3QZPA

Staphylococcus aureus isda neat domain in complex with cobalt-protoporphyrin ix
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
124
structure length
124
Chain Sequence
MSQATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAIPTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-regulated surface determinant protein A
publication title Iron-Coordinating Tyrosine Is a Key Determinant of NEAT Domain Heme Transfer.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Metal binding protein
total genus 30
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qzpA00
2O1AA 2H3KA 3OVUB 4H8PA 4WJG3 3SZ6A 4MYPA 5D1XE 3SZKC 3QZMA 4YMPA 3QUGA 5D1ZI 4H8QA 3QZNA 4NLAA 3QZLA 2ITEA 3VTMA 4FC3E 3QUHA 5D1QE 3QZOA 3RTLA 2O6PA 2K78A 3RURA 3VUAA 2ITFA 2Z6FA 3S48A 2E7DA 2Q7AA 3QZPA 3SIKA 2MOQA
chains in the Genus database with same CATH superfamily
3BZFB 4ODXA 1S7UB 3EYSH 3R4RA 4WHYH 1JVOA 1IFHH 1CF8H 2R23B 1RHHA 1QBLL 2JTYA 3BAEL 4JN2A 3AM8A 2DWEB 2PCXA 4BDVB 4IHOA 3VE0A 3L3GA 4FL4C 4E41D 3OKEB 4D8PA 4D0DA 1JZIA 4PCYA 5M94B 5KUKA 1FYTD 4X8CA 3BD3A 3T77A 5EU4B 4YSSA 4HKBA 2WQRA 5F0LB 5FYKD 5T1DL 3NK3A 4XO4A 1ZTMA 4ZQTA 5DJYB 3BPOC 3JYCA 3MLVH 2V17H 3QHTC 2ZOTA 4WVRA 4RNRB 2OFQA 4RISL 4F8TA 1F13A 4JZJB 3HS0B 3LD8C 4BD4A 1NDMA 1OM3H 4NBYB 2AGJH 1J5OL 3EH2A 3QEQE 2ATPA 2PWEA 3O9WD 4GRMA 1I7TA 4L2LA 4RFEA 2N4IA 4L4VE 4ZUSA 4I87A 1UURA 1WAPA 1UJ3C 1BXAA 2WXLA 1IZKA 4WK2B 3LKRB 2OZ4L 4GY4A 1Q9KB 3QUMH 4FA8A 3OBAA 4XRCB 5IGXH 2QQKH 2NY6B 5L0QB 1VPOL 1KIUB 2DDQL 5ID0B 5TH2A 3JV6B 4CN1A 3KPMA 4TQIA 4ERSH 3CK0H 1U8PA 2QKIB 3ULVC 1EPFA 1TCMA 3KS0H 4QTIL 2EP6A 1G6RL 3UZQA 1DBBH 5TK2A 2AQSA 3CN1A 2XT1B 5KUMA 2ZJSH 3VD1A 3VX1A 5A2LH 1JPGB 2VZSA 4I0KA 4B9PA 1IE5A 1PLAA 3BRFA 2R83A 4DUWA 3PG2A 3D34A 3IDJB 3IRCA 3V0WL 3EXJA 4FFTA 1HEZB 3HI1B 1XVSA 1EGJH 2CRZA 2ICEA 1NBVH 1T5WA 1MREL 3CFEA 4LCIL 1YECH 5AVXB 3VI4E 3DO4A 2ENQA 3C9NB 5E8OA 3ZGIA 4DEUA 2NR6A 3M7OA 1IGJB 2F58L 4Z3IA 5D1XB 4E9YA 4RSYA 3QYMA 3GHPA 1QNIA 1JAEA 2N0KA 2YEZA 2YD6A 1LL1A 5DURD 1A0QH 3MV9B 5IQMA 3TV3H 1MFBL 2EC8A 4QJ4B 3E8VA 4UOW1 3T4AA 3UPRB 2NTFA 3ZHFA 4R8WH 5I0XA 4M6OL 2XUWA 3PUCA 3IMWA 2IWGA 4JBSA 4R4FL 4I85A 2I9LB 2OMXB 5JDSA 3SPIA 3CVHB 4N1HB 1D9KD 5K9JH 1QAWA 4B3VA 3D09A 3DTXA 3X14B 4WWID 4JKKA 3G08B 5T1JA 2Q7YA 2QSQA 1QYGL 1LEKB 3CC1A 4GAYA 4NPYA 2IGTA 1I8AA 4YDJB 4PJXF 2JKIS 3K4DA 4ORGA 3DX8B 3QQ4A 2XTLA 3HLKA 2FO1A 1FO0L 1UQSB 5IMKA 5L9DH 4OF3A 4ZPVB 4PWEA 5LBVA 2IAMB 4F7TA 3DGGA 1XGQB 4GRWH 3WIHL 2QDVA 3VXSE 2C3WA 3AREA 4R7NA 4MNQA 2CSPA 1X5LA 3UC0L 3O6FB 4R96B 4DEWA 1T22A 2VDRL 1MZYA 4OUUB 3WTUA 4WFHD 4MMXC 1AQMA 4TSAH 3VTTA 3CXDH 3AU1B 3B43A 5E6RB 4UTBA 3IF1A 2DYRB 3QHZL 3F7QA 2FHCA 3ZTNH 3L3DA 2NX5B 4R2GC 2ZPKL 3B2UD 4HS6A 5E6SB 2VZTA 4JHAL 1JXDA 4M5TA 1ORSA 2BCKB 4YFLF 2HLFC 3B9KC 3CVHH 4XC1H 2HJFA 4ETYA 3BHBA 1MCPL 1SMDA 3VWKB 4JDTH 4AZUA 4DGIH 3MLYL 3OR7A 2MMXA 1OXYA 3PF2A 4K8RH 4DK5A 5ICYB 3RVVD 3W38A 4DN4H 1KEGL 2NQCA 4J6RL 1DLFL 1PX3A 3FULA 5F7EH 3M88A 3OKNB 3H2PA 3UDWC 1D5ZB 1UATA 4YHML 2CDEA 2X6BA 3CSPA 3IKCB 4ONHA 2Q1EA 1UA6L 4QHMA 3BWZA 5C9JA 3QARA 4FI6A 4F15B 2F54E 1ZJBA 1U30A 4ZX4A 5D71H 3QDGE 5C70A 1QACA 2FJGB 1N64L 4H2AA 2XYBA 3T65A 2WBJB 4XPBH 1EUUA 2BSEA 4FF9A 3O3BB 1BPVA 2FBOJ 1I8UA 4AMXA 4AE0A 1HINH 4U7KA 4FQCL 4M9PA 5EN2A 3P4LA 1TO4A 4QRSB 4WO4D 3STZA 3DJ9A 3UCRA 2OA9A 3FF7A 5HHNA 3SGDI 2NY4C 1KLUB 3W0WA 3EYSL 1ZA6A 1IFHL 1CF8L 4ODHH 3CVIH 5BRQA 1NUGA 1UXLA 1XD0A 2AFNA 2FJUB 3K2MC 4WHTB 2EC9T 4GO9A 1MFNA 1I3RA 1JPEA 4DEPC 3L4TA 5HDQH 1K8DB 4H8HA 1ZT1B 2VAJA 4JB9L 2WINA 3AUVA 3SGEI 1DUYB 2XWBB 2Y3NA 4WU7A 3QG6A 5B21A 3OKMB 1NCTA 3BZEA 3DMMC 3D5OF 3B2MA 3MLVL 2V17L 1BVNT 1TETH 4X6DE 3ULVD 3FCSB 2Y2YA 3DSNB 3GM0A 1DDHA 4HS8H 1NOFA 2HT3C 1YNTB 3KEHA 3QFJB 4RWHA 4TTGA 1OM3L 4P99A 1TMCB 3Q2LA 2AGJL 2BO0A 4U3HA 3HE7C 4I18B 4OZHB 4WWOA 3WJLC 5AAMC 4M4PA 3QEUA 4DZ8A 1G7PB 2FHBA 1GOHA 4KRPB 5IVXF 3QUML 3T5WA 3PJSA 3TBVB 5IGXL 4B97A 2QQKL 3WIAA 3T2PA 1LE9B 4PV1C 3G6JA 3MNVB 2VT0A 2X4RA 4ERSL 3CK0L 1FNFA 5I0ZA 5IHWA 3OQRA 4HA1A 2XWZA 3JWNG 1AR1B 4GI8A 1KGCD 2ZJSL 2ZXGA 1I85A 1HOCA 2V2WB 4ECNA 2O61A 4NPKA 4UQBA 1BXUA 5F7HA 1U8LB 1RIVH 1JGDA 4NIYE 4BFBD 1T4KA 3CSYB 2EXTA 3PV7A 4H26B 3MN8A 1EGJL 4P2RE 5GSVB 4ZZFA 1NBVL 2DLFH 2AQRA 1YECL 4JN1H 5AB2A 4Y16C 2EICA 2JKSA 2ADFH 7PCYA 1QHPA 4X6FB 4PVMA 5IROC 5BUAA 5FYLD 4IKLA 3JTBA 4L4TD 5C7XH 3KPSD 4H88L 4NRXA 5F96H 4POUB 3AS2A 4UINH 3RURA 4EXPX 5JTWA 5GS0C 2PYFB 3UBXA 1A0QL 2WWMC 1KUMA 3APNA 1ODAA 1KB3A 3H53A 3L3KA 3TV3L 1W72B 1A5FH 5ESQA 3U36A 5J6GA 3QJHB 3QZWB 3UTPD 1MIMH 2FECL 1XGZA 2I26N 3ARDD 2YBRA 3C6LD 3DX7A 5T1LA 3F12A 2HX9A 3F00A 3SE9H 3SOTA 6PAZA 1XBDA 4DK6A 4R8WL 3SQOH 4BWWA 4Q9QH 2WNXA 3FH7A 1OCRB 2HFEB 3QB7C 3NCYS 1OKEA 1ROCA 3LRKA 1M57B 2AJ3A 4KAQH 5K9JL 3T4YB 2VN5A 1J12A 2C9SA 3KVQA 3T0VA 1Z5HA 4A7QA 5BO1H 5I76B 3VFNA 1F4HA 3Q6FA 3FUJA 1I3GH 1WGVA 4JREC 5EZLB 5FCUL 1AQHA 4LDOB 4MNQE 5EZPA 4FXTA 1DJXA 2BNQD 2DD8L 1MLCA 1LDSA 3H9SA 4U3XA 3R8QA 3RWDB 2HLFD 1I7UB 2B3RA 5L9DL 3R06A 4DGVH 1G6VK 3N0PB 1Z32X 4FQQB 3QZMA 5ANHA 1PVHA 3Q7JA 2J12B 5BVPH 4WEMB 2Q76B 3K2IA 3TV8A 1YMMD 5IB2A 1RUKH 2AK4A 5CUSH 4IBUA 1BEXA 1A6AA 1NA8A 4N2MA 1CB4A 2F8VA 4C56D 1W72H 3EJZC 4TSAL 1NCUA 3CXDL 2YLHA 3M86A 1S7TA 3QQDB 4CSZA 5IBUB 3ZTNL 3IJSA 5F6HJ 1CJYA 2ICWA 3GRBA 3MDJA 4HUNB 4A6YA 1NBYA 3VGGA 2E86A 3CFIC 1UZGA 3CVHL 4XC1L 5EOCJ 4A7TA 4APXB 1BFVH 1DQIA 4P5KB 4GKOA 3MNZB 1M2VB 4JDTL 2HAZA 4BKLA 4JUTA 1M9WA 2WXGA 5DMGC 2LHAA 4DN4L 4IW4C 1T03H 5D1QC 3LTVA 1NAKH 5F7EL 1ZK9A 1TVDA 1CGTA 1R5IB 2OSLA 4TQEH 5IJKC 5H4YA 3BC9A 4JFFB 5D2LB 3HC0B 1IEAA 1G7QB 1P7QA 3PWPA 5T3XH 5KOVC 2VOTA 3ZL4H 2WCGA 1V8HA 3C6EA 3RJOA 5D71L 2ZCHH 3X13B 4GG6B 4NJAH 3S4SG 1S9WA 4KKZA 3T2QA 1AO7B 1MCOH 4XPBL 1TEFA 3W0WE 4CGUB 2JJUA 1E8WA 2Z4TA 2P5WA 3MGAA 5DZVA 4YSQA 2Y5TA 2W81C 3GFUA 1HINL 4KJYB 4NZ8A 4Y4KB 5B4MD 4A04A 2NXYC 1BF5A 2E9BA 1JPST 1JYXA 3QIUB 2PXYB 5DO2D 1WH0A 2HT3D 2RR3A 3GSQB 3KBPA 4KROC 5FK9A 5EG6C 4HHWA 1J0YA 1YEIH 2CUIA 4GSUA 4ODHL 3HE7D 3CVIL 4TULL 5C08D 5SWZE 1QLRB 3WUWA 3JUZA 4RZCB 3EFFA 2DMCA 4CVXA 4MQ7A 1ZGLB 2HSIA 5HDQL 1KDIA 4JVWA 2BSRA 2SODB 1HEHC 2PABA 4NN7B 3KHOA 1FUNA 1WPCA 2FSEA 4QRAA 5J1TC 5FX3A 4GP4B 4PJ9B 4BXSV 3QUYA 5PCYA 3RVXC 4IEFB 1TETL 1R46A 1G7IA 4HS8L 4UT9L 2JKLA 3U1SH 5LNDA 5BOPA 4F7PB 2C1OB 4ZRGA 1Q0YH 1LO5B 2X88A 3GXUB 4A2GA 4KJPD 4HP5A 2FE0A 3RWHA 1RZIB 4LLQA 3G9AB 4X6CA 3G6JE 4H8UA 4TVPD 2WXKA 2BNRA 2FWLB 2ZP8A 4MA3A 3ESNA 4TUOA 1J5DA 5K33A 2CO7A 1S9YA 5HGDA 1AFVL 3FYEB 4XOEA 3W82A 3BW9B 2J6WA 1H15A 4XAKE 4M56A 1M6OA 2VDQH 4XN2A 2AEPH 2PF6A 5IROD 1J9CT 1E5ZA 1KBWA 4JS7A 4PJ8B 5LNGA 3ARQA 4RAUA 5MEQB 4N0FB 3QC6X 4YLBA 3ZTJG 1O9WA 2BVUA 2Y2TA 5E8EB 2Z4QB 4IBSA 2WWMD 2Z7ZA 4J3OD 1P69B 3RZWA 2X4OA 1G7HB 3UYRH 5KZCB 3N42B 2VLKB 1RPUA 3WUZA 1ASOA 5IIEB 1RIVL 4CRPA 5EIVA 1ZSDA 1OTTC 2COQA 3IJYB 5DS8A 4HX1A 2BP0B 2APTA 1Z3GH 2P7TA 3QW9A 4LLDA 4NAJA 8PAZA 1FYHB 3HFFA 2X9YA 2YQ2A 4WW2A 4ZK8A 4DOHE 4HOWA 5H37H 4WDIB 1D2PA 2DLFL 3G04A 1L9SA 5TE7H 5INDA 3RZCB 4HUVB 1T20B 4JN1L 2EDNA 4A7SA 2ADFL 2E9JA 2DQHH 4OJYA 3G5VA 3VFWB 4CMMA 4E0RB 1WO2A 3FOLB 3LPPA 5C7XL 1I8MB 5F96L 2D7NA 2D03H 3PXHA 4UINL 2ILLA 3HMWH 5EORH 3SYOA 5KBNC 3T0BA 5GGTH 4A63A 1A4BA 3BCDA 4OFIA 2EDEA 4Z8FH 2NY5C 1A5FL 4KI5D 3ARFC 2OXGB 5B7FA 1MIML 3WNPA 2IPTH 3EDEA 5BOJA 2WIIB 3SE9L 4NRYB 3IPEA 3SQOL 1U3ZA 4OKDA 4ZS7H 2ARWA 3O11A 3CJJA 1GVIA 4F2EA 3H9SE 3VSVA 5IHLB 4KAQL 4FULA 1UD6A 1QHOA 3EJZD 5BO1L 1QLEH 4WAFA 1JK8B 3KGRA 4BSWA 5HHME 1I3GL 4WTQA 3MFGB 3BE1H 3LN9A 4K55A 4XN1A 1H6FA 2GJPA 3FUIA 4JPIA 2C8NA 1NANI 3LHPH 2JCCA 4PWFA 2OI9C 2AK4E 3LAFA 4HUUA 1E9QB 3L8QA 5AVWB 3NJMA 5SV4A 2ZOOA 3ZVVA 4K3EH 4DGVL 4S1RH 2MKLC 4KH2A 1J7VR 3LH2H 1KB5B 5LNEA 3KLDA 5C0IA 2ODIA 1FNGB 1GMEA 5DMGD 1KIQB 4MZIA 2X1QA 1NPNA 3X11A 1G7MA 5BVPL 4LL1A 5D1QD 2NZ9D 3REVB 1OP4A 4IU2A 3RRQA 1BOGB 4IOSD 1RUKL 3C2AH 5CUSL 4QGTA 4L0ZA 3ZKQD 1NJ9A 4KNTA 1T5XA 3QBTB 1FVEA 4GP8B 2GSMB 1W72L 3F7VA 1LO2H 4M8QA 3W39A 4AM0Q 4AGLA 3MRHA 3WU1A 2ZAHA 4LEXH 4O9HH 4D2NA 4H8PA 3EAKA 3LEXB 3M1BA 4PRIA 2VLRA 4N8VG 5I1DA 2YXWA 2CO3A 1BJ1J 3DI3B 5ERWB 4HWNA 3DDGA 4IHBA 1ANUA 4HIIA 2RALA 1ONQA 1BFVL 3C09B 3NEOA 3OF6A 4NO5B 5DEJA 5F7DB 4A7VA 5EU7C 1RZ7H 4UIKH 3MNWB 1WUNT 3PWPE 3H4FA 3V0DA 3REWB 4NLHA 1YYLH 3EOBA 1T03L 2H41A 3F05A 1NAKL 4FTVA 1CXIA 1SDAB 4TQEL 3E80A 1NCAH 2P5WE 4BFFA 2CALA 1KB5H 3BAYA 2OCFD 5T3XL 1GJWA 3X3FH 5EO0A 3ZL4L 4OVVA 1O7VA 2ZCHL 2DI8A 4NJAL 4E41A 1PZSA 1L9PA 1MCOL 4YZFE 2BIOA 4K7FB 1ZLUH 4DP1X 3APMA 1HAWA 1CYWA 1DVFB 2PCFA 5F9WB 3FB5A 1ZHLB 4FXGC 5BJTA 4LCWE 2WO2B 4WUUB 5ESVA 1OE3A 4UM9B 1HTYA 1AOHA 2VR6A 5CWSB 1P1VA 4NX0A 4EAEA 1BQ5A 3R0MA 1UXMA 1YEIL 3C5XA 2VABA 4I77H 4Z7OF 3AXHA 1EZLA 5IB4B 5C0JA 3TC9A 4U05A 5DVOA 3GB7A 1PG7X 3U7AA 1IJ9A 1ASQA 1DBMH 5I1IL 3BAXA 2BK8A 4WEUD 3STLB 3B37A 4I1RA 2WOBA 2VQ1B 4X6CE 1CG9A 2YARA 2VL5B 3MA7A 2BERA 3P4OB 2KZWA 1MNUL 3V0EA 3QA3B 2WTOA 5T1KA 2BVEA 4OFYD 3BKJH 1Q0YL 4H8WH 5DEFA 1TQVA 5BQ7B 5EIIG 1NCWH 2N7BA 3OZ9H 4CAGA 3ZZLA 4MXVF 3KLLA 1PAZA 3MRDA 1E0OB 2P80D 1C12B 3TL5A 4RIRB 1OGTB 4HJIA 2K78A 5JPMC 1T83C 1CTNA 1UCBH 3KCWA 2OL3H 3MRCB 4HGWB 4OKVA 1BZDA 4YDZA 1QLFB 5FA4A 5ICXB 3BVNB 1U8JA 3D3VA 4N2DA 1DVZA 2VDQL 5B38B 1KCVH 4LRNH 4HAGA 5HGBB 5KYXB 3KWVA 2WM0A 3UTZA 4YSTA 4ZAKC 4X5WA 5MERB 1HCVA 4N8CH 4PRBB 4BFIB 4GLRI 4XNMB 4FADA 3ZKXB 1BVOA 4AYMC 5T3ZE 3QGVA 5DQDH 1J5IA 4MNGB 2G9HA 1CD1B 4DP0X 1QA9A 3UYRL 1ND0B 5AVUB 12E8H 1I1AB 2YA2A 4NKDB 2Z91A 2DJ4A 4DZBB 3O2WH 2BHFA 5LO7A 4GSXA 2EKSB 1MDAA 1FAKT 1B4TA 3FT2B 5C0FB 5J11B 3BQUD 2F2HA 4W4OA 4AYGA 5EMYA 4LSTH 2YAOA 5TE7L 4FQXA 1N7MH 4KGLA 5JHDA 4LBEA 5FHAH 2DQHL 1YY8A 1I31A 4I0CC 3K5SA 3LNEA 4HIQA 1SY6A 4NNYB 3DX4A 2NOYA 2WSDA 3HRZA 3HMWL 3FU7A 5EORL 5GGTL 1KPUA 1XEUA 1A3RH 2VW7A 3B3IA 3CH1B 4Z8FL 4OCXH 5GGRA 1DQLH 2AMUA 3AG4B 1R3LA 3QEGH 4WFFE 1EFQA 2IPTL 3KPNA 3WENA 1PCSA 2PO6C 2RCSL 1NLBH 3RAJH 3TIEB 5JA9A 4LPTA 1JNNH 3MBWB 4ZS7L 4ZT1A 2I9TB 4NN6B 3QXTA 5DEZA 1NCOA 2F68X 2JCCE 4B95C 2ZNWA 1WS8A 1Y7VA 5AALA 3ZT6A 4QRPD 1BZEA 2NLJA 2BSSA 4JANB 4JCMA 3VJ6A 5JXEC 1JVKA 1QLEL 2WBKA 1DANU 2XQYG 1EANA 4Q6IC 4YUEH 4BKTC 3A6CH 3BE1L 4G8GD 4OT1H 3ASNB 4Y88A 3LHPL 2DZEA 2R2HB 3WELA 1A4KA 4N1EA 2AI0H 1X7QB 4K3EL 4S1RL 3GMQA 2UXVA 4Z1PA 5AAWA 3SGDH 1ML0A 4LKXA 3LH2L 4JY6B 4XE5B 4ZOBA 3UIZA 5LLIC 5C2UB 2P5PA 2C4XA 1ZLUK 2NDFA 4IRSB 1TLKA 3LQAC 4QXGH 2VLRE 5C09B 4TYUA 3VH8B 4CN6A 3C2AL 4NN5B 4GS7C 4WJG3 2MCMA 4AC4A 4EIBA 1T1WA 1RI8A 5FYKH 5GGRY 5I1CH 1OCOB 5AENA 4ICWA 2C4FU 2CO6A 2HFGH 3I9GH 4PGCB 3DROB 3D2UA 4LEXL 4O9HL 1FFQA 3M7FB 5FM4A 3WEOA 3ZE2E 4WO0A 4ZG1A 1NGZA 5E94A 2WYIA 3ARWA 4DN3H 2V3DA 5ACMA 3VXUD 1FSKB 1GY2A 1RZGB 4FTVE 4QHUA 4KC3B 5CLWA 2BOCB 2WNKA 1P5VB 4I9XA 1COBA 2CLVB 5HXMA 1RZ7L 4UIKL 4QT5B 1Z9OA 1QFUH 4Q7DA 1YYLL 2ARJA 5L2KD 4E41E 4HWZA 1XEDA 1FYTE 4OQTH 1MCJA 3DHPA 3QCTH 1NGQH 1NCAL 3ENEA 4YSCA 1KB5L 1HT6A 3X3FL 2WD0A 2ZKYA 5E1AB 4XGZA 1CICB 3QDMA 4F3FB 3GMLB 2BY3A 4EF3A 1HWGB 3NIGB 1MJUH 2V9RA 1D9KB 1FLTX 4PJHA 4NUJB 2X2JA 2WTRB 1H9DA 1N5YH 5GS2D 3NJIA 2GITA 3WKYA 4FXKB 5HP5A 1LQBC 1RK1A 1G9NH 1XGPA 3BUTA 4IGBC 3RGVB 3ROOB 1MAKA 2E4FA 3I74A 5EWIH 3GZPA 4AWJC 1U58B 4K4KA 4U3SB 3RWEA 2WIMA 5EZJB 3VDCA 4K3HA 1WS7A 1LNUB 2J8UB 3IBEA 4UQ3A 2P24B 2CHDA 5EEUA 4G9DA 3Q06A 3LV3B 3V6OA 4U1NB 1DBML 1JG9A 3FHAA 2AKRA 3DECA 4I88A 2QPSA 4JO1H 3FO9B 2VM9A 1EO5A 2NTSP 3ISYA 1A1NB 2ZSWB 4PWJA 2WO3B 1HHJA 3GF8A 3ME0B 3MLXH 3PY9A 4U6HA 4XAWH 4ZAKD 1YUHB 4IBZA 4JE4B 3U79A 2HP4A 4U6XB 2RMNA 3UGXA 5EO9A 3BKJL 1VENA 4H8WL 4Z3TA 4P4RB 1NCWL 5A7BA 3OZ9L 1PYWB 2NSQA 3DUSA 1MEXL 3D3VE 3OTTA 5TQ0L 5CEXA 4TLUA 4G42B 2R39A 1DJHA 2LU3A 3DVIA 1UCBL 4IK7A 2OL3L 3PWJB 4R83A 3V4PA 2YA0A 2A83B 1FN4A 4X80H 5GZOC 1BM7A 3VRJA 2P5EA 4UQDA 2KMWA 4LRNL 4YHKH 3MA9L 1JN6B 5DJ2B 2MOGA 2E59A 4N8CL 3ECWA 2Q2LA 4KFMA 1A65A 3KPSA 2FQDA 4E5XA 5IF0B 1EO8H 1CFTB 1Q8MA 2W9DH 4U1MB 1OWRM 1GYCA 1N3NB 2J21A 3QWOB 5DQDL 5CCHE 1VFBA 3KLAA 2EIMB 12E8L 1XGTA 1CIUA 1U8MA 4UZGA 1G9EA 4TUJB 3OLGA 4PLJC 3O2WL 5JHDE 4CVWA 1AQKH 5DHDA 2C7UB 3LD8B 5JA8B 2KL6A 4PJ7A 1AACA 4YC2C 3TBYA 1HL8A 4LSTL 2LW3A 3OG4B 5KYUB 2DKUA 2E9GA 3KCPB 5CN2A 2A7BA 3P4MA 5DJCA 1GKEA 1N7ML 5JXED 4NENB 1UJ3B 5FHAL 3ZE1F 1F0LA 5I1LB 4K94H 1CI5A 3QRBA 2YQBA 3CVCA 5FS5A 3DPBA 4AIZA 5L4IA 5ENWA 3E6HA 3VWJC 1CFNA 1N2RB 2PLTA 1A3RL 4Z77A 3U6XA 4GKZA 3IJEA 4WFHE 1DQLL 4HIPA 4PJDB 5C0BD 1VHPA 2Q3ZA 1BLIA 4XN7A 1HKLH 4K5PA 3IDMA 4FP8L 3QUXB 1NLBL 3RAJL 4LF3A 4Z7WF 3OXRA 1JNNL 1MAMH 5IEHA 4G43A 1E4JA 1JYWA 4QWWC 1HK6A 2QSCH 3S98A 3ZDZB 3T6ZA 3TBTA 3P9LB 5DVKA 2OULB 2WP3T 1P6WA 4C8XA 1UKTA 3MJGX 3CPLB 3LVTA 4ENZA 1TVHA 1M1XB 1DHKA 1KCKA 4YUEL 3OX8B 3A6CL 3GMNA 3SE3A 4MWFA 3U6RB 4OT1L 3DYPA 2XWDA 3TBWB 5EUOA 4XCCH 4X50A 3WIHA 1M6UA 2CGZA 3TOPA 3WO3B 2AI0L 4BH7A 4JNXA 1A6TB 3H7LA 2YGQA 2EXSA 2W60B 1QBMH 4HXAH 2YA1A 1RCYA 3PABB 4M5SA 2O6EA 3MRNB 3KPPB 1GHFH 4QXGL 3ZHKA 3D39B 1KGUA 5I1CL 5FYKL 5FOBA 5TK4A 4PS4H 4Q9BA 5D2NC 2H3NA 4DO5A 3I9GL 4LNRA 3ULVH 2PETA 4ZMXA 4I2XA 2VR4A 4PJBE 1BQHA 5AUMB 1IVLA 4NQVA 4QOKD 1A2YA 2BVTA 3SDAB 4DN3L 1IAII 1PTZA 1AOZA 1MOEA 7TAAA 4LAQH 4PV8B 2TSAA 1NMBH 1WJ3A 2APSA 3B7TA 1S3RA 3MO1B 5JHAA 1AP2A 4GFXA 4KH9A 2ZCLH 5EC1B 5FECA 3MRKA 3MRMB 4LP4A 1QFUL 3U0PB 1QPPA 5F1IA 1CYXA 5SWSA 1S78C 3QDME 3QPXH 1OW0C 1TF4A 5C6TH 4IGBD 4BV1A 3SKOB 4PJHE 4OQTL 3QCTL 4KY1H 1NGQL 4YO0B 3SDDD 5I6XC 4N6RA 4MD0A 4U1JB 5AVTB 1DN0A 5CKAA 1HN1A 2WLJA 4XXWC 5FV1L 5IESH 2JIXA 3CFJB 1ACYH 4MMXB 4OIFA 1MY5A 3CFDB 4NQCB 2R27A 4R7DB 2KKQA 1IGFH 3F7LA 1N5YL 4LCCA 1DYZA 5CGTA 2XWTB 4R2GB 2H8PB 3EOAB 5FGBA 4UOJA 4GRWF 2V9QA 1TJIH 1G9NL 1ZT7B 4Z7VB 1UZ8B 3B9KB 3KPRD 3V6OE 4HMDA 5E2UH 2GEEA 3VG9B 2XXMB 5C6WH 5DD5H 5B3SB 5BRPA 4C83A 1P7BA 5HHOB 4Y4HC 1NFKA 1PY0A 3BAIA 1SOKA 3E38A 3GRWL 2Q9OA 4I9WE 5FYLH 4I48A 1INEH 2XRAH 1L0PA 4OCNC 1YMMB 1OGAA 5GZOD 5FDYA 4JO1L 3OSVA 1PD0A 3P02A 3CFMA 4HWBH 4MSWB 3TZVA 1EEZB 2WQSA 5DHYB 3MLXL 3W9DB 1WT5A 3JUYA 1J8RA 4XAWL 3CDGA 1SMAA 5FYJE 2OX5B 2QQNH 1JIBA 5IOPA 2ADIB 3CSGA 4X7DC 4AZ8A 2HVJB 2AQ2A 2XTJC 1RUPH 3G5ZA 1UOKA 3L7EB 3NOIA 1QEWB 1UXWB 1S6NA 3QJSB 4NXSA 4PLJD 3O3DB 4YMPA 1FC1A 1Y18B 1RERA 2NY4B 4YHYC 2EEDA 3KPSE 1ZA3B 1T21B 4PWIA 5ECGA 3MAWA 5JO5B 4X80L 5AFAA 2YRZA 2CCLA 5AW3B 4WSKA 1EVUA 1SXNA 3V4VL 4BDVA 1NANH 1FZKB 4DEPB 1A9VA 4YHKL 3ESVF 2DTMH 2YAFA 3OKEA 4PLNC 2Z34A 1RZFH 4X6DF 4DCQB 1EO8L 4M7LH 1OF2A 2W9DL 3C60A 3FQWA 3GM8A 3VWJD 4DKDC 5DJYA 4PJ7E 4Y19D 4BBWA 2XZCL 5E1IA 5ANMB 3DMMB 1DO6A 2ZUVA 4LGPB 4YDNA 5KSAC 5IMOA 4RX4A 4J2QA 1F3DH 1KTLB 4Z76A 1AQKL 2DRUA 1EZVY 1G1CA 5HJ3B 1JTOA 1BIIB 4JDVA 4KK6C 2N01B 4Y9FA 4WLCA 2BNQE 1YQVL 2A1WH 3EHBC 3K6OA 4QWWD 3HE7B 5MP6H 2XHNA 5IEKB 1HI6B 1KTDA 3I9PA 1XCQA 4K94L 3PAZA 1AGDB 2L7JA 2F74B 4HXBH 2A6JB 4F9PC 2IFFH 3NVQA 5HYIA 1KIUA 4KUCF 4D8PB 5D7HA 3KXFD 5IFAH 2YXMA 2JJVA 5FCSH 5I23A 3JV6A 5I16A 4BZ2L 4E2OA 2QKIA 2GUOA 4L3FA 4N0UB 4ZMAT 3CFUA 4FQLH 1HKLL 4PWGA 3S2CA 1QSED 3EBAA 4YDLC 4BK5C 1I1YB 2HG5B 4GT7A 1MAML 1VERA 3KEDA 5E0QA 4X5XB 5JXAH 2ZUXA 4HF5H 2WN3A 5D5MB 2QSCL 1BAFH 4J12A 1RJCA 1ADQH 4M6AA 3TNMA 5GS1C 4U4BA 5HYJD 2DICA 4K3JH 3IDJA 1IVTA 1FV1B 4I5BA 2PYED 2K45A 4WF7A 1HEZA 5DSCA 1WLHA 3HI1A 2YD8A 4CDHA 4DPAX 5GISH 4ALAC 1TLMA 2Q6WA 2P46B 2ZX9A 4XCCL 2GEQA 3MJ9A 1AC6A 4Y16B 4ZFZA 5ID1B 5HD8D 5GS3A 1QBML 4HXAL 2NUPA 5A3IC 2BSTA 4I2XE 4ZX6A 1BJ8A 4YFEA 5E4EC 1CLYH 1GHFL 1S78D 4C54A 5L2JB 2AJSH 2Z65C 4X7SH 3P9MB 2J72A 4OV5B 4PS4L 1YNTF 1ZXKA 5F9OH 2QJDA 3UPRA 3ULVL 2PTTB 2C7FA 2FH6A 1ZVSB 5DYOB 5F7KC 4UCFA 3HZKB 4OZHF 1C16B 1OE1A 2DQDH 3HHMA 5D7LD 2OMXA 4AQ8A 5SWSE 1DO5A 1ZIAA 3MV8B 3X14A 1O6TA 4LAQL 4HIHB 5IWLA 2XN0A 2K9FB 1NMBL 4YDJA 3SDYH 2EYRB 4TVPH 4MJ6A 4Q4EA 2ZCLL 4JREB 1P1ZB 1WIUA 2QVMA 3DX8A 3L4ZA 1QPXA 4DUVA 4V1DB 4NHUB 1UQSA 4ZPVA 3CWGA 5DRZB 1RK0B 1F3RB 3QPXL 5I1JH 1EXUB 4LKCB 4ELMB 3KJ4C 4ATTA 4BGDA 4NPJA 1T1YA 3N85H 9PCYA 2BP5M 4KY1L 3Q48A 3GMRB 4TSBH 3EYFA 2J8HA 2X2HA 4LPXA 4WGKA 1IKNA 1D6VH 3O6FA 3PQYB 4R96A 5C3IA 4PJFB 5I8EB 8FABB 3GNMH 5C0EB 3HIZA 4OUUA 5AOIA 2R0WH 5GS0H 4XMKH 4EI5A 1L0YA 5IESL 2YKLH 2FEEL 3JSSA 3K91A 1ACYL 4DPRA 1HZKA 1QTSA 1CUOA 1IGFL 2NX5A 1QI3A 3NFPA 1FFRA 5BZXA 1XSOA 4AY0A 2D31B 2A6DB 1AKPA 1RAMA 4YLQT 3QHFH 2VUOA 2BCKA 3V6FA 4Q97A 3LRMA 3ARSA 5DZNA 3RTQB 1TJIL 3SDCC 3BVVA 2GT9A 1OGAE 5E2UL 1OV8A 5DD5L 2W95A 4EUPB 2XTJD 1WK0A 2OR8A 2EH8H 3H56A 5FYLL 1T6BX 3LRHA 3LRLA 1INEL 2WQVA 3DHJA 2XRAL 3OKNA 2WUBH 4R7VA 5GZNC 1ROWA 1OALA 3IKCA 2OMZA 4MGXA 5JPNA 3QNYB 4AGPA 4X5LA 1NMCB 1Z9MA 3D9AH 4HWBL 1E9PB 3HS9A 4Z3HA 4QD2E 3LDBC 3MMEB 2EE0A 1XGUB 2X87A 4I0PB 5F1OB 2QQNL 4DKFH 3ISRA 4G6AC 3F84A 2BFGA 1RUPL 1XIWC 4QXVA 2JTDA 2NXYB 3LHAA 3GUTA 1YCSA 3FRPA 4JFED 2WW8A 5KSAD 2XXCB 1A7RH 1KLUA 3RX8A 4MDRA 1TTRA 4ZW3A 2VQ4A 4KROB 3IDIB 4AEEA 4BFKA 3HNSH 1FG2B 2GJZA 3BQUA 4PMFA 1FA4A 2G75B 2WUCH 1TQUA 4EUPH 1K8DA 4OBRA 1ZT1A 4KI5E 5K59F 5H35B 2X4QB 5B39B 3B8YA 2FWOB 4WSJA 1RZFL 5ECJE 4ZUVB 4ES8A 1DUYA 5CIPB 1WA1X 3I02B 1DFXA 1I7RB 3KNBB 1USZA 1ZDQA 2VUKA 4MA1C 4TNGA 1PEWA 2GABA 1DZBA 1XDTT 2J88H 3FCSA 2MSPA 2K6YA 4LSVH 4V33A 3WKPA 1QUPA 3D4YA 3EDKA 1FNEA 1H3GA 1NCBH 1GS8A 1EAPB 4OF6A 1SM3H 1U36A 1DSFH 5C0CD 5MP6L 4PJIF 1D5MB 1ZHBB 2IG2H 3UBXG 4QRPA 4YGVA 2C9AA 5T5NF 1G7PA 3RHWK 2JMRA 3U2JA 2IV8A 2V8LA 1RZKC 5D2LF 3TBVA 3UG4A 3OB0H 2X70A 2B1AH 4HXBL 1TJXA 3IBOA 3QWRD 3DC0A 3KBEA 2IFFL 3NGBC 4YSDA 5GSRB 2ZUSA 1LXMA 4FNLH 3RL1A 5IFAL 3EFDL 2B77A 1FVDB 1MLBB 2BIIA 4MAUH 5HYSG 2K1MA 3U46B 5IB1B 3LRSB 4FQLL 2Y1YA 2L0DA 2DQCL 5A3ID 5LXVA 3W9EA 1WWCA 5CIPH 4AYBA 1O9VA 3MCKB 1VESA 3MX0A 1QRND 2V2WA 1R3HA 3VFRB 5JXAL 3MYJA 2UWEB 1BAFL 1U8LA 1QNZH 3JBG7 3NACH 1ADQL 3OXSA 5F7WC 1AXSB 4HAKA 5JZ7C 3BO8A 2BP8B 2VJXA 4K3JL 5DRNB 5HDLA 2X3CA 3G6AB 3DXAB 4PVLA 4BK4A 3VD2A 2CDGA 3HAEH 5GISL 5GSVA 3DSFH 3VXUA 1XX9C 3KS0J 4P4KC 5DTFB 3DX3A 1OSYA 4PS8A 1MFMA 5AOMA 5JIPA 4X6FA 1IB5A 1W0YT 3QIWB 1KJ2B 3NTCH 5IB5B 3OMNB 3QI9A 1EIBA 3MBEA 4CU8A 1CLYL 3TA3C 2WVVB 4ZO7A 1GCFA 3QJHA 3QZWA 4M7KL 2QHLA 3LIZH 2YPLD 32C2B 3PV6A 3PWUA 5AVZB 3VXNA 5EEVA 1E4HA 3ARFB 1HCFX 5F9OL 2BINA 5DHXB 2IPKA 5KS9B 2KHAA 3ELQA 3WTWA 2HFEA 1SN5A 2DQDL 2O5ZL 3QIBD 1SUJA 4WFGD 4M4RB 5I76A 2M1KA 2VRAA 2DIAA 3GEFA 3SDYL 2ID5A 3FTGA 4TVPL 3L4YA 5IK3A 2W91A 3ZDXE 3FFCA 1T2QH 3NCFB 3O6LH 3QUZC 4FE9A 4QAMB 4LHJB 4RGMC 3RWDA 3SDCD 3BGMB 4EN3C 2OI9B 2ZF9A 2BVPB 1FC2D 3OAWA 5I1JL 3SDXB 1MN4A 3NFNA 4Y1AD 4Z3FA 5I8CB 3F6LA 3N85L 4PGZA 1KJ2H 3MRPA 1KTCA 2QGCA 3DKHA 2NX5E 1KCSH 2AJUH 1D6VL 2FHFA 4QNPF 5A6MA 1SQMA 5GZND 3GNML 1YEKH 1O7DC 2FJFA 2R0WL 4XMKL 4PREA 2YKLL 5AB0A 5CR1A 2HLAB 1A3LL 2NY5H 3QQDA 2GAZB 2W92A 4JFXB 5F9JB 1M7XA 2K3TA 1NC2D 3QHFL 3CZKA 4KKAC 4APXA 4HOZA 1WG3A 4P07A 2R69A 4LSPH 2FVNA 4BHUA 5DFTA 4JHZA 1CL7H 5HGAB 5IQ7H 2X4SB 4N28A 4FHJA 4WK4B 4X99B 2WUBL 1JZFA 1KFGA 1M56B 1M7DA 3EYOA 2LFGA 5D7JC 1NIEA 2ZOLB 3NUKA 2QADC 1G7QA 1HILB 2HVBA 2WZPA 1H3VA 3OKDB 4PHXA 4C4KT 5I5RA 4YZFF 1F02I 3D9AL 3JTSA 2F53D 2MFNA 4KMLB 3IDGB 4NQQA 2JJSA 3X13A 4GG6A 1BZ7A 1JRHI 1PJ9A 4LFHG 4M1CD 3HR5A 4NLAA 3J07A 1A7QH 1U33A 4L5FE 4IBVA 3A4AA 3OB0K 1HYRC 4V2CB 3PXJA 4M6NH 2WO4A 4KJYA 4Y4KA 4ODTH 5F7AA 5AZEL 1ACXA 2VTFA 1SYSA 2PXYA 4QXTB 4BSVA 5EF0A 1DSYA 5T5FA 1YPZB 1A7RL 5IFHH 2OBGA 4FXGB 5E6ZA 1T4WA 1ZXQA 3RX7A 3GZQA 3BN3B 1GAFH 3HNSL 3U1QA 3TEYA 4R3SB 1OHZA 1QLRA 1VRSA 2F61A 2WUCL 3QEHB 2UY6B 4R7XA 2HMIC 1ZGLA 4TNWK 3H9YA 1IFRA 2XU9A 2KH2B 5ITFA 1A9EB 1E5CA 4O51A 1SVCP 1N0LB 1KN2H 1S8DB 2NY2B 3BAWA 1IC1A 2IVFC 4J4PA 4QYOA 3VGDA 4PJ9A 5C92A 1BVKA 2YPVA 2QV4A 3IFLH 3QR1A 1OB0A 4IEFA 4JQIH 5F6HI 3Q1SH 3TP4A 5LUMA 4ADIA 4QRPE 2GSGB 2J88L 2VDOB 2DTSA 2BRQA 4LSVL 4DGUA 4XO5A 1MI5B 1F90H 1RZIA 4G8GE 1SM3L 2D7TH 5EO1A 1DSFL 1SXZA 2Y7SA 2IG2L 2NY0C 2CG9X 1JF6A 3C5ZD 4U3CA 5JZ7D 2YFNA 1IAIH 3VDAA 1E4KC 2EXWC 4FG2A 5BRZD 3Q9QA 4DNLA 2B9AA 3IU3A 2WWOA 4GRLC 1AS6A 4UILH 2BRRH 1E42A 4NDMA 5IJCC 1H8SA 4P4KD 1MHCB 3CZLA 3WJMB 2Q7NA 3CFNA 4JJOA 3BFQG 5D96C 4MAUL 4NC0B 4RRPG 4F7EB 4FERA 1R1CA 1HQ4A 1AQDB 1R24A 1XB8A 3LQZA 4ZAKB 5F3HA 3WKQA 2XWJA 2YS4A 4YXHH 3ASOB 2E9WA 3IGFA 4N0YH 4XBEH 2Z4QA 4Y4FD 1IO4C 1NOAA 1G7HA 3VXUE 1GS7A 3WAKA 2H9GB 2VLKA 4TM9A 4Y2NA 3NZ8A 1QNZL 4R84A 5DFAA 4M7JH 4QRUB 5GS2H 3FTXA 2BP0A 3ZKMC 2VDOH 1U21A 3H4HA 2RAMA 4NFCA 1U92A 4IBYA 3L9EA 2Y07H 3HI5H 2WKOA 3Q9PA 2ZWYA 3DSFL 2FIRT 4HUVA 3RZCA 2HUEA 1OEZW 4RRPM 3NN8B 2WYTA 4MTMA 1QFWM 3VFWA 4E0RA 1E3ZA 3FOLA 5CJXC 1RD6A 1I8MA 3VA6A 2GBTA 1TEYA 3BXNA 3EZ8A 2FQGA 2ZUYA 4NKOB 1UM4L 2LTQB 4KV5E 4LDCA 3QUZD 3SE4C 3T3ME 4Z3EA 2G0KA 3ARGB 1OOAA 2V9TA 3ZRFC 4NQXB 5ALBH 2FLRT 4JO5A 1X9QA 4EN3D 2ZYHA 4HGMA 4YHOH 1T0NB 2OXGA 1X7TA 3BDXA 3LIZL 4NZUH 2DQJL 4U1KB 2WIIA 5EDSA 4KQ0A 1X6LA 4KTEH 3FL7A 4GSQA 3L6FB 2PO6B 5GQBA 2Y7QB 4N90D 2GYSA 4LLMB 5BVJA 3BLKA 3FFCE 3WHE0 4OFDA 5D55A 5F88B 2DM7A 4NC2B 4K7PL 2FEDC 4YHPB 1FGVH 2G5RA 1KV7A 1JK8A 3B5TA 4Y5YA 1RFDH 4WV1C 4UWQB 4JM2C 1BQLH 1XGRB 4Q6IB 1T2QL 2V9UA 3C8HA 4PS7A 4YIQB 4KKAD 3BVWA 1E9QA 1BX2A 4ZQKB 3PDOA 3DO3A 3EJCA 4GG8B 2WP3O 3RBGA 4RAVA 1FNGA 2YGOA 4GEJA 2DB8A 1IM9B 1KJ2L 2WXFA 1KCSL 3BH8B 2AJUL 3FF8A 1BOGA 1YEKL 3N1QC 4GBXC 5GGVL 1Q4NX 4RWYH 5D7JD 1CFSB 1BVLB 1JPSL 4GS7B 4D7PA 2QADD 1WF5A 4X42A 2UUDK 2NY5L 1B88A 3NFSH 3TLRA 3FT4B 3NCMA 3AG1B 4JDZB 2Z31D 1CDIA 5KVEH 5D4QA 4MKMA 2UY7B 2GC7C 4G1MB 3UIYA 1I8IA 3V6ZB 3ECBA 1ACCA 1YEDB 5F7DA 2H32A 4LSPL 5D7KE 1CL7L 2F8OA 5F1KC 5IQ7L 3G9VA 1BYOA 4XT1C 3T6XA 2B5IB 4GG6E 2ZP0T 4EBQH 2Z93A 2B7DT 4G6KL 3HG1D 1XT5A 1DANT 1NGXB 4TNVK 5F7BA 4ZYKB 2EXYD 1BGXH 1T2XA 3ARBC 3PL6A 1Q94A 4QDGA 5L4FA 1S9XB 4FEMA 5IOKA 2HMID 3KW8A 3MROB 3LQAH 5J9PA 5BQDA 3DOIA 2PPFA 3EBIA 1KXVA 4WY7H 4K7FA 1CLOH 4XMXA 4DVBB 1J0KA 4UQEA 4M6NL 3BUPA 1ZV9A 4HC1H 4MLSA 4LGSB 1DVFA 3H85A 1NUDA 5E5UB 5B8CA 3NSJA 5LBSH 1ZHLA 1S7RB 4WUUA 3C8KA 2X9WA 2AITA 1ILSA 2XY2A 4BSJA 4TSCH 2C4FT 1S7VA 4XVTH 3WMQA 3K4ZA 1GAFL 3PGCA 4Y5VC 2ZXWB 2WVUA 1WICA 2HRPH 5I2IB 1T7YA 4M93C 4MX7B 4N6QA 2HKHL 5IB4A 1TDQA 5F70A 2DKMA 3IDNB 1EQWA 5C0BE 2XBZA 5LCVA 4YHIB 4G8EB 2EDKA 4N9GA 1UB6B 1N0XH 1QHQA 4GRLD 3PDDA 1KN2L 1TJMA 3PPEA 3STLA 1DCEA 1F45A 4NNPL 3WOVA 1Q90A 2VQ1A 3IFLL 4B7LA 1TPXC 3CFKB 4JQIL 4YFLI 2CMRH 2Y36H 3Q1SL 5DJ0A 5DJAB 3ZYZA 4OF8A 3UTTB 4PLKC 4Z7NB 5AEAA 3EBHA 3GJEA 5IV2B 1SGKA 1QSEA 3HTLX 3ARPA 4XP9L 1F90L 3KPRB 2AERT 4JFYB 2YRBA 1T0MB 1E67A 2D7TL 3SYAA 4LCVA 1SBSH 3HW7A 2DQEH 3WN5C 1GYVA 3O41B 4QY8B 3S36H 1C12A 1ZS2A 1JDAA 1JI2A 2RACA 1OGTA 4RIRA 1NM4A 3VSTA 4MDIB 1VB9A 1BDYA 4HGWA 2YD7A 1OCCB 2G2RB 3U1PA 3ISWA 3BMVA 1QLFA 1VF5C 4UILL 3HE6C 4CVZA 4LMQE 2XFXB 3BVNA 4HJTA 5L4MA 3L4VA 5F7LB 2BSDA 4NO2B 4FGMA 5HGBA 5KYXA 3WTXA 3I75A 4P46B 4HFWB 5MERA 1NDGB 3NIGF 1UJTA 4PRBA 4BFIA 4WWNA 2XN9D 4XNMA 3GRGA 2EDWA 4YXHL 4XBEL 4N0YL 4FI8A 4MNGA 3K6SB 1CD1A 2VKWA 1ND0A 2OMYB 3UO1H 3VNZA 4KGJA 4PHZA 4BH8B 1U3HB 2KQNA 3B1UA 4JRXD 4M7JL 1WAAF 4NI3A 2VDOL 3FT2A 3B2PA 3ZUCA 1EO7A 4P2OD 1CCZA 4XB7A 4YR6B 2Y07L 3BJLA 5IHZB 3HI5L 4OLVL 4YEFA 4WWKC 4HJUA 2DMGA 1U42A 2IDTA 2J8UF 3GDCA 4YC2B 5E1HB 4WNQB 4FYTA 3S35H 3UAJD 5HPOA 2HKAA 4L0YA 2FEDD 4D9RD 4IRZA 4H1LH 3L4XA 5LVEA 2DM4A 2DMBA 4NNYA 4LLVA 2VH5H 5CFAA 3V9FA 1C08A 5KSUB 2ZAGA 3IFPB 5ALBL 3CH1A 2ARJQ 3LNIA 3VWJB 1TZGH 4YHOL 1EHXA 1MWAB 3NJHA 4QTHA 4NZUL 5CMAB 1G87A 2AV1B 5JMRA 3TIEA 5T33H 5IVNA 4KTEL 4X9HA 2I9TA 1SFDA 1BG1A 2R1YB 3U4KA 4GBXD 2IBBA 3ZPDA 2XICA 4RMSA 5F44A 1FGVL 2CR0A 2YJLA 1FL6B 1NEZG 1RFDL 4IRJC 1JGUH 3UP1A 3BMWA 1E3FA 1BQLL 1GGTA 1SFHA 5EA0H 3D1MC 2HN7B 1E4WH 1X7QA 4ZFOB 2BMKB 1S7XA 1ZT4A 3KXFB 3HBGA 3RG1C 3L2NA 3NAAH 4NQSA 2D2CC 1U8QB 1NKGA 1PCXA 3ZE0F 4BGLA 3V0VB 4IRSA 1THCA 1JERA 3TCLA 3T8VA 5H8DA 3V8OA 3VB8A 4IIQA 2JELH 2G60H 3CLWA 4OCMC 4XN4A 4ZO6A 2A4EA 4HPYH 4RWYL 2LU7A 1N4XH 4IMLB 1MWAH 1IC7H 3ARBD 4PGCA 2DYPD 2XQYK 3DROA 2V6HA 3NFSL 2EVFA 5D2NB 2N7SA 4KZCA 2CPUA 1FZMB 2AXJA 3VRLE 5CP7B 4OZIB 1PLGH 4LL4A 3HB3C 1C5BH 4TLTA 1RZGA 2N56A 5KVEL 4PEEA 5JOPD 5EEWA 1FH5H 4QTFA 4PJAB 3CH8A 2YUWA 2CLVA 5AW1B 2FO4B 2E6PA 5I71C 2HT2C 2P52A 3D25B 2R4SH 3T8MA 4JRYD 4OH2A 5C07B 4BFRA 1SQ2N 4A66A 4EBQL 5E6ID 2Z1KA 4KKLC 5GRWA 5LGJA 2VO5A 4LOUC 4Z7QF 4Y5XC 3L7FA 4PJDF 3U4BH 3PCYA 3KVDD 5C86A 3ULVF 1IAOA 1B4RA 2WLZA 2EDTA 3DBXB 2N59A 3VFVB 1BGXL 2BVQB 3FSWA 2BWQA 4E68A 4Y19E 5E1AA 3BWAB 5ABAA 5GJSH 1F5WA 1CICA 4KJQC 4F3FA 3HG2A 3GMLA 5D7LB 4OIAA 4F92B 3B7YA 5A2AA 4NUJA 4WTZA 4Y1SA 1WHOA 4WY7L 1CLOL 2Q2EB 3HNTH 1SN2A 1GZHA 2WTRA 4E9QA 1OT2A 4G7RB 3SKNB 4HC1L 1HCZA 4EIGB 2P43B 3D85D 4HK0B 1KYAA 3RPIB 5LBSL 1RLBA 2GIXA 4L8BB 4UT7H 5EBWB 2JKRM 2IANB 4TSCL 3RGVA 1ET5A 2BX5A 4XVTL 3ROOA 1BFOB 4GW1B 4RQQB 2RBLA 5DQ9B 1U58A 4U3SA 2A6IB 2HRPL 4LEOB 4M3KB 1LNUA 5DYFA 4AH2B 1LWHA 4Y4HB 2X4NB 2P24A 1KXTB 5F7NC 1H8LA 1MVUB 5CEZH 3LV3A 4OB5H 4U1NA 5BMFH 2V7HB 3B3BA 1N0XL 1QSEE 3MRQB 4Z0XB 4OCRH 3UL4A 4B9CA 3FO9A 4HUXB 3VXRD 1N6QH 3NIDB 1NDTA 2NXZB 1RUAH 1A1NA 1MQKH 1HNFA 2ZSWA 3FS9A 3P69A 2JKWA 2CMRL 2NY7L 2Y36L 5C2BH 4B9FA 1YUHA 2D3NA 1UHVA 5KAQF 4L3EB 4U6XA 4X7EC 3ARZA 2H6PB 4EDXA 2XPGB 3MOAH 1ZWIA 3TWCL 2HT4C 2X89A 3TFKC 3EF7A 3HZVA 4GO8A 5GGSB 1D7DA 5TDNB 4ATWA 1U6AH 3D07A 2YAEA 2A2QT 4N3UA 4EEEA 2E75C 2XVBA 5F2FA 2VDLH 3GXNA 4EI6A 1SBSL 2XG4B 1B0GB 2DQEL 4Y9EA 3BEWB 3Q5OA 3QDJD 3S36L 1T0PB 3PS6A 4KXCA 1DQMH 4BFNA 3EO9H 1P0SE 1NC4B 3PWJA 3RVTC 4YHYB 2A83A 3N9GH 2FYYB 3CIAA 5GRVL 3HFML 2FX9H 3MLRH 1FNAA 2HTLD 3L95B 3ARYA 2XVGA 4DP7X 2IV9A 3D6GA 5DJ2A 1XTMA 5F6IC 3IMSA 1KYDA 4L37A 1CFTA 2HJKB 4U1MA 3MFFB 1N3NA 3QWOA 4F5CA 1T7XA 4KK5C 3U25A 3UO1L 2ZXDA 4JPVH 2UZXA 4N9OB 4JHUA 3ULAB 4Z7VF 3K1DA 4TKWA 4XPHH 4GKNA 4X5PA 2C7UA 4XOBA 4WJKB 4IBTA 3TVMA 4CU6A 2R2EB 5KYUA 3EHBB 3Q5TA 3S35L 3KCPA 4FQIH 4WUKH 4NENA 5EN3A 3IM1A 2WVSA 5I1LA 4K9EC 3PWNB 5LG6A 1NWOA 2ZG1A 2D7PA 4IRJD 2VH5L 2OR7A 4OIBA 5EF3A 2ESVA 2VB5A 2J2ZA 2WXRA 3FRUB 5D7EA 2KDGA 3WXVH 1BMWA 4F27A 1MCSA 4HH9A 1TZGL 5I1EH 1I4FB 2NNAB 4L29B 4AVJA 3QUXA 1E4XI 5EULV 4HIXH 5T33L 5FO8B 2FQFA 4KDTA 4YDLB 3DJTA 5JHLA 1PZBA 2ICES 1LGVA 3QXAB 2V7NA 2VXTH 3EYVA 4WGWB 2P1YA 3P9LA 2BH0A 2Z3FA 1MFVA 5GS1B 3K74B 4HKZA 1T7VA 1M1XA 2RIKA 3FBQA 4OV6F 3U6RA 1JGUL 3JWOC 4KKBC 5HDBB 4OZFG 3HB3D 1LD9B 3ZHLA 4F2MB 4D9LL 1IBHA 3FK3A 1E4WL 3F7YA 4NP9A 3DHMA 1A6TA 1HXMB 4KOBA 4B0MM 4MDJB 3NAAL 2HT2D 2W60A 4GW5B 1HHKB 3T0AA 1JYVA 5HPMB 3MRNA 3OWEA 3KPPA 2A77H 2EJ1A 1A1MB 3RU8H 3D39A 3L16A 3FMGH 5E4EB 3FW6A 2EIKB 2ORBH 3DJRA 1HZLA 2JELL 1A25A 1QRNB 2E7DA 2G60L 4G7VH 1W9XA 4HPYL 4LOUD 5DK0B 2WBXA 3RILA 3TTYA 3U2IA 1N4XL 5CZRA 4BQ8A 4WHYG 3T0EB 1MWAL 1IC7L 1MUJB 1NZRA 2XWRA 3OR6B 2MQGA 5K9KB 1AKJB 3PU7A 5FKPB 1PLGL 4AC2A 3SDAA 3VXQB 1ADWA 2WSPA 4KJQD 2WMPB 2XVKA 2IMMA 1C5BL 4G3YH 4NQDD 3UGEA 5KWYC 4GFTB 1VACA 3F83A 4HZLB 2BXYA 4ZMOA 3TT3H 1FH5L 1AZUA 2XV0A 3MO1A 4G6FD 4Z78A 4BZ1A 3MLSH 5EC1A 4MJID 6FABH 2R4SL 2EO9A 3MRMA 5A6LA 1I1FB 2DOCA 5GRZA 3RHWF 1HYSC 4ALAH 1SHXA 3CSFA 3U4BL 5IFJA 1WFIA 2E9IA 5B7MA 4S0SD 2X2YA 4KO9A 2DYSB 4YO0A 3S3SA 5FYJU 5FLVA 5D1ZC 5D7IF 1N5AB 5GJSL 4U2ZA 1WDAA 3H3KA 4U1JA 3N40P 1FG9C 5D5MF 2ZNXA 2ETWA 2OLDA 1KTRL 3N2JA 3TT1H 4UTAH 5KYNA 3CFDA 2HRGA 4NQCA 3KG5A 4UNUA 3O3AA 3GS0A 4YFDB 4UDUA 4NRZA 5C9KA 3AS0A 2XWTA 1P9MA 2H8PA 1J8HB 1I82A 3EOAA 3VI3A 4OI8A 3BRDA 2B2XH 1ULVA 2CK0H 2P49B 1ZT7A 3SYPA 2UZIH 5CGMA 1UZ8A 4UT7L 1PD6A 4E42B 3CFCH 2MOVA 2HT4D 2YD4A 2NUTB 3EUUA 2CNYA 4XCEB 4CN4A 3TFKD 1F4YH 4D9QD 4Y1AB 5HHOA 5DC0A 1GXEA 3PHSA 3ATAA 1JWMB 43C9B 3LPWA 1UOVA 1BAWA 2VR5A 1HKFA 1WZ1H 3C5ZA 4R4BB 5FW7A 1IM3B 1NGYA 5AVQB 1NLDH 4J3OF 3OC5A 3UDWA 4OB5L 2FUQA 1CXHA 4F1ZA 1C5DB 3ARXA 5G2NA 4OCRL 3RVTD 1MZZA 3SB3A 3OL2A 1BCIA 1N6QL 3M1CA 5HGHB 3WFDH 1AD9B 1RUAL 1EEZA 3W9DA 5C2BL 4JCWA 2OTUB 3MUUA 3WG7B 2OX5A 4NT6A 4F9LA 5FDWB 3MOAL 1A1OB 4FFVC 4G9FD 3TEXA 1THAA 4FHKA 1CDGA 2DW5A 2ZOKB 4HHAB 1U6AL 2HVJA 1OO2A 1A6ZB 2VDLL 1A7PH 1QEWA 1UXWA 2ZAIA 3I6GB 1XIWB 3O3DA 3MC0A 2WKGA 4JQXC 1QG3A 1H3UA 1C7TA 4HCRH 2F1AA 5EU6A 2MCAA 3EO9L 1ZA3A 1WE5A 2XWCA 3FONA 3WAJA 2FX9L 4F5CE 3HOGA 3MLRL 2BVOB 4FCHA 4PJFF 4Y2OB 2IC2A 1SJHB 5SX4H 3C75A 3BUYA 3BPLB 4QKXB 5I73C 2F53B 3IAQA 5B1JA 1G4MA 3VM5A 1EH9A 4DCQA 3IXAB 1UEMA 4OBSA 5BS0D 3MRLB 5J6HB 3VO0A 1SEBB 3BP7B 3VXMD 3CFTA 4CKQA 5ANMA 4MA1B 2W5PA 4MNHB 2GB2A 4JPVL 5I1AA 1NEUA 1R4XA 1JP5A 4KKPA 4IJTA 4XPHL 3ZDYF 1IEBB 5HJ3A 5GGUB 4PJXB 4XMZA 1L7IH 2ESVE 2G3ZA 4KX9A 5CBAA 3PJLA 3MJWA 4OZ4B 1VJSA 3WN6A 2LAGB 4MAYC 3WJLA 1HI6A 1DVTA 1KPVB 2H7WA 3X12B 4JEGB 4FQIL 4NNXA 2O6CA 3BRGC 1BMGA 4H20H 3IGUA 1AGBB 4MB1A 1AGDA 5DJDB 2F74A 4GQRA 4KKBD 5GJTH 2FX8H 1F3JA 2VXQH 1F97A 3SCMA 3ZDZE 4NM4H 4TN9A 5KSBF 5I1EL 4N0UA 4HHGA 2Y25A 2NW3A 5FXCH 4U6YB 3MLWH 3FFOA 1F00I 3NPZB 3R7RA 3APDA 4HIXL 4XZ4A 3V0IA 3CZFA 1RP8A 2VLJD 3O6MH 3LMJH 3QT2A 4X5XA 5I6MA 4P23C 4P3DA 1LJMA 2J25A 2VXTL 4S2SB 1GTFA 2GSIA 2YKKA 2JKXA 4G80A 5FAAA 4FAAB 5AB9A 4U4IA 4RGOH 1OAXH 1YN7B 1PNCA 4UOW0 1M05A 4GEIA 1FF5A 3ALXA 3H3PH 4OZGF 3OKKA 5F8RC 1E27B 4P4KB 4H4NA 1DBJH 5JIIA 3P1VA 3HC4H 1KG0A 5L7XH 3BWUC 4FFZA 4G83A 2BSCA 3OHXA 3F7RA 1OPGH 2XJKA 1RZKH 4ZXBD 1LEGB 2A77L 3I9IA 3DX6B 4H5SB 4TNWF 4M7ZC 3RU8L 3TEUA 5L2JA 2VISA 3FMGL 3TA3B 1U8NA 2ORBL 3P9MA 3AM8C 4G7VL 4AVKA 4OV5A 4M1GH 3HG1A 4P5TD 4L4JA 4Z7UB 3H42H 2Z92B 1ZVSA 2K7PA 1S2EA 3HZKA 5D1ZD 1C16A 3QEQD 4PYGA 3WFHB 1AD0B 3IE4A 1R3JA 5KG9B 3COOA 4L4VD 4G3YL 5CLXA 3ETBJ 3MV8A 4HIJA 1I7ZB 5GPRA 1C1EL 3TT3L 4IKJA 4JFHD 1EBPA 2L4OA 1CFQB 2EYRA 2V5TA 4PG2A 5C0AA 1YEGH 3MLSL 4GUPB 1JJUA 6FABL 4WJ5B 4V1DA 2AABH 4PBXA 2DWDB 4J23A 4WK0B 3QUZB 3KH4A 2Y22A 4PG9B 4LKCA 3TJHC 4ELMA 1O5PA 1HIMH 1ES0B 4NQCE 4KPHH 4JFDB 4OJCA 5BZWB 1JK9B 5C3TA 5HVWA 3PQYA 4H0GA 5L8JB 2DBLH 8FABA 4JY4A 3O0RL 3O4LA 4F1SA 5C0EA 2FYVA 1YVLA 3VI3E 5ICZB 5HI3C 3LCYA 2JCWA 4NUGL 3KYNB 1PMYA 4J5VA 3M45A 3RUGA 1DJIA 4L1LA 1U95B 1XFPA 3MXVH 5MENB 1IC0A 2NNRA 1IGCH 5LGYA 2VMFA 3IB4A 5AZ2H 3LB6C 3MGOB 2A6DA 1VEPA 2XBTA 3I6KA 4J7RA 4DF9A 3U30B 1SLUA 3PJNA 3RTQA 2B2XL 2CK0L 2UZIL 3O6KH 4N5EC 3X1GA 1J10A 5IVXB 3CFCL 1P6FA 1ZIBA 2C9QA 1F4YL 2OW6A 1JCVA 2XPYA 4XOAA 1WZ1L 3A21A 3EJYC 1O75A 4ABVA 2YEQA 1NLDL 4IKKA 2NR6C 3QNYA 2CLRB 5D7JB 5FM5M 2VLLB 1IQDB 1WFOA 4W9LC 4DIXA 2FNWA 3VFMB 1E9PA 2BC4B 2V8MA 4BA8A 4CBZA 3EGXA 4J39A 1W8OA 1Z9LA 1NIDA 4LVHC 1ZHNB 1CDUA 1XGUA 3BGFC 2XC8A 3MRBB 1A4AA 4I0PA 3ABZA 5EU6E 1F1GA 4FI7A 5CAYB 4HUWB 1UA7A 2C1PA 2VL4A 4FQ1L 1KIPB 3B9EA 3T4AC 1PZ5A 3UERA 3O8XA 3CC5B 4TQPA 1A7PL 1QZNA 3OGCA 5L88H 1X9LA 4NZTH 3KPQA 4OAWB 4JRXA 5D6DA 3E1F1 3D48R 4V2BA 1R33A 1OP5H 1ZANH 4YGAB 4JG5A 3SDXF 4HCRL 3UOAB 1J0HA 3RI5F 1FG2A 3B6SB 3RY5A 3WTVA 4HS3B 4P2OA 1J8KA 4XMLH 4FEIA 2YUZA 1O0VA 3EYQC 4JE0A 4MAYD 3U4AA 5ANME 5EIQA 4M5ZH 5FO7B 1K5NA 2ODHA 1V3JA 2X4QA 4GI9A 2FWOA 3QJFA 2UXGA 4HDIB 3AXLB 2AANA 4ZUVA 2W1NA 3I02A 4AL8C 1B4JH 3V9CA 1WIOA 3D33A 3KNBA 4DERA 3AREC 1ZAGA 4P2QD 1TEGA 3IYLW 3C5SB 3S4SA 1K3ZA 4DKTA 3Q8EA 2VDPB 4NKMB 3EXLA 1JNLH 2GIYA 3S8FB 3WNIA 1TSHA 2C9PA 3A4DA 1BVZA 4LHUD 1L7IL 3CPUA 1EAPA 1IGIH 4YJZL 3W81A 4QMEA 1INQA 1D5MA 1ZHBA 4P23D 3RNKB 5E95B 3B1TA 1T1ZB 2NY0B 1SF5A 3N43F 3QPKA 3QVAA 4GNKB 4N0UE 4H20L 3UYPA 1SHWA 2O6PA 5KYYB 1YAZA 3E6FB 1XBRA 4ZZKA 1TT6A 3PPSA 4HFUH 4TLSA 2FX8L 5GJTL 3ULUD 5GSRA 2F54D 4WWPA 4JRFA 2VXQL 2X4TB 3QXWA 4W6YB 1H8OA 3DHUA 1OAYH 1F3DJ 5JDJA 1FVDA 3LKOB 4NM4L 3ZHDA 4PMEA 5IB1A 5DRXB 5D96B 3LRSA 2J56A 4TNVF 2FR4B 3MLWL 2GTWA 1OSZB 1QPKA 4DGYH 2NMSA 4NYLB 5E1GA 5E5MB 3MUY1 2WLLB 3O6ML 3LMJL 2Y0SA 1T6WA 1UWGH 1AGFB 3VFRA 2UWEA 1WAEA 1AXSA 1YPZF 4B9IA 2BCMA 2E8YA 2VDPH 2X41A 3QR0A 4FYRA 5JOFA 4QLWA 4RGOL 2AV7B 1OAXL 1GZPA 1W91A 1WTLA 2XI9A 2XKUA 3DXAA 3G6AA 4PJCB 2BZDA 5AVVB 3ZXAC 1ZS8A 3H3PL 3DV6B 1HS6A 3U4EA 3WMSA 3WLBA 4FJYA 1KLGB 4NQED 4L3CA 2HH0L 2WYHA 3QIWA 1ZD6A 1KJ2A 3HG1E 3HHSB 1DBJL 3JWNE 4BQBA 3D0AA 4W9GC 2EIBA 5L7XL 4OLYH 3RWJA 1OPGL 1RZKL 3CXHK 5IBUG 1L9OA 1PIGA 3FU0A 4UYPA 3B8SA 1YUKB 3HNVH 3MV8E 3TJHD 32C2A 4M1GL 1NFDA 3ARFA 4XHQA 2ZWNA 1KN4H 4HJ1A 1E40A 1XF3B 3K6DA 3H42L 5C0AE 4DKEH 5KS9A 3WKNA 2CU9A 2CUHA 2XXGA 4G8AC 5HI3D 1R5WA 4LPUA 4ZTEA 4YPJA 1CLZH 5T5NG 1KYFA 2PWDA 4PR5B 4ELME 3FQUA 3FTSA 3SBRA 1IQWH 3WHE1 1YEGL 4Q89A 4WV1B 3SBWC 3LB6D 4F7MA 3PQYE 4JM2B 2WZ5A 4QRQB 4JAMA 2AABL 1G94A 3O4LE 1VZIA 2QR0B 3QSKB 4N5ED 2BVPA 2NNCA 3A23A 3QNFA 3RUGE 1HIML 5I8CA 2A9BA 2BJMH 4WI0A 4KPHL 5A2JH 1RZQA 2CM6A 4ZDHA 3V55A 4DPCX 2DBLL 3P3RA 3K0WA 4QHNB 1OP5K 3TN0A 3ZTDC 4MS8D 5JLZB 3LN4B 3WY4A 3MXVL 2CLZB 1IGCL 4L1BA 5F9JA 5AZ2L 4H8QA 4JY5L 1WBXA 4ZW8A 2BHZA 2WB1A 1PD1A 1I85C 2B8OT 5C97A 5MEPB 3O6KL 3T09A 4FCAA 2ED6A 2Y1VA 3FUFA 5J0BA 4P2CG 4CSPA 3OKLA 1SVZA 1A9BA 2X4SA 4G2AA 3K6FA 3JQOB 5H2BB 1S3KH 1NM9A 3QDJA 4X99A 3MLZL 3WY3A 5F3BA 1RU9H 4MB4A 2ZOLA 3OAUH 3WHXB 1HOEA 1HILA 3GBDA 5IHUH 1ZE3C 4H8VA 1Q1JH 4AVIA 4LLWA 2VM3A 3DVGA 2R56H 3OMAB 3EYQD 2FZ3B 3ARBB 4KVNH 4ODSL 4OLZH 5H37G 5TFSH 1MIEH 3JZ7A 3IDGA 3KPOB 5IUSA 3INOA 1S9KC 3GIZH 2E7CA 3PUUA 4O2CB 5I9QB 3D0LB 5FEBA 2QVTA 4JRXE 2DIEA 3K5RA 1ZGLM 2SEBA 2YXFA 2E5EA 5DD3L 4PRPA 5A16B 3FAXA 3APCA 2WXOA 3ZZSA 5F3FA 3ARED 3B2VH 3FUEA 3VVWA 2E56A 4HG4K 4MNQD 4N8VA 1NKOA 5DC2A 2FT8A 2JK5B 5IVOA 4CADA 2WZ0A 2X1XR 4PAZA 5HSFA 5LBGA 4TL5A 4IBLT 3VA2C 2LAAA 2YD2A 3GYRA 2FECI 5L88L 3S88H 4NZTL 3W2DH 4HWUA 4JRYB 2QTEA 1WBZB 1ZANL 3K72A 4JLRB 5DMKB 2CBOA 4N1CA 5BZZA 4XXCA 1WIPA 2OQJB 1QSZA 4XMLL 2W0FB 4Y5VB 5CNHA 3N0AA 1TO5A 1X5ZA 4M93B 2G3XA 3EG9B 4W9CC 3NBNA 4M5ZL 4XE0A 4AEFA 2RFXB 4PJGF 4AQEB 5C0GB 1N0LA 2R0KH 4YDKH 1S8DA 1B4JL 2HLEB 3KJ6H 3MRFB 5FKAA 2R1WB 5CEYB 1YC8A 5ESAB 3GJFH 1NFIA 5TF1H 1BZ9A 2GSGA 2W07B 1TPXB 5IZ7A 1KCWA 4RGND 2GPZA 4MASA 3VFOB 1JNLL 1LWJA 1MI5A 3ZL1A 2EQDA 2UVEA 2FCBA 2BIHA 4ELDA 4YHLL 2Y7LA 5EOQH 3FQRA 4FYSA 5DD0H 5JNYA 4PLOB 5DFWH 5CBEB 3GXFA 4AXWB 2CPCA 3OG6B 3WN5B 3V79C 5CSZB 1Z6JT 3EH1A 5IVZB 5I19H 2BSED 2Q0ZX 3CQFA 1Q38A 3V0FA 5CLYA 4WI7A 2YD9A 1T83A 3ZX1A 1MJ7H 1T1XA 1QO3B 3H9HA 4HFUL 1UASA 2NSXA 3IGAB 4X83A 3Q8FA 2O5YH 1G9HA 3HE6B 4UU9A 3WJMA 1OAYL 2AJZB 3O4OC 3WNLA 4HPHA 4OW6A 1XCTA 4N2OA 3W0WD 4AQ1C 5LQBL 3DIVA 1LP9B 3EYUH 3MV7B 3DXAE 4XNXL 4DGYL 5ILTH 1AIFB 4POYA 2K8MA 3ET9F 4ETQA 1UWGL 4JHBA 2VSDA 2H9GA 4XCYB 5JOPE 1SDYA 4QRUA 1KNOB 1K9TA 2VDPL 3VXPB 2QMKA 5E8PB 5EIIA 3RJQB 5E00B 2ZKMX 1CBVH 4GKLA 2NW2B 4YPGA 1KLFB 3GLDA 5BCAA 1EEUA 3IDXH 1TZHB 1UZ6E 4WWKB 1AJ7L 4EO5A 1NFDE 1TFHA 2DQMA 1I9EA 2AXGB 3GSNH 1VFAB 3LZFH 5KS9E 4MJIA 3FJTA 4KKNA 4NKOA 4OLYL 2ADGB 1T3FA 3ARGA 4PP1C 2I25N 1WISA 3UJJH 5KANI 1AG0A 1IUZA 1NAMB 2EKJA 2JKJA 3HNVL 4UUJB 5AOZA 3S36X 4Z7NF 5HVHC 5HJGA 1LHZA 1NCCH 3WBDA 1KN4L 2EVGA 4U0RB 3L6FA 4ENED 4DKEL 2PO6A 3UADA 4AM0B 4LLMA 2YD1A 5AKTA 1OVZA 4FNRA 4DO6A 5LDSA 2C9VA 5IM7B 1RIHH 5F88A 1N67A 3LSOB 3WO4C 2EUWA 2DI9A 5DD6B 4HUKB 2WLNA 3LKQB 4P05A 4YHPA 3JYBA 4L8DB 4X0NA 1FNSH 3TF7C 1YO4A 5AZUA 1IQWL 5INCB 3A22A 1QX1A 4PBDA 4Z7OB 1XGRA 4IRJB 1C5CH 4XAKD 4YIQA 2PW2B 2B16A 1IKOP 1H0DB 2GBUA 5C6PB 1BXVA 2P45B 1MF2H 3NSDA 4PFEA 1R17A 1IM9A 2BJML 1U8OB 3JTTA 4PN6A 3BH8A 4HKXB 5EU5B 5TDOA 3S35X 1GGYA 3AAZB 4NM8H 2E47A 4H0IA 4BE6A 1TQSA 3FT4A 4RH4A 2GCYA 1CTMA 2Y6SD 5LBSA 2HJLB 4QO1A 4G70B 1AGCB 3QC5X 2EYTB 3QDJE 2UY7A 1PQZB 2XQYA 3AG2B 1YEDA 2E7LA 3SODB 3KYMB 4OLUH 5T1LD 3D08A 2AJXL 1HH9A 1JSYA 1RSYA 3DV4B 2A5UA 4A2FA 3FBKA 5BXFB 5I71B 4P5RA 4WW2C 4AMWA 4YLCA 4BIKA 1S3KL 3FT3B 3DK2A 3L2MA 5DR5H 1KTBA 4HV8B 3QNZA 1RU9L 3BZ5A 3HCVB 3OAUL 5LDUA 4YN3A 4PRPE 2PNDA 4PI2A 4Y5XB 3VXTB 1Q1JL 5IHUL 4HCGA 3DUUB 3WNMA 4KVNL 5TFSL 1XZ0A 4OLZL 1KULA 3S48A 1MIEL 3H9SD 2PCPB 4YHNA 3ETSA 4OI9A 3ZO9A 3FO2A 1QVOB 3BESR 3AB0C 3PAUA 4GI6A 4DVBA 2LLGA 4AIEA 5HHMD 3D51A 3B2VL 3KYKH 5CJBA 4BK8A 1DQKA 2AP2A 2W9EH 1PFOA 2XNAA 4L9LA 2AK4D 1S7RA 4IM8A 5IQLA 3TH3T 2FUTA 4B9GA 4DP4X 3S88L 3W2DL 5B38G 4PJEE 1BREA 1UVQB 2HVKB 2UZYA 3BP5B 3EUDA 3L3IB 1MJJA 2PR9A 5I2IA 3MYZA 4MX7A 3DX2A 3QDHA 3LEVL 1O9ZA 4ESKA 4A37A 2WWNA 4IU3A 3SOBH 1OE2A 4U31A 3OVUB 1NUFA 1MI5E 5CCJA 2R0KL 2OMTB 4YDKL 4XMTA 2CRMA 5BOZG 1HQRB 3KJ6L 5E1QA 4OZIF 5HDRA 3DURB 3CFKA 4NUQA 3CHOA 1GS6X 3HUJB 5TF1L 3IS1X 3UTTA 2X7LB 1J48A 3UP6A 1IILE 2AVFA 2O30A 5IV2A 3B4NA 1CDHA 1V3KA 5EDXA 4IJ3B 4PJAF 2Q86B 3VFSA 1YEHH 3SBQA 3KL5A 4JFYA 2V2TB 1T0MA 1NWPA 1P7QD 1WWBX 2D73A 3PWPD 5EOQL 5DD0L 1VKXB 1GSKA 2ZWKA 3GTVA 2ED8A 3QNXA 3O41A 5AKRA 3QQ3B 4QY8A 1FIGH 2CBPA 2XXFA 4PGDB 4AK1A 1C8QA 5SWQB 2E3VA 5I19L 2G2RA 5CZXC 1JFHA 1MJ7L 5EUKB 5IQ9B 2XFXA 3LEYH 4JKLA 1GJIA 5EC2B 4FLSA 3NQKA 3ZKND 3RWFB 3UAFA 3DOSB 3KYOB 4PP2A 4P46A 3DARA 1FFTB 1NDGA 4Z3GA 1CXKA 1CFBA 5F6IB 4JX0A 2BDNH 5F7MC 1IBBA 5KVDH 5ILTL 2BNUB 4ELKB 3CDCA 3K6SA 1A4JB 3LN5A 1W0WB 3O2DH 4NO0B 1B6DA 5A40E 2OMYA 4XCNB 4CNIA 1G7JB 1U3HA 1C9SA 4JM4H 2JJWA 1MRFH 4P5TA 3S3CB 3M46A 4IBQA 1CBVL 1L3NA 4MJIE 4CJ1A 4YR6A 1N12A 3U7WH 1DVSA 1QATA 1F41A 3QUYD 3U9UB 2H6OA 1G5GA 4UT6H 3AROA 3IDXL 1JHTB 1XH3A 4WNQA 4XPAH 1UB5A 3U6XS 1ZLEA 4MMYA 4HAFA 3VH8G 4GMTL 1NCIA 2WYZA 3H54A 3VSQA 2YC1B 5GIRA 3GSNL 3T04D 1DN2A 3LZFL 1RHFA 4B9KC 1KBGH 3VD4A 2OJZH 4RMVA 1P2CB 4W9ZA 3IFPA 3O9WC 4LFHD 2KLTA 4ADJA 3FUDA 3UJJL 1IE4A 4R0LA 1FZJB 1JPTH 2BNRD 4HK3N 2AV1A 2MKWA 1NCCL 3AY4C 4R26H 3VVVA 4IQHA 1RK7A 2YJQA 1FO0B 1IGYB 1IRAY 2YAHA 1SYVB 2R1YA 3MNDA 1RIHL 1QFOA 2IXQB 5DJ6A 1D5BB 3GBLA 4YX2L 1U8IB 4CC0A 4OGXH 2G5UA 2DQGH 4UV7H 3AQXA 5JOEA 1NBZB 1FNSL 2H1XA 2RHEA 4XHJC 5FGRA 2XG5B 4QRRB 1ILUA 5LG1A 1G43A 1C5CL 4XNYH 3IGKA 4WKXA 2HN7A 3ULSB 4UZUA 4ZFOA 4EZMA 5FFLA 1MF2L 1ZVNA 1U8QA 2EDYA 1K4DA 3DPDA 3IJ8A 4LLUA 1L5GB 4AJVA 3V0VA 3TBSB 4K9EH 5T3ZD 3EF4A 2VLJB 4GIAA 5K9QG 3P77B 5E9DB 3L9RB 3E2HC 3P0GB 4IMLA 1QYGH 3CHRA 4K3GA 4JPWH 4E9SA 4NM8L 1L9RA 1A64A 2NQ3A 2LU5A 4OU3A 2F19H 4I3SH 4XWOC 1EXGA 1XWVA 2FL5B 4QHKI 2D2OA 4PJ5D 1M7IB 1BG9A 3V5KA 4YNYB 1D7CA 1KZYA 4J3BA 5EOTB 4DUXA 1H5BA 4DQOL 4J3XA 4OLUL 2EYSA 4Q58C 3EO1A 3RGBA 3D25A 2ZG3A 5ACZB 3C5JB 1Q9WA 1TVBA 5AYTA 1BF2A 4M02A 5JIDA 2YSTA 5C07A 4I13B 4KMQA 3VUAA 5JYLA 1FCGA 2DWYA 3JWOH 4CMHC 2Z6FA 3BSZL 3Q2VA 3AS1A 5BV7C 4GW4B 2NT1A 3QS3A 4FQXC 1NEPA 3VFVA 5BS0E 2BVQA 4O02B 1B90A 4A67A 5AQ0A 2CO4A 1EFXB 4RFNB 1JZ4A 1RUMH 2C3GA 2B9BA 3BWAA 1BQSA 4OY9A 3L5WB 3HS8A 2K7QA 1MDTA 3QFDB 3NDZE 1X6NA 5L4JA 1F86A 2DJUA 1QSFB 4ZUUB 3CBJB 3KYKL 3PWVB 3BVDB 3OKOA 4HK0A 1H3TA 2W9EL 1QR4A 2KI6A 1DLFH 2OJEA 3TCTA 4L8BA 3H0TB 2ICWI 1DQQB 2IANA 1IEHA 3WEAA 4ADGA 5DLMH 3U48A 4IBWA 1BFOA 1RZJC 5I66B 4RQQA 1AGEB 1QMUA 5DQ9A 2A6IA 5LAXB 1ETZB 3MJ6A 4PRID 3D18A 2VLRD 2X4NA 1KXTA 1MVUA 3SOBL 1G1KA 2V7HA 1L9QA 4Z0XA 3MRQA 4OD1H 4WW1B 2ZWLT 4Y2LA 1CK0L 2DPKA 3K81A 2Z0UA 3OF6D 2WNWA 4G8IA 4Z7WB 5I18H 4HUXA 1QWHA 2A4ZA 1AY1H 2X0VA 3PAYA 4O02H 1OP3H 4FQCH 2P8LB 4KKCD 4ANVA 1ZK5A 2PN5A 1JPFB 1BV8A 2JB6A 1MKFA 1GCYA 2OPCA 5ACLA 3RDTB 4L3EA 3QUMB 4FTVD 1UKSA 2GVYA 2MPVA 3V0HA 1EWHA 3VI4B 2XPGA 4NC1E 3ZBMA 4PGBB 1YEHL 1JHKH 2WSKA 5GGSA 4F58L 3DX0A 1N6UA 1YDPA 4KQ3H 1AAJA 2A9NH 2XG4A 1AIZA 1B0GA 1N8ZB 3BEWA 3F6IA 3LNDA 3MUGA 1FIGL 3D05A 4JB9H 3O81A 5CXPA 1SPDA 2R29H 2IOIA 2Y7OA 1NC4A 2VCOA 2ZXBA 2ITFA 3TWYA 3LEYL 2CJSA 3UTQA 2VR3A 4NJ9H 2E46A 4LCUA 4WO4C 4PRDB 5AAPA 4NQEA 4FFWD 3PHQB 2UYLB 5K1NA 1Z9SA 3IXTA 4UTCA 3UPAA 2HJKA 1DLHA 2BDNL 2IALB 5D7IE 5KVDL 1P6AB 3DLQR 1HSBA 4LK4A 3O2DL 1Z5LB 2DIJA 1H19A 3GSVA 2VMEA 1FBIL 2IAAC 2NPLX 2Y7MA 2CGYA 4JFHE 4JM4L 4U1HA 3WNKA 1MRFL 1FCCA 2DM2A 4M8VA 5C7ZA 2X44D 3IWUA 4DJMA 5GGSY 3QUKA 3VXSB 3U7WL 2KQMA 2R2EA 3GSWB 3I3EA 4UT6L 1ZV2A 1CDJA 4MAYB 4HKJA 4J3WA 4XPAL 2OCCB 4FZEL 4F7CA 2EIDA 1WFUA 2ENJA 5T1KD 3PWNA 4A39A 4AVHA 4XHJD 4HALA 3GEWB 1KBGL 1NCNA 2A74A 2OJZL 5FO9B 1IX2A 4PJ6A 5KN5A 3I50H 1KBKA 4X4ZA 3X3GH 1JPTL 1I4FA 3OZKA 5KAQG 2NNAA 2WXIA 2ZYSA 4FXLA 4R26L 3O3EB 3V6OC 1I3VA 5DUBB 1S7QB 3SY0A 4PPTA 3WLWC 3M17B 4U1IB 4W68A 1GYWA 1BD2A 4EXKA 4LHUB 3T6WA 4X4YB 2MTPA 3D3VD 4MAZA 3BYYA 4GRWB 1YZZA 4P23B 1WZKA 4F7KA 2D0HA 3A3YB 2VERN 2DQGL 4OGXL 4UV7L 5IW1B 4H88H 3MRGB 3ZU8A 4XWOD 5EF2A 3MLTB 3HEIB 2VKXA 5DK2B 3DNKA 1LD9A 4PBVC 1YNKL 4XNYL 2JB5H 5DI8B 1E65A 4P2YA 5KVFE 3T3PE 4F2MA 4S0HA 3BSHA 3DX9A 4XO8A 4ONGH 1HXMA 3H2WA 2P26A 3K8KA 3QDGB 1TG8A 4QIRA 4AOFA 4PTUB 2G0LA 5DWUH 5SV3A 3S34L 1H6UA 2IDFA 4YZWA 4FKKA 3P0YH 4FLRA 4HPOH 4K9EL 5AW0B 3QE5A 1E7VA 3NSFA 3BUDA 4M7ZB 2AMGA 4UTAA 5DK0A 4FQXD 1X9UA 4G7QB 5JHDD 2QFRA 3CGTA 4MD5B 3HVNA 3T0EA 3BP6B 3M6DA 3VE0B 3L3GB 4JPWL 5FCUH 3OR6A 5K9KA 2BOBB 4K3DH 1CC3A 2F19L 1AKJA 1CDCA 2DH3A 2PPAA 3QP3A 4I3SL 4D0DB 3VXQA 2DD8H 3S3PA 3T77B 2WMPA 3QORA 5C07E 5CEZE 3QRGH 3FCGA 5E8DH 3WEMA 3L2LA 3ARDC 3C6LC 2EH7H 1WHPA 1G0DA 2A6KB 1OP3K 1OY3B 1CURA 3LKPB 1I1FA 3JWOL 4GRMB 2ATKB 4YDVA 4X6DB 1NOLA 3BYTA 1MW0A 3BP4B 4R6UA 4P2QE 1N5AA 1RUML 3S9DB 5FGCE 3OJ2C 5IMLA 3S37H 4J1UA 2ICCA 2Z35B 1PU0A 2QSTA 3KPTA 2Q20A 1MPAH 2IANE 3GLZA 3GBMH 1BBJB 5I24A 3C12A 4JFTA 3BZDA 5HI4C 4WSGA 2FEJA 4HH8A 3ZT7A 1O5DT 3NJNA 1TXKA 2YR3A 3BAKA 4XCEA 5DLML 4TVSa 2B0SH 3RFZB 3D2UD 3O45A 3ULUE 2OMUB 1JWMA 3BT0A 43C9A 3GQFA 3W37A 4YAQA 1IM3A 3TONA 3FTZA