ESUF 5JR1L 5JDSB 3GRWH 5IJKA 4BH7A 1CTOA 3TYFB 4X4MA 1KV3A 5ADPL 5HHXL 1IAIH 1WWBX 4U1JA 3H9SA 3JWDL 5KVEL 3S97C 4GG6B 4D94A 2PW1B 4MJ4A 4AENA 1I9EA 3IS1X 3NCFB 4I5BB 4EDWL 1HI6B 4UILL 1GYAA 5JORA 4D9LH 1I8LC 1MRCH 4GG6F 2AJ3B 5HHOD 1IEBA 1IGIL 4FQHA 4YXKL 1FH5H 1NAKL 5AG9A 3OR6B 4YDIH 1XIWA 1YYLH 4XGZB 4XAWL 3WIIH 3BP4B 3SPVA 4Q6IC 4UT9L 2OMBA 1TTUA 4JZNA 1ZA3A 3BPOC 1GH7A 4ZUUB 4RMUA 1DUZB 3QB7C 3HS0B 4OCXH 2IQ9H 1A6ZB 2Z93A 4N8VG 5SWZD 1MRDL 4QHNB 1VEPA 3PHSA 4OQTA 3RWGA 4ZUSA 4HAGA 5BV7L 1MFEH 1OCWH 2C26A 2KPNA 3MRFA 5LWYL 1N5YL 4NOFA 1LVEA 4MYWB 2OJZL 5BOPA 4U1GC 5CHNA 1KN2H 1ZANL 1F4XH 5F96L 3WO4B 1QEWB 4G3YL 1ZVSB 4F37K 4OLEA 1BAFH 1ZT4B 4XI5D 4ZO6A 5J6HA 4LSDA 5C0RH 5F97E 3OKKB 1OTUC 2ATKB 3V95A 4R7NA 2UWEE 1HHHB 1XT5A 2Y06H 3GRWA 4XNMB 4DUWA 1CD9B 1LK2B 1UVQB 4HH9A 3MJ7B 5F9OL 3T0BA 2RQ8A 2PR4L 3CUPB 5GGRA 3F6LA 2XQBL 5DRNA 4R97B 2VLRE 1WT5C 1NH6A 1FZKA 2GJZA 1KGCE 1Q0XH 1OAQL 3BAEL 5DYOA 1UM4L 2IADA 4EI6A 4BJLA 1BQUA 3SDAC 1AKJA 2LVEA 3GUTA 1NGWB 3SKJL 4PJCB 1Z9MA 4JHAH 1OARL 4HF5H 1T89A 3SKNB 4CRPA 1BLNB 3G5VB 1MFBL 2NXYC 5DUMH 1Y6KR